2OQMA

Crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
180
structure length
180
Chain Sequence
HHENLYFQGMLYDLTVVQFSKMLKNLNAIFDKAEAFAELKKVDMDVLLNSRLAADQFNLIRQVQIACDTAKVGVARLTGQLETAPKHDDSETTLAELRQRIASVLTYLEGFSEADFANAATIQISQPRWQGKYLTGYEFAIEHAIPNLYFHITTAYGILRHNGVEVGKKDYLGAMPYKAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (YP_561575.1) from Shewanella denitrificans OS-217 at 1.83 A resolution
rcsb
source organism Shewanella denitrificans
molecule tags Unknown function
total genus 61
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09351 DUF1993 Domain of unknown function (DUF1993)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2oqmA01
2YQYA 3DKAA 2QE9A 3DI5A 2NSGA 2OQMA 5COMA 1RXQA 5COFA 2P1AA 2HKVA 2QNLA 3QTHA 4N6CA 5CIVA 3GORA 2NSFA 3CEXA 2F22A 5COGA 2RD9A 2OU6A
chains in the Genus database with same CATH superfamily
4MVUA 3A9CA 1V74B 3JSEO 4NCQA 3ZG1A 2XS1A 4CIPA 1ZVZA 4ZLCA 5DQTA 4FWVA 4K1OA 2H7BA 2Y3GA 4XEVA 1OW6A 1F1MA 2J9VA 3I5QA 5FZTA 5L0HA 4E0IA 1OCCC 1GGQA 1ZYRF 2Y69C 4E18A 2H7VC 2KSFA 3FHDA 3JYYA 3DD7A 1NU9C 3K6BA 4OIPF 3TJ5A 4MQ9F 3VM6A 4G7HF 3EH1A 3DZAA 4Z9JA 3CEXA 4C3DA 2F22A 4JC7A 4E0HA 1VK5A 4IGGA 3ZQVA 3DJUB 4U5BE 2HS5A 2CDQA 4NTBA 1B68A 3DAGA 2A0BA 3AG3C 1DOVA 3NMIA 1HE9A 1D1AA 2Q9AA 1FNTc 4UDVA 1YARO 3S27A 5L3VA 3WAQA 3DJNB 1CPRA 4EIYA 1A7EA 1JMWA 4E7SA 1Z5ZA 3CAXA 4DVZA 2V3CC 2J7PD 4J32B 1JR8A 3VYWA 3EGXA 3EQLF 3NRHA 1KTMA 4JTDB 4IB4A 3RIPA 4JW1A 2ICWG 5COFA 5E2QA 3ZTZA 3GODA 3SEOA 4MTOA 4G78A 4PFPA 1OCZC 5L0IA 1UG7A 3B0PA 2AWCA 3GORA 1Z6AA 5BQIA 4EWCA 2BE5F 1XWJA 1MMAA 1QKRA 5L0FA 2BC5A 1A0BA 5A6BD 1OR3A 3TULA 2OU6A 3LNRA 4NTFA 3NMKA 3U8VA 1E83A 3EFOB 4LDQA 1SF8A 5KYUA 1YDIA 2I15A 5AC5A 4CSAA 3G50A 1KNYA 1RJ9B 1T01A 2QLAA 1ZHZA 1ZW3A 2IXMA 4G7ZF 2UUHA 4JCHA 4K7BA 1BR1A 4H4KC 2Q4FA 3EG9B 5F28E 2XRHA 4I1MA 3DXJF 3K1HA 4U9EA 2YLDA 4U5FE 3RF3A 3UMHA 1I5NA 5HV9A 3I5PA 1A7DA 1LI5A 2PX3A 1ORSC 2VB6A 2A6HF 4JJGA 1O5HA 4K0DA 4U5DE 1J8MF 2L6FA 1U0BB 1YA9A 2NG1A 1VOMA 3EHNA 1R5ID 1M2OA 1RKEB 3NKDA 1WWPA 4HE8D 3FOOA 4CS8A 1HW2A 3HNKA 3M79A 4KBLA 4JZAA 4DRJB 4CS7A 1M56C 5AGFA 3NDBB 2Z15A 3X1OA 3GEHA 4IWBA 5JLIA 2ZXPA 1QQ3A 2OEVA 3SXMA 4N06A 1Q0FA 4JURI 4KI2A 1Q0GA 4I1OB 4MVOA 3RFYA 1I4ZA 2OOCA 2R7OA 1RCPA 2XLOA 4I44A 3AGUA 4L6RA 3SZRA 1OKKA 3ABLC 3DM9B 2R7SA 2C04A 2CGEA 3M4BA 1UFBA 3V5YA 2OEXA 2XL6A 2O9XA 4JTCB 3AQCA 3N0TA 3U8PA 4C7OB 4JEAA 2DGJA 4MVMA 2XLDA 4XLNF 2XM4A 4WGYA 1YYXA 1GQAA 1OXKA 2YHSA 4JE9A 1E84A 2FGYA 1BR4A 3ITFA 4J30B 3E70C 4N4WA 2ZD9A 1R4TA 1NLXA 1TR2A 2Y3BA 3BRJA 5B1AC 2W9YA 3DM5A 1PCXA 1OW8A 2Y3DA 3Q7GA 5KYWB 1PV3A 2H7OA 3EGDA 5E33A 4MTGA 2OJED 4MVQA 1EKYA 5IY5C 1XZPA 2XLHA 2R7QA 3GWNA 4AL1A 4HFKB 5COMA 2JX0A 1OCOC 3GEEA 2EIKC 2KYHA 1C02A 2JD3A 3MX3A 4JIOA 3OWTA 3PCVA 5AC4A 3U2MA 4G7OF 1TFKB 5TJ5E 5KYXA 1Y6DA 3KH2A 5L0CA 5E3AA 2LFDA 3KYIA 3QTHA 1LE4A 3QW1A 3BEHA 3IHUA 2KJGA 2YKZA 4P6IC 3EPVA 1LS4A 3LS0A 2QUPA 4CBEA 2WVOA 3L8IA 4DRHB 2P7VA 4C3EA 2OKUA 2VCAA 1JAFA 3O10A 4MNDA 3ZVRA 5JS5A 1YZCA 3IQ5A 2NUPB 4DVYP 4XLPF 2H8AA 2HJMA 4U5GA 4PFOA 3TQOA 2YZSA 3L34A 3ZTMA 4XTKA 2XXAA 1Z7Qc 4I3MA 1WGWA 4OD4A 3UNGC 2G3KA 3L0IA 3U3FA 4D4XA 1VB5A 1SZIA 2VC9A 4CSAC 2LCHA 4YT8A 3VF0A 3G4XA 2MWQA 3S9OA 1QPUA 1M57C 2DB4A 3VAYA 3WG7C 1QSPA 3JCUQ 4WABA 3B0VC 5EK0A 1TWCA 2A69F 4EBBA 1Q0KA 1WATA 2LSEA 5DLJA 2HMQA 3FAJA 4FX5A 4U5EE 4AX2A 1D0ZA 3T4RA 4M63A 4CDVA 2W45A 2NSFA 5JSLA 2VCCA 1O3UA 2A6EF 2HUJA 3FMSA 3HNIA 4XPXA 5EGYA 1K04A 3GM1A 3SYNA 1HW1A 1FFHA 2EINC 1U89A 3U2LA 2PF4E 2GFHA 1ZU4A 1XZQA 2IBFA 3C8GA 4DOZA 3LS1A 4YT2A 2YLGA 2J45A 3R7CA 3ABMC 4LLEA 5A6KA 1H6GA 4FAPB 3RVZA 2DYRC 4AE4A 2KQ9A 2ZXRA 1JPJA 3UMKA 5A69A 4X0RA 1FR0A 2FFHA 1JPNA 1WASA 2KNHA 4ANJA 2CNWD 2VASA 1NU7D 1CGNA 3QVYA 1OKKD 3N24A 2I8BA 2OG2A 4R32A 3UR3C 3S28A 3KYJA 4FESA 2MHRA 2UUIA 3S0XA 3K66A 2RD9A 2R7TA 2A68F 1ZHXA 2XLWA 3ECSA 2QTVA 3H65A 2HV6A 1MQVA 1ZW2A 2LQGA 1V54C 4ER9A 3ZDLA 4CS9C 3MYIA 3EGXB 1D0XA 3T6GB 2IOQA 2MYSA 2PX0A 3JTLO 3K7DA 4OINF 3B29A 4YL1A 1YZAA 4E7ZA 4BG0A 5B3SC 2AP3A 1LI7A 1LVKA 1YJGA 1OQCA 1S7ZA 3CZ6A 3H2UA 3JYHA 4EKWA 4DBRA 1VYKA 1Z23A 3K1IA 2XLVA 3AQBA 1LE2A 1A7VA 2HKVA 2W4MA 1G4WR 3E9VA 4P9FA 4YK5A 4BPMA 3JZ0A 2HJ3A 3EZHA 4CIHA 2YVKA 3AJMA 5F5FA 3DAFA 5F5HA 5KYUB 2XS8A 5T3TA 2VCBA 1YYJA 2L6HA 3AG4C 3W4YA 1TKNA 3ASNC 3LEOA 2R7WA 1VTMP 2Q9BA 4A4AA 3NMJA 1L7CA 1TFOB 5EHHA 2CW0F 2LD6A 1L3PA 2L81A 3JRTA 1M6TA 3LLKA 3UGOA 1K40A 4LERA 3RW0A 4IAQA 1QLEC 4JEBA 2ZXOA 1T5OA 3U9MA 5JT4A 3ZSUA 1LKXA 3TOLA 4XQ1A 3VRCA 3R2PA 4AL0A 1ST6A 3G4ZA 1ZHWA 2CNWA 1E2XA 1MMDA 2GA0A 1BR2A 1G5ZA 2XSEA 4MW8A 4ULWA 3N2ZB 2WVQA 3TJ6A 2JPUA 3M15A 1LIHA 3HKKA 2TMVP 4DRIB 4BJ5A 5GPGB 1ZZPA 2P6VA 4MTFA 1NBBA 3I4UA 5D91A 3CSKA 3MBGA 1Y4CA 4MS2A 3ZC4A 2ASRA 1T9KA 3UGPA 4OIOF 1RMVA 4Z9HA 3AGTA 4EBJA 4MVRA 3OA1A 4IAOA 5A6JA 2IXPA 5JVEA 5L0GA 4CDYA 1LM3B 3EH2A 1T6UA 3EZIA 1ZHTA 3C8GD 4JVSA 2J9UA 3T6JA 2YL7A 1J8YF 4YWQA 1MMNA 1LPEA 4U5CE 1M2VA 2PP4A 2Q3TA 3WODF 4WGZA 4MVSA 5D92A 2WL8A 5T3WA 1GS9A 1O87A 1OXBA 3FDQA 5B1BC 1D0YA 1TWGA 3V5ZA 1WTYA 3LEVA 4KC9A 4Z9IA 2Y39A 4PJNA 2M64A 2PNOA 4GQHA 2OJQA 2PBEA 4JTAB 4CDAA 2YEVA 3SXZA 1JOGA 4PK4A 2P0NA 2ETSA 2J0WA 4E17A 2LP4A 2HV7A 2XLEA 1DOWA 3U0CA 2KW3C 2L7AA 4O7GA 3C18A 5BQHA 256BA 1NZEA 3T9OA 5JRAA 3EGDB 4YT5A 2WZLA 1YAUO 2VH3A 1N1CA 1S05A 1VYIA 3AG1C 3JSZA 2X51A 2KK1A 4JKVA 4U5HA 2J8WA 2R02A 3W2VA 1JRAA 1Z63A 2IM8A 2E87A 4LLCA 2LIGA 1YVIA 3GM2A 2AU5A 4W8PA 2YL3A 4XPWA 5KYXB 4LDKA 3TOMA 2OQMA 2Y3HA 3CQZA 3ZWIA 3O39A 3ZQYA 1IZMA 4OIQF 4QI2A 4BJ1A 1WN0A 2L6GA 3NKEA 2P1AA 4U9DA 4PR9A 3V5XA 4EHPA 1WOLA 2A1DD 4LACB 1RKCA 2BL2A 4N6CA 4BEJA 5CIVA 2IYLD 3RQGA 5DQZA 2OCCC 3K1IC 3QW0A 5L3QA 5COGA 1Z3IX 4ONSA 1PD1A 2R03A 3ABKC 3PDMP 2XXAB 3NG1A 2HSBA 2ZPAA 2YQYA 1V55C 3DKAA 3NYMA 3US6A 2Q9CA 3L8JA 2DYSC 3LESA 4O6NA 4CS8C 5DS4A 3WHNA 1QZXA 1EA8A 4BJ6A 4JRZA 4EBKA 1FMWA 2YL1A 3ATPA 2HZ8A 2KC3A 3M1CB 4AK9A 2G3VA 1FTSA 3EHMA 5T1DB 2A0UA 1H7IA 1RXQA 4PACA 2Q7RA 3POVA 3DMDA 1OR2A 3GWLA 4PJJA 3RH3A 5DS6A 2YL0A 5BUOA 1EI7A 1ORYA 2ZXWC 3IPMO 3F47A 3Q6MA 4O6YA 3LJBA 1MNEA 1T6QA 4OIRF 1C17M 2KGOA 3HJCA 2R25A 3C8GB 1NFNA 4GYTA 4ZLDA 4W8KA 4WJ0A 3DWWA 2D4UA 5DVWA 3MYFA 2EILC 4PJLA 2W4BA 3PMRA 3RYLA 3ASOC 4XWJA 3W8IA 1NG1A 4HFFB 4AE4B 4BJ5C 3H2VA 3IQ6A 4H54A 3IEEA 1VLSA 3RQEA 3U9JA 3SXYA 1AVOB 2QE9A 3FOPA 2YRFA 1H9GA 3HNLA 3U5SA 4N6HA 4O79A 4MVZA 3JT1A 5CI8A 2IXOA 3EFOA 3EJNA 4KNWA 3Q6NA 4P9TA 2M4EA 3SP1A 3LLIA 1BDJB 1C03A 1RJ9A 2PFDA 1KU2A 1W2WA 2CYDA 2V26A 2AVKA 2WZGA 3EG9A 3LUTB 2C03A 2QY9A 2RSEB 4XPYA 4CX9A 1OW7A 2GAQA 4NC3A 1YLMA 4BJTA 5K0IA 3UMIA 2EPOA 4A2NB 1MMGA 2J9WA 2IXNA 3KMIA 1CPQA 3GEIA 3IQCA 4NTAA 2FAPB 2GWWA 3J06A 1FFTC 4D4NA 4Q5SF 4Q7CA 3S90A 4MW3A 4YL3A 4JCZA 1Q0MA 1RKEA 1QVXA 2P61A 2Q00A 2R9RB 2XM0A 1SYQA 2XL4A 3IQTA 3MLGA 3Q7LA 2NUTA 3C8ZA 3KL4A 5KYWA 1I4YA 3HNJA 3A11A 2R7XA 1D1CA 2AWYA 4G0HA 2NSGA 2XLMA 4JJFA 4RBNA 3NYLA 1NSGB 4XEKA 1EQ1A 4J7YA 2D5RB 2HFIA 2WVNA 3QVZA 5KYYA 1HMDA 3HTKC 4BEMJ 1TWAA 3LNMB 3TK0A 1HY5A 2DI3A 4YN0B 5BQGA 2J9BA 3TD7A 4YL0A 1PD0A 3HLZA 3S84A 2NUTB 2EIJC 2XL8A 4O6MA 3AOUA 4ULVA 1NFOA 5L0DA 1GM5A 3X2QC 4QDLA 5HSWA 4C7OA 3O55A 2WB7A 2GDCA 3B71A 3FXHA 4IRUA 4NQFA 3KKBA 2LK4A 3C63A 3K33A 3V7OA 1D1BA 3DE9A 1ORJA 2HMZA 2J7PA 2HSQA 4CJOA 4DBQA 2L9JA 5KYYB 2CCYA 3W8HA 1G4US 2J46A 4F4BA 3PHF2 3DI5A 1MNDA 2EPLX 5B3IA 1V4AA 1FAPB 4BJ6C 1BZ4A 5A6AA 1E85A 1HMOA 1CGOA 2G62A 1T6IA 1Q0DA 1BBHA 3QMKA 5CI9A 4HEAJ 1LS1A 2YWAA 3NYJA 3DE8A 1VMAA 3RQFA 5DS5A 1ZU5A 4IARA 4QI0A 2X0CA 5A6BA 3B0UX 4B6IA 4RDAA 5FCLA 5KYNA 4CS9A 3GM3A 1A41A 3QZCA 4NY3A 2R7VA 2EPMX 3M4CA 4EUKB 1AEPA 3U3BA 3W2WA 3C62A 3O6XA 1YA7O 2B0JA 3FAPB 2EIMC 1TQGA 2WZFA 4CJGA 1FMVA 2R7UA 3C7JA 1M2VB 1ZHYA 2NPUA 1SR2A 4RD9A 2B0HA 1TWHA 3JRMO 3GANA 5E3CA 4OD5A 1G8XA 1K05A 3FVYA 4KNVA 1CGME 5JUAA 1OCRC 4IJJA 3RVYA 3LAYA 3S29A 3OEOA 5L0JA 3SNHA 4GEHA 2EPNA 2NUPA 3KPHA 5JP7A 3SXKA 4YT4A 4PJMA 1VLTA 2YLIA 1HE1A 1U6HA 4LDRA 4C3BA 4J7TA 4YJWA 1E86A 1H9TA 3T6BA 3L1MA 4XEFA 4DXWA 2QNLA 3F46A 1APCA 3ZIBA 3MFNA 3B9QA 2LFFA 2EPKX 4DJ9A 1AUEA 2R7RA 1SMYF 4Q4ZF 2J0XA 3AG2C 3RKOF 1IW7F 2R05A
chains in the Genus database with same CATH topology
2YQYA 3DKAA 2QE9A 3DI5A 2NSGA 2OQMA 5COMA 1RXQA 5COFA 2P1AA 2HKVA 2QNLA 3QTHA 4N6CA 5CIVA 3GORA 2NSFA 3CEXA 2F22A 5COGA 2RD9A 2OU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQY A;  3DKA A;  2QE9 A;  3DI5 A;  2NSG A;  2OQM A;  5COM A;  1RXQ A;  5COF A;  2P1A A;  2HKV A;  2QNL A;  3QTH A;  4N6C A;  5CIV A;  3GOR A;  2NSF A;  3CEX A;  2F22 A;  5COG A;  2RD9 A;  2OU6 A; 
#chains in the Genus database with same CATH topology
 4MVU A;  3A9C A;  1V74 B;  3JSE O;  4NCQ A;  3ZG1 A;  2XS1 A;  4CIP A;  1ZVZ A;  4ZLC A;  5DQT A;  4FWV A;  4K1O A;  2H7B A;  2Y3G A;  4XEV A;  1OW6 A;  1F1M A;  2J9V A;  3I5Q A;  5FZT A;  5L0H A;  4E0I A;  1OCC C;  1GGQ A;  1ZYR F;  2Y69 C;  4E18 A;  2H7V C;  2KSF A;  3FHD A;  3JYY A;  3DD7 A;  1NU9 C;  3K6B A;  4OIP F;  3TJ5 A;  4MQ9 F;  3VM6 A;  4G7H F;  3EH1 A;  3DZA A;  4Z9J A;  3CEX A;  4C3D A;  2F22 A;  4JC7 A;  4E0H A;  1VK5 A;  4IGG A;  3ZQV A;  3DJU B;  4U5B E;  2HS5 A;  2CDQ A;  4NTB A;  1B68 A;  3DAG A;  2A0B A;  3AG3 C;  1DOV A;  3NMI A;  1HE9 A;  1D1A A;  2Q9A A;  1FNT c;  4UDV A;  1YAR O;  3S27 A;  5L3V A;  3WAQ A;  3DJN B;  1CPR A;  4EIY A;  1A7E A;  1JMW A;  4E7S A;  1Z5Z A;  3CAX A;  4DVZ A;  2V3C C;  2J7P D;  4J32 B;  1JR8 A;  3VYW A;  3EGX A;  3EQL F;  3NRH A;  1KTM A;  4JTD B;  4IB4 A;  3RIP A;  4JW1 A;  2ICW G;  5COF A;  5E2Q A;  3ZTZ A;  3GOD A;  3SEO A;  4MTO A;  4G78 A;  4PFP A;  1OCZ C;  5L0I A;  1UG7 A;  3B0P A;  2AWC A;  3GOR A;  1Z6A A;  5BQI A;  4EWC A;  2BE5 F;  1XWJ A;  1MMA A;  1QKR A;  5L0F A;  2BC5 A;  1A0B A;  5A6B D;  1OR3 A;  3TUL A;  2OU6 A;  3LNR A;  4NTF A;  3NMK A;  3U8V A;  1E83 A;  3EFO B;  4LDQ A;  1SF8 A;  5KYU A;  1YDI A;  2I15 A;  5AC5 A;  4CSA A;  3G50 A;  1KNY A;  1RJ9 B;  1T01 A;  2QLA A;  1ZHZ A;  1ZW3 A;  2IXM A;  4G7Z F;  2UUH A;  4JCH A;  4K7B A;  1BR1 A;  4H4K C;  2Q4F A;  3EG9 B;  5F28 E;  2XRH A;  4I1M A;  3DXJ F;  3K1H A;  4U9E A;  2YLD A;  4U5F E;  3RF3 A;  3UMH A;  1I5N A;  5HV9 A;  3I5P A;  1A7D A;  1LI5 A;  2PX3 A;  1ORS C;  2VB6 A;  2A6H F;  4JJG A;  1O5H A;  4K0D A;  4U5D E;  1J8M F;  2L6F A;  1U0B B;  1YA9 A;  2NG1 A;  1VOM A;  3EHN A;  1R5I D;  1M2O A;  1RKE B;  3NKD A;  1WWP A;  4HE8 D;  3FOO A;  4CS8 A;  1HW2 A;  3HNK A;  3M79 A;  4KBL A;  4JZA A;  4DRJ B;  4CS7 A;  1M56 C;  5AGF A;  3NDB B;  2Z15 A;  3X1O A;  3GEH A;  4IWB A;  5JLI A;  2ZXP A;  1QQ3 A;  2OEV A;  3SXM A;  4N06 A;  1Q0F A;  4JUR I;  4KI2 A;  1Q0G A;  4I1O B;  4MVO A;  3RFY A;  1I4Z A;  2OOC A;  2R7O A;  1RCP A;  2XLO A;  4I44 A;  3AGU A;  4L6R A;  3SZR A;  1OKK A;  3ABL C;  3DM9 B;  2R7S A;  2C04 A;  2CGE A;  3M4B A;  1UFB A;  3V5Y A;  2OEX A;  2XL6 A;  2O9X A;  4JTC B;  3AQC A;  3N0T A;  3U8P A;  4C7O B;  4JEA A;  2DGJ A;  4MVM A;  2XLD A;  4XLN F;  2XM4 A;  4WGY A;  1YYX A;  1GQA A;  1OXK A;  2YHS A;  4JE9 A;  1E84 A;  2FGY A;  1BR4 A;  3ITF A;  4J30 B;  3E70 C;  4N4W A;  2ZD9 A;  1R4T A;  1NLX A;  1TR2 A;  2Y3B A;  3BRJ A;  5B1A C;  2W9Y A;  3DM5 A;  1PCX A;  1OW8 A;  2Y3D A;  3Q7G A;  5KYW B;  1PV3 A;  2H7O A;  3EGD A;  5E33 A;  4MTG A;  2OJE D;  4MVQ A;  1EKY A;  5IY5 C;  1XZP A;  2XLH A;  2R7Q A;  3GWN A;  4AL1 A;  4HFK B;  5COM A;  2JX0 A;  1OCO C;  3GEE A;  2EIK C;  2KYH A;  1C02 A;  2JD3 A;  3MX3 A;  4JIO A;  3OWT A;  3PCV A;  5AC4 A;  3U2M A;  4G7O F;  1TFK B;  5TJ5 E;  5KYX A;  1Y6D A;  3KH2 A;  5L0C A;  5E3A A;  2LFD A;  3KYI A;  3QTH A;  1LE4 A;  3QW1 A;  3BEH A;  3IHU A;  2KJG A;  2YKZ A;  4P6I C;  3EPV A;  1LS4 A;  3LS0 A;  2QUP A;  4CBE A;  2WVO A;  3L8I A;  4DRH B;  2P7V A;  4C3E A;  2OKU A;  2VCA A;  1JAF A;  3O10 A;  4MND A;  3ZVR A;  5JS5 A;  1YZC A;  3IQ5 A;  2NUP B;  4DVY P;  4XLP F;  2H8A A;  2HJM A;  4U5G A;  4PFO A;  3TQO A;  2YZS A;  3L34 A;  3ZTM A;  4XTK A;  2XXA A;  1Z7Q c;  4I3M A;  1WGW A;  4OD4 A;  3UNG C;  2G3K A;  3L0I A;  3U3F A;  4D4X A;  1VB5 A;  1SZI A;  2VC9 A;  4CSA C;  2LCH A;  4YT8 A;  3VF0 A;  3G4X A;  2MWQ A;  3S9O A;  1QPU A;  1M57 C;  2DB4 A;  3VAY A;  3WG7 C;  1QSP A;  3JCU Q;  4WAB A;  3B0V C;  5EK0 A;  1TWC A;  2A69 F;  4EBB A;  1Q0K A;  1WAT A;  2LSE A;  5DLJ A;  2HMQ A;  3FAJ A;  4FX5 A;  4U5E E;  4AX2 A;  1D0Z A;  3T4R A;  4M63 A;  4CDV A;  2W45 A;  2NSF A;  5JSL A;  2VCC A;  1O3U A;  2A6E F;  2HUJ A;  3FMS A;  3HNI A;  4XPX A;  5EGY A;  1K04 A;  3GM1 A;  3SYN A;  1HW1 A;  1FFH A;  2EIN C;  1U89 A;  3U2L A;  2PF4 E;  2GFH A;  1ZU4 A;  1XZQ A;  2IBF A;  3C8G A;  4DOZ A;  3LS1 A;  4YT2 A;  2YLG A;  2J45 A;  3R7C A;  3ABM C;  4LLE A;  5A6K A;  1H6G A;  4FAP B;  3RVZ A;  2DYR C;  4AE4 A;  2KQ9 A;  2ZXR A;  1JPJ A;  3UMK A;  5A69 A;  4X0R A;  1FR0 A;  2FFH A;  1JPN A;  1WAS A;  2KNH A;  4ANJ A;  2CNW D;  2VAS A;  1NU7 D;  1CGN A;  3QVY A;  1OKK D;  3N24 A;  2I8B A;  2OG2 A;  4R32 A;  3UR3 C;  3S28 A;  3KYJ A;  4FES A;  2MHR A;  2UUI A;  3S0X A;  3K66 A;  2RD9 A;  2R7T A;  2A68 F;  1ZHX A;  2XLW A;  3ECS A;  2QTV A;  3H65 A;  2HV6 A;  1MQV A;  1ZW2 A;  2LQG A;  1V54 C;  4ER9 A;  3ZDL A;  4CS9 C;  3MYI A;  3EGX B;  1D0X A;  3T6G B;  2IOQ A;  2MYS A;  2PX0 A;  3JTL O;  3K7D A;  4OIN F;  3B29 A;  4YL1 A;  1YZA A;  4E7Z A;  4BG0 A;  5B3S C;  2AP3 A;  1LI7 A;  1LVK A;  1YJG A;  1OQC A;  1S7Z A;  3CZ6 A;  3H2U A;  3JYH A;  4EKW A;  4DBR A;  1VYK A;  1Z23 A;  3K1I A;  2XLV A;  3AQB A;  1LE2 A;  1A7V A;  2HKV A;  2W4M A;  1G4W R;  3E9V A;  4P9F A;  4YK5 A;  4BPM A;  3JZ0 A;  2HJ3 A;  3EZH A;  4CIH A;  2YVK A;  3AJM A;  5F5F A;  3DAF A;  5F5H A;  5KYU B;  2XS8 A;  5T3T A;  2VCB A;  1YYJ A;  2L6H A;  3AG4 C;  3W4Y A;  1TKN A;  3ASN C;  3LEO A;  2R7W A;  1VTM P;  2Q9B A;  4A4A A;  3NMJ A;  1L7C A;  1TFO B;  5EHH A;  2CW0 F;  2LD6 A;  1L3P A;  2L81 A;  3JRT A;  1M6T A;  3LLK A;  3UGO A;  1K40 A;  4LER A;  3RW0 A;  4IAQ A;  1QLE C;  4JEB A;  2ZXO A;  1T5O A;  3U9M A;  5JT4 A;  3ZSU A;  1LKX A;  3TOL A;  4XQ1 A;  3VRC A;  3R2P A;  4AL0 A;  1ST6 A;  3G4Z A;  1ZHW A;  2CNW A;  1E2X A;  1MMD A;  2GA0 A;  1BR2 A;  1G5Z A;  2XSE A;  4MW8 A;  4ULW A;  3N2Z B;  2WVQ A;  3TJ6 A;  2JPU A;  3M15 A;  1LIH A;  3HKK A;  2TMV P;  4DRI B;  4BJ5 A;  5GPG B;  1ZZP A;  2P6V A;  4MTF A;  1NBB A;  3I4U A;  5D91 A;  3CSK A;  3MBG A;  1Y4C A;  4MS2 A;  3ZC4 A;  2ASR A;  1T9K A;  3UGP A;  4OIO F;  1RMV A;  4Z9H A;  3AGT A;  4EBJ A;  4MVR A;  3OA1 A;  4IAO A;  5A6J A;  2IXP A;  5JVE A;  5L0G A;  4CDY A;  1LM3 B;  3EH2 A;  1T6U A;  3EZI A;  1ZHT A;  3C8G D;  4JVS A;  2J9U A;  3T6J A;  2YL7 A;  1J8Y F;  4YWQ A;  1MMN A;  1LPE A;  4U5C E;  1M2V A;  2PP4 A;  2Q3T A;  3WOD F;  4WGZ A;  4MVS A;  5D92 A;  2WL8 A;  5T3W A;  1GS9 A;  1O87 A;  1OXB A;  3FDQ A;  5B1B C;  1D0Y A;  1TWG A;  3V5Z A;  1WTY A;  3LEV A;  4KC9 A;  4Z9I A;  2Y39 A;  4PJN A;  2M64 A;  2PNO A;  4GQH A;  2OJQ A;  2PBE A;  4JTA B;  4CDA A;  2YEV A;  3SXZ A;  1JOG A;  4PK4 A;  2P0N A;  2ETS A;  2J0W A;  4E17 A;  2LP4 A;  2HV7 A;  2XLE A;  1DOW A;  3U0C A;  2KW3 C;  2L7A A;  4O7G A;  3C18 A;  5BQH A;  256B A;  1NZE A;  3T9O A;  5JRA A;  3EGD B;  4YT5 A;  2WZL A;  1YAU O;  2VH3 A;  1N1C A;  1S05 A;  1VYI A;  3AG1 C;  3JSZ A;  2X51 A;  2KK1 A;  4JKV A;  4U5H A;  2J8W A;  2R02 A;  3W2V A;  1JRA A;  1Z63 A;  2IM8 A;  2E87 A;  4LLC A;  2LIG A;  1YVI A;  3GM2 A;  2AU5 A;  4W8P A;  2YL3 A;  4XPW A;  5KYX B;  4LDK A;  3TOM A;  2OQM A;  2Y3H A;  3CQZ A;  3ZWI A;  3O39 A;  3ZQY A;  1IZM A;  4OIQ F;  4QI2 A;  4BJ1 A;  1WN0 A;  2L6G A;  3NKE A;  2P1A A;  4U9D A;  4PR9 A;  3V5X A;  4EHP A;  1WOL A;  2A1D D;  4LAC B;  1RKC A;  2BL2 A;  4N6C A;  4BEJ A;  5CIV A;  2IYL D;  3RQG A;  5DQZ A;  2OCC C;  3K1I C;  3QW0 A;  5L3Q A;  5COG A;  1Z3I X;  4ONS A;  1PD1 A;  2R03 A;  3ABK C;  3PDM P;  2XXA B;  3NG1 A;  2HSB A;  2ZPA A;  2YQY A;  1V55 C;  3DKA A;  3NYM A;  3US6 A;  2Q9C A;  3L8J A;  2DYS C;  3LES A;  4O6N A;  4CS8 C;  5DS4 A;  3WHN A;  1QZX A;  1EA8 A;  4BJ6 A;  4JRZ A;  4EBK A;  1FMW A;  2YL1 A;  3ATP A;  2HZ8 A;  2KC3 A;  3M1C B;  4AK9 A;  2G3V A;  1FTS A;  3EHM A;  5T1D B;  2A0U A;  1H7I A;  1RXQ A;  4PAC A;  2Q7R A;  3POV A;  3DMD A;  1OR2 A;  3GWL A;  4PJJ A;  3RH3 A;  5DS6 A;  2YL0 A;  5BUO A;  1EI7 A;  1ORY A;  2ZXW C;  3IPM O;  3F47 A;  3Q6M A;  4O6Y A;  3LJB A;  1MNE A;  1T6Q A;  4OIR F;  1C17 M;  2KGO A;  3HJC A;  2R25 A;  3C8G B;  1NFN A;  4GYT A;  4ZLD A;  4W8K A;  4WJ0 A;  3DWW A;  2D4U A;  5DVW A;  3MYF A;  2EIL C;  4PJL A;  2W4B A;  3PMR A;  3RYL A;  3ASO C;  4XWJ A;  3W8I A;  1NG1 A;  4HFF B;  4AE4 B;  4BJ5 C;  3H2V A;  3IQ6 A;  4H54 A;  3IEE A;  1VLS A;  3RQE A;  3U9J A;  3SXY A;  1AVO B;  2QE9 A;  3FOP A;  2YRF A;  1H9G A;  3HNL A;  3U5S A;  4N6H A;  4O79 A;  4MVZ A;  3JT1 A;  5CI8 A;  2IXO A;  3EFO A;  3EJN A;  4KNW A;  3Q6N A;  4P9T A;  2M4E A;  3SP1 A;  3LLI A;  1BDJ B;  1C03 A;  1RJ9 A;  2PFD A;  1KU2 A;  1W2W A;  2CYD A;  2V26 A;  2AVK A;  2WZG A;  3EG9 A;  3LUT B;  2C03 A;  2QY9 A;  2RSE B;  4XPY A;  4CX9 A;  1OW7 A;  2GAQ A;  4NC3 A;  1YLM A;  4BJT A;  5K0I A;  3UMI A;  2EPO A;  4A2N B;  1MMG A;  2J9W A;  2IXN A;  3KMI A;  1CPQ A;  3GEI A;  3IQC A;  4NTA A;  2FAP B;  2GWW A;  3J06 A;  1FFT C;  4D4N A;  4Q5S F;  4Q7C A;  3S90 A;  4MW3 A;  4YL3 A;  4JCZ A;  1Q0M A;  1RKE A;  1QVX A;  2P61 A;  2Q00 A;  2R9R B;  2XM0 A;  1SYQ A;  2XL4 A;  3IQT A;  3MLG A;  3Q7L A;  2NUT A;  3C8Z A;  3KL4 A;  5KYW A;  1I4Y A;  3HNJ A;  3A11 A;  2R7X A;  1D1C A;  2AWY A;  4G0H A;  2NSG A;  2XLM A;  4JJF A;  4RBN A;  3NYL A;  1NSG B;  4XEK A;  1EQ1 A;  4J7Y A;  2D5R B;  2HFI A;  2WVN A;  3QVZ A;  5KYY A;  1HMD A;  3HTK C;  4BEM J;  1TWA A;  3LNM B;  3TK0 A;  1HY5 A;  2DI3 A;  4YN0 B;  5BQG A;  2J9B A;  3TD7 A;  4YL0 A;  1PD0 A;  3HLZ A;  3S84 A;  2NUT B;  2EIJ C;  2XL8 A;  4O6M A;  3AOU A;  4ULV A;  1NFO A;  5L0D A;  1GM5 A;  3X2Q C;  4QDL A;  5HSW A;  4C7O A;  3O55 A;  2WB7 A;  2GDC A;  3B71 A;  3FXH A;  4IRU A;  4NQF A;  3KKB A;  2LK4 A;  3C63 A;  3K33 A;  3V7O A;  1D1B A;  3DE9 A;  1ORJ A;  2HMZ A;  2J7P A;  2HSQ A;  4CJO A;  4DBQ A;  2L9J A;  5KYY B;  2CCY A;  3W8H A;  1G4U S;  2J46 A;  4F4B A;  3PHF 2;  3DI5 A;  1MND A;  2EPL X;  5B3I A;  1V4A A;  1FAP B;  4BJ6 C;  1BZ4 A;  5A6A A;  1E85 A;  1HMO A;  1CGO A;  2G62 A;  1T6I A;  1Q0D A;  1BBH A;  3QMK A;  5CI9 A;  4HEA J;  1LS1 A;  2YWA A;  3NYJ A;  3DE8 A;  1VMA A;  3RQF A;  5DS5 A;  1ZU5 A;  4IAR A;  4QI0 A;  2X0C A;  5A6B A;  3B0U X;  4B6I A;  4RDA A;  5FCL A;  5KYN A;  4CS9 A;  3GM3 A;  1A41 A;  3QZC A;  4NY3 A;  2R7V A;  2EPM X;  3M4C A;  4EUK B;  1AEP A;  3U3B A;  3W2W A;  3C62 A;  3O6X A;  1YA7 O;  2B0J A;  3FAP B;  2EIM C;  1TQG A;  2WZF A;  4CJG A;  1FMV A;  2R7U A;  3C7J A;  1M2V B;  1ZHY A;  2NPU A;  1SR2 A;  4RD9 A;  2B0H A;  1TWH A;  3JRM O;  3GAN A;  5E3C A;  4OD5 A;  1G8X A;  1K05 A;  3FVY A;  4KNV A;  1CGM E;  5JUA A;  1OCR C;  4IJJ A;  3RVY A;  3LAY A;  3S29 A;  3OEO A;  5L0J A;  3SNH A;  4GEH A;  2EPN A;  2NUP A;  3KPH A;  5JP7 A;  3SXK A;  4YT4 A;  4PJM A;  1VLT A;  2YLI A;  1HE1 A;  1U6H A;  4LDR A;  4C3B A;  4J7T A;  4YJW A;  1E86 A;  1H9T A;  3T6B A;  3L1M A;  4XEF A;  4DXW A;  2QNL A;  3F46 A;  1APC A;  3ZIB A;  3MFN A;  3B9Q A;  2LFF A;  2EPK X;  4DJ9 A;  1AUE A;  2R7R A;  1SMY F;  4Q4Z F;  2J0X A;  3AG2 C;  3RKO F;  1IW7 F;  2R05 A; 
#chains in the Genus database with same CATH homology
 2YQY A;  3DKA A;  2QE9 A;  3DI5 A;  2NSG A;  2OQM A;  5COM A;  1RXQ A;  5COF A;  2P1A A;  2HKV A;  2QNL A;  3QTH A;  4N6C A;  5CIV A;  3GOR A;  2NSF A;  3CEX A;  2F22 A;  5COG A;  2RD9 A;  2OU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...