2OQMA

Crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
180
structure length
180
Chain Sequence
HHENLYFQGMLYDLTVVQFSKMLKNLNAIFDKAEAFAELKKVDMDVLLNSRLAADQFNLIRQVQIACDTAKVGVARLTGQLETAPKHDDSETTLAELRQRIASVLTYLEGFSEADFANAATIQISQPRWQGKYLTGYEFAIEHAIPNLYFHITTAYGILRHNGVEVGKKDYLGAMPYKAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (YP_561575.1) from Shewanella denitrificans OS-217 at 1.83 A resolution
rcsb
source organism Shewanella denitrificans
molecule tags Unknown function
molecule keywords Hypothetical protein
total genus 61
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09351 DUF1993 Domain of unknown function (DUF1993)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2oqmA01
3DKAA 5COFA 2P1AA 2NSGA 5COGA 5COMA 2YQYA 2NSFA 5CIVA 2QNLA 3DI5A 2F22A 3CEXA 2OQMA 2QE9A 1RXQA 4N6CA 3GORA 2HKVA 2RD9A 3QTHA 2OU6A
chains in the Genus database with same CATH superfamily
1OCCC 256BA 2YLGA 3EPVA 4YK5A 3SXYA 4DBQA 2XL8A 3FVYA 2J46A 1HW1A 4BJ5A 5A69A 3DM9B 5E33A 2W9YA 1CGME 4IB4A 3C8GA 3O55A 4AL1A 2H8AA 3L8IA 3TOMA 3U2MA 2G62A 2KC3A 4U5DE 2P0NA 1G5ZA 4B6IA 4G7ZF 4DRIB 1FMVA 1D0YA 3MLGA 2XLHA 2Y69C 4YT8A 4QI0A 4CS9C 3K6BA 2QE9A 1RXQA 4NCQA 3S27A 4JKVA 3UMIA 2NUPA 3B71A 2YL1A 5KYWB 1RMVA 3A9CA 4MTGA 3GEHA 3LJBA 1MMNA 4H54A 4RD9A 3AQBA 3NKEA 3U9MA 2D5RB 5JUAA 1M2VB 4Q7CA 2Q00A 3GEIA 3GWNA 2KYHA 3TJ5A 3POVA 3EJNA 4WABA 4BJ6C 4HEAJ 2LK4A 3TULA 5T3WA 5DS5A 3V5ZA 1SYQA 1B68A 1JPJA 2LP4A 4OD4A 4Z9HA 5DLJA 5JRAA 4MVMA 1AUEA 2AU5A 3LLKA 4HFFB 5COMA 5TJ5E 5F28E 1RJ9B 3O10A 4Z9JA 1LI5A 3I4UA 2EIKC 4HE8D 5D92A 1QLEC 2DYSC 3U0CA 1QQ3A 3IQ5A 3FMSA 3C62A 4DXWA 1JRAA 2Q9AA 4OIQF 2OKUA 3DZAA 1KTMA 3H65A 1Z7Qc 2XL4A 5HV9A 3U5SA 2KW3C 4JCHA 2HJ3A 3EG9A 2WVNA 1XWJA 4KC9A 2QY9A 3AG1C 3ASNC 3E9VA 4C3EA 2R02A 1A7EA 1ZHWA 4CJGA 3L8JA 2G3VA 2VH3A 3A11A 2ZXOA 1M6TA 1O3UA 3DAFA 5L0IA 4CSAA 3ABKC 1IZMA 3HNLA 2XXAB 1J8MF 2NUTA 4IGGA 3HJCA 1A7DA 1K04A 1Q0MA 4XQ1A 3ZTZA 4Q5SF 1NU9C 2ZXRA 3DJUB 2R7QA 3DXJF 2JD3A 2H7OA 2I15A 3OEOA 3KH2A 4ANJA 3EFOA 2HS5A 3X2QC 1M2OA 3DM5A 3TK0A 1A0BA 2DGJA 3G4XA 2IM8A 2P61A 2YLDA 3UNGC 4CS9A 1KU2A 4E0IA 1TWHA 3KYJA 4PJJA 2G3KA 3BRJA 2C04A 3R7CA 2FFHA 4ULWA 4DVZA 3S84A 1FNTc 5KYYA 5A6BA 3T6BA 1ZU4A 5T3TA 2W4MA 2RD9A 4NTAA 3QTHA 4DJ9A 1BZ4A 1WATA 2VASA 3JYHA 4DOZA 3SXKA 4JTCB 1ZHTA 1LKXA 3GANA 4M63A 2CGEA 2L7AA 5CI9A 3IEEA 1BBHA 3S9OA 1V54C 2YL3A 2MWQA 2KNHA 3EZIA 2WL8A 3FHDA 4IAOA 5A6AA 2DB4A 1LM3B 1U89A 2ETSA 3TQOA 3QVZA 3S28A 5L3VA 1ZHYA 2OQMA 1VMAA 2R7TA 4NTBA 3I5QA 3L34A 1T5OA 1YARO 1LVKA 2C03A 1L7CA 3ABLC 1JMWA 4MW8A 5T1DB 1TWCA 4YL0A 1OXBA 4XWJA 4YJWA 1C03A 3ECSA 3L0IA 4DRJB 4K1OA 4EKWA 1O87A 2CNWD 4NY3A 4LDRA 3LAYA 3LNRA 2X0CA 3AGTA 2A68F 1YJGA 2OU6A 3ASOC 2Y3HA 1HE1A 2KK1A 2PFDA 2PNOA 3QMKA 5EGYA 4MTFA 2AVKA 2LCHA 3DWWA 1ZU5A 1LIHA 1Z6AA 3W8IA 3RKOF 4NC3A 3UMKA 5B3IA 1I4YA 4G7OF 3G4ZA 3W8HA 2Q9CA 4PFPA 2NPUA 4D4NA 1DOWA 4BJ1A 2Y3GA 1WGWA 1O5HA 4N4WA 2AP3A 2CYDA 2FAPB 3TD7A 4CDAA 4DVYP 3AQCA 3MYIA 3ZG1A 5BUOA 3EZHA 4MVZA 5KYXB 3RQGA 4LLCA 5KYWA 3UMHA 4AE4B 1YYJA 2KJGA 4IRUA 2J7PA 2OJQA 1G8XA 2YEVA 4XLNF 3H2VA 1G4US 5EHHA 1FFHA 1TFKB 4EBBA 1HW2A 1U6HA 4PR9A 1EQ1A 3GODA 3JSEO 3AG4C 4NQFA 3T6JA 1AEPA 1UG7A 3ZIBA 2J9VA 4YN0B 2PBEA 3VAYA 4YWQA 3DI5A 2F22A 1L3PA 1ZZPA 3GWLA 3IQTA 5AGFA 3SP1A 2XS1A 4AE4A 2HSQA 5EK0A 1BR4A 2M64A 1GS9A 4U9DA 1OR2A 3B29A 2YZSA 1EA8A 2B0JA 2CNWA 3FAPB 3US6A 4D4XA 4LDKA 4C7OB 1NSGB 4KNWA 3IQCA 3NRHA 3K1HA 2PF4E 2XM0A 2AWYA 3RVYA 5L0JA 4MVSA 2R7RA 4R32A 2CW0F 3ATPA 1OW6A 4O79A 4OIRF 1Y6DA 5DQZA 1U0BB 3MBGA 4JZAA 3HNJA 4LACB 4XEVA 3DKAA 1T6UA 4U9EA 2IBFA 1SZIA 2A0UA 3GM3A 3NMIA 1NLXA 3UGOA 3KMIA 4JRZA 3UGPA 4C7OA 2R7OA 2LQGA 4CSAC 1MMAA 2EIJC 2ICWG 3IQ6A 2NUPB 4OIOF 4K0DA 3Q7LA 3O39A 5B1BC 3B0PA 4KI2A 2B0HA 2R03A 2KSFA 2EPKX 4XEKA 3QZCA 4XPXA 1T01A 3PDMP 2WZFA 2ASRA 4H4KC 1OW8A 4U5GA 4W8KA 4ZLDA 2HZ8A 2VCAA 3DD7A 3ZDLA 4CS8C 1C17M 5B3SC 3KPHA 4BJTA 4BEJA 1WWPA 4N6CA 2CDQA 3H2UA 1T9KA 2Y3BA 4PJNA 3RVZA 4QI2A 4XPWA 3LEVA 3S0XA 1QKRA 2XLMA 4ONSA 2X51A 5KYXA 2XLWA 4G0HA 3RIPA 1Y4CA 2VCCA 2EIMC 1XZQA 4J32B 2A6HF 1H6GA 4IWBA 4EBKA 2WB7A 3MFNA 1R5ID 4UDVA 3Q7GA 5BQGA 4JTAB 4I1MA 1YLMA 2EPOA 4I44A 1Q0GA 4U5HA 2TMVP 3SEOA 3CSKA 3ZWIA 4MS2A 3MYFA 1OCOC 2E87A 4E0HA 4JIOA 2LSEA 4KNVA 1E86A 3M15A 3SNHA 2HKVA 1LS4A 2H7VC 3K1IA 4L6RA 1YDIA 1GQAA 2A0BA 2W45A 4JJFA 3ZSUA 3KKBA 2LD6A 4J7YA 5DVWA 1RJ9A 2J7PD 1VLTA 4JCZA 4MVRA 2XL6A 1D1CA 2HV6A 1ZHXA 2PX3A 3K1IC 2HFIA 2XLVA 3S29A 3U8VA 2UUHA 5IY5C 5CI8A 5L3QA 1CPRA 1YA7O 3ABMC 3O6XA 2Q7RA 3M4CA 3GEEA 2GDCA 1M56C 4AL0A 4PJLA 1SMYF 3HKKA 1VK5A 2MYSA 2R25A 5A6KA 1TR2A 4CS8A 4EWCA 4G78A 1WTYA 3EFOB 1V55C 3M79A 4LLEA 1VTMP 3FAJA 1XZPA 4J7TA 3WG7C 3ZVRA 1M2VA 1V74B 1A41A 3EQLF 4FAPB 4EIYA 1YZAA 3RFYA 1NFNA 2R9RB 4JE9A 1VB5A 2WZGA 5D91A 1CGOA 1HMOA 1OCZC 1NBBA 2CCYA 2VC9A 1HY5A 2OEXA 2ZXPA 3CZ6A 1MQVA 3LNMB 3N0TA 1LI7A 2L9JA 3K33A 2W4BA 4JURI 2XXAA 1APCA 3C7JA 1ORSC 5KYYB 1ZW3A 2WVOA 1NZEA 1D0ZA 2BL2A 3VRCA 4F4BA 3U9JA 4AK9A 1E84A 1VOMA 2V26A 3R2PA 2LFFA 1NU7D 3KYIA 3NYMA 2NSFA 4ZLCA 5E3AA 5KYNA 2IXPA 2VCBA 2OOCA 2FGYA 1Z3IX 2GFHA 2A69F 3LLIA 3I5PA 2DI3A 1M57C 2XSEA 3N24A 4EBJA 3AJMA 1DOVA 5JP7A 3U3BA 3VM6A 1LS1A 2Q4FA 3X1OA 4CJOA 1YAUO 3LS1A 4IAQA 4E7SA 2BC5A 2L81A 4RDAA 3RW0A 3DMDA 1RKCA 2UUIA 1SR2A 2IXNA 2R7WA 3LESA 2ZD9A 1JAFA 3VYWA 4MQ9F 4P9FA 3AOUA 4MTOA 5HSWA 2YHSA 2NG1A 3AG3C 1ZYRF 1Q0KA 3JYYA 4EHPA 2R05A 4JW1A 3B9QA 1BR1A 3NYJA 4WGZA 5BQHA 2YKZA 2P6VA 5A6BD 5CIVA 1OXKA 3OWTA 3V5XA 4BEMJ 1W2WA 5L0FA 2XM4A 3PCVA 1VLSA 5JVEA 3HLZA 4CIPA 2QLAA 1TFOB 4JJGA 4E18A 2J9WA 3LUTB 1HMDA 3W2VA 4FWVA 4O7GA 2EINC 3ZC4A 3FDQA 2H7BA 3EH1A 4YT4A 1Z63A 4E7ZA 4QDLA 3PMRA 2HMZA 1YYXA 3RQFA 2J45A 4AX2A 2XLOA 3DE8A 3E70C 1JOGA 5FCLA 1OKKA 4Q4ZF 4W8PA 2GA0A 2Q3TA 3OA1A 1LE2A 2Q9BA 3U2LA 3WAQA 2GWWA 2XLDA 5COFA 5JLIA 1FMWA 1LE4A 2J0XA 3ITFA 1YZCA 3IHUA 3JCUQ 2YQYA 5JSLA 4PFOA 1TWGA 1KNYA 4Z9IA 4OD5A 2QNLA 1Z5ZA 1JPNA 4WGYA 4CX9A 3N2ZB 3U3FA 2OEVA 4PK4A 1JR8A 1QVXA 4U5FE 3EGXB 3U8PA 1BR2A 3JSZA 3SXMA 3C8GD 4XPYA 2V3CC 2DYRC 4CDVA 4P6IC 5E3CA 4GEHA 4JVSA 4O6MA 3JRTA 5KYUB 1H9TA 3M1CB 3C63A 1D0XA 3W4YA 1MNEA 3IPMO 3RH3A 5L0GA 2EPMX 3EHMA 4DBRA 1QPUA 1ZW2A 2GAQA 1EI7A 1A7VA 1PD0A 1YA9A 4FESA 1D1AA 3NG1A 1ZVZA 4YL1A 5JT4A 2OG2A 4CS7A 1MMDA 2Z15A 3RYLA 2J0WA 5AC4A 2NSGA 3ZQVA 1G4WR 2OCCC 5COGA 3QVYA 1OR3A 4KBLA 3C18A 3J06A 2YVKA 1GM5A 4N06A 1OW7A 4K7BA 2AWCA 3PHF2 3TJ6A 4CIHA 4C3DA 2EPNA 3F47A 3T4RA 4MVQA 4YT5A 1WOLA 1S05A 3K66A 3FOOA 1N1CA 1HE9A 2ZPAA 1ORJA 3V7OA 3WODF 4XTKA 3EG9B 4CDYA 3B0UX 3UR3C 1V4AA 2HV7A 4E17A 4X0RA 4OIPF 5B1AC 3DJNB 3EGDB 4LDQA 4MVUA 4JEBA 4WJ0A 3SYNA 3RF3A 4EUKB 3JTLO 3MX3A 1RKEB 4XLPF 3GORA 3NDBB 5E2QA 4G7HF 3B0VC 3NYLA 5L0HA 2QUPA 2EILC 2Y3DA 3K7DA 4FX5A 1VYIA 2R7UA 4I3MA 3RQEA 3G50A 1PCXA 2R7SA 3F46A 2D4UA 4C3BA 2P1AA 4PACA 1FAPB 4MW3A 4OINF 3TOLA 2KGOA 3EHNA 3WHNA 1K05A 3HNKA 1H7IA 5F5FA 1T6IA 1TKNA 1AVOB 3KL4A 1RKEA 1F1MA 3CEXA 2WZLA 5L0DA 5K0IA 2O9XA 2YL7A 2A1DD 3NKDA 4N6HA 5GPGB 2WVQA 3JT1A 3VF0A 5BQIA 2YWAA 2J9UA 3DE9A 1FTSA 3HNIA 3M4BA 1OQCA 2NUTB 3GM2A 4PJMA 3T9OA 2QTVA 4U5EE 3S90A 1J8YF 2JPUA 5DQTA 2VB6A 1Q0FA 4RBNA 3EGXA 1E83A 1H9GA 4A4AA 2ZXWC 3JRMO 2XLEA 1WASA 2LIGA 5DS4A 2IOQA 1PV3A 2MHRA 1I4ZA 1OCRC 1S7ZA 2M4EA 3LS0A 4J30B 4JC7A 2BE5F 1SF8A 3EGDA 3Q6NA 1FFTC 1CGNA 2HUJA 4BJ5C 2L6GA 3EH2A 3W2WA 2JX0A 4YT2A 4IJJA 5AC5A 1PD1A 2YLIA 4U5CE 1MMGA 1T6QA 4BG0A 3NMJA 3QW1A 3T6GB 2L6HA 2IYLD 1ZHZA 5DS6A 1E85A 3Q6MA 1OKKD 1QSPA 1UFBA 2IXMA 1C02A 3DAGA 3FOPA 2I8BA 3GM1A 3V5YA 5KYUA 4NTFA 1K40A 3NMKA 4P9TA 4BPMA 3BEHA 1MNDA 1ORYA 1VYKA 4LERA 3ZTMA 2L6FA 4ER9A 2R7XA 1LPEA 1GGQA 2KQ9A 2PX0A 2RSEB 1Z23A 2LFDA 4IARA 4ULVA 1IW7F 1QZXA 5A6JA 1YVIA 4U5BE 2YL0A 4GYTA 3JZ0A 1Q0DA 1R4TA 2OJED 3QW0A 3SXZA 5F5HA 1WN0A 1TQGA 4A2NB 4BJ6A 2HMQA 4CBEA 1ST6A 4DRHB 2HJMA 2J9BA 3ZQYA 1EKYA 1FR0A 3AG2C 1TWAA 2Y39A 3FXHA 5FZTA 4MNDA 1CPQA 4I1OB 2P7VA 4JTDB 5JS5A 4GQHA 1E2XA 3HTKC 3L1MA 4HFKB 5L0CA 2XRHA 2EPLX 1D1BA 4O6NA 4MVOA 1NG1A 3C8GB 1BDJB 1I5NA 1RCPA 2PP4A 2A6EF 2YRFA 3CAXA 3CQZA 2XS8A 3LEOA 4XEFA 2J8WA 2R7VA 2HSBA 4O6YA 2IXOA 3SZRA 1NFOA 4JEAA 3C8ZA 3AGUA 4YL3A
chains in the Genus database with same CATH topology
3DKAA 5COFA 2P1AA 2NSGA 5COGA 5COMA 2YQYA 2NSFA 5CIVA 2QNLA 3DI5A 2F22A 3CEXA 2OQMA 2QE9A 1RXQA 4N6CA 3GORA 2HKVA 2RD9A 3QTHA 2OU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKA A;  5COF A;  2P1A A;  2NSG A;  5COG A;  5COM A;  2YQY A;  2NSF A;  5CIV A;  2QNL A;  3DI5 A;  2F22 A;  3CEX A;  2OQM A;  2QE9 A;  1RXQ A;  4N6C A;  3GOR A;  2HKV A;  2RD9 A;  3QTH A;  2OU6 A; 
#chains in the Genus database with same CATH topology
 1OCC C;  256B A;  2YLG A;  3EPV A;  4YK5 A;  3SXY A;  4DBQ A;  2XL8 A;  3FVY A;  2J46 A;  1HW1 A;  4BJ5 A;  5A69 A;  3DM9 B;  5E33 A;  2W9Y A;  1CGM E;  4IB4 A;  3C8G A;  3O55 A;  4AL1 A;  2H8A A;  3L8I A;  3TOM A;  3U2M A;  2G62 A;  2KC3 A;  4U5D E;  2P0N A;  1G5Z A;  4B6I A;  4G7Z F;  4DRI B;  1FMV A;  1D0Y A;  3MLG A;  2XLH A;  2Y69 C;  4YT8 A;  4QI0 A;  4CS9 C;  3K6B A;  2QE9 A;  1RXQ A;  4NCQ A;  3S27 A;  4JKV A;  3UMI A;  2NUP A;  3B71 A;  2YL1 A;  5KYW B;  1RMV A;  3A9C A;  4MTG A;  3GEH A;  3LJB A;  1MMN A;  4H54 A;  4RD9 A;  3AQB A;  3NKE A;  3U9M A;  2D5R B;  5JUA A;  1M2V B;  4Q7C A;  2Q00 A;  3GEI A;  3GWN A;  2KYH A;  3TJ5 A;  3POV A;  3EJN A;  4WAB A;  4BJ6 C;  4HEA J;  2LK4 A;  3TUL A;  5T3W A;  5DS5 A;  3V5Z A;  1SYQ A;  1B68 A;  1JPJ A;  2LP4 A;  4OD4 A;  4Z9H A;  5DLJ A;  5JRA A;  4MVM A;  1AUE A;  2AU5 A;  3LLK A;  4HFF B;  5COM A;  5TJ5 E;  5F28 E;  1RJ9 B;  3O10 A;  4Z9J A;  1LI5 A;  3I4U A;  2EIK C;  4HE8 D;  5D92 A;  1QLE C;  2DYS C;  3U0C A;  1QQ3 A;  3IQ5 A;  3FMS A;  3C62 A;  4DXW A;  1JRA A;  2Q9A A;  4OIQ F;  2OKU A;  3DZA A;  1KTM A;  3H65 A;  1Z7Q c;  2XL4 A;  5HV9 A;  3U5S A;  2KW3 C;  4JCH A;  2HJ3 A;  3EG9 A;  2WVN A;  1XWJ A;  4KC9 A;  2QY9 A;  3AG1 C;  3ASN C;  3E9V A;  4C3E A;  2R02 A;  1A7E A;  1ZHW A;  4CJG A;  3L8J A;  2G3V A;  2VH3 A;  3A11 A;  2ZXO A;  1M6T A;  1O3U A;  3DAF A;  5L0I A;  4CSA A;  3ABK C;  1IZM A;  3HNL A;  2XXA B;  1J8M F;  2NUT A;  4IGG A;  3HJC A;  1A7D A;  1K04 A;  1Q0M A;  4XQ1 A;  3ZTZ A;  4Q5S F;  1NU9 C;  2ZXR A;  3DJU B;  2R7Q A;  3DXJ F;  2JD3 A;  2H7O A;  2I15 A;  3OEO A;  3KH2 A;  4ANJ A;  3EFO A;  2HS5 A;  3X2Q C;  1M2O A;  3DM5 A;  3TK0 A;  1A0B A;  2DGJ A;  3G4X A;  2IM8 A;  2P61 A;  2YLD A;  3UNG C;  4CS9 A;  1KU2 A;  4E0I A;  1TWH A;  3KYJ A;  4PJJ A;  2G3K A;  3BRJ A;  2C04 A;  3R7C A;  2FFH A;  4ULW A;  4DVZ A;  3S84 A;  1FNT c;  5KYY A;  5A6B A;  3T6B A;  1ZU4 A;  5T3T A;  2W4M A;  2RD9 A;  4NTA A;  3QTH A;  4DJ9 A;  1BZ4 A;  1WAT A;  2VAS A;  3JYH A;  4DOZ A;  3SXK A;  4JTC B;  1ZHT A;  1LKX A;  3GAN A;  4M63 A;  2CGE A;  2L7A A;  5CI9 A;  3IEE A;  1BBH A;  3S9O A;  1V54 C;  2YL3 A;  2MWQ A;  2KNH A;  3EZI A;  2WL8 A;  3FHD A;  4IAO A;  5A6A A;  2DB4 A;  1LM3 B;  1U89 A;  2ETS A;  3TQO A;  3QVZ A;  3S28 A;  5L3V A;  1ZHY A;  2OQM A;  1VMA A;  2R7T A;  4NTB A;  3I5Q A;  3L34 A;  1T5O A;  1YAR O;  1LVK A;  2C03 A;  1L7C A;  3ABL C;  1JMW A;  4MW8 A;  5T1D B;  1TWC A;  4YL0 A;  1OXB A;  4XWJ A;  4YJW A;  1C03 A;  3ECS A;  3L0I A;  4DRJ B;  4K1O A;  4EKW A;  1O87 A;  2CNW D;  4NY3 A;  4LDR A;  3LAY A;  3LNR A;  2X0C A;  3AGT A;  2A68 F;  1YJG A;  2OU6 A;  3ASO C;  2Y3H A;  1HE1 A;  2KK1 A;  2PFD A;  2PNO A;  3QMK A;  5EGY A;  4MTF A;  2AVK A;  2LCH A;  3DWW A;  1ZU5 A;  1LIH A;  1Z6A A;  3W8I A;  3RKO F;  4NC3 A;  3UMK A;  5B3I A;  1I4Y A;  4G7O F;  3G4Z A;  3W8H A;  2Q9C A;  4PFP A;  2NPU A;  4D4N A;  1DOW A;  4BJ1 A;  2Y3G A;  1WGW A;  1O5H A;  4N4W A;  2AP3 A;  2CYD A;  2FAP B;  3TD7 A;  4CDA A;  4DVY P;  3AQC A;  3MYI A;  3ZG1 A;  5BUO A;  3EZH A;  4MVZ A;  5KYX B;  3RQG A;  4LLC A;  5KYW A;  3UMH A;  4AE4 B;  1YYJ A;  2KJG A;  4IRU A;  2J7P A;  2OJQ A;  1G8X A;  2YEV A;  4XLN F;  3H2V A;  1G4U S;  5EHH A;  1FFH A;  1TFK B;  4EBB A;  1HW2 A;  1U6H A;  4PR9 A;  1EQ1 A;  3GOD A;  3JSE O;  3AG4 C;  4NQF A;  3T6J A;  1AEP A;  1UG7 A;  3ZIB A;  2J9V A;  4YN0 B;  2PBE A;  3VAY A;  4YWQ A;  3DI5 A;  2F22 A;  1L3P A;  1ZZP A;  3GWL A;  3IQT A;  5AGF A;  3SP1 A;  2XS1 A;  4AE4 A;  2HSQ A;  5EK0 A;  1BR4 A;  2M64 A;  1GS9 A;  4U9D A;  1OR2 A;  3B29 A;  2YZS A;  1EA8 A;  2B0J A;  2CNW A;  3FAP B;  3US6 A;  4D4X A;  4LDK A;  4C7O B;  1NSG B;  4KNW A;  3IQC A;  3NRH A;  3K1H A;  2PF4 E;  2XM0 A;  2AWY A;  3RVY A;  5L0J A;  4MVS A;  2R7R A;  4R32 A;  2CW0 F;  3ATP A;  1OW6 A;  4O79 A;  4OIR F;  1Y6D A;  5DQZ A;  1U0B B;  3MBG A;  4JZA A;  3HNJ A;  4LAC B;  4XEV A;  3DKA A;  1T6U A;  4U9E A;  2IBF A;  1SZI A;  2A0U A;  3GM3 A;  3NMI A;  1NLX A;  3UGO A;  3KMI A;  4JRZ A;  3UGP A;  4C7O A;  2R7O A;  2LQG A;  4CSA C;  1MMA A;  2EIJ C;  2ICW G;  3IQ6 A;  2NUP B;  4OIO F;  4K0D A;  3Q7L A;  3O39 A;  5B1B C;  3B0P A;  4KI2 A;  2B0H A;  2R03 A;  2KSF A;  2EPK X;  4XEK A;  3QZC A;  4XPX A;  1T01 A;  3PDM P;  2WZF A;  2ASR A;  4H4K C;  1OW8 A;  4U5G A;  4W8K A;  4ZLD A;  2HZ8 A;  2VCA A;  3DD7 A;  3ZDL A;  4CS8 C;  1C17 M;  5B3S C;  3KPH A;  4BJT A;  4BEJ A;  1WWP A;  4N6C A;  2CDQ A;  3H2U A;  1T9K A;  2Y3B A;  4PJN A;  3RVZ A;  4QI2 A;  4XPW A;  3LEV A;  3S0X A;  1QKR A;  2XLM A;  4ONS A;  2X51 A;  5KYX A;  2XLW A;  4G0H A;  3RIP A;  1Y4C A;  2VCC A;  2EIM C;  1XZQ A;  4J32 B;  2A6H F;  1H6G A;  4IWB A;  4EBK A;  2WB7 A;  3MFN A;  1R5I D;  4UDV A;  3Q7G A;  5BQG A;  4JTA B;  4I1M A;  1YLM A;  2EPO A;  4I44 A;  1Q0G A;  4U5H A;  2TMV P;  3SEO A;  3CSK A;  3ZWI A;  4MS2 A;  3MYF A;  1OCO C;  2E87 A;  4E0H A;  4JIO A;  2LSE A;  4KNV A;  1E86 A;  3M15 A;  3SNH A;  2HKV A;  1LS4 A;  2H7V C;  3K1I A;  4L6R A;  1YDI A;  1GQA A;  2A0B A;  2W45 A;  4JJF A;  3ZSU A;  3KKB A;  2LD6 A;  4J7Y A;  5DVW A;  1RJ9 A;  2J7P D;  1VLT A;  4JCZ A;  4MVR A;  2XL6 A;  1D1C A;  2HV6 A;  1ZHX A;  2PX3 A;  3K1I C;  2HFI A;  2XLV A;  3S29 A;  3U8V A;  2UUH A;  5IY5 C;  5CI8 A;  5L3Q A;  1CPR A;  1YA7 O;  3ABM C;  3O6X A;  2Q7R A;  3M4C A;  3GEE A;  2GDC A;  1M56 C;  4AL0 A;  4PJL A;  1SMY F;  3HKK A;  1VK5 A;  2MYS A;  2R25 A;  5A6K A;  1TR2 A;  4CS8 A;  4EWC A;  4G78 A;  1WTY A;  3EFO B;  1V55 C;  3M79 A;  4LLE A;  1VTM P;  3FAJ A;  1XZP A;  4J7T A;  3WG7 C;  3ZVR A;  1M2V A;  1V74 B;  1A41 A;  3EQL F;  4FAP B;  4EIY A;  1YZA A;  3RFY A;  1NFN A;  2R9R B;  4JE9 A;  1VB5 A;  2WZG A;  5D91 A;  1CGO A;  1HMO A;  1OCZ C;  1NBB A;  2CCY A;  2VC9 A;  1HY5 A;  2OEX A;  2ZXP A;  3CZ6 A;  1MQV A;  3LNM B;  3N0T A;  1LI7 A;  2L9J A;  3K33 A;  2W4B A;  4JUR I;  2XXA A;  1APC A;  3C7J A;  1ORS C;  5KYY B;  1ZW3 A;  2WVO A;  1NZE A;  1D0Z A;  2BL2 A;  3VRC A;  4F4B A;  3U9J A;  4AK9 A;  1E84 A;  1VOM A;  2V26 A;  3R2P A;  2LFF A;  1NU7 D;  3KYI A;  3NYM A;  2NSF A;  4ZLC A;  5E3A A;  5KYN A;  2IXP A;  2VCB A;  2OOC A;  2FGY A;  1Z3I X;  2GFH A;  2A69 F;  3LLI A;  3I5P A;  2DI3 A;  1M57 C;  2XSE A;  3N24 A;  4EBJ A;  3AJM A;  1DOV A;  5JP7 A;  3U3B A;  3VM6 A;  1LS1 A;  2Q4F A;  3X1O A;  4CJO A;  1YAU O;  3LS1 A;  4IAQ A;  4E7S A;  2BC5 A;  2L81 A;  4RDA A;  3RW0 A;  3DMD A;  1RKC A;  2UUI A;  1SR2 A;  2IXN A;  2R7W A;  3LES A;  2ZD9 A;  1JAF A;  3VYW A;  4MQ9 F;  4P9F A;  3AOU A;  4MTO A;  5HSW A;  2YHS A;  2NG1 A;  3AG3 C;  1ZYR F;  1Q0K A;  3JYY A;  4EHP A;  2R05 A;  4JW1 A;  3B9Q A;  1BR1 A;  3NYJ A;  4WGZ A;  5BQH A;  2YKZ A;  2P6V A;  5A6B D;  5CIV A;  1OXK A;  3OWT A;  3V5X A;  4BEM J;  1W2W A;  5L0F A;  2XM4 A;  3PCV A;  1VLS A;  5JVE A;  3HLZ A;  4CIP A;  2QLA A;  1TFO B;  4JJG A;  4E18 A;  2J9W A;  3LUT B;  1HMD A;  3W2V A;  4FWV A;  4O7G A;  2EIN C;  3ZC4 A;  3FDQ A;  2H7B A;  3EH1 A;  4YT4 A;  1Z63 A;  4E7Z A;  4QDL A;  3PMR A;  2HMZ A;  1YYX A;  3RQF A;  2J45 A;  4AX2 A;  2XLO A;  3DE8 A;  3E70 C;  1JOG A;  5FCL A;  1OKK A;  4Q4Z F;  4W8P A;  2GA0 A;  2Q3T A;  3OA1 A;  1LE2 A;  2Q9B A;  3U2L A;  3WAQ A;  2GWW A;  2XLD A;  5COF A;  5JLI A;  1FMW A;  1LE4 A;  2J0X A;  3ITF A;  1YZC A;  3IHU A;  3JCU Q;  2YQY A;  5JSL A;  4PFO A;  1TWG A;  1KNY A;  4Z9I A;  4OD5 A;  2QNL A;  1Z5Z A;  1JPN A;  4WGY A;  4CX9 A;  3N2Z B;  3U3F A;  2OEV A;  4PK4 A;  1JR8 A;  1QVX A;  4U5F E;  3EGX B;  3U8P A;  1BR2 A;  3JSZ A;  3SXM A;  3C8G D;  4XPY A;  2V3C C;  2DYR C;  4CDV A;  4P6I C;  5E3C A;  4GEH A;  4JVS A;  4O6M A;  3JRT A;  5KYU B;  1H9T A;  3M1C B;  3C63 A;  1D0X A;  3W4Y A;  1MNE A;  3IPM O;  3RH3 A;  5L0G A;  2EPM X;  3EHM A;  4DBR A;  1QPU A;  1ZW2 A;  2GAQ A;  1EI7 A;  1A7V A;  1PD0 A;  1YA9 A;  4FES A;  1D1A A;  3NG1 A;  1ZVZ A;  4YL1 A;  5JT4 A;  2OG2 A;  4CS7 A;  1MMD A;  2Z15 A;  3RYL A;  2J0W A;  5AC4 A;  2NSG A;  3ZQV A;  1G4W R;  2OCC C;  5COG A;  3QVY A;  1OR3 A;  4KBL A;  3C18 A;  3J06 A;  2YVK A;  1GM5 A;  4N06 A;  1OW7 A;  4K7B A;  2AWC A;  3PHF 2;  3TJ6 A;  4CIH A;  4C3D A;  2EPN A;  3F47 A;  3T4R A;  4MVQ A;  4YT5 A;  1WOL A;  1S05 A;  3K66 A;  3FOO A;  1N1C A;  1HE9 A;  2ZPA A;  1ORJ A;  3V7O A;  3WOD F;  4XTK A;  3EG9 B;  4CDY A;  3B0U X;  3UR3 C;  1V4A A;  2HV7 A;  4E17 A;  4X0R A;  4OIP F;  5B1A C;  3DJN B;  3EGD B;  4LDQ A;  4MVU A;  4JEB A;  4WJ0 A;  3SYN A;  3RF3 A;  4EUK B;  3JTL O;  3MX3 A;  1RKE B;  4XLP F;  3GOR A;  3NDB B;  5E2Q A;  4G7H F;  3B0V C;  3NYL A;  5L0H A;  2QUP A;  2EIL C;  2Y3D A;  3K7D A;  4FX5 A;  1VYI A;  2R7U A;  4I3M A;  3RQE A;  3G50 A;  1PCX A;  2R7S A;  3F46 A;  2D4U A;  4C3B A;  2P1A A;  4PAC A;  1FAP B;  4MW3 A;  4OIN F;  3TOL A;  2KGO A;  3EHN A;  3WHN A;  1K05 A;  3HNK A;  1H7I A;  5F5F A;  1T6I A;  1TKN A;  1AVO B;  3KL4 A;  1RKE A;  1F1M A;  3CEX A;  2WZL A;  5L0D A;  5K0I A;  2O9X A;  2YL7 A;  2A1D D;  3NKD A;  4N6H A;  5GPG B;  2WVQ A;  3JT1 A;  3VF0 A;  5BQI A;  2YWA A;  2J9U A;  3DE9 A;  1FTS A;  3HNI A;  3M4B A;  1OQC A;  2NUT B;  3GM2 A;  4PJM A;  3T9O A;  2QTV A;  4U5E E;  3S90 A;  1J8Y F;  2JPU A;  5DQT A;  2VB6 A;  1Q0F A;  4RBN A;  3EGX A;  1E83 A;  1H9G A;  4A4A A;  2ZXW C;  3JRM O;  2XLE A;  1WAS A;  2LIG A;  5DS4 A;  2IOQ A;  1PV3 A;  2MHR A;  1I4Z A;  1OCR C;  1S7Z A;  2M4E A;  3LS0 A;  4J30 B;  4JC7 A;  2BE5 F;  1SF8 A;  3EGD A;  3Q6N A;  1FFT C;  1CGN A;  2HUJ A;  4BJ5 C;  2L6G A;  3EH2 A;  3W2W A;  2JX0 A;  4YT2 A;  4IJJ A;  5AC5 A;  1PD1 A;  2YLI A;  4U5C E;  1MMG A;  1T6Q A;  4BG0 A;  3NMJ A;  3QW1 A;  3T6G B;  2L6H A;  2IYL D;  1ZHZ A;  5DS6 A;  1E85 A;  3Q6M A;  1OKK D;  1QSP A;  1UFB A;  2IXM A;  1C02 A;  3DAG A;  3FOP A;  2I8B A;  3GM1 A;  3V5Y A;  5KYU A;  4NTF A;  1K40 A;  3NMK A;  4P9T A;  4BPM A;  3BEH A;  1MND A;  1ORY A;  1VYK A;  4LER A;  3ZTM A;  2L6F A;  4ER9 A;  2R7X A;  1LPE A;  1GGQ A;  2KQ9 A;  2PX0 A;  2RSE B;  1Z23 A;  2LFD A;  4IAR A;  4ULV A;  1IW7 F;  1QZX A;  5A6J A;  1YVI A;  4U5B E;  2YL0 A;  4GYT A;  3JZ0 A;  1Q0D A;  1R4T A;  2OJE D;  3QW0 A;  3SXZ A;  5F5H A;  1WN0 A;  1TQG A;  4A2N B;  4BJ6 A;  2HMQ A;  4CBE A;  1ST6 A;  4DRH B;  2HJM A;  2J9B A;  3ZQY A;  1EKY A;  1FR0 A;  3AG2 C;  1TWA A;  2Y39 A;  3FXH A;  5FZT A;  4MND A;  1CPQ A;  4I1O B;  2P7V A;  4JTD B;  5JS5 A;  4GQH A;  1E2X A;  3HTK C;  3L1M A;  4HFK B;  5L0C A;  2XRH A;  2EPL X;  1D1B A;  4O6N A;  4MVO A;  1NG1 A;  3C8G B;  1BDJ B;  1I5N A;  1RCP A;  2PP4 A;  2A6E F;  2YRF A;  3CAX A;  3CQZ A;  2XS8 A;  3LEO A;  4XEF A;  2J8W A;  2R7V A;  2HSB A;  4O6Y A;  2IXO A;  3SZR A;  1NFO A;  4JEA A;  3C8Z A;  3AGU A;  4YL3 A; 
#chains in the Genus database with same CATH homology
 3DKA A;  5COF A;  2P1A A;  2NSG A;  5COG A;  5COM A;  2YQY A;  2NSF A;  5CIV A;  2QNL A;  3DI5 A;  2F22 A;  3CEX A;  2OQM A;  2QE9 A;  1RXQ A;  4N6C A;  3GOR A;  2HKV A;  2RD9 A;  3QTH A;  2OU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...