3PCVA

Crystal structure analysis of human leukotriene c4 synthase at 1.9 angstrom resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
146
structure length
146
Chain Sequence
b'MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
molecule tags Lyase
source organism Homo sapiens
publication title The catalytic architecture of leukotriene C4 synthase with two arginine residues
pubmed doi rcsb
total genus 61
structure length 146
sequence length 146
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 3pcvA00
4AL1A 4NTFA 2UUHA 4JC7A 2UUIA 5BQHA 4WABA 4YL1A 3B29A 3PCVA 4JCZA 2Q7RA 4J7YA 4YL3A 3DWWA 4NTAA 4JRZA 4YK5A 2PNOA 4BPMA 3LEOA 5K0IA 4YL0A 2H8AA 4NTBA 4AL0A 5HV9A 5BQGA 4J7TA 3HKKA 5BQIA
chains in the Genus database with same CATH superfamily
2KYHA 3Q6NA 3AG2C 5L0CA 1MNDA 1JMWA 2AVKA 3RH3A 2Q3TA 2YHSA 3EZHA 4LACB 1AUEA 5DLJA 3QW0A 3C63A 4NY3A 1OCOC 5AGFA 1ZHTA 3GWNA 1ORJA 1TFKB 2A0UA 3S28A 1LI7A 2XLVA 3CEXA 3NYLA 5L3QA 3X1OA 2OEXA 4CJGA 2P7VA 2WVQA 2AP3A 4IAQA 1MMDA 5L0HA 1Z63A 2R7UA 3RIPA 3EPVA 2YLIA 4PJMA 1LVKA 3B0PA 2HZ8A 1S05A 1DOVA 1WOLA 2HSBA 3W8HA 4NTBA 4PFOA 3W2WA 4OIRF 3ZDLA 2CDQA 3EQLF 3JRMO 2HKVA 2VCAA 3M79A 1SYQA 2CNWA 3S9OA 2XM4A 5KYUB 2LIGA 2CGEA 1G4WR 1WATA 1YYJA 2PBEA 3DJNB 3F46A 4U9DA 2X0CA 4MVMA 1E85A 1M57C 1RCPA 1PCXA 4WJ0A 3KH2A 2L7AA 5E33A 1BBHA 4DBQA 1L3PA 4EHPA 4C3DA 3NKDA 4FESA 2MHRA 3EH2A 2EPMX 2PNOA 4U5CE 1EKYA 1H7IA 2P61A 3HNLA 4DXWA 4X0RA 2HMQA 5B3SC 2HUJA 1I4ZA 2J45A 1DOWA 4U5DE 2VB6A 2A1DD 3EZIA 1IW7F 4IAOA 4Z9HA 4XEKA 1M2VA 3S0XA 3G4XA 4R32A 1LI5A 5B3IA 4O6MA 5D92A 1ZHYA 3ZIBA 2V3CC 2WVNA 1NFNA 2L6GA 2W9YA 3M15A 4YN0B 2R03A 3GEEA 3W8IA 2DB4A 2Q7RA 4JEAA 4IRUA 2LK4A 4N06A 3U9MA 4PJJA 4NTAA 2PX0A 1NU7D 2IXPA 1OR3A 3H2UA 1HW1A 1T6UA 1ZZPA 2G3KA 1J8MF 1EI7A 5E3CA 3U2LA 4FAPB 1WASA 3VF0A 1NBBA 3FOPA 3K1IA 1JRAA 2EINC 3B71A 3MFNA 4JJFA 1Q0KA 3HNIA 4OD5A 5BQGA 1QKRA 1Q0MA 1G5ZA 1TKNA 256BA 2YZSA 5HV9A 2XLMA 1RXQA 3I5PA 5KYWA 4DVYP 1WWPA 3FVYA 4CX9A 5JRAA 1PD1A 1WGWA 1ZYRF 3WAQA 3M4BA 4NTFA 2UUHA 3SXMA 3ZC4A 2YLGA 5D91A 3A9CA 1T01A 4G7HF 4WABA 3EGDA 4DJ9A 2MWQA 3SXZA 3Q7GA 4Q4ZF 1QVXA 3ZG1A 3BRJA 4A4AA 3R7CA 1EQ1A 3LNMB 1JPNA 4PK4A 3AGUA 4ULWA 2DI3A 1FMWA 1E84A 2LQGA 3EGXA 1A7EA 4ONSA 2FGYA 1SF8A 2A6EF 2J7PA 2YEVA 2G62A 2IYLD 3V7OA 3X2QC 3O39A 1NZEA 5DQZA 1YLMA 1AVOB 2PFDA 4U5HA 5TJ5E 3RYLA 3V5XA 4ZLCA 1WN0A 2L81A 4I44A 4IB4A 3N24A 5JUAA 5JSLA 1LE4A 4MVSA 3EG9A 1R5ID 3WG7C 1VYIA 2H7OA 2QNLA 1SMYF 3R2PA 2YQYA 4JJGA 3KYIA 3C8ZA 4MW8A 5JT4A 4AL1A 4DRJB 2YKZA 2IOQA 2Y3BA 4QDLA 3UMHA 4XLNF 2J0WA 4Z9JA 3B29A 3RVYA 2F22A 1ZHXA 4WGYA 4IWBA 4EBJA 1LS4A 4MQ9F 1D0XA 2HSQA 1D1CA 4IGGA 2J9VA 4XPYA 2G3VA 4EBKA 4MVOA 1SZIA 1ST6A 2R7WA 4CBEA 3QVZA 2L6FA 1Z5ZA 4JTDB 4XEFA 1ORSC 2WZGA 2HFIA 1OXBA 3W2VA 2C04A 4WGZA 3ZTZA 4LDQA 2C03A 2NUPB 3DE9A 3QW1A 1QPUA 2ICWG 4XPXA 3S27A 1SR2A 4ER9A 1APCA 4RD9A 2LFDA 3VM6A 2OOCA 2XLEA 4XEVA 2Y39A 3IQCA 2YWAA 3PDMP 4U5BE 3SYNA 1V54C 4JKVA 2IXOA 3N0TA 2VCCA 2E87A 1M2OA 2A68F 3DJUB 2I8BA 4U5GA 5IY5C 2WL8A 3KKBA 4CDYA 4QI2A 1QQ3A 3BEHA 1F1MA 1OW6A 2FAPB 2PP4A 4FX5A 4JC7A 4LDRA 3TK0A 1S7ZA 2Y3HA 4HFFB 4QI0A 2YL3A 1HMDA 2ZPAA 1MMNA 5COGA 4BEMJ 2XS1A 3ITFA 1XZPA 3FAPB 1K40A 3JYYA 3TJ5A 2YL1A 4CSAC 1YDIA 4G7OF 3ZQVA 3Q6MA 1M2VB 4G78A 4CS7A 2JD3A 4BEJA 3POVA 4DRHB 2L6HA 1RJ9A 1ZU4A 3EFOA 3NMKA 1E86A 4Q7CA 5BUOA 3DKAA 2YL0A 1O3UA 4JTCB 5L0JA 3AG1C 3VRCA 3L0IA 2HV6A 1FFHA 2DYRC 3ASNC 3ECSA 3OEOA 3PMRA 3ASOC 4MTFA 5GPGB 5AC5A 3J06A 4J7TA 1KTMA 3AJMA 4EWCA 4JCHA 2XSEA 1K05A 1C03A 2WB7A 3TOMA 1VTMP 1RJ9B 2UUIA 3EFOB 1M56C 5L3VA 3L34A 3U3FA 4LERA 1BR2A 2YL7A 2FFHA 4KNVA 4AK9A 3ATPA 1QSPA 2QUPA 5A6BD 2Y3GA 3MYIA 4BJTA 2HJ3A 3JSEO 4MW3A 1YZCA 5JS5A 1TWHA 1U89A 4GYTA 5L0GA 2R7OA 1Q0GA 4K1OA 2R7SA 1TFOB 1JR8A 1JOGA 2A0BA 1OCRC 2Y3DA 3T4RA 2X51A 2HV7A 2WZFA 5DQTA 1XZQA 3FXHA 3NRHA 1HY5A 1VMAA 1YVIA 3H65A 5F5HA 3WHNA 2H7VC 3F47A 4ANJA 1C02A 3DM5A 3UNGC 4OIOF 3UMKA 4PJNA 2J0XA 4MVQA 3HKKA 4H4KC 1I5NA 1W2WA 3CSKA 4LDKA 4LLCA 4U5FE 3B0VC 4C3EA 2I15A 2BC5A 4DRIB 5KYXB 5KYNA 1ZHWA 4NC3A 1T9KA 3RF3A 3ZVRA 1NFOA 1G8XA 3FHDA 4JCZA 2ASRA 1CPQA 4YL3A 3RFYA 1M6TA 3ZQYA 4OIPF 1RKCA 4PACA 1T6IA 1NG1A 1TR2A 2EIMC 1CGNA 3K7DA 1FMVA 3LS0A 3O10A 4KNWA 4OD4A 1UFBA 4CIHA 3EGXB 1A7VA 1R4TA 4BPMA 2HMZA 4JEBA 2GWWA 2Q4FA 2OJQA 5EGYA 4O7GA 4EBBA 3SNHA 3GODA 4BG0A 2R7VA 1LPEA 1MMGA 3B9QA 1YA7O 2XS8A 2EPLX 4C7OA 3FAJA 5F28E 2QE9A 2ZXOA 3IQ6A 3G50A 3QTHA 3T6GB 5A6BA 3O55A 1WTYA 2NUTA 5HSWA 2XXAB 3RQGA 4YL1A 2KSFA 5FZTA 4U9EA 3K33A 3SXYA 2Q9AA 3SEOA 1OQCA 1TQGA 2OG2A 3GM2A 4IARA 1LKXA 4CS8C 2LSEA 4F4BA 3LS1A 3ABLC 3PHF2 3GEIA 1VLTA 2NUTB 1ZW2A 2ZXPA 1VK5A 3IEEA 3L8JA 4JE9A 2J9UA 4EKWA 3LESA 1YZAA 4P6IC 2OU6A 2BE5F 2IXMA 3TD7A 2W45A 3VAYA 3ZTMA 2TMVP 3DXJF 2W4MA 3GWLA 2CYDA 1YYXA 4EUKB 3AQCA 3UGOA 4JURI 1ORYA 1FFTC 2QLAA 3EJNA 3FOOA 2GA0A 3SXKA 2D5RB 2P0NA 3DAGA 3K6BA 3GANA 3PCVA 1K04A 2DGJA 3HJCA 4ULVA 1Y6DA 5CI8A 5E3AA 4CIPA 4BJ5A 4C7OB 2Y69C 4E17A 3GORA 4YWQA 3FMSA 2Q00A 3LEVA 2WVOA 3UMIA 1U0BB 3S29A 5COMA 1U6HA 3T9OA 1AEPA 2D4UA 2AWCA 4I1MA 2KQ9A 2A6HF 2NUPA 4L6RA 1OW7A 4N6HA 3NDBB 2CCYA 2RD9A 5E2QA 1J8YF 1A41A 1GS9A 2OEVA 3C62A 5EK0A 1OR2A 1Z23A 3L8IA 4J32B 1VLSA 1L7CA 4YT8A 1TWCA 1JAFA 2ETSA 3CQZA 5KYUA 4MS2A 2P1AA 2HS5A 2J7PD 3LJBA 2A69F 3KMIA 3UR3C 3UGPA 2KW3C 2EPKX 4NQFA 4E0IA 3DD7A 4W8PA 1ZHZA 2R7QA 3IQ5A 1YAUO 1Q0DA 3MBGA 1HE9A 1A7DA 5A6AA 3I4UA 1TWAA 3JT1A 3S84A 2NG1A 2OQMA 2QY9A 4I1OB 1ZVZA 4OIQF 1GM5A 4P9TA 2CNWD 1D0ZA 2KNHA 2XL4A 3V5ZA 2LFFA 1FTSA 2LD6A 4C3BA 3A11A 3IHUA 4IJJA 4KBLA 4YK5A 3ABMC 1D1AA 3K1IC 2J9WA 4XPWA 5T3WA 4AX2A 1CGOA 3AG3C 4MVZA 1BR1A 1I4YA 4CDVA 5L0IA 2IM8A 3RKOF 3SP1A 4UDVA 1TWGA 2ZD9A 3M4CA 4AE4B 3O6XA 3HNKA 1BR4A 2WZLA 1GQAA 1LM3B 3EGDB 4U5EE 3CZ6A 4HE8D 4JTAB 3IQTA 3FDQA 1HE1A 2L9JA 2YVKA 4B6IA 3LUTB 3M1CB 1MQVA 1VB5A 4EIYA 3ZWIA 2W4BA 1NU9C 1E83A 4JZAA 4BJ5C 4CJOA 5KYWB 3QMKA 1V74B 2XL8A 4G0HA 3SZRA 3QVYA 1RKEB 2XLHA 4MNDA 5A6KA 3C8GA 3RVZA 4K7BA 5JP7A 4DVZA 2XXAA 3G4ZA 3HNJA 3DI5A 3NG1A 4PJLA 4Z9IA 2R9RB 3DM9B 3TJ6A 4XQ1A 4YT5A 4CS9A 4D4XA 1JPJA 5CI9A 5CIVA 5EHHA 5DS6A 2M4EA 4BJ6C 2R7RA 1H9TA 4O6NA 1D1BA 2ZXRA 2JPUA 2VH3A 1MMAA 1G4US 3MYFA 3C18A 2J46A 1QZXA 2H7BA 3C8GD 3NMIA 2JX0A 1LIHA 2R02A 1VYKA 4N4WA 5B1AC 4AE4A 2KK1A 5BQIA 4YT4A 4XTKA 4KI2A 4CDAA 3EHNA 1CGME 5BQHA 4I3MA 3NKEA 2KC3A 3LAYA 2EIKC 1Z3IX 2HJMA 4XWJA 3CAXA 5A6JA 4J7YA 1RMVA 4O79A 1Y4CA 2DYSC 2MYSA 3JZ0A 3OA1A 3U9JA 1V55C 3GM3A 4N6CA 3TQOA 4DOZA 2EILC 4GQHA 4RDAA 5T3TA 3ZSUA 2XRHA 4YT2A 4J30B 3E70C 3TOLA 1O5HA 3L1MA 2R7XA 1N1CA 1C17M 2XLDA 3JRTA 3GM1A 2YLDA 3EG9B 1H6GA 4MVUA 1UG7A 3EHMA 3HLZA 5KYYB 4D4NA 2B0JA 2ZXWC 4CSAA 3DMDA 3T6BA 3EH1A 5FCLA 3WODF 4Q5SF 5DS5A 2EPOA 2XM0A 1PD0A 5DS4A 2KGOA 2OCCC 2M64A 1FAPB 4K0DA 1D0YA 1MNEA 4JW1A 3U5SA 5DVWA 2AU5A 5F5FA 4A2NB 2EPNA 4G7ZF 2J9BA 4M63A 5KYYA 5JLIA 4E7SA 3TULA 1A0BA 3NYMA 4NCQA 3LNRA 4E7ZA 3DE8A 4W8KA 1O87A 3AQBA 4RBNA 4YL0A 3RQEA 1E2XA 3JTLO 4ZLDA 1YARO 4JVSA 4BJ6A 4HFKB 1OKKA 2Q9CA 3NMJA 4GEHA 3IPMO 3V5YA 3W4YA 4HEAJ 1XWJA 2B0HA 3VYWA 1OXKA 4BJ1A 2NSGA 3ABKC 3HTKC 3U8PA 4JIOA 3U0CA 2V26A 1EA8A 3KYJA 3T6JA 2IBFA 5L0FA 1NLXA 2PX3A 1Q0FA 4PFPA 1T5OA 3N2ZB 2VASA 2XL6A 1OCZC 4XLPF 3K66A 3GEHA 3MLGA 1ZU5A 4JRZA 2GFHA 2NSFA 1Z6AA 3LLIA 3NYJA 5COFA 1LS1A 1RKEA 3JSZA 1HMOA 1Z7Qc 2P6VA 2QTVA 3U2MA 2IXNA 4OINF 3LLKA 1B68A 3OWTA 1OW8A 5T1DB 3C7JA 3JCUQ 3MX3A 2RSEB 4MTGA 4MTOA 5K0IA 4CS9C 1ZW3A 2OKUA 5JVEA 2GDCA 2H8AA 2VC9A 2GAQA 3KPHA 1NSGB 4P9FA 5L0DA 3Q7LA 3U3BA 2BL2A 3DZAA 3RQFA 2LCHA 1YJGA 1CPRA 1YA9A 1PV3A 1FR0A 1QLEC 2Q9BA 3C8GB 3AOUA 5AC4A 2CW0F 3H2VA 2EIJC 2LP4A 1HW2A 4CS8A 2AWYA 1T6QA 4MVRA 3AG4C 2PF4E 2R25A 3RW0A 3QZCA 1OKKD 5A69A 1BZ4A 3DAFA 1H9GA 3DWWA 4E18A 4LLEA 3KL4A 1KNYA 3B0UX 3S90A 4KC9A 3U8VA 2Z15A 1LE2A 2VCBA 3E9VA 3JYHA 4FWVA 4PR9A 3AGTA 3LEOA 2OJED 5B1BC 1IZMA 4E0HA 4DBRA 2XLOA 4O6YA 1KU2A 5KYXA 4YJWA 4AL0A 1V4AA 1FNTc 1VOMA 4H54A 2YRFA 3I5QA 2J8WA 2XLWA 2R05A 3K1HA 1BDJB 1OCCC 2R7TA 3US6A 1GGQA 2NPUA 2O9XA 2KJGA
chains in the Genus database with same CATH topology
4AL1A 4NTFA 2UUHA 4JC7A 2UUIA 5BQHA 4WABA 4YL1A 3B29A 3PCVA 4JCZA 2Q7RA 4J7YA 4YL3A 3DWWA 4NTAA 4JRZA 4YK5A 2PNOA 4BPMA 3LEOA 5K0IA 4YL0A 2H8AA 4NTBA 4AL0A 5HV9A 5BQGA 4J7TA 3HKKA 5BQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AL1 A;  4NTF A;  2UUH A;  4JC7 A;  2UUI A;  5BQH A;  4WAB A;  4YL1 A;  3B29 A;  3PCV A;  4JCZ A;  2Q7R A;  4J7Y A;  4YL3 A;  3DWW A;  4NTA A;  4JRZ A;  4YK5 A;  2PNO A;  4BPM A;  3LEO A;  5K0I A;  4YL0 A;  2H8A A;  4NTB A;  4AL0 A;  5HV9 A;  5BQG A;  4J7T A;  3HKK A;  5BQI A; 
#chains in the Genus database with same CATH topology
 2KYH A;  3Q6N A;  3AG2 C;  5L0C A;  1MND A;  1JMW A;  2AVK A;  3RH3 A;  2Q3T A;  2YHS A;  3EZH A;  4LAC B;  1AUE A;  5DLJ A;  3QW0 A;  3C63 A;  4NY3 A;  1OCO C;  5AGF A;  1ZHT A;  3GWN A;  1ORJ A;  1TFK B;  2A0U A;  3S28 A;  1LI7 A;  2XLV A;  3CEX A;  3NYL A;  5L3Q A;  3X1O A;  2OEX A;  4CJG A;  2P7V A;  2WVQ A;  2AP3 A;  4IAQ A;  1MMD A;  5L0H A;  1Z63 A;  2R7U A;  3RIP A;  3EPV A;  2YLI A;  4PJM A;  1LVK A;  3B0P A;  2HZ8 A;  1S05 A;  1DOV A;  1WOL A;  2HSB A;  3W8H A;  4NTB A;  4PFO A;  3W2W A;  4OIR F;  3ZDL A;  2CDQ A;  3EQL F;  3JRM O;  2HKV A;  2VCA A;  3M79 A;  1SYQ A;  2CNW A;  3S9O A;  2XM4 A;  5KYU B;  2LIG A;  2CGE A;  1G4W R;  1WAT A;  1YYJ A;  2PBE A;  3DJN B;  3F46 A;  4U9D A;  2X0C A;  4MVM A;  1E85 A;  1M57 C;  1RCP A;  1PCX A;  4WJ0 A;  3KH2 A;  2L7A A;  5E33 A;  1BBH A;  4DBQ A;  1L3P A;  4EHP A;  4C3D A;  3NKD A;  4FES A;  2MHR A;  3EH2 A;  2EPM X;  2PNO A;  4U5C E;  1EKY A;  1H7I A;  2P61 A;  3HNL A;  4DXW A;  4X0R A;  2HMQ A;  5B3S C;  2HUJ A;  1I4Z A;  2J45 A;  1DOW A;  4U5D E;  2VB6 A;  2A1D D;  3EZI A;  1IW7 F;  4IAO A;  4Z9H A;  4XEK A;  1M2V A;  3S0X A;  3G4X A;  4R32 A;  1LI5 A;  5B3I A;  4O6M A;  5D92 A;  1ZHY A;  3ZIB A;  2V3C C;  2WVN A;  1NFN A;  2L6G A;  2W9Y A;  3M15 A;  4YN0 B;  2R03 A;  3GEE A;  3W8I A;  2DB4 A;  2Q7R A;  4JEA A;  4IRU A;  2LK4 A;  4N06 A;  3U9M A;  4PJJ A;  4NTA A;  2PX0 A;  1NU7 D;  2IXP A;  1OR3 A;  3H2U A;  1HW1 A;  1T6U A;  1ZZP A;  2G3K A;  1J8M F;  1EI7 A;  5E3C A;  3U2L A;  4FAP B;  1WAS A;  3VF0 A;  1NBB A;  3FOP A;  3K1I A;  1JRA A;  2EIN C;  3B71 A;  3MFN A;  4JJF A;  1Q0K A;  3HNI A;  4OD5 A;  5BQG A;  1QKR A;  1Q0M A;  1G5Z A;  1TKN A;  256B A;  2YZS A;  5HV9 A;  2XLM A;  1RXQ A;  3I5P A;  5KYW A;  4DVY P;  1WWP A;  3FVY A;  4CX9 A;  5JRA A;  1PD1 A;  1WGW A;  1ZYR F;  3WAQ A;  3M4B A;  4NTF A;  2UUH A;  3SXM A;  3ZC4 A;  2YLG A;  5D91 A;  3A9C A;  1T01 A;  4G7H F;  4WAB A;  3EGD A;  4DJ9 A;  2MWQ A;  3SXZ A;  3Q7G A;  4Q4Z F;  1QVX A;  3ZG1 A;  3BRJ A;  4A4A A;  3R7C A;  1EQ1 A;  3LNM B;  1JPN A;  4PK4 A;  3AGU A;  4ULW A;  2DI3 A;  1FMW A;  1E84 A;  2LQG A;  3EGX A;  1A7E A;  4ONS A;  2FGY A;  1SF8 A;  2A6E F;  2J7P A;  2YEV A;  2G62 A;  2IYL D;  3V7O A;  3X2Q C;  3O39 A;  1NZE A;  5DQZ A;  1YLM A;  1AVO B;  2PFD A;  4U5H A;  5TJ5 E;  3RYL A;  3V5X A;  4ZLC A;  1WN0 A;  2L81 A;  4I44 A;  4IB4 A;  3N24 A;  5JUA A;  5JSL A;  1LE4 A;  4MVS A;  3EG9 A;  1R5I D;  3WG7 C;  1VYI A;  2H7O A;  2QNL A;  1SMY F;  3R2P A;  2YQY A;  4JJG A;  3KYI A;  3C8Z A;  4MW8 A;  5JT4 A;  4AL1 A;  4DRJ B;  2YKZ A;  2IOQ A;  2Y3B A;  4QDL A;  3UMH A;  4XLN F;  2J0W A;  4Z9J A;  3B29 A;  3RVY A;  2F22 A;  1ZHX A;  4WGY A;  4IWB A;  4EBJ A;  1LS4 A;  4MQ9 F;  1D0X A;  2HSQ A;  1D1C A;  4IGG A;  2J9V A;  4XPY A;  2G3V A;  4EBK A;  4MVO A;  1SZI A;  1ST6 A;  2R7W A;  4CBE A;  3QVZ A;  2L6F A;  1Z5Z A;  4JTD B;  4XEF A;  1ORS C;  2WZG A;  2HFI A;  1OXB A;  3W2V A;  2C04 A;  4WGZ A;  3ZTZ A;  4LDQ A;  2C03 A;  2NUP B;  3DE9 A;  3QW1 A;  1QPU A;  2ICW G;  4XPX A;  3S27 A;  1SR2 A;  4ER9 A;  1APC A;  4RD9 A;  2LFD A;  3VM6 A;  2OOC A;  2XLE A;  4XEV A;  2Y39 A;  3IQC A;  2YWA A;  3PDM P;  4U5B E;  3SYN A;  1V54 C;  4JKV A;  2IXO A;  3N0T A;  2VCC A;  2E87 A;  1M2O A;  2A68 F;  3DJU B;  2I8B A;  4U5G A;  5IY5 C;  2WL8 A;  3KKB A;  4CDY A;  4QI2 A;  1QQ3 A;  3BEH A;  1F1M A;  1OW6 A;  2FAP B;  2PP4 A;  4FX5 A;  4JC7 A;  4LDR A;  3TK0 A;  1S7Z A;  2Y3H A;  4HFF B;  4QI0 A;  2YL3 A;  1HMD A;  2ZPA A;  1MMN A;  5COG A;  4BEM J;  2XS1 A;  3ITF A;  1XZP A;  3FAP B;  1K40 A;  3JYY A;  3TJ5 A;  2YL1 A;  4CSA C;  1YDI A;  4G7O F;  3ZQV A;  3Q6M A;  1M2V B;  4G78 A;  4CS7 A;  2JD3 A;  4BEJ A;  3POV A;  4DRH B;  2L6H A;  1RJ9 A;  1ZU4 A;  3EFO A;  3NMK A;  1E86 A;  4Q7C A;  5BUO A;  3DKA A;  2YL0 A;  1O3U A;  4JTC B;  5L0J A;  3AG1 C;  3VRC A;  3L0I A;  2HV6 A;  1FFH A;  2DYR C;  3ASN C;  3ECS A;  3OEO A;  3PMR A;  3ASO C;  4MTF A;  5GPG B;  5AC5 A;  3J06 A;  4J7T A;  1KTM A;  3AJM A;  4EWC A;  4JCH A;  2XSE A;  1K05 A;  1C03 A;  2WB7 A;  3TOM A;  1VTM P;  1RJ9 B;  2UUI A;  3EFO B;  1M56 C;  5L3V A;  3L34 A;  3U3F A;  4LER A;  1BR2 A;  2YL7 A;  2FFH A;  4KNV A;  4AK9 A;  3ATP A;  1QSP A;  2QUP A;  5A6B D;  2Y3G A;  3MYI A;  4BJT A;  2HJ3 A;  3JSE O;  4MW3 A;  1YZC A;  5JS5 A;  1TWH A;  1U89 A;  4GYT A;  5L0G A;  2R7O A;  1Q0G A;  4K1O A;  2R7S A;  1TFO B;  1JR8 A;  1JOG A;  2A0B A;  1OCR C;  2Y3D A;  3T4R A;  2X51 A;  2HV7 A;  2WZF A;  5DQT A;  1XZQ A;  3FXH A;  3NRH A;  1HY5 A;  1VMA A;  1YVI A;  3H65 A;  5F5H A;  3WHN A;  2H7V C;  3F47 A;  4ANJ A;  1C02 A;  3DM5 A;  3UNG C;  4OIO F;  3UMK A;  4PJN A;  2J0X A;  4MVQ A;  3HKK A;  4H4K C;  1I5N A;  1W2W A;  3CSK A;  4LDK A;  4LLC A;  4U5F E;  3B0V C;  4C3E A;  2I15 A;  2BC5 A;  4DRI B;  5KYX B;  5KYN A;  1ZHW A;  4NC3 A;  1T9K A;  3RF3 A;  3ZVR A;  1NFO A;  1G8X A;  3FHD A;  4JCZ A;  2ASR A;  1CPQ A;  4YL3 A;  3RFY A;  1M6T A;  3ZQY A;  4OIP F;  1RKC A;  4PAC A;  1T6I A;  1NG1 A;  1TR2 A;  2EIM C;  1CGN A;  3K7D A;  1FMV A;  3LS0 A;  3O10 A;  4KNW A;  4OD4 A;  1UFB A;  4CIH A;  3EGX B;  1A7V A;  1R4T A;  4BPM A;  2HMZ A;  4JEB A;  2GWW A;  2Q4F A;  2OJQ A;  5EGY A;  4O7G A;  4EBB A;  3SNH A;  3GOD A;  4BG0 A;  2R7V A;  1LPE A;  1MMG A;  3B9Q A;  1YA7 O;  2XS8 A;  2EPL X;  4C7O A;  3FAJ A;  5F28 E;  2QE9 A;  2ZXO A;  3IQ6 A;  3G50 A;  3QTH A;  3T6G B;  5A6B A;  3O55 A;  1WTY A;  2NUT A;  5HSW A;  2XXA B;  3RQG A;  4YL1 A;  2KSF A;  5FZT A;  4U9E A;  3K33 A;  3SXY A;  2Q9A A;  3SEO A;  1OQC A;  1TQG A;  2OG2 A;  3GM2 A;  4IAR A;  1LKX A;  4CS8 C;  2LSE A;  4F4B A;  3LS1 A;  3ABL C;  3PHF 2;  3GEI A;  1VLT A;  2NUT B;  1ZW2 A;  2ZXP A;  1VK5 A;  3IEE A;  3L8J A;  4JE9 A;  2J9U A;  4EKW A;  3LES A;  1YZA A;  4P6I C;  2OU6 A;  2BE5 F;  2IXM A;  3TD7 A;  2W45 A;  3VAY A;  3ZTM A;  2TMV P;  3DXJ F;  2W4M A;  3GWL A;  2CYD A;  1YYX A;  4EUK B;  3AQC A;  3UGO A;  4JUR I;  1ORY A;  1FFT C;  2QLA A;  3EJN A;  3FOO A;  2GA0 A;  3SXK A;  2D5R B;  2P0N A;  3DAG A;  3K6B A;  3GAN A;  3PCV A;  1K04 A;  2DGJ A;  3HJC A;  4ULV A;  1Y6D A;  5CI8 A;  5E3A A;  4CIP A;  4BJ5 A;  4C7O B;  2Y69 C;  4E17 A;  3GOR A;  4YWQ A;  3FMS A;  2Q00 A;  3LEV A;  2WVO A;  3UMI A;  1U0B B;  3S29 A;  5COM A;  1U6H A;  3T9O A;  1AEP A;  2D4U A;  2AWC A;  4I1M A;  2KQ9 A;  2A6H F;  2NUP A;  4L6R A;  1OW7 A;  4N6H A;  3NDB B;  2CCY A;  2RD9 A;  5E2Q A;  1J8Y F;  1A41 A;  1GS9 A;  2OEV A;  3C62 A;  5EK0 A;  1OR2 A;  1Z23 A;  3L8I A;  4J32 B;  1VLS A;  1L7C A;  4YT8 A;  1TWC A;  1JAF A;  2ETS A;  3CQZ A;  5KYU A;  4MS2 A;  2P1A A;  2HS5 A;  2J7P D;  3LJB A;  2A69 F;  3KMI A;  3UR3 C;  3UGP A;  2KW3 C;  2EPK X;  4NQF A;  4E0I A;  3DD7 A;  4W8P A;  1ZHZ A;  2R7Q A;  3IQ5 A;  1YAU O;  1Q0D A;  3MBG A;  1HE9 A;  1A7D A;  5A6A A;  3I4U A;  1TWA A;  3JT1 A;  3S84 A;  2NG1 A;  2OQM A;  2QY9 A;  4I1O B;  1ZVZ A;  4OIQ F;  1GM5 A;  4P9T A;  2CNW D;  1D0Z A;  2KNH A;  2XL4 A;  3V5Z A;  2LFF A;  1FTS A;  2LD6 A;  4C3B A;  3A11 A;  3IHU A;  4IJJ A;  4KBL A;  4YK5 A;  3ABM C;  1D1A A;  3K1I C;  2J9W A;  4XPW A;  5T3W A;  4AX2 A;  1CGO A;  3AG3 C;  4MVZ A;  1BR1 A;  1I4Y A;  4CDV A;  5L0I A;  2IM8 A;  3RKO F;  3SP1 A;  4UDV A;  1TWG A;  2ZD9 A;  3M4C A;  4AE4 B;  3O6X A;  3HNK A;  1BR4 A;  2WZL A;  1GQA A;  1LM3 B;  3EGD B;  4U5E E;  3CZ6 A;  4HE8 D;  4JTA B;  3IQT A;  3FDQ A;  1HE1 A;  2L9J A;  2YVK A;  4B6I A;  3LUT B;  3M1C B;  1MQV A;  1VB5 A;  4EIY A;  3ZWI A;  2W4B A;  1NU9 C;  1E83 A;  4JZA A;  4BJ5 C;  4CJO A;  5KYW B;  3QMK A;  1V74 B;  2XL8 A;  4G0H A;  3SZR A;  3QVY A;  1RKE B;  2XLH A;  4MND A;  5A6K A;  3C8G A;  3RVZ A;  4K7B A;  5JP7 A;  4DVZ A;  2XXA A;  3G4Z A;  3HNJ A;  3DI5 A;  3NG1 A;  4PJL A;  4Z9I A;  2R9R B;  3DM9 B;  3TJ6 A;  4XQ1 A;  4YT5 A;  4CS9 A;  4D4X A;  1JPJ A;  5CI9 A;  5CIV A;  5EHH A;  5DS6 A;  2M4E A;  4BJ6 C;  2R7R A;  1H9T A;  4O6N A;  1D1B A;  2ZXR A;  2JPU A;  2VH3 A;  1MMA A;  1G4U S;  3MYF A;  3C18 A;  2J46 A;  1QZX A;  2H7B A;  3C8G D;  3NMI A;  2JX0 A;  1LIH A;  2R02 A;  1VYK A;  4N4W A;  5B1A C;  4AE4 A;  2KK1 A;  5BQI A;  4YT4 A;  4XTK A;  4KI2 A;  4CDA A;  3EHN A;  1CGM E;  5BQH A;  4I3M A;  3NKE A;  2KC3 A;  3LAY A;  2EIK C;  1Z3I X;  2HJM A;  4XWJ A;  3CAX A;  5A6J A;  4J7Y A;  1RMV A;  4O79 A;  1Y4C A;  2DYS C;  2MYS A;  3JZ0 A;  3OA1 A;  3U9J A;  1V55 C;  3GM3 A;  4N6C A;  3TQO A;  4DOZ A;  2EIL C;  4GQH A;  4RDA A;  5T3T A;  3ZSU A;  2XRH A;  4YT2 A;  4J30 B;  3E70 C;  3TOL A;  1O5H A;  3L1M A;  2R7X A;  1N1C A;  1C17 M;  2XLD A;  3JRT A;  3GM1 A;  2YLD A;  3EG9 B;  1H6G A;  4MVU A;  1UG7 A;  3EHM A;  3HLZ A;  5KYY B;  4D4N A;  2B0J A;  2ZXW C;  4CSA A;  3DMD A;  3T6B A;  3EH1 A;  5FCL A;  3WOD F;  4Q5S F;  5DS5 A;  2EPO A;  2XM0 A;  1PD0 A;  5DS4 A;  2KGO A;  2OCC C;  2M64 A;  1FAP B;  4K0D A;  1D0Y A;  1MNE A;  4JW1 A;  3U5S A;  5DVW A;  2AU5 A;  5F5F A;  4A2N B;  2EPN A;  4G7Z F;  2J9B A;  4M63 A;  5KYY A;  5JLI A;  4E7S A;  3TUL A;  1A0B A;  3NYM A;  4NCQ A;  3LNR A;  4E7Z A;  3DE8 A;  4W8K A;  1O87 A;  3AQB A;  4RBN A;  4YL0 A;  3RQE A;  1E2X A;  3JTL O;  4ZLD A;  1YAR O;  4JVS A;  4BJ6 A;  4HFK B;  1OKK A;  2Q9C A;  3NMJ A;  4GEH A;  3IPM O;  3V5Y A;  3W4Y A;  4HEA J;  1XWJ A;  2B0H A;  3VYW A;  1OXK A;  4BJ1 A;  2NSG A;  3ABK C;  3HTK C;  3U8P A;  4JIO A;  3U0C A;  2V26 A;  1EA8 A;  3KYJ A;  3T6J A;  2IBF A;  5L0F A;  1NLX A;  2PX3 A;  1Q0F A;  4PFP A;  1T5O A;  3N2Z B;  2VAS A;  2XL6 A;  1OCZ C;  4XLP F;  3K66 A;  3GEH A;  3MLG A;  1ZU5 A;  4JRZ A;  2GFH A;  2NSF A;  1Z6A A;  3LLI A;  3NYJ A;  5COF A;  1LS1 A;  1RKE A;  3JSZ A;  1HMO A;  1Z7Q c;  2P6V A;  2QTV A;  3U2M A;  2IXN A;  4OIN F;  3LLK A;  1B68 A;  3OWT A;  1OW8 A;  5T1D B;  3C7J A;  3JCU Q;  3MX3 A;  2RSE B;  4MTG A;  4MTO A;  5K0I A;  4CS9 C;  1ZW3 A;  2OKU A;  5JVE A;  2GDC A;  2H8A A;  2VC9 A;  2GAQ A;  3KPH A;  1NSG B;  4P9F A;  5L0D A;  3Q7L A;  3U3B A;  2BL2 A;  3DZA A;  3RQF A;  2LCH A;  1YJG A;  1CPR A;  1YA9 A;  1PV3 A;  1FR0 A;  1QLE C;  2Q9B A;  3C8G B;  3AOU A;  5AC4 A;  2CW0 F;  3H2V A;  2EIJ C;  2LP4 A;  1HW2 A;  4CS8 A;  2AWY A;  1T6Q A;  4MVR A;  3AG4 C;  2PF4 E;  2R25 A;  3RW0 A;  3QZC A;  1OKK D;  5A69 A;  1BZ4 A;  3DAF A;  1H9G A;  3DWW A;  4E18 A;  4LLE A;  3KL4 A;  1KNY A;  3B0U X;  3S90 A;  4KC9 A;  3U8V A;  2Z15 A;  1LE2 A;  2VCB A;  3E9V A;  3JYH A;  4FWV A;  4PR9 A;  3AGT A;  3LEO A;  2OJE D;  5B1B C;  1IZM A;  4E0H A;  4DBR A;  2XLO A;  4O6Y A;  1KU2 A;  5KYX A;  4YJW A;  4AL0 A;  1V4A A;  1FNT c;  1VOM A;  4H54 A;  2YRF A;  3I5Q A;  2J8W A;  2XLW A;  2R05 A;  3K1H A;  1BDJ B;  1OCC C;  2R7T A;  3US6 A;  1GGQ A;  2NPU A;  2O9X A;  2KJG A; 
#chains in the Genus database with same CATH homology
 4AL1 A;  4NTF A;  2UUH A;  4JC7 A;  2UUI A;  5BQH A;  4WAB A;  4YL1 A;  3B29 A;  3PCV A;  4JCZ A;  2Q7R A;  4J7Y A;  4YL3 A;  3DWW A;  4NTA A;  4JRZ A;  4YK5 A;  2PNO A;  4BPM A;  3LEO A;  5K0I A;  4YL0 A;  2H8A A;  4NTB A;  4AL0 A;  5HV9 A;  5BQG A;  4J7T A;  3HKK A;  5BQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...