3PCVA

Crystal structure analysis of human leukotriene c4 synthase at 1.9 angstrom resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
146
structure length
146
Chain Sequence
b'MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title The catalytic architecture of leukotriene C4 synthase with two arginine residues
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 61
structure length 146
sequence length 146
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 3pcvA00
4AL1A 4YK5A 2UUIA 4AL0A 4NTFA 5BQIA 4WABA 5BQHA 5BQGA 4YL0A 4JC7A 4J7YA 2H8AA 4YL1A 4JCZA 3DWWA 4BPMA 2PNOA 4NTBA 4YL3A 4JRZA 5HV9A 2Q7RA 3B29A 3LEOA 2UUHA 4J7TA 5K0IA 3HKKA 4NTAA 3PCVA
chains in the Genus database with same CATH superfamily
1OKKD 2GAQA 2YQYA 4WGZA 3S29A 4DXWA 4G7HF 4CSAC 3EHNA 4KNWA 4KC9A 2HJMA 4X0RA 1HW1A 3DXJF 3HNJA 4MVOA 4N6HA 4Z9IA 1A7EA 3S0XA 4G7ZF 4ONSA 1CGME 1OCRC 3FMSA 3GWNA 3T6BA 4N06A 3CQZA 5L0FA 4JTCB 5AC4A 2ZD9A 2CYDA 4IARA 4DRJB 4LERA 4NY3A 4YT5A 3V5YA 2QE9A 3T4RA 4BJ1A 5KYXB 4YL3A 2ETSA 3LAYA 3TK0A 2J9UA 4CSAA 1FAPB 1FTSA 1U6HA 3CZ6A 3LS0A 3UMHA 5K0IA 4MW3A 4WJ0A 1YZAA 4NTAA 3L34A 2PF4E 5D91A 4BJTA 2F22A 3T6JA 4IRUA 1FFTC 4NQFA 1IZMA 1VYKA 2HMQA 4I1OB 1WOLA 3FVYA 3M4BA 2HJ3A 2YL7A 3VF0A 4DBRA 4O6MA 1V74B 1YVIA 2AWYA 2JD3A 3TJ6A 2B0HA 2HZ8A 2YLIA 2YRFA 3B9QA 3C62A 4JIOA 4YT4A 4CS9A 3V7OA 1R4TA 2R7WA 4CDVA 1LE2A 4PACA 1KTMA 2H7OA 2NSFA 2NUPA 2KSFA 4PJJA 4ZLDA 2XRHA 3UGOA 1DOVA 2G3KA 1G4WR 2J9WA 4C7OA 3ABKC 3ZTZA 2PX0A 1GQAA 2A6EF 1ZHYA 4O6YA 1H9TA 1Y6DA 4JJGA 5JS5A 2P6VA 2R25A 1T01A 3SP1A 2ZPAA 1FNTc 1J8MF 1XWJA 1XZQA 1U0BB 1UG7A 4C7OB 1BR1A 2LK4A 1TKNA 4EBBA 3IQ6A 2CNWD 3Q6MA 3U3BA 1ORSC 1HW2A 1QZXA 3UNGC 4U5CE 5L0GA 4YN0B 3IPMO 1ZU5A 4PFOA 3NYMA 3W2WA 3H2VA 2VCCA 3H65A 3UR3C 3DAGA 5BQHA 4PJLA 3GANA 2DB4A 1JOGA 2LP4A 2P7VA 2FFHA 1ZHXA 4U5DE 4HFFB 4JJFA 4PJMA 4U5BE 2HSQA 3IQTA 3UMIA 2ZXOA 4GQHA 3N2ZB 4MVUA 1BBHA 1WASA 4AX2A 2LSEA 3SXYA 2GFHA 1U89A 3NKEA 2AP3A 5DS5A 4XEVA 4Q4ZF 1OR2A 3I4UA 4YT8A 3NMKA 4D4XA 3DJNB 4I1MA 3M1CB 1H6GA 1A7DA 4DRIB 2Y39A 3EQLF 5L0IA 3K7DA 3O55A 2LQGA 4NTFA 5A6BD 2YL3A 1T6UA 4NCQA 4DRHB 1D0YA 2R7VA 3HNIA 2P1AA 5A6AA 1GS9A 4I44A 3OA1A 3JCUQ 4OIRF 3N24A 3RH3A 4MVSA 3K66A 5KYUA 2YVKA 3K1HA 1T5OA 1NFOA 1SYQA 2KC3A 4MVRA 4O7GA 3V5XA 4JZAA 5DS6A 4OIOF 4ER9A 5D92A 1L7CA 2H7BA 2H8AA 4KI2A 5CI9A 4JVSA 2GWWA 5E33A 3GORA 4Q7CA 4WGYA 5IY5C 3JZ0A 4IJJA 4U5HA 3I5PA 3MYFA 2J8WA 3ATPA 3NRHA 4W8PA 2Q7RA 4CIHA 1C02A 2EINC 2J0WA 3LEOA 1JAFA 1TWCA 3QTHA 3X1OA 4MTFA 4BEMJ 4CJGA 4EIYA 3W2VA 1MNDA 1ZHWA 3K1IA 3VM6A 3C8GA 3IHUA 5L3QA 3AGTA 2DGJA 1MNEA 2WVOA 5JT4A 1JR8A 3JYYA 4JURI 2OQMA 3O6XA 4A2NB 4E17A 1S05A 5BQIA 3GEIA 3LESA 4KBLA 1Z23A 1K04A 3C8GB 3EHMA 3MFNA 5DVWA 3IQ5A 3S27A 4QDLA 1YAUO 4JCHA 4PFPA 2NG1A 1GGQA 1K05A 2BE5F 3U9MA 3R7CA 1D0XA 1ZW3A 2KQ9A 3UMKA 3TULA 1NU9C 2R7QA 1Q0GA 4IB4A 3WODF 1LI7A 1QQ3A 1JPNA 1LI5A 1V54C 2XS8A 2MWQA 4F4BA 3ZVRA 2PFDA 3T9OA 4HE8D 4OINF 2CDQA 2Y3BA 2WZGA 1QVXA 2Q3TA 1SMYF 4DVYP 1O5HA 2MYSA 5A69A 2R7XA 2H7VC 2JPUA 3AJMA 5T3WA 2NUTA 4C3EA 5EHHA 3OWTA 1RKCA 1Z5ZA 3AQBA 2YL0A 3Q7LA 5JP7A 4YK5A 3ZIBA 2J45A 1OCCC 1ZU4A 1NSGB 2ZXWC 1VLSA 3IQCA 3L8IA 4LDKA 5E3CA 1A41A 2IOQA 2QLAA 2WL8A 2WVQA 2XL8A 3JYHA 256BA 2W4BA 3S84A 2NUTB 4P6IC 4RBNA 1LKXA 3LLKA 3A9CA 4YWQA 5KYXA 3SXMA 3E70C 4AK9A 2VCAA 3F46A 1ORYA 2WZLA 4FWVA 4YL1A 2ICWG 3SEOA 3TQOA 3KYIA 1LS4A 3C8ZA 2KJGA 2VH3A 3GEHA 3ZSUA 4DVZA 4L6RA 2DYSC 4E18A 5AC5A 2OU6A 4G7OF 2W9YA 4MVZA 4UDVA 1NZEA 3SXKA 1BDJB 3DE9A 1EKYA 2FAPB 1QSPA 3RQEA 5F5HA 1BR2A 4R32A 3B71A 1OW7A 1SR2A 1OW8A 2WB7A 3G4ZA 2XM4A 4FX5A 3RVZA 3ASOC 2Y69C 3BRJA 4DJ9A 3EGXB 2R7SA 2EIMC 1J8YF 4H4KC 1A0BA 1NBBA 1QKRA 4OIPF 2EPNA 2I8BA 1VB5A 3QVYA 4M63A 5KYWA 3CSKA 4IAQA 1FFHA 4N6CA 1IW7F 3DD7A 3ASNC 1TQGA 2OCCC 3W4YA 5JLIA 2IXNA 2L6GA 2GDCA 3EH1A 1ST6A 2QUPA 5L0DA 4FESA 4OD5A 1C03A 3ECSA 4JRZA 3U2MA 1PD0A 1EI7A 3C63A 3MYIA 4BJ6C 4XPXA 5KYYA 1WTYA 4EUKB 3GWLA 3FXHA 3VYWA 2HSBA 4HFKB 2TMVP 1MMDA 2IBFA 3ITFA 4EBJA 3PCVA 5E2QA 2KW3C 5B1BC 2HS5A 2IM8A 3FOOA 2A6HF 2XL6A 5KYYB 2YHSA 3PDMP 4J32B 3JTLO 2OOCA 1HMOA 3K6BA 2PX3A 1YARO 2L9JA 1TWAA 2UUIA 1YA9A 4AL0A 3KPHA 2O9XA 1VK5A 1Z63A 1WATA 1PD1A 2M64A 1F1MA 1H7IA 1JRAA 3EG9B 4BJ5C 2AVKA 1VTMP 1CPQA 2EIJC 2QTVA 3FAJA 2YLDA 4HEAJ 5DLJA 1E2XA 4JC7A 4JW1A 4Q5SF 1G5ZA 5GPGB 2IYLD 3EGDB 1OCZC 4N4WA 5CIVA 3FAPB 1OQCA 3G50A 4JE9A 3NDBB 2EILC 3U0CA 1MMAA 3AG1C 3X2QC 2KK1A 3O39A 3NKDA 4W8KA 1TWHA 1H9GA 5EGYA 3TOMA 1ZZPA 3W8HA 1NU7D 4LACB 3DM5A 1RKEA 3AOUA 3TOLA 4BJ5A 4IGGA 1EQ1A 4K0DA 1Q0FA 3AG2C 2L81A 3U2LA 5KYNA 3CAXA 3B0PA 3DI5A 3SZRA 2YWAA 1RKEB 3GODA 1HMDA 4MTGA 5DS4A 3WHNA 2J7PA 3HLZA 2PP4A 1MMNA 1XZPA 1VMAA 2CGEA 4JEAA 5T1DB 1I4YA 3V5ZA 1EA8A 2R05A 2J0XA 3DWWA 3GM2A 4XEFA 5CI8A 4P9FA 3AG3C 2J46A 5JSLA 1RJ9A 4NTBA 3RW0A 1Y4CA 1Q0MA 2R9RB 4A4AA 4E0IA 3B29A 5TJ5E 3RKOF 4JTDB 4CS8C 2J9VA 2Y3GA 2YZSA 1AVOB 2LCHA 2A0UA 1RJ9B 1TR2A 4EWCA 2WZFA 2LFFA 3MBGA 4MVQA 4B6IA 2Q9CA 2DI3A 2XLOA 3RF3A 4CBEA 4I3MA 2HFIA 4PK4A 1JMWA 3NMIA 1OKKA 2FGYA 4MS2A 3DJUB 1OR3A 1ZHTA 3E9VA 4XPWA 1LS1A 3AGUA 3QW1A 3H2UA 3MX3A 1HE1A 1N1CA 1V55C 4MNDA 2NPUA 1YYJA 4JEBA 4J7YA 3UGPA 3AQCA 2A68F 2P0NA 2GA0A 1G8XA 3QW0A 1M6TA 1Z6AA 4LLEA 2V26A 2YLGA 2PBEA 2C04A 2XLMA 2OKUA 3NYLA 4FAPB 3ZQVA 4AE4B 2UUHA 1T6IA 4JTAB 5A6KA 3NMJA 4ZLCA 1RMVA 2VCBA 1FMVA 4D4NA 3OEOA 2Y3DA 3NYJA 2AWCA 2CW0F 2G62A 4C3DA 3R2PA 3S9OA 4BG0A 1D1CA 4WABA 2ZXRA 2XLHA 1SF8A 1S7ZA 2LFDA 4U5GA 1YJGA 3JSEO 4J30B 3ZC4A 2HV7A 2QNLA 2XLDA 4KNVA 3LEVA 2OJED 2YKZA 4QI0A 1UFBA 1VYIA 2HUJA 2E87A 4MVMA 5HV9A 1QLEC 3O10A 3IEEA 3N0TA 5JUAA 4RD9A 4U9DA 2P61A 3CEXA 3C8GD 3EGXA 2J9BA 5B3SC 1ZVZA 2HKVA 2MHRA 2OJQA 3M4CA 4CX9A 3HKKA 3PMRA 1M57C 2HMZA 3W8IA 3ZDLA 3SNHA 4E0HA 5JVEA 2A1DD 4EKWA 3JT1A 4GEHA 1LVKA 1HE9A 2OEXA 2LIGA 3U5SA 3LLIA 1CGOA 3Q7GA 1NG1A 3POVA 3LNMB 2WVNA 3HJCA 3I5QA 3JRTA 2JX0A 1ZYRF 1LE4A 2RD9A 2CNWA 1WWPA 2ASRA 3GEEA 3U9JA 5F28E 2R7RA 1I4ZA 2B0JA 1T6QA 2L6HA 2OEVA 2QY9A 3HNLA 4XEKA 2W45A 4YL0A 4DOZA 2R7TA 1AEPA 3S28A 1SZIA 4JCZA 3U8PA 2LD6A 4CDYA 4C3BA 3GM1A 2Q9BA 3PHF2 1D0ZA 1WGWA 2W4MA 5B1AC 1O87A 2RSEB 4CS9C 4QI2A 1HY5A 2PNOA 3EZHA 3B0VC 4O79A 1PCXA 1GM5A 3ZQYA 4G0HA 2Q4FA 3WG7C 4J7TA 1OXBA 1VLTA 3S90A 5HSWA 1OCOC 4XTKA 4XWJA 2Y3HA 4CIPA 2D5RB 3Q6NA 2R7UA 4ULWA 3EFOA 4MW8A 3EG9A 3JSZA 4JKVA 1APCA 2V3CC 1BZ4A 2AU5A 4DBQA 2EPOA 3AG4C 1AUEA 4XQ1A 3JRMO 5E3AA 2KGOA 1WN0A 3EGDA 1TWGA 3M15A 3WAQA 4NC3A 5A6BA 5L0CA 1CGNA 2XLEA 1KNYA 3DMDA 3EFOB 4OD4A 3EJNA 1I5NA 1BR4A 2A69F 2L7AA 2XSEA 2XS1A 4MTOA 3U8VA 4BJ6A 1FR0A 1M2VA 3U3FA 3DAFA 5FCLA 1YYXA 2BL2A 2IXMA 3HTKC 3RQFA 4XLPF 3J06A 3HNKA 1QPUA 2KNHA 2NUPB 3RVYA 3M79A 5L0JA 1M2VB 4XPYA 3LNRA 2R7OA 3EPVA 3TJ5A 1YZCA 1E86A 1YDIA 4G78A 5F5FA 3KMIA 4MQ9F 3QZCA 2EPKX 1RXQA 1JPJA 4CS7A 2G3VA 5B3IA 3RFYA 1E83A 1Q0DA 3C7JA 1YA7O 1L3PA 4LDQA 1K40A 4U5EE 3FHDA 4CDAA 3LUTB 5BQGA 1Z7Qc 5COGA 1R5ID 2OG2A 4XLNF 1LM3B 2X51A 3KH2A 4CJOA 3B0UX 2XL4A 2VASA 4H54A 3QVZA 5FZTA 3RQGA 2NSGA 3FOPA 1Q0KA 1TFOB 1V4AA 4YJWA 3FDQA 1M56C 1O3UA 3L8JA 4K1OA 4PJNA 3TD7A 5A6JA 3EH2A 3DE8A 4LDRA 4YT2A 4OIQF 3ABLC 3L0IA 3ZWIA 3LJBA 4IWBA 1E85A 1C17M 2IXOA 3C18A 2D4UA 1B68A 4U9EA 3K1IC 4RDAA 3ZTMA 2XLWA 2EIKC 5L3VA 2DYRC 2VC9A 3A11A 3NG1A 2M4EA 4Z9HA 1OW6A 4U5FE 1OXKA 1ZHZA 1DOWA 2R03A 3MLGA 2EPMX 5EK0A 2YL1A 1M2OA 3DKAA 3DZAA 1G4US 3KKBA 4ULVA 3VRCA 4E7SA 4AE4A 5KYUB 1RCPA 4CS8A 2C03A 2L6FA 3G4XA 2ZXPA 3SYNA 2XXAA 1YLMA 1TFKB 1VOMA 3DM9B 5COFA 2KYHA 3L1MA 4O6NA 5KYWB 1D1AA 1Z3IX 3QMKA 4EHPA 4IAOA 3EZIA 3ABMC 4PR9A 5AGFA 3T6GB 4AL1A 5DQTA 1W2WA 3KL4A 2XXAB 4BEJA 2CCYA 2Q00A 3BEHA 3RYLA 3GM3A 3SXZA 3LS1A 1CPRA 2J7PD 1LPEA 1LIHA 1MQVA 1ORJA 2XLVA 5DQZA 5COMA 1E84A 3US6A 4K7BA 4Z9JA 2R02A 2HV6A 4EBKA 2A0BA 4GYTA 5T3TA 1NFNA 3F47A 3K33A 4LLCA 2VB6A 3VAYA 4P9TA 4BPMA 3ZG1A 2XM0A 2Z15A 3KYJA 1ZW2A 1NLXA 3RIPA 1FMWA 2I15A 1T9KA 2IXPA 5BUOA 1MMGA 1PV3A 2EPLX 4ANJA 2X0CA 5L0HA 2Q9AA 2BC5A 2YEVA 4E7ZA 1KU2A 1A7VA 1D1BA 5JRAA
chains in the Genus database with same CATH topology
4AL1A 4YK5A 2UUIA 4AL0A 4NTFA 5BQIA 4WABA 5BQHA 5BQGA 4YL0A 4JC7A 4J7YA 2H8AA 4YL1A 4JCZA 3DWWA 4BPMA 2PNOA 4NTBA 4YL3A 4JRZA 5HV9A 2Q7RA 3B29A 3LEOA 2UUHA 4J7TA 5K0IA 3HKKA 4NTAA 3PCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AL1 A;  4YK5 A;  2UUI A;  4AL0 A;  4NTF A;  5BQI A;  4WAB A;  5BQH A;  5BQG A;  4YL0 A;  4JC7 A;  4J7Y A;  2H8A A;  4YL1 A;  4JCZ A;  3DWW A;  4BPM A;  2PNO A;  4NTB A;  4YL3 A;  4JRZ A;  5HV9 A;  2Q7R A;  3B29 A;  3LEO A;  2UUH A;  4J7T A;  5K0I A;  3HKK A;  4NTA A;  3PCV A; 
#chains in the Genus database with same CATH topology
 1OKK D;  2GAQ A;  2YQY A;  4WGZ A;  3S29 A;  4DXW A;  4G7H F;  4CSA C;  3EHN A;  4KNW A;  4KC9 A;  2HJM A;  4X0R A;  1HW1 A;  3DXJ F;  3HNJ A;  4MVO A;  4N6H A;  4Z9I A;  1A7E A;  3S0X A;  4G7Z F;  4ONS A;  1CGM E;  1OCR C;  3FMS A;  3GWN A;  3T6B A;  4N06 A;  3CQZ A;  5L0F A;  4JTC B;  5AC4 A;  2ZD9 A;  2CYD A;  4IAR A;  4DRJ B;  4LER A;  4NY3 A;  4YT5 A;  3V5Y A;  2QE9 A;  3T4R A;  4BJ1 A;  5KYX B;  4YL3 A;  2ETS A;  3LAY A;  3TK0 A;  2J9U A;  4CSA A;  1FAP B;  1FTS A;  1U6H A;  3CZ6 A;  3LS0 A;  3UMH A;  5K0I A;  4MW3 A;  4WJ0 A;  1YZA A;  4NTA A;  3L34 A;  2PF4 E;  5D91 A;  4BJT A;  2F22 A;  3T6J A;  4IRU A;  1FFT C;  4NQF A;  1IZM A;  1VYK A;  2HMQ A;  4I1O B;  1WOL A;  3FVY A;  3M4B A;  2HJ3 A;  2YL7 A;  3VF0 A;  4DBR A;  4O6M A;  1V74 B;  1YVI A;  2AWY A;  2JD3 A;  3TJ6 A;  2B0H A;  2HZ8 A;  2YLI A;  2YRF A;  3B9Q A;  3C62 A;  4JIO A;  4YT4 A;  4CS9 A;  3V7O A;  1R4T A;  2R7W A;  4CDV A;  1LE2 A;  4PAC A;  1KTM A;  2H7O A;  2NSF A;  2NUP A;  2KSF A;  4PJJ A;  4ZLD A;  2XRH A;  3UGO A;  1DOV A;  2G3K A;  1G4W R;  2J9W A;  4C7O A;  3ABK C;  3ZTZ A;  2PX0 A;  1GQA A;  2A6E F;  1ZHY A;  4O6Y A;  1H9T A;  1Y6D A;  4JJG A;  5JS5 A;  2P6V A;  2R25 A;  1T01 A;  3SP1 A;  2ZPA A;  1FNT c;  1J8M F;  1XWJ A;  1XZQ A;  1U0B B;  1UG7 A;  4C7O B;  1BR1 A;  2LK4 A;  1TKN A;  4EBB A;  3IQ6 A;  2CNW D;  3Q6M A;  3U3B A;  1ORS C;  1HW2 A;  1QZX A;  3UNG C;  4U5C E;  5L0G A;  4YN0 B;  3IPM O;  1ZU5 A;  4PFO A;  3NYM A;  3W2W A;  3H2V A;  2VCC A;  3H65 A;  3UR3 C;  3DAG A;  5BQH A;  4PJL A;  3GAN A;  2DB4 A;  1JOG A;  2LP4 A;  2P7V A;  2FFH A;  1ZHX A;  4U5D E;  4HFF B;  4JJF A;  4PJM A;  4U5B E;  2HSQ A;  3IQT A;  3UMI A;  2ZXO A;  4GQH A;  3N2Z B;  4MVU A;  1BBH A;  1WAS A;  4AX2 A;  2LSE A;  3SXY A;  2GFH A;  1U89 A;  3NKE A;  2AP3 A;  5DS5 A;  4XEV A;  4Q4Z F;  1OR2 A;  3I4U A;  4YT8 A;  3NMK A;  4D4X A;  3DJN B;  4I1M A;  3M1C B;  1H6G A;  1A7D A;  4DRI B;  2Y39 A;  3EQL F;  5L0I A;  3K7D A;  3O55 A;  2LQG A;  4NTF A;  5A6B D;  2YL3 A;  1T6U A;  4NCQ A;  4DRH B;  1D0Y A;  2R7V A;  3HNI A;  2P1A A;  5A6A A;  1GS9 A;  4I44 A;  3OA1 A;  3JCU Q;  4OIR F;  3N24 A;  3RH3 A;  4MVS A;  3K66 A;  5KYU A;  2YVK A;  3K1H A;  1T5O A;  1NFO A;  1SYQ A;  2KC3 A;  4MVR A;  4O7G A;  3V5X A;  4JZA A;  5DS6 A;  4OIO F;  4ER9 A;  5D92 A;  1L7C A;  2H7B A;  2H8A A;  4KI2 A;  5CI9 A;  4JVS A;  2GWW A;  5E33 A;  3GOR A;  4Q7C A;  4WGY A;  5IY5 C;  3JZ0 A;  4IJJ A;  4U5H A;  3I5P A;  3MYF A;  2J8W A;  3ATP A;  3NRH A;  4W8P A;  2Q7R A;  4CIH A;  1C02 A;  2EIN C;  2J0W A;  3LEO A;  1JAF A;  1TWC A;  3QTH A;  3X1O A;  4MTF A;  4BEM J;  4CJG A;  4EIY A;  3W2V A;  1MND A;  1ZHW A;  3K1I A;  3VM6 A;  3C8G A;  3IHU A;  5L3Q A;  3AGT A;  2DGJ A;  1MNE A;  2WVO A;  5JT4 A;  1JR8 A;  3JYY A;  4JUR I;  2OQM A;  3O6X A;  4A2N B;  4E17 A;  1S05 A;  5BQI A;  3GEI A;  3LES A;  4KBL A;  1Z23 A;  1K04 A;  3C8G B;  3EHM A;  3MFN A;  5DVW A;  3IQ5 A;  3S27 A;  4QDL A;  1YAU O;  4JCH A;  4PFP A;  2NG1 A;  1GGQ A;  1K05 A;  2BE5 F;  3U9M A;  3R7C A;  1D0X A;  1ZW3 A;  2KQ9 A;  3UMK A;  3TUL A;  1NU9 C;  2R7Q A;  1Q0G A;  4IB4 A;  3WOD F;  1LI7 A;  1QQ3 A;  1JPN A;  1LI5 A;  1V54 C;  2XS8 A;  2MWQ A;  4F4B A;  3ZVR A;  2PFD A;  3T9O A;  4HE8 D;  4OIN F;  2CDQ A;  2Y3B A;  2WZG A;  1QVX A;  2Q3T A;  1SMY F;  4DVY P;  1O5H A;  2MYS A;  5A69 A;  2R7X A;  2H7V C;  2JPU A;  3AJM A;  5T3W A;  2NUT A;  4C3E A;  5EHH A;  3OWT A;  1RKC A;  1Z5Z A;  3AQB A;  2YL0 A;  3Q7L A;  5JP7 A;  4YK5 A;  3ZIB A;  2J45 A;  1OCC C;  1ZU4 A;  1NSG B;  2ZXW C;  1VLS A;  3IQC A;  3L8I A;  4LDK A;  5E3C A;  1A41 A;  2IOQ A;  2QLA A;  2WL8 A;  2WVQ A;  2XL8 A;  3JYH A;  256B A;  2W4B A;  3S84 A;  2NUT B;  4P6I C;  4RBN A;  1LKX A;  3LLK A;  3A9C A;  4YWQ A;  5KYX A;  3SXM A;  3E70 C;  4AK9 A;  2VCA A;  3F46 A;  1ORY A;  2WZL A;  4FWV A;  4YL1 A;  2ICW G;  3SEO A;  3TQO A;  3KYI A;  1LS4 A;  3C8Z A;  2KJG A;  2VH3 A;  3GEH A;  3ZSU A;  4DVZ A;  4L6R A;  2DYS C;  4E18 A;  5AC5 A;  2OU6 A;  4G7O F;  2W9Y A;  4MVZ A;  4UDV A;  1NZE A;  3SXK A;  1BDJ B;  3DE9 A;  1EKY A;  2FAP B;  1QSP A;  3RQE A;  5F5H A;  1BR2 A;  4R32 A;  3B71 A;  1OW7 A;  1SR2 A;  1OW8 A;  2WB7 A;  3G4Z A;  2XM4 A;  4FX5 A;  3RVZ A;  3ASO C;  2Y69 C;  3BRJ A;  4DJ9 A;  3EGX B;  2R7S A;  2EIM C;  1J8Y F;  4H4K C;  1A0B A;  1NBB A;  1QKR A;  4OIP F;  2EPN A;  2I8B A;  1VB5 A;  3QVY A;  4M63 A;  5KYW A;  3CSK A;  4IAQ A;  1FFH A;  4N6C A;  1IW7 F;  3DD7 A;  3ASN C;  1TQG A;  2OCC C;  3W4Y A;  5JLI A;  2IXN A;  2L6G A;  2GDC A;  3EH1 A;  1ST6 A;  2QUP A;  5L0D A;  4FES A;  4OD5 A;  1C03 A;  3ECS A;  4JRZ A;  3U2M A;  1PD0 A;  1EI7 A;  3C63 A;  3MYI A;  4BJ6 C;  4XPX A;  5KYY A;  1WTY A;  4EUK B;  3GWL A;  3FXH A;  3VYW A;  2HSB A;  4HFK B;  2TMV P;  1MMD A;  2IBF A;  3ITF A;  4EBJ A;  3PCV A;  5E2Q A;  2KW3 C;  5B1B C;  2HS5 A;  2IM8 A;  3FOO A;  2A6H F;  2XL6 A;  5KYY B;  2YHS A;  3PDM P;  4J32 B;  3JTL O;  2OOC A;  1HMO A;  3K6B A;  2PX3 A;  1YAR O;  2L9J A;  1TWA A;  2UUI A;  1YA9 A;  4AL0 A;  3KPH A;  2O9X A;  1VK5 A;  1Z63 A;  1WAT A;  1PD1 A;  2M64 A;  1F1M A;  1H7I A;  1JRA A;  3EG9 B;  4BJ5 C;  2AVK A;  1VTM P;  1CPQ A;  2EIJ C;  2QTV A;  3FAJ A;  2YLD A;  4HEA J;  5DLJ A;  1E2X A;  4JC7 A;  4JW1 A;  4Q5S F;  1G5Z A;  5GPG B;  2IYL D;  3EGD B;  1OCZ C;  4N4W A;  5CIV A;  3FAP B;  1OQC A;  3G50 A;  4JE9 A;  3NDB B;  2EIL C;  3U0C A;  1MMA A;  3AG1 C;  3X2Q C;  2KK1 A;  3O39 A;  3NKD A;  4W8K A;  1TWH A;  1H9G A;  5EGY A;  3TOM A;  1ZZP A;  3W8H A;  1NU7 D;  4LAC B;  3DM5 A;  1RKE A;  3AOU A;  3TOL A;  4BJ5 A;  4IGG A;  1EQ1 A;  4K0D A;  1Q0F A;  3AG2 C;  2L81 A;  3U2L A;  5KYN A;  3CAX A;  3B0P A;  3DI5 A;  3SZR A;  2YWA A;  1RKE B;  3GOD A;  1HMD A;  4MTG A;  5DS4 A;  3WHN A;  2J7P A;  3HLZ A;  2PP4 A;  1MMN A;  1XZP A;  1VMA A;  2CGE A;  4JEA A;  5T1D B;  1I4Y A;  3V5Z A;  1EA8 A;  2R05 A;  2J0X A;  3DWW A;  3GM2 A;  4XEF A;  5CI8 A;  4P9F A;  3AG3 C;  2J46 A;  5JSL A;  1RJ9 A;  4NTB A;  3RW0 A;  1Y4C A;  1Q0M A;  2R9R B;  4A4A A;  4E0I A;  3B29 A;  5TJ5 E;  3RKO F;  4JTD B;  4CS8 C;  2J9V A;  2Y3G A;  2YZS A;  1AVO B;  2LCH A;  2A0U A;  1RJ9 B;  1TR2 A;  4EWC A;  2WZF A;  2LFF A;  3MBG A;  4MVQ A;  4B6I A;  2Q9C A;  2DI3 A;  2XLO A;  3RF3 A;  4CBE A;  4I3M A;  2HFI A;  4PK4 A;  1JMW A;  3NMI A;  1OKK A;  2FGY A;  4MS2 A;  3DJU B;  1OR3 A;  1ZHT A;  3E9V A;  4XPW A;  1LS1 A;  3AGU A;  3QW1 A;  3H2U A;  3MX3 A;  1HE1 A;  1N1C A;  1V55 C;  4MND A;  2NPU A;  1YYJ A;  4JEB A;  4J7Y A;  3UGP A;  3AQC A;  2A68 F;  2P0N A;  2GA0 A;  1G8X A;  3QW0 A;  1M6T A;  1Z6A A;  4LLE A;  2V26 A;  2YLG A;  2PBE A;  2C04 A;  2XLM A;  2OKU A;  3NYL A;  4FAP B;  3ZQV A;  4AE4 B;  2UUH A;  1T6I A;  4JTA B;  5A6K A;  3NMJ A;  4ZLC A;  1RMV A;  2VCB A;  1FMV A;  4D4N A;  3OEO A;  2Y3D A;  3NYJ A;  2AWC A;  2CW0 F;  2G62 A;  4C3D A;  3R2P A;  3S9O A;  4BG0 A;  1D1C A;  4WAB A;  2ZXR A;  2XLH A;  1SF8 A;  1S7Z A;  2LFD A;  4U5G A;  1YJG A;  3JSE O;  4J30 B;  3ZC4 A;  2HV7 A;  2QNL A;  2XLD A;  4KNV A;  3LEV A;  2OJE D;  2YKZ A;  4QI0 A;  1UFB A;  1VYI A;  2HUJ A;  2E87 A;  4MVM A;  5HV9 A;  1QLE C;  3O10 A;  3IEE A;  3N0T A;  5JUA A;  4RD9 A;  4U9D A;  2P61 A;  3CEX A;  3C8G D;  3EGX A;  2J9B A;  5B3S C;  1ZVZ A;  2HKV A;  2MHR A;  2OJQ A;  3M4C A;  4CX9 A;  3HKK A;  3PMR A;  1M57 C;  2HMZ A;  3W8I A;  3ZDL A;  3SNH A;  4E0H A;  5JVE A;  2A1D D;  4EKW A;  3JT1 A;  4GEH A;  1LVK A;  1HE9 A;  2OEX A;  2LIG A;  3U5S A;  3LLI A;  1CGO A;  3Q7G A;  1NG1 A;  3POV A;  3LNM B;  2WVN A;  3HJC A;  3I5Q A;  3JRT A;  2JX0 A;  1ZYR F;  1LE4 A;  2RD9 A;  2CNW A;  1WWP A;  2ASR A;  3GEE A;  3U9J A;  5F28 E;  2R7R A;  1I4Z A;  2B0J A;  1T6Q A;  2L6H A;  2OEV A;  2QY9 A;  3HNL A;  4XEK A;  2W45 A;  4YL0 A;  4DOZ A;  2R7T A;  1AEP A;  3S28 A;  1SZI A;  4JCZ A;  3U8P A;  2LD6 A;  4CDY A;  4C3B A;  3GM1 A;  2Q9B A;  3PHF 2;  1D0Z A;  1WGW A;  2W4M A;  5B1A C;  1O87 A;  2RSE B;  4CS9 C;  4QI2 A;  1HY5 A;  2PNO A;  3EZH A;  3B0V C;  4O79 A;  1PCX A;  1GM5 A;  3ZQY A;  4G0H A;  2Q4F A;  3WG7 C;  4J7T A;  1OXB A;  1VLT A;  3S90 A;  5HSW A;  1OCO C;  4XTK A;  4XWJ A;  2Y3H A;  4CIP A;  2D5R B;  3Q6N A;  2R7U A;  4ULW A;  3EFO A;  4MW8 A;  3EG9 A;  3JSZ A;  4JKV A;  1APC A;  2V3C C;  1BZ4 A;  2AU5 A;  4DBQ A;  2EPO A;  3AG4 C;  1AUE A;  4XQ1 A;  3JRM O;  5E3A A;  2KGO A;  1WN0 A;  3EGD A;  1TWG A;  3M15 A;  3WAQ A;  4NC3 A;  5A6B A;  5L0C A;  1CGN A;  2XLE A;  1KNY A;  3DMD A;  3EFO B;  4OD4 A;  3EJN A;  1I5N A;  1BR4 A;  2A69 F;  2L7A A;  2XSE A;  2XS1 A;  4MTO A;  3U8V A;  4BJ6 A;  1FR0 A;  1M2V A;  3U3F A;  3DAF A;  5FCL A;  1YYX A;  2BL2 A;  2IXM A;  3HTK C;  3RQF A;  4XLP F;  3J06 A;  3HNK A;  1QPU A;  2KNH A;  2NUP B;  3RVY A;  3M79 A;  5L0J A;  1M2V B;  4XPY A;  3LNR A;  2R7O A;  3EPV A;  3TJ5 A;  1YZC A;  1E86 A;  1YDI A;  4G78 A;  5F5F A;  3KMI A;  4MQ9 F;  3QZC A;  2EPK X;  1RXQ A;  1JPJ A;  4CS7 A;  2G3V A;  5B3I A;  3RFY A;  1E83 A;  1Q0D A;  3C7J A;  1YA7 O;  1L3P A;  4LDQ A;  1K40 A;  4U5E E;  3FHD A;  4CDA A;  3LUT B;  5BQG A;  1Z7Q c;  5COG A;  1R5I D;  2OG2 A;  4XLN F;  1LM3 B;  2X51 A;  3KH2 A;  4CJO A;  3B0U X;  2XL4 A;  2VAS A;  4H54 A;  3QVZ A;  5FZT A;  3RQG A;  2NSG A;  3FOP A;  1Q0K A;  1TFO B;  1V4A A;  4YJW A;  3FDQ A;  1M56 C;  1O3U A;  3L8J A;  4K1O A;  4PJN A;  3TD7 A;  5A6J A;  3EH2 A;  3DE8 A;  4LDR A;  4YT2 A;  4OIQ F;  3ABL C;  3L0I A;  3ZWI A;  3LJB A;  4IWB A;  1E85 A;  1C17 M;  2IXO A;  3C18 A;  2D4U A;  1B68 A;  4U9E A;  3K1I C;  4RDA A;  3ZTM A;  2XLW A;  2EIK C;  5L3V A;  2DYR C;  2VC9 A;  3A11 A;  3NG1 A;  2M4E A;  4Z9H A;  1OW6 A;  4U5F E;  1OXK A;  1ZHZ A;  1DOW A;  2R03 A;  3MLG A;  2EPM X;  5EK0 A;  2YL1 A;  1M2O A;  3DKA A;  3DZA A;  1G4U S;  3KKB A;  4ULV A;  3VRC A;  4E7S A;  4AE4 A;  5KYU B;  1RCP A;  4CS8 A;  2C03 A;  2L6F A;  3G4X A;  2ZXP A;  3SYN A;  2XXA A;  1YLM A;  1TFK B;  1VOM A;  3DM9 B;  5COF A;  2KYH A;  3L1M A;  4O6N A;  5KYW B;  1D1A A;  1Z3I X;  3QMK A;  4EHP A;  4IAO A;  3EZI A;  3ABM C;  4PR9 A;  5AGF A;  3T6G B;  4AL1 A;  5DQT A;  1W2W A;  3KL4 A;  2XXA B;  4BEJ A;  2CCY A;  2Q00 A;  3BEH A;  3RYL A;  3GM3 A;  3SXZ A;  3LS1 A;  1CPR A;  2J7P D;  1LPE A;  1LIH A;  1MQV A;  1ORJ A;  2XLV A;  5DQZ A;  5COM A;  1E84 A;  3US6 A;  4K7B A;  4Z9J A;  2R02 A;  2HV6 A;  4EBK A;  2A0B A;  4GYT A;  5T3T A;  1NFN A;  3F47 A;  3K33 A;  4LLC A;  2VB6 A;  3VAY A;  4P9T A;  4BPM A;  3ZG1 A;  2XM0 A;  2Z15 A;  3KYJ A;  1ZW2 A;  1NLX A;  3RIP A;  1FMW A;  2I15 A;  1T9K A;  2IXP A;  5BUO A;  1MMG A;  1PV3 A;  2EPL X;  4ANJ A;  2X0C A;  5L0H A;  2Q9A A;  2BC5 A;  2YEV A;  4E7Z A;  1KU2 A;  1A7V A;  1D1B A;  5JRA A; 
#chains in the Genus database with same CATH homology
 4AL1 A;  4YK5 A;  2UUI A;  4AL0 A;  4NTF A;  5BQI A;  4WAB A;  5BQH A;  5BQG A;  4YL0 A;  4JC7 A;  4J7Y A;  2H8A A;  4YL1 A;  4JCZ A;  3DWW A;  4BPM A;  2PNO A;  4NTB A;  4YL3 A;  4JRZ A;  5HV9 A;  2Q7R A;  3B29 A;  3LEO A;  2UUH A;  4J7T A;  5K0I A;  3HKK A;  4NTA A;  3PCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...