1VK5A

X-ray structure of gene product from arabidopsis thaliana at3g22680
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
121
structure length
121
Chain Sequence
GSLLRRAEMYQDYMKQVPIPTNRGSLIPFTSWVGLSISMKQLYGQPLHYLTNVLLQRWDQSRFGTDSEEQRLDSIIHPTKAEATIWLVEEIHRLTPSHLHMALLWRSDPMYHSFIDPIFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords expressed protein
publication title Structure at 1.6 A resolution of the protein from gene locus At3g22680 from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Structural genomics, unknown function
total genus 45
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2004-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09187 RdDM_RDM1 RNA-directed DNA methylation 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.690 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1vk5A00
3GANA 2Q3TA 1VK5A
chains in the Genus database with same CATH superfamily
2LP4A 3VRCA 1T9KA 1KTMA 3C8GA 4PJNA 4XQ1A 2AP3A 1VYIA 3UMIA 2BL2A 4AK9A 1OXKA 4M63A 2CGEA 4AL1A 3OWTA 4U5GA 5E2QA 1D0ZA 1FNTc 1BR2A 4PR9A 1JMWA 3G4ZA 2Y3GA 4L6RA 2Q7RA 2NUTA 3ZTZA 5JRAA 4DBRA 5DQZA 1OW8A 3L34A 3W8IA 5L3VA 3W8HA 4MNDA 1GGQA 4LERA 4MTGA 3S9OA 4CJOA 3RKOF 3ZG1A 5L0HA 2W45A 1NFNA 1H9TA 3LLKA 1NU9C 2GDCA 2J0XA 2EPOA 1Y6DA 2M64A 1MMNA 3ATPA 4DXWA 1ZHWA 4JJFA 3UMKA 1E83A 2C03A 3T6BA 4H54A 4MVRA 4OINF 2HJMA 1OQCA 3RYLA 2HV7A 4IGGA 4ULWA 1M2OA 3RVZA 1VMAA 2OEXA 3EQLF 3NYMA 2QNLA 1GS9A 4G78A 2RSEB 3SXKA 2R9RB 2KK1A 1BR4A 4EBJA 2L6FA 3K7DA 2TMVP 4HE8D 1MMAA 3LLIA 2R7OA 256BA 1MMGA 2A68F 5L0CA 4JJGA 2J9UA 2LD6A 1HE1A 4PJLA 4BJ5A 4YT8A 2ASRA 4JURI 5KYUB 4AE4A 1L3PA 2J7PA 2LCHA 2PBEA 1M56C 5KYYB 4QI2A 4AX2A 4XPYA 1AUEA 1WATA 3HNJA 3NMIA 4G0HA 4KC9A 3W2WA 2XS1A 5JP7A 1MNEA 3TJ5A 4JVSA 3TOLA 3I4UA 1BBHA 4U5BE 3DKAA 1YARO 4MVOA 2R7WA 3MBGA 3O55A 4X0RA 3TJ6A 1ZVZA 1Z63A 1OCRC 5T3WA 1K40A 1V54C 3ZDLA 2J45A 3FXHA 3HJCA 4MW8A 3F47A 4BJ6A 4CS9C 5AC5A 1AEPA 3EHNA 1QZXA 3SXYA 2VC9A 1M2VB 4CJGA 4ANJA 2H8AA 5AGFA 1OXBA 3AQCA 3CEXA 1NBBA 1LI5A 4MTFA 2FAPB 2YQYA 2A6HF 2Y69C 4I3MA 4IARA 1NSGB 3H2VA 2E87A 3GM2A 2CW0F 2BC5A 3F46A 3EGXB 3LESA 4JTAB 3RFYA 4BG0A 2WB7A 5FCLA 4E7SA 2YVKA 1Z7Qc 2C04A 2PF4E 2YZSA 2EIJC 2MWQA 1XZQA 2XLVA 3HLZA 1U0BB 4MVQA 2OEVA 3EGDA 3UNGC 4YWQA 4G7HF 1VB5A 1ZHTA 4OIRF 2YHSA 2IXPA 4IWBA 4YN0B 3WAQA 3EZIA 4NCQA 4DRJB 2XLHA 3G4XA 5BQHA 4RBNA 1EI7A 3TK0A 2Q9AA 1AVOB 3K6BA 3ASOC 2KYHA 1O87A 4OD5A 3SXZA 3IEEA 4NTAA 3TD7A 4YT2A 2PX3A 5L3QA 4IJJA 2DGJA 2PNOA 4O7GA 5E3AA 1MNDA 1RCPA 4JTCB 3QVZA 5JT4A 2IXOA 1E2XA 2XL6A 2A0BA 2KJGA 2HV6A 2Q9CA 2W9YA 3EHMA 4ULVA 5DS4A 1ORSC 1WGWA 2VCAA 4PJMA 3I5QA 3ABMC 3NKEA 1HE9A 5KYXB 1OKKA 4C3DA 2ZD9A 1H9GA 2HSQA 3L8IA 3QW1A 2XLOA 3E70C 5DQTA 3U2LA 2VCBA 3U9JA 1QLEC 2J46A 2L6HA 2H7OA 3GM1A 5JUAA 2AWYA 3NDBB 3L0IA 2YRFA 3FAPB 1BDJB 3QZCA 4KI2A 3AG2C 2YEVA 1LM3B 2EIMC 1D0YA 4K0DA 5L0IA 4HFKB 2XL4A 1LPEA 4RD9A 3M4CA 2OJED 4P9FA 3SYNA 5DS5A 3ASNC 1HY5A 4E0HA 1FMVA 3B0PA 1WWPA 3CAXA 2R03A 4U9EA 1NG1A 2XLDA 1ZU4A 4WJ0A 4BJ6C 4E17A 5T3TA 4U5FE 2EINC 4CS9A 1V4AA 4LDKA 4CDYA 3JSZA 1SYQA 3I5PA 3VAYA 2KSFA 4JE9A 1A7DA 2F22A 4CS8C 3AQBA 2R7VA 2Y3BA 3N2ZB 4MVSA 3V5ZA 1JAFA 1YYJA 3EZHA 4J7TA 4Z9JA 3DAGA 3QVYA 5COGA 2JX0A 3B0VC 3GWNA 1VTMP 1BZ4A 2Q4FA 4DVYP 2YL0A 1LIHA 2A0UA 2A69F 4E18A 3AG4C 3H65A 4MVZA 5DS6A 3B9QA 2EPNA 2D5RB 3B71A 3QMKA 3KH2A 2NSGA 5KYUA 2LSEA 3JTLO 4JKVA 3T6JA 2HMQA 2YL7A 3ZTMA 1UG7A 1JOGA 2IXMA 3MYFA 3JT1A 4LACB 4EIYA 3VF0A 5L0GA 5KYYA 2P0NA 1LI7A 1LVKA 3FMSA 3JCUQ 2NPUA 3EFOB 3GM3A 4PFPA 5CI8A 5EHHA 1E86A 3DAFA 2R7XA 1Q0DA 3GANA 4N6HA 1OR3A 4R32A 2KC3A 4LDQA 5L0FA 4CSAA 1U89A 2H7VC 2A6EF 1G5ZA 4PACA 3FDQA 3T4RA 4MW3A 1RKEB 2Q3TA 2XLMA 2IXNA 2KW3C 5B3IA 2EPKX 3B29A 4IAQA 4NC3A 1FAPB 4XWJA 5F5HA 4JRZA 2I8BA 1VLTA 2VCCA 2WVNA 3V5XA 1Q0FA 3S90A 2YLIA 1M2VA 3ITFA 4WGYA 5A69A 2ZXPA 1J8YF 4DBQA 4LDRA 2D4UA 4U5EE 4XPWA 3SZRA 1SF8A 3ZVRA 3KKBA 1Z3IX 4JCHA 4GQHA 4EHPA 1LS1A 1S05A 3LNRA 1K05A 4YK5A 1JPJA 1RMVA 1HW1A 1NZEA 4O6MA 1FTSA 1CGNA 2J8WA 3C7JA 2JPUA 1FFHA 3AGUA 1R5ID 2IBFA 4KNVA 2AU5A 1CGOA 2MHRA 3C63A 3X2QC 1Z5ZA 4K7BA 3W4YA 5KYWB 1QKRA 1M57C 3AG1C 3KPHA 1OW7A 4FX5A 1MQVA 2YWAA 1FMWA 1OCOC 5E33A 2AWCA 3GEEA 2NUTB 2RD9A 2PP4A 3U5SA 3EG9B 1LS4A 1TWAA 3O10A 3US6A 2P6VA 1K04A 3LEOA 3O39A 2LQGA 1TWGA 3R7CA 3DD7A 3M4BA 3EJNA 4U5HA 3V7OA 5TJ5E 1ZHZA 4CS8A 1OR2A 2Q9BA 1Y4CA 2L9JA 2NUPA 2HMZA 2NSFA 3NMJA 4ONSA 3MLGA 5KYXA 1VK5A 3Q6NA 2R7RA 1D1CA 4JEBA 2IM8A 1ZYRF 4Z9IA 1HMDA 1OCZC 5COMA 4EUKB 1LE2A 3C8ZA 3T6GB 2XXAB 5A6BD 3LS1A 4YL3A 1PD1A 1T5OA 2OQMA 3MFNA 2X0CA 2XL8A 3RQGA 3IHUA 3NYJA 4EBBA 1KNYA 2HUJA 4YT5A 4EBKA 3PDMP 2Y39A 4O6NA 4YJWA 2EIKC 4WGZA 5D91A 1TWHA 4O79A 2IYLD 5B3SC 3GODA 3GEHA 4EKWA 4CBEA 1C03A 5IY5C 2QE9A 3Q7LA 3S0XA 1YZAA 2J9WA 3M1CB 4CSAC 1WTYA 1QVXA 1JRAA 1A0BA 4W8PA 4G7OF 2GWWA 2DYSC 3EH2A 1G8XA 3BEHA 3U3FA 3IQ5A 2P61A 1PV3A 3UGPA 3S84A 2AVKA 1JR8A 2FFHA 1V74B 4I44A 4I1MA 4LLCA 3DXJF 3LJBA 1SZIA 4P6IC 4EWCA 2I15A 3IQ6A 5HV9A 1RXQA 1W2WA 4GYTA 1RJ9B 1YJGA 3K1IC 3M79A 4OIPF 4BEMJ 2EPMX 5DVWA 1NFOA 3T9OA 5JVEA 3EPVA 3HNIA 4KBLA 1L7CA 4RDAA 3DMDA 2O9XA 3K1HA 3EH1A 5JSLA 1T01A 4ZLCA 2R25A 3RW0A 5COFA 1VOMA 5L0DA 3TQOA 1OW6A 4IAOA 1A7VA 4C7OB 1RKCA 4W8KA 1MMDA 1E85A 1XZPA 1Z23A 2YL3A 4MTOA 4ER9A 1Z6AA 5BQIA 2J9BA 4MVMA 2R02A 2A1DD 1GQAA 3RQEA 3UR3C 4BJ1A 1ZW2A 1EQ1A 2DB4A 3U8VA 2XM4A 4XEFA 3DZAA 1YDIA 4E0IA 2XRHA 2G62A 1I5NA 3JSEO 4Q7CA 4JEAA 2Y3DA 3GWLA 4XTKA 2PFDA 5T1DB 3CQZA 2R7UA 1U6HA 3SXMA 1SMYF 1RKEA 1Q0GA 3G50A 3ZSUA 1APCA 3IQTA 2UUHA 2YL1A 3ECSA 5BQGA 3LAYA 1ZHYA 4JTDB 3KYIA 1LE4A 3U9MA 5BUOA 2P7VA 4MQ9F 1CPQA 2KNHA 1F1MA 3PHF2 5A6KA 1H7IA 1CGME 5B1BC 4J30B 2W4BA 1A7EA 1WOLA 3JYYA 5CI9A 5FZTA 3S28A 1TFOB 4ZLDA 1TFKB 4PK4A 3VYWA 1H6GA 5B1AC 5A6JA 3POVA 1SR2A 1BR1A 4BEJA 2XM0A 5KYNA 1FFTC 2LFDA 3LNMB 3A9CA 4JZAA 4NY3A 2QTVA 3FHDA 3KYJA 2WVOA 3S29A 1HMOA 4PFOA 4J7YA 4OIOF 4YL1A 4A4AA 2YLDA 3JRTA 5KYWA 1J8MF 3IQCA 2OCCC 3J06A 1KU2A 3H2UA 1VYKA 3DJNB 3NMKA 2WZLA 3U3BA 2R05A 4NTFA 2R7SA 1YLMA 1M6TA 4N06A 3ZQVA 3ZWIA 2HS5A 4DVZA 3LEVA 5A6AA 3AJMA 4C3EA 3FAJA 1EKYA 3EG9A 4MVUA 2OKUA 3ABLC 1R4TA 1T6QA 1VLSA 3TULA 4IRUA 2CNWD 3NG1A 3K1IA 5E3CA 4DRIB 2VH3A 4C3BA 3HNKA 4O6YA 4YL0A 3SEOA 3EGXA 1IW7F 3NKDA 3A11A 3C8GD 1O3UA 1V55C 2W4MA 4UDVA 3M15A 2R7TA 3C62A 5F28E 3U2MA 1N1CA 1G4WR 2XXAA 3DM5A 2Q00A 2LFFA 3C8GB 3DWWA 1IZMA 3DM9B 2HSBA 1ZW3A 2OOCA 4BPMA 5EGYA 2ETSA 3OEOA 5A6BA 3LUTB 2X51A 4H4KC 4JIOA 4XPXA 4Z9HA 1T6IA 3W2VA 2BE5F 3RVYA 2XLWA 1O5HA 1PD0A 2L6GA 3RF3A 3WODF 3HTKC 1NLXA 1C02A 4AL0A 1S7ZA 2EPLX 4KNWA 1QSPA 3AGTA 3Q6MA 3ZC4A 4BJTA 5F5FA 3VM6A 4FAPB 2FGYA 1C17M 1YZCA 2QUPA 2HFIA 1YA9A 2GFHA 2XS8A 2CDQA 2HKVA 3RIPA 3MYIA 3X1OA 3QW0A 4J32B 4E7ZA 3ABKC 1PCXA 2OJQA 4U5CE 5D92A 3U8PA 4G7ZF 3MX3A 1GM5A 1RJ9A 3OA1A 3L1MA 2ZPAA 4YT4A 5JS5A 4P9TA 1NU7D 2CYDA 2WZFA 4CX9A 1A41A 3UMHA 3NRHA 1TQGA 4A2NB 1JPNA 1OCCC 3Q7GA 4CIHA 3CSKA 1LKXA 3U0CA 3S27A 3CZ6A 3JZ0A 2P1AA 3E9VA 3GORA 4N6CA 4JW1A 4DOZA 3KMIA 4HFFB 1TKNA 4F4BA 3ZQYA 2WVQA 1ORJA 3R2PA 4Q4ZF 4C7OA 1XWJA 2J7PD 3JYHA 4CIPA 2HZ8A 5EK0A 1E84A 1ZHXA 3IPMO 4JCZA 5DLJA 2LK4A 3HKKA 3KL4A 1DOWA 4NQFA 4AE4B 4D4XA 2GA0A 4XLPF 5CIVA 4HEAJ 3BRJA 2G3VA 3DE8A 2V3CC 2HJ3A 3PCVA 1YA7O 2UUIA 3LS0A 2JD3A 4DJ9A 1ORYA 1B68A 1EA8A 1DOVA 3C18A 4MS2A 4CS7A 4FESA 1YVIA 2CCYA 2GAQA 4QI0A 2B0HA 2L81A 2Y3HA 2ZXRA 3WHNA 1Q0KA 4XLNF 3JRMO 4GEHA 2J0WA 4I1OB 1ZZPA 1TWCA 2M4EA 1G4US 3K66A 5K0IA 4B6IA 1CPRA 1T6UA 1TR2A 2WL8A 3O6XA 5L0JA 3L8JA 3PMRA 4QDLA 3RQFA 1ZU5A 3DI5A 3AG3C 2G3KA 3K33A 1HW2A 4FWVA 2NUPB 2R7QA 2YKZA 1D1AA 1D0XA 3B0UX 2Z15A 2OU6A 2IOQA 2MYSA 2VASA 4XEKA 1WN0A 4U9DA 4XEVA 4CDVA 1I4YA 2ZXWC 3EFOA 5JLIA 3AOUA 4BJ5C 3EGDB 1YAUO 4JC7A 4Q5SF 2NG1A 2ZXOA 1Q0MA 2KGOA 2PX0A 4K1OA 3SP1A 4N4WA 4D4NA 2WZGA 5AC4A 2DYRC 2QY9A 3GEIA 2EILC 1UFBA 1ST6A 1YYXA 3RH3A 2LIGA 3FVYA 1QPUA 4U5DE 1FR0A 1I4ZA 2H7BA 1WASA 3NYLA 4IB4A 3TOMA 2DI3A 3FOOA 4DRHB 3DJUB 2B0JA 2VB6A 3QTHA 2XSEA 3HNLA 1OKKD 4NTBA 2L7AA 1QQ3A 4OD4A 3V5YA 4LLEA 2ICWG 2XLEA 2V26A 4WABA 3N0TA 2CNWA 2QLAA 3N24A 4PJJA 3ZIBA 3SNHA 3WG7C 2OG2A 3FOPA 1D1BA 5GPGB 4OIQF 2KQ9A 2YLGA 3DE9A 4CDAA 5HSWA 3UGOA 2J9VA
chains in the Genus database with same CATH topology
4PJNA 1VYIA 3UMIA 4AK9A 4M63A 2CGEA 3OWTA 4U5GA 5E2QA 1D0ZA 1BR2A 2Y3GA 2NUTA 4DBRA 5DQZA 3L34A 3W8IA 5L3VA 3W8HA 4MNDA 3UGPA 4LERA 3RKOF 3ZG1A 2W45A 3LLKA 1NU9C 2J0XA 1MMNA 1ZHWA 4JJFA 3UMKA 2C03A 3T6BA 4OINF 3RYLA 2HV7A 4ULWA 1M2OA 1VMAA 3EQLF 3NYMA 1BR4A 3K7DA 4HE8D 1MMAA 3LLIA 2R7OA 2A68F 1MMGA 4JJGA 2J9UA 4PJLA 4BJ5A 4YT8A 4JURI 5KYUB 4AE4A 2J7PA 1M56C 5KYYB 4QI2A 4AX2A 4G0HA 4KC9A 3W2WA 1MNEA 4JVSA 3I4UA 4U5BE 2R7WA 4X0RA 1Z63A 1OCRC 5T3WA 1V54C 2J45A 3HJCA 4BJ6A 3F47A 4CS9C 3EHNA 1QZXA 1M2VB 4ANJA 3AQCA 2A6HF 2Y69C 4I3MA 2E87A 3LESA 2CW0F 3F46A 3EGXB 3RFYA 4BG0A 2WB7A 5FCLA 4E7SA 2C04A 2PF4E 2YZSA 2EIJC 2MWQA 3HLZA 4YWQA 3EGDA 3UNGC 4G7HF 1ZHTA 4OIRF 2YHSA 2IXPA 4IWBA 4YN0B 3EZIA 4RBNA 2Q9AA 3K6BA 3ASOC 4OD5A 1O87A 3TD7A 4YT2A 3IEEA 2PX3A 5L3QA 4IJJA 2DGJA 4O7GA 5E3AA 1MNDA 2IXOA 3EHMA 2KJGA 2Q9CA 2HV6A 2W9YA 5DS4A 1WGWA 4PJMA 3I5QA 3ABMC 3NKEA 5KYXB 1OKKA 4C3DA 5DQTA 3E70C 1QLEC 2J46A 2H7OA 3NDBB 3L0IA 3QZCA 4KI2A 3AG2C 2YEVA 2EIMC 1D0YA 4K0DA 4HFKB 2XL4A 3SYNA 4RD9A 5DS5A 3ASNC 1FMVA 3B0PA 1NG1A 4BJ6C 1ZU4A 4WJ0A 5T3TA 4U5FE 2EINC 4CS9A 3JSZA 3I5PA 3VAYA 4CS8C 3AQBA 2R7VA 2Y3BA 3N2ZB 3EZHA 3DAGA 3B0VC 4DVYP 2A69F 3AG4C 3H65A 5DS6A 3B9QA 2D5RB 3QMKA 3KH2A 5KYUA 2LSEA 3T6JA 2IXMA 3JT1A 4LACB 5KYYA 1LVKA 3JCUQ 5CI8A 5EHHA 4PFPA 3EFOB 2R7XA 3DAFA 3GANA 4CSAA 2H7VC 2A6EF 3FDQA 3T4RA 2Q3TA 2IXNA 2KW3C 4XWJA 5F5HA 2I8BA 2WVNA 1M2VA 3ITFA 2ZXPA 1J8YF 4DBQA 4U5EE 3SZRA 1SF8A 3ZVRA 3KKBA 1Z3IX 4JCHA 1LS1A 3LNRA 1JPJA 1NZEA 4O6MA 1FTSA 1FFHA 4KNVA 3X2QC 1Z5ZA 4K7BA 5KYWB 1M57C 3AG1C 4FX5A 1FMWA 1OCOC 5E33A 2NUTB 2PP4A 3EG9B 1TWAA 2P6VA 3O39A 1TWGA 4CS8A 3DD7A 3V7OA 3EJNA 4U5HA 1ZHZA 2Q9BA 2L9JA 2NUPA 3MLGA 5KYXA 1VK5A 3Q6NA 2R7RA 1D1CA 1ZYRF 1OCZC 2XXAB 3LS1A 1PD1A 4EBBA 3NYJA 4YT5A 2Y39A 4O6NA 4YJWA 2EIKC 5D91A 1TWHA 4O79A 2IYLD 5B3SC 3GODA 4CBEA 5IY5C 3S0XA 3Q7LA 2J9WA 3M1CB 4CSAC 4G7OF 2DYSC 3EH2A 1G8XA 2FFHA 4I44A 4I1MA 4LLCA 3DXJF 3LJBA 1SZIA 4P6IC 4EWCA 1W2WA 4GYTA 1RJ9B 3K1IC 4OIPF 5DVWA 3EPVA 4KBLA 4RDAA 3DMDA 2O9XA 3K1HA 3EH1A 4ZLCA 1VOMA 4IAOA 4C7OB 4W8KA 1MMDA 1Z23A 1Z6AA 2A1DD 3UR3C 4BJ1A 3DZAA 2XRHA 2G62A 4Q7CA 2Y3DA 5T1DB 4XTKA 2PFDA 2R7UA 3CQZA 1SMYF 3ZSUA 3ECSA 3LAYA 1ZHYA 5BUOA 2P7VA 4MQ9F 2KNHA 3PHF2 5B1BC 4J30B 2W4BA 3S28A 5CI9A 4ZLDA 3VYWA 4PK4A 3POVA 5B1AC 1BR1A 4BEJA 5KYNA 1FFTC 4NY3A 4JZAA 2QTVA 3FHDA 3S29A 2WVOA 4PFOA 4OIOF 3JRTA 5KYWA 1J8MF 2OCCC 1KU2A 1VYKA 3DJNB 2WZLA 2R7SA 4N06A 4DVZA 3LEVA 4C3EA 3FAJA 3EG9A 3ABLC 4IRUA 2CNWD 3NG1A 5E3CA 2VH3A 4C3BA 4O6YA 3SEOA 3EGXA 1IW7F 3NKDA 1V55C 2W4MA 2R7TA 1N1CA 2XXAA 3DM5A 1IZMA 3DM9B 5EGYA 3OEOA 4H4KC 2X51A 3W2VA 2BE5F 1O5HA 1PD0A 3WODF 3HTKC 1S7ZA 4KNWA 3Q6MA 3ZC4A 4BJTA 5F5FA 2FGYA 2GFHA 3X1OA 2CDQA 3RIPA 4E7ZA 4J32B 3ABKC 1PCXA 4U5CE 5D92A 4G7ZF 3MX3A 1RJ9A 3OA1A 4YT4A 2ZPAA 1NU7D 2WZFA 3UMHA 4A2NB 3NRHA 4CIHA 1JPNA 1OCCC 3Q7GA 3CSKA 1LKXA 3S27A 3CZ6A 3E9VA 4JW1A 4DOZA 3KMIA 4HFFB 1TKNA 4F4BA 2WVQA 4Q4ZF 4C7OA 2J7PD 3JYHA 1ZHXA 5DLJA 3KL4A 4AE4B 4XLPF 4HEAJ 2G3VA 2V3CC 3LS0A 2JD3A 4CS7A 4FESA 4QI0A 2L81A 2Y3HA 2ZXRA 4XLNF 4GEHA 2J0WA 4I1OB 2M4EA 1TWCA 3K66A 4B6IA 3O6XA 1TR2A 2WL8A 3PMRA 4QDLA 1ZU5A 3AG3C 2G3KA 3K33A 4FWVA 2NUPB 2R7QA 1D1AA 1D0XA 3B0UX 2Z15A 2IOQA 2MYSA 2VASA 2ZXWC 3EFOA 4BJ5C 3EGDB 4Q5SF 2NG1A 2ZXOA 2KGOA 2PX0A 3SP1A 2WZGA 2DYRC 2QY9A 2EILC 1ST6A 3RH3A 3FVYA 4U5DE 3NYLA 2H7BA 3DJUB 2B0JA 2VB6A 2XSEA 1OKKD 4OD4A 4LLEA 2V26A 3ZIBA 3N0TA 2CNWA 3N24A 4PJJA 3SNHA 3WG7C 2OG2A 1D1BA 4OIQF 2KQ9A 5HSWA 3UGOA 2J9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GAN A;  2Q3T A;  1VK5 A; 
#chains in the Genus database with same CATH topology
 2LP4 A;  3VRC A;  1T9K A;  1KTM A;  3C8G A;  4PJN A;  4XQ1 A;  2AP3 A;  1VYI A;  3UMI A;  2BL2 A;  4AK9 A;  1OXK A;  4M63 A;  2CGE A;  4AL1 A;  3OWT A;  4U5G A;  5E2Q A;  1D0Z A;  1FNT c;  1BR2 A;  4PR9 A;  1JMW A;  3G4Z A;  2Y3G A;  4L6R A;  2Q7R A;  2NUT A;  3ZTZ A;  5JRA A;  4DBR A;  5DQZ A;  1OW8 A;  3L34 A;  3W8I A;  5L3V A;  3W8H A;  4MND A;  1GGQ A;  4LER A;  4MTG A;  3S9O A;  4CJO A;  3RKO F;  3ZG1 A;  5L0H A;  2W45 A;  1NFN A;  1H9T A;  3LLK A;  1NU9 C;  2GDC A;  2J0X A;  2EPO A;  1Y6D A;  2M64 A;  1MMN A;  3ATP A;  4DXW A;  1ZHW A;  4JJF A;  3UMK A;  1E83 A;  2C03 A;  3T6B A;  4H54 A;  4MVR A;  4OIN F;  2HJM A;  1OQC A;  3RYL A;  2HV7 A;  4IGG A;  4ULW A;  1M2O A;  3RVZ A;  1VMA A;  2OEX A;  3EQL F;  3NYM A;  2QNL A;  1GS9 A;  4G78 A;  2RSE B;  3SXK A;  2R9R B;  2KK1 A;  1BR4 A;  4EBJ A;  2L6F A;  3K7D A;  2TMV P;  4HE8 D;  1MMA A;  3LLI A;  2R7O A;  256B A;  1MMG A;  2A68 F;  5L0C A;  4JJG A;  2J9U A;  2LD6 A;  1HE1 A;  4PJL A;  4BJ5 A;  4YT8 A;  2ASR A;  4JUR I;  5KYU B;  4AE4 A;  1L3P A;  2J7P A;  2LCH A;  2PBE A;  1M56 C;  5KYY B;  4QI2 A;  4AX2 A;  4XPY A;  1AUE A;  1WAT A;  3HNJ A;  3NMI A;  4G0H A;  4KC9 A;  3W2W A;  2XS1 A;  5JP7 A;  1MNE A;  3TJ5 A;  4JVS A;  3TOL A;  3I4U A;  1BBH A;  4U5B E;  3DKA A;  1YAR O;  4MVO A;  2R7W A;  3MBG A;  3O55 A;  4X0R A;  3TJ6 A;  1ZVZ A;  1Z63 A;  1OCR C;  5T3W A;  1K40 A;  1V54 C;  3ZDL A;  2J45 A;  3FXH A;  3HJC A;  4MW8 A;  3F47 A;  4BJ6 A;  4CS9 C;  5AC5 A;  1AEP A;  3EHN A;  1QZX A;  3SXY A;  2VC9 A;  1M2V B;  4CJG A;  4ANJ A;  2H8A A;  5AGF A;  1OXB A;  3AQC A;  3CEX A;  1NBB A;  1LI5 A;  4MTF A;  2FAP B;  2YQY A;  2A6H F;  2Y69 C;  4I3M A;  4IAR A;  1NSG B;  3H2V A;  2E87 A;  3GM2 A;  2CW0 F;  2BC5 A;  3F46 A;  3EGX B;  3LES A;  4JTA B;  3RFY A;  4BG0 A;  2WB7 A;  5FCL A;  4E7S A;  2YVK A;  1Z7Q c;  2C04 A;  2PF4 E;  2YZS A;  2EIJ C;  2MWQ A;  1XZQ A;  2XLV A;  3HLZ A;  1U0B B;  4MVQ A;  2OEV A;  3EGD A;  3UNG C;  4YWQ A;  4G7H F;  1VB5 A;  1ZHT A;  4OIR F;  2YHS A;  2IXP A;  4IWB A;  4YN0 B;  3WAQ A;  3EZI A;  4NCQ A;  4DRJ B;  2XLH A;  3G4X A;  5BQH A;  4RBN A;  1EI7 A;  3TK0 A;  2Q9A A;  1AVO B;  3K6B A;  3ASO C;  2KYH A;  1O87 A;  4OD5 A;  3SXZ A;  3IEE A;  4NTA A;  3TD7 A;  4YT2 A;  2PX3 A;  5L3Q A;  4IJJ A;  2DGJ A;  2PNO A;  4O7G A;  5E3A A;  1MND A;  1RCP A;  4JTC B;  3QVZ A;  5JT4 A;  2IXO A;  1E2X A;  2XL6 A;  2A0B A;  2KJG A;  2HV6 A;  2Q9C A;  2W9Y A;  3EHM A;  4ULV A;  5DS4 A;  1ORS C;  1WGW A;  2VCA A;  4PJM A;  3I5Q A;  3ABM C;  3NKE A;  1HE9 A;  5KYX B;  1OKK A;  4C3D A;  2ZD9 A;  1H9G A;  2HSQ A;  3L8I A;  3QW1 A;  2XLO A;  3E70 C;  5DQT A;  3U2L A;  2VCB A;  3U9J A;  1QLE C;  2J46 A;  2L6H A;  2H7O A;  3GM1 A;  5JUA A;  2AWY A;  3NDB B;  3L0I A;  2YRF A;  3FAP B;  1BDJ B;  3QZC A;  4KI2 A;  3AG2 C;  2YEV A;  1LM3 B;  2EIM C;  1D0Y A;  4K0D A;  5L0I A;  4HFK B;  2XL4 A;  1LPE A;  4RD9 A;  3M4C A;  2OJE D;  4P9F A;  3SYN A;  5DS5 A;  3ASN C;  1HY5 A;  4E0H A;  1FMV A;  3B0P A;  1WWP A;  3CAX A;  2R03 A;  4U9E A;  1NG1 A;  2XLD A;  1ZU4 A;  4WJ0 A;  4BJ6 C;  4E17 A;  5T3T A;  4U5F E;  2EIN C;  4CS9 A;  1V4A A;  4LDK A;  4CDY A;  3JSZ A;  1SYQ A;  3I5P A;  3VAY A;  2KSF A;  4JE9 A;  1A7D A;  2F22 A;  4CS8 C;  3AQB A;  2R7V A;  2Y3B A;  3N2Z B;  4MVS A;  3V5Z A;  1JAF A;  1YYJ A;  3EZH A;  4J7T A;  4Z9J A;  3DAG A;  3QVY A;  5COG A;  2JX0 A;  3B0V C;  3GWN A;  1VTM P;  1BZ4 A;  2Q4F A;  4DVY P;  2YL0 A;  1LIH A;  2A0U A;  2A69 F;  4E18 A;  3AG4 C;  3H65 A;  4MVZ A;  5DS6 A;  3B9Q A;  2EPN A;  2D5R B;  3B71 A;  3QMK A;  3KH2 A;  2NSG A;  5KYU A;  2LSE A;  3JTL O;  4JKV A;  3T6J A;  2HMQ A;  2YL7 A;  3ZTM A;  1UG7 A;  1JOG A;  2IXM A;  3MYF A;  3JT1 A;  4LAC B;  4EIY A;  3VF0 A;  5L0G A;  5KYY A;  2P0N A;  1LI7 A;  1LVK A;  3FMS A;  3JCU Q;  2NPU A;  3EFO B;  3GM3 A;  4PFP A;  5CI8 A;  5EHH A;  1E86 A;  3DAF A;  2R7X A;  1Q0D A;  3GAN A;  4N6H A;  1OR3 A;  4R32 A;  2KC3 A;  4LDQ A;  5L0F A;  4CSA A;  1U89 A;  2H7V C;  2A6E F;  1G5Z A;  4PAC A;  3FDQ A;  3T4R A;  4MW3 A;  1RKE B;  2Q3T A;  2XLM A;  2IXN A;  2KW3 C;  5B3I A;  2EPK X;  3B29 A;  4IAQ A;  4NC3 A;  1FAP B;  4XWJ A;  5F5H A;  4JRZ A;  2I8B A;  1VLT A;  2VCC A;  2WVN A;  3V5X A;  1Q0F A;  3S90 A;  2YLI A;  1M2V A;  3ITF A;  4WGY A;  5A69 A;  2ZXP A;  1J8Y F;  4DBQ A;  4LDR A;  2D4U A;  4U5E E;  4XPW A;  3SZR A;  1SF8 A;  3ZVR A;  3KKB A;  1Z3I X;  4JCH A;  4GQH A;  4EHP A;  1LS1 A;  1S05 A;  3LNR A;  1K05 A;  4YK5 A;  1JPJ A;  1RMV A;  1HW1 A;  1NZE A;  4O6M A;  1FTS A;  1CGN A;  2J8W A;  3C7J A;  2JPU A;  1FFH A;  3AGU A;  1R5I D;  2IBF A;  4KNV A;  2AU5 A;  1CGO A;  2MHR A;  3C63 A;  3X2Q C;  1Z5Z A;  4K7B A;  3W4Y A;  5KYW B;  1QKR A;  1M57 C;  3AG1 C;  3KPH A;  1OW7 A;  4FX5 A;  1MQV A;  2YWA A;  1FMW A;  1OCO C;  5E33 A;  2AWC A;  3GEE A;  2NUT B;  2RD9 A;  2PP4 A;  3U5S A;  3EG9 B;  1LS4 A;  1TWA A;  3O10 A;  3US6 A;  2P6V A;  1K04 A;  3LEO A;  3O39 A;  2LQG A;  1TWG A;  3R7C A;  3DD7 A;  3M4B A;  3EJN A;  4U5H A;  3V7O A;  5TJ5 E;  1ZHZ A;  4CS8 A;  1OR2 A;  2Q9B A;  1Y4C A;  2L9J A;  2NUP A;  2HMZ A;  2NSF A;  3NMJ A;  4ONS A;  3MLG A;  5KYX A;  1VK5 A;  3Q6N A;  2R7R A;  1D1C A;  4JEB A;  2IM8 A;  1ZYR F;  4Z9I A;  1HMD A;  1OCZ C;  5COM A;  4EUK B;  1LE2 A;  3C8Z A;  3T6G B;  2XXA B;  5A6B D;  3LS1 A;  4YL3 A;  1PD1 A;  1T5O A;  2OQM A;  3MFN A;  2X0C A;  2XL8 A;  3RQG A;  3IHU A;  3NYJ A;  4EBB A;  1KNY A;  2HUJ A;  4YT5 A;  4EBK A;  3PDM P;  2Y39 A;  4O6N A;  4YJW A;  2EIK C;  4WGZ A;  5D91 A;  1TWH A;  4O79 A;  2IYL D;  5B3S C;  3GOD A;  3GEH A;  4EKW A;  4CBE A;  1C03 A;  5IY5 C;  2QE9 A;  3Q7L A;  3S0X A;  1YZA A;  2J9W A;  3M1C B;  4CSA C;  1WTY A;  1QVX A;  1JRA A;  1A0B A;  4W8P A;  4G7O F;  2GWW A;  2DYS C;  3EH2 A;  1G8X A;  3BEH A;  3U3F A;  3IQ5 A;  2P61 A;  1PV3 A;  3UGP A;  3S84 A;  2AVK A;  1JR8 A;  2FFH A;  1V74 B;  4I44 A;  4I1M A;  4LLC A;  3DXJ F;  3LJB A;  1SZI A;  4P6I C;  4EWC A;  2I15 A;  3IQ6 A;  5HV9 A;  1RXQ A;  1W2W A;  4GYT A;  1RJ9 B;  1YJG A;  3K1I C;  3M79 A;  4OIP F;  4BEM J;  2EPM X;  5DVW A;  1NFO A;  3T9O A;  5JVE A;  3EPV A;  3HNI A;  4KBL A;  1L7C A;  4RDA A;  3DMD A;  2O9X A;  3K1H A;  3EH1 A;  5JSL A;  1T01 A;  4ZLC A;  2R25 A;  3RW0 A;  5COF A;  1VOM A;  5L0D A;  3TQO A;  1OW6 A;  4IAO A;  1A7V A;  4C7O B;  1RKC A;  4W8K A;  1MMD A;  1E85 A;  1XZP A;  1Z23 A;  2YL3 A;  4MTO A;  4ER9 A;  1Z6A A;  5BQI A;  2J9B A;  4MVM A;  2R02 A;  2A1D D;  1GQA A;  3RQE A;  3UR3 C;  4BJ1 A;  1ZW2 A;  1EQ1 A;  2DB4 A;  3U8V A;  2XM4 A;  4XEF A;  3DZA A;  1YDI A;  4E0I A;  2XRH A;  2G62 A;  1I5N A;  3JSE O;  4Q7C A;  4JEA A;  2Y3D A;  3GWL A;  4XTK A;  2PFD A;  5T1D B;  3CQZ A;  2R7U A;  1U6H A;  3SXM A;  1SMY F;  1RKE A;  1Q0G A;  3G50 A;  3ZSU A;  1APC A;  3IQT A;  2UUH A;  2YL1 A;  3ECS A;  5BQG A;  3LAY A;  1ZHY A;  4JTD B;  3KYI A;  1LE4 A;  3U9M A;  5BUO A;  2P7V A;  4MQ9 F;  1CPQ A;  2KNH A;  1F1M A;  3PHF 2;  5A6K A;  1H7I A;  1CGM E;  5B1B C;  4J30 B;  2W4B A;  1A7E A;  1WOL A;  3JYY A;  5CI9 A;  5FZT A;  3S28 A;  1TFO B;  4ZLD A;  1TFK B;  4PK4 A;  3VYW A;  1H6G A;  5B1A C;  5A6J A;  3POV A;  1SR2 A;  1BR1 A;  4BEJ A;  2XM0 A;  5KYN A;  1FFT C;  2LFD A;  3LNM B;  3A9C A;  4JZA A;  4NY3 A;  2QTV A;  3FHD A;  3KYJ A;  2WVO A;  3S29 A;  1HMO A;  4PFO A;  4J7Y A;  4OIO F;  4YL1 A;  4A4A A;  2YLD A;  3JRT A;  5KYW A;  1J8M F;  3IQC A;  2OCC C;  3J06 A;  1KU2 A;  3H2U A;  1VYK A;  3DJN B;  3NMK A;  2WZL A;  3U3B A;  2R05 A;  4NTF A;  2R7S A;  1YLM A;  1M6T A;  4N06 A;  3ZQV A;  3ZWI A;  2HS5 A;  4DVZ A;  3LEV A;  5A6A A;  3AJM A;  4C3E A;  3FAJ A;  1EKY A;  3EG9 A;  4MVU A;  2OKU A;  3ABL C;  1R4T A;  1T6Q A;  1VLS A;  3TUL A;  4IRU A;  2CNW D;  3NG1 A;  3K1I A;  5E3C A;  4DRI B;  2VH3 A;  4C3B A;  3HNK A;  4O6Y A;  4YL0 A;  3SEO A;  3EGX A;  1IW7 F;  3NKD A;  3A11 A;  3C8G D;  1O3U A;  1V55 C;  2W4M A;  4UDV A;  3M15 A;  2R7T A;  3C62 A;  5F28 E;  3U2M A;  1N1C A;  1G4W R;  2XXA A;  3DM5 A;  2Q00 A;  2LFF A;  3C8G B;  3DWW A;  1IZM A;  3DM9 B;  2HSB A;  1ZW3 A;  2OOC A;  4BPM A;  5EGY A;  2ETS A;  3OEO A;  5A6B A;  3LUT B;  2X51 A;  4H4K C;  4JIO A;  4XPX A;  4Z9H A;  1T6I A;  3W2V A;  2BE5 F;  3RVY A;  2XLW A;  1O5H A;  1PD0 A;  2L6G A;  3RF3 A;  3WOD F;  3HTK C;  1NLX A;  1C02 A;  4AL0 A;  1S7Z A;  2EPL X;  4KNW A;  1QSP A;  3AGT A;  3Q6M A;  3ZC4 A;  4BJT A;  5F5F A;  3VM6 A;  4FAP B;  2FGY A;  1C17 M;  1YZC A;  2QUP A;  2HFI A;  1YA9 A;  2GFH A;  2XS8 A;  2CDQ A;  2HKV A;  3RIP A;  3MYI A;  3X1O A;  3QW0 A;  4J32 B;  4E7Z A;  3ABK C;  1PCX A;  2OJQ A;  4U5C E;  5D92 A;  3U8P A;  4G7Z F;  3MX3 A;  1GM5 A;  1RJ9 A;  3OA1 A;  3L1M A;  2ZPA A;  4YT4 A;  5JS5 A;  4P9T A;  1NU7 D;  2CYD A;  2WZF A;  4CX9 A;  1A41 A;  3UMH A;  3NRH A;  1TQG A;  4A2N B;  1JPN A;  1OCC C;  3Q7G A;  4CIH A;  3CSK A;  1LKX A;  3U0C A;  3S27 A;  3CZ6 A;  3JZ0 A;  2P1A A;  3E9V A;  3GOR A;  4N6C A;  4JW1 A;  4DOZ A;  3KMI A;  4HFF B;  1TKN A;  4F4B A;  3ZQY A;  2WVQ A;  1ORJ A;  3R2P A;  4Q4Z F;  4C7O A;  1XWJ A;  2J7P D;  3JYH A;  4CIP A;  2HZ8 A;  5EK0 A;  1E84 A;  1ZHX A;  3IPM O;  4JCZ A;  5DLJ A;  2LK4 A;  3HKK A;  3KL4 A;  1DOW A;  4NQF A;  4AE4 B;  4D4X A;  2GA0 A;  4XLP F;  5CIV A;  4HEA J;  3BRJ A;  2G3V A;  3DE8 A;  2V3C C;  2HJ3 A;  3PCV A;  1YA7 O;  2UUI A;  3LS0 A;  2JD3 A;  4DJ9 A;  1ORY A;  1B68 A;  1EA8 A;  1DOV A;  3C18 A;  4MS2 A;  4CS7 A;  4FES A;  1YVI A;  2CCY A;  2GAQ A;  4QI0 A;  2B0H A;  2L81 A;  2Y3H A;  2ZXR A;  3WHN A;  1Q0K A;  4XLN F;  3JRM O;  4GEH A;  2J0W A;  4I1O B;  1ZZP A;  1TWC A;  2M4E A;  1G4U S;  3K66 A;  5K0I A;  4B6I A;  1CPR A;  1T6U A;  1TR2 A;  2WL8 A;  3O6X A;  5L0J A;  3L8J A;  3PMR A;  4QDL A;  3RQF A;  1ZU5 A;  3DI5 A;  3AG3 C;  2G3K A;  3K33 A;  1HW2 A;  4FWV A;  2NUP B;  2R7Q A;  2YKZ A;  1D1A A;  1D0X A;  3B0U X;  2Z15 A;  2OU6 A;  2IOQ A;  2MYS A;  2VAS A;  4XEK A;  1WN0 A;  4U9D A;  4XEV A;  4CDV A;  1I4Y A;  2ZXW C;  3EFO A;  5JLI A;  3AOU A;  4BJ5 C;  3EGD B;  1YAU O;  4JC7 A;  4Q5S F;  2NG1 A;  2ZXO A;  1Q0M A;  2KGO A;  2PX0 A;  4K1O A;  3SP1 A;  4N4W A;  4D4N A;  2WZG A;  5AC4 A;  2DYR C;  2QY9 A;  3GEI A;  2EIL C;  1UFB A;  1ST6 A;  1YYX A;  3RH3 A;  2LIG A;  3FVY A;  1QPU A;  4U5D E;  1FR0 A;  1I4Z A;  2H7B A;  1WAS A;  3NYL A;  4IB4 A;  3TOM A;  2DI3 A;  3FOO A;  4DRH B;  3DJU B;  2B0J A;  2VB6 A;  3QTH A;  2XSE A;  3HNL A;  1OKK D;  4NTB A;  2L7A A;  1QQ3 A;  4OD4 A;  3V5Y A;  4LLE A;  2ICW G;  2XLE A;  2V26 A;  4WAB A;  3N0T A;  2CNW A;  2QLA A;  3N24 A;  4PJJ A;  3ZIB A;  3SNH A;  3WG7 C;  2OG2 A;  3FOP A;  1D1B A;  5GPG B;  4OIQ F;  2KQ9 A;  2YLG A;  3DE9 A;  4CDA A;  5HSW A;  3UGO A;  2J9V A; 
#chains in the Genus database with same CATH homology
 4PJN A;  1VYI A;  3UMI A;  4AK9 A;  4M63 A;  2CGE A;  3OWT A;  4U5G A;  5E2Q A;  1D0Z A;  1BR2 A;  2Y3G A;  2NUT A;  4DBR A;  5DQZ A;  3L34 A;  3W8I A;  5L3V A;  3W8H A;  4MND A;  3UGP A;  4LER A;  3RKO F;  3ZG1 A;  2W45 A;  3LLK A;  1NU9 C;  2J0X A;  1MMN A;  1ZHW A;  4JJF A;  3UMK A;  2C03 A;  3T6B A;  4OIN F;  3RYL A;  2HV7 A;  4ULW A;  1M2O A;  1VMA A;  3EQL F;  3NYM A;  1BR4 A;  3K7D A;  4HE8 D;  1MMA A;  3LLI A;  2R7O A;  2A68 F;  1MMG A;  4JJG A;  2J9U A;  4PJL A;  4BJ5 A;  4YT8 A;  4JUR I;  5KYU B;  4AE4 A;  2J7P A;  1M56 C;  5KYY B;  4QI2 A;  4AX2 A;  4G0H A;  4KC9 A;  3W2W A;  1MNE A;  4JVS A;  3I4U A;  4U5B E;  2R7W A;  4X0R A;  1Z63 A;  1OCR C;  5T3W A;  1V54 C;  2J45 A;  3HJC A;  4BJ6 A;  3F47 A;  4CS9 C;  3EHN A;  1QZX A;  1M2V B;  4ANJ A;  3AQC A;  2A6H F;  2Y69 C;  4I3M A;  2E87 A;  3LES A;  2CW0 F;  3F46 A;  3EGX B;  3RFY A;  4BG0 A;  2WB7 A;  5FCL A;  4E7S A;  2C04 A;  2PF4 E;  2YZS A;  2EIJ C;  2MWQ A;  3HLZ A;  4YWQ A;  3EGD A;  3UNG C;  4G7H F;  1ZHT A;  4OIR F;  2YHS A;  2IXP A;  4IWB A;  4YN0 B;  3EZI A;  4RBN A;  2Q9A A;  3K6B A;  3ASO C;  4OD5 A;  1O87 A;  3TD7 A;  4YT2 A;  3IEE A;  2PX3 A;  5L3Q A;  4IJJ A;  2DGJ A;  4O7G A;  5E3A A;  1MND A;  2IXO A;  3EHM A;  2KJG A;  2Q9C A;  2HV6 A;  2W9Y A;  5DS4 A;  1WGW A;  4PJM A;  3I5Q A;  3ABM C;  3NKE A;  5KYX B;  1OKK A;  4C3D A;  5DQT A;  3E70 C;  1QLE C;  2J46 A;  2H7O A;  3NDB B;  3L0I A;  3QZC A;  4KI2 A;  3AG2 C;  2YEV A;  2EIM C;  1D0Y A;  4K0D A;  4HFK B;  2XL4 A;  3SYN A;  4RD9 A;  5DS5 A;  3ASN C;  1FMV A;  3B0P A;  1NG1 A;  4BJ6 C;  1ZU4 A;  4WJ0 A;  5T3T A;  4U5F E;  2EIN C;  4CS9 A;  3JSZ A;  3I5P A;  3VAY A;  4CS8 C;  3AQB A;  2R7V A;  2Y3B A;  3N2Z B;  3EZH A;  3DAG A;  3B0V C;  4DVY P;  2A69 F;  3AG4 C;  3H65 A;  5DS6 A;  3B9Q A;  2D5R B;  3QMK A;  3KH2 A;  5KYU A;  2LSE A;  3T6J A;  2IXM A;  3JT1 A;  4LAC B;  5KYY A;  1LVK A;  3JCU Q;  5CI8 A;  5EHH A;  4PFP A;  3EFO B;  2R7X A;  3DAF A;  3GAN A;  4CSA A;  2H7V C;  2A6E F;  3FDQ A;  3T4R A;  2Q3T A;  2IXN A;  2KW3 C;  4XWJ A;  5F5H A;  2I8B A;  2WVN A;  1M2V A;  3ITF A;  2ZXP A;  1J8Y F;  4DBQ A;  4U5E E;  3SZR A;  1SF8 A;  3ZVR A;  3KKB A;  1Z3I X;  4JCH A;  1LS1 A;  3LNR A;  1JPJ A;  1NZE A;  4O6M A;  1FTS A;  1FFH A;  4KNV A;  3X2Q C;  1Z5Z A;  4K7B A;  5KYW B;  1M57 C;  3AG1 C;  4FX5 A;  1FMW A;  1OCO C;  5E33 A;  2NUT B;  2PP4 A;  3EG9 B;  1TWA A;  2P6V A;  3O39 A;  1TWG A;  4CS8 A;  3DD7 A;  3V7O A;  3EJN A;  4U5H A;  1ZHZ A;  2Q9B A;  2L9J A;  2NUP A;  3MLG A;  5KYX A;  1VK5 A;  3Q6N A;  2R7R A;  1D1C A;  1ZYR F;  1OCZ C;  2XXA B;  3LS1 A;  1PD1 A;  4EBB A;  3NYJ A;  4YT5 A;  2Y39 A;  4O6N A;  4YJW A;  2EIK C;  5D91 A;  1TWH A;  4O79 A;  2IYL D;  5B3S C;  3GOD A;  4CBE A;  5IY5 C;  3S0X A;  3Q7L A;  2J9W A;  3M1C B;  4CSA C;  4G7O F;  2DYS C;  3EH2 A;  1G8X A;  2FFH A;  4I44 A;  4I1M A;  4LLC A;  3DXJ F;  3LJB A;  1SZI A;  4P6I C;  4EWC A;  1W2W A;  4GYT A;  1RJ9 B;  3K1I C;  4OIP F;  5DVW A;  3EPV A;  4KBL A;  4RDA A;  3DMD A;  2O9X A;  3K1H A;  3EH1 A;  4ZLC A;  1VOM A;  4IAO A;  4C7O B;  4W8K A;  1MMD A;  1Z23 A;  1Z6A A;  2A1D D;  3UR3 C;  4BJ1 A;  3DZA A;  2XRH A;  2G62 A;  4Q7C A;  2Y3D A;  5T1D B;  4XTK A;  2PFD A;  2R7U A;  3CQZ A;  1SMY F;  3ZSU A;  3ECS A;  3LAY A;  1ZHY A;  5BUO A;  2P7V A;  4MQ9 F;  2KNH A;  3PHF 2;  5B1B C;  4J30 B;  2W4B A;  3S28 A;  5CI9 A;  4ZLD A;  3VYW A;  4PK4 A;  3POV A;  5B1A C;  1BR1 A;  4BEJ A;  5KYN A;  1FFT C;  4NY3 A;  4JZA A;  2QTV A;  3FHD A;  3S29 A;  2WVO A;  4PFO A;  4OIO F;  3JRT A;  5KYW A;  1J8M F;  2OCC C;  1KU2 A;  1VYK A;  3DJN B;  2WZL A;  2R7S A;  4N06 A;  4DVZ A;  3LEV A;  4C3E A;  3FAJ A;  3EG9 A;  3ABL C;  4IRU A;  2CNW D;  3NG1 A;  5E3C A;  2VH3 A;  4C3B A;  4O6Y A;  3SEO A;  3EGX A;  1IW7 F;  3NKD A;  1V55 C;  2W4M A;  2R7T A;  1N1C A;  2XXA A;  3DM5 A;  1IZM A;  3DM9 B;  5EGY A;  3OEO A;  4H4K C;  2X51 A;  3W2V A;  2BE5 F;  1O5H A;  1PD0 A;  3WOD F;  3HTK C;  1S7Z A;  4KNW A;  3Q6M A;  3ZC4 A;  4BJT A;  5F5F A;  2FGY A;  2GFH A;  3X1O A;  2CDQ A;  3RIP A;  4E7Z A;  4J32 B;  3ABK C;  1PCX A;  4U5C E;  5D92 A;  4G7Z F;  3MX3 A;  1RJ9 A;  3OA1 A;  4YT4 A;  2ZPA A;  1NU7 D;  2WZF A;  3UMH A;  4A2N B;  3NRH A;  4CIH A;  1JPN A;  1OCC C;  3Q7G A;  3CSK A;  1LKX A;  3S27 A;  3CZ6 A;  3E9V A;  4JW1 A;  4DOZ A;  3KMI A;  4HFF B;  1TKN A;  4F4B A;  2WVQ A;  4Q4Z F;  4C7O A;  2J7P D;  3JYH A;  1ZHX A;  5DLJ A;  3KL4 A;  4AE4 B;  4XLP F;  4HEA J;  2G3V A;  2V3C C;  3LS0 A;  2JD3 A;  4CS7 A;  4FES A;  4QI0 A;  2L81 A;  2Y3H A;  2ZXR A;  4XLN F;  4GEH A;  2J0W A;  4I1O B;  2M4E A;  1TWC A;  3K66 A;  4B6I A;  3O6X A;  1TR2 A;  2WL8 A;  3PMR A;  4QDL A;  1ZU5 A;  3AG3 C;  2G3K A;  3K33 A;  4FWV A;  2NUP B;  2R7Q A;  1D1A A;  1D0X A;  3B0U X;  2Z15 A;  2IOQ A;  2MYS A;  2VAS A;  2ZXW C;  3EFO A;  4BJ5 C;  3EGD B;  4Q5S F;  2NG1 A;  2ZXO A;  2KGO A;  2PX0 A;  3SP1 A;  2WZG A;  2DYR C;  2QY9 A;  2EIL C;  1ST6 A;  3RH3 A;  3FVY A;  4U5D E;  3NYL A;  2H7B A;  3DJU B;  2B0J A;  2VB6 A;  2XSE A;  1OKK D;  4OD4 A;  4LLE A;  2V26 A;  3ZIB A;  3N0T A;  2CNW A;  3N24 A;  4PJJ A;  3SNH A;  3WG7 C;  2OG2 A;  1D1B A;  4OIQ F;  2KQ9 A;  5HSW A;  3UGO A;  2J9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...