2XLOA

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124e variant with bound no
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 51
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xloA00
4CDAA 4WGZA 4JE9A 5B3IA 1MQVA 1NBBA 2BC5A 3ZWIA 2YLIA 3HNKA 3DE9A 1E83A 4IARA 2XL8A 1CGOA 4U9DA 3VRCA 2XLOA 3ZTZA 2J8WA 2XLVA 3FOOA 3QW0A 2XLHA 1E85A 5JRAA 3ZQVA 1CPQA 3M4BA 3IQ5A 2XLEA 2QLAA 1E84A 3HNJA 1YZAA 3QVYA 1LM3B 3NMJA 3M4CA 3U8PA 1YYXA 3DE8A 3ZQYA 3HNLA 2YLGA 1BBHA 1GQAA 4JKVA 2CCYA 4CDVA 256BA 4CJOA 4NC3A 3IQ6A 1CGNA 1APCA 3ZTMA 3TOMA 3C62A 1S05A 2YL1A 1YYJA 5JS5A 2YL7A 4CDYA 2YL3A 4N4WA 3NMKA 4L6RA 5JP7A 3FOPA 2XM0A 4IAQA 2YLDA 4U9EA 3HNIA 3TOLA 4CJGA 3QW1A 3M15A 2XL6A 4CX9A 3C63A 1A7VA 4CIPA 1RCPA 1CPRA 4ER9A 3QVZA 1EKYA 4N6HA 5JLIA 3L1MA 5JUAA 1YZCA 1QPUA 4EIYA 4D4XA 4JEAA 5JT4A 1E86A 1JAFA 2YL0A 2XLDA 5AGFA 5JVEA 4ULVA 2XLWA 4D4NA 3NMIA 3M79A 1M6TA 2YKZA 4IB4A 4JEBA 1QQ3A 2XLMA 2XM4A 4WGYA 2J9BA 5JSLA
chains in the Genus database with same CATH superfamily
4CDAA 4WGZA 3OA1A 3ASOC 2A1DD 1AUEA 4R32A 5COMA 2HFIA 3AJMA 1H9TA 2A0UA 5TJ5E 2Y3GA 3ABLC 1D0YA 3Q7GA 4PR9A 3LLKA 1J8YF 3EGDB 1JPNA 4KC9A 1E83A 2IXNA 2AU5A 4ULWA 3C18A 3AG4C 1NG1A 1Z5ZA 1LVKA 3VRCA 3QZCA 4I44A 4U5HA 4AX2A 1ORJA 1TQGA 4PFOA 5BQGA 3S0XA 2R7VA 1WTYA 2IOQA 1O5HA 3RQEA 2XS1A 2QNLA 3S9OA 2XLVA 3S28A 4O79A 2OEXA 3RKOF 3DZAA 2XLHA 2A68F 2CDQA 2WZLA 3ABMC 3DD7A 3EQLF 3DWWA 4JTAB 3W4YA 4MW3A 1Z23A 3RVYA 5BQIA 5L3VA 4GYTA 3HLZA 1V54C 3JRTA 4WJ0A 1T9KA 3ZQVA 4MVQA 2KJGA 3M4BA 1GM5A 2XLEA 2QLAA 5DS4A 3PCVA 4HE8D 2J7PA 3HNJA 2EPMX 2J9VA 3LLIA 1BZ4A 2L6GA 4P9TA 4NTAA 2P0NA 3DM5A 1BR4A 5CIVA 1SZIA 3OEOA 3ZQYA 4W8PA 5COFA 2ZXPA 3HJCA 5B1AC 5EGYA 4G7ZF 2NUPB 4BPMA 1D1BA 2F22A 3HNLA 3N24A 1VOMA 2OG2A 1Z7Qc 2XL4A 4JKVA 1JRAA 3C7JA 4EKWA 2OJQA 3NRHA 3G4ZA 4C3EA 2P61A 2KQ9A 4Q7CA 2A0BA 3TOMA 5KYXA 3JTLO 1O87A 3TQOA 1MNDA 1R5ID 3AGTA 1IZMA 4CS8C 5E3AA 3MYIA 1K40A 1YYJA 2AP3A 3DXJF 3L0IA 1W2WA 3KYIA 4U5FE 2PFDA 1SR2A 2OKUA 2YL3A 3SXYA 4CIHA 4RDAA 4OIRF 3EG9A 3FDQA 3UNGC 1ZHXA 4L6RA 4JIOA 1YJGA 3CSKA 4JZAA 4DVZA 2XM0A 4MTOA 3LJBA 3LS1A 4OD4A 5AC5A 4KNWA 1OCZC 1LI7A 1VYIA 2PNOA 1ZHZA 2W9YA 3ECSA 4J7YA 4XEKA 1T6IA 2EIJC 2JPUA 3AOUA 1OKKD 1BR2A 2EPLX 2YEVA 2JD3A 1ZVZA 3CZ6A 3MLGA 5KYXB 2OEVA 3QW1A 2CNWD 2DB4A 3JSZA 5KYUA 2JX0A 4MTFA 2AWYA 4LDQA 4NTFA 3UGPA 4CX9A 4JJGA 1A7VA 1QKRA 1RJ9B 4UDVA 3X1OA 2YRFA 1AEPA 4OD5A 3B71A 4PJNA 2G3KA 1FAPB 2YZSA 3RW0A 1YZCA 1QPUA 4EHPA 4D4XA 4YK5A 1PV3A 4EIYA 4H54A 2LQGA 3MX3A 4HFKB 2VC9A 1T6QA 2QE9A 1YLMA 5JT4A 2DYRC 1E86A 4EBBA 3DAGA 3VYWA 5AGFA 1JOGA 4Q5SF 2R03A 2PX0A 3V5YA 2QTVA 3S84A 3U0CA 2J0WA 3H2UA 2Q00A 3K1IC 4RBNA 1NFNA 5L0HA 2XLWA 3H65A 4NTBA 3GM1A 2DGJA 2GWWA 4JJFA 3U2LA 5CI9A 2J9UA 4CS9A 3B0VC 2Y3DA 1QQ3A 2OCCC 4N6CA 1VK5A 2XLMA 2XSEA 3ZG1A 5KYNA 1VMAA 3VF0A 2J9BA 4LLEA 1LPEA 1L7CA 1OXBA 4JE9A 3GEHA 3LEOA 1A0BA 2R02A 2BC5A 3EH2A 3ZWIA 2G62A 2CW0F 4LERA 2NPUA 3V7OA 1LE2A 3IQTA 1ST6A 2CGEA 3ASNC 2Z15A 3GORA 4XTKA 1MMGA 4XPYA 2XLOA 4KBLA 2ASRA 2KK1A 3DM9B 5F28E 2Q7RA 3EGDA 3UR3C 2PF4E 2UUHA 1LE4A 4OIPF 2XS8A 1ZW2A 1L3PA 4J7TA 2R05A 1GS9A 3FOOA 4MNDA 3ZSUA 5L0GA 5B3SC 1YAUO 4AK9A 2J7PD 1OW6A 1YDIA 1E85A 2D4UA 5JRAA 1IW7F 3S90A 2BL2A 5DLJA 3K66A 4GEHA 2EIKC 3QTHA 4IGGA 2L81A 4BJ5C 4E0HA 2R7RA 2J0XA 1EA8A 1LI5A 4E17A 4LACB 3SNHA 1WASA 3TJ6A 1YZAA 3RF3A 5IY5C 2KGOA 3M4CA 4YL0A 3U8PA 5DQTA 2L9JA 1M2OA 2DYSC 2PX3A 4XEFA 1VYKA 5DQZA 5DVWA 4JRZA 1BBHA 4CDVA 3LNMB 2CCYA 2LD6A 2A69F 1YA9A 2NUPA 3LUTB 1ZHWA 1CGNA 1D0XA 1TWGA 2KYHA 3AGUA 3IQ6A 4E7ZA 5BUOA 4I1MA 3T4RA 5AC4A 2W4MA 4I1OB 3T6BA 4JCZA 4QI2A 4PJJA 2R9RB 3B0PA 1YVIA 2H8AA 3AG3C 4XEVA 5D92A 3TJ5A 2YWAA 5L0CA 1SMYF 5JS5A 4CDYA 3A11A 3WAQA 1RKEA 1VLSA 4G78A 3T9OA 1TFOB 1T6UA 4KI2A 1G4WR 3Q6MA 3NMKA 1NLXA 3L8IA 1VLTA 2LCHA 3VAYA 3MFNA 4Q4ZF 2J46A 2LFFA 2NSFA 3FOPA 2Q3TA 5COGA 2XXAA 4QI0A 3KPHA 1UFBA 1HW2A 1MMDA 1OCCC 2HS5A 5T3WA 2R7XA 2A6EF 5F5HA 5L0IA 3K1IA 3EJNA 4CJGA 2ICWG 5D91A 1U6HA 3E9VA 4O7GA 2Q9BA 1E2XA 2AVKA 2C04A 2VCCA 3NDBB 3CQZA 1V74B 4O6YA 3S29A 1C02A 3F47A 1T01A 3AG1C 4YWQA 3POVA 3C63A 1I5NA 1KTMA 4DBQA 1RKEB 2H7BA 2WVNA 3MBGA 2ZPAA 2VCAA 1ZU4A 3QVZA 4JC7A 1JR8A 5JUAA 3C8GB 3L1MA 4G7OF 4AL1A 1Y6DA 2LP4A 2MWQA 1RJ9A 2XXAB 4Z9JA 1ORYA 4HEAJ 4MVRA 2NUTA 4ONSA 2R25A 5KYYB 4JW1A 1LKXA 3B29A 1YA7O 3U3BA 1OQCA 3U5SA 4DJ9A 1Z6AA 4A2NB 4I3MA 3QMKA 4BJ1A 4LLCA 3DAFA 4MVUA 2Y69C 4CSAC 1M56C 4D4NA 3E70C 3NMIA 4PK4A 3WHNA 3UGOA 1KNYA 4BJ6C 1G5ZA 1C03A 1M6TA 2YKZA 3EHMA 4IB4A 4BJ5A 1XZPA 1ORSC 4WGYA 3SXMA 4XLPF 4PJMA 1FFTC 1MMAA 2KSFA 1A7DA 3EH1A 2NUTB 3FMSA 4CS7A 3U9JA 4DRIB 4E7SA 5B3IA 1MQVA 1NBBA 1A7EA 3AG2C 4OIQF 3T6GB 2YLIA 3HNKA 4BJTA 1JMWA 1FTSA 1F1MA 4O6MA 1G4US 4XLNF 4IARA 2XL8A 1TR2A 2LK4A 3J06A 1NZEA 3JSEO 4YT4A 3SEOA 4ZLCA 1N1CA 4PACA 2EPOA 5A6JA 1FNTc 2NG1A 1O3UA 2ZXRA 1R4TA 3CAXA 1TKNA 2J8WA 3N0TA 3T6JA 4AL0A 1OR3A 2W45A 5E2QA 1ZU5A 2Y3HA 3UMKA 3X2QC 5L3QA 2OJED 2J9WA 2L6HA 2Q9AA 3R7CA 4N06A 1U0BB 4PFPA 2PBEA 1U89A 1CPQA 3GEEA 1NU7D 1Q0MA 3GWLA 2HV6A 3UMIA 3IQ5A 2RD9A 3WODF 4C7OA 4C3DA 5EHHA 2NSGA 3W2WA 1JPJA 2A6HF 4RD9A 4J30B 3RQGA 4A4AA 2OOCA 3O55A 2WL8A 3K1HA 2J45A 4U5CE 3AQCA 2FAPB 1LM3B 3NMJA 4FWVA 1YYXA 3DE8A 2KW3C 4Z9IA 4EWCA 2V26A 2LIGA 2M4EA 3S27A 4ANJA 5KYWA 3Q7LA 3DMDA 4BEJA 4DRHB 3I5QA 1HMOA 4YN0B 4H4KC 1T5OA 5DS6A 2R7QA 2H7OA 1EI7A 2HSQA 2YLGA 2CYDA 4HFFB 1GQAA 1I4YA 4CJOA 256BA 2HSBA 3EZHA 4O6NA 3GM3A 2HV7A 1D1AA 3ZTMA 5FCLA 2R7OA 3RVZA 1FMVA 1XWJA 1YARO 4C7OB 1S05A 5L0FA 1LS4A 2P6VA 4CS8A 1OW7A 3V5ZA 4DVYP 3UMHA 2M64A 3FHDA 3JCUQ 1H7IA 1M2VA 1TWHA 1QSPA 4AE4A 1D1CA 4P6IC 1LIHA 4YT5A 4YT8A 2IXMA 5KYWB 1TWAA 4U9EA 2GDCA 2YLDA 1D0ZA 3ITFA 1ZYRF 1V55C 4IRUA 3I5PA 2GA0A 1FMWA 2I8BA 4DXWA 1WGWA 4IJJA 3TOLA 4EBKA 4P9FA 3BEHA 3Q6NA 2I15A 3DJNB 2Q4FA 4EUKB 3IEEA 2ZXWC 3I4UA 2PP4A 4YJWA 4ZLDA 3RYLA 1HMDA 1RMVA 2DI3A 4JTDB 5A69A 1OR2A 2W4BA 4PJLA 4U5GA 3W2VA 4CIPA 1M2VB 4AE4B 1RCPA 3SXZA 1CPRA 1HE9A 2Q9CA 3SP1A 3L34A 3VM6A 3US6A 1EKYA 3ZVRA 4N6HA 4W8KA 4MVZA 3ZC4A 3IPMO 4B6IA 3RQFA 2MHRA 4DOZA 5A6BA 5JLIA 5F5FA 2HKVA 3WG7C 3SZRA 1EQ1A 4MTGA 1Y4CA 5A6AA 2L7AA 1OCOC 1A41A 2KC3A 3C8GA 1JAFA 2AWCA 1ZZPA 1GGQA 3FXHA 4K0DA 5B1BC 3CEXA 1HY5A 3NKDA 2E87A 3A9CA 1OCRC 5JVEA 5KYYA 4ULVA 3KH2A 2ETSA 4MVMA 4BG0A 3ABKC 3F46A 1Z3IX 5HV9A 1RXQA 3HKKA 2IXPA 1NFOA 3M79A 3KYJA 4CS9C 2WVQA 3O39A 1FFHA 1V4AA 2LSEA 1TWCA 2IXOA 3ATPA 4JEBA 2TMVP 3TD7A 1XZQA 2XM4A 1DOWA 1WN0A 4YL3A 1PD1A 5GPGB 5T3TA 4DRJB 4EBJA 2HMQA 3DI5A 5JSLA 1HW1A 1PD0A 2P7VA 3K6BA 2ZXOA 1KU2A 1NSGB 5E33A 3DE9A 1NU9C 4E0IA 4F4BA 5L0JA 4FAPB 4U9DA 1CGOA 1G8XA 2RSEB 2R7WA 4NCQA 4IAOA 4NY3A 4CBEA 1I4ZA 1ZW3A 1WOLA 2HJ3A 2MYSA 3B9QA 2LFDA 3NYLA 4NQFA 3ZTZA 2WZFA 1DOVA 3GODA 4JURI 2HUJA 4XPXA 4QDLA 1LS1A 3EHNA 1ZHTA 3QW0A 2UUIA 2Y3BA 3FAPB 3N2ZB 3R2PA 5E3CA 2H7VC 4X0RA 2FFHA 3ZIBA 1PCXA 1H9GA 2OQMA 3KL4A 2G3VA 3NYMA 2X51A 4JTCB 4MVSA 5A6KA 1Z63A 2EPNA 3EGXA 4FESA 1WWPA 3U3FA 2GFHA 1E84A 3JYHA 2QY9A 2C03A 5CI8A 2EIMC 1C17M 2QUPA 1M57C 2B0HA 5K0IA 3QVYA 2BE5F 1BDJB 4FX5A 5EK0A 3EPVA 4MQ9F 4YT2A 1QZXA 2WVOA 4JCHA 4KNVA 4MVOA 2HMZA 1TFKB 3GWNA 4MW8A 4C3BA 3FAJA 3G50A 2XRHA 4IWBA 4G7HF 1FR0A 2IBFA 1QVXA 2IM8A 1QLEC 2EINC 3BRJA 4NC3A 1BR1A 1APCA 1HE1A 3DKAA 1Q0KA 3EGXB 2FGYA 3K33A 3U2MA 4Z9HA 1RKCA 3AQBA 3C62A 2YL1A 3EG9B 3L8JA 3OWTA 1J8MF 3EFOA 1ZHYA 3PHF2 2YL7A 3H2VA 3NYJA 4G0HA 2VASA 3RH3A 3TULA 5HSWA 2D5RB 4XQ1A 4U5EE 3GM2A 4U5BE 4N4WA 2B0JA 5L0DA 3EZIA 2VCBA 4YL1A 3HTKC 3GEIA 5JP7A 3LNRA 1Q0DA 3SYNA 4IAQA 3C8ZA 1K05A 3U8VA 3KMIA 3JRMO 3RIPA 4LDKA 3HNIA 1AVOB 3FVYA 2L6FA 3O6XA 5KYUB 2O9XA 2VH3A 3JZ0A 4U5DE 3IQCA 3DJUB 3G4XA 1SF8A 2KNHA 3U9MA 1S7ZA 3M15A 3KKBA 2V3CC 1MMNA 1Q0GA 2XL6A 4XPWA 2VB6A 3TK0A 4E18A 2R7UA 1WATA 3PMRA 2EPKX 3EFOB 4M63A 4K7BA 4DBRA 5A6BD 1OKKA 4LDRA 4XWJA 3W8IA 4WABA 3O10A 4BEMJ 3B0UX 3C8GD 2Y39A 3K7DA 4J32B 3W8HA 4ER9A 2CNWA 1VB5A 2R7TA 3GANA 1OXKA 1OW8A 4JEAA 2HZ8A 3ZDLA 1VTMP 3NG1A 3JT1A 4OIOF 2OU6A 3LEVA 2YL0A 2P1AA 3IHUA 3M1CB 2XLDA 3RFYA 1Q0FA 3V5XA 5BQHA 4JVSA 4OINF 3LAYA 2WZGA 4MS2A 2WB7A 2YQYA 4GQHA 2X0CA 2YHSA 2EILC 2ZD9A 4CSAA 1UG7A 2YVKA 2HJMA 3SXKA 3JYYA 4K1OA 4BJ6A 1K04A 1CGME 1H6GA 3LS0A 3MYFA 2R7SA 2IYLD 1B68A 5T1DB 5DS5A 1MNEA 3NKEA 5FZTA 3PDMP 3LESA 1SYQA 2GAQA
chains in the Genus database with same CATH topology
4CDAA 4WGZA 4JE9A 5B3IA 1MQVA 1NBBA 2BC5A 3ZWIA 2YLIA 3HNKA 3DE9A 1E83A 4IARA 2XL8A 1CGOA 4U9DA 3VRCA 2XLOA 3ZTZA 2J8WA 2XLVA 3FOOA 3QW0A 2XLHA 1E85A 5JRAA 3ZQVA 1CPQA 3M4BA 3IQ5A 2XLEA 2QLAA 1E84A 3HNJA 1YZAA 3QVYA 1LM3B 3NMJA 3M4CA 3U8PA 1YYXA 3DE8A 3ZQYA 3HNLA 2YLGA 1BBHA 1GQAA 4JKVA 2CCYA 4CDVA 256BA 4CJOA 4NC3A 3IQ6A 1CGNA 1APCA 3ZTMA 3TOMA 3C62A 1S05A 2YL1A 1YYJA 5JS5A 2YL7A 4CDYA 2YL3A 4N4WA 3NMKA 4L6RA 5JP7A 3FOPA 2XM0A 4IAQA 2YLDA 4U9EA 3HNIA 3TOLA 4CJGA 3QW1A 3M15A 2XL6A 4CX9A 3C63A 1A7VA 4CIPA 1RCPA 1CPRA 4ER9A 3QVZA 1EKYA 4N6HA 5JLIA 3L1MA 5JUAA 1YZCA 1QPUA 4EIYA 4D4XA 4JEAA 5JT4A 1E86A 1JAFA 2YL0A 2XLDA 5AGFA 5JVEA 4ULVA 2XLWA 4D4NA 3NMIA 3M79A 1M6TA 2YKZA 4IB4A 4JEBA 1QQ3A 2XLMA 2XM4A 4WGYA 2J9BA 5JSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDA A;  4WGZ A;  4JE9 A;  5B3I A;  1MQV A;  1NBB A;  2BC5 A;  3ZWI A;  2YLI A;  3HNK A;  3DE9 A;  1E83 A;  4IAR A;  2XL8 A;  1CGO A;  4U9D A;  3VRC A;  2XLO A;  3ZTZ A;  2J8W A;  2XLV A;  3FOO A;  3QW0 A;  2XLH A;  1E85 A;  5JRA A;  3ZQV A;  1CPQ A;  3M4B A;  3IQ5 A;  2XLE A;  2QLA A;  1E84 A;  3HNJ A;  1YZA A;  3QVY A;  1LM3 B;  3NMJ A;  3M4C A;  3U8P A;  1YYX A;  3DE8 A;  3ZQY A;  3HNL A;  2YLG A;  1BBH A;  1GQA A;  4JKV A;  2CCY A;  4CDV A;  256B A;  4CJO A;  4NC3 A;  3IQ6 A;  1CGN A;  1APC A;  3ZTM A;  3TOM A;  3C62 A;  1S05 A;  2YL1 A;  1YYJ A;  5JS5 A;  2YL7 A;  4CDY A;  2YL3 A;  4N4W A;  3NMK A;  4L6R A;  5JP7 A;  3FOP A;  2XM0 A;  4IAQ A;  2YLD A;  4U9E A;  3HNI A;  3TOL A;  4CJG A;  3QW1 A;  3M15 A;  2XL6 A;  4CX9 A;  3C63 A;  1A7V A;  4CIP A;  1RCP A;  1CPR A;  4ER9 A;  3QVZ A;  1EKY A;  4N6H A;  5JLI A;  3L1M A;  5JUA A;  1YZC A;  1QPU A;  4EIY A;  4D4X A;  4JEA A;  5JT4 A;  1E86 A;  1JAF A;  2YL0 A;  2XLD A;  5AGF A;  5JVE A;  4ULV A;  2XLW A;  4D4N A;  3NMI A;  3M79 A;  1M6T A;  2YKZ A;  4IB4 A;  4JEB A;  1QQ3 A;  2XLM A;  2XM4 A;  4WGY A;  2J9B A;  5JSL A; 
#chains in the Genus database with same CATH topology
 4CDA A;  4WGZ A;  3OA1 A;  3ASO C;  2A1D D;  1AUE A;  4R32 A;  5COM A;  2HFI A;  3AJM A;  1H9T A;  2A0U A;  5TJ5 E;  2Y3G A;  3ABL C;  1D0Y A;  3Q7G A;  4PR9 A;  3LLK A;  1J8Y F;  3EGD B;  1JPN A;  4KC9 A;  1E83 A;  2IXN A;  2AU5 A;  4ULW A;  3C18 A;  3AG4 C;  1NG1 A;  1Z5Z A;  1LVK A;  3VRC A;  3QZC A;  4I44 A;  4U5H A;  4AX2 A;  1ORJ A;  1TQG A;  4PFO A;  5BQG A;  3S0X A;  2R7V A;  1WTY A;  2IOQ A;  1O5H A;  3RQE A;  2XS1 A;  2QNL A;  3S9O A;  2XLV A;  3S28 A;  4O79 A;  2OEX A;  3RKO F;  3DZA A;  2XLH A;  2A68 F;  2CDQ A;  2WZL A;  3ABM C;  3DD7 A;  3EQL F;  3DWW A;  4JTA B;  3W4Y A;  4MW3 A;  1Z23 A;  3RVY A;  5BQI A;  5L3V A;  4GYT A;  3HLZ A;  1V54 C;  3JRT A;  4WJ0 A;  1T9K A;  3ZQV A;  4MVQ A;  2KJG A;  3M4B A;  1GM5 A;  2XLE A;  2QLA A;  5DS4 A;  3PCV A;  4HE8 D;  2J7P A;  3HNJ A;  2EPM X;  2J9V A;  3LLI A;  1BZ4 A;  2L6G A;  4P9T A;  4NTA A;  2P0N A;  3DM5 A;  1BR4 A;  5CIV A;  1SZI A;  3OEO A;  3ZQY A;  4W8P A;  5COF A;  2ZXP A;  3HJC A;  5B1A C;  5EGY A;  4G7Z F;  2NUP B;  4BPM A;  1D1B A;  2F22 A;  3HNL A;  3N24 A;  1VOM A;  2OG2 A;  1Z7Q c;  2XL4 A;  4JKV A;  1JRA A;  3C7J A;  4EKW A;  2OJQ A;  3NRH A;  3G4Z A;  4C3E A;  2P61 A;  2KQ9 A;  4Q7C A;  2A0B A;  3TOM A;  5KYX A;  3JTL O;  1O87 A;  3TQO A;  1MND A;  1R5I D;  3AGT A;  1IZM A;  4CS8 C;  5E3A A;  3MYI A;  1K40 A;  1YYJ A;  2AP3 A;  3DXJ F;  3L0I A;  1W2W A;  3KYI A;  4U5F E;  2PFD A;  1SR2 A;  2OKU A;  2YL3 A;  3SXY A;  4CIH A;  4RDA A;  4OIR F;  3EG9 A;  3FDQ A;  3UNG C;  1ZHX A;  4L6R A;  4JIO A;  1YJG A;  3CSK A;  4JZA A;  4DVZ A;  2XM0 A;  4MTO A;  3LJB A;  3LS1 A;  4OD4 A;  5AC5 A;  4KNW A;  1OCZ C;  1LI7 A;  1VYI A;  2PNO A;  1ZHZ A;  2W9Y A;  3ECS A;  4J7Y A;  4XEK A;  1T6I A;  2EIJ C;  2JPU A;  3AOU A;  1OKK D;  1BR2 A;  2EPL X;  2YEV A;  2JD3 A;  1ZVZ A;  3CZ6 A;  3MLG A;  5KYX B;  2OEV A;  3QW1 A;  2CNW D;  2DB4 A;  3JSZ A;  5KYU A;  2JX0 A;  4MTF A;  2AWY A;  4LDQ A;  4NTF A;  3UGP A;  4CX9 A;  4JJG A;  1A7V A;  1QKR A;  1RJ9 B;  4UDV A;  3X1O A;  2YRF A;  1AEP A;  4OD5 A;  3B71 A;  4PJN A;  2G3K A;  1FAP B;  2YZS A;  3RW0 A;  1YZC A;  1QPU A;  4EHP A;  4D4X A;  4YK5 A;  1PV3 A;  4EIY A;  4H54 A;  2LQG A;  3MX3 A;  4HFK B;  2VC9 A;  1T6Q A;  2QE9 A;  1YLM A;  5JT4 A;  2DYR C;  1E86 A;  4EBB A;  3DAG A;  3VYW A;  5AGF A;  1JOG A;  4Q5S F;  2R03 A;  2PX0 A;  3V5Y A;  2QTV A;  3S84 A;  3U0C A;  2J0W A;  3H2U A;  2Q00 A;  3K1I C;  4RBN A;  1NFN A;  5L0H A;  2XLW A;  3H65 A;  4NTB A;  3GM1 A;  2DGJ A;  2GWW A;  4JJF A;  3U2L A;  5CI9 A;  2J9U A;  4CS9 A;  3B0V C;  2Y3D A;  1QQ3 A;  2OCC C;  4N6C A;  1VK5 A;  2XLM A;  2XSE A;  3ZG1 A;  5KYN A;  1VMA A;  3VF0 A;  2J9B A;  4LLE A;  1LPE A;  1L7C A;  1OXB A;  4JE9 A;  3GEH A;  3LEO A;  1A0B A;  2R02 A;  2BC5 A;  3EH2 A;  3ZWI A;  2G62 A;  2CW0 F;  4LER A;  2NPU A;  3V7O A;  1LE2 A;  3IQT A;  1ST6 A;  2CGE A;  3ASN C;  2Z15 A;  3GOR A;  4XTK A;  1MMG A;  4XPY A;  2XLO A;  4KBL A;  2ASR A;  2KK1 A;  3DM9 B;  5F28 E;  2Q7R A;  3EGD A;  3UR3 C;  2PF4 E;  2UUH A;  1LE4 A;  4OIP F;  2XS8 A;  1ZW2 A;  1L3P A;  4J7T A;  2R05 A;  1GS9 A;  3FOO A;  4MND A;  3ZSU A;  5L0G A;  5B3S C;  1YAU O;  4AK9 A;  2J7P D;  1OW6 A;  1YDI A;  1E85 A;  2D4U A;  5JRA A;  1IW7 F;  3S90 A;  2BL2 A;  5DLJ A;  3K66 A;  4GEH A;  2EIK C;  3QTH A;  4IGG A;  2L81 A;  4BJ5 C;  4E0H A;  2R7R A;  2J0X A;  1EA8 A;  1LI5 A;  4E17 A;  4LAC B;  3SNH A;  1WAS A;  3TJ6 A;  1YZA A;  3RF3 A;  5IY5 C;  2KGO A;  3M4C A;  4YL0 A;  3U8P A;  5DQT A;  2L9J A;  1M2O A;  2DYS C;  2PX3 A;  4XEF A;  1VYK A;  5DQZ A;  5DVW A;  4JRZ A;  1BBH A;  4CDV A;  3LNM B;  2CCY A;  2LD6 A;  2A69 F;  1YA9 A;  2NUP A;  3LUT B;  1ZHW A;  1CGN A;  1D0X A;  1TWG A;  2KYH A;  3AGU A;  3IQ6 A;  4E7Z A;  5BUO A;  4I1M A;  3T4R A;  5AC4 A;  2W4M A;  4I1O B;  3T6B A;  4JCZ A;  4QI2 A;  4PJJ A;  2R9R B;  3B0P A;  1YVI A;  2H8A A;  3AG3 C;  4XEV A;  5D92 A;  3TJ5 A;  2YWA A;  5L0C A;  1SMY F;  5JS5 A;  4CDY A;  3A11 A;  3WAQ A;  1RKE A;  1VLS A;  4G78 A;  3T9O A;  1TFO B;  1T6U A;  4KI2 A;  1G4W R;  3Q6M A;  3NMK A;  1NLX A;  3L8I A;  1VLT A;  2LCH A;  3VAY A;  3MFN A;  4Q4Z F;  2J46 A;  2LFF A;  2NSF A;  3FOP A;  2Q3T A;  5COG A;  2XXA A;  4QI0 A;  3KPH A;  1UFB A;  1HW2 A;  1MMD A;  1OCC C;  2HS5 A;  5T3W A;  2R7X A;  2A6E F;  5F5H A;  5L0I A;  3K1I A;  3EJN A;  4CJG A;  2ICW G;  5D91 A;  1U6H A;  3E9V A;  4O7G A;  2Q9B A;  1E2X A;  2AVK A;  2C04 A;  2VCC A;  3NDB B;  3CQZ A;  1V74 B;  4O6Y A;  3S29 A;  1C02 A;  3F47 A;  1T01 A;  3AG1 C;  4YWQ A;  3POV A;  3C63 A;  1I5N A;  1KTM A;  4DBQ A;  1RKE B;  2H7B A;  2WVN A;  3MBG A;  2ZPA A;  2VCA A;  1ZU4 A;  3QVZ A;  4JC7 A;  1JR8 A;  5JUA A;  3C8G B;  3L1M A;  4G7O F;  4AL1 A;  1Y6D A;  2LP4 A;  2MWQ A;  1RJ9 A;  2XXA B;  4Z9J A;  1ORY A;  4HEA J;  4MVR A;  2NUT A;  4ONS A;  2R25 A;  5KYY B;  4JW1 A;  1LKX A;  3B29 A;  1YA7 O;  3U3B A;  1OQC A;  3U5S A;  4DJ9 A;  1Z6A A;  4A2N B;  4I3M A;  3QMK A;  4BJ1 A;  4LLC A;  3DAF A;  4MVU A;  2Y69 C;  4CSA C;  1M56 C;  4D4N A;  3E70 C;  3NMI A;  4PK4 A;  3WHN A;  3UGO A;  1KNY A;  4BJ6 C;  1G5Z A;  1C03 A;  1M6T A;  2YKZ A;  3EHM A;  4IB4 A;  4BJ5 A;  1XZP A;  1ORS C;  4WGY A;  3SXM A;  4XLP F;  4PJM A;  1FFT C;  1MMA A;  2KSF A;  1A7D A;  3EH1 A;  2NUT B;  3FMS A;  4CS7 A;  3U9J A;  4DRI B;  4E7S A;  5B3I A;  1MQV A;  1NBB A;  1A7E A;  3AG2 C;  4OIQ F;  3T6G B;  2YLI A;  3HNK A;  4BJT A;  1JMW A;  1FTS A;  1F1M A;  4O6M A;  1G4U S;  4XLN F;  4IAR A;  2XL8 A;  1TR2 A;  2LK4 A;  3J06 A;  1NZE A;  3JSE O;  4YT4 A;  3SEO A;  4ZLC A;  1N1C A;  4PAC A;  2EPO A;  5A6J A;  1FNT c;  2NG1 A;  1O3U A;  2ZXR A;  1R4T A;  3CAX A;  1TKN A;  2J8W A;  3N0T A;  3T6J A;  4AL0 A;  1OR3 A;  2W45 A;  5E2Q A;  1ZU5 A;  2Y3H A;  3UMK A;  3X2Q C;  5L3Q A;  2OJE D;  2J9W A;  2L6H A;  2Q9A A;  3R7C A;  4N06 A;  1U0B B;  4PFP A;  2PBE A;  1U89 A;  1CPQ A;  3GEE A;  1NU7 D;  1Q0M A;  3GWL A;  2HV6 A;  3UMI A;  3IQ5 A;  2RD9 A;  3WOD F;  4C7O A;  4C3D A;  5EHH A;  2NSG A;  3W2W A;  1JPJ A;  2A6H F;  4RD9 A;  4J30 B;  3RQG A;  4A4A A;  2OOC A;  3O55 A;  2WL8 A;  3K1H A;  2J45 A;  4U5C E;  3AQC A;  2FAP B;  1LM3 B;  3NMJ A;  4FWV A;  1YYX A;  3DE8 A;  2KW3 C;  4Z9I A;  4EWC A;  2V26 A;  2LIG A;  2M4E A;  3S27 A;  4ANJ A;  5KYW A;  3Q7L A;  3DMD A;  4BEJ A;  4DRH B;  3I5Q A;  1HMO A;  4YN0 B;  4H4K C;  1T5O A;  5DS6 A;  2R7Q A;  2H7O A;  1EI7 A;  2HSQ A;  2YLG A;  2CYD A;  4HFF B;  1GQA A;  1I4Y A;  4CJO A;  256B A;  2HSB A;  3EZH A;  4O6N A;  3GM3 A;  2HV7 A;  1D1A A;  3ZTM A;  5FCL A;  2R7O A;  3RVZ A;  1FMV A;  1XWJ A;  1YAR O;  4C7O B;  1S05 A;  5L0F A;  1LS4 A;  2P6V A;  4CS8 A;  1OW7 A;  3V5Z A;  4DVY P;  3UMH A;  2M64 A;  3FHD A;  3JCU Q;  1H7I A;  1M2V A;  1TWH A;  1QSP A;  4AE4 A;  1D1C A;  4P6I C;  1LIH A;  4YT5 A;  4YT8 A;  2IXM A;  5KYW B;  1TWA A;  4U9E A;  2GDC A;  2YLD A;  1D0Z A;  3ITF A;  1ZYR F;  1V55 C;  4IRU A;  3I5P A;  2GA0 A;  1FMW A;  2I8B A;  4DXW A;  1WGW A;  4IJJ A;  3TOL A;  4EBK A;  4P9F A;  3BEH A;  3Q6N A;  2I15 A;  3DJN B;  2Q4F A;  4EUK B;  3IEE A;  2ZXW C;  3I4U A;  2PP4 A;  4YJW A;  4ZLD A;  3RYL A;  1HMD A;  1RMV A;  2DI3 A;  4JTD B;  5A69 A;  1OR2 A;  2W4B A;  4PJL A;  4U5G A;  3W2V A;  4CIP A;  1M2V B;  4AE4 B;  1RCP A;  3SXZ A;  1CPR A;  1HE9 A;  2Q9C A;  3SP1 A;  3L34 A;  3VM6 A;  3US6 A;  1EKY A;  3ZVR A;  4N6H A;  4W8K A;  4MVZ A;  3ZC4 A;  3IPM O;  4B6I A;  3RQF A;  2MHR A;  4DOZ A;  5A6B A;  5JLI A;  5F5F A;  2HKV A;  3WG7 C;  3SZR A;  1EQ1 A;  4MTG A;  1Y4C A;  5A6A A;  2L7A A;  1OCO C;  1A41 A;  2KC3 A;  3C8G A;  1JAF A;  2AWC A;  1ZZP A;  1GGQ A;  3FXH A;  4K0D A;  5B1B C;  3CEX A;  1HY5 A;  3NKD A;  2E87 A;  3A9C A;  1OCR C;  5JVE A;  5KYY A;  4ULV A;  3KH2 A;  2ETS A;  4MVM A;  4BG0 A;  3ABK C;  3F46 A;  1Z3I X;  5HV9 A;  1RXQ A;  3HKK A;  2IXP A;  1NFO A;  3M79 A;  3KYJ A;  4CS9 C;  2WVQ A;  3O39 A;  1FFH A;  1V4A A;  2LSE A;  1TWC A;  2IXO A;  3ATP A;  4JEB A;  2TMV P;  3TD7 A;  1XZQ A;  2XM4 A;  1DOW A;  1WN0 A;  4YL3 A;  1PD1 A;  5GPG B;  5T3T A;  4DRJ B;  4EBJ A;  2HMQ A;  3DI5 A;  5JSL A;  1HW1 A;  1PD0 A;  2P7V A;  3K6B A;  2ZXO A;  1KU2 A;  1NSG B;  5E33 A;  3DE9 A;  1NU9 C;  4E0I A;  4F4B A;  5L0J A;  4FAP B;  4U9D A;  1CGO A;  1G8X A;  2RSE B;  2R7W A;  4NCQ A;  4IAO A;  4NY3 A;  4CBE A;  1I4Z A;  1ZW3 A;  1WOL A;  2HJ3 A;  2MYS A;  3B9Q A;  2LFD A;  3NYL A;  4NQF A;  3ZTZ A;  2WZF A;  1DOV A;  3GOD A;  4JUR I;  2HUJ A;  4XPX A;  4QDL A;  1LS1 A;  3EHN A;  1ZHT A;  3QW0 A;  2UUI A;  2Y3B A;  3FAP B;  3N2Z B;  3R2P A;  5E3C A;  2H7V C;  4X0R A;  2FFH A;  3ZIB A;  1PCX A;  1H9G A;  2OQM A;  3KL4 A;  2G3V A;  3NYM A;  2X51 A;  4JTC B;  4MVS A;  5A6K A;  1Z63 A;  2EPN A;  3EGX A;  4FES A;  1WWP A;  3U3F A;  2GFH A;  1E84 A;  3JYH A;  2QY9 A;  2C03 A;  5CI8 A;  2EIM C;  1C17 M;  2QUP A;  1M57 C;  2B0H A;  5K0I A;  3QVY A;  2BE5 F;  1BDJ B;  4FX5 A;  5EK0 A;  3EPV A;  4MQ9 F;  4YT2 A;  1QZX A;  2WVO A;  4JCH A;  4KNV A;  4MVO A;  2HMZ A;  1TFK B;  3GWN A;  4MW8 A;  4C3B A;  3FAJ A;  3G50 A;  2XRH A;  4IWB A;  4G7H F;  1FR0 A;  2IBF A;  1QVX A;  2IM8 A;  1QLE C;  2EIN C;  3BRJ A;  4NC3 A;  1BR1 A;  1APC A;  1HE1 A;  3DKA A;  1Q0K A;  3EGX B;  2FGY A;  3K33 A;  3U2M A;  4Z9H A;  1RKC A;  3AQB A;  3C62 A;  2YL1 A;  3EG9 B;  3L8J A;  3OWT A;  1J8M F;  3EFO A;  1ZHY A;  3PHF 2;  2YL7 A;  3H2V A;  3NYJ A;  4G0H A;  2VAS A;  3RH3 A;  3TUL A;  5HSW A;  2D5R B;  4XQ1 A;  4U5E E;  3GM2 A;  4U5B E;  4N4W A;  2B0J A;  5L0D A;  3EZI A;  2VCB A;  4YL1 A;  3HTK C;  3GEI A;  5JP7 A;  3LNR A;  1Q0D A;  3SYN A;  4IAQ A;  3C8Z A;  1K05 A;  3U8V A;  3KMI A;  3JRM O;  3RIP A;  4LDK A;  3HNI A;  1AVO B;  3FVY A;  2L6F A;  3O6X A;  5KYU B;  2O9X A;  2VH3 A;  3JZ0 A;  4U5D E;  3IQC A;  3DJU B;  3G4X A;  1SF8 A;  2KNH A;  3U9M A;  1S7Z A;  3M15 A;  3KKB A;  2V3C C;  1MMN A;  1Q0G A;  2XL6 A;  4XPW A;  2VB6 A;  3TK0 A;  4E18 A;  2R7U A;  1WAT A;  3PMR A;  2EPK X;  3EFO B;  4M63 A;  4K7B A;  4DBR A;  5A6B D;  1OKK A;  4LDR A;  4XWJ A;  3W8I A;  4WAB A;  3O10 A;  4BEM J;  3B0U X;  3C8G D;  2Y39 A;  3K7D A;  4J32 B;  3W8H A;  4ER9 A;  2CNW A;  1VB5 A;  2R7T A;  3GAN A;  1OXK A;  1OW8 A;  4JEA A;  2HZ8 A;  3ZDL A;  1VTM P;  3NG1 A;  3JT1 A;  4OIO F;  2OU6 A;  3LEV A;  2YL0 A;  2P1A A;  3IHU A;  3M1C B;  2XLD A;  3RFY A;  1Q0F A;  3V5X A;  5BQH A;  4JVS A;  4OIN F;  3LAY A;  2WZG A;  4MS2 A;  2WB7 A;  2YQY A;  4GQH A;  2X0C A;  2YHS A;  2EIL C;  2ZD9 A;  4CSA A;  1UG7 A;  2YVK A;  2HJM A;  3SXK A;  3JYY A;  4K1O A;  4BJ6 A;  1K04 A;  1CGM E;  1H6G A;  3LS0 A;  3MYF A;  2R7S A;  2IYL D;  1B68 A;  5T1D B;  5DS5 A;  1MNE A;  3NKE A;  5FZT A;  3PDM P;  3LES A;  1SYQ A;  2GAQ A; 
#chains in the Genus database with same CATH homology
 4CDA A;  4WGZ A;  4JE9 A;  5B3I A;  1MQV A;  1NBB A;  2BC5 A;  3ZWI A;  2YLI A;  3HNK A;  3DE9 A;  1E83 A;  4IAR A;  2XL8 A;  1CGO A;  4U9D A;  3VRC A;  2XLO A;  3ZTZ A;  2J8W A;  2XLV A;  3FOO A;  3QW0 A;  2XLH A;  1E85 A;  5JRA A;  3ZQV A;  1CPQ A;  3M4B A;  3IQ5 A;  2XLE A;  2QLA A;  1E84 A;  3HNJ A;  1YZA A;  3QVY A;  1LM3 B;  3NMJ A;  3M4C A;  3U8P A;  1YYX A;  3DE8 A;  3ZQY A;  3HNL A;  2YLG A;  1BBH A;  1GQA A;  4JKV A;  2CCY A;  4CDV A;  256B A;  4CJO A;  4NC3 A;  3IQ6 A;  1CGN A;  1APC A;  3ZTM A;  3TOM A;  3C62 A;  1S05 A;  2YL1 A;  1YYJ A;  5JS5 A;  2YL7 A;  4CDY A;  2YL3 A;  4N4W A;  3NMK A;  4L6R A;  5JP7 A;  3FOP A;  2XM0 A;  4IAQ A;  2YLD A;  4U9E A;  3HNI A;  3TOL A;  4CJG A;  3QW1 A;  3M15 A;  2XL6 A;  4CX9 A;  3C63 A;  1A7V A;  4CIP A;  1RCP A;  1CPR A;  4ER9 A;  3QVZ A;  1EKY A;  4N6H A;  5JLI A;  3L1M A;  5JUA A;  1YZC A;  1QPU A;  4EIY A;  4D4X A;  4JEA A;  5JT4 A;  1E86 A;  1JAF A;  2YL0 A;  2XLD A;  5AGF A;  5JVE A;  4ULV A;  2XLW A;  4D4N A;  3NMI A;  3M79 A;  1M6T A;  2YKZ A;  4IB4 A;  4JEB A;  1QQ3 A;  2XLM A;  2XM4 A;  4WGY A;  2J9B A;  5JSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...