3PCVA

Crystal structure analysis of human leukotriene c4 synthase at 1.9 angstrom resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
146
structure length
146
Chain Sequence
MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
publication title The catalytic architecture of leukotriene C4 synthase with two arginine residues
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 146
sequence length 146
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 3pcvA00
5K0IA 4AL0A 4NTAA 5BQIA 4YL0A 4YL1A 4YL3A 2H8AA 5HV9A 2UUIA 4J7YA 4JC7A 3HKKA 4YK5A 2UUHA 4NTBA 4AL1A 3B29A 3LEOA 4WABA 4JRZA 5BQGA 2Q7RA 4NTFA 2PNOA 5BQHA 4J7TA 4BPMA 3PCVA 4JCZA 3DWWA
chains in the Genus database with same CATH superfamily
2QE9A 1IZMA 1I4YA 1FMWA 2HSBA 3US6A 3SYNA 3U9JA 3ASNC 4CDVA 4CIPA 1HE1A 1E86A 4AE4A 3N24A 2YEVA 3KMIA 5IY5C 3ZWIA 1LM3B 3C18A 3SNHA 3B0PA 2TMVP 4Q7CA 1XZQA 3W2WA 4JIOA 3ABKC 2Y69C 3TQOA 1TFOB 1TWAA 1XWJA 3NRHA 3B0VC 2HJMA 3RW0A 3EHMA 3PMRA 2OQMA 1AEPA 3EPVA 2XXAB 3HNJA 5L0JA 4Q5SF 5JS5A 3RVZA 4FAPB 2VB6A 3Q6MA 2YLDA 3F46A 3KH2A 1VLSA 3ZTZA 4QI2A 1QPUA 1TKNA 2BC5A 4M63A 4YT4A 1TWGA 3G50A 4MNDA 1ZHYA 1T6UA 1YZAA 3UMKA 5JRAA 3C7JA 1HY5A 4XTKA 3T6GB 3BEHA 4EBBA 2X0CA 3FMSA 1SMYF 1U89A 4IAQA 2NUTA 5L0DA 1VMAA 4XLPF 1Z63A 3A11A 2CYDA 3B0UX 3LJBA 2WVOA 2XLDA 2XL4A 3EG9A 2Y39A 3TD7A 3EJNA 4LDQA 1WASA 1TQGA 1ZZPA 2OG2A 2P7VA 1LPEA 4B6IA 2XM0A 1Z7Qc 2R9RB 4FESA 1LE2A 2QTVA 1OCRC 1SYQA 1FAPB 4WABA 2LSEA 4KNWA 1UG7A 1OXKA 2OJED 2AP3A 3LLIA 3B9QA 2KSFA 4G78A 1E83A 1N1CA 1Z5ZA 1BR4A 1RKEA 2B0HA 2PBEA 2B0JA 3CSKA 4MW8A 3RQFA 1W2WA 4CS9C 4KI2A 4RDAA 4XLNF 3JRMO 1R4TA 1PCXA 2DYSC 1V74B 2GAQA 5CIVA 3B71A 4MW3A 1DOWA 2ZXOA 5JSLA 1QQ3A 3DM5A 2Y3HA 3W8HA 3VAYA 2J9WA 5TJ5E 1YYJA 4I1OB 1ZW2A 1RMVA 5HV9A 1JPJA 3ZSUA 2RSEB 1R5ID 2UUIA 3LUTB 1QLEC 3MFNA 4CS9A 2MWQA 4CS8C 3ZIBA 5F28E 3EH1A 4OD5A 1T6IA 5E3CA 3SXYA 3S0XA 3W8IA 2XRHA 4P9TA 4W8PA 1L7CA 4U5CE 2EPLX 4F4BA 1E2XA 5COFA 4JJFA 2OKUA 3DMDA 3EH2A 4U9EA 4BG0A 4NTFA 3DAFA 1M2VB 2J7PA 3N2ZB 4XQ1A 4G7HF 4N6CA 2R7VA 3HNLA 1CGME 1GS9A 1UFBA 2ETSA 4H4KC 2IOQA 2YQYA 3SXZA 2QY9A 4NTAA 3TULA 4GEHA 4K7BA 4Z9JA 1FFTC 5COMA 1M56C 1VTMP 3W2VA 4YL3A 4EBJA 3O39A 3QMKA 2OOCA 3QTHA 4PJMA 3MLGA 1Z3IX 2ZPAA 5JUAA 4K0DA 3UNGC 4YK5A 5KYYA 2KK1A 4C3DA 4NCQA 3EFOA 4DRJB 4OIQF 2W9YA 4DOZA 2GDCA 2H7VC 3IEEA 4C7OA 2EIMC 3T9OA 3JYHA 4OINF 2NUTB 3T6JA 1O5HA 3V5XA 1VK5A 2YVKA 3L34A 3AG2C 2X51A 3IQ6A 3DWWA 2LP4A 4HFFB 5A6AA 3EGXA 1H9GA 3L1MA 2XSEA 3LAYA 1WN0A 3EG9B 3ITFA 4MQ9F 4EHPA 4ULWA 3Q7LA 1O3UA 3M4CA 1ST6A 2PF4E 1CPRA 2WZLA 3V7OA 1D1CA 4A2NB 1EA8A 3LS0A 4Q4ZF 3U2LA 4OIPF 5E2QA 3C62A 3GEIA 1JR8A 3I5PA 2A1DD 1J8YF 1YLMA 2FGYA 2H8AA 3DE9A 1VYKA 4E18A 3M1CB 3U5SA 1QSPA 2JPUA 1Z23A 4J32B 4QDLA 1S7ZA 4U5HA 5DVWA 4D4XA 1RKEB 4AL1A 2V3CC 1TWCA 1MMGA 1O87A 3HNIA 3DD7A 3FXHA 4EIYA 1HW1A 1VYIA 2QUPA 2GFHA 3S84A 5A6BD 4DVYP 4WGZA 4ANJA 1BDJB 3PCVA 3U3BA 3JRTA 2VC9A 3G4ZA 3OWTA 4RBNA 3HTKC 4GYTA 4OD4A 1TFKB 4I3MA 4N6HA 2NSFA 3AQBA 4I1MA 4JEAA 1ORSC 1QKRA 2W45A 4AL0A 5BUOA 3G4XA 3MYIA 2IYLD 1YZCA 4I44A 3T4RA 3WAQA 4XPXA 3NMIA 4A4AA 1NU7D 4JVSA 2I8BA 4OIRF 1T6QA 4KC9A 1RJ9B 2Q4FA 2VASA 3NYMA 3FDQA 2WVQA 2YL7A 3RH3A 3LEVA 4JEBA 1ZYRF 4JTDB 2WVNA 1K05A 4NTBA 2R03A 5A6KA 4N06A 4C3EA 3SZRA 4LLEA 2PP4A 1WATA 3RIPA 1APCA 2J9BA 1OW7A 3PDMP 2VH3A 1U6HA 4BJ5C 3DXJF 3ZC4A 4DRHB 3AG4C 2R02A 3MBGA 2V26A 2NUPA 3K1IA 4O79A 2C04A 256BA 2QNLA 5CI8A 2L6FA 2G62A 1JMWA 2KNHA 1ZHTA 5K0IA 1Z6AA 2KJGA 3LS1A 5KYYB 2OCCC 2AU5A 4U9DA 1C02A 4L6RA 3EFOB 5AC5A 3ABLC 3O55A 4PK4A 4BJ5A 3POVA 3KPHA 4C7OB 1VB5A 1PD1A 4PFOA 4LDKA 5T1DB 5T3WA 4CS7A 4UDVA 2Q9AA 3DE8A 1EKYA 3EQLF 1EI7A 1QZXA 2IXMA 1NBBA 3AGUA 3DAGA 3GM3A 2J0WA 4FX5A 1OR2A 4DVZA 3EGXB 2R7SA 3C8GA 4EUKB 3RF3A 1BZ4A 1YJGA 4U5DE 4DBQA 2XLMA 1JPNA 1PV3A 2YWAA 2L6HA 4XEVA 4ER9A 2HUJA 3L8JA 2P1AA 5JLIA 2DB4A 2CNWA 1L3PA 1NU9C 5AC4A 4YT8A 1S05A 2J9UA 3EGDA 3IQCA 4BJTA 1H7IA 1LKXA 4EKWA 1HMDA 4JW1A 2A68F 1FNTc 2XLHA 5DQZA 4K1OA 3M4BA 3NMJA 4FWVA 5L0FA 3M79A 1MNEA 3ZQVA 1OKKA 5EGYA 5CI9A 5DS5A 1OCCC 3AJMA 1SR2A 1G5ZA 1KU2A 2WZFA 2GA0A 2VCAA 3AG1C 4IAOA 5KYUA 5T3TA 2P6VA 3A9CA 4MVQA 1JRAA 1OXBA 3AG3C 5F5FA 3JSZA 3RQEA 1OR3A 3AQCA 3ZTMA 1VOMA 2Z15A 3LEOA 3NMKA 1J8MF 2JX0A 1LE4A 3E70C 2R7RA 2ZXPA 2C03A 2PFDA 4CX9A 2NPUA 4AE4B 1NFNA 3BRJA 4MVRA 1V4AA 5L3VA 5COGA 1YDIA 1XZPA 2YHSA 1B68A 1RKCA 4JZAA 3R7CA 1ZHXA 5A69A 1YYXA 1V55C 1C17M 1MQVA 1D0XA 2OU6A 2XM4A 3ABMC 3V5ZA 2ZXWC 2W4BA 1WOLA 2ASRA 2KQ9A 1MNDA 3ATPA 3DZAA 4JJGA 2HV7A 4PFPA 2XL8A 5B1AC 1YA9A 2PX0A 1HMOA 2EPOA 4XWJA 5E3AA 3DJNB 3FAJA 5B3IA 2R7TA 1VLTA 2KGOA 3DI5A 3DJUB 3S27A 3SXMA 4CBEA 5A6JA 1D0ZA 2NUPB 2WZGA 5B1BC 1Q0GA 3ZVRA 1OW6A 2R05A 2P61A 3DM9B 3S28A 3JZ0A 3NG1A 5EK0A 1QVXA 2VCBA 2E87A 3GEEA 3OA1A 4N4WA 1H6GA 4BJ6C 3FVYA 5KYWA 5BQHA 1FR0A 3U8PA 3S9OA 2IXOA 4Z9HA 1TWHA 2YLGA 4MTGA 4O6NA 3WHNA 2EPMX 2A0UA 1ZW3A 2IM8A 2R7OA 3AOUA 1NSGB 3RKOF 2NG1A 2LK4A 3C8GB 4BJ6A 3HJCA 3AGTA 2R25A 3WG7C 4CJGA 2G3KA 3ZQYA 3U2MA 3F47A 3I4UA 4H54A 4KNVA 2XLOA 1FTSA 1G4WR 2XL6A 1BBHA 4NQFA 1NFOA 4PJNA 1Y4CA 5L0HA 1A7DA 2WL8A 4XEFA 3UR3C 1Y6DA 3V5YA 3MX3A 5D91A 2R7XA 3B29A 2D4UA 4LACB 3JSEO 5BQGA 1I5NA 2Q7RA 2YL0A 5DS4A 4G7OF 2HFIA 2PNOA 2EIJC 1OCOC 1WGWA 2YRFA 1GM5A 3RFYA 3O6XA 2OJQA 3GANA 1ZU5A 3JTLO 2ZD9A 2KYHA 5GPGB 4ZLDA 4U5GA 1LI5A 3X2QC 1OQCA 2H7OA 2MYSA 3H2VA 5BQIA 1OKKD 1YVIA 3GM1A 1LIHA 4JKVA 1V54C 4LLCA 4KBLA 4LERA 1AUEA 1MMAA 2CDQA 4IJJA 3JT1A 4IGGA 4W8KA 3FHDA 4J30B 1D0YA 3K1IC 3KKBA 4XEKA 3WODF 2HKVA 5FZTA 2BE5F 2UUHA 2YLIA 5F5HA 1LVKA 2L7AA 3CAXA 4WGYA 3NYJA 4U5FE 2GWWA 4LDRA 2H7BA 2P0NA 2LFDA 1A41A 3W4YA 5DS6A 2J7PD 4JCHA 4WJ0A 1T01A 2M4EA 3IPMO 3SEOA 3U8VA 4E0HA 4G7ZF 4AX2A 2YL1A 4C3BA 5FCLA 3M15A 3LNRA 5JVEA 1HW2A 1G8XA 1D1BA 4Z9IA 1ZU4A 2EPKX 2A6EF 2CGEA 2Y3BA 3EZIA 1M2VA 2LFFA 3LESA 1TR2A 3J06A 1T9KA 3NKDA 3VRCA 3VF0A 4MVMA 5KYWB 4J7YA 3FAPB 2R7QA 2G3VA 2WB7A 3ECSA 3HKKA 2XLVA 4JC7A 4PJLA 4HE8D 3PHF2 4MVUA 1RXQA 3ZDLA 1OW8A 1ORJA 4MTFA 3QVZA 2DI3A 3UMHA 2ZXRA 1PD0A 4IARA 2J46A 2XS8A 3U3FA 4BPMA 1NZEA 3GM2A 3IHUA 4YJWA 4EBKA 2IBFA 2YL3A 1WWPA 4G0HA 1K40A 3QVYA 2XS1A 2D5RB 1LS1A 2IXNA 2L6GA 2RD9A 3CEXA 3N0TA 4XPYA 2HJ3A 5E33A 4HFKB 1T5OA 1MMDA 2J0XA 1NLXA 4YN0B 3T6BA 3K1HA 4YL1A 3TOLA 5L0IA 2EINC 1K04A 3I5QA 4IRUA 2NSGA 2A0BA 2DYRC 4RD9A 4AK9A 4PACA 4E7SA 5KYXA 4CSAC 3KYIA 2MHRA 2ICWG 4XPWA 1D1AA 3U9MA 1E85A 3EZHA 1BR2A 2LCHA 3K7DA 3LLKA 4MTOA 4MVZA 4BJ1A 3H65A 4E7ZA 3DKAA 3QW0A 1JOGA 2CW0F 3R2PA 4GQHA 4MVOA 2J9VA 4CDAA 1Q0KA 2HSQA 4PR9A 1ZHWA 3FOPA 3NKEA 2LIGA 3JCUQ 5A6BA 5L0GA 1IW7F 4NC3A 5JP7A 4CSAA 1LI7A 3U0CA 1CPQA 2HV6A 3S90A 2YKZA 3UGOA 3SP1A 4IWBA 4E0IA 2HZ8A 3FOOA 1A7VA 2A69F 2EILC 3GWNA 1Q0DA 1FMVA 1SF8A 3CZ6A 1U0BB 3K33A 1BR1A 4YL0A 3O10A 4CJOA 3RQGA 3LNMB 3GEHA 3NYLA 4BEJA 3VM6A 4JTCB 4E17A 3S29A 4MS2A 5B3SC 2EPNA 2R7WA 3Q7GA 4P6IC 2XLWA 5AGFA 2FFHA 3MYFA 2Q00A 4X0RA 3L8IA 3C63A 4JE9A 2FAPB 5JT4A 5KYNA 1RJ9A 4OIOF 3VYWA 4CDYA 2Q3TA 1LS4A 4CS8A 5L3QA 2OEVA 1AVOB 4JURI 1KTMA 1KNYA 1SZIA 1OCZC 4DRIB 1EQ1A 4YT5A 2XXAA 3TJ5A 4DJ9A 2IXPA 4MVSA 1E84A 1GGQA 2QLAA 3JYYA 3OEOA 1CGNA 3IQTA 1FFHA 3RVYA 2I15A 2PX3A 1HE9A 1H9TA 2F22A 4R32A 1CGOA 4U5EE 4IB4A 3X1OA 4ZLCA 1ORYA 1YAUO 3CQZA 3UMIA 3C8ZA 3ASOC 2M64A 3C8GD 4DXWA 2Q9BA 1WTYA 3EGDB 2Q9CA 3EHNA 4YWQA 2HMQA 1YARO 1M57C 5DQTA 2AWCA 2L81A 4ONSA 2W4MA 4JRZA 2A6HF 1G4US 2BL2A 1NG1A 4CIHA 2CNWD 2LD6A 2DGJA 3ZG1A 3UGPA 1A7EA 2LQGA 3GORA 4J7TA 2L9JA 4JCZA 4ULVA 5HSWA 3TK0A 4JTAB 1ZHZA 2Y3DA 3IQ5A 3GODA 1MMNA 4YT2A 2JD3A 1I4ZA 4D4NA 5KYXB 2VCCA 1DOVA 1Q0FA 2OEXA 3RYLA 4P9FA 5EHHA 5KYUB 3E9VA 4U5BE 2AWYA 2KW3C 2XLEA 2O9XA 2AVKA 4O6MA 3K66A 1F1MA 2Y3GA 1A0BA 1M6TA 2EIKC 2J45A 3QW1A 1Q0MA 1YA7O 3KYJA 4HEAJ 3TJ6A 4BEMJ 3Q6NA 3KL4A 3GWLA 3SXKA 2CCYA 1GQAA 2HS5A 3K6BA 4O6YA 2R7UA 1JAFA 2J8WA 4EWCA 1C03A 4NY3A 4DBRA 5D92A 2YZSA 4PJJA 3HNKA 3L0IA 3TOMA 1M2OA 5L0CA 2KC3A 3H2UA 4O7GA 1RCPA 3HLZA 3QZCA 4QI0A 5DLJA 1ZVZA 2HMZA 3NDBB
chains in the Genus database with same CATH topology
5K0IA 4AL0A 4NTAA 5BQIA 4YL0A 4YL1A 4YL3A 2H8AA 5HV9A 2UUIA 4J7YA 4JC7A 3HKKA 4YK5A 2UUHA 4NTBA 4AL1A 3B29A 3LEOA 4WABA 4JRZA 5BQGA 2Q7RA 4NTFA 2PNOA 5BQHA 4J7TA 4BPMA 3PCVA 4JCZA 3DWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K0I A;  4AL0 A;  4NTA A;  5BQI A;  4YL0 A;  4YL1 A;  4YL3 A;  2H8A A;  5HV9 A;  2UUI A;  4J7Y A;  4JC7 A;  3HKK A;  4YK5 A;  2UUH A;  4NTB A;  4AL1 A;  3B29 A;  3LEO A;  4WAB A;  4JRZ A;  5BQG A;  2Q7R A;  4NTF A;  2PNO A;  5BQH A;  4J7T A;  4BPM A;  3PCV A;  4JCZ A;  3DWW A; 
#chains in the Genus database with same CATH topology
 2QE9 A;  1IZM A;  1I4Y A;  1FMW A;  2HSB A;  3US6 A;  3SYN A;  3U9J A;  3ASN C;  4CDV A;  4CIP A;  1HE1 A;  1E86 A;  4AE4 A;  3N24 A;  2YEV A;  3KMI A;  5IY5 C;  3ZWI A;  1LM3 B;  3C18 A;  3SNH A;  3B0P A;  2TMV P;  4Q7C A;  1XZQ A;  3W2W A;  4JIO A;  3ABK C;  2Y69 C;  3TQO A;  1TFO B;  1TWA A;  1XWJ A;  3NRH A;  3B0V C;  2HJM A;  3RW0 A;  3EHM A;  3PMR A;  2OQM A;  1AEP A;  3EPV A;  2XXA B;  3HNJ A;  5L0J A;  4Q5S F;  5JS5 A;  3RVZ A;  4FAP B;  2VB6 A;  3Q6M A;  2YLD A;  3F46 A;  3KH2 A;  1VLS A;  3ZTZ A;  4QI2 A;  1QPU A;  1TKN A;  2BC5 A;  4M63 A;  4YT4 A;  1TWG A;  3G50 A;  4MND A;  1ZHY A;  1T6U A;  1YZA A;  3UMK A;  5JRA A;  3C7J A;  1HY5 A;  4XTK A;  3T6G B;  3BEH A;  4EBB A;  2X0C A;  3FMS A;  1SMY F;  1U89 A;  4IAQ A;  2NUT A;  5L0D A;  1VMA A;  4XLP F;  1Z63 A;  3A11 A;  2CYD A;  3B0U X;  3LJB A;  2WVO A;  2XLD A;  2XL4 A;  3EG9 A;  2Y39 A;  3TD7 A;  3EJN A;  4LDQ A;  1WAS A;  1TQG A;  1ZZP A;  2OG2 A;  2P7V A;  1LPE A;  4B6I A;  2XM0 A;  1Z7Q c;  2R9R B;  4FES A;  1LE2 A;  2QTV A;  1OCR C;  1SYQ A;  1FAP B;  4WAB A;  2LSE A;  4KNW A;  1UG7 A;  1OXK A;  2OJE D;  2AP3 A;  3LLI A;  3B9Q A;  2KSF A;  4G78 A;  1E83 A;  1N1C A;  1Z5Z A;  1BR4 A;  1RKE A;  2B0H A;  2PBE A;  2B0J A;  3CSK A;  4MW8 A;  3RQF A;  1W2W A;  4CS9 C;  4KI2 A;  4RDA A;  4XLN F;  3JRM O;  1R4T A;  1PCX A;  2DYS C;  1V74 B;  2GAQ A;  5CIV A;  3B71 A;  4MW3 A;  1DOW A;  2ZXO A;  5JSL A;  1QQ3 A;  3DM5 A;  2Y3H A;  3W8H A;  3VAY A;  2J9W A;  5TJ5 E;  1YYJ A;  4I1O B;  1ZW2 A;  1RMV A;  5HV9 A;  1JPJ A;  3ZSU A;  2RSE B;  1R5I D;  2UUI A;  3LUT B;  1QLE C;  3MFN A;  4CS9 A;  2MWQ A;  4CS8 C;  3ZIB A;  5F28 E;  3EH1 A;  4OD5 A;  1T6I A;  5E3C A;  3SXY A;  3S0X A;  3W8I A;  2XRH A;  4P9T A;  4W8P A;  1L7C A;  4U5C E;  2EPL X;  4F4B A;  1E2X A;  5COF A;  4JJF A;  2OKU A;  3DMD A;  3EH2 A;  4U9E A;  4BG0 A;  4NTF A;  3DAF A;  1M2V B;  2J7P A;  3N2Z B;  4XQ1 A;  4G7H F;  4N6C A;  2R7V A;  3HNL A;  1CGM E;  1GS9 A;  1UFB A;  2ETS A;  4H4K C;  2IOQ A;  2YQY A;  3SXZ A;  2QY9 A;  4NTA A;  3TUL A;  4GEH A;  4K7B A;  4Z9J A;  1FFT C;  5COM A;  1M56 C;  1VTM P;  3W2V A;  4YL3 A;  4EBJ A;  3O39 A;  3QMK A;  2OOC A;  3QTH A;  4PJM A;  3MLG A;  1Z3I X;  2ZPA A;  5JUA A;  4K0D A;  3UNG C;  4YK5 A;  5KYY A;  2KK1 A;  4C3D A;  4NCQ A;  3EFO A;  4DRJ B;  4OIQ F;  2W9Y A;  4DOZ A;  2GDC A;  2H7V C;  3IEE A;  4C7O A;  2EIM C;  3T9O A;  3JYH A;  4OIN F;  2NUT B;  3T6J A;  1O5H A;  3V5X A;  1VK5 A;  2YVK A;  3L34 A;  3AG2 C;  2X51 A;  3IQ6 A;  3DWW A;  2LP4 A;  4HFF B;  5A6A A;  3EGX A;  1H9G A;  3L1M A;  2XSE A;  3LAY A;  1WN0 A;  3EG9 B;  3ITF A;  4MQ9 F;  4EHP A;  4ULW A;  3Q7L A;  1O3U A;  3M4C A;  1ST6 A;  2PF4 E;  1CPR A;  2WZL A;  3V7O A;  1D1C A;  4A2N B;  1EA8 A;  3LS0 A;  4Q4Z F;  3U2L A;  4OIP F;  5E2Q A;  3C62 A;  3GEI A;  1JR8 A;  3I5P A;  2A1D D;  1J8Y F;  1YLM A;  2FGY A;  2H8A A;  3DE9 A;  1VYK A;  4E18 A;  3M1C B;  3U5S A;  1QSP A;  2JPU A;  1Z23 A;  4J32 B;  4QDL A;  1S7Z A;  4U5H A;  5DVW A;  4D4X A;  1RKE B;  4AL1 A;  2V3C C;  1TWC A;  1MMG A;  1O87 A;  3HNI A;  3DD7 A;  3FXH A;  4EIY A;  1HW1 A;  1VYI A;  2QUP A;  2GFH A;  3S84 A;  5A6B D;  4DVY P;  4WGZ A;  4ANJ A;  1BDJ B;  3PCV A;  3U3B A;  3JRT A;  2VC9 A;  3G4Z A;  3OWT A;  4RBN A;  3HTK C;  4GYT A;  4OD4 A;  1TFK B;  4I3M A;  4N6H A;  2NSF A;  3AQB A;  4I1M A;  4JEA A;  1ORS C;  1QKR A;  2W45 A;  4AL0 A;  5BUO A;  3G4X A;  3MYI A;  2IYL D;  1YZC A;  4I44 A;  3T4R A;  3WAQ A;  4XPX A;  3NMI A;  4A4A A;  1NU7 D;  4JVS A;  2I8B A;  4OIR F;  1T6Q A;  4KC9 A;  1RJ9 B;  2Q4F A;  2VAS A;  3NYM A;  3FDQ A;  2WVQ A;  2YL7 A;  3RH3 A;  3LEV A;  4JEB A;  1ZYR F;  4JTD B;  2WVN A;  1K05 A;  4NTB A;  2R03 A;  5A6K A;  4N06 A;  4C3E A;  3SZR A;  4LLE A;  2PP4 A;  1WAT A;  3RIP A;  1APC A;  2J9B A;  1OW7 A;  3PDM P;  2VH3 A;  1U6H A;  4BJ5 C;  3DXJ F;  3ZC4 A;  4DRH B;  3AG4 C;  2R02 A;  3MBG A;  2V26 A;  2NUP A;  3K1I A;  4O79 A;  2C04 A;  256B A;  2QNL A;  5CI8 A;  2L6F A;  2G62 A;  1JMW A;  2KNH A;  1ZHT A;  5K0I A;  1Z6A A;  2KJG A;  3LS1 A;  5KYY B;  2OCC C;  2AU5 A;  4U9D A;  1C02 A;  4L6R A;  3EFO B;  5AC5 A;  3ABL C;  3O55 A;  4PK4 A;  4BJ5 A;  3POV A;  3KPH A;  4C7O B;  1VB5 A;  1PD1 A;  4PFO A;  4LDK A;  5T1D B;  5T3W A;  4CS7 A;  4UDV A;  2Q9A A;  3DE8 A;  1EKY A;  3EQL F;  1EI7 A;  1QZX A;  2IXM A;  1NBB A;  3AGU A;  3DAG A;  3GM3 A;  2J0W A;  4FX5 A;  1OR2 A;  4DVZ A;  3EGX B;  2R7S A;  3C8G A;  4EUK B;  3RF3 A;  1BZ4 A;  1YJG A;  4U5D E;  4DBQ A;  2XLM A;  1JPN A;  1PV3 A;  2YWA A;  2L6H A;  4XEV A;  4ER9 A;  2HUJ A;  3L8J A;  2P1A A;  5JLI A;  2DB4 A;  2CNW A;  1L3P A;  1NU9 C;  5AC4 A;  4YT8 A;  1S05 A;  2J9U A;  3EGD A;  3IQC A;  4BJT A;  1H7I A;  1LKX A;  4EKW A;  1HMD A;  4JW1 A;  2A68 F;  1FNT c;  2XLH A;  5DQZ A;  4K1O A;  3M4B A;  3NMJ A;  4FWV A;  5L0F A;  3M79 A;  1MNE A;  3ZQV A;  1OKK A;  5EGY A;  5CI9 A;  5DS5 A;  1OCC C;  3AJM A;  1SR2 A;  1G5Z A;  1KU2 A;  2WZF A;  2GA0 A;  2VCA A;  3AG1 C;  4IAO A;  5KYU A;  5T3T A;  2P6V A;  3A9C A;  4MVQ A;  1JRA A;  1OXB A;  3AG3 C;  5F5F A;  3JSZ A;  3RQE A;  1OR3 A;  3AQC A;  3ZTM A;  1VOM A;  2Z15 A;  3LEO A;  3NMK A;  1J8M F;  2JX0 A;  1LE4 A;  3E70 C;  2R7R A;  2ZXP A;  2C03 A;  2PFD A;  4CX9 A;  2NPU A;  4AE4 B;  1NFN A;  3BRJ A;  4MVR A;  1V4A A;  5L3V A;  5COG A;  1YDI A;  1XZP A;  2YHS A;  1B68 A;  1RKC A;  4JZA A;  3R7C A;  1ZHX A;  5A69 A;  1YYX A;  1V55 C;  1C17 M;  1MQV A;  1D0X A;  2OU6 A;  2XM4 A;  3ABM C;  3V5Z A;  2ZXW C;  2W4B A;  1WOL A;  2ASR A;  2KQ9 A;  1MND A;  3ATP A;  3DZA A;  4JJG A;  2HV7 A;  4PFP A;  2XL8 A;  5B1A C;  1YA9 A;  2PX0 A;  1HMO A;  2EPO A;  4XWJ A;  5E3A A;  3DJN B;  3FAJ A;  5B3I A;  2R7T A;  1VLT A;  2KGO A;  3DI5 A;  3DJU B;  3S27 A;  3SXM A;  4CBE A;  5A6J A;  1D0Z A;  2NUP B;  2WZG A;  5B1B C;  1Q0G A;  3ZVR A;  1OW6 A;  2R05 A;  2P61 A;  3DM9 B;  3S28 A;  3JZ0 A;  3NG1 A;  5EK0 A;  1QVX A;  2VCB A;  2E87 A;  3GEE A;  3OA1 A;  4N4W A;  1H6G A;  4BJ6 C;  3FVY A;  5KYW A;  5BQH A;  1FR0 A;  3U8P A;  3S9O A;  2IXO A;  4Z9H A;  1TWH A;  2YLG A;  4MTG A;  4O6N A;  3WHN A;  2EPM X;  2A0U A;  1ZW3 A;  2IM8 A;  2R7O A;  3AOU A;  1NSG B;  3RKO F;  2NG1 A;  2LK4 A;  3C8G B;  4BJ6 A;  3HJC A;  3AGT A;  2R25 A;  3WG7 C;  4CJG A;  2G3K A;  3ZQY A;  3U2M A;  3F47 A;  3I4U A;  4H54 A;  4KNV A;  2XLO A;  1FTS A;  1G4W R;  2XL6 A;  1BBH A;  4NQF A;  1NFO A;  4PJN A;  1Y4C A;  5L0H A;  1A7D A;  2WL8 A;  4XEF A;  3UR3 C;  1Y6D A;  3V5Y A;  3MX3 A;  5D91 A;  2R7X A;  3B29 A;  2D4U A;  4LAC B;  3JSE O;  5BQG A;  1I5N A;  2Q7R A;  2YL0 A;  5DS4 A;  4G7O F;  2HFI A;  2PNO A;  2EIJ C;  1OCO C;  1WGW A;  2YRF A;  1GM5 A;  3RFY A;  3O6X A;  2OJQ A;  3GAN A;  1ZU5 A;  3JTL O;  2ZD9 A;  2KYH A;  5GPG B;  4ZLD A;  4U5G A;  1LI5 A;  3X2Q C;  1OQC A;  2H7O A;  2MYS A;  3H2V A;  5BQI A;  1OKK D;  1YVI A;  3GM1 A;  1LIH A;  4JKV A;  1V54 C;  4LLC A;  4KBL A;  4LER A;  1AUE A;  1MMA A;  2CDQ A;  4IJJ A;  3JT1 A;  4IGG A;  4W8K A;  3FHD A;  4J30 B;  1D0Y A;  3K1I C;  3KKB A;  4XEK A;  3WOD F;  2HKV A;  5FZT A;  2BE5 F;  2UUH A;  2YLI A;  5F5H A;  1LVK A;  2L7A A;  3CAX A;  4WGY A;  3NYJ A;  4U5F E;  2GWW A;  4LDR A;  2H7B A;  2P0N A;  2LFD A;  1A41 A;  3W4Y A;  5DS6 A;  2J7P D;  4JCH A;  4WJ0 A;  1T01 A;  2M4E A;  3IPM O;  3SEO A;  3U8V A;  4E0H A;  4G7Z F;  4AX2 A;  2YL1 A;  4C3B A;  5FCL A;  3M15 A;  3LNR A;  5JVE A;  1HW2 A;  1G8X A;  1D1B A;  4Z9I A;  1ZU4 A;  2EPK X;  2A6E F;  2CGE A;  2Y3B A;  3EZI A;  1M2V A;  2LFF A;  3LES A;  1TR2 A;  3J06 A;  1T9K A;  3NKD A;  3VRC A;  3VF0 A;  4MVM A;  5KYW B;  4J7Y A;  3FAP B;  2R7Q A;  2G3V A;  2WB7 A;  3ECS A;  3HKK A;  2XLV A;  4JC7 A;  4PJL A;  4HE8 D;  3PHF 2;  4MVU A;  1RXQ A;  3ZDL A;  1OW8 A;  1ORJ A;  4MTF A;  3QVZ A;  2DI3 A;  3UMH A;  2ZXR A;  1PD0 A;  4IAR A;  2J46 A;  2XS8 A;  3U3F A;  4BPM A;  1NZE A;  3GM2 A;  3IHU A;  4YJW A;  4EBK A;  2IBF A;  2YL3 A;  1WWP A;  4G0H A;  1K40 A;  3QVY A;  2XS1 A;  2D5R B;  1LS1 A;  2IXN A;  2L6G A;  2RD9 A;  3CEX A;  3N0T A;  4XPY A;  2HJ3 A;  5E33 A;  4HFK B;  1T5O A;  1MMD A;  2J0X A;  1NLX A;  4YN0 B;  3T6B A;  3K1H A;  4YL1 A;  3TOL A;  5L0I A;  2EIN C;  1K04 A;  3I5Q A;  4IRU A;  2NSG A;  2A0B A;  2DYR C;  4RD9 A;  4AK9 A;  4PAC A;  4E7S A;  5KYX A;  4CSA C;  3KYI A;  2MHR A;  2ICW G;  4XPW A;  1D1A A;  3U9M A;  1E85 A;  3EZH A;  1BR2 A;  2LCH A;  3K7D A;  3LLK A;  4MTO A;  4MVZ A;  4BJ1 A;  3H65 A;  4E7Z A;  3DKA A;  3QW0 A;  1JOG A;  2CW0 F;  3R2P A;  4GQH A;  4MVO A;  2J9V A;  4CDA A;  1Q0K A;  2HSQ A;  4PR9 A;  1ZHW A;  3FOP A;  3NKE A;  2LIG A;  3JCU Q;  5A6B A;  5L0G A;  1IW7 F;  4NC3 A;  5JP7 A;  4CSA A;  1LI7 A;  3U0C A;  1CPQ A;  2HV6 A;  3S90 A;  2YKZ A;  3UGO A;  3SP1 A;  4IWB A;  4E0I A;  2HZ8 A;  3FOO A;  1A7V A;  2A69 F;  2EIL C;  3GWN A;  1Q0D A;  1FMV A;  1SF8 A;  3CZ6 A;  1U0B B;  3K33 A;  1BR1 A;  4YL0 A;  3O10 A;  4CJO A;  3RQG A;  3LNM B;  3GEH A;  3NYL A;  4BEJ A;  3VM6 A;  4JTC B;  4E17 A;  3S29 A;  4MS2 A;  5B3S C;  2EPN A;  2R7W A;  3Q7G A;  4P6I C;  2XLW A;  5AGF A;  2FFH A;  3MYF A;  2Q00 A;  4X0R A;  3L8I A;  3C63 A;  4JE9 A;  2FAP B;  5JT4 A;  5KYN A;  1RJ9 A;  4OIO F;  3VYW A;  4CDY A;  2Q3T A;  1LS4 A;  4CS8 A;  5L3Q A;  2OEV A;  1AVO B;  4JUR I;  1KTM A;  1KNY A;  1SZI A;  1OCZ C;  4DRI B;  1EQ1 A;  4YT5 A;  2XXA A;  3TJ5 A;  4DJ9 A;  2IXP A;  4MVS A;  1E84 A;  1GGQ A;  2QLA A;  3JYY A;  3OEO A;  1CGN A;  3IQT A;  1FFH A;  3RVY A;  2I15 A;  2PX3 A;  1HE9 A;  1H9T A;  2F22 A;  4R32 A;  1CGO A;  4U5E E;  4IB4 A;  3X1O A;  4ZLC A;  1ORY A;  1YAU O;  3CQZ A;  3UMI A;  3C8Z A;  3ASO C;  2M64 A;  3C8G D;  4DXW A;  2Q9B A;  1WTY A;  3EGD B;  2Q9C A;  3EHN A;  4YWQ A;  2HMQ A;  1YAR O;  1M57 C;  5DQT A;  2AWC A;  2L81 A;  4ONS A;  2W4M A;  4JRZ A;  2A6H F;  1G4U S;  2BL2 A;  1NG1 A;  4CIH A;  2CNW D;  2LD6 A;  2DGJ A;  3ZG1 A;  3UGP A;  1A7E A;  2LQG A;  3GOR A;  4J7T A;  2L9J A;  4JCZ A;  4ULV A;  5HSW A;  3TK0 A;  4JTA B;  1ZHZ A;  2Y3D A;  3IQ5 A;  3GOD A;  1MMN A;  4YT2 A;  2JD3 A;  1I4Z A;  4D4N A;  5KYX B;  2VCC A;  1DOV A;  1Q0F A;  2OEX A;  3RYL A;  4P9F A;  5EHH A;  5KYU B;  3E9V A;  4U5B E;  2AWY A;  2KW3 C;  2XLE A;  2O9X A;  2AVK A;  4O6M A;  3K66 A;  1F1M A;  2Y3G A;  1A0B A;  1M6T A;  2EIK C;  2J45 A;  3QW1 A;  1Q0M A;  1YA7 O;  3KYJ A;  4HEA J;  3TJ6 A;  4BEM J;  3Q6N A;  3KL4 A;  3GWL A;  3SXK A;  2CCY A;  1GQA A;  2HS5 A;  3K6B A;  4O6Y A;  2R7U A;  1JAF A;  2J8W A;  4EWC A;  1C03 A;  4NY3 A;  4DBR A;  5D92 A;  2YZS A;  4PJJ A;  3HNK A;  3L0I A;  3TOM A;  1M2O A;  5L0C A;  2KC3 A;  3H2U A;  4O7G A;  1RCP A;  3HLZ A;  3QZC A;  4QI0 A;  5DLJ A;  1ZVZ A;  2HMZ A;  3NDB B; 
#chains in the Genus database with same CATH homology
 5K0I A;  4AL0 A;  4NTA A;  5BQI A;  4YL0 A;  4YL1 A;  4YL3 A;  2H8A A;  5HV9 A;  2UUI A;  4J7Y A;  4JC7 A;  3HKK A;  4YK5 A;  2UUH A;  4NTB A;  4AL1 A;  3B29 A;  3LEO A;  4WAB A;  4JRZ A;  5BQG A;  2Q7R A;  4NTF A;  2PNO A;  5BQH A;  4J7T A;  4BPM A;  3PCV A;  4JCZ A;  3DWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...