3PCVA

Crystal structure analysis of human leukotriene c4 synthase at 1.9 angstrom resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
146
structure length
146
Chain Sequence
MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title The catalytic architecture of leukotriene C4 synthase with two arginine residues
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 61
structure length 146
sequence length 146
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 3pcvA00
4J7TA 5HV9A 4YK5A 4NTFA 4YL3A 2PNOA 4AL1A 4YL0A 3LEOA 4WABA 2H8AA 4JC7A 4BPMA 4NTAA 3PCVA 5BQHA 2UUIA 2UUHA 4AL0A 4YL1A 4JCZA 5BQIA 5BQGA 5K0IA 4NTBA 3HKKA 2Q7RA 4J7YA 4JRZA 3B29A 3DWWA
chains in the Genus database with same CATH superfamily
1PV3A 1YZCA 4C3EA 3GEHA 3S9OA 4E0HA 4C7OA 3GM2A 2CNWD 4CS9A 1RJ9A 2P61A 2IXPA 5KYWA 5IY5C 1R4TA 3DXJF 3FXHA 5JT4A 3E9VA 2F22A 2OG2A 4AK9A 1G5ZA 2Y39A 3ZQVA 3SYNA 2IYLD 4EBBA 4CDYA 1YYXA 5EGYA 1Z63A 2I15A 1LI7A 4I3MA 1BR1A 1K05A 1Q0GA 5T1DB 3H65A 3SEOA 3CZ6A 4BG0A 1ZW2A 5B3SC 1A7VA 3AGTA 5AC4A 1WWPA 4QI2A 3ZDLA 1SZIA 2C04A 4HEAJ 3AG3C 4D4NA 1OW8A 1Q0KA 5JP7A 2GWWA 1MQVA 1L7CA 4MTGA 3K1IC 4W8KA 3ZC4A 3MFNA 3GEEA 2M64A 3ZTMA 3JZ0A 4KNVA 2OJQA 1TWCA 4GQHA 4N6CA 1LKXA 1U6HA 2HS5A 2BE5F 2L9JA 1RKEA 1BR4A 1OXBA 4MQ9F 1YDIA 2CCYA 5F28E 4MVOA 2W4BA 3IEEA 4XPXA 4WABA 2PX0A 2A6HF 1FMWA 1ZW3A 2XLVA 5DVWA 4CSAA 3GEIA 4B6IA 4YWQA 1ZHYA 2Y3GA 4BPMA 4E17A 3FAPB 3O10A 2PBEA 4JTDB 2ETSA 3TJ6A 2R02A 3ZTZA 4DBQA 3K1IA 5COFA 4BEMJ 1OW6A 4CS8C 4ONSA 3BEHA 3PDMP 1K40A 5L3VA 1OW7A 1QLEC 4FESA 2IXOA 2HJMA 2R05A 4LLEA 1G8XA 4U5DE 4IRUA 1NSGB 2VCBA 4MVRA 1HW2A 5HV9A 3V5ZA 3HNKA 2KSFA 4AE4B 1Q0DA 2ASRA 5EK0A 3TK0A 1ZYRF 2HSBA 4JJFA 3EH2A 4CX9A 3LEOA 3GWNA 3TJ5A 5A6JA 3DMDA 3LJBA 3W8IA 3DJNB 3LLKA 5DLJA 1TKNA 4IAQA 2CGEA 5F5FA 2Y3DA 3IQTA 1MMNA 1BBHA 1TWAA 2YLDA 3NMKA 2OCCC 3EFOB 3C8GB 1D1CA 2JD3A 1MMAA 2CDQA 2ICWG 3UMHA 5DS4A 3RVYA 4LDQA 3QVZA 2MHRA 2AWYA 4XWJA 4YT2A 2Q7RA 3V5XA 3Q6MA 1ZVZA 2GDCA 3NKDA 1T9KA 2G3KA 2J9BA 2L81A 2B0JA 2WZLA 4K7BA 1E83A 3KMIA 4ZLDA 1G4WR 5E3CA 1VLTA 3B0PA 4QDLA 4RBNA 3VM6A 1JMWA 3JYYA 3WHNA 1H9GA 1VLSA 2B0HA 3H2UA 2R7QA 4XEVA 2KC3A 3EGDB 2WZFA 4YL0A 2X0CA 4PFPA 2NUPB 3W4YA 1AVOB 1I4YA 3DE8A 3EGXA 3U9JA 4MTOA 2O9XA 2YRFA 3U2MA 3L0IA 2HJ3A 2XLOA 3EJNA 1T6IA 2YKZA 1D0YA 4XPWA 1RCPA 1EA8A 2BC5A 4J32B 5K0IA 1TFOB 2XLDA 5KYXA 4UDVA 4PJMA 4OIRF 3CEXA 3WAQA 4BJ1A 4JURI 1LIHA 1DOVA 1JPJA 3OEOA 2J9VA 1ZHTA 4JEAA 3IHUA 1YLMA 3AG1C 4CDVA 1PCXA 3FVYA 1YAUO 3NYLA 4CBEA 1VYIA 3VF0A 4EKWA 1KTMA 4U9EA 2OQMA 3RVZA 2P1AA 1R5ID 4FAPB 3S27A 3CSKA 2VB6A 3HTKC 4HFFB 2A6EF 2CW0F 5JUAA 4H54A 2XXAB 4OIOF 2Z15A 1LS4A 3I5PA 1VK5A 2R9RB 4Q5SF 1APCA 3T9OA 4X0RA 3E70C 4Z9IA 1WN0A 3KYJA 2J0XA 2PF4E 4HE8D 5KYUA 3ZSUA 2J45A 4EWCA 3JCUQ 4LLCA 1CPRA 3C8ZA 3I5QA 4YT4A 4XEFA 2ZXOA 1FNTc 2JX0A 3KYIA 3EG9B 4XLNF 5A6KA 3OA1A 3GM3A 2Q9CA 3W8HA 1GS9A 3C62A 1ST6A 2WVOA 4YL3A 2L6GA 3Q7GA 1M57C 4IB4A 4DRIB 4E0IA 2XS8A 4E7ZA 2RD9A 4NY3A 3RQGA 3EQLF 3J06A 4WGYA 1V55C 1HW1A 5GPGB 1SR2A 2CYDA 3VYWA 4EUKB 2R7TA 3PMRA 2YL0A 3ASOC 5BQHA 3FAJA 1I5NA 1UFBA 2TMVP 1O3UA 3B0UX 2YLIA 2OOCA 3WG7C 5L0CA 1Z5ZA 4JCZA 4BJTA 1H6GA 2XLHA 3UR3C 1ORJA 2C03A 2QNLA 2QTVA 4U5BE 5B1AC 3M1CB 3S90A 4G7ZF 5L0DA 4JVSA 3L34A 5D92A 5L0HA 3TULA 2JPUA 4IGGA 2FGYA 3AOUA 3G50A 3F47A 4K1OA 4O7GA 1FAPB 4GEHA 1UG7A 3QW1A 4YJWA 5COGA 3SXMA 3AG2C 3EZHA 2PNOA 3Q7LA 1V4AA 2E87A 3EHNA 3LNRA 3LLIA 4DBRA 4MVZA 2ZXRA 1E85A 2LFFA 1MMDA 1S05A 1ZU5A 5B1BC 4OINF 4U5FE 2OJED 3O6XA 2A0UA 2UUHA 4JCHA 4Q4ZF 4BJ6C 2GFHA 3AQCA 2EPNA 4NQFA 3TOLA 2Q9AA 3AJMA 2DB4A 1EI7A 5F5HA 3SXYA 1CGOA 4OD4A 1Y4CA 2ZD9A 2P0NA 3LESA 4MW8A 4WGZA 1MNEA 3V7OA 3LS1A 4OIQF 2IM8A 1QSPA 4LACB 3ITFA 4FX5A 3JTLO 1M2VB 2XSEA 2IXMA 2Y69C 4XPYA 4XQ1A 1J8MF 4MVMA 5DQZA 2RSEB 1S7ZA 3RH3A 4J7TA 2HFIA 3IQ6A 3JRTA 2R7XA 1HMOA 1Z6AA 3NG1A 2VC9A 1Z7Qc 1LVKA 5KYYB 2A1DD 1QQ3A 5KYYA 1OR3A 2R03A 1YARO 3L8JA 3U0CA 1WTYA 1A41A 3NYJA 2XRHA 5JVEA 3SP1A 5L0GA 2HV6A 1YA9A 3TQOA 4KNWA 2R7VA 1L3PA 1TR2A 2ZPAA 2L6HA 2UUIA 4ULWA 1NFNA 4JTAB 4O6YA 3DD7A 4AL0A 2YZSA 3U8PA 4CS8A 3AGUA 1WOLA 4Z9JA 5BQIA 1U0BB 3FMSA 3JYHA 3S28A 3S0XA 4MW3A 4CIHA 4YT8A 4I1OB 4CIPA 1E84A 1M6TA 5KYXB 2EILC 4XLPF 1SYQA 2YHSA 4YN0B 4U5HA 4YT5A 1XZPA 3ZIBA 5L0JA 1VTMP 3DWWA 1LE2A 2V26A 2D4UA 1H7IA 4BJ5C 3K7DA 3K1HA 2AP3A 2H7VC 2QLAA 3B0VC 2AWCA 4E18A 4CDAA 1A7EA 1CGNA 3RW0A 3UNGC 3HLZA 4F4BA 4DVZA 1NBBA 1O87A 1YJGA 3ABLC 4OIPF 3ECSA 4PR9A 4MVSA 4G0HA 3RQEA 2LFDA 3DAFA 2HKVA 4G7HF 1CGME 1U89A 4QI0A 1E2XA 2J9WA 2DYSC 1TWGA 3ABKC 4RD9A 2OEXA 2YQYA 2DGJA 2BL2A 2NUTB 3ATPA 2GA0A 1VB5A 4JIOA 3U2LA 2R7SA 4NTBA 3AQBA 1BDJB 5COMA 3T6GB 4O79A 3DM5A 3GANA 3T4RA 5E2QA 4C3BA 5JLIA 3UGPA 1QVXA 2EIMC 1Q0FA 1QPUA 2LQGA 3LNMB 4BJ5A 4AE4A 4DVYP 2KQ9A 3MLGA 2PX3A 2XL8A 1V74B 3TOMA 2W45A 1TQGA 1MMGA 3LS0A 3U5SA 4DRHB 1D1AA 1V54C 4P6IC 3PHF2 3NRHA 1J8YF 5CI8A 3RF3A 4E7SA 3M79A 3QVYA 2H8AA 3EFOA 2Y3HA 4C7OB 2HMQA 2Y3BA 3C8GA 4I1MA 1RJ9B 1RXQA 2DYRC 5KYWB 2V3CC 2GAQA 1LM3B 3L1MA 2J9UA 2A68F 2YL3A 3PCVA 1HY5A 3X2QC 2P6VA 2AVKA 1D0XA 1K04A 1A7DA 1TFKB 4GYTA 5EHHA 1T01A 2WVNA 3ZVRA 2EPLX 5BUOA 5DS5A 1PD0A 256BA 5HSWA 2EINC 2J8WA 1XZQA 1OXKA 2D5RB 4N6HA 2HMZA 1YVIA 1Q0MA 3JSZA 5A69A 1F1MA 1KU2A 1TWHA 2KYHA 4MVUA 3FOPA 3EGDA 3NMJA 2NUPA 5D91A 4MTFA 4AX2A 4DXWA 3CAXA 3F46A 2XM0A 3EH1A 1RKEB 1D0ZA 4CS9C 4JC7A 5DS6A 2KJGA 3K66A 4EBJA 5A6BA 3B71A 3FDQA 5E3AA 3SXKA 3BRJA 3GORA 3MX3A 3ZWIA 2WZGA 3JT1A 1H9TA 1Z23A 1WATA 1FTSA 1ZHZA 3IPMO 3S84A 2R7RA 4HFKB 4U5GA 1JAFA 1ORSC 1NU9C 2VH3A 3I4UA 3UMKA 3M15A 4LERA 3UGOA 3C63A 3AG4C 2FAPB 2W9YA 4H4KC 1AUEA 2QE9A 3R2PA 2ZXPA 4FWVA 2OU6A 4PFOA 3U9MA 3RFYA 2H7OA 4JJGA 3T6JA 1OR2A 2EIKC 3KL4A 1SF8A 4MS2A 3U8VA 4U9DA 2PFDA 4RDAA 1FR0A 3R7CA 3HNJA 3A11A 4JKVA 4AL1A 3O39A 1ORYA 3L8IA 4BEJA 1AEPA 4A4AA 3G4XA 2WL8A 5T3TA 2G3VA 4NCQA 1C17M 2VCCA 4MVQA 4P9TA 3S29A 3SZRA 1E86A 4CSAC 2XLEA 1QKRA 2X51A 4XTKA 1HMDA 3H2VA 3QTHA 2W4MA 1RMVA 3LAYA 1Z3IX 3Q6NA 5L0IA 1VMAA 4O6NA 4OD5A 2VCAA 2WB7A 1B68A 3RQFA 3X1OA 3RYLA 1QZXA 4CJOA 5CIVA 3EG9A 4J7YA 1C02A 2YWAA 3A9CA 3C8GD 2I8BA 4DOZA 3G4ZA 2L6FA 4LDKA 2XLWA 4CS7A 3DJUB 3JRMO 1T5OA 2VASA 3KPHA 3N2ZB 3NKEA 4KC9A 4N06A 2L7AA 1I4ZA 1MNDA 1YA7O 2LCHA 1LE4A 1OCZC 2MWQA 3HNLA 3RIPA 5FCLA 4WJ0A 4CJGA 3US6A 2XLMA 5CI9A 4XEKA 2M4EA 3NYMA 3MYIA 4NC3A 1CPQA 1NZEA 2J7PA 2LSEA 3GM1A 3M4BA 3DKAA 1JOGA 2EIJC 4JE9A 4BJ6A 4DJ9A 4U5CE 2FFHA 3EGXB 4DRJB 1PD1A 4PACA 1N1CA 3U3BA 3WODF 3DM9B 1JPNA 1ZHWA 1GGQA 1ZHXA 2XM4A 1ZZPA 2XL6A 3C18A 1OCCC 1SMYF 4IAOA 4IWBA 1NU7D 1WASA 4JZAA 3C7JA 4U5EE 3HKKA 1IZMA 1OKKD 4PJJA 3TD7A 2AU5A 3GODA 3ASNC 2HSQA 5B3IA 5A6BD 2EPKX 1FMVA 2OKUA 5KYNA 2J0WA 3IQ5A 2LP4A 1JRAA 1BZ4A 1M56C 2YVKA 3O55A 1KNYA 4IJJA 4KI2A 2DI3A 1A0BA 2EPMX 2KK1A 1GQAA 2IBFA 4G78A 4KBLA 3B9QA 1RKCA 1M2OA 1LI5A 4W8PA 3GWLA 1W2WA 2A0BA 1GM5A 2Q9BA 1DOWA 3LUTB 3ZG1A 2OEVA 4JW1A 4N4WA 4ZLCA 2A69F 5A6AA 1FFHA 3CQZA 4YL1A 4PJLA 3W2VA 2CNWA 3EHMA 2NSFA 3IQCA 1NG1A 3K6BA 5DQTA 2LD6A 2Q3TA 1M2VA 4MNDA 4L6RA 5TJ5E 4ANJA 4Z9HA 3DE9A 2KGOA 2XS1A 3QW0A 3MYFA 3OWTA 3KH2A 4JRZA 5KYUB 3LEVA 1WGWA 1Y6DA 2LIGA 4D4XA 2R7WA 4J30B 1OCOC 4YK5A 3V5YA 4PJNA 1XWJA 3NMIA 2ZXWC 3EPVA 4A2NB 5AGFA 1YYJA 4EHPA 4G7OF 4JTCB 4Q7CA 5JSLA 3HNIA 3SNHA 3UMIA 2P7VA 1C03A 2WVQA 3HJCA 3JSEO 3ABMC 1LS1A 3T6BA 2KW3C 2NPUA 5JRAA 1VOMA 1YZAA 4LDRA 4EBKA 1G4US 1NLXA 4O6MA 4ULVA 2G62A 1T6QA 2IOQA 5E33A 3ZQYA 2HZ8A 2HUJA 2PP4A 3SXZA 2EPOA 3DAGA 3DZAA 1VYKA 3M4CA 1OCRC 3VRCA 4C3DA 3POVA 1EQ1A 3N24A 2J7PD 3DI5A 2XL4A 1O5HA 3QZCA 2R7UA 3B29A 4ER9A 1D1BA 2NSGA 3U3FA 4M63A 4NTFA 2Q4FA 3FHDA 4P9FA 2YL7A 2Q00A 3RKOF 3N0TA 4JEBA 2R7OA 4IARA 2QUPA 3K33A 2H7BA 2QY9A 2IXNA 2YL1A 2YLGA 4PK4A 5FZTA 3W2WA 5L3QA 5JS5A 1EKYA 1BR2A 1OKKA 1OQCA 4I44A 1HE9A 4NTAA 1NFOA 1FFTC 3MBGA 3QMKA 2NUTA 3KKBA 4R32A 2XXAA 3NDBB 1IW7F 5BQGA 4EIYA 2J46A 1HE1A 2LK4A 1JR8A 1LPEA 1T6UA 1ZU4A 2MYSA 3VAYA 2HV7A 2R25A 2YEVA 3EZIA 4K0DA 5T3WA 2KNHA 2NG1A 5AC5A 5L0FA 3FOOA
chains in the Genus database with same CATH topology
4J7TA 5HV9A 4YK5A 4NTFA 4YL3A 2PNOA 4AL1A 4YL0A 3LEOA 4WABA 2H8AA 4JC7A 4BPMA 4NTAA 3PCVA 5BQHA 2UUIA 2UUHA 4AL0A 4YL1A 4JCZA 5BQIA 5BQGA 5K0IA 4NTBA 3HKKA 2Q7RA 4J7YA 4JRZA 3B29A 3DWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7T A;  5HV9 A;  4YK5 A;  4NTF A;  4YL3 A;  2PNO A;  4AL1 A;  4YL0 A;  3LEO A;  4WAB A;  2H8A A;  4JC7 A;  4BPM A;  4NTA A;  3PCV A;  5BQH A;  2UUI A;  2UUH A;  4AL0 A;  4YL1 A;  4JCZ A;  5BQI A;  5BQG A;  5K0I A;  4NTB A;  3HKK A;  2Q7R A;  4J7Y A;  4JRZ A;  3B29 A;  3DWW A; 
#chains in the Genus database with same CATH topology
 1PV3 A;  1YZC A;  4C3E A;  3GEH A;  3S9O A;  4E0H A;  4C7O A;  3GM2 A;  2CNW D;  4CS9 A;  1RJ9 A;  2P61 A;  2IXP A;  5KYW A;  5IY5 C;  1R4T A;  3DXJ F;  3FXH A;  5JT4 A;  3E9V A;  2F22 A;  2OG2 A;  4AK9 A;  1G5Z A;  2Y39 A;  3ZQV A;  3SYN A;  2IYL D;  4EBB A;  4CDY A;  1YYX A;  5EGY A;  1Z63 A;  2I15 A;  1LI7 A;  4I3M A;  1BR1 A;  1K05 A;  1Q0G A;  5T1D B;  3H65 A;  3SEO A;  3CZ6 A;  4BG0 A;  1ZW2 A;  5B3S C;  1A7V A;  3AGT A;  5AC4 A;  1WWP A;  4QI2 A;  3ZDL A;  1SZI A;  2C04 A;  4HEA J;  3AG3 C;  4D4N A;  1OW8 A;  1Q0K A;  5JP7 A;  2GWW A;  1MQV A;  1L7C A;  4MTG A;  3K1I C;  4W8K A;  3ZC4 A;  3MFN A;  3GEE A;  2M64 A;  3ZTM A;  3JZ0 A;  4KNV A;  2OJQ A;  1TWC A;  4GQH A;  4N6C A;  1LKX A;  1U6H A;  2HS5 A;  2BE5 F;  2L9J A;  1RKE A;  1BR4 A;  1OXB A;  4MQ9 F;  1YDI A;  2CCY A;  5F28 E;  4MVO A;  2W4B A;  3IEE A;  4XPX A;  4WAB A;  2PX0 A;  2A6H F;  1FMW A;  1ZW3 A;  2XLV A;  5DVW A;  4CSA A;  3GEI A;  4B6I A;  4YWQ A;  1ZHY A;  2Y3G A;  4BPM A;  4E17 A;  3FAP B;  3O10 A;  2PBE A;  4JTD B;  2ETS A;  3TJ6 A;  2R02 A;  3ZTZ A;  4DBQ A;  3K1I A;  5COF A;  4BEM J;  1OW6 A;  4CS8 C;  4ONS A;  3BEH A;  3PDM P;  1K40 A;  5L3V A;  1OW7 A;  1QLE C;  4FES A;  2IXO A;  2HJM A;  2R05 A;  4LLE A;  1G8X A;  4U5D E;  4IRU A;  1NSG B;  2VCB A;  4MVR A;  1HW2 A;  5HV9 A;  3V5Z A;  3HNK A;  2KSF A;  4AE4 B;  1Q0D A;  2ASR A;  5EK0 A;  3TK0 A;  1ZYR F;  2HSB A;  4JJF A;  3EH2 A;  4CX9 A;  3LEO A;  3GWN A;  3TJ5 A;  5A6J A;  3DMD A;  3LJB A;  3W8I A;  3DJN B;  3LLK A;  5DLJ A;  1TKN A;  4IAQ A;  2CGE A;  5F5F A;  2Y3D A;  3IQT A;  1MMN A;  1BBH A;  1TWA A;  2YLD A;  3NMK A;  2OCC C;  3EFO B;  3C8G B;  1D1C A;  2JD3 A;  1MMA A;  2CDQ A;  2ICW G;  3UMH A;  5DS4 A;  3RVY A;  4LDQ A;  3QVZ A;  2MHR A;  2AWY A;  4XWJ A;  4YT2 A;  2Q7R A;  3V5X A;  3Q6M A;  1ZVZ A;  2GDC A;  3NKD A;  1T9K A;  2G3K A;  2J9B A;  2L81 A;  2B0J A;  2WZL A;  4K7B A;  1E83 A;  3KMI A;  4ZLD A;  1G4W R;  5E3C A;  1VLT A;  3B0P A;  4QDL A;  4RBN A;  3VM6 A;  1JMW A;  3JYY A;  3WHN A;  1H9G A;  1VLS A;  2B0H A;  3H2U A;  2R7Q A;  4XEV A;  2KC3 A;  3EGD B;  2WZF A;  4YL0 A;  2X0C A;  4PFP A;  2NUP B;  3W4Y A;  1AVO B;  1I4Y A;  3DE8 A;  3EGX A;  3U9J A;  4MTO A;  2O9X A;  2YRF A;  3U2M A;  3L0I A;  2HJ3 A;  2XLO A;  3EJN A;  1T6I A;  2YKZ A;  1D0Y A;  4XPW A;  1RCP A;  1EA8 A;  2BC5 A;  4J32 B;  5K0I A;  1TFO B;  2XLD A;  5KYX A;  4UDV A;  4PJM A;  4OIR F;  3CEX A;  3WAQ A;  4BJ1 A;  4JUR I;  1LIH A;  1DOV A;  1JPJ A;  3OEO A;  2J9V A;  1ZHT A;  4JEA A;  3IHU A;  1YLM A;  3AG1 C;  4CDV A;  1PCX A;  3FVY A;  1YAU O;  3NYL A;  4CBE A;  1VYI A;  3VF0 A;  4EKW A;  1KTM A;  4U9E A;  2OQM A;  3RVZ A;  2P1A A;  1R5I D;  4FAP B;  3S27 A;  3CSK A;  2VB6 A;  3HTK C;  4HFF B;  2A6E F;  2CW0 F;  5JUA A;  4H54 A;  2XXA B;  4OIO F;  2Z15 A;  1LS4 A;  3I5P A;  1VK5 A;  2R9R B;  4Q5S F;  1APC A;  3T9O A;  4X0R A;  3E70 C;  4Z9I A;  1WN0 A;  3KYJ A;  2J0X A;  2PF4 E;  4HE8 D;  5KYU A;  3ZSU A;  2J45 A;  4EWC A;  3JCU Q;  4LLC A;  1CPR A;  3C8Z A;  3I5Q A;  4YT4 A;  4XEF A;  2ZXO A;  1FNT c;  2JX0 A;  3KYI A;  3EG9 B;  4XLN F;  5A6K A;  3OA1 A;  3GM3 A;  2Q9C A;  3W8H A;  1GS9 A;  3C62 A;  1ST6 A;  2WVO A;  4YL3 A;  2L6G A;  3Q7G A;  1M57 C;  4IB4 A;  4DRI B;  4E0I A;  2XS8 A;  4E7Z A;  2RD9 A;  4NY3 A;  3RQG A;  3EQL F;  3J06 A;  4WGY A;  1V55 C;  1HW1 A;  5GPG B;  1SR2 A;  2CYD A;  3VYW A;  4EUK B;  2R7T A;  3PMR A;  2YL0 A;  3ASO C;  5BQH A;  3FAJ A;  1I5N A;  1UFB A;  2TMV P;  1O3U A;  3B0U X;  2YLI A;  2OOC A;  3WG7 C;  5L0C A;  1Z5Z A;  4JCZ A;  4BJT A;  1H6G A;  2XLH A;  3UR3 C;  1ORJ A;  2C03 A;  2QNL A;  2QTV A;  4U5B E;  5B1A C;  3M1C B;  3S90 A;  4G7Z F;  5L0D A;  4JVS A;  3L34 A;  5D92 A;  5L0H A;  3TUL A;  2JPU A;  4IGG A;  2FGY A;  3AOU A;  3G50 A;  3F47 A;  4K1O A;  4O7G A;  1FAP B;  4GEH A;  1UG7 A;  3QW1 A;  4YJW A;  5COG A;  3SXM A;  3AG2 C;  3EZH A;  2PNO A;  3Q7L A;  1V4A A;  2E87 A;  3EHN A;  3LNR A;  3LLI A;  4DBR A;  4MVZ A;  2ZXR A;  1E85 A;  2LFF A;  1MMD A;  1S05 A;  1ZU5 A;  5B1B C;  4OIN F;  4U5F E;  2OJE D;  3O6X A;  2A0U A;  2UUH A;  4JCH A;  4Q4Z F;  4BJ6 C;  2GFH A;  3AQC A;  2EPN A;  4NQF A;  3TOL A;  2Q9A A;  3AJM A;  2DB4 A;  1EI7 A;  5F5H A;  3SXY A;  1CGO A;  4OD4 A;  1Y4C A;  2ZD9 A;  2P0N A;  3LES A;  4MW8 A;  4WGZ A;  1MNE A;  3V7O A;  3LS1 A;  4OIQ F;  2IM8 A;  1QSP A;  4LAC B;  3ITF A;  4FX5 A;  3JTL O;  1M2V B;  2XSE A;  2IXM A;  2Y69 C;  4XPY A;  4XQ1 A;  1J8M F;  4MVM A;  5DQZ A;  2RSE B;  1S7Z A;  3RH3 A;  4J7T A;  2HFI A;  3IQ6 A;  3JRT A;  2R7X A;  1HMO A;  1Z6A A;  3NG1 A;  2VC9 A;  1Z7Q c;  1LVK A;  5KYY B;  2A1D D;  1QQ3 A;  5KYY A;  1OR3 A;  2R03 A;  1YAR O;  3L8J A;  3U0C A;  1WTY A;  1A41 A;  3NYJ A;  2XRH A;  5JVE A;  3SP1 A;  5L0G A;  2HV6 A;  1YA9 A;  3TQO A;  4KNW A;  2R7V A;  1L3P A;  1TR2 A;  2ZPA A;  2L6H A;  2UUI A;  4ULW A;  1NFN A;  4JTA B;  4O6Y A;  3DD7 A;  4AL0 A;  2YZS A;  3U8P A;  4CS8 A;  3AGU A;  1WOL A;  4Z9J A;  5BQI A;  1U0B B;  3FMS A;  3JYH A;  3S28 A;  3S0X A;  4MW3 A;  4CIH A;  4YT8 A;  4I1O B;  4CIP A;  1E84 A;  1M6T A;  5KYX B;  2EIL C;  4XLP F;  1SYQ A;  2YHS A;  4YN0 B;  4U5H A;  4YT5 A;  1XZP A;  3ZIB A;  5L0J A;  1VTM P;  3DWW A;  1LE2 A;  2V26 A;  2D4U A;  1H7I A;  4BJ5 C;  3K7D A;  3K1H A;  2AP3 A;  2H7V C;  2QLA A;  3B0V C;  2AWC A;  4E18 A;  4CDA A;  1A7E A;  1CGN A;  3RW0 A;  3UNG C;  3HLZ A;  4F4B A;  4DVZ A;  1NBB A;  1O87 A;  1YJG A;  3ABL C;  4OIP F;  3ECS A;  4PR9 A;  4MVS A;  4G0H A;  3RQE A;  2LFD A;  3DAF A;  2HKV A;  4G7H F;  1CGM E;  1U89 A;  4QI0 A;  1E2X A;  2J9W A;  2DYS C;  1TWG A;  3ABK C;  4RD9 A;  2OEX A;  2YQY A;  2DGJ A;  2BL2 A;  2NUT B;  3ATP A;  2GA0 A;  1VB5 A;  4JIO A;  3U2L A;  2R7S A;  4NTB A;  3AQB A;  1BDJ B;  5COM A;  3T6G B;  4O79 A;  3DM5 A;  3GAN A;  3T4R A;  5E2Q A;  4C3B A;  5JLI A;  3UGP A;  1QVX A;  2EIM C;  1Q0F A;  1QPU A;  2LQG A;  3LNM B;  4BJ5 A;  4AE4 A;  4DVY P;  2KQ9 A;  3MLG A;  2PX3 A;  2XL8 A;  1V74 B;  3TOM A;  2W45 A;  1TQG A;  1MMG A;  3LS0 A;  3U5S A;  4DRH B;  1D1A A;  1V54 C;  4P6I C;  3PHF 2;  3NRH A;  1J8Y F;  5CI8 A;  3RF3 A;  4E7S A;  3M79 A;  3QVY A;  2H8A A;  3EFO A;  2Y3H A;  4C7O B;  2HMQ A;  2Y3B A;  3C8G A;  4I1M A;  1RJ9 B;  1RXQ A;  2DYR C;  5KYW B;  2V3C C;  2GAQ A;  1LM3 B;  3L1M A;  2J9U A;  2A68 F;  2YL3 A;  3PCV A;  1HY5 A;  3X2Q C;  2P6V A;  2AVK A;  1D0X A;  1K04 A;  1A7D A;  1TFK B;  4GYT A;  5EHH A;  1T01 A;  2WVN A;  3ZVR A;  2EPL X;  5BUO A;  5DS5 A;  1PD0 A;  256B A;  5HSW A;  2EIN C;  2J8W A;  1XZQ A;  1OXK A;  2D5R B;  4N6H A;  2HMZ A;  1YVI A;  1Q0M A;  3JSZ A;  5A69 A;  1F1M A;  1KU2 A;  1TWH A;  2KYH A;  4MVU A;  3FOP A;  3EGD A;  3NMJ A;  2NUP A;  5D91 A;  4MTF A;  4AX2 A;  4DXW A;  3CAX A;  3F46 A;  2XM0 A;  3EH1 A;  1RKE B;  1D0Z A;  4CS9 C;  4JC7 A;  5DS6 A;  2KJG A;  3K66 A;  4EBJ A;  5A6B A;  3B71 A;  3FDQ A;  5E3A A;  3SXK A;  3BRJ A;  3GOR A;  3MX3 A;  3ZWI A;  2WZG A;  3JT1 A;  1H9T A;  1Z23 A;  1WAT A;  1FTS A;  1ZHZ A;  3IPM O;  3S84 A;  2R7R A;  4HFK B;  4U5G A;  1JAF A;  1ORS C;  1NU9 C;  2VH3 A;  3I4U A;  3UMK A;  3M15 A;  4LER A;  3UGO A;  3C63 A;  3AG4 C;  2FAP B;  2W9Y A;  4H4K C;  1AUE A;  2QE9 A;  3R2P A;  2ZXP A;  4FWV A;  2OU6 A;  4PFO A;  3U9M A;  3RFY A;  2H7O A;  4JJG A;  3T6J A;  1OR2 A;  2EIK C;  3KL4 A;  1SF8 A;  4MS2 A;  3U8V A;  4U9D A;  2PFD A;  4RDA A;  1FR0 A;  3R7C A;  3HNJ A;  3A11 A;  4JKV A;  4AL1 A;  3O39 A;  1ORY A;  3L8I A;  4BEJ A;  1AEP A;  4A4A A;  3G4X A;  2WL8 A;  5T3T A;  2G3V A;  4NCQ A;  1C17 M;  2VCC A;  4MVQ A;  4P9T A;  3S29 A;  3SZR A;  1E86 A;  4CSA C;  2XLE A;  1QKR A;  2X51 A;  4XTK A;  1HMD A;  3H2V A;  3QTH A;  2W4M A;  1RMV A;  3LAY A;  1Z3I X;  3Q6N A;  5L0I A;  1VMA A;  4O6N A;  4OD5 A;  2VCA A;  2WB7 A;  1B68 A;  3RQF A;  3X1O A;  3RYL A;  1QZX A;  4CJO A;  5CIV A;  3EG9 A;  4J7Y A;  1C02 A;  2YWA A;  3A9C A;  3C8G D;  2I8B A;  4DOZ A;  3G4Z A;  2L6F A;  4LDK A;  2XLW A;  4CS7 A;  3DJU B;  3JRM O;  1T5O A;  2VAS A;  3KPH A;  3N2Z B;  3NKE A;  4KC9 A;  4N06 A;  2L7A A;  1I4Z A;  1MND A;  1YA7 O;  2LCH A;  1LE4 A;  1OCZ C;  2MWQ A;  3HNL A;  3RIP A;  5FCL A;  4WJ0 A;  4CJG A;  3US6 A;  2XLM A;  5CI9 A;  4XEK A;  2M4E A;  3NYM A;  3MYI A;  4NC3 A;  1CPQ A;  1NZE A;  2J7P A;  2LSE A;  3GM1 A;  3M4B A;  3DKA A;  1JOG A;  2EIJ C;  4JE9 A;  4BJ6 A;  4DJ9 A;  4U5C E;  2FFH A;  3EGX B;  4DRJ B;  1PD1 A;  4PAC A;  1N1C A;  3U3B A;  3WOD F;  3DM9 B;  1JPN A;  1ZHW A;  1GGQ A;  1ZHX A;  2XM4 A;  1ZZP A;  2XL6 A;  3C18 A;  1OCC C;  1SMY F;  4IAO A;  4IWB A;  1NU7 D;  1WAS A;  4JZA A;  3C7J A;  4U5E E;  3HKK A;  1IZM A;  1OKK D;  4PJJ A;  3TD7 A;  2AU5 A;  3GOD A;  3ASN C;  2HSQ A;  5B3I A;  5A6B D;  2EPK X;  1FMV A;  2OKU A;  5KYN A;  2J0W A;  3IQ5 A;  2LP4 A;  1JRA A;  1BZ4 A;  1M56 C;  2YVK A;  3O55 A;  1KNY A;  4IJJ A;  4KI2 A;  2DI3 A;  1A0B A;  2EPM X;  2KK1 A;  1GQA A;  2IBF A;  4G78 A;  4KBL A;  3B9Q A;  1RKC A;  1M2O A;  1LI5 A;  4W8P A;  3GWL A;  1W2W A;  2A0B A;  1GM5 A;  2Q9B A;  1DOW A;  3LUT B;  3ZG1 A;  2OEV A;  4JW1 A;  4N4W A;  4ZLC A;  2A69 F;  5A6A A;  1FFH A;  3CQZ A;  4YL1 A;  4PJL A;  3W2V A;  2CNW A;  3EHM A;  2NSF A;  3IQC A;  1NG1 A;  3K6B A;  5DQT A;  2LD6 A;  2Q3T A;  1M2V A;  4MND A;  4L6R A;  5TJ5 E;  4ANJ A;  4Z9H A;  3DE9 A;  2KGO A;  2XS1 A;  3QW0 A;  3MYF A;  3OWT A;  3KH2 A;  4JRZ A;  5KYU B;  3LEV A;  1WGW A;  1Y6D A;  2LIG A;  4D4X A;  2R7W A;  4J30 B;  1OCO C;  4YK5 A;  3V5Y A;  4PJN A;  1XWJ A;  3NMI A;  2ZXW C;  3EPV A;  4A2N B;  5AGF A;  1YYJ A;  4EHP A;  4G7O F;  4JTC B;  4Q7C A;  5JSL A;  3HNI A;  3SNH A;  3UMI A;  2P7V A;  1C03 A;  2WVQ A;  3HJC A;  3JSE O;  3ABM C;  1LS1 A;  3T6B A;  2KW3 C;  2NPU A;  5JRA A;  1VOM A;  1YZA A;  4LDR A;  4EBK A;  1G4U S;  1NLX A;  4O6M A;  4ULV A;  2G62 A;  1T6Q A;  2IOQ A;  5E33 A;  3ZQY A;  2HZ8 A;  2HUJ A;  2PP4 A;  3SXZ A;  2EPO A;  3DAG A;  3DZA A;  1VYK A;  3M4C A;  1OCR C;  3VRC A;  4C3D A;  3POV A;  1EQ1 A;  3N24 A;  2J7P D;  3DI5 A;  2XL4 A;  1O5H A;  3QZC A;  2R7U A;  3B29 A;  4ER9 A;  1D1B A;  2NSG A;  3U3F A;  4M63 A;  4NTF A;  2Q4F A;  3FHD A;  4P9F A;  2YL7 A;  2Q00 A;  3RKO F;  3N0T A;  4JEB A;  2R7O A;  4IAR A;  2QUP A;  3K33 A;  2H7B A;  2QY9 A;  2IXN A;  2YL1 A;  2YLG A;  4PK4 A;  5FZT A;  3W2W A;  5L3Q A;  5JS5 A;  1EKY A;  1BR2 A;  1OKK A;  1OQC A;  4I44 A;  1HE9 A;  4NTA A;  1NFO A;  1FFT C;  3MBG A;  3QMK A;  2NUT A;  3KKB A;  4R32 A;  2XXA A;  3NDB B;  1IW7 F;  5BQG A;  4EIY A;  2J46 A;  1HE1 A;  2LK4 A;  1JR8 A;  1LPE A;  1T6U A;  1ZU4 A;  2MYS A;  3VAY A;  2HV7 A;  2R25 A;  2YEV A;  3EZI A;  4K0D A;  5T3W A;  2KNH A;  2NG1 A;  5AC5 A;  5L0F A;  3FOO A; 
#chains in the Genus database with same CATH homology
 4J7T A;  5HV9 A;  4YK5 A;  4NTF A;  4YL3 A;  2PNO A;  4AL1 A;  4YL0 A;  3LEO A;  4WAB A;  2H8A A;  4JC7 A;  4BPM A;  4NTA A;  3PCV A;  5BQH A;  2UUI A;  2UUH A;  4AL0 A;  4YL1 A;  4JCZ A;  5BQI A;  5BQG A;  5K0I A;  4NTB A;  3HKK A;  2Q7R A;  4J7Y A;  4JRZ A;  3B29 A;  3DWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...