2OQMA

Crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
180
structure length
180
Chain Sequence
b'HHENLYFQGMLYDLTVVQFSKMLKNLNAIFDKAEAFAELKKVDMDVLLNSRLAADQFNLIRQVQIACDTAKVGVARLTGQLETAPKHDDSETTLAELRQRIASVLTYLEGFSEADFANAATIQISQPRWQGKYLTGYEFAIEHAIPNLYFHITTAYGILRHNGVEVGKKDYLGAMPYKAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
molecule tags Unknown function
source organism Shewanella denitrificans
publication title Crystal structure of hypothetical protein (YP_561575.1) from Shewanella denitrificans OS-217 at 1.83 A resolution
rcsb
total genus 61
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09351 DUF1993 Domain of unknown function (DUF1993)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2oqmA01
2QE9A 2RD9A 2NSFA 2QNLA 2OQMA 3CEXA 3DI5A 2P1AA 3GORA 1RXQA 5COFA 2NSGA 2HKVA 4N6CA 5COGA 5COMA 3DKAA 2OU6A 3QTHA 2F22A 5CIVA 2YQYA
chains in the Genus database with same CATH superfamily
1T5OA 2J9WA 2A0BA 3AGUA 4O7GA 5KYXA 4MVZA 2AWCA 1M57C 2CW0F 1D1AA 1WWPA 2QLAA 4XTKA 3T9OA 3POVA 4XPWA 2B0JA 3U8PA 1LI5A 2G62A 5CI9A 3U8VA 4JTAB 3W8HA 4E7SA 4YT4A 4YK5A 4U5HA 1L7CA 3I5PA 3JYYA 3LLIA 4O6MA 4EKWA 1BR2A 1V55C 3JSZA 4OD5A 3U3FA 1S05A 4XEVA 4BEJA 3FAJA 3GM2A 4IARA 1PV3A 3O39A 2EILC 4EBKA 3H2UA 2NSGA 4IGGA 2XLOA 1JMWA 4PACA 3KPHA 4U5DE 2VCCA 3DKAA 2PX3A 1DOVA 3NYLA 1I4ZA 3C63A 2FGYA 4ZLDA 4NC3A 1CGNA 2XM0A 2CCYA 2YLIA 4JTDB 1K05A 3RW0A 1TWGA 2WB7A 1LKXA 3UGPA 1NU7D 4N6HA 3ITFA 1U89A 2XLWA 2ICWG 3C8GD 5JRAA 1YZCA 2Z15A 3U9MA 1WGWA 2YL3A 2XLMA 4MW8A 2ZD9A 4PJLA 3R7CA 5JVEA 4EHPA 3I5QA 5T3WA 4MVQA 4O79A 4JJGA 4E7ZA 1VMAA 2WVNA 2YLDA 2KNHA 1H9TA 3DE8A 3LS1A 3NYJA 3Q6NA 3U9JA 2Q9BA 2R7VA 3IQCA 3UNGC 1HMDA 3DJNB 4H54A 1OR3A 2CNWD 2XRHA 2BC5A 1FMWA 1RMVA 3K1IC 1BR1A 4KNVA 4Z9JA 3VF0A 2P0NA 3KKBA 3EZHA 3BEHA 3Q7GA 5T1DB 3RKOF 2DYRC 4CIHA 2CYDA 5JS5A 1ZHYA 1LE4A 2QE9A 3U2MA 3KMIA 3NKEA 2FAPB 3LEOA 2HFIA 3CAXA 1T6IA 1VB5A 1GS9A 3S84A 1ST6A 4FESA 4JKVA 3JRMO 1JPNA 3LEVA 4F4BA 3CEXA 4J30B 1QPUA 2B0HA 3QVZA 3RQFA 5DQTA 5L0CA 3KYIA 2L6GA 2J9VA 2EIMC 3W4YA 4CJOA 2I15A 4C3BA 1AUEA 4NTAA 3FOPA 3C7JA 5JSLA 3UMKA 4BJ5C 3NDBB 1ORSC 3GANA 1TWCA 3C8GB 1E2XA 4I1OB 1LS1A 5COMA 5B1BC 1KTMA 3H2VA 3RVYA 3US6A 5L0FA 5KYXB 3Q6MA 1A0BA 1ZVZA 3UMIA 256BA 5A69A 5A6BA 3FDQA 2Q9AA 2NG1A 3C8ZA 1D0YA 3HTKC 1O3UA 4IRUA 2H7BA 1OCCC 3S29A 4CS9C 5JLIA 4N4WA 2QY9A 2R7QA 3L34A 3U3BA 1LS4A 4P6IC 2C04A 4XLPF 3J06A 2XL6A 3E70C 4JZAA 4G7OF 2IYLD 1G8XA 1YLMA 4DJ9A 4JVSA 2CGEA 2J46A 5CI8A 1R4TA 3ABKC 4C7OA 2RSEB 2Y69C 5D91A 3T6GB 1PD1A 1WASA 2IXOA 2AVKA 2LD6A 1NLXA 2A6EF 1ZYRF 3RYLA 1K40A 2OEVA 3HNKA 4Z9IA 2R7XA 3EFOA 1YVIA 3DD7A 1PCXA 4H4KC 4L6RA 1QSPA 3TOLA 1E84A 3S0XA 5HSWA 1L3PA 4LACB 1OW7A 4HEAJ 4J7TA 4CDAA 3O10A 1EA8A 1V54C 4CJGA 1APCA 1NBBA 1U0BB 1DOWA 3DWWA 4PJJA 1H9GA 4IB4A 3DMDA 4IJJA 3M1CB 4OIOF 1GQAA 2OJED 1NG1A 2PBEA 2XS1A 3S9OA 3KYJA 1LPEA 2YKZA 2MYSA 3I4UA 4WJ0A 4X0RA 1HMOA 5F5FA 3NG1A 1YARO 2L6FA 1YA9A 2UUIA 3LS0A 4W8KA 1K04A 1Z7Qc 1V74B 1RKEA 2A1DD 2GFHA 3X2QC 2W45A 3SXKA 2A69F 1SZIA 3Q7LA 3SXYA 4ONSA 3JRTA 3OA1A 4RDAA 2XLEA 2IXMA 1NSGB 1A7VA 2IXPA 1Z23A 1T6UA 2KW3C 5E3AA 3U0CA 3EFOB 5CIVA 3VRCA 5L0IA 3ZTZA 3SZRA 2YQYA 1AEPA 4G7ZF 4NCQA 1FTSA 3RVZA 1OCZC 3M15A 3WODF 4ULVA 5FCLA 4XEFA 1J8YF 2QTVA 2IOQA 3QVYA 3DM9B 4K0DA 3EQLF 3O6XA 4JIOA 2Y3GA 2YVKA 1FFHA 4HE8D 2VB6A 2Q4FA 4MTOA 4PFOA 4YL3A 2VASA 3AOUA 4KNWA 4CSAA 3DI5A 2JX0A 3K7DA 3HKKA 2DYSC 3GEEA 4E17A 4PFPA 4MTGA 4CDVA 3IQTA 3DAGA 4ULWA 3LLKA 3R2PA 1IW7F 2A68F 2Q9CA 3CZ6A 1KU2A 2E87A 2HKVA 1JR8A 1LVKA 2P7VA 3DAFA 4JE9A 5K0IA 4JCZA 2EINC 2R9RB 2EPKX 4MW3A 4MVRA 4JEBA 1TFOB 4Q4ZF 2XSEA 5DS6A 3OEOA 1FMVA 1NZEA 4WGZA 4JEAA 4N06A 5JUAA 3B0VC 3GM3A 3AG4C 1W2WA 1HY5A 2R7OA 3HNIA 1WN0A 3B29A 2J7PD 3ZQVA 3DE9A 4NTFA 1TQGA 2ZXWC 2TMVP 2NUPB 1IZMA 2ETSA 4CIPA 3GEIA 4JC7A 4AE4A 3CSKA 3MX3A 4Z9HA 1OXKA 1LI7A 2JD3A 3GM1A 3V5YA 1YYJA 4B6IA 4GEHA 3S27A 1VK5A 1ZHXA 2NUPA 2R02A 5EHHA 2J8WA 1VLTA 1SYQA 1OR2A 4E0HA 3K1IA 3FMSA 3EGDB 1N1CA 3JTLO 3RIPA 2PX0A 3KL4A 5TJ5E 4GYTA 1F1MA 4AK9A 2J9UA 1MMNA 1E85A 2BL2A 2GA0A 4CS7A 2XLDA 1SF8A 1UG7A 2KK1A 3QW0A 3X1OA 1SR2A 4AX2A 1LIHA 1NFNA 2ZXPA 4QI0A 1OCRC 2UUHA 4U5EE 4YL0A 4XLNF 3NRHA 2L9JA 3DZAA 5A6AA 2AP3A 1M6TA 1Z63A 3N0TA 1ZHTA 1FFTC 1ZHWA 1TFKB 4BJ5A 2P1AA 2WZLA 4BEMJ 5D92A 3IPMO 2J9BA 2HJ3A 1R5ID 3L8JA 3QW1A 2XL8A 2YL1A 3NMKA 4OIQF 4N6CA 3K6BA 2R7WA 2R03A 4WGYA 2V26A 2ZPAA 5COGA 4O6NA 1WTYA 3N2ZB 1XZQA 2DI3A 2WL8A 3C62A 3PMRA 4NY3A 3K66A 5L0HA 3TJ5A 3U2LA 2NUTB 3IEEA 3RF3A 3U5SA 3RH3A 4EUKB 3EPVA 3N24A 3ZQYA 2IXNA 1EQ1A 1MNEA 5L3VA 2R25A 4MQ9F 5T3TA 3SEOA 4ANJA 4DVZA 5A6BD 3NKDA 4XPYA 5EGYA 3B0UX 2LSEA 3SXZA 3PCVA 3M79A 4MVSA 5DS4A 5BQHA 5L0JA 3VM6A 2YHSA 3LESA 5KYYB 1G4WR 2KSFA 2OQMA 4XWJA 1D1CA 2Y3HA 3EH2A 3F46A 3G4ZA 4E0IA 5HV9A 1RJ9A 3K1HA 3W2VA 1VTMP 4OIRF 1RKEB 1EI7A 3EJNA 4QI2A 1RCPA 2VCAA 3GWLA 3JCUQ 1G4US 1T9KA 1WATA 2PF4E 1YYXA 4CX9A 3UMHA 5KYWB 4AL1A 5BUOA 1VLSA 4G78A 4JTCB 4EIYA 2NPUA 1T01A 1VYKA 4RBNA 4K1OA 2GDCA 2H8AA 2O9XA 2OU6A 2CNWA 3TQOA 2EIJC 2ZXOA 3AQBA 3IQ6A 3W8IA 3RFYA 5IY5C 3EH1A 1HW2A 2QUPA 1CPRA 2CDQA 4YT2A 4QDLA 1Q0DA 1HE1A 2EPLX 3EHMA 1E83A 1OW6A 2XXAA 4GQHA 4I1MA 1OW8A 4HFKB 1B68A 5DS5A 2XM4A 2EPOA 1SMYF 4J7YA 2OCCC 1HW1A 4DXWA 4E18A 4JCHA 5KYUB 1VYIA 3AQCA 4OINF 3WG7C 5DQZA 4G0HA 3GEHA 1T6QA 3AG3C 3ZG1A 4U5FE 2WZGA 3MLGA 2M64A 2HMQA 5KYUA 1MQVA 1ZU5A 2YL0A 3FOOA 1XZPA 3VAYA 1OKKA 4J32B 2G3VA 2G3KA 1H6GA 2VH3A 5L3QA 2R05A 2XXAB 4MTFA 3K33A 2H7VC 1OXBA 2R7UA 1QQ3A 3IQ5A 3ECSA 3QTHA 1TR2A 3A9CA 3F47A 2X0CA 3SXMA 4D4XA 3ZTMA 3FHDA 2MHRA 3RQEA 1GM5A 3B0PA 2P61A 1Q0MA 4CDYA 4C3DA 2KJGA 2I8BA 3DJUB 4MS2A 3T4RA 2J7PA 3TK0A 1PD0A 1A41A 1I5NA 1RJ9B 2EPNA 2L7AA 2LP4A 4YL1A 5B3IA 1FNTc 1QVXA 2MWQA 2LK4A 2Q3TA 4O6YA 2C03A 2J0XA 4XQ1A 3GODA 1OCOC 4FWVA 1ZZPA 3UGOA 4CSAC 1CGME 2IBFA 2WZFA 3ABMC 2V3CC 4JW1A 2YRFA 4DOZA 3KH2A 3QMKA 5KYYA 1TKNA 2NUTA 4I44A 1OQCA 3SNHA 4BPMA 2GWWA 1Z3IX 3AG2C 5KYNA 1A7EA 1TWAA 2A6HF 4IAOA 4FX5A 4MVUA 1CPQA 3G4XA 1BR4A 4LDRA 3ATPA 2P6VA 3NMJA 3ZVRA 1YDIA 2PNOA 2R7TA 4CS9A 5B1AC 5AC5A 2D5RB 4U5BE 5A6JA 2NSFA 3ASNC 4NQFA 2HMZA 3MYIA 4CS8C 2QNLA 3EG9A 2OG2A 3MFNA 1GGQA 1Q0GA 3NMIA 3FXHA 3E9VA 2XL4A 3MBGA 1D0XA 1G5ZA 4IAQA 4BJ6A 3IHUA 3A11A 3GORA 4WABA 3TOMA 1ORYA 2A0UA 2HJMA 2Y3DA 2H7OA 4KBLA 3WHNA 2OJQA 3S28A 3LNRA 4U9EA 3SYNA 1BBHA 5E3CA 5L0DA 1RKCA 1UFBA 3HJCA 3EGDA 4YN0B 2ASRA 2J0WA 2F22A 1JAFA 4OIPF 1YA7O 3RQGA 1FAPB 3CQZA 3AJMA 4CBEA 4D4NA 5AC4A 2XLHA 1ZHZA 3AG1C 3T6BA 3TJ6A 4C3EA 4Q7CA 2HUJA 4KI2A 2OKUA 2R7RA 2OOCA 3V5XA 1MMAA 4AE4B 1C03A 1JOGA 3LNMB 3AGTA 5JP7A 1ZW3A 1Z6AA 1JPJA 1LE2A 3W2WA 4XPXA 3V7OA 4BJ1A 2KYHA 4BJ6C 3JYHA 3EHNA 2L6HA 3ZDLA 4DVYP 4K7BA 3M4CA 5F28E 3B9QA 2VCBA 5COFA 3L0IA 1BZ4A 3DXJF 2YL7A 3SP1A 3UR3C 5DLJA 3OWTA 4HFFB 2R7SA 2DGJA 4IWBA 1Z5ZA 1ZU4A 1CGOA 3M4BA 4PR9A 5E33A 4FAPB 4EBBA 3EGXA 1OKKD 2IM8A 2AWYA 4KC9A 3PDMP 1A7DA 5KYWA 3TULA 4LDKA 3G50A 3LAYA 1KNYA 4P9FA 4LERA 5BQIA 4OD4A 1VOMA 2RD9A 3NYMA 4BG0A 2PP4A 4CS8A 2Q00A 2HZ8A 1C02A 4EBJA 2GAQA 2J45A 4LLCA 4YT8A 4DRJB 4XEKA 2HV6A 4A2NB 2PFDA 2XS8A 1M2VA 3TD7A 4YJWA 5EK0A 3ZC4A 3C18A 3L1MA 1MNDA 2Y39A 2YZSA 3O55A 1EKYA 2EIKC 5AGFA 2W4BA 2HV7A 2W9YA 2DB4A 5F5HA 1RXQA 4DBRA 2YEVA 5DVWA 3VYWA 3EZIA 2HS5A 3FVYA 3V5ZA 1U6HA 2YLGA 1LM3B 3ASOC 4R32A 2Y3BA 4U5CE 4DRHB 3H65A 1I4YA 1V4AA 3GWNA 4U9DA 2HSBA 4MVMA 4ER9A 1HE9A 1NU9C 1Q0FA 1YZAA 3T6JA 3S90A 4YT5A 1FR0A 3HNJA 1E86A 2WVOA 3HLZA 1NFOA 2VC9A 2AU5A 2W4MA 3JT1A 1M2VB 1QZXA 1YAUO 5GPGB 1BDJB 4LDQA 2LQGA 3B71A 2X51A 5BQGA 4AL0A 4M63A 2KC3A 4U5GA 4UDVA 2JPUA 2LIGA 3QZCA 2KGOA 2YWAA 4P9TA 5L0GA 3L8IA 3EG9B 4MVOA 1D1BA 3LUTB 4A4AA 4DRIB 3EGXB 1ORJA 3BRJA 3DM5A 1MMGA 3ZWIA 3ABLC 4LLEA 5B3SC 3WAQA 4W8PA 4ZLCA 2LFDA 1AVOB 1M2OA 1MMDA 1Y6DA 4EWCA 4G7HF 3LJBA 3ZSUA 2OEXA 4PJMA 5A6KA 4C7OB 4MNDA 1XWJA 4DBQA 1H7IA 4JURI 4NTBA 1Y4CA 1S7ZA 2WVQA 3HNLA 4RD9A 1M56C 4PJNA 4Q5SF 4BJTA 2KQ9A 2L81A 3PHF2 1J8MF 2EPMX 2XLVA 3JSEO 2ZXRA 2D4UA 5E2QA 4JJFA 4JRZA 2M4EA 1O5HA 3JZ0A 1JRAA 1Q0KA 1QLEC 1TWHA 2LFFA 1WOLA 2FFHA 4PK4A 2HSQA 2BE5F 2LCHA 3FAPB 5JT4A 1YJGA 3ZIBA 1QKRA 4I3MA 2Q7RA 1O87A 3C8GA 1C17M 1ZW2A 1D0ZA 4YWQA 5FZTA 3MYFA
chains in the Genus database with same CATH topology
2QE9A 2RD9A 2NSFA 2QNLA 2OQMA 3CEXA 3DI5A 2P1AA 3GORA 1RXQA 5COFA 2NSGA 2HKVA 4N6CA 5COGA 5COMA 3DKAA 2OU6A 3QTHA 2F22A 5CIVA 2YQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QE9 A;  2RD9 A;  2NSF A;  2QNL A;  2OQM A;  3CEX A;  3DI5 A;  2P1A A;  3GOR A;  1RXQ A;  5COF A;  2NSG A;  2HKV A;  4N6C A;  5COG A;  5COM A;  3DKA A;  2OU6 A;  3QTH A;  2F22 A;  5CIV A;  2YQY A; 
#chains in the Genus database with same CATH topology
 1T5O A;  2J9W A;  2A0B A;  3AGU A;  4O7G A;  5KYX A;  4MVZ A;  2AWC A;  1M57 C;  2CW0 F;  1D1A A;  1WWP A;  2QLA A;  4XTK A;  3T9O A;  3POV A;  4XPW A;  2B0J A;  3U8P A;  1LI5 A;  2G62 A;  5CI9 A;  3U8V A;  4JTA B;  3W8H A;  4E7S A;  4YT4 A;  4YK5 A;  4U5H A;  1L7C A;  3I5P A;  3JYY A;  3LLI A;  4O6M A;  4EKW A;  1BR2 A;  1V55 C;  3JSZ A;  4OD5 A;  3U3F A;  1S05 A;  4XEV A;  4BEJ A;  3FAJ A;  3GM2 A;  4IAR A;  1PV3 A;  3O39 A;  2EIL C;  4EBK A;  3H2U A;  2NSG A;  4IGG A;  2XLO A;  1JMW A;  4PAC A;  3KPH A;  4U5D E;  2VCC A;  3DKA A;  2PX3 A;  1DOV A;  3NYL A;  1I4Z A;  3C63 A;  2FGY A;  4ZLD A;  4NC3 A;  1CGN A;  2XM0 A;  2CCY A;  2YLI A;  4JTD B;  1K05 A;  3RW0 A;  1TWG A;  2WB7 A;  1LKX A;  3UGP A;  1NU7 D;  4N6H A;  3ITF A;  1U89 A;  2XLW A;  2ICW G;  3C8G D;  5JRA A;  1YZC A;  2Z15 A;  3U9M A;  1WGW A;  2YL3 A;  2XLM A;  4MW8 A;  2ZD9 A;  4PJL A;  3R7C A;  5JVE A;  4EHP A;  3I5Q A;  5T3W A;  4MVQ A;  4O79 A;  4JJG A;  4E7Z A;  1VMA A;  2WVN A;  2YLD A;  2KNH A;  1H9T A;  3DE8 A;  3LS1 A;  3NYJ A;  3Q6N A;  3U9J A;  2Q9B A;  2R7V A;  3IQC A;  3UNG C;  1HMD A;  3DJN B;  4H54 A;  1OR3 A;  2CNW D;  2XRH A;  2BC5 A;  1FMW A;  1RMV A;  3K1I C;  1BR1 A;  4KNV A;  4Z9J A;  3VF0 A;  2P0N A;  3KKB A;  3EZH A;  3BEH A;  3Q7G A;  5T1D B;  3RKO F;  2DYR C;  4CIH A;  2CYD A;  5JS5 A;  1ZHY A;  1LE4 A;  2QE9 A;  3U2M A;  3KMI A;  3NKE A;  2FAP B;  3LEO A;  2HFI A;  3CAX A;  1T6I A;  1VB5 A;  1GS9 A;  3S84 A;  1ST6 A;  4FES A;  4JKV A;  3JRM O;  1JPN A;  3LEV A;  4F4B A;  3CEX A;  4J30 B;  1QPU A;  2B0H A;  3QVZ A;  3RQF A;  5DQT A;  5L0C A;  3KYI A;  2L6G A;  2J9V A;  2EIM C;  3W4Y A;  4CJO A;  2I15 A;  4C3B A;  1AUE A;  4NTA A;  3FOP A;  3C7J A;  5JSL A;  3UMK A;  4BJ5 C;  3NDB B;  1ORS C;  3GAN A;  1TWC A;  3C8G B;  1E2X A;  4I1O B;  1LS1 A;  5COM A;  5B1B C;  1KTM A;  3H2V A;  3RVY A;  3US6 A;  5L0F A;  5KYX B;  3Q6M A;  1A0B A;  1ZVZ A;  3UMI A;  256B A;  5A69 A;  5A6B A;  3FDQ A;  2Q9A A;  2NG1 A;  3C8Z A;  1D0Y A;  3HTK C;  1O3U A;  4IRU A;  2H7B A;  1OCC C;  3S29 A;  4CS9 C;  5JLI A;  4N4W A;  2QY9 A;  2R7Q A;  3L34 A;  3U3B A;  1LS4 A;  4P6I C;  2C04 A;  4XLP F;  3J06 A;  2XL6 A;  3E70 C;  4JZA A;  4G7O F;  2IYL D;  1G8X A;  1YLM A;  4DJ9 A;  4JVS A;  2CGE A;  2J46 A;  5CI8 A;  1R4T A;  3ABK C;  4C7O A;  2RSE B;  2Y69 C;  5D91 A;  3T6G B;  1PD1 A;  1WAS A;  2IXO A;  2AVK A;  2LD6 A;  1NLX A;  2A6E F;  1ZYR F;  3RYL A;  1K40 A;  2OEV A;  3HNK A;  4Z9I A;  2R7X A;  3EFO A;  1YVI A;  3DD7 A;  1PCX A;  4H4K C;  4L6R A;  1QSP A;  3TOL A;  1E84 A;  3S0X A;  5HSW A;  1L3P A;  4LAC B;  1OW7 A;  4HEA J;  4J7T A;  4CDA A;  3O10 A;  1EA8 A;  1V54 C;  4CJG A;  1APC A;  1NBB A;  1U0B B;  1DOW A;  3DWW A;  4PJJ A;  1H9G A;  4IB4 A;  3DMD A;  4IJJ A;  3M1C B;  4OIO F;  1GQA A;  2OJE D;  1NG1 A;  2PBE A;  2XS1 A;  3S9O A;  3KYJ A;  1LPE A;  2YKZ A;  2MYS A;  3I4U A;  4WJ0 A;  4X0R A;  1HMO A;  5F5F A;  3NG1 A;  1YAR O;  2L6F A;  1YA9 A;  2UUI A;  3LS0 A;  4W8K A;  1K04 A;  1Z7Q c;  1V74 B;  1RKE A;  2A1D D;  2GFH A;  3X2Q C;  2W45 A;  3SXK A;  2A69 F;  1SZI A;  3Q7L A;  3SXY A;  4ONS A;  3JRT A;  3OA1 A;  4RDA A;  2XLE A;  2IXM A;  1NSG B;  1A7V A;  2IXP A;  1Z23 A;  1T6U A;  2KW3 C;  5E3A A;  3U0C A;  3EFO B;  5CIV A;  3VRC A;  5L0I A;  3ZTZ A;  3SZR A;  2YQY A;  1AEP A;  4G7Z F;  4NCQ A;  1FTS A;  3RVZ A;  1OCZ C;  3M15 A;  3WOD F;  4ULV A;  5FCL A;  4XEF A;  1J8Y F;  2QTV A;  2IOQ A;  3QVY A;  3DM9 B;  4K0D A;  3EQL F;  3O6X A;  4JIO A;  2Y3G A;  2YVK A;  1FFH A;  4HE8 D;  2VB6 A;  2Q4F A;  4MTO A;  4PFO A;  4YL3 A;  2VAS A;  3AOU A;  4KNW A;  4CSA A;  3DI5 A;  2JX0 A;  3K7D A;  3HKK A;  2DYS C;  3GEE A;  4E17 A;  4PFP A;  4MTG A;  4CDV A;  3IQT A;  3DAG A;  4ULW A;  3LLK A;  3R2P A;  1IW7 F;  2A68 F;  2Q9C A;  3CZ6 A;  1KU2 A;  2E87 A;  2HKV A;  1JR8 A;  1LVK A;  2P7V A;  3DAF A;  4JE9 A;  5K0I A;  4JCZ A;  2EIN C;  2R9R B;  2EPK X;  4MW3 A;  4MVR A;  4JEB A;  1TFO B;  4Q4Z F;  2XSE A;  5DS6 A;  3OEO A;  1FMV A;  1NZE A;  4WGZ A;  4JEA A;  4N06 A;  5JUA A;  3B0V C;  3GM3 A;  3AG4 C;  1W2W A;  1HY5 A;  2R7O A;  3HNI A;  1WN0 A;  3B29 A;  2J7P D;  3ZQV A;  3DE9 A;  4NTF A;  1TQG A;  2ZXW C;  2TMV P;  2NUP B;  1IZM A;  2ETS A;  4CIP A;  3GEI A;  4JC7 A;  4AE4 A;  3CSK A;  3MX3 A;  4Z9H A;  1OXK A;  1LI7 A;  2JD3 A;  3GM1 A;  3V5Y A;  1YYJ A;  4B6I A;  4GEH A;  3S27 A;  1VK5 A;  1ZHX A;  2NUP A;  2R02 A;  5EHH A;  2J8W A;  1VLT A;  1SYQ A;  1OR2 A;  4E0H A;  3K1I A;  3FMS A;  3EGD B;  1N1C A;  3JTL O;  3RIP A;  2PX0 A;  3KL4 A;  5TJ5 E;  4GYT A;  1F1M A;  4AK9 A;  2J9U A;  1MMN A;  1E85 A;  2BL2 A;  2GA0 A;  4CS7 A;  2XLD A;  1SF8 A;  1UG7 A;  2KK1 A;  3QW0 A;  3X1O A;  1SR2 A;  4AX2 A;  1LIH A;  1NFN A;  2ZXP A;  4QI0 A;  1OCR C;  2UUH A;  4U5E E;  4YL0 A;  4XLN F;  3NRH A;  2L9J A;  3DZA A;  5A6A A;  2AP3 A;  1M6T A;  1Z63 A;  3N0T A;  1ZHT A;  1FFT C;  1ZHW A;  1TFK B;  4BJ5 A;  2P1A A;  2WZL A;  4BEM J;  5D92 A;  3IPM O;  2J9B A;  2HJ3 A;  1R5I D;  3L8J A;  3QW1 A;  2XL8 A;  2YL1 A;  3NMK A;  4OIQ F;  4N6C A;  3K6B A;  2R7W A;  2R03 A;  4WGY A;  2V26 A;  2ZPA A;  5COG A;  4O6N A;  1WTY A;  3N2Z B;  1XZQ A;  2DI3 A;  2WL8 A;  3C62 A;  3PMR A;  4NY3 A;  3K66 A;  5L0H A;  3TJ5 A;  3U2L A;  2NUT B;  3IEE A;  3RF3 A;  3U5S A;  3RH3 A;  4EUK B;  3EPV A;  3N24 A;  3ZQY A;  2IXN A;  1EQ1 A;  1MNE A;  5L3V A;  2R25 A;  4MQ9 F;  5T3T A;  3SEO A;  4ANJ A;  4DVZ A;  5A6B D;  3NKD A;  4XPY A;  5EGY A;  3B0U X;  2LSE A;  3SXZ A;  3PCV A;  3M79 A;  4MVS A;  5DS4 A;  5BQH A;  5L0J A;  3VM6 A;  2YHS A;  3LES A;  5KYY B;  1G4W R;  2KSF A;  2OQM A;  4XWJ A;  1D1C A;  2Y3H A;  3EH2 A;  3F46 A;  3G4Z A;  4E0I A;  5HV9 A;  1RJ9 A;  3K1H A;  3W2V A;  1VTM P;  4OIR F;  1RKE B;  1EI7 A;  3EJN A;  4QI2 A;  1RCP A;  2VCA A;  3GWL A;  3JCU Q;  1G4U S;  1T9K A;  1WAT A;  2PF4 E;  1YYX A;  4CX9 A;  3UMH A;  5KYW B;  4AL1 A;  5BUO A;  1VLS A;  4G78 A;  4JTC B;  4EIY A;  2NPU A;  1T01 A;  1VYK A;  4RBN A;  4K1O A;  2GDC A;  2H8A A;  2O9X A;  2OU6 A;  2CNW A;  3TQO A;  2EIJ C;  2ZXO A;  3AQB A;  3IQ6 A;  3W8I A;  3RFY A;  5IY5 C;  3EH1 A;  1HW2 A;  2QUP A;  1CPR A;  2CDQ A;  4YT2 A;  4QDL A;  1Q0D A;  1HE1 A;  2EPL X;  3EHM A;  1E83 A;  1OW6 A;  2XXA A;  4GQH A;  4I1M A;  1OW8 A;  4HFK B;  1B68 A;  5DS5 A;  2XM4 A;  2EPO A;  1SMY F;  4J7Y A;  2OCC C;  1HW1 A;  4DXW A;  4E18 A;  4JCH A;  5KYU B;  1VYI A;  3AQC A;  4OIN F;  3WG7 C;  5DQZ A;  4G0H A;  3GEH A;  1T6Q A;  3AG3 C;  3ZG1 A;  4U5F E;  2WZG A;  3MLG A;  2M64 A;  2HMQ A;  5KYU A;  1MQV A;  1ZU5 A;  2YL0 A;  3FOO A;  1XZP A;  3VAY A;  1OKK A;  4J32 B;  2G3V A;  2G3K A;  1H6G A;  2VH3 A;  5L3Q A;  2R05 A;  2XXA B;  4MTF A;  3K33 A;  2H7V C;  1OXB A;  2R7U A;  1QQ3 A;  3IQ5 A;  3ECS A;  3QTH A;  1TR2 A;  3A9C A;  3F47 A;  2X0C A;  3SXM A;  4D4X A;  3ZTM A;  3FHD A;  2MHR A;  3RQE A;  1GM5 A;  3B0P A;  2P61 A;  1Q0M A;  4CDY A;  4C3D A;  2KJG A;  2I8B A;  3DJU B;  4MS2 A;  3T4R A;  2J7P A;  3TK0 A;  1PD0 A;  1A41 A;  1I5N A;  1RJ9 B;  2EPN A;  2L7A A;  2LP4 A;  4YL1 A;  5B3I A;  1FNT c;  1QVX A;  2MWQ A;  2LK4 A;  2Q3T A;  4O6Y A;  2C03 A;  2J0X A;  4XQ1 A;  3GOD A;  1OCO C;  4FWV A;  1ZZP A;  3UGO A;  4CSA C;  1CGM E;  2IBF A;  2WZF A;  3ABM C;  2V3C C;  4JW1 A;  2YRF A;  4DOZ A;  3KH2 A;  3QMK A;  5KYY A;  1TKN A;  2NUT A;  4I44 A;  1OQC A;  3SNH A;  4BPM A;  2GWW A;  1Z3I X;  3AG2 C;  5KYN A;  1A7E A;  1TWA A;  2A6H F;  4IAO A;  4FX5 A;  4MVU A;  1CPQ A;  3G4X A;  1BR4 A;  4LDR A;  3ATP A;  2P6V A;  3NMJ A;  3ZVR A;  1YDI A;  2PNO A;  2R7T A;  4CS9 A;  5B1A C;  5AC5 A;  2D5R B;  4U5B E;  5A6J A;  2NSF A;  3ASN C;  4NQF A;  2HMZ A;  3MYI A;  4CS8 C;  2QNL A;  3EG9 A;  2OG2 A;  3MFN A;  1GGQ A;  1Q0G A;  3NMI A;  3FXH A;  3E9V A;  2XL4 A;  3MBG A;  1D0X A;  1G5Z A;  4IAQ A;  4BJ6 A;  3IHU A;  3A11 A;  3GOR A;  4WAB A;  3TOM A;  1ORY A;  2A0U A;  2HJM A;  2Y3D A;  2H7O A;  4KBL A;  3WHN A;  2OJQ A;  3S28 A;  3LNR A;  4U9E A;  3SYN A;  1BBH A;  5E3C A;  5L0D A;  1RKC A;  1UFB A;  3HJC A;  3EGD A;  4YN0 B;  2ASR A;  2J0W A;  2F22 A;  1JAF A;  4OIP F;  1YA7 O;  3RQG A;  1FAP B;  3CQZ A;  3AJM A;  4CBE A;  4D4N A;  5AC4 A;  2XLH A;  1ZHZ A;  3AG1 C;  3T6B A;  3TJ6 A;  4C3E A;  4Q7C A;  2HUJ A;  4KI2 A;  2OKU A;  2R7R A;  2OOC A;  3V5X A;  1MMA A;  4AE4 B;  1C03 A;  1JOG A;  3LNM B;  3AGT A;  5JP7 A;  1ZW3 A;  1Z6A A;  1JPJ A;  1LE2 A;  3W2W A;  4XPX A;  3V7O A;  4BJ1 A;  2KYH A;  4BJ6 C;  3JYH A;  3EHN A;  2L6H A;  3ZDL A;  4DVY P;  4K7B A;  3M4C A;  5F28 E;  3B9Q A;  2VCB A;  5COF A;  3L0I A;  1BZ4 A;  3DXJ F;  2YL7 A;  3SP1 A;  3UR3 C;  5DLJ A;  3OWT A;  4HFF B;  2R7S A;  2DGJ A;  4IWB A;  1Z5Z A;  1ZU4 A;  1CGO A;  3M4B A;  4PR9 A;  5E33 A;  4FAP B;  4EBB A;  3EGX A;  1OKK D;  2IM8 A;  2AWY A;  4KC9 A;  3PDM P;  1A7D A;  5KYW A;  3TUL A;  4LDK A;  3G50 A;  3LAY A;  1KNY A;  4P9F A;  4LER A;  5BQI A;  4OD4 A;  1VOM A;  2RD9 A;  3NYM A;  4BG0 A;  2PP4 A;  4CS8 A;  2Q00 A;  2HZ8 A;  1C02 A;  4EBJ A;  2GAQ A;  2J45 A;  4LLC A;  4YT8 A;  4DRJ B;  4XEK A;  2HV6 A;  4A2N B;  2PFD A;  2XS8 A;  1M2V A;  3TD7 A;  4YJW A;  5EK0 A;  3ZC4 A;  3C18 A;  3L1M A;  1MND A;  2Y39 A;  2YZS A;  3O55 A;  1EKY A;  2EIK C;  5AGF A;  2W4B A;  2HV7 A;  2W9Y A;  2DB4 A;  5F5H A;  1RXQ A;  4DBR A;  2YEV A;  5DVW A;  3VYW A;  3EZI A;  2HS5 A;  3FVY A;  3V5Z A;  1U6H A;  2YLG A;  1LM3 B;  3ASO C;  4R32 A;  2Y3B A;  4U5C E;  4DRH B;  3H65 A;  1I4Y A;  1V4A A;  3GWN A;  4U9D A;  2HSB A;  4MVM A;  4ER9 A;  1HE9 A;  1NU9 C;  1Q0F A;  1YZA A;  3T6J A;  3S90 A;  4YT5 A;  1FR0 A;  3HNJ A;  1E86 A;  2WVO A;  3HLZ A;  1NFO A;  2VC9 A;  2AU5 A;  2W4M A;  3JT1 A;  1M2V B;  1QZX A;  1YAU O;  5GPG B;  1BDJ B;  4LDQ A;  2LQG A;  3B71 A;  2X51 A;  5BQG A;  4AL0 A;  4M63 A;  2KC3 A;  4U5G A;  4UDV A;  2JPU A;  2LIG A;  3QZC A;  2KGO A;  2YWA A;  4P9T A;  5L0G A;  3L8I A;  3EG9 B;  4MVO A;  1D1B A;  3LUT B;  4A4A A;  4DRI B;  3EGX B;  1ORJ A;  3BRJ A;  3DM5 A;  1MMG A;  3ZWI A;  3ABL C;  4LLE A;  5B3S C;  3WAQ A;  4W8P A;  4ZLC A;  2LFD A;  1AVO B;  1M2O A;  1MMD A;  1Y6D A;  4EWC A;  4G7H F;  3LJB A;  3ZSU A;  2OEX A;  4PJM A;  5A6K A;  4C7O B;  4MND A;  1XWJ A;  4DBQ A;  1H7I A;  4JUR I;  4NTB A;  1Y4C A;  1S7Z A;  2WVQ A;  3HNL A;  4RD9 A;  1M56 C;  4PJN A;  4Q5S F;  4BJT A;  2KQ9 A;  2L81 A;  3PHF 2;  1J8M F;  2EPM X;  2XLV A;  3JSE O;  2ZXR A;  2D4U A;  5E2Q A;  4JJF A;  4JRZ A;  2M4E A;  1O5H A;  3JZ0 A;  1JRA A;  1Q0K A;  1QLE C;  1TWH A;  2LFF A;  1WOL A;  2FFH A;  4PK4 A;  2HSQ A;  2BE5 F;  2LCH A;  3FAP B;  5JT4 A;  1YJG A;  3ZIB A;  1QKR A;  4I3M A;  2Q7R A;  1O87 A;  3C8G A;  1C17 M;  1ZW2 A;  1D0Z A;  4YWQ A;  5FZT A;  3MYF A; 
#chains in the Genus database with same CATH homology
 2QE9 A;  2RD9 A;  2NSF A;  2QNL A;  2OQM A;  3CEX A;  3DI5 A;  2P1A A;  3GOR A;  1RXQ A;  5COF A;  2NSG A;  2HKV A;  4N6C A;  5COG A;  5COM A;  3DKA A;  2OU6 A;  3QTH A;  2F22 A;  5CIV A;  2YQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...