2OQMA

Crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
180
structure length
180
Chain Sequence
HHENLYFQGMLYDLTVVQFSKMLKNLNAIFDKAEAFAELKKVDMDVLLNSRLAADQFNLIRQVQIACDTAKVGVARLTGQLETAPKHDDSETTLAELRQRIASVLTYLEGFSEADFANAATIQISQPRWQGKYLTGYEFAIEHAIPNLYFHITTAYGILRHNGVEVGKKDYLGAMPYKAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (YP_561575.1) from Shewanella denitrificans OS-217 at 1.83 A resolution
rcsb
source organism Shewanella denitrificans
molecule tags Unknown function
total genus 61
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09351 DUF1993 Domain of unknown function (DUF1993)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2oqmA01
1RXQA 5COMA 2OQMA 2RD9A 3DKAA 5COGA 5COFA 3GORA 2YQYA 2NSFA 2QE9A 3QTHA 5CIVA 2NSGA 2P1AA 3CEXA 2F22A 2QNLA 2HKVA 2OU6A 4N6CA 3DI5A
chains in the Genus database with same CATH superfamily
3LS0A 2V26A 3SP1A 1L3PA 1CPQA 1MMAA 2L6FA 3ABMC 1QQ3A 4WABA 3RKOF 3ZTMA 1LIHA 1M6TA 3RQFA 4EUKB 4XTKA 5EK0A 3SEOA 3JT1A 1NLXA 2AWCA 3RF3A 1G5ZA 4CJGA 2IXMA 3EGXA 5FCLA 2J7PD 4JC7A 2P1AA 1KNYA 2BC5A 1YDIA 1JMWA 3EG9A 5GPGB 5B1BC 2XS8A 3CSKA 1GQAA 3NYJA 1D1AA 2LIGA 1AUEA 4C3BA 4IAOA 1ORSC 4HEAJ 3LUTB 1S7ZA 2DYSC 2J9VA 4JZAA 5JLIA 1T6UA 3KYJA 1ZU5A 3TULA 4XLPF 3TJ5A 3EQLF 1XZQA 5JRAA 4QI2A 3AOUA 3S9OA 1R5ID 1YJGA 3NMIA 1Q0KA 1LVKA 2I15A 2VH3A 2XLHA 4LLCA 5CI9A 2YL7A 3B0PA 4XPXA 2MYSA 2EIMC 4IB4A 1MQVA 5COMA 2ICWG 5FZTA 1YA7O 3WG7C 4U5DE 5D92A 1NU9C 2PX0A 2XL4A 1HMDA 3C18A 4ULVA 1ZHXA 2AVKA 3N0TA 1WGWA 1ORYA 2JD3A 2M4EA 3EH1A 3QTHA 4AE4B 3L8IA 3F47A 3ASOC 3EZIA 3L0IA 4BJ6A 1IW7F 3KPHA 5TJ5E 3AGUA 2Q3TA 1YYJA 1BR1A 3DM5A 3LLIA 3M79A 4WGZA 3S28A 5JS5A 3B9QA 1A7EA 2Q9AA 5KYUB 4U9DA 4I1MA 4PJJA 3MYIA 1BR4A 2BE5F 1VMAA 1JOGA 2NUPA 4KC9A 4LDKA 4OIRF 5BQIA 4JTCB 4FWVA 1T5OA 2FFHA 4MW8A 2QTVA 1NFOA 1T9KA 3DE8A 5DS6A 3OWTA 3TK0A 3Q6MA 4BEMJ 3PHF2 2TMVP 3PMRA 5F28E 3V5XA 3UGPA 4Q5SF 4XPYA 2J0WA 5EHHA 1MMGA 1E86A 3DKAA 3U9MA 2HUJA 3MX3A 1Q0FA 3FMSA 2XS1A 3TD7A 1LKXA 4BJTA 3DD7A 4CDVA 3KYIA 2CNWD 2J46A 1QPUA 3GWNA 1BZ4A 2GWWA 1SYQA 1F1MA 3AG3C 3ZG1A 4EBKA 2XLWA 3UGOA 4I44A 1FR0A 3LS1A 2XL6A 2A0UA 2WVNA 5AC5A 1M57C 2X51A 1WTYA 3OA1A 3PDMP 1HW1A 2G62A 2PF4E 4JIOA 2NUTA 3VRCA 2Z15A 2DYRC 1ZVZA 1MNEA 2XM0A 3E70C 2CCYA 2Y3BA 4HFFB 4EBJA 3U0CA 2XLMA 2KNHA 3MYFA 4C3EA 2R7RA 2YHSA 2ETSA 2P61A 5IY5C 4AL0A 3EGDA 3MLGA 4JURI 4XEKA 4RBNA 3FXHA 4XWJA 3IQCA 4IAQA 1DOWA 1H9GA 2UUIA 3C8GA 4MQ9F 4OINF 5F5HA 3AG2C 3ZQYA 1BDJB 3EFOA 3NKDA 1CGME 4OIOF 4O6NA 3W8HA 2DI3A 1V74B 2L6GA 2EPKX 1J8YF 4Q4ZF 3G4XA 3O6XA 1YZCA 1QZXA 2OEXA 4O6MA 2W4BA 3H2UA 4YT8A 2D5RB 2M64A 3U9JA 3CEXA 2YL1A 4JKVA 4DRIB 1G4US 5KYXA 3O55A 1K04A 2QNLA 3FDQA 3I5PA 1AEPA 3ITFA 3MFNA 5JP7A 2J0XA 4G78A 4ER9A 3KMIA 4N4WA 2A6HF 3M15A 256BA 3B71A 2EPMX 1TWAA 3S90A 2J9BA 2ZXWC 2QY9A 2R02A 1FTSA 4R32A 1UFBA 3C8ZA 3X1OA 2IM8A 3BRJA 3RFYA 3T6JA 1A41A 1Y6DA 5A6BA 4E17A 2R7SA 4YJWA 4ZLCA 2VCBA 1OCOC 3LAYA 3ZDLA 4B6IA 1DOVA 3VM6A 4CIHA 3FOOA 5E3AA 1UG7A 2NUTB 2D4UA 1ZHYA 4MVUA 4X0RA 5COGA 2YLGA 3FVYA 5L0GA 1D1BA 3Q6NA 3S84A 2Y3HA 3K33A 3DXJF 3LESA 1PCXA 4NC3A 3WAQA 4CDYA 2KSFA 3I5QA 1RCPA 2NSGA 2Q4FA 3FHDA 2CGEA 3NKEA 1E84A 5EGYA 4D4NA 3DAGA 3N2ZB 4AK9A 1U6HA 3CAXA 4OIPF 4CS7A 2IBFA 1YVIA 2LP4A 5E3CA 4EWCA 1RKEA 3EH2A 4U5HA 2QLAA 1NZEA 2IOQA 1J8MF 2KYHA 3K1IA 3SYNA 5KYWB 5HSWA 4YT4A 3K1IC 3DI5A 1H6GA 4J30B 1VK5A 1V54C 4JJGA 4KBLA 1C03A 3IHUA 4MVRA 4DBRA 5L0JA 2XSEA 4U5FE 4WGYA 4XEFA 2LCHA 4MVQA 3ZQVA 1NU7D 1OW6A 1YLMA 1RKCA 3JTLO 3W8IA 4YK5A 1AVOB 1QKRA 4NQFA 1L7CA 4IGGA 2ASRA 2LFFA 4LDQA 1T6QA 1LPEA 4MS2A 3JRTA 1VOMA 2XLVA 1A7VA 2R7TA 2KC3A 1SR2A 3ZTZA 1YYXA 1Z23A 3GEIA 2GFHA 3X2QC 3BEHA 4YT2A 3GM3A 4GEHA 3DAFA 2WZFA 1JR8A 5E33A 3U3FA 2HMQA 2LK4A 2P6VA 4ULWA 2EINC 3L1MA 4XLNF 2VCCA 1GM5A 4FAPB 3IQTA 5HV9A 3O10A 3I4UA 4G7HF 2MHRA 4XQ1A 4YN0B 1A0BA 3ASNC 2PFDA 2BL2A 2Q7RA 4E18A 3JRMO 5A69A 3Q7LA 3H65A 3K6BA 3AJMA 3WODF 4P9FA 2DGJA 2XXAA 4P6IC 3DM9B 1V4AA 4ZLDA 1M2VB 5F5FA 3MBGA 3KKBA 1TWCA 4I1OB 4BJ5A 3GODA 4HE8D 5L0IA 2VB6A 3T6BA 1OW8A 1NSGB 4O6YA 3ZWIA 5KYYA 2JPUA 3V5ZA 3W2WA 2A68F 3NMJA 1ORJA 4RD9A 4MVOA 2CYDA 4O7GA 2F22A 4BJ6C 1O3UA 3J06A 2KW3C 5T3TA 4MTGA 2L81A 1JPJA 3UMHA 4EKWA 2HJ3A 2W45A 2Y3GA 3QW1A 2XM4A 4MW3A 1TKNA 2Q9BA 3IPMO 4JVSA 4U9EA 3RH3A 1PV3A 1G4WR 3GM1A 3FOPA 3EGXB 4JCHA 4QI0A 4DRJB 4IWBA 3C62A 3SZRA 4LERA 4YL0A 3EG9B 5B1AC 3HKKA 3AQBA 4KNVA 1GS9A 3HLZA 4M63A 2UUHA 1QLEC 3JCUQ 3FAJA 1N1CA 1YZAA 1ZHTA 3QW0A 3U8VA 2HV6A 1H9TA 1IZMA 1R4TA 2NSFA 4G7ZF 1RJ9A 1JPNA 2AP3A 2R25A 3JSZA 4BEJA 2NPUA 4DXWA 4CS8A 2HV7A 3O39A 4E0IA 2QUPA 5K0IA 3DJUB 2WVQA 4CS8C 1Q0GA 5E2QA 1GGQA 1MMDA 1TFKB 2C04A 2LD6A 4DRHB 3EZHA 2YKZA 3NRHA 3S27A 4PJNA 2B0HA 2JX0A 5L3QA 5KYYB 3L34A 3CZ6A 3B0UX 1I4YA 1E85A 4EIYA 1RXQA 3AG4C 1WATA 1ZW3A 2R7OA 3ATPA 1RMVA 4RDAA 1HE1A 4KI2A 4K7BA 1ZHWA 3SXKA 4C7OA 3HNLA 1PD0A 2NUPB 4NY3A 1TFOB 3EHMA 3GORA 1M56C 1TR2A 1KU2A 3UNGC 2AWYA 5KYNA 2YL3A 3ZC4A 4U5EE 1APCA 1A7DA 5D91A 1VB5A 2HJMA 2WB7A 4JE9A 3ZVRA 2R7WA 3ABKC 4MTOA 4DVYP 2XLDA 4E7SA 1SZIA 1W2WA 2DB4A 3T9OA 4N6CA 4F4BA 5L0DA 1LS1A 2OEVA 4H54A 4FX5A 4WJ0A 3G50A 5JSLA 3DE9A 2WL8A 1OKKA 2VASA 2YZSA 4YL1A 1XZPA 2Y69C 4N06A 2KJGA 4MVZA 1LE2A 1SMYF 3W2VA 1G8XA 3C8GD 3EJNA 3U5SA 4QDLA 4YWQA 1VTMP 2HZ8A 2L7AA 2HMZA 3H2VA 3IQ5A 4BJ1A 2O9XA 2HSBA 2RD9A 4PK4A 3U8PA 2CDQA 3CQZA 3RQEA 4GQHA 1C17M 4UDVA 4A4AA 2NG1A 2R7XA 1U0BB 1VLSA 3NYMA 2PBEA 1V55C 5DVWA 1OR3A 1OCCC 1BBHA 3C63A 3EGDB 3JZ0A 2A1DD 2R7VA 2VC9A 3C8GB 2OG2A 2H7VC 4KNWA 1FFHA 1QVXA 2OKUA 3EFOB 3HNJA 3QVYA 4N6HA 3T6GB 4PACA 3VYWA 4CBEA 2E87A 1LM3B 1Q0MA 2OCCC 2IXOA 3LEVA 1WASA 5A6BD 2R05A 4JRZA 4MNDA 4EBBA 2YL0A 4CIPA 4CS9A 5KYXB 2GA0A 2KK1A 1PD1A 2XLEA 3DJNB 1OCZC 1TWHA 1ST6A 2PNOA 1OQCA 3UR3C 3B29A 3JSEO 3GWLA 4A2NB 4U5CE 2Y3DA 5BQGA 2IYLD 4DJ9A 2YQYA 3JYYA 2R7QA 2YWAA 2Q00A 3U2LA 1CGNA 1WWPA 2J7PA 3WHNA 2HS5A 3A11A 4LACB 4OIQF 1E2XA 1Z5ZA 5JT4A 3R2PA 2HKVA 1LI7A 3ABLC 4LDRA 4E0HA 2A0BA 2P0NA 5L0HA 5B3SC 1B68A 1CPRA 4J7TA 3SXYA 1K40A 1K05A 3TOLA 3V7OA 4AE4A 5JUAA 4OD5A 3LEOA 1D0YA 4W8KA 2ZXPA 4PJLA 3US6A 5BQHA 1EKYA 4CJOA 4DBQA 4JEBA 1RKEB 5KYUA 3UMKA 4OD4A 3SXMA 3LNMB 1OR2A 2GAQA 3GM2A 4XPWA 2Y39A 1D0ZA 4FESA 4U5GA 1WN0A 3HTKC 2EPNA 4BJ5C 2G3VA 3VAYA 1I5NA 2J8WA 4E7ZA 3VF0A 2EIJC 1FMVA 3Q7GA 3AG1C 3B0VC 1JAFA 3JYHA 4NTAA 1LE4A 3U3BA 3K1HA 1Z63A 3M1CB 5CI8A 4YT5A 1FFTC 3G4ZA 2OJED 4PR9A 3FAPB 3K66A 3TJ6A 5L3VA 2L6HA 1D0XA 4D4XA 4Z9IA 5DQTA 1XWJA 2OJQA 1U89A 4NTFA 1I4ZA 2IXNA 1O5HA 2W9YA 2ZXOA 1OW7A 1ZZPA 3LLKA 2GDCA 1VYIA 5A6KA 3HJCA 2H7BA 4J7YA 3NG1A 5L0FA 4AL1A 5BUOA 2YLDA 3DZAA 2CW0F 3U2MA 4C3DA 2G3KA 4BG0A 1EI7A 1HE9A 1H7IA 4JEAA 2XXAB 2CNWA 2XL8A 2LQGA 2PX3A 3IEEA 1OXKA 2HFIA 2YLIA 3K7DA 5DQZA 5T1DB 4CDAA 4HFKB 3V5YA 1YA9A 4CX9A 2XLOA 3GEHA 2AU5A 3KH2A 4J32B 5A6JA 3KL4A 1NG1A 2YVKA 1FNTc 5DLJA 1E83A 1NBBA 1WOLA 2YEVA 3R7CA 1TWGA 3DWWA 4Z9HA 5JVEA 3AGTA 3RQGA 3NDBB 3RVZA 2OQMA 4H4KC 3SNHA 4ONSA 1M2OA 2FAPB 5T3WA 4GYTA 2W4MA 1HY5A 4XEVA 2Q9CA 3AQCA 2QE9A 1MMNA 2A6EF 2WZLA 3SXZA 4U5BE 1SF8A 5AGFA 4NTBA 1Z7Qc 4K1OA 4ANJA 2ZPAA 1ZW2A 3EHNA 3C7JA 4EHPA 4Z9JA 3UMIA 1ZU4A 3N24A 2B0JA 2EIKC 2R9RB 4I3MA 4W8PA 3GANA 1LS4A 1Z3IX 1VYKA 2J45A 2V3CC 3S29A 4DOZA 3QMKA 4CSAA 1RJ9B 1D1CA 4NCQA 1JRAA 1OXBA 4JW1A 2C03A 4PJMA 4CSAC 3IQ6A 3F46A 3LNRA 4PFOA 3TQOA 1YAUO 4JJFA 3ZSUA 1QSPA 2J9WA 3S0XA 3NMKA 2OOCA 1NFNA 1O87A 2LSEA 5KYWA 3E9VA 5COFA 2H8AA 3RIPA 3M4BA 3NYLA 4LLEA 4O79A 2YRFA 5CIVA 1CGOA 4YL3A 2X0CA 1FAPB 4P9TA 4BPMA 1EA8A 2HSQA 3HNKA 1Q0DA 5DS4A 1EQ1A 3RW0A 3QZCA 1Z6AA 2OU6A 2EILC 2ZD9A 4C7OB 3EPVA 3QVZA 2FGYA 5L0CA 3A9CA 1OKKD 3TOMA 1LI5A 2KQ9A 2J9UA 4MVSA 3HNIA 2EPLX 1C02A 3M4CA 3DMDA 1BR2A 1S05A 1OCRC 4K0DA 1MNDA 2PP4A 3L8JA 3POVA 5AC4A 5DS5A 2R7UA 1T01A 1Y4CA 4AX2A 2EPOA 2I8BA 4IJJA 4DVZA 2A69F 3W4YA 4CS9C 3OEOA 2IXPA 2WVOA 2R03A 4JTAB 3RVYA 2RSEB 3ECSA 3LJBA 3PCVA 4Q7CA 5B3IA 4JTDB 1HW2A 2LFDA 3ZIBA 4MVMA 1KTMA 4IRUA 4G0HA 5A6AA 2H7OA 2ZXRA 1FMWA 4IARA 2MWQA 2WZGA 1ZHZA 1M2VA 3T4RA 1VLTA 1YARO 1ZYRF 1T6IA 4MTFA 2XRHA 2L9JA 2KGOA 1HMOA 4PFPA 1TQGA 3RYLA 4JCZA 2P7VA 4G7OF 2VCAA 3GEEA 4L6RA
chains in the Genus database with same CATH topology
1RXQA 5COMA 2OQMA 2RD9A 3DKAA 5COGA 5COFA 3GORA 2YQYA 2NSFA 2QE9A 3QTHA 5CIVA 2NSGA 2P1AA 3CEXA 2F22A 2QNLA 2HKVA 2OU6A 4N6CA 3DI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RXQ A;  5COM A;  2OQM A;  2RD9 A;  3DKA A;  5COG A;  5COF A;  3GOR A;  2YQY A;  2NSF A;  2QE9 A;  3QTH A;  5CIV A;  2NSG A;  2P1A A;  3CEX A;  2F22 A;  2QNL A;  2HKV A;  2OU6 A;  4N6C A;  3DI5 A; 
#chains in the Genus database with same CATH topology
 3LS0 A;  2V26 A;  3SP1 A;  1L3P A;  1CPQ A;  1MMA A;  2L6F A;  3ABM C;  1QQ3 A;  4WAB A;  3RKO F;  3ZTM A;  1LIH A;  1M6T A;  3RQF A;  4EUK B;  4XTK A;  5EK0 A;  3SEO A;  3JT1 A;  1NLX A;  2AWC A;  3RF3 A;  1G5Z A;  4CJG A;  2IXM A;  3EGX A;  5FCL A;  2J7P D;  4JC7 A;  2P1A A;  1KNY A;  2BC5 A;  1YDI A;  1JMW A;  3EG9 A;  5GPG B;  5B1B C;  2XS8 A;  3CSK A;  1GQA A;  3NYJ A;  1D1A A;  2LIG A;  1AUE A;  4C3B A;  4IAO A;  1ORS C;  4HEA J;  3LUT B;  1S7Z A;  2DYS C;  2J9V A;  4JZA A;  5JLI A;  1T6U A;  3KYJ A;  1ZU5 A;  3TUL A;  4XLP F;  3TJ5 A;  3EQL F;  1XZQ A;  5JRA A;  4QI2 A;  3AOU A;  3S9O A;  1R5I D;  1YJG A;  3NMI A;  1Q0K A;  1LVK A;  2I15 A;  2VH3 A;  2XLH A;  4LLC A;  5CI9 A;  2YL7 A;  3B0P A;  4XPX A;  2MYS A;  2EIM C;  4IB4 A;  1MQV A;  5COM A;  2ICW G;  5FZT A;  1YA7 O;  3WG7 C;  4U5D E;  5D92 A;  1NU9 C;  2PX0 A;  2XL4 A;  1HMD A;  3C18 A;  4ULV A;  1ZHX A;  2AVK A;  3N0T A;  1WGW A;  1ORY A;  2JD3 A;  2M4E A;  3EH1 A;  3QTH A;  4AE4 B;  3L8I A;  3F47 A;  3ASO C;  3EZI A;  3L0I A;  4BJ6 A;  1IW7 F;  3KPH A;  5TJ5 E;  3AGU A;  2Q3T A;  1YYJ A;  1BR1 A;  3DM5 A;  3LLI A;  3M79 A;  4WGZ A;  3S28 A;  5JS5 A;  3B9Q A;  1A7E A;  2Q9A A;  5KYU B;  4U9D A;  4I1M A;  4PJJ A;  3MYI A;  1BR4 A;  2BE5 F;  1VMA A;  1JOG A;  2NUP A;  4KC9 A;  4LDK A;  4OIR F;  5BQI A;  4JTC B;  4FWV A;  1T5O A;  2FFH A;  4MW8 A;  2QTV A;  1NFO A;  1T9K A;  3DE8 A;  5DS6 A;  3OWT A;  3TK0 A;  3Q6M A;  4BEM J;  3PHF 2;  2TMV P;  3PMR A;  5F28 E;  3V5X A;  3UGP A;  4Q5S F;  4XPY A;  2J0W A;  5EHH A;  1MMG A;  1E86 A;  3DKA A;  3U9M A;  2HUJ A;  3MX3 A;  1Q0F A;  3FMS A;  2XS1 A;  3TD7 A;  1LKX A;  4BJT A;  3DD7 A;  4CDV A;  3KYI A;  2CNW D;  2J46 A;  1QPU A;  3GWN A;  1BZ4 A;  2GWW A;  1SYQ A;  1F1M A;  3AG3 C;  3ZG1 A;  4EBK A;  2XLW A;  3UGO A;  4I44 A;  1FR0 A;  3LS1 A;  2XL6 A;  2A0U A;  2WVN A;  5AC5 A;  1M57 C;  2X51 A;  1WTY A;  3OA1 A;  3PDM P;  1HW1 A;  2G62 A;  2PF4 E;  4JIO A;  2NUT A;  3VRC A;  2Z15 A;  2DYR C;  1ZVZ A;  1MNE A;  2XM0 A;  3E70 C;  2CCY A;  2Y3B A;  4HFF B;  4EBJ A;  3U0C A;  2XLM A;  2KNH A;  3MYF A;  4C3E A;  2R7R A;  2YHS A;  2ETS A;  2P61 A;  5IY5 C;  4AL0 A;  3EGD A;  3MLG A;  4JUR I;  4XEK A;  4RBN A;  3FXH A;  4XWJ A;  3IQC A;  4IAQ A;  1DOW A;  1H9G A;  2UUI A;  3C8G A;  4MQ9 F;  4OIN F;  5F5H A;  3AG2 C;  3ZQY A;  1BDJ B;  3EFO A;  3NKD A;  1CGM E;  4OIO F;  4O6N A;  3W8H A;  2DI3 A;  1V74 B;  2L6G A;  2EPK X;  1J8Y F;  4Q4Z F;  3G4X A;  3O6X A;  1YZC A;  1QZX A;  2OEX A;  4O6M A;  2W4B A;  3H2U A;  4YT8 A;  2D5R B;  2M64 A;  3U9J A;  3CEX A;  2YL1 A;  4JKV A;  4DRI B;  1G4U S;  5KYX A;  3O55 A;  1K04 A;  2QNL A;  3FDQ A;  3I5P A;  1AEP A;  3ITF A;  3MFN A;  5JP7 A;  2J0X A;  4G78 A;  4ER9 A;  3KMI A;  4N4W A;  2A6H F;  3M15 A;  256B A;  3B71 A;  2EPM X;  1TWA A;  3S90 A;  2J9B A;  2ZXW C;  2QY9 A;  2R02 A;  1FTS A;  4R32 A;  1UFB A;  3C8Z A;  3X1O A;  2IM8 A;  3BRJ A;  3RFY A;  3T6J A;  1A41 A;  1Y6D A;  5A6B A;  4E17 A;  2R7S A;  4YJW A;  4ZLC A;  2VCB A;  1OCO C;  3LAY A;  3ZDL A;  4B6I A;  1DOV A;  3VM6 A;  4CIH A;  3FOO A;  5E3A A;  1UG7 A;  2NUT B;  2D4U A;  1ZHY A;  4MVU A;  4X0R A;  5COG A;  2YLG A;  3FVY A;  5L0G A;  1D1B A;  3Q6N A;  3S84 A;  2Y3H A;  3K33 A;  3DXJ F;  3LES A;  1PCX A;  4NC3 A;  3WAQ A;  4CDY A;  2KSF A;  3I5Q A;  1RCP A;  2NSG A;  2Q4F A;  3FHD A;  2CGE A;  3NKE A;  1E84 A;  5EGY A;  4D4N A;  3DAG A;  3N2Z B;  4AK9 A;  1U6H A;  3CAX A;  4OIP F;  4CS7 A;  2IBF A;  1YVI A;  2LP4 A;  5E3C A;  4EWC A;  1RKE A;  3EH2 A;  4U5H A;  2QLA A;  1NZE A;  2IOQ A;  1J8M F;  2KYH A;  3K1I A;  3SYN A;  5KYW B;  5HSW A;  4YT4 A;  3K1I C;  3DI5 A;  1H6G A;  4J30 B;  1VK5 A;  1V54 C;  4JJG A;  4KBL A;  1C03 A;  3IHU A;  4MVR A;  4DBR A;  5L0J A;  2XSE A;  4U5F E;  4WGY A;  4XEF A;  2LCH A;  4MVQ A;  3ZQV A;  1NU7 D;  1OW6 A;  1YLM A;  1RKC A;  3JTL O;  3W8I A;  4YK5 A;  1AVO B;  1QKR A;  4NQF A;  1L7C A;  4IGG A;  2ASR A;  2LFF A;  4LDQ A;  1T6Q A;  1LPE A;  4MS2 A;  3JRT A;  1VOM A;  2XLV A;  1A7V A;  2R7T A;  2KC3 A;  1SR2 A;  3ZTZ A;  1YYX A;  1Z23 A;  3GEI A;  2GFH A;  3X2Q C;  3BEH A;  4YT2 A;  3GM3 A;  4GEH A;  3DAF A;  2WZF A;  1JR8 A;  5E33 A;  3U3F A;  2HMQ A;  2LK4 A;  2P6V A;  4ULW A;  2EIN C;  3L1M A;  4XLN F;  2VCC A;  1GM5 A;  4FAP B;  3IQT A;  5HV9 A;  3O10 A;  3I4U A;  4G7H F;  2MHR A;  4XQ1 A;  4YN0 B;  1A0B A;  3ASN C;  2PFD A;  2BL2 A;  2Q7R A;  4E18 A;  3JRM O;  5A69 A;  3Q7L A;  3H65 A;  3K6B A;  3AJM A;  3WOD F;  4P9F A;  2DGJ A;  2XXA A;  4P6I C;  3DM9 B;  1V4A A;  4ZLD A;  1M2V B;  5F5F A;  3MBG A;  3KKB A;  1TWC A;  4I1O B;  4BJ5 A;  3GOD A;  4HE8 D;  5L0I A;  2VB6 A;  3T6B A;  1OW8 A;  1NSG B;  4O6Y A;  3ZWI A;  5KYY A;  2JPU A;  3V5Z A;  3W2W A;  2A68 F;  3NMJ A;  1ORJ A;  4RD9 A;  4MVO A;  2CYD A;  4O7G A;  2F22 A;  4BJ6 C;  1O3U A;  3J06 A;  2KW3 C;  5T3T A;  4MTG A;  2L81 A;  1JPJ A;  3UMH A;  4EKW A;  2HJ3 A;  2W45 A;  2Y3G A;  3QW1 A;  2XM4 A;  4MW3 A;  1TKN A;  2Q9B A;  3IPM O;  4JVS A;  4U9E A;  3RH3 A;  1PV3 A;  1G4W R;  3GM1 A;  3FOP A;  3EGX B;  4JCH A;  4QI0 A;  4DRJ B;  4IWB A;  3C62 A;  3SZR A;  4LER A;  4YL0 A;  3EG9 B;  5B1A C;  3HKK A;  3AQB A;  4KNV A;  1GS9 A;  3HLZ A;  4M63 A;  2UUH A;  1QLE C;  3JCU Q;  3FAJ A;  1N1C A;  1YZA A;  1ZHT A;  3QW0 A;  3U8V A;  2HV6 A;  1H9T A;  1IZM A;  1R4T A;  2NSF A;  4G7Z F;  1RJ9 A;  1JPN A;  2AP3 A;  2R25 A;  3JSZ A;  4BEJ A;  2NPU A;  4DXW A;  4CS8 A;  2HV7 A;  3O39 A;  4E0I A;  2QUP A;  5K0I A;  3DJU B;  2WVQ A;  4CS8 C;  1Q0G A;  5E2Q A;  1GGQ A;  1MMD A;  1TFK B;  2C04 A;  2LD6 A;  4DRH B;  3EZH A;  2YKZ A;  3NRH A;  3S27 A;  4PJN A;  2B0H A;  2JX0 A;  5L3Q A;  5KYY B;  3L34 A;  3CZ6 A;  3B0U X;  1I4Y A;  1E85 A;  4EIY A;  1RXQ A;  3AG4 C;  1WAT A;  1ZW3 A;  2R7O A;  3ATP A;  1RMV A;  4RDA A;  1HE1 A;  4KI2 A;  4K7B A;  1ZHW A;  3SXK A;  4C7O A;  3HNL A;  1PD0 A;  2NUP B;  4NY3 A;  1TFO B;  3EHM A;  3GOR A;  1M56 C;  1TR2 A;  1KU2 A;  3UNG C;  2AWY A;  5KYN A;  2YL3 A;  3ZC4 A;  4U5E E;  1APC A;  1A7D A;  5D91 A;  1VB5 A;  2HJM A;  2WB7 A;  4JE9 A;  3ZVR A;  2R7W A;  3ABK C;  4MTO A;  4DVY P;  2XLD A;  4E7S A;  1SZI A;  1W2W A;  2DB4 A;  3T9O A;  4N6C A;  4F4B A;  5L0D A;  1LS1 A;  2OEV A;  4H54 A;  4FX5 A;  4WJ0 A;  3G50 A;  5JSL A;  3DE9 A;  2WL8 A;  1OKK A;  2VAS A;  2YZS A;  4YL1 A;  1XZP A;  2Y69 C;  4N06 A;  2KJG A;  4MVZ A;  1LE2 A;  1SMY F;  3W2V A;  1G8X A;  3C8G D;  3EJN A;  3U5S A;  4QDL A;  4YWQ A;  1VTM P;  2HZ8 A;  2L7A A;  2HMZ A;  3H2V A;  3IQ5 A;  4BJ1 A;  2O9X A;  2HSB A;  2RD9 A;  4PK4 A;  3U8P A;  2CDQ A;  3CQZ A;  3RQE A;  4GQH A;  1C17 M;  4UDV A;  4A4A A;  2NG1 A;  2R7X A;  1U0B B;  1VLS A;  3NYM A;  2PBE A;  1V55 C;  5DVW A;  1OR3 A;  1OCC C;  1BBH A;  3C63 A;  3EGD B;  3JZ0 A;  2A1D D;  2R7V A;  2VC9 A;  3C8G B;  2OG2 A;  2H7V C;  4KNW A;  1FFH A;  1QVX A;  2OKU A;  3EFO B;  3HNJ A;  3QVY A;  4N6H A;  3T6G B;  4PAC A;  3VYW A;  4CBE A;  2E87 A;  1LM3 B;  1Q0M A;  2OCC C;  2IXO A;  3LEV A;  1WAS A;  5A6B D;  2R05 A;  4JRZ A;  4MND A;  4EBB A;  2YL0 A;  4CIP A;  4CS9 A;  5KYX B;  2GA0 A;  2KK1 A;  1PD1 A;  2XLE A;  3DJN B;  1OCZ C;  1TWH A;  1ST6 A;  2PNO A;  1OQC A;  3UR3 C;  3B29 A;  3JSE O;  3GWL A;  4A2N B;  4U5C E;  2Y3D A;  5BQG A;  2IYL D;  4DJ9 A;  2YQY A;  3JYY A;  2R7Q A;  2YWA A;  2Q00 A;  3U2L A;  1CGN A;  1WWP A;  2J7P A;  3WHN A;  2HS5 A;  3A11 A;  4LAC B;  4OIQ F;  1E2X A;  1Z5Z A;  5JT4 A;  3R2P A;  2HKV A;  1LI7 A;  3ABL C;  4LDR A;  4E0H A;  2A0B A;  2P0N A;  5L0H A;  5B3S C;  1B68 A;  1CPR A;  4J7T A;  3SXY A;  1K40 A;  1K05 A;  3TOL A;  3V7O A;  4AE4 A;  5JUA A;  4OD5 A;  3LEO A;  1D0Y A;  4W8K A;  2ZXP A;  4PJL A;  3US6 A;  5BQH A;  1EKY A;  4CJO A;  4DBQ A;  4JEB A;  1RKE B;  5KYU A;  3UMK A;  4OD4 A;  3SXM A;  3LNM B;  1OR2 A;  2GAQ A;  3GM2 A;  4XPW A;  2Y39 A;  1D0Z A;  4FES A;  4U5G A;  1WN0 A;  3HTK C;  2EPN A;  4BJ5 C;  2G3V A;  3VAY A;  1I5N A;  2J8W A;  4E7Z A;  3VF0 A;  2EIJ C;  1FMV A;  3Q7G A;  3AG1 C;  3B0V C;  1JAF A;  3JYH A;  4NTA A;  1LE4 A;  3U3B A;  3K1H A;  1Z63 A;  3M1C B;  5CI8 A;  4YT5 A;  1FFT C;  3G4Z A;  2OJE D;  4PR9 A;  3FAP B;  3K66 A;  3TJ6 A;  5L3V A;  2L6H A;  1D0X A;  4D4X A;  4Z9I A;  5DQT A;  1XWJ A;  2OJQ A;  1U89 A;  4NTF A;  1I4Z A;  2IXN A;  1O5H A;  2W9Y A;  2ZXO A;  1OW7 A;  1ZZP A;  3LLK A;  2GDC A;  1VYI A;  5A6K A;  3HJC A;  2H7B A;  4J7Y A;  3NG1 A;  5L0F A;  4AL1 A;  5BUO A;  2YLD A;  3DZA A;  2CW0 F;  3U2M A;  4C3D A;  2G3K A;  4BG0 A;  1EI7 A;  1HE9 A;  1H7I A;  4JEA A;  2XXA B;  2CNW A;  2XL8 A;  2LQG A;  2PX3 A;  3IEE A;  1OXK A;  2HFI A;  2YLI A;  3K7D A;  5DQZ A;  5T1D B;  4CDA A;  4HFK B;  3V5Y A;  1YA9 A;  4CX9 A;  2XLO A;  3GEH A;  2AU5 A;  3KH2 A;  4J32 B;  5A6J A;  3KL4 A;  1NG1 A;  2YVK A;  1FNT c;  5DLJ A;  1E83 A;  1NBB A;  1WOL A;  2YEV A;  3R7C A;  1TWG A;  3DWW A;  4Z9H A;  5JVE A;  3AGT A;  3RQG A;  3NDB B;  3RVZ A;  2OQM A;  4H4K C;  3SNH A;  4ONS A;  1M2O A;  2FAP B;  5T3W A;  4GYT A;  2W4M A;  1HY5 A;  4XEV A;  2Q9C A;  3AQC A;  2QE9 A;  1MMN A;  2A6E F;  2WZL A;  3SXZ A;  4U5B E;  1SF8 A;  5AGF A;  4NTB A;  1Z7Q c;  4K1O A;  4ANJ A;  2ZPA A;  1ZW2 A;  3EHN A;  3C7J A;  4EHP A;  4Z9J A;  3UMI A;  1ZU4 A;  3N24 A;  2B0J A;  2EIK C;  2R9R B;  4I3M A;  4W8P A;  3GAN A;  1LS4 A;  1Z3I X;  1VYK A;  2J45 A;  2V3C C;  3S29 A;  4DOZ A;  3QMK A;  4CSA A;  1RJ9 B;  1D1C A;  4NCQ A;  1JRA A;  1OXB A;  4JW1 A;  2C03 A;  4PJM A;  4CSA C;  3IQ6 A;  3F46 A;  3LNR A;  4PFO A;  3TQO A;  1YAU O;  4JJF A;  3ZSU A;  1QSP A;  2J9W A;  3S0X A;  3NMK A;  2OOC A;  1NFN A;  1O87 A;  2LSE A;  5KYW A;  3E9V A;  5COF A;  2H8A A;  3RIP A;  3M4B A;  3NYL A;  4LLE A;  4O79 A;  2YRF A;  5CIV A;  1CGO A;  4YL3 A;  2X0C A;  1FAP B;  4P9T A;  4BPM A;  1EA8 A;  2HSQ A;  3HNK A;  1Q0D A;  5DS4 A;  1EQ1 A;  3RW0 A;  3QZC A;  1Z6A A;  2OU6 A;  2EIL C;  2ZD9 A;  4C7O B;  3EPV A;  3QVZ A;  2FGY A;  5L0C A;  3A9C A;  1OKK D;  3TOM A;  1LI5 A;  2KQ9 A;  2J9U A;  4MVS A;  3HNI A;  2EPL X;  1C02 A;  3M4C A;  3DMD A;  1BR2 A;  1S05 A;  1OCR C;  4K0D A;  1MND A;  2PP4 A;  3L8J A;  3POV A;  5AC4 A;  5DS5 A;  2R7U A;  1T01 A;  1Y4C A;  4AX2 A;  2EPO A;  2I8B A;  4IJJ A;  4DVZ A;  2A69 F;  3W4Y A;  4CS9 C;  3OEO A;  2IXP A;  2WVO A;  2R03 A;  4JTA B;  3RVY A;  2RSE B;  3ECS A;  3LJB A;  3PCV A;  4Q7C A;  5B3I A;  4JTD B;  1HW2 A;  2LFD A;  3ZIB A;  4MVM A;  1KTM A;  4IRU A;  4G0H A;  5A6A A;  2H7O A;  2ZXR A;  1FMW A;  4IAR A;  2MWQ A;  2WZG A;  1ZHZ A;  1M2V A;  3T4R A;  1VLT A;  1YAR O;  1ZYR F;  1T6I A;  4MTF A;  2XRH A;  2L9J A;  2KGO A;  1HMO A;  4PFP A;  1TQG A;  3RYL A;  4JCZ A;  2P7V A;  4G7O F;  2VCA A;  3GEE A;  4L6R A; 
#chains in the Genus database with same CATH homology
 1RXQ A;  5COM A;  2OQM A;  2RD9 A;  3DKA A;  5COG A;  5COF A;  3GOR A;  2YQY A;  2NSF A;  2QE9 A;  3QTH A;  5CIV A;  2NSG A;  2P1A A;  3CEX A;  2F22 A;  2QNL A;  2HKV A;  2OU6 A;  4N6C A;  3DI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...