3PCVA

Crystal structure analysis of human leukotriene c4 synthase at 1.9 angstrom resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
146
structure length
146
Chain Sequence
MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The catalytic architecture of leukotriene C4 synthase with two arginine residues
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
total genus 61
structure length 146
sequence length 146
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 3pcvA00
5K0IA 4YK5A 5BQHA 5HV9A 4YL1A 4WABA 4YL3A 2Q7RA 4JRZA 3HKKA 4BPMA 5BQIA 2UUHA 5BQGA 3B29A 4AL1A 4YL0A 4JC7A 3LEOA 2UUIA 4J7TA 3DWWA 2H8AA 4NTAA 4NTFA 4AL0A 4J7YA 4JCZA 2PNOA 4NTBA 3PCVA
chains in the Genus database with same CATH superfamily
3FHDA 1TR2A 3ZG1A 2YL0A 3U0CA 3H2UA 3HNIA 4NY3A 2HMQA 4CIPA 2YL7A 5A6BD 5HV9A 2Q7RA 2CGEA 1YAUO 2BC5A 3IEEA 5L0IA 4LDRA 3S28A 3UNGC 4MTFA 3L34A 3TOMA 2H7BA 2G62A 2J7PD 4RDAA 3T6JA 4PFPA 2B0JA 2W9YA 3VF0A 5BQIA 1E83A 4DVYP 1WGWA 3LS0A 3C8GD 3M4BA 2HMZA 3O10A 4LACB 1Q0FA 2A0BA 2W4BA 2Z15A 3AG3C 3JYYA 3QVYA 4PFOA 2J9WA 3EHNA 3X1OA 2A6EF 3AQBA 3CAXA 4J7YA 3TULA 3JRTA 1MNEA 4C7OB 4W8KA 3N0TA 4XLNF 3BRJA 2R05A 4EUKB 2XXAB 2R7RA 2WL8A 2I15A 2XLVA 3L8IA 4HFKB 4EIYA 4CS8A 4YJWA 3DAFA 3IPMO 3OA1A 4O6NA 3TJ5A 1O3UA 2CNWA 5KYUB 1XWJA 1J8MF 4I1OB 4Q4ZF 3DE9A 2P0NA 1RKEA 3E70C 3MFNA 1I4YA 1ZHYA 2XSEA 2UUHA 4FX5A 1LKXA 1LVKA 2ZD9A 3EQLF 2WVNA 2R7UA 3V5YA 1YA9A 2XL8A 4I44A 1AVOB 4AE4B 3RKOF 3NYMA 2OEVA 3HJCA 4CS9C 4EBBA 2TMVP 3TJ6A 1A7DA 1Y6DA 3QMKA 4NTFA 4E0HA 3AGTA 3H65A 1NFOA 3C8GB 1OR2A 4A4AA 2EIMC 2HFIA 2FAPB 2YL1A 1OKKA 4JE9A 1D0YA 1S7ZA 3HNJA 4NTBA 3S27A 1HY5A 4C7OA 3SXZA 3W4YA 5L0JA 3FAJA 1WATA 3B0PA 2Y3DA 1BR1A 3WHNA 1E85A 3ABMC 3RQGA 2AWCA 1D1BA 2XS8A 1JOGA 2VC9A 2YKZA 1TKNA 3M4CA 4BJTA 1T01A 3LNMB 3O55A 4CBEA 1Z5ZA 3OWTA 4EWCA 4JJFA 3NYJA 4MVSA 4M63A 1OCRC 3TD7A 3AG2C 3HNLA 1ZU4A 3EGXB 3NMKA 4ULWA 5KYWA 5B1AC 1T6IA 4OIPF 1TQGA 1VOMA 3G4XA 4JTAB 4DBQA 3EGDB 2UUIA 3GWLA 3TOLA 3EPVA 1L3PA 4O6MA 3QW1A 4CJGA 4BEJA 4NTAA 2IXPA 2I8BA 1R4TA 2J9BA 3B71A 3RYLA 4YT4A 1O5HA 1OW6A 5JS5A 1BR4A 2MHRA 3H2VA 3JT1A 1YARO 3GODA 5GPGB 2KJGA 1APCA 1MMDA 3PCVA 3QW0A 5L3QA 4GQHA 2EIKC 2OEXA 2QE9A 2R9RB 4MNDA 2GWWA 3X2QC 4EBKA 1FNTc 3LNRA 3NMJA 2EIJC 4LDQA 3VAYA 4OIQF 1YYXA 2XL4A 5JRAA 3FAPB 4A2NB 1VB5A 2W45A 1CPRA 4U5FE 5BQGA 2YZSA 2L81A 1TFOB 4KBLA 5COGA 2X51A 1F1MA 2C04A 3LEOA 4O7GA 4NQFA 4EKWA 4E7ZA 5L0FA 1FMVA 1YZCA 1ZHTA 1JPNA 1E84A 2R7VA 2FGYA 1FMWA 1NLXA 3GM1A 3K1IC 2NUPA 3SP1A 2CDQA 3EH1A 5KYUA 3GM3A 2CNWD 2DYRC 2PNOA 3EFOB 2AWYA 5AC5A 1CGME 3JTLO 2OG2A 3AQCA 2XLOA 3IQ5A 1OQCA 3U3BA 2IM8A 1LE4A 3CQZA 3UGPA 2WB7A 3HTKC 3POVA 1HE9A 2ZXPA 5AC4A 3IHUA 1NZEA 4C3DA 4YL1A 3ZC4A 2HZ8A 2KSFA 2GFHA 5T1DB 1HE1A 3DAGA 1G5ZA 5KYNA 4XPXA 1HMDA 2A1DD 2QNLA 3MBGA 5DQTA 4RBNA 1N1CA 1K04A 5BUOA 5KYYB 2LFFA 3QVZA 5EGYA 4JC7A 1WOLA 4WGYA 3BEHA 5D91A 1YJGA 2YLIA 4NCQA 1G8XA 2NPUA 3ABLC 4DRHB 1BR2A 2YVKA 1M2VB 2OKUA 4LDKA 4RD9A 3ZIBA 1YA7O 3S0XA 4IAOA 1ZU5A 3NKEA 1Z7Qc 4CDAA 1I5NA 5COMA 4FESA 2Q4FA 1GQAA 3Q6MA 2OOCA 2ZXRA 3EGDA 4JW1A 4MVZA 3V5ZA 4BJ5C 2P61A 2XLDA 3RW0A 5A6AA 5DQZA 2NUPB 1FTSA 1RJ9B 3SXKA 2EINC 4DBRA 3PHF2 3J06A 1M56C 4OD4A 1M2OA 3ECSA 3EJNA 2Q9BA 3C7JA 3M15A 4G78A 1D1CA 3FOOA 3JSZA 2ZXWC 3F46A 2DGJA 2QY9A 3PMRA 1TFKB 3FXHA 1YLMA 1OCZC 2XLHA 3A11A 2XRHA 5A69A 3M1CB 1QZXA 2F22A 2NUTA 1C03A 1RKEB 4MVOA 2D5RB 3DMDA 2IXOA 2L6HA 3F47A 1NU9C 4HEAJ 1MMGA 2RSEB 5F28E 2L9JA 1WWPA 2MYSA 4XQ1A 4BJ6A 1LPEA 3NDBB 2R7SA 4U5CE 4E18A 1O87A 1ORSC 4K0DA 4JVSA 3U3FA 3GEHA 3KKBA 4AL0A 2HKVA 3K6BA 3SZRA 5L0DA 1OXBA 2NSFA 3FOPA 5JP7A 4GEHA 4Q7CA 1ZHXA 2LFDA 3AGUA 4G0HA 4KC9A 1K40A 3EH2A 4IJJA 5T3WA 5HSWA 1JAFA 4CJOA 1YDIA 3G50A 1U89A 3JSEO 1FFHA 5L3VA 1E86A 4L6RA 3JYHA 1FFTC 4BJ5A 1DOVA 3NRHA 2BL2A 3LUTB 3Q7GA 1LS4A 3EGXA 2D4UA 1YVIA 2R02A 3HKKA 3KH2A 1MQVA 1QQ3A 4DJ9A 1YZAA 1PD0A 4AL1A 2OU6A 3B29A 1R5ID 3US6A 1YYJA 2ZXOA 2EILC 2PP4A 4YT5A 1PCXA 4CX9A 2M4EA 2YLDA 2G3VA 3O6XA 5KYXA 4K7BA 2IOQA 1QVXA 3CEXA 2H8AA 1D0ZA 3GEEA 3K1HA 4CDYA 2EPOA 2FFHA 1QPUA 3VRCA 4KNWA 3DD7A 3K33A 1K05A 1JMWA 3VM6A 3GEIA 4NC3A 2ZPAA 5DS5A 2XM4A 4I3MA 5FCLA 5JUAA 3FDQA 1G4WR 3DE8A 4JCHA 1A7EA 4JRZA 1ST6A 2KQ9A 3C63A 2LP4A 3ABKC 3WG7C 2V26A 4BPMA 2XS1A 5L0CA 1VMAA 3DJNB 1V55C 4JTDB 3ZTZA 5COFA 3S9OA 3W2WA 1AEPA 3U5SA 3DXJF 2B0HA 2J0WA 2CYDA 3IQCA 3UMIA 3G4ZA 3PDMP 1RJ9A 2WZLA 1ZHZA 2CCYA 2H7VC 3GM2A 3U2LA 1KTMA 2OQMA 4GYTA 3A9CA 1C02A 1JR8A 5E3CA 5DVWA 2KYHA 1UFBA 2L7AA 3U9MA 4QI0A 5CI8A 4OIOF 3LAYA 4ZLCA 3C8GA 2IXMA 2J46A 4JTCB 2PX3A 1CGNA 2P1AA 3WODF 1XZPA 5AGFA 3UMKA 3RH3A 3B0VC 5KYYA 2Q9CA 2J8WA 3KPHA 4FWVA 1D0XA 2VCBA 3CZ6A 3ASNC 3T9OA 3GORA 3DKAA 5A6BA 3JRMO 3EZIA 2XL6A 4N4WA 2C03A 4D4NA 4DVZA 3V7OA 2ASRA 4J7TA 4R32A 4W8PA 5A6JA 4C3BA 1ZVZA 1VK5A 2J9VA 2XLMA 4DRJB 2LQGA 2OCCC 2WVOA 1SF8A 3AG1C 2JX0A 5E33A 5T3TA 5F5HA 4FAPB 1UG7A 1H9TA 4G7HF 3SYNA 1LE2A 3S29A 4WJ0A 3W8IA 4JEBA 4U9EA 1QKRA 2JD3A 2WZFA 4JZAA 4Z9HA 4U9DA 3RF3A 4DOZA 4IARA 4IAQA 3RFYA 5DS6A 3W2VA 4E7SA 3S90A 4MTGA 3N2ZB 1U6HA 4MW8A 1T6QA 2NUTB 3TQOA 2R7OA 5JSLA 1SZIA 1KU2A 2OJQA 3K66A 3ATPA 1T5OA 3MYFA 4OD5A 1PV3A 2KNHA 1A0BA 2BE5F 1VLTA 2GAQA 3CSKA 3IQTA 3SEOA 5B3IA 3LEVA 2PBEA 4MTOA 3U8PA 3ZSUA 4PJNA 1VTMP 2HV7A 4U5HA 1A41A 4MVMA 4D4XA 2VASA 2YEVA 4PJLA 4DRIB 3LS1A 3N24A 1D1AA 5L0HA 4XLPF 1EQ1A 2RD9A 2VB6A 3EG9A 2VH3A 1Z23A 2QLAA 1V4AA 3IQ6A 4EHPA 2R03A 1EKYA 3RQEA 2YL3A 3B0UX 4U5BE 4ANJA 3FMSA 3B9QA 1SYQA 3DI5A 3U2MA 1DOWA 3EFOA 3W8HA 2G3KA 5JT4A 1GM5A 2WVQA 4U5DE 2WZGA 4QI2A 1CPQA 4YT2A 3GANA 3ZQVA 4JURI 5JVEA 3MYIA 1TWCA 2YHSA 5L0GA 1VLSA 1VYIA 4PJJA 4BG0A 2W4MA 1IW7F 4CS7A 4E17A 3E9VA 1HW1A 1ZZPA 4PACA 4MVQA 3R7CA 3RIPA 4ER9A 1NSGB 2IBFA 1TWHA 3LJBA 2ETSA 4XEKA 4Q5SF 1BDJB 4K1OA 1EA8A 2NSGA 1SMYF 3ZTMA 3SXYA 4P6IC 4G7OF 4J30B 1OW7A 1QLEC 3AG4C 4MVUA 3SXMA 3NMIA 4IWBA 4F4BA 1KNYA 3UGOA 1ZYRF 1Q0KA 1ZHWA 3EZHA 4O79A 4AK9A 3V5XA 1NBBA 3TK0A 1LI7A 1A7VA 2KGOA 2Y39A 1Y4CA 2LCHA 4U5GA 3HNKA 4CDVA 3C62A 3ASOC 4QDLA 4BJ1A 3QZCA 4MQ9F 4E0IA 3T4RA 256BA 1Q0DA 1LI5A 1Q0MA 2A69F 4X0RA 2A68F 4C3EA 2VCCA 2HV6A 3O39A 1RXQA 2YWAA 3LLIA 1LIHA 3ZDLA 1RCPA 1V54C 3L8JA 4IGGA 1G4US 4IRUA 3DWWA 1FR0A 3NKDA 5DS4A 1QSPA 1I4ZA 1L7CA 3OEOA 1TWGA 2XM0A 3DJUB 3HLZA 1FAPB 4PK4A 2XLWA 4XWJA 3I4UA 4BJ6C 4HFFB 2Y3BA 2XLEA 2KW3C 2HUJA 4P9FA 2DB4A 2ICWG 3DM9B 5K0IA 1OCCC 3C8ZA 4U5EE 1ZW2A 2R7TA 3UMHA 2V3CC 4AE4A 4WGZA 3ZQYA 1OKKD 2P7VA 1Z6AA 4YN0B 4AX2A 3T6GB 2LSEA 2LIGA 4JEAA 1RKCA 2AP3A 2IXNA 1OCOC 2LD6A 4YL0A 1XZQA 4JIOA 5E3AA 3R2PA 3NG1A 2M64A 3I5PA 1B68A 5KYWB 1WASA 4CSAA 1WTYA 2R7WA 3C18A 1S05A 1NU7D 4B6IA 2LK4A 4CS9A 4JJGA 3K7DA 1Q0GA 4N6HA 3S84A 2J45A 4P9TA 2KC3A 1HW2A 3KMIA 4BEMJ 3I5QA 5B1BC 5JLIA 1OR3A 2CW0F 4YK5A 2A0UA 5TJ5E 2KK1A 3JZ0A 1TWAA 2A6HF 4O6YA 3MX3A 1NFNA 3ZVRA 5DLJA 1LS1A 1Z63A 4CS8C 3KYJA 1JPJA 1M57C 2IYLD 3M79A 1H7IA 3EHMA 4PJMA 2EPKX 3FVYA 2Q3TA 2PX0A 4MVRA 4OINF 3L0IA 2P6VA 1SR2A 1LM3B 3EG9B 4MS2A 4XTKA 4CIHA 1H6GA 2O9XA 4CSAC 1ORYA 2H7OA 2YQYA 4XPYA 3ITFA 3MLGA 1AUEA 1IZMA 2VCAA 3DZAA 3U8VA 1GS9A 1J8YF 1NG1A 1WN0A 2YLGA 3QTHA 3LESA 2R7QA 1U0BB 3Q7LA 2GDCA 5BQHA 2J7PA 4WABA 2MWQA 4YL3A 4JKVA 1EI7A 3KL4A 3RQFA 1ORJA 2Q00A 2AVKA 2EPMX 4YT8A 1H9GA 2PF4E 4LLCA 2L6GA 3AJMA 1M6TA 4XPWA 4Z9IA 4ULVA 5IY5C 2YRFA 2QTVA 3AOUA 1MMAA 1OW8A 2GA0A 1PD1A 2Y3GA 5CIVA 5EK0A 1OXKA 2DI3A 2L6FA 4LERA 3JCUQ 4PR9A 2X0CA 3L1MA 4UDVA 2HS5A 2EPNA 4LLEA 4G7ZF 2OJED 5A6KA 5KYXB 4IB4A 2DYSC 2Y69C 1JRAA 3DM5A 3LLKA 4H54A 1T6UA 4HE8D 2HSQA 5D92A 2HJ3A 1BZ4A 4MW3A 4N06A 1ZW3A 2J9UA 4H4KC 4J32B 3RVYA 4KNVA 1HMOA 1MNDA 1CGOA 3T6BA 3VYWA 3NYLA 2QUPA 1C17M 1M2VA 4Z9JA 2EPLX 2PFDA 2Q9AA 3Q6NA 4I1MA 4N6CA 2HJMA 3U9JA 5EHHA 3K1IA 2Y3HA 4EBJA 4YWQA 4KI2A 5E2QA 1RMVA 3GWNA 4XEFA 5FZTA 2AU5A 1V74B 3KYIA 3SNHA 1T9KA 4OIRF 1W2WA 1VYKA 3RVZA 3ZWIA 5B3SC 2R7XA 1MMNA 2XXAA 2NG1A 4DXWA 5CI9A 3WAQA 1BBHA 4JCZA 2HSBA 3UR3C 4ZLDA 1Z3IX 1E2XA 2JPUA 5F5FA 2J0XA 2E87A 4XEVA 4ONSA 2R25A 1GGQA
chains in the Genus database with same CATH topology
5K0IA 4YK5A 5BQHA 5HV9A 4YL1A 4WABA 4YL3A 2Q7RA 4JRZA 3HKKA 4BPMA 5BQIA 2UUHA 5BQGA 3B29A 4AL1A 4YL0A 4JC7A 3LEOA 2UUIA 4J7TA 3DWWA 2H8AA 4NTAA 4NTFA 4AL0A 4J7YA 4JCZA 2PNOA 4NTBA 3PCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K0I A;  4YK5 A;  5BQH A;  5HV9 A;  4YL1 A;  4WAB A;  4YL3 A;  2Q7R A;  4JRZ A;  3HKK A;  4BPM A;  5BQI A;  2UUH A;  5BQG A;  3B29 A;  4AL1 A;  4YL0 A;  4JC7 A;  3LEO A;  2UUI A;  4J7T A;  3DWW A;  2H8A A;  4NTA A;  4NTF A;  4AL0 A;  4J7Y A;  4JCZ A;  2PNO A;  4NTB A;  3PCV A; 
#chains in the Genus database with same CATH topology
 3FHD A;  1TR2 A;  3ZG1 A;  2YL0 A;  3U0C A;  3H2U A;  3HNI A;  4NY3 A;  2HMQ A;  4CIP A;  2YL7 A;  5A6B D;  5HV9 A;  2Q7R A;  2CGE A;  1YAU O;  2BC5 A;  3IEE A;  5L0I A;  4LDR A;  3S28 A;  3UNG C;  4MTF A;  3L34 A;  3TOM A;  2H7B A;  2G62 A;  2J7P D;  4RDA A;  3T6J A;  4PFP A;  2B0J A;  2W9Y A;  3VF0 A;  5BQI A;  1E83 A;  4DVY P;  1WGW A;  3LS0 A;  3C8G D;  3M4B A;  2HMZ A;  3O10 A;  4LAC B;  1Q0F A;  2A0B A;  2W4B A;  2Z15 A;  3AG3 C;  3JYY A;  3QVY A;  4PFO A;  2J9W A;  3EHN A;  3X1O A;  2A6E F;  3AQB A;  3CAX A;  4J7Y A;  3TUL A;  3JRT A;  1MNE A;  4C7O B;  4W8K A;  3N0T A;  4XLN F;  3BRJ A;  2R05 A;  4EUK B;  2XXA B;  2R7R A;  2WL8 A;  2I15 A;  2XLV A;  3L8I A;  4HFK B;  4EIY A;  4CS8 A;  4YJW A;  3DAF A;  3IPM O;  3OA1 A;  4O6N A;  3TJ5 A;  1O3U A;  2CNW A;  5KYU B;  1XWJ A;  1J8M F;  4I1O B;  4Q4Z F;  3DE9 A;  2P0N A;  1RKE A;  3E70 C;  3MFN A;  1I4Y A;  1ZHY A;  2XSE A;  2UUH A;  4FX5 A;  1LKX A;  1LVK A;  2ZD9 A;  3EQL F;  2WVN A;  2R7U A;  3V5Y A;  1YA9 A;  2XL8 A;  4I44 A;  1AVO B;  4AE4 B;  3RKO F;  3NYM A;  2OEV A;  3HJC A;  4CS9 C;  4EBB A;  2TMV P;  3TJ6 A;  1A7D A;  1Y6D A;  3QMK A;  4NTF A;  4E0H A;  3AGT A;  3H65 A;  1NFO A;  3C8G B;  1OR2 A;  4A4A A;  2EIM C;  2HFI A;  2FAP B;  2YL1 A;  1OKK A;  4JE9 A;  1D0Y A;  1S7Z A;  3HNJ A;  4NTB A;  3S27 A;  1HY5 A;  4C7O A;  3SXZ A;  3W4Y A;  5L0J A;  3FAJ A;  1WAT A;  3B0P A;  2Y3D A;  1BR1 A;  3WHN A;  1E85 A;  3ABM C;  3RQG A;  2AWC A;  1D1B A;  2XS8 A;  1JOG A;  2VC9 A;  2YKZ A;  1TKN A;  3M4C A;  4BJT A;  1T01 A;  3LNM B;  3O55 A;  4CBE A;  1Z5Z A;  3OWT A;  4EWC A;  4JJF A;  3NYJ A;  4MVS A;  4M63 A;  1OCR C;  3TD7 A;  3AG2 C;  3HNL A;  1ZU4 A;  3EGX B;  3NMK A;  4ULW A;  5KYW A;  5B1A C;  1T6I A;  4OIP F;  1TQG A;  1VOM A;  3G4X A;  4JTA B;  4DBQ A;  3EGD B;  2UUI A;  3GWL A;  3TOL A;  3EPV A;  1L3P A;  4O6M A;  3QW1 A;  4CJG A;  4BEJ A;  4NTA A;  2IXP A;  2I8B A;  1R4T A;  2J9B A;  3B71 A;  3RYL A;  4YT4 A;  1O5H A;  1OW6 A;  5JS5 A;  1BR4 A;  2MHR A;  3H2V A;  3JT1 A;  1YAR O;  3GOD A;  5GPG B;  2KJG A;  1APC A;  1MMD A;  3PCV A;  3QW0 A;  5L3Q A;  4GQH A;  2EIK C;  2OEX A;  2QE9 A;  2R9R B;  4MND A;  2GWW A;  3X2Q C;  4EBK A;  1FNT c;  3LNR A;  3NMJ A;  2EIJ C;  4LDQ A;  3VAY A;  4OIQ F;  1YYX A;  2XL4 A;  5JRA A;  3FAP B;  4A2N B;  1VB5 A;  2W45 A;  1CPR A;  4U5F E;  5BQG A;  2YZS A;  2L81 A;  1TFO B;  4KBL A;  5COG A;  2X51 A;  1F1M A;  2C04 A;  3LEO A;  4O7G A;  4NQF A;  4EKW A;  4E7Z A;  5L0F A;  1FMV A;  1YZC A;  1ZHT A;  1JPN A;  1E84 A;  2R7V A;  2FGY A;  1FMW A;  1NLX A;  3GM1 A;  3K1I C;  2NUP A;  3SP1 A;  2CDQ A;  3EH1 A;  5KYU A;  3GM3 A;  2CNW D;  2DYR C;  2PNO A;  3EFO B;  2AWY A;  5AC5 A;  1CGM E;  3JTL O;  2OG2 A;  3AQC A;  2XLO A;  3IQ5 A;  1OQC A;  3U3B A;  2IM8 A;  1LE4 A;  3CQZ A;  3UGP A;  2WB7 A;  3HTK C;  3POV A;  1HE9 A;  2ZXP A;  5AC4 A;  3IHU A;  1NZE A;  4C3D A;  4YL1 A;  3ZC4 A;  2HZ8 A;  2KSF A;  2GFH A;  5T1D B;  1HE1 A;  3DAG A;  1G5Z A;  5KYN A;  4XPX A;  1HMD A;  2A1D D;  2QNL A;  3MBG A;  5DQT A;  4RBN A;  1N1C A;  1K04 A;  5BUO A;  5KYY B;  2LFF A;  3QVZ A;  5EGY A;  4JC7 A;  1WOL A;  4WGY A;  3BEH A;  5D91 A;  1YJG A;  2YLI A;  4NCQ A;  1G8X A;  2NPU A;  3ABL C;  4DRH B;  1BR2 A;  2YVK A;  1M2V B;  2OKU A;  4LDK A;  4RD9 A;  3ZIB A;  1YA7 O;  3S0X A;  4IAO A;  1ZU5 A;  3NKE A;  1Z7Q c;  4CDA A;  1I5N A;  5COM A;  4FES A;  2Q4F A;  1GQA A;  3Q6M A;  2OOC A;  2ZXR A;  3EGD A;  4JW1 A;  4MVZ A;  3V5Z A;  4BJ5 C;  2P61 A;  2XLD A;  3RW0 A;  5A6A A;  5DQZ A;  2NUP B;  1FTS A;  1RJ9 B;  3SXK A;  2EIN C;  4DBR A;  3PHF 2;  3J06 A;  1M56 C;  4OD4 A;  1M2O A;  3ECS A;  3EJN A;  2Q9B A;  3C7J A;  3M15 A;  4G78 A;  1D1C A;  3FOO A;  3JSZ A;  2ZXW C;  3F46 A;  2DGJ A;  2QY9 A;  3PMR A;  1TFK B;  3FXH A;  1YLM A;  1OCZ C;  2XLH A;  3A11 A;  2XRH A;  5A69 A;  3M1C B;  1QZX A;  2F22 A;  2NUT A;  1C03 A;  1RKE B;  4MVO A;  2D5R B;  3DMD A;  2IXO A;  2L6H A;  3F47 A;  1NU9 C;  4HEA J;  1MMG A;  2RSE B;  5F28 E;  2L9J A;  1WWP A;  2MYS A;  4XQ1 A;  4BJ6 A;  1LPE A;  3NDB B;  2R7S A;  4U5C E;  4E18 A;  1O87 A;  1ORS C;  4K0D A;  4JVS A;  3U3F A;  3GEH A;  3KKB A;  4AL0 A;  2HKV A;  3K6B A;  3SZR A;  5L0D A;  1OXB A;  2NSF A;  3FOP A;  5JP7 A;  4GEH A;  4Q7C A;  1ZHX A;  2LFD A;  3AGU A;  4G0H A;  4KC9 A;  1K40 A;  3EH2 A;  4IJJ A;  5T3W A;  5HSW A;  1JAF A;  4CJO A;  1YDI A;  3G50 A;  1U89 A;  3JSE O;  1FFH A;  5L3V A;  1E86 A;  4L6R A;  3JYH A;  1FFT C;  4BJ5 A;  1DOV A;  3NRH A;  2BL2 A;  3LUT B;  3Q7G A;  1LS4 A;  3EGX A;  2D4U A;  1YVI A;  2R02 A;  3HKK A;  3KH2 A;  1MQV A;  1QQ3 A;  4DJ9 A;  1YZA A;  1PD0 A;  4AL1 A;  2OU6 A;  3B29 A;  1R5I D;  3US6 A;  1YYJ A;  2ZXO A;  2EIL C;  2PP4 A;  4YT5 A;  1PCX A;  4CX9 A;  2M4E A;  2YLD A;  2G3V A;  3O6X A;  5KYX A;  4K7B A;  2IOQ A;  1QVX A;  3CEX A;  2H8A A;  1D0Z A;  3GEE A;  3K1H A;  4CDY A;  2EPO A;  2FFH A;  1QPU A;  3VRC A;  4KNW A;  3DD7 A;  3K33 A;  1K05 A;  1JMW A;  3VM6 A;  3GEI A;  4NC3 A;  2ZPA A;  5DS5 A;  2XM4 A;  4I3M A;  5FCL A;  5JUA A;  3FDQ A;  1G4W R;  3DE8 A;  4JCH A;  1A7E A;  4JRZ A;  1ST6 A;  2KQ9 A;  3C63 A;  2LP4 A;  3ABK C;  3WG7 C;  2V26 A;  4BPM A;  2XS1 A;  5L0C A;  1VMA A;  3DJN B;  1V55 C;  4JTD B;  3ZTZ A;  5COF A;  3S9O A;  3W2W A;  1AEP A;  3U5S A;  3DXJ F;  2B0H A;  2J0W A;  2CYD A;  3IQC A;  3UMI A;  3G4Z A;  3PDM P;  1RJ9 A;  2WZL A;  1ZHZ A;  2CCY A;  2H7V C;  3GM2 A;  3U2L A;  1KTM A;  2OQM A;  4GYT A;  3A9C A;  1C02 A;  1JR8 A;  5E3C A;  5DVW A;  2KYH A;  1UFB A;  2L7A A;  3U9M A;  4QI0 A;  5CI8 A;  4OIO F;  3LAY A;  4ZLC A;  3C8G A;  2IXM A;  2J46 A;  4JTC B;  2PX3 A;  1CGN A;  2P1A A;  3WOD F;  1XZP A;  5AGF A;  3UMK A;  3RH3 A;  3B0V C;  5KYY A;  2Q9C A;  2J8W A;  3KPH A;  4FWV A;  1D0X A;  2VCB A;  3CZ6 A;  3ASN C;  3T9O A;  3GOR A;  3DKA A;  5A6B A;  3JRM O;  3EZI A;  2XL6 A;  4N4W A;  2C03 A;  4D4N A;  4DVZ A;  3V7O A;  2ASR A;  4J7T A;  4R32 A;  4W8P A;  5A6J A;  4C3B A;  1ZVZ A;  1VK5 A;  2J9V A;  2XLM A;  4DRJ B;  2LQG A;  2OCC C;  2WVO A;  1SF8 A;  3AG1 C;  2JX0 A;  5E33 A;  5T3T A;  5F5H A;  4FAP B;  1UG7 A;  1H9T A;  4G7H F;  3SYN A;  1LE2 A;  3S29 A;  4WJ0 A;  3W8I A;  4JEB A;  4U9E A;  1QKR A;  2JD3 A;  2WZF A;  4JZA A;  4Z9H A;  4U9D A;  3RF3 A;  4DOZ A;  4IAR A;  4IAQ A;  3RFY A;  5DS6 A;  3W2V A;  4E7S A;  3S90 A;  4MTG A;  3N2Z B;  1U6H A;  4MW8 A;  1T6Q A;  2NUT B;  3TQO A;  2R7O A;  5JSL A;  1SZI A;  1KU2 A;  2OJQ A;  3K66 A;  3ATP A;  1T5O A;  3MYF A;  4OD5 A;  1PV3 A;  2KNH A;  1A0B A;  2BE5 F;  1VLT A;  2GAQ A;  3CSK A;  3IQT A;  3SEO A;  5B3I A;  3LEV A;  2PBE A;  4MTO A;  3U8P A;  3ZSU A;  4PJN A;  1VTM P;  2HV7 A;  4U5H A;  1A41 A;  4MVM A;  4D4X A;  2VAS A;  2YEV A;  4PJL A;  4DRI B;  3LS1 A;  3N24 A;  1D1A A;  5L0H A;  4XLP F;  1EQ1 A;  2RD9 A;  2VB6 A;  3EG9 A;  2VH3 A;  1Z23 A;  2QLA A;  1V4A A;  3IQ6 A;  4EHP A;  2R03 A;  1EKY A;  3RQE A;  2YL3 A;  3B0U X;  4U5B E;  4ANJ A;  3FMS A;  3B9Q A;  1SYQ A;  3DI5 A;  3U2M A;  1DOW A;  3EFO A;  3W8H A;  2G3K A;  5JT4 A;  1GM5 A;  2WVQ A;  4U5D E;  2WZG A;  4QI2 A;  1CPQ A;  4YT2 A;  3GAN A;  3ZQV A;  4JUR I;  5JVE A;  3MYI A;  1TWC A;  2YHS A;  5L0G A;  1VLS A;  1VYI A;  4PJJ A;  4BG0 A;  2W4M A;  1IW7 F;  4CS7 A;  4E17 A;  3E9V A;  1HW1 A;  1ZZP A;  4PAC A;  4MVQ A;  3R7C A;  3RIP A;  4ER9 A;  1NSG B;  2IBF A;  1TWH A;  3LJB A;  2ETS A;  4XEK A;  4Q5S F;  1BDJ B;  4K1O A;  1EA8 A;  2NSG A;  1SMY F;  3ZTM A;  3SXY A;  4P6I C;  4G7O F;  4J30 B;  1OW7 A;  1QLE C;  3AG4 C;  4MVU A;  3SXM A;  3NMI A;  4IWB A;  4F4B A;  1KNY A;  3UGO A;  1ZYR F;  1Q0K A;  1ZHW A;  3EZH A;  4O79 A;  4AK9 A;  3V5X A;  1NBB A;  3TK0 A;  1LI7 A;  1A7V A;  2KGO A;  2Y39 A;  1Y4C A;  2LCH A;  4U5G A;  3HNK A;  4CDV A;  3C62 A;  3ASO C;  4QDL A;  4BJ1 A;  3QZC A;  4MQ9 F;  4E0I A;  3T4R A;  256B A;  1Q0D A;  1LI5 A;  1Q0M A;  2A69 F;  4X0R A;  2A68 F;  4C3E A;  2VCC A;  2HV6 A;  3O39 A;  1RXQ A;  2YWA A;  3LLI A;  1LIH A;  3ZDL A;  1RCP A;  1V54 C;  3L8J A;  4IGG A;  1G4U S;  4IRU A;  3DWW A;  1FR0 A;  3NKD A;  5DS4 A;  1QSP A;  1I4Z A;  1L7C A;  3OEO A;  1TWG A;  2XM0 A;  3DJU B;  3HLZ A;  1FAP B;  4PK4 A;  2XLW A;  4XWJ A;  3I4U A;  4BJ6 C;  4HFF B;  2Y3B A;  2XLE A;  2KW3 C;  2HUJ A;  4P9F A;  2DB4 A;  2ICW G;  3DM9 B;  5K0I A;  1OCC C;  3C8Z A;  4U5E E;  1ZW2 A;  2R7T A;  3UMH A;  2V3C C;  4AE4 A;  4WGZ A;  3ZQY A;  1OKK D;  2P7V A;  1Z6A A;  4YN0 B;  4AX2 A;  3T6G B;  2LSE A;  2LIG A;  4JEA A;  1RKC A;  2AP3 A;  2IXN A;  1OCO C;  2LD6 A;  4YL0 A;  1XZQ A;  4JIO A;  5E3A A;  3R2P A;  3NG1 A;  2M64 A;  3I5P A;  1B68 A;  5KYW B;  1WAS A;  4CSA A;  1WTY A;  2R7W A;  3C18 A;  1S05 A;  1NU7 D;  4B6I A;  2LK4 A;  4CS9 A;  4JJG A;  3K7D A;  1Q0G A;  4N6H A;  3S84 A;  2J45 A;  4P9T A;  2KC3 A;  1HW2 A;  3KMI A;  4BEM J;  3I5Q A;  5B1B C;  5JLI A;  1OR3 A;  2CW0 F;  4YK5 A;  2A0U A;  5TJ5 E;  2KK1 A;  3JZ0 A;  1TWA A;  2A6H F;  4O6Y A;  3MX3 A;  1NFN A;  3ZVR A;  5DLJ A;  1LS1 A;  1Z63 A;  4CS8 C;  3KYJ A;  1JPJ A;  1M57 C;  2IYL D;  3M79 A;  1H7I A;  3EHM A;  4PJM A;  2EPK X;  3FVY A;  2Q3T A;  2PX0 A;  4MVR A;  4OIN F;  3L0I A;  2P6V A;  1SR2 A;  1LM3 B;  3EG9 B;  4MS2 A;  4XTK A;  4CIH A;  1H6G A;  2O9X A;  4CSA C;  1ORY A;  2H7O A;  2YQY A;  4XPY A;  3ITF A;  3MLG A;  1AUE A;  1IZM A;  2VCA A;  3DZA A;  3U8V A;  1GS9 A;  1J8Y F;  1NG1 A;  1WN0 A;  2YLG A;  3QTH A;  3LES A;  2R7Q A;  1U0B B;  3Q7L A;  2GDC A;  5BQH A;  2J7P A;  4WAB A;  2MWQ A;  4YL3 A;  4JKV A;  1EI7 A;  3KL4 A;  3RQF A;  1ORJ A;  2Q00 A;  2AVK A;  2EPM X;  4YT8 A;  1H9G A;  2PF4 E;  4LLC A;  2L6G A;  3AJM A;  1M6T A;  4XPW A;  4Z9I A;  4ULV A;  5IY5 C;  2YRF A;  2QTV A;  3AOU A;  1MMA A;  1OW8 A;  2GA0 A;  1PD1 A;  2Y3G A;  5CIV A;  5EK0 A;  1OXK A;  2DI3 A;  2L6F A;  4LER A;  3JCU Q;  4PR9 A;  2X0C A;  3L1M A;  4UDV A;  2HS5 A;  2EPN A;  4LLE A;  4G7Z F;  2OJE D;  5A6K A;  5KYX B;  4IB4 A;  2DYS C;  2Y69 C;  1JRA A;  3DM5 A;  3LLK A;  4H54 A;  1T6U A;  4HE8 D;  2HSQ A;  5D92 A;  2HJ3 A;  1BZ4 A;  4MW3 A;  4N06 A;  1ZW3 A;  2J9U A;  4H4K C;  4J32 B;  3RVY A;  4KNV A;  1HMO A;  1MND A;  1CGO A;  3T6B A;  3VYW A;  3NYL A;  2QUP A;  1C17 M;  1M2V A;  4Z9J A;  2EPL X;  2PFD A;  2Q9A A;  3Q6N A;  4I1M A;  4N6C A;  2HJM A;  3U9J A;  5EHH A;  3K1I A;  2Y3H A;  4EBJ A;  4YWQ A;  4KI2 A;  5E2Q A;  1RMV A;  3GWN A;  4XEF A;  5FZT A;  2AU5 A;  1V74 B;  3KYI A;  3SNH A;  1T9K A;  4OIR F;  1W2W A;  1VYK A;  3RVZ A;  3ZWI A;  5B3S C;  2R7X A;  1MMN A;  2XXA A;  2NG1 A;  4DXW A;  5CI9 A;  3WAQ A;  1BBH A;  4JCZ A;  2HSB A;  3UR3 C;  4ZLD A;  1Z3I X;  1E2X A;  2JPU A;  5F5F A;  2J0X A;  2E87 A;  4XEV A;  4ONS A;  2R25 A;  1GGQ A; 
#chains in the Genus database with same CATH homology
 5K0I A;  4YK5 A;  5BQH A;  5HV9 A;  4YL1 A;  4WAB A;  4YL3 A;  2Q7R A;  4JRZ A;  3HKK A;  4BPM A;  5BQI A;  2UUH A;  5BQG A;  3B29 A;  4AL1 A;  4YL0 A;  4JC7 A;  3LEO A;  2UUI A;  4J7T A;  3DWW A;  2H8A A;  4NTA A;  4NTF A;  4AL0 A;  4J7Y A;  4JCZ A;  2PNO A;  4NTB A;  3PCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...