2XLOA

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124e variant with bound no
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 51
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xloA00
2J9BA 3ZWIA 1LM3B 5JP7A 2YL1A 3C63A 4WGZA 1M6TA 3L1MA 4CX9A 4JKVA 4CIPA 3C62A 2XLVA 3HNKA 3NMJA 4ER9A 3HNJA 4CJOA 3TOLA 3M15A 3DE8A 3TOMA 5B3IA 4CJGA 2XLEA 4IB4A 2XL6A 2QLAA 4JE9A 1A7VA 5JVEA 2YL0A 5JT4A 3HNLA 1JAFA 1APCA 3ZTMA 3IQ6A 3M79A 4IARA 4JEBA 2YL7A 3FOPA 4IAQA 3NMKA 2XLDA 4ULVA 4CDYA 3QVYA 1BBHA 3QVZA 2YLGA 1EKYA 2XM4A 1MQVA 1E86A 2J8WA 2YL3A 5JLIA 4D4XA 4L6RA 1YYJA 2YLDA 3M4BA 1YYXA 4U9DA 3ZQYA 3IQ5A 4WGYA 2XLWA 1QPUA 3ZQVA 2CCYA 3DE9A 3QW0A 1QQ3A 4N6HA 2XLOA 3FOOA 1CGOA 1E83A 4CDVA 1E84A 1YZCA 256BA 4N4WA 4D4NA 3NMIA 4EIYA 3HNIA 2BC5A 4CDAA 5JRAA 3QW1A 1GQAA 1CGNA 4NC3A 1RCPA 3U8PA 5JSLA 3VRCA 1YZAA 2XLHA 3ZTZA 2XL8A 1S05A 5AGFA 1CPQA 2YLIA 1CPRA 5JUAA 2YKZA 1E85A 1NBBA 5JS5A 2XLMA 2XM0A 3M4CA 4U9EA 4JEAA
chains in the Genus database with same CATH superfamily
4MVZA 5E2QA 3S28A 3H2UA 2J9BA 1HW1A 1A7EA 3T9OA 1PCXA 2NUPA 3EGXA 3LLKA 3W8IA 2GAQA 4DOZA 1LVKA 4GQHA 2X0CA 4FWVA 1LM3B 2ZXPA 5FZTA 2KSFA 2YL1A 4GEHA 1OXKA 4JIOA 3E9VA 2GA0A 3O10A 4AE4B 2R7WA 2TMVP 1WTYA 4MW3A 4YL3A 1M6TA 1K40A 2L6HA 2QTVA 1MNEA 1VYKA 3GM1A 4CS8A 4CX9A 5KYNA 3WG7C 3EFOA 1R5ID 3W2VA 1Y4CA 1D1BA 1PD1A 4Q7CA 5F5FA 3HNJA 2EIMC 4BJ6A 2H8AA 3JZ0A 4CJOA 4MQ9F 4YK5A 1HY5A 3OEOA 3X2QC 3ATPA 1Z63A 1NSGB 2OKUA 4N6CA 3POVA 1RJ9A 4IB4A 1SMYF 2CYDA 1A7DA 2QLAA 3ECSA 3H65A 4H54A 5EHHA 2P1AA 3S90A 3EHMA 3JRTA 4PR9A 4LACB 3B9QA 1LE4A 4X0RA 4EWCA 2EINC 2HSBA 3SXYA 1JAFA 4YL0A 4B6IA 1I5NA 3UR3C 3RVZA 4MW8A 5B1AC 3IQ6A 3JSEO 3KMIA 5GPGB 5KYWB 3LS0A 4PJJA 3DM9B 4FX5A 4MTGA 2YWAA 4U5FE 4IAQA 3DWWA 5L3QA 5DS5A 2VCAA 1Z7Qc 4J7YA 3OA1A 4F4BA 3NYLA 1EA8A 2J9VA 1BDJB 1H6GA 2R9RB 2ZPAA 3GODA 1NLXA 4OIPF 4XQ1A 4O6NA 1Z3IX 3AQBA 1ORSC 2VCCA 4J30B 4C3BA 3KPHA 4A2NB 1G5ZA 1M56C 2R7RA 2HFIA 2IOQA 2XRHA 3IQ5A 1AEPA 1V74B 2A0UA 4WGYA 3TK0A 2IXNA 3GM2A 3V5ZA 3LNMB 2OOCA 3CAXA 2KYHA 2EPOA 4K1OA 4MVOA 1B68A 1FFHA 1PD0A 1ZW3A 2HZ8A 2P0NA 4CS8C 2XLOA 3S84A 1OW7A 4PJMA 3GORA 3U9MA 1F1MA 4BJTA 1Z23A 2P7VA 1Z6AA 4JW1A 4OD5A 4U5GA 4U5CE 1E84A 1YZCA 1ZHTA 4BJ6C 3NMIA 3VAYA 2G62A 3KYIA 1OR2A 3X1OA 4EIYA 2JD3A 4KNVA 5A6KA 3F47A 4XLNF 3B0VC 2D5RB 4A4AA 2R7TA 4LDKA 2IXMA 4PJLA 3AJMA 3N0TA 4CS7A 1GQAA 1LI7A 4RD9A 2H7BA 4NC3A 1ZHYA 5KYXB 1YARO 1MMDA 4G0HA 2J7PD 3SP1A 3AQCA 4K0DA 4DRIB 2XLHA 2JPUA 1UFBA 3DZAA 2DYSC 3NG1A 3AOUA 3ZTZA 3ZVRA 5KYYA 3GEHA 2O9XA 2WVQA 2PNOA 4R32A 5AGFA 3DKAA 2YQYA 1ZHZA 4KC9A 2RD9A 1GGQA 1RKEB 5D92A 3EG9B 4EBJA 4MNDA 4E7ZA 2NPUA 4BEJA 3EPVA 3WAQA 1Q0MA 2YEVA 3C8GB 2AWCA 3PMRA 4WABA 4MTOA 2H7OA 1ZVZA 1IW7F 1E85A 1H7IA 4MVSA 1OQCA 2FFHA 1YAUO 1JR8A 2XM0A 5A6BD 3M4CA 1M2VB 1ZU4A 5EK0A 1OR3A 2Q9AA 2X51A 3ZWIA 1V54C 1YA9A 1TWCA 2HS5A 2NG1A 2MYSA 3L8JA 4JRZA 3RQEA 1T6QA 3LEOA 5JP7A 3U3FA 3U9JA 2OG2A 1VYIA 1NU9C 3CSKA 4NQFA 5T3TA 3ASOC 1CGME 4MVQA 3LS1A 3ABKC 1ZW2A 4JTAB 3ABLC 4G7ZF 1I4YA 1VTMP 4OINF 1RXQA 2P6VA 3ITFA 3S0XA 4JKVA 2LP4A 3W2WA 2YVKA 3L8IA 3C62A 4PK4A 1U6HA 1VB5A 3NMJA 2W45A 1M57C 2OEVA 2VB6A 3RQFA 3R7CA 4XTKA 5A6BA 3A9CA 4C3DA 2R7QA 3B29A 2A6EF 1A0BA 4QI0A 2GDCA 3OWTA 4Z9IA 5E3AA 3I5PA 4IGGA 4CJGA 2OU6A 1OKKA 2XXAA 2XL6A 2OCCC 4LLEA 4MS2A 2Q9BA 2W9YA 4JE9A 2YRFA 4KNWA 3DI5A 5BQGA 5JT4A 2J9WA 3IHUA 4OIQF 1KNYA 1QLEC 3DJUB 4EKWA 4RDAA 4C7OA 4RBNA 1HMOA 2EILC 3LAYA 1YLMA 3AG4C 3KH2A 3M79A 3O39A 4IARA 4JEBA 4BG0A 4BEMJ 2OEXA 1TKNA 3RW0A 3I4UA 3SNHA 4MVRA 2H7VC 2FAPB 1UG7A 1J8MF 1AVOB 2VASA 3DM5A 4ULVA 4WJ0A 4AK9A 5F28E 3T4RA 5L0HA 2BE5F 4JZAA 2XSEA 2NUPB 2LIGA 3EGXB 4CS9A 1BZ4A 3F46A 4CBEA 4ZLCA 4ZLDA 4JURI 2AVKA 4XWJA 5JLIA 4L6RA 1YYJA 2KQ9A 4XEVA 3MX3A 2VCBA 1T01A 4DXWA 3C18A 4NY3A 1LS1A 2WZFA 2IYLD 4U5HA 5K0IA 2XLWA 3RVYA 3PCVA 2DB4A 1OCZC 1SZIA 3DE9A 5E3CA 1U0BB 3EFOB 2CNWA 1QQ3A 4N6HA 3K33A 1TWHA 2L6FA 3TJ6A 4ONSA 4DVZA 1E83A 2KK1A 3GEIA 4J7TA 4DRJB 3EGDA 3CEXA 2HJ3A 1BR1A 4D4NA 2NUTA 4O6MA 2DI3A 4QDLA 1O5HA 1ZHWA 1TFKB 2R7XA 2ZXOA 3HNIA 2A68F 1RJ9B 5A69A 4OD4A 5DVWA 4E17A 3NDBB 3O6XA 1WATA 3K1IA 4CDAA 2R7OA 3FMSA 1CGNA 3SXMA 2QUPA 3KKBA 3G4ZA 4BJ1A 1I4ZA 1JPJA 5JSLA 4PJNA 1D0XA 2C03A 3AGUA 3JSZA 2ZXWC 1T6UA 3DXJF 5A6AA 2VC9A 3IQCA 2J46A 3MYIA 3SXZA 1M2OA 3ZIBA 3UGOA 3QZCA 4AL1A 1JOGA 1S05A 1TWGA 2XL8A 4YL1A 4YJWA 1ORJA 2QNLA 2IXOA 5T1DB 2OJQA 3W8HA 1TR2A 1Y6DA 1YJGA 2M4EA 3DMDA 4LDQA 4Z9HA 1FMWA 3VF0A 1ZYRF 3NKEA 3MLGA 4CS9C 1KU2A 2XS1A 4IRUA 3FAJA 1MNDA 4XPWA 3RF3A 3J06A 1LS4A 4FAPB 1EQ1A 5JUAA 1LIHA 4PFOA 2WZGA 4DBQA 1BR4A 1NZEA 3RIPA 5CIVA 2EPMX 2HJMA 1D0YA 3M1CB 3NKDA 1T5OA 5B1BC 3SYNA 5L3VA 2ZD9A 5DQTA 2KC3A 1NU7D 2AU5A 2QE9A 1NG1A 3RQGA 3KYJA 1XZQA 2Z15A 4HE8D 2UUHA 2LCHA 2UUIA 3RKOF 3R2PA 1FR0A 3Q6NA 2HKVA 5DLJA 2PFDA 4YWQA 3V7OA 4YT2A 3L0IA 2EPKX 3C63A 4FESA 3HLZA 1OW8A 3I5QA 2YZSA 4MVUA 4W8PA 4E0HA 4O7GA 4WGZA 3US6A 2KNHA 1C02A 3LNRA 4CIHA 1MMAA 3JCUQ 4DRHB 2LSEA 3TJ5A 2PP4A 1N1CA 1R4TA 5EGYA 2XLVA 3EHNA 1NFNA 1L3PA 2AWYA 3T6JA 3O55A 3K1IC 2CW0F 3S9OA 4P6IC 4Q4ZF 1LE2A 1V4AA 3DE8A 3ZG1A 5KYYB 5B3IA 1FMVA 2LQGA 4J32B 5DS4A 2R7VA 3BRJA 3SXKA 5L0DA 1QKRA 4U5DE 5KYUA 3ZC4A 4JJFA 1OKKD 1T6IA 2Y69C 2YL0A 3GM3A 3HTKC 4YT4A 4HFKB 1XWJA 5AC5A 1Q0DA 3HNLA 1OCOC 4JCHA 2Y3HA 3S27A 3ZTMA 3EH1A 4AX2A 2R02A 1MMNA 1ZZPA 3VYWA 3FOPA 2HUJA 3NMKA 2XLDA 2Y3GA 2V3CC 1OCCC 4P9TA 1ST6A 1BBHA 3UNGC 1D1CA 2KW3C 4I3MA 1T9KA 1EKYA 2W4BA 2A6HF 4UDVA 1KTMA 1E86A 1O3UA 2B0JA 2LK4A 4D4XA 1TQGA 4MTFA 4ANJA 2YLDA 2I8BA 1LI5A 3AGTA 1S7ZA 2DGJA 4H4KC 3JTLO 3ZQYA 3JRMO 3FVYA 4OIRF 2HSQA 3Q7LA 2ICWG 1FFTC 1C03A 3TD7A 2GFHA 3ZQVA 5BUOA 4Q5SF 4IJJA 2P61A 4XPXA 3IEEA 5BQIA 3UGPA 4YT5A 2PX3A 3C7JA 1C17M 3FOOA 1CGOA 1Z5ZA 3EZIA 1GS9A 4KI2A 2BL2A 2CNWD 2J45A 3EH2A 3NYMA 3JT1A 4CDVA 3B0UX 256BA 4AE4A 4CSAA 2NSGA 4XLPF 3LLIA 5DQZA 3LUTB 2ASRA 2CGEA 3EJNA 3K7DA 4EBBA 2XXAB 2A1DD 2LFDA 2Q00A 3RFYA 4LDRA 4BJ5A 5L0FA 4N06A 3WODF 1RKCA 1W2WA 1FAPB 1D1AA 1WASA 3AG3C 1SYQA 2DYRC 3N2ZB 4C7OB 3LEVA 4JC7A 4JVSA 3U0CA 1RCPA 2KGOA 3U8PA 1ORYA 2GWWA 3VRCA 2IM8A 1YZAA 4W8KA 1QVXA 2M64A 3MFNA 2R03A 3QMKA 1JRAA 3GANA 4AL0A 4DBRA 1VLTA 5L0GA 3G4XA 3DAGA 3EZHA 5BQHA 2KJGA 3W4YA 3Q7GA 1EI7A 4DJ9A 1LKXA 3JYYA 1MMGA 2L81A 3ZSUA 3U8VA 1CPQA 2R25A 3DD7A 3K6BA 2XL4A 3PDMP 1G4WR 1L7CA 4BPMA 2YKZA 5KYWA 3UMHA 3MBGA 3IPMO 4NTFA 2IXPA 4JJGA 2WL8A 2PF4E 5E33A 2ETSA 4U9EA 4PACA 3ABMC 1YA7O 2HV7A 4PFPA 4Z9JA 2J0WA 4IAOA 2JX0A 2V26A 2Y3DA 4YN0B 4G7OF 4XPYA 3EGDB 4C3EA 2MHRA 3K1HA 5L0IA 1NFOA 2LD6A 2NUTB 4I1MA 4I1OB 3UMKA 3GWNA 4K7BA 3LESA 1WWPA 3L1MA 4CSAC 3V5XA 1OXBA 1VK5A 2MWQA 4CIPA 1H9TA 3SEOA 2HMQA 3QTHA 4G78A 3HNKA 4HEAJ 2L7AA 3B71A 4BJ5C 4EHPA 2OQMA 1VLSA 3JYHA 5F5HA 1AUEA 2XS8A 4ER9A 4GYTA 1V55C 3RYLA 2IBFA 4EUKB 3DAFA 1FNTc 1WOLA 3TOLA 3M15A 2A69F 4LERA 3TOMA 3C8ZA 4DVYP 1YVIA 1YDIA 2WVNA 2Y39A 2XLEA 3C8GD 1ZU5A 2Q9CA 4NCQA 4EBKA 4YT8A 3PHF2 2OJED 2F22A 1HW2A 4OIOF 2G3VA 1Q0GA 1A7VA 5JVEA 4U5BE 1JPNA 3A11A 2G3KA 4NTAA 3B0PA 3Q6MA 5KYXA 5COFA 4QI2A 1K05A 1APCA 2Y3BA 3L34A 5TJ5E 1TFOB 1OW6A 2L6GA 2YL7A 5FCLA 2WB7A 3BEHA 3S29A 4XEKA 1DOVA 4CDYA 5L0JA 3MYFA 3QVYA 4P9FA 5L0CA 3QVZA 2E87A 3V5YA 1RKEA 3EG9A 2YLGA 5HV9A 2XM4A 1XZPA 4U5EE 1MQVA 3K66A 4JTDB 2J8WA 2LFFA 2WVOA 2YL3A 3CQZA 3NYJA 3C8GA 1H9GA 2EPLX 3U2MA 3U2LA 3M4BA 1YYXA 2EIJC 4I44A 1IZMA 3AG1C 1QZXA 4U9DA 4E0IA 2C04A 2I15A 2VH3A 2W4MA 1RMVA 4JCZA 1QPUA 1HMDA 1HE1A 3ZDLA 5DS6A 2CCYA 2HV6A 1A41A 1M2VA 1Q0KA 2NSFA 3QW0A 1TWAA 5COMA 1FTSA 3EQLF 2J9UA 3CZ6A 3U5SA 2L9JA 3FXHA 1SR2A 2R05A 3FHDA 2FGYA 2J0XA 1WN0A 3TULA 4ULWA 5COGA 2RSEB 3VM6A 4O6YA 3HKKA 4N4WA 4LLCA 2R7UA 3E70C 3GWLA 2PBEA 2Q4FA 1K04A 3KL4A 2ZXRA 5B3SC 3NRHA 5D91A 1OCRC 2WZLA 4KBLA 5KYUB 2R7SA 2BC5A 1O87A 4M63A 3QW1A 3N24A 3WHNA 5JRAA 1GM5A 2J7PA 1Q0FA 3RH3A 3G50A 2EPNA 5A6JA 2HMZA 3FDQA 4NTBA 1JMWA 1BR2A 1WGWA 4E18A 5AC4A 5T3WA 2Q7RA 1DOWA 2Q3TA 4MVMA 3DJNB 1VMAA 3ASNC 3FAPB 4G7HF 3H2VA 4HFFB 1G4US 2AP3A 3GEEA 4E7SA 1U89A 1PV3A 4IWBA 1D0ZA 4JEAA 2A0BA 5IY5C 4O79A 2QY9A 3U3BA 1VOMA 3TQOA 3HJCA 3T6GB 4JTCB 2EIKC 2YLIA 5CI9A 1CPRA 1ZHXA 5HSWA 2CDQA 1QSPA 2D4UA 1G8XA 2PX0A 3AG2C 2YHSA 3IQTA 1SF8A 1E2XA 1NBBA 1LPEA 4XEFA 2B0HA 3T6BA 3SZRA 3UMIA 5JS5A 2XLMA 1HE9A 1J8YF 5CI8A 3LJBA
chains in the Genus database with same CATH topology
2J9BA 3ZWIA 1LM3B 5JP7A 2YL1A 3C63A 4WGZA 1M6TA 3L1MA 4CX9A 4JKVA 4CIPA 3C62A 2XLVA 3HNKA 3NMJA 4ER9A 3HNJA 4CJOA 3TOLA 3M15A 3DE8A 3TOMA 5B3IA 4CJGA 2XLEA 4IB4A 2XL6A 2QLAA 4JE9A 1A7VA 5JVEA 2YL0A 5JT4A 3HNLA 1JAFA 1APCA 3ZTMA 3IQ6A 3M79A 4IARA 4JEBA 2YL7A 3FOPA 4IAQA 3NMKA 2XLDA 4ULVA 4CDYA 3QVYA 1BBHA 3QVZA 2YLGA 1EKYA 2XM4A 1MQVA 1E86A 2J8WA 2YL3A 5JLIA 4D4XA 4L6RA 1YYJA 2YLDA 3M4BA 1YYXA 4U9DA 3ZQYA 3IQ5A 4WGYA 2XLWA 1QPUA 3ZQVA 2CCYA 3DE9A 3QW0A 1QQ3A 4N6HA 2XLOA 3FOOA 1CGOA 1E83A 4CDVA 1E84A 1YZCA 256BA 4N4WA 4D4NA 3NMIA 4EIYA 3HNIA 2BC5A 4CDAA 5JRAA 3QW1A 1GQAA 1CGNA 4NC3A 1RCPA 3U8PA 5JSLA 3VRCA 1YZAA 2XLHA 3ZTZA 2XL8A 1S05A 5AGFA 1CPQA 2YLIA 1CPRA 5JUAA 2YKZA 1E85A 1NBBA 5JS5A 2XLMA 2XM0A 3M4CA 4U9EA 4JEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9B A;  3ZWI A;  1LM3 B;  5JP7 A;  2YL1 A;  3C63 A;  4WGZ A;  1M6T A;  3L1M A;  4CX9 A;  4JKV A;  4CIP A;  3C62 A;  2XLV A;  3HNK A;  3NMJ A;  4ER9 A;  3HNJ A;  4CJO A;  3TOL A;  3M15 A;  3DE8 A;  3TOM A;  5B3I A;  4CJG A;  2XLE A;  4IB4 A;  2XL6 A;  2QLA A;  4JE9 A;  1A7V A;  5JVE A;  2YL0 A;  5JT4 A;  3HNL A;  1JAF A;  1APC A;  3ZTM A;  3IQ6 A;  3M79 A;  4IAR A;  4JEB A;  2YL7 A;  3FOP A;  4IAQ A;  3NMK A;  2XLD A;  4ULV A;  4CDY A;  3QVY A;  1BBH A;  3QVZ A;  2YLG A;  1EKY A;  2XM4 A;  1MQV A;  1E86 A;  2J8W A;  2YL3 A;  5JLI A;  4D4X A;  4L6R A;  1YYJ A;  2YLD A;  3M4B A;  1YYX A;  4U9D A;  3ZQY A;  3IQ5 A;  4WGY A;  2XLW A;  1QPU A;  3ZQV A;  2CCY A;  3DE9 A;  3QW0 A;  1QQ3 A;  4N6H A;  2XLO A;  3FOO A;  1CGO A;  1E83 A;  4CDV A;  1E84 A;  1YZC A;  256B A;  4N4W A;  4D4N A;  3NMI A;  4EIY A;  3HNI A;  2BC5 A;  4CDA A;  5JRA A;  3QW1 A;  1GQA A;  1CGN A;  4NC3 A;  1RCP A;  3U8P A;  5JSL A;  3VRC A;  1YZA A;  2XLH A;  3ZTZ A;  2XL8 A;  1S05 A;  5AGF A;  1CPQ A;  2YLI A;  1CPR A;  5JUA A;  2YKZ A;  1E85 A;  1NBB A;  5JS5 A;  2XLM A;  2XM0 A;  3M4C A;  4U9E A;  4JEA A; 
#chains in the Genus database with same CATH topology
 4MVZ A;  5E2Q A;  3S28 A;  3H2U A;  2J9B A;  1HW1 A;  1A7E A;  3T9O A;  1PCX A;  2NUP A;  3EGX A;  3LLK A;  3W8I A;  2GAQ A;  4DOZ A;  1LVK A;  4GQH A;  2X0C A;  4FWV A;  1LM3 B;  2ZXP A;  5FZT A;  2KSF A;  2YL1 A;  4GEH A;  1OXK A;  4JIO A;  3E9V A;  2GA0 A;  3O10 A;  4AE4 B;  2R7W A;  2TMV P;  1WTY A;  4MW3 A;  4YL3 A;  1M6T A;  1K40 A;  2L6H A;  2QTV A;  1MNE A;  1VYK A;  3GM1 A;  4CS8 A;  4CX9 A;  5KYN A;  3WG7 C;  3EFO A;  1R5I D;  3W2V A;  1Y4C A;  1D1B A;  1PD1 A;  4Q7C A;  5F5F A;  3HNJ A;  2EIM C;  4BJ6 A;  2H8A A;  3JZ0 A;  4CJO A;  4MQ9 F;  4YK5 A;  1HY5 A;  3OEO A;  3X2Q C;  3ATP A;  1Z63 A;  1NSG B;  2OKU A;  4N6C A;  3POV A;  1RJ9 A;  4IB4 A;  1SMY F;  2CYD A;  1A7D A;  2QLA A;  3ECS A;  3H65 A;  4H54 A;  5EHH A;  2P1A A;  3S90 A;  3EHM A;  3JRT A;  4PR9 A;  4LAC B;  3B9Q A;  1LE4 A;  4X0R A;  4EWC A;  2EIN C;  2HSB A;  3SXY A;  1JAF A;  4YL0 A;  4B6I A;  1I5N A;  3UR3 C;  3RVZ A;  4MW8 A;  5B1A C;  3IQ6 A;  3JSE O;  3KMI A;  5GPG B;  5KYW B;  3LS0 A;  4PJJ A;  3DM9 B;  4FX5 A;  4MTG A;  2YWA A;  4U5F E;  4IAQ A;  3DWW A;  5L3Q A;  5DS5 A;  2VCA A;  1Z7Q c;  4J7Y A;  3OA1 A;  4F4B A;  3NYL A;  1EA8 A;  2J9V A;  1BDJ B;  1H6G A;  2R9R B;  2ZPA A;  3GOD A;  1NLX A;  4OIP F;  4XQ1 A;  4O6N A;  1Z3I X;  3AQB A;  1ORS C;  2VCC A;  4J30 B;  4C3B A;  3KPH A;  4A2N B;  1G5Z A;  1M56 C;  2R7R A;  2HFI A;  2IOQ A;  2XRH A;  3IQ5 A;  1AEP A;  1V74 B;  2A0U A;  4WGY A;  3TK0 A;  2IXN A;  3GM2 A;  3V5Z A;  3LNM B;  2OOC A;  3CAX A;  2KYH A;  2EPO A;  4K1O A;  4MVO A;  1B68 A;  1FFH A;  1PD0 A;  1ZW3 A;  2HZ8 A;  2P0N A;  4CS8 C;  2XLO A;  3S84 A;  1OW7 A;  4PJM A;  3GOR A;  3U9M A;  1F1M A;  4BJT A;  1Z23 A;  2P7V A;  1Z6A A;  4JW1 A;  4OD5 A;  4U5G A;  4U5C E;  1E84 A;  1YZC A;  1ZHT A;  4BJ6 C;  3NMI A;  3VAY A;  2G62 A;  3KYI A;  1OR2 A;  3X1O A;  4EIY A;  2JD3 A;  4KNV A;  5A6K A;  3F47 A;  4XLN F;  3B0V C;  2D5R B;  4A4A A;  2R7T A;  4LDK A;  2IXM A;  4PJL A;  3AJM A;  3N0T A;  4CS7 A;  1GQA A;  1LI7 A;  4RD9 A;  2H7B A;  4NC3 A;  1ZHY A;  5KYX B;  1YAR O;  1MMD A;  4G0H A;  2J7P D;  3SP1 A;  3AQC A;  4K0D A;  4DRI B;  2XLH A;  2JPU A;  1UFB A;  3DZA A;  2DYS C;  3NG1 A;  3AOU A;  3ZTZ A;  3ZVR A;  5KYY A;  3GEH A;  2O9X A;  2WVQ A;  2PNO A;  4R32 A;  5AGF A;  3DKA A;  2YQY A;  1ZHZ A;  4KC9 A;  2RD9 A;  1GGQ A;  1RKE B;  5D92 A;  3EG9 B;  4EBJ A;  4MND A;  4E7Z A;  2NPU A;  4BEJ A;  3EPV A;  3WAQ A;  1Q0M A;  2YEV A;  3C8G B;  2AWC A;  3PMR A;  4WAB A;  4MTO A;  2H7O A;  1ZVZ A;  1IW7 F;  1E85 A;  1H7I A;  4MVS A;  1OQC A;  2FFH A;  1YAU O;  1JR8 A;  2XM0 A;  5A6B D;  3M4C A;  1M2V B;  1ZU4 A;  5EK0 A;  1OR3 A;  2Q9A A;  2X51 A;  3ZWI A;  1V54 C;  1YA9 A;  1TWC A;  2HS5 A;  2NG1 A;  2MYS A;  3L8J A;  4JRZ A;  3RQE A;  1T6Q A;  3LEO A;  5JP7 A;  3U3F A;  3U9J A;  2OG2 A;  1VYI A;  1NU9 C;  3CSK A;  4NQF A;  5T3T A;  3ASO C;  1CGM E;  4MVQ A;  3LS1 A;  3ABK C;  1ZW2 A;  4JTA B;  3ABL C;  4G7Z F;  1I4Y A;  1VTM P;  4OIN F;  1RXQ A;  2P6V A;  3ITF A;  3S0X A;  4JKV A;  2LP4 A;  3W2W A;  2YVK A;  3L8I A;  3C62 A;  4PK4 A;  1U6H A;  1VB5 A;  3NMJ A;  2W45 A;  1M57 C;  2OEV A;  2VB6 A;  3RQF A;  3R7C A;  4XTK A;  5A6B A;  3A9C A;  4C3D A;  2R7Q A;  3B29 A;  2A6E F;  1A0B A;  4QI0 A;  2GDC A;  3OWT A;  4Z9I A;  5E3A A;  3I5P A;  4IGG A;  4CJG A;  2OU6 A;  1OKK A;  2XXA A;  2XL6 A;  2OCC C;  4LLE A;  4MS2 A;  2Q9B A;  2W9Y A;  4JE9 A;  2YRF A;  4KNW A;  3DI5 A;  5BQG A;  5JT4 A;  2J9W A;  3IHU A;  4OIQ F;  1KNY A;  1QLE C;  3DJU B;  4EKW A;  4RDA A;  4C7O A;  4RBN A;  1HMO A;  2EIL C;  3LAY A;  1YLM A;  3AG4 C;  3KH2 A;  3M79 A;  3O39 A;  4IAR A;  4JEB A;  4BG0 A;  4BEM J;  2OEX A;  1TKN A;  3RW0 A;  3I4U A;  3SNH A;  4MVR A;  2H7V C;  2FAP B;  1UG7 A;  1J8M F;  1AVO B;  2VAS A;  3DM5 A;  4ULV A;  4WJ0 A;  4AK9 A;  5F28 E;  3T4R A;  5L0H A;  2BE5 F;  4JZA A;  2XSE A;  2NUP B;  2LIG A;  3EGX B;  4CS9 A;  1BZ4 A;  3F46 A;  4CBE A;  4ZLC A;  4ZLD A;  4JUR I;  2AVK A;  4XWJ A;  5JLI A;  4L6R A;  1YYJ A;  2KQ9 A;  4XEV A;  3MX3 A;  2VCB A;  1T01 A;  4DXW A;  3C18 A;  4NY3 A;  1LS1 A;  2WZF A;  2IYL D;  4U5H A;  5K0I A;  2XLW A;  3RVY A;  3PCV A;  2DB4 A;  1OCZ C;  1SZI A;  3DE9 A;  5E3C A;  1U0B B;  3EFO B;  2CNW A;  1QQ3 A;  4N6H A;  3K33 A;  1TWH A;  2L6F A;  3TJ6 A;  4ONS A;  4DVZ A;  1E83 A;  2KK1 A;  3GEI A;  4J7T A;  4DRJ B;  3EGD A;  3CEX A;  2HJ3 A;  1BR1 A;  4D4N A;  2NUT A;  4O6M A;  2DI3 A;  4QDL A;  1O5H A;  1ZHW A;  1TFK B;  2R7X A;  2ZXO A;  3HNI A;  2A68 F;  1RJ9 B;  5A69 A;  4OD4 A;  5DVW A;  4E17 A;  3NDB B;  3O6X A;  1WAT A;  3K1I A;  4CDA A;  2R7O A;  3FMS A;  1CGN A;  3SXM A;  2QUP A;  3KKB A;  3G4Z A;  4BJ1 A;  1I4Z A;  1JPJ A;  5JSL A;  4PJN A;  1D0X A;  2C03 A;  3AGU A;  3JSZ A;  2ZXW C;  1T6U A;  3DXJ F;  5A6A A;  2VC9 A;  3IQC A;  2J46 A;  3MYI A;  3SXZ A;  1M2O A;  3ZIB A;  3UGO A;  3QZC A;  4AL1 A;  1JOG A;  1S05 A;  1TWG A;  2XL8 A;  4YL1 A;  4YJW A;  1ORJ A;  2QNL A;  2IXO A;  5T1D B;  2OJQ A;  3W8H A;  1TR2 A;  1Y6D A;  1YJG A;  2M4E A;  3DMD A;  4LDQ A;  4Z9H A;  1FMW A;  3VF0 A;  1ZYR F;  3NKE A;  3MLG A;  4CS9 C;  1KU2 A;  2XS1 A;  4IRU A;  3FAJ A;  1MND A;  4XPW A;  3RF3 A;  3J06 A;  1LS4 A;  4FAP B;  1EQ1 A;  5JUA A;  1LIH A;  4PFO A;  2WZG A;  4DBQ A;  1BR4 A;  1NZE A;  3RIP A;  5CIV A;  2EPM X;  2HJM A;  1D0Y A;  3M1C B;  3NKD A;  1T5O A;  5B1B C;  3SYN A;  5L3V A;  2ZD9 A;  5DQT A;  2KC3 A;  1NU7 D;  2AU5 A;  2QE9 A;  1NG1 A;  3RQG A;  3KYJ A;  1XZQ A;  2Z15 A;  4HE8 D;  2UUH A;  2LCH A;  2UUI A;  3RKO F;  3R2P A;  1FR0 A;  3Q6N A;  2HKV A;  5DLJ A;  2PFD A;  4YWQ A;  3V7O A;  4YT2 A;  3L0I A;  2EPK X;  3C63 A;  4FES A;  3HLZ A;  1OW8 A;  3I5Q A;  2YZS A;  4MVU A;  4W8P A;  4E0H A;  4O7G A;  4WGZ A;  3US6 A;  2KNH A;  1C02 A;  3LNR A;  4CIH A;  1MMA A;  3JCU Q;  4DRH B;  2LSE A;  3TJ5 A;  2PP4 A;  1N1C A;  1R4T A;  5EGY A;  2XLV A;  3EHN A;  1NFN A;  1L3P A;  2AWY A;  3T6J A;  3O55 A;  3K1I C;  2CW0 F;  3S9O A;  4P6I C;  4Q4Z F;  1LE2 A;  1V4A A;  3DE8 A;  3ZG1 A;  5KYY B;  5B3I A;  1FMV A;  2LQG A;  4J32 B;  5DS4 A;  2R7V A;  3BRJ A;  3SXK A;  5L0D A;  1QKR A;  4U5D E;  5KYU A;  3ZC4 A;  4JJF A;  1OKK D;  1T6I A;  2Y69 C;  2YL0 A;  3GM3 A;  3HTK C;  4YT4 A;  4HFK B;  1XWJ A;  5AC5 A;  1Q0D A;  3HNL A;  1OCO C;  4JCH A;  2Y3H A;  3S27 A;  3ZTM A;  3EH1 A;  4AX2 A;  2R02 A;  1MMN A;  1ZZP A;  3VYW A;  3FOP A;  2HUJ A;  3NMK A;  2XLD A;  2Y3G A;  2V3C C;  1OCC C;  4P9T A;  1ST6 A;  1BBH A;  3UNG C;  1D1C A;  2KW3 C;  4I3M A;  1T9K A;  1EKY A;  2W4B A;  2A6H F;  4UDV A;  1KTM A;  1E86 A;  1O3U A;  2B0J A;  2LK4 A;  4D4X A;  1TQG A;  4MTF A;  4ANJ A;  2YLD A;  2I8B A;  1LI5 A;  3AGT A;  1S7Z A;  2DGJ A;  4H4K C;  3JTL O;  3ZQY A;  3JRM O;  3FVY A;  4OIR F;  2HSQ A;  3Q7L A;  2ICW G;  1FFT C;  1C03 A;  3TD7 A;  2GFH A;  3ZQV A;  5BUO A;  4Q5S F;  4IJJ A;  2P61 A;  4XPX A;  3IEE A;  5BQI A;  3UGP A;  4YT5 A;  2PX3 A;  3C7J A;  1C17 M;  3FOO A;  1CGO A;  1Z5Z A;  3EZI A;  1GS9 A;  4KI2 A;  2BL2 A;  2CNW D;  2J45 A;  3EH2 A;  3NYM A;  3JT1 A;  4CDV A;  3B0U X;  256B A;  4AE4 A;  4CSA A;  2NSG A;  4XLP F;  3LLI A;  5DQZ A;  3LUT B;  2ASR A;  2CGE A;  3EJN A;  3K7D A;  4EBB A;  2XXA B;  2A1D D;  2LFD A;  2Q00 A;  3RFY A;  4LDR A;  4BJ5 A;  5L0F A;  4N06 A;  3WOD F;  1RKC A;  1W2W A;  1FAP B;  1D1A A;  1WAS A;  3AG3 C;  1SYQ A;  2DYR C;  3N2Z B;  4C7O B;  3LEV A;  4JC7 A;  4JVS A;  3U0C A;  1RCP A;  2KGO A;  3U8P A;  1ORY A;  2GWW A;  3VRC A;  2IM8 A;  1YZA A;  4W8K A;  1QVX A;  2M64 A;  3MFN A;  2R03 A;  3QMK A;  1JRA A;  3GAN A;  4AL0 A;  4DBR A;  1VLT A;  5L0G A;  3G4X A;  3DAG A;  3EZH A;  5BQH A;  2KJG A;  3W4Y A;  3Q7G A;  1EI7 A;  4DJ9 A;  1LKX A;  3JYY A;  1MMG A;  2L81 A;  3ZSU A;  3U8V A;  1CPQ A;  2R25 A;  3DD7 A;  3K6B A;  2XL4 A;  3PDM P;  1G4W R;  1L7C A;  4BPM A;  2YKZ A;  5KYW A;  3UMH A;  3MBG A;  3IPM O;  4NTF A;  2IXP A;  4JJG A;  2WL8 A;  2PF4 E;  5E33 A;  2ETS A;  4U9E A;  4PAC A;  3ABM C;  1YA7 O;  2HV7 A;  4PFP A;  4Z9J A;  2J0W A;  4IAO A;  2JX0 A;  2V26 A;  2Y3D A;  4YN0 B;  4G7O F;  4XPY A;  3EGD B;  4C3E A;  2MHR A;  3K1H A;  5L0I A;  1NFO A;  2LD6 A;  2NUT B;  4I1M A;  4I1O B;  3UMK A;  3GWN A;  4K7B A;  3LES A;  1WWP A;  3L1M A;  4CSA C;  3V5X A;  1OXB A;  1VK5 A;  2MWQ A;  4CIP A;  1H9T A;  3SEO A;  2HMQ A;  3QTH A;  4G78 A;  3HNK A;  4HEA J;  2L7A A;  3B71 A;  4BJ5 C;  4EHP A;  2OQM A;  1VLS A;  3JYH A;  5F5H A;  1AUE A;  2XS8 A;  4ER9 A;  4GYT A;  1V55 C;  3RYL A;  2IBF A;  4EUK B;  3DAF A;  1FNT c;  1WOL A;  3TOL A;  3M15 A;  2A69 F;  4LER A;  3TOM A;  3C8Z A;  4DVY P;  1YVI A;  1YDI A;  2WVN A;  2Y39 A;  2XLE A;  3C8G D;  1ZU5 A;  2Q9C A;  4NCQ A;  4EBK A;  4YT8 A;  3PHF 2;  2OJE D;  2F22 A;  1HW2 A;  4OIO F;  2G3V A;  1Q0G A;  1A7V A;  5JVE A;  4U5B E;  1JPN A;  3A11 A;  2G3K A;  4NTA A;  3B0P A;  3Q6M A;  5KYX A;  5COF A;  4QI2 A;  1K05 A;  1APC A;  2Y3B A;  3L34 A;  5TJ5 E;  1TFO B;  1OW6 A;  2L6G A;  2YL7 A;  5FCL A;  2WB7 A;  3BEH A;  3S29 A;  4XEK A;  1DOV A;  4CDY A;  5L0J A;  3MYF A;  3QVY A;  4P9F A;  5L0C A;  3QVZ A;  2E87 A;  3V5Y A;  1RKE A;  3EG9 A;  2YLG A;  5HV9 A;  2XM4 A;  1XZP A;  4U5E E;  1MQV A;  3K66 A;  4JTD B;  2J8W A;  2LFF A;  2WVO A;  2YL3 A;  3CQZ A;  3NYJ A;  3C8G A;  1H9G A;  2EPL X;  3U2M A;  3U2L A;  3M4B A;  1YYX A;  2EIJ C;  4I44 A;  1IZM A;  3AG1 C;  1QZX A;  4U9D A;  4E0I A;  2C04 A;  2I15 A;  2VH3 A;  2W4M A;  1RMV A;  4JCZ A;  1QPU A;  1HMD A;  1HE1 A;  3ZDL A;  5DS6 A;  2CCY A;  2HV6 A;  1A41 A;  1M2V A;  1Q0K A;  2NSF A;  3QW0 A;  1TWA A;  5COM A;  1FTS A;  3EQL F;  2J9U A;  3CZ6 A;  3U5S A;  2L9J A;  3FXH A;  1SR2 A;  2R05 A;  3FHD A;  2FGY A;  2J0X A;  1WN0 A;  3TUL A;  4ULW A;  5COG A;  2RSE B;  3VM6 A;  4O6Y A;  3HKK A;  4N4W A;  4LLC A;  2R7U A;  3E70 C;  3GWL A;  2PBE A;  2Q4F A;  1K04 A;  3KL4 A;  2ZXR A;  5B3S C;  3NRH A;  5D91 A;  1OCR C;  2WZL A;  4KBL A;  5KYU B;  2R7S A;  2BC5 A;  1O87 A;  4M63 A;  3QW1 A;  3N24 A;  3WHN A;  5JRA A;  1GM5 A;  2J7P A;  1Q0F A;  3RH3 A;  3G50 A;  2EPN A;  5A6J A;  2HMZ A;  3FDQ A;  4NTB A;  1JMW A;  1BR2 A;  1WGW A;  4E18 A;  5AC4 A;  5T3W A;  2Q7R A;  1DOW A;  2Q3T A;  4MVM A;  3DJN B;  1VMA A;  3ASN C;  3FAP B;  4G7H F;  3H2V A;  4HFF B;  1G4U S;  2AP3 A;  3GEE A;  4E7S A;  1U89 A;  1PV3 A;  4IWB A;  1D0Z A;  4JEA A;  2A0B A;  5IY5 C;  4O79 A;  2QY9 A;  3U3B A;  1VOM A;  3TQO A;  3HJC A;  3T6G B;  4JTC B;  2EIK C;  2YLI A;  5CI9 A;  1CPR A;  1ZHX A;  5HSW A;  2CDQ A;  1QSP A;  2D4U A;  1G8X A;  2PX0 A;  3AG2 C;  2YHS A;  3IQT A;  1SF8 A;  1E2X A;  1NBB A;  1LPE A;  4XEF A;  2B0H A;  3T6B A;  3SZR A;  3UMI A;  5JS5 A;  2XLM A;  1HE9 A;  1J8Y F;  5CI8 A;  3LJB A; 
#chains in the Genus database with same CATH homology
 2J9B A;  3ZWI A;  1LM3 B;  5JP7 A;  2YL1 A;  3C63 A;  4WGZ A;  1M6T A;  3L1M A;  4CX9 A;  4JKV A;  4CIP A;  3C62 A;  2XLV A;  3HNK A;  3NMJ A;  4ER9 A;  3HNJ A;  4CJO A;  3TOL A;  3M15 A;  3DE8 A;  3TOM A;  5B3I A;  4CJG A;  2XLE A;  4IB4 A;  2XL6 A;  2QLA A;  4JE9 A;  1A7V A;  5JVE A;  2YL0 A;  5JT4 A;  3HNL A;  1JAF A;  1APC A;  3ZTM A;  3IQ6 A;  3M79 A;  4IAR A;  4JEB A;  2YL7 A;  3FOP A;  4IAQ A;  3NMK A;  2XLD A;  4ULV A;  4CDY A;  3QVY A;  1BBH A;  3QVZ A;  2YLG A;  1EKY A;  2XM4 A;  1MQV A;  1E86 A;  2J8W A;  2YL3 A;  5JLI A;  4D4X A;  4L6R A;  1YYJ A;  2YLD A;  3M4B A;  1YYX A;  4U9D A;  3ZQY A;  3IQ5 A;  4WGY A;  2XLW A;  1QPU A;  3ZQV A;  2CCY A;  3DE9 A;  3QW0 A;  1QQ3 A;  4N6H A;  2XLO A;  3FOO A;  1CGO A;  1E83 A;  4CDV A;  1E84 A;  1YZC A;  256B A;  4N4W A;  4D4N A;  3NMI A;  4EIY A;  3HNI A;  2BC5 A;  4CDA A;  5JRA A;  3QW1 A;  1GQA A;  1CGN A;  4NC3 A;  1RCP A;  3U8P A;  5JSL A;  3VRC A;  1YZA A;  2XLH A;  3ZTZ A;  2XL8 A;  1S05 A;  5AGF A;  1CPQ A;  2YLI A;  1CPR A;  5JUA A;  2YKZ A;  1E85 A;  1NBB A;  5JS5 A;  2XLM A;  2XM0 A;  3M4C A;  4U9E A;  4JEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...