2OQMA

Crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
180
structure length
180
Chain Sequence
HHENLYFQGMLYDLTVVQFSKMLKNLNAIFDKAEAFAELKKVDMDVLLNSRLAADQFNLIRQVQIACDTAKVGVARLTGQLETAPKHDDSETTLAELRQRIASVLTYLEGFSEADFANAATIQISQPRWQGKYLTGYEFAIEHAIPNLYFHITTAYGILRHNGVEVGKKDYLGAMPYKAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Hypothetical protein
publication title Crystal structure of hypothetical protein (YP_561575.1) from Shewanella denitrificans OS-217 at 1.83 A resolution
rcsb
source organism Shewanella denitrificans
total genus 61
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09351 DUF1993 Domain of unknown function (DUF1993)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 2oqmA01
2NSGA 2F22A 2OQMA 2RD9A 2OU6A 3DI5A 3GORA 5COGA 5COMA 4N6CA 2P1AA 2NSFA 1RXQA 2HKVA 2QE9A 2QNLA 3CEXA 2YQYA 3QTHA 3DKAA 5COFA 5CIVA
chains in the Genus database with same CATH superfamily
3RQEA 3CZ6A 2YLGA 3FMSA 3RQFA 1RKEA 2G3VA 3NMIA 1T5OA 1YAUO 1IZMA 4KI2A 3V5ZA 2VC9A 5F5FA 2HMQA 2QUPA 3B9QA 3O55A 3ASOC 5COMA 4UDVA 1KTMA 2XL4A 1U6HA 2NUTA 4O6YA 1SR2A 1H7IA 4BJ6A 4U5DE 3UNGC 1RCPA 1YYJA 1T6QA 4A2NB 2HS5A 2YLIA 2G62A 3JYYA 1VK5A 5KYUA 4CIPA 1MQVA 2W9YA 4JTDB 1EQ1A 3DAGA 3OWTA 5DQZA 2X0CA 2WVQA 1D0XA 1MNDA 2R9RB 3X1OA 5JLIA 3DAFA 4G7ZF 4ULWA 2B0JA 4JE9A 1WN0A 4U5FE 1D1CA 2XL8A 4Q5SF 3V5XA 5FZTA 4ANJA 2XM4A 4FAPB 3SXZA 2LFFA 5T3TA 3IQTA 3S9OA 2WVOA 2BL2A 4E7SA 4C7OB 2IYLD 3A9CA 3N24A 2NUPB 3G4XA 1ZW3A 1A0BA 5DS5A 2UUHA 5A6BD 2DGJA 3HLZA 2VASA 4HFKB 1OW6A 4XPYA 4E0IA 3KPHA 1CGNA 1R4TA 2HV7A 3L1MA 3N2ZB 4FWVA 4MTOA 3UGOA 4OD5A 1R5ID 4AL1A 4PACA 5EHHA 3UGPA 3GM1A 2VCBA 4LACB 3GM3A 3MLGA 4MS2A 3S84A 1Q0GA 3AG4C 4JURI 3IEEA 5E33A 2Q4FA 4G78A 1PV3A 2AP3A 1BDJB 2XS1A 3K66A 4MVQA 5HSWA 1QPUA 1ORSC 4XQ1A 2IOQA 2AWCA 2RD9A 2PFDA 1HW1A 5L0HA 2LK4A 3UMIA 5KYWA 2P7VA 2KK1A 2Y3GA 2O9XA 5L0JA 1YZAA 1KNYA 1HE9A 1NSGB 3TJ5A 2YRFA 4WABA 3RIPA 5JVEA 4CBEA 1V55C 1O5HA 3WHNA 3J06A 1FFTC 2J7PD 3GWNA 4EKWA 2Y3BA 3ZWIA 1SZIA 4IB4A 4MVUA 3LS1A 3C8GA 4MW8A 1L7CA 2JX0A 4XLNF 2A0BA 4XWJA 2H7BA 2H7VC 2P61A 3K1HA 4OD4A 3FOPA 2HFIA 2XS8A 1Q0DA 2ZD9A 4B6IA 1SMYF 5KYYB 1WATA 2OKUA 3DKAA 3I5QA 4FESA 4KNVA 3ZIBA 2IXPA 1RKEB 5FCLA 1E84A 1A7DA 2L81A 1NZEA 1T6IA 4J30B 4U9DA 2IXNA 1RKCA 1Q0KA 2YHSA 3U9MA 5F28E 1LI7A 3LLIA 1FR0A 2XLVA 3DE8A 4JKVA 1Q0FA 1I5NA 3GORA 1C17M 3LLKA 3E9VA 4JRZA 2NUTB 2MYSA 4R32A 5BQIA 4C7OA 4ZLDA 1OXKA 4P6IC 1U0BB 3M4BA 4O6NA 3TD7A 5A69A 3HJCA 2ZPAA 1RXQA 1WTYA 4XTKA 5BUOA 2J9VA 1Q0MA 1QQ3A 1K40A 4G0HA 5KYUB 2XLDA 3AJMA 4EBBA 1M57C 1NU7D 4O79A 3DJUB 3W2VA 4CDYA 3T6BA 1WASA 2HSBA 2R7XA 3M79A 4Q4ZF 1T9KA 4K7BA 4P9FA 3PHF2 4I44A 3VYWA 4LDQA 4XEKA 4DRHB 1J8MF 2Y39A 1Z3IX 3NKEA 1JPNA 2EPOA 1M56C 1TFKB 3DM5A 3FXHA 1OQCA 1CGME 1NG1A 4ULVA 1I4YA 2HJ3A 3Q7LA 1M6TA 3JSZA 3EH1A 4MVRA 4NCQA 3PCVA 2YWAA 3PDMP 3MX3A 5T1DB 5COGA 3RF3A 3ZG1A 1C02A 3IQ5A 3KYJA 2UUIA 3I4UA 3JTLO 3SXMA 1L3PA 3ECSA 4EHPA 1LS4A 1VOMA 4OIPF 4A4AA 3NMJA 3LJBA 3T9OA 3OA1A 4G7HF 3IQ6A 5L0IA 3B0PA 4FX5A 1OW7A 2LP4A 3CQZA 5L0DA 4D4NA 3I5PA 1Y4CA 2R7SA 1ZU4A 3B0VC 1RJ9A 1OCZC 4BG0A 4C3BA 1TKNA 2Y69C 4JC7A 2LIGA 2XM0A 1WWPA 1NFOA 2D4UA 3KH2A 4BEJA 1HE1A 2Q00A 4OIRF 4MTGA 3N0TA 4QI0A 2YKZA 1E85A 1Z6AA 3EHNA 4IRUA 5KYWB 2IXOA 3HTKC 4PK4A 4ZLCA 3NKDA 3NDBB 3DI5A 2GA0A 2PNOA 3MBGA 2KYHA 3EZHA 3VF0A 5DQTA 1YA9A 4OIQF 1BZ4A 4XPWA 4GYTA 2M64A 1OW8A 1QLEC 2XL6A 3MYFA 1VTMP 3GM2A 4BJ5A 5D91A 1WOLA 3KYIA 4EBJA 4XLPF 3TOLA 2YZSA 3ZSUA 3NYMA 1EKYA 1QVXA 1A41A 3TK0A 2J9BA 4AK9A 1HY5A 1M2VB 1ORJA 2OG2A 3C8GB 3RFYA 4YT2A 1D1AA 1ZU5A 5JUAA 2YL3A 4NQFA 5L3VA 3DM9B 3SXKA 3NYJA 1ZHZA 3JCUQ 3VM6A 5DS4A 2XRHA 3L8IA 4C3EA 1PD0A 3AG2C 4JIOA 2DI3A 2MWQA 2KW3C 3IHUA 3U3FA 2HV6A 2J7PA 3QTHA 2W4BA 3US6A 1LE2A 5L0GA 3JT1A 3U8PA 4DOZA 3AG1C 5JP7A 3SZRA 3U9JA 3NMKA 3IPMO 2CYDA 5B3IA 1JR8A 2AU5A 4CJOA 2R05A 3CAXA 3E70C 5JRAA 3MFNA 4YL3A 3UR3C 2J8WA 3EGXA 4YJWA 3WAQA 1YLMA 4MVZA 3HNJA 1C03A 2IM8A 4NTAA 4Q7CA 2PX3A 4U9EA 2RSEB 4QI2A 3QW0A 3ATPA 5JT4A 2HMZA 3QZCA 1QKRA 3DMDA 3TJ6A 1BR4A 3H65A 3DZAA 3JRTA 3LS0A 4CJGA 3B0UX 3QVYA 4EWCA 3RQGA 1LPEA 1BR2A 2IBFA 3AGTA 4JZAA 4YN0B 4AL0A 3EZIA 3TQOA 3DXJF 4YT8A 4XEVA 3GANA 3QMKA 3FDQA 4Z9IA 1ZVZA 3RYLA 2CNWD 1FFHA 2CCYA 1V4AA 2FFHA 1NBBA 2HJMA 4CSAC 2BC5A 2R7QA 4G7OF 1PD1A 5GPGB 2KC3A 2OEVA 3OEOA 3U5SA 5EK0A 5DS6A 2Y3DA 2GFHA 5E3AA 5A6KA 2R7RA 4N6CA 4BPMA 1WGWA 3Q7GA 3C7JA 2XLMA 4QDLA 1OXBA 4X0RA 2AWYA 1QSPA 1G5ZA 3C62A 3ZQVA 1QZXA 1ST6A 4CS8C 2HKVA 1UG7A 3IQCA 3VAYA 2QY9A 4L6RA 4Z9HA 1RJ9B 4JTCB 2LCHA 1M2VA 2D5RB 1LI5A 4JTAB 1ZW2A 4XEFA 2EIJC 4JCZA 1T01A 1VMAA 3W8HA 3G50A 4MVOA 1V54C 1AEPA 1E83A 1OKKD 2YL1A 3WG7C 2P0NA 4MVSA 2OQMA 1OR3A 1YA7O 5E3CA 1Z7Qc 2QTVA 2P6VA 3GODA 4GEHA 3ZTMA 4KC9A 3HNLA 2YL7A 2DYSC 2WZFA 2GDCA 4AX2A 2LSEA 1KU2A 3C63A 2XLWA 2QLAA 3Q6NA 3U3BA 2MHRA 2PF4E 5B3SC 2CGEA 4W8PA 4JCHA 1O3UA 3DJNB 4RD9A 3UMHA 1ZHXA 4RBNA 4U5GA 5D92A 2ICWG 1AUEA 4DJ9A 1IW7F 1VB5A 2XLOA 2X51A 4JEAA 2KGOA 5CI8A 4EUKB 3T4RA 1A7EA 2A0UA 1ZHWA 3K1IC 2W45A 1G8XA 3ZQYA 3POVA 2A6EF 2ZXRA 4JJFA 3UMKA 2FAPB 3AG3C 2L6FA 4E17A 3ZDLA 3S0XA 1I4ZA 3S28A 3S29A 1Z63A 3ZTZA 2NPUA 4E18A 5DVWA 3B71A 1NLXA 2W4MA 3EGXB 4NC3A 3R7CA 2R7VA 3SXYA 2DYRC 4AE4B 4I1OB 3LEOA 2WL8A 2WZGA 4J7TA 4C3DA 3G4ZA 3H2UA 4D4XA 1VYKA 2VCCA 4YT4A 3LNMB 2QE9A 2E87A 1NU9C 2Q9CA 1E86A 2Q9BA 1ZZPA 3EH2A 2R7UA 1LKXA 2KQ9A 2YEVA 3S27A 2LD6A 1VLTA 3NRHA 3T6JA 3WODF 4ONSA 3X2QC 4IAOA 5JS5A 5IY5C 1LE4A 1HMOA 1H6GA 4DBQA 5A6BA 5EGYA 2YQYA 3RH3A 3K7DA 2YVKA 3R2PA 4MNDA 3V5YA 3AOUA 5L0FA 256BA 1G4US 2B0HA 2LFDA 3ABKC 4YL1A 2ASRA 4I3MA 2OJQA 2WZLA 2OOCA 3KMIA 1S05A 3C18A 3JYHA 4HEAJ 3U8VA 1VLSA 1TWGA 1E2XA 2WB7A 1MMGA 3DD7A 3LAYA 1TWAA 3LEVA 3O6XA 4CDAA 4BJ6C 1F1MA 2CNWA 2M4EA 3SP1A 2NSFA 4PJLA 1O87A 4YK5A 1MNEA 2I15A 3EG9A 1HW2A 2J45A 3M1CB 4JVSA 3FAPB 1JMWA 1MMDA 1OR2A 4I1MA 4O6MA 3MYIA 4JJGA 1APCA 2ZXPA 1S7ZA 1JPJA 2ETSA 1FMVA 2KNHA 3HNIA 2EILC 1G4WR 2WVNA 3PMRA 4MW3A 3H2VA 1XZQA 2YLDA 4DRIB 2NSGA 3TULA 1YJGA 2I8BA 1CPRA 1LVKA 1H9TA 3O10A 1A7VA 3U2MA 4LERA 1LS1A 2OU6A 5KYXA 5E2QA 2XXAA 4WGZA 1FAPB 3EGDA 1BBHA 1D0YA 1OKKA 4H54A 1TQGA 3L0IA 4YWQA 2KSFA 3JZ0A 4CS7A 2PP4A 3EFOA 1B68A 1MMNA 4DVYP 4AE4A 3FOOA 4IWBA 4K0DA 4E0HA 2OCCC 4NY3A 3NG1A 2JPUA 2R7WA 4JW1A 4HE8D 2XSEA 5KYNA 1OCRC 3KL4A 3LESA 4U5BE 3W4YA 3K6BA 2J0WA 2VB6A 3QVZA 4KNWA 2CW0F 1XWJA 3ZC4A 3AQCA 2BE5F 2IXMA 2A6HF 1CGOA 3AGUA 3SYNA 3T6GB 4PR9A 2H7OA 4P9TA 2H8AA 1UFBA 2LQGA 2NG1A 1M2OA 4J32B 2PBEA 3CSKA 3W2WA 3ABLC 1XZPA 2ZXOA 1JRAA 3L34A 2PX0A 2OJED 4WGYA 3TOMA 4U5EE 4HFFB 4MQ9F 3JRMO 3RW0A 4E7ZA 4WJ0A 3SNHA 1YVIA 3B29A 2HUJA 4DBRA 2Q3TA 2R03A 3AQBA 4PFPA 4U5HA 3VRCA 1FNTc 1ZHYA 1V74B 4BJ1A 4CS9C 3GWLA 2L6HA 2R7TA 5L0CA 5AC5A 3U0CA 4OINF 1DOVA 2DB4A 1K05A 2HZ8A 3FVYA 5B1AC 1TFOB 3U2LA 2V3CC 4ER9A 4LDKA 2VH3A 4KBLA 5BQHA 2J46A 5COFA 4GQHA 4IGGA 1SF8A 5CIVA 4N4WA 1TR2A 2CDQA 1MMAA 4BJTA 2R02A 1BR1A 2J0XA 1GQAA 4J7YA 2A1DD 4CSAA 1GGQA 3HNKA 4EIYA 2J9UA 2L9JA 2FGYA 3EPVA 3BRJA 3GEHA 4H4KC 1FTSA 2YL0A 2P1AA 1OCCC 3EG9B 3DE9A 1Y6DA 4OIOF 1SYQA 1W2WA 4PJJA 5JSLA 4CS9A 4CS8A 4IAQA 4LDRA 3Q6MA 4YL0A 1GM5A 2EIMC 3ITFA 3NYLA 5DLJA 1RMVA 2A68F 3LNRA 5F5HA 2EINC 2TMVP 2F22A 5B1BC 4CX9A 2Q9AA 2Y3HA 3M4CA 5K0IA 4DRJB 4N06A 4DXWA 5KYXB 2XXAB 3LUTB 4PFOA 3EHMA 3KKBA 2JD3A 3EJNA 3EGDB 3GEIA 2R7OA 2L7AA 2HSQA 3GEEA 3HKKA 3M15A 1DOWA 4IJJA 1T6UA 4W8KA 2EIKC 2KJGA 2NUPA 3EFOB 1TWCA 3K33A 1TWHA 4LLCA 4U5CE 3SEOA 2C04A 3C8ZA 1H9GA 2V26A 4PJNA 1EA8A 3W8IA 1YDIA 2Q7RA 1Z5ZA 2EPMX 2VCAA 4CDVA 1EI7A 1HMDA 1ZYRF 1ZHTA 5TJ5E 1D1BA 1N1CA 2OEXA 3O39A 4M63A 3V7OA 3CEXA 3ABMC 3F46A 4O7GA 2XLEA 4PJMA 5HV9A 1AVOB 3L8JA 3K1IA 2EPKX 2R25A 1JAFA 3RVZA 2G3KA 4MTFA 5CI9A 3S90A 1FMWA 4N6HA 2L6GA 3EQLF 2ZXWC 1VYIA 1ORYA 3JSEO 1U89A 1JOGA 2C03A 2XLHA 4RDAA 1YARO 5L3QA 4LLEA 4MVMA 4Z9JA 4CIHA 2Z15A 3ASNC 5T3WA 1D0ZA 4JEBA 3C8GD 1YZCA 4BEMJ 2GAQA 2AVKA 3RVYA 4YT5A 3DWWA 3FAJA 4BJ5C 5AGFA 1LM3B 3RKOF 4EBKA 1NFNA 5A6AA 4XPXA 1GS9A 4DVZA 1YYXA 4NTFA 4F4BA 4IARA 2QNLA 2EPLX 1PCXA 3QW1A 1J8YF 5A6JA 3ZVRA 1LIHA 3BEHA 4K1OA 4NTBA 5AC4A 1CPQA 5BQGA 2A69F 2EPNA 3A11A 3F47A 5KYYA 2J9WA 1Z23A 2GWWA 1OCOC 3FHDA 1K04A
chains in the Genus database with same CATH topology
2NSGA 2F22A 2OQMA 2RD9A 2OU6A 3DI5A 3GORA 5COGA 5COMA 4N6CA 2P1AA 2NSFA 1RXQA 2HKVA 2QE9A 2QNLA 3CEXA 2YQYA 3QTHA 3DKAA 5COFA 5CIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NSG A;  2F22 A;  2OQM A;  2RD9 A;  2OU6 A;  3DI5 A;  3GOR A;  5COG A;  5COM A;  4N6C A;  2P1A A;  2NSF A;  1RXQ A;  2HKV A;  2QE9 A;  2QNL A;  3CEX A;  2YQY A;  3QTH A;  3DKA A;  5COF A;  5CIV A; 
#chains in the Genus database with same CATH topology
 3RQE A;  3CZ6 A;  2YLG A;  3FMS A;  3RQF A;  1RKE A;  2G3V A;  3NMI A;  1T5O A;  1YAU O;  1IZM A;  4KI2 A;  3V5Z A;  2VC9 A;  5F5F A;  2HMQ A;  2QUP A;  3B9Q A;  3O55 A;  3ASO C;  5COM A;  4UDV A;  1KTM A;  2XL4 A;  1U6H A;  2NUT A;  4O6Y A;  1SR2 A;  1H7I A;  4BJ6 A;  4U5D E;  3UNG C;  1RCP A;  1YYJ A;  1T6Q A;  4A2N B;  2HS5 A;  2YLI A;  2G62 A;  3JYY A;  1VK5 A;  5KYU A;  4CIP A;  1MQV A;  2W9Y A;  4JTD B;  1EQ1 A;  3DAG A;  3OWT A;  5DQZ A;  2X0C A;  2WVQ A;  1D0X A;  1MND A;  2R9R B;  3X1O A;  5JLI A;  3DAF A;  4G7Z F;  4ULW A;  2B0J A;  4JE9 A;  1WN0 A;  4U5F E;  1D1C A;  2XL8 A;  4Q5S F;  3V5X A;  5FZT A;  4ANJ A;  2XM4 A;  4FAP B;  3SXZ A;  2LFF A;  5T3T A;  3IQT A;  3S9O A;  2WVO A;  2BL2 A;  4E7S A;  4C7O B;  2IYL D;  3A9C A;  3N24 A;  2NUP B;  3G4X A;  1ZW3 A;  1A0B A;  5DS5 A;  2UUH A;  5A6B D;  2DGJ A;  3HLZ A;  2VAS A;  4HFK B;  1OW6 A;  4XPY A;  4E0I A;  3KPH A;  1CGN A;  1R4T A;  2HV7 A;  3L1M A;  3N2Z B;  4FWV A;  4MTO A;  3UGO A;  4OD5 A;  1R5I D;  4AL1 A;  4PAC A;  5EHH A;  3UGP A;  3GM1 A;  2VCB A;  4LAC B;  3GM3 A;  3MLG A;  4MS2 A;  3S84 A;  1Q0G A;  3AG4 C;  4JUR I;  3IEE A;  5E33 A;  2Q4F A;  4G78 A;  1PV3 A;  2AP3 A;  1BDJ B;  2XS1 A;  3K66 A;  4MVQ A;  5HSW A;  1QPU A;  1ORS C;  4XQ1 A;  2IOQ A;  2AWC A;  2RD9 A;  2PFD A;  1HW1 A;  5L0H A;  2LK4 A;  3UMI A;  5KYW A;  2P7V A;  2KK1 A;  2Y3G A;  2O9X A;  5L0J A;  1YZA A;  1KNY A;  1HE9 A;  1NSG B;  3TJ5 A;  2YRF A;  4WAB A;  3RIP A;  5JVE A;  4CBE A;  1V55 C;  1O5H A;  3WHN A;  3J06 A;  1FFT C;  2J7P D;  3GWN A;  4EKW A;  2Y3B A;  3ZWI A;  1SZI A;  4IB4 A;  4MVU A;  3LS1 A;  3C8G A;  4MW8 A;  1L7C A;  2JX0 A;  4XLN F;  2A0B A;  4XWJ A;  2H7B A;  2H7V C;  2P61 A;  3K1H A;  4OD4 A;  3FOP A;  2HFI A;  2XS8 A;  1Q0D A;  2ZD9 A;  4B6I A;  1SMY F;  5KYY B;  1WAT A;  2OKU A;  3DKA A;  3I5Q A;  4FES A;  4KNV A;  3ZIB A;  2IXP A;  1RKE B;  5FCL A;  1E84 A;  1A7D A;  2L81 A;  1NZE A;  1T6I A;  4J30 B;  4U9D A;  2IXN A;  1RKC A;  1Q0K A;  2YHS A;  3U9M A;  5F28 E;  1LI7 A;  3LLI A;  1FR0 A;  2XLV A;  3DE8 A;  4JKV A;  1Q0F A;  1I5N A;  3GOR A;  1C17 M;  3LLK A;  3E9V A;  4JRZ A;  2NUT B;  2MYS A;  4R32 A;  5BQI A;  4C7O A;  4ZLD A;  1OXK A;  4P6I C;  1U0B B;  3M4B A;  4O6N A;  3TD7 A;  5A69 A;  3HJC A;  2ZPA A;  1RXQ A;  1WTY A;  4XTK A;  5BUO A;  2J9V A;  1Q0M A;  1QQ3 A;  1K40 A;  4G0H A;  5KYU B;  2XLD A;  3AJM A;  4EBB A;  1M57 C;  1NU7 D;  4O79 A;  3DJU B;  3W2V A;  4CDY A;  3T6B A;  1WAS A;  2HSB A;  2R7X A;  3M79 A;  4Q4Z F;  1T9K A;  4K7B A;  4P9F A;  3PHF 2;  4I44 A;  3VYW A;  4LDQ A;  4XEK A;  4DRH B;  1J8M F;  2Y39 A;  1Z3I X;  3NKE A;  1JPN A;  2EPO A;  1M56 C;  1TFK B;  3DM5 A;  3FXH A;  1OQC A;  1CGM E;  1NG1 A;  4ULV A;  1I4Y A;  2HJ3 A;  3Q7L A;  1M6T A;  3JSZ A;  3EH1 A;  4MVR A;  4NCQ A;  3PCV A;  2YWA A;  3PDM P;  3MX3 A;  5T1D B;  5COG A;  3RF3 A;  3ZG1 A;  1C02 A;  3IQ5 A;  3KYJ A;  2UUI A;  3I4U A;  3JTL O;  3SXM A;  1L3P A;  3ECS A;  4EHP A;  1LS4 A;  1VOM A;  4OIP F;  4A4A A;  3NMJ A;  3LJB A;  3T9O A;  3OA1 A;  4G7H F;  3IQ6 A;  5L0I A;  3B0P A;  4FX5 A;  1OW7 A;  2LP4 A;  3CQZ A;  5L0D A;  4D4N A;  3I5P A;  1Y4C A;  2R7S A;  1ZU4 A;  3B0V C;  1RJ9 A;  1OCZ C;  4BG0 A;  4C3B A;  1TKN A;  2Y69 C;  4JC7 A;  2LIG A;  2XM0 A;  1WWP A;  1NFO A;  2D4U A;  3KH2 A;  4BEJ A;  1HE1 A;  2Q00 A;  4OIR F;  4MTG A;  3N0T A;  4QI0 A;  2YKZ A;  1E85 A;  1Z6A A;  3EHN A;  4IRU A;  5KYW B;  2IXO A;  3HTK C;  4PK4 A;  4ZLC A;  3NKD A;  3NDB B;  3DI5 A;  2GA0 A;  2PNO A;  3MBG A;  2KYH A;  3EZH A;  3VF0 A;  5DQT A;  1YA9 A;  4OIQ F;  1BZ4 A;  4XPW A;  4GYT A;  2M64 A;  1OW8 A;  1QLE C;  2XL6 A;  3MYF A;  1VTM P;  3GM2 A;  4BJ5 A;  5D91 A;  1WOL A;  3KYI A;  4EBJ A;  4XLP F;  3TOL A;  2YZS A;  3ZSU A;  3NYM A;  1EKY A;  1QVX A;  1A41 A;  3TK0 A;  2J9B A;  4AK9 A;  1HY5 A;  1M2V B;  1ORJ A;  2OG2 A;  3C8G B;  3RFY A;  4YT2 A;  1D1A A;  1ZU5 A;  5JUA A;  2YL3 A;  4NQF A;  5L3V A;  3DM9 B;  3SXK A;  3NYJ A;  1ZHZ A;  3JCU Q;  3VM6 A;  5DS4 A;  2XRH A;  3L8I A;  4C3E A;  1PD0 A;  3AG2 C;  4JIO A;  2DI3 A;  2MWQ A;  2KW3 C;  3IHU A;  3U3F A;  2HV6 A;  2J7P A;  3QTH A;  2W4B A;  3US6 A;  1LE2 A;  5L0G A;  3JT1 A;  3U8P A;  4DOZ A;  3AG1 C;  5JP7 A;  3SZR A;  3U9J A;  3NMK A;  3IPM O;  2CYD A;  5B3I A;  1JR8 A;  2AU5 A;  4CJO A;  2R05 A;  3CAX A;  3E70 C;  5JRA A;  3MFN A;  4YL3 A;  3UR3 C;  2J8W A;  3EGX A;  4YJW A;  3WAQ A;  1YLM A;  4MVZ A;  3HNJ A;  1C03 A;  2IM8 A;  4NTA A;  4Q7C A;  2PX3 A;  4U9E A;  2RSE B;  4QI2 A;  3QW0 A;  3ATP A;  5JT4 A;  2HMZ A;  3QZC A;  1QKR A;  3DMD A;  3TJ6 A;  1BR4 A;  3H65 A;  3DZA A;  3JRT A;  3LS0 A;  4CJG A;  3B0U X;  3QVY A;  4EWC A;  3RQG A;  1LPE A;  1BR2 A;  2IBF A;  3AGT A;  4JZA A;  4YN0 B;  4AL0 A;  3EZI A;  3TQO A;  3DXJ F;  4YT8 A;  4XEV A;  3GAN A;  3QMK A;  3FDQ A;  4Z9I A;  1ZVZ A;  3RYL A;  2CNW D;  1FFH A;  2CCY A;  1V4A A;  2FFH A;  1NBB A;  2HJM A;  4CSA C;  2BC5 A;  2R7Q A;  4G7O F;  1PD1 A;  5GPG B;  2KC3 A;  2OEV A;  3OEO A;  3U5S A;  5EK0 A;  5DS6 A;  2Y3D A;  2GFH A;  5E3A A;  5A6K A;  2R7R A;  4N6C A;  4BPM A;  1WGW A;  3Q7G A;  3C7J A;  2XLM A;  4QDL A;  1OXB A;  4X0R A;  2AWY A;  1QSP A;  1G5Z A;  3C62 A;  3ZQV A;  1QZX A;  1ST6 A;  4CS8 C;  2HKV A;  1UG7 A;  3IQC A;  3VAY A;  2QY9 A;  4L6R A;  4Z9H A;  1RJ9 B;  4JTC B;  2LCH A;  1M2V A;  2D5R B;  1LI5 A;  4JTA B;  1ZW2 A;  4XEF A;  2EIJ C;  4JCZ A;  1T01 A;  1VMA A;  3W8H A;  3G50 A;  4MVO A;  1V54 C;  1AEP A;  1E83 A;  1OKK D;  2YL1 A;  3WG7 C;  2P0N A;  4MVS A;  2OQM A;  1OR3 A;  1YA7 O;  5E3C A;  1Z7Q c;  2QTV A;  2P6V A;  3GOD A;  4GEH A;  3ZTM A;  4KC9 A;  3HNL A;  2YL7 A;  2DYS C;  2WZF A;  2GDC A;  4AX2 A;  2LSE A;  1KU2 A;  3C63 A;  2XLW A;  2QLA A;  3Q6N A;  3U3B A;  2MHR A;  2PF4 E;  5B3S C;  2CGE A;  4W8P A;  4JCH A;  1O3U A;  3DJN B;  4RD9 A;  3UMH A;  1ZHX A;  4RBN A;  4U5G A;  5D92 A;  2ICW G;  1AUE A;  4DJ9 A;  1IW7 F;  1VB5 A;  2XLO A;  2X51 A;  4JEA A;  2KGO A;  5CI8 A;  4EUK B;  3T4R A;  1A7E A;  2A0U A;  1ZHW A;  3K1I C;  2W45 A;  1G8X A;  3ZQY A;  3POV A;  2A6E F;  2ZXR A;  4JJF A;  3UMK A;  2FAP B;  3AG3 C;  2L6F A;  4E17 A;  3ZDL A;  3S0X A;  1I4Z A;  3S28 A;  3S29 A;  1Z63 A;  3ZTZ A;  2NPU A;  4E18 A;  5DVW A;  3B71 A;  1NLX A;  2W4M A;  3EGX B;  4NC3 A;  3R7C A;  2R7V A;  3SXY A;  2DYR C;  4AE4 B;  4I1O B;  3LEO A;  2WL8 A;  2WZG A;  4J7T A;  4C3D A;  3G4Z A;  3H2U A;  4D4X A;  1VYK A;  2VCC A;  4YT4 A;  3LNM B;  2QE9 A;  2E87 A;  1NU9 C;  2Q9C A;  1E86 A;  2Q9B A;  1ZZP A;  3EH2 A;  2R7U A;  1LKX A;  2KQ9 A;  2YEV A;  3S27 A;  2LD6 A;  1VLT A;  3NRH A;  3T6J A;  3WOD F;  4ONS A;  3X2Q C;  4IAO A;  5JS5 A;  5IY5 C;  1LE4 A;  1HMO A;  1H6G A;  4DBQ A;  5A6B A;  5EGY A;  2YQY A;  3RH3 A;  3K7D A;  2YVK A;  3R2P A;  4MND A;  3V5Y A;  3AOU A;  5L0F A;  256B A;  1G4U S;  2B0H A;  2LFD A;  3ABK C;  4YL1 A;  2ASR A;  4I3M A;  2OJQ A;  2WZL A;  2OOC A;  3KMI A;  1S05 A;  3C18 A;  3JYH A;  4HEA J;  3U8V A;  1VLS A;  1TWG A;  1E2X A;  2WB7 A;  1MMG A;  3DD7 A;  3LAY A;  1TWA A;  3LEV A;  3O6X A;  4CDA A;  4BJ6 C;  1F1M A;  2CNW A;  2M4E A;  3SP1 A;  2NSF A;  4PJL A;  1O87 A;  4YK5 A;  1MNE A;  2I15 A;  3EG9 A;  1HW2 A;  2J45 A;  3M1C B;  4JVS A;  3FAP B;  1JMW A;  1MMD A;  1OR2 A;  4I1M A;  4O6M A;  3MYI A;  4JJG A;  1APC A;  2ZXP A;  1S7Z A;  1JPJ A;  2ETS A;  1FMV A;  2KNH A;  3HNI A;  2EIL C;  1G4W R;  2WVN A;  3PMR A;  4MW3 A;  3H2V A;  1XZQ A;  2YLD A;  4DRI B;  2NSG A;  3TUL A;  1YJG A;  2I8B A;  1CPR A;  1LVK A;  1H9T A;  3O10 A;  1A7V A;  3U2M A;  4LER A;  1LS1 A;  2OU6 A;  5KYX A;  5E2Q A;  2XXA A;  4WGZ A;  1FAP B;  3EGD A;  1BBH A;  1D0Y A;  1OKK A;  4H54 A;  1TQG A;  3L0I A;  4YWQ A;  2KSF A;  3JZ0 A;  4CS7 A;  2PP4 A;  3EFO A;  1B68 A;  1MMN A;  4DVY P;  4AE4 A;  3FOO A;  4IWB A;  4K0D A;  4E0H A;  2OCC C;  4NY3 A;  3NG1 A;  2JPU A;  2R7W A;  4JW1 A;  4HE8 D;  2XSE A;  5KYN A;  1OCR C;  3KL4 A;  3LES A;  4U5B E;  3W4Y A;  3K6B A;  2J0W A;  2VB6 A;  3QVZ A;  4KNW A;  2CW0 F;  1XWJ A;  3ZC4 A;  3AQC A;  2BE5 F;  2IXM A;  2A6H F;  1CGO A;  3AGU A;  3SYN A;  3T6G B;  4PR9 A;  2H7O A;  4P9T A;  2H8A A;  1UFB A;  2LQG A;  2NG1 A;  1M2O A;  4J32 B;  2PBE A;  3CSK A;  3W2W A;  3ABL C;  1XZP A;  2ZXO A;  1JRA A;  3L34 A;  2PX0 A;  2OJE D;  4WGY A;  3TOM A;  4U5E E;  4HFF B;  4MQ9 F;  3JRM O;  3RW0 A;  4E7Z A;  4WJ0 A;  3SNH A;  1YVI A;  3B29 A;  2HUJ A;  4DBR A;  2Q3T A;  2R03 A;  3AQB A;  4PFP A;  4U5H A;  3VRC A;  1FNT c;  1ZHY A;  1V74 B;  4BJ1 A;  4CS9 C;  3GWL A;  2L6H A;  2R7T A;  5L0C A;  5AC5 A;  3U0C A;  4OIN F;  1DOV A;  2DB4 A;  1K05 A;  2HZ8 A;  3FVY A;  5B1A C;  1TFO B;  3U2L A;  2V3C C;  4ER9 A;  4LDK A;  2VH3 A;  4KBL A;  5BQH A;  2J46 A;  5COF A;  4GQH A;  4IGG A;  1SF8 A;  5CIV A;  4N4W A;  1TR2 A;  2CDQ A;  1MMA A;  4BJT A;  2R02 A;  1BR1 A;  2J0X A;  1GQA A;  4J7Y A;  2A1D D;  4CSA A;  1GGQ A;  3HNK A;  4EIY A;  2J9U A;  2L9J A;  2FGY A;  3EPV A;  3BRJ A;  3GEH A;  4H4K C;  1FTS A;  2YL0 A;  2P1A A;  1OCC C;  3EG9 B;  3DE9 A;  1Y6D A;  4OIO F;  1SYQ A;  1W2W A;  4PJJ A;  5JSL A;  4CS9 A;  4CS8 A;  4IAQ A;  4LDR A;  3Q6M A;  4YL0 A;  1GM5 A;  2EIM C;  3ITF A;  3NYL A;  5DLJ A;  1RMV A;  2A68 F;  3LNR A;  5F5H A;  2EIN C;  2TMV P;  2F22 A;  5B1B C;  4CX9 A;  2Q9A A;  2Y3H A;  3M4C A;  5K0I A;  4DRJ B;  4N06 A;  4DXW A;  5KYX B;  2XXA B;  3LUT B;  4PFO A;  3EHM A;  3KKB A;  2JD3 A;  3EJN A;  3EGD B;  3GEI A;  2R7O A;  2L7A A;  2HSQ A;  3GEE A;  3HKK A;  3M15 A;  1DOW A;  4IJJ A;  1T6U A;  4W8K A;  2EIK C;  2KJG A;  2NUP A;  3EFO B;  1TWC A;  3K33 A;  1TWH A;  4LLC A;  4U5C E;  3SEO A;  2C04 A;  3C8Z A;  1H9G A;  2V26 A;  4PJN A;  1EA8 A;  3W8I A;  1YDI A;  2Q7R A;  1Z5Z A;  2EPM X;  2VCA A;  4CDV A;  1EI7 A;  1HMD A;  1ZYR F;  1ZHT A;  5TJ5 E;  1D1B A;  1N1C A;  2OEX A;  3O39 A;  4M63 A;  3V7O A;  3CEX A;  3ABM C;  3F46 A;  4O7G A;  2XLE A;  4PJM A;  5HV9 A;  1AVO B;  3L8J A;  3K1I A;  2EPK X;  2R25 A;  1JAF A;  3RVZ A;  2G3K A;  4MTF A;  5CI9 A;  3S90 A;  1FMW A;  4N6H A;  2L6G A;  3EQL F;  2ZXW C;  1VYI A;  1ORY A;  3JSE O;  1U89 A;  1JOG A;  2C03 A;  2XLH A;  4RDA A;  1YAR O;  5L3Q A;  4LLE A;  4MVM A;  4Z9J A;  4CIH A;  2Z15 A;  3ASN C;  5T3W A;  1D0Z A;  4JEB A;  3C8G D;  1YZC A;  4BEM J;  2GAQ A;  2AVK A;  3RVY A;  4YT5 A;  3DWW A;  3FAJ A;  4BJ5 C;  5AGF A;  1LM3 B;  3RKO F;  4EBK A;  1NFN A;  5A6A A;  4XPX A;  1GS9 A;  4DVZ A;  1YYX A;  4NTF A;  4F4B A;  4IAR A;  2QNL A;  2EPL X;  1PCX A;  3QW1 A;  1J8Y F;  5A6J A;  3ZVR A;  1LIH A;  3BEH A;  4K1O A;  4NTB A;  5AC4 A;  1CPQ A;  5BQG A;  2A69 F;  2EPN A;  3A11 A;  3F47 A;  5KYY A;  2J9W A;  1Z23 A;  2GWW A;  1OCO C;  3FHD A;  1K04 A; 
#chains in the Genus database with same CATH homology
 2NSG A;  2F22 A;  2OQM A;  2RD9 A;  2OU6 A;  3DI5 A;  3GOR A;  5COG A;  5COM A;  4N6C A;  2P1A A;  2NSF A;  1RXQ A;  2HKV A;  2QE9 A;  2QNL A;  3CEX A;  2YQY A;  3QTH A;  3DKA A;  5COF A;  5CIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...