1VK5A

X-ray structure of gene product from arabidopsis thaliana at3g22680
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
121
structure length
121
Chain Sequence
GSLLRRAEMYQDYMKQVPIPTNRGSLIPFTSWVGLSISMKQLYGQPLHYLTNVLLQRWDQSRFGTDSEEQRLDSIIHPTKAEATIWLVEEIHRLTPSHLHMALLWRSDPMYHSFIDPIFPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords expressed protein
publication title Structure at 1.6 A resolution of the protein from gene locus At3g22680 from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 45
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2004-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09187 RdDM_RDM1 RNA-directed DNA methylation 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.690 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1vk5A00
2Q3TA 1VK5A 3GANA
chains in the Genus database with same CATH superfamily
4P9TA 2J45A 5TJ5E 1OW7A 3RQFA 3AJMA 3ZC4A 4E7SA 1WTYA 2XL4A 2ICWG 4W8PA 1LKXA 2PNOA 4DXWA 4HEAJ 4MVQA 1T6IA 1BR4A 1NBBA 2R9RB 1Z23A 2R7UA 3MX3A 2M4EA 2LP4A 3C62A 2V3CC 3UNGC 5HSWA 2R7WA 2OKUA 5COFA 4CS7A 3ASNC 3AG1C 3IQTA 3B71A 1Z7Qc 2NPUA 4LACB 3RIPA 4MVSA 4DBQA 1HMOA 1GGQA 3ECSA 3EG9A 1GQAA 5E2QA 3K1HA 4PFOA 2J9BA 4U5GA 4X0RA 3S29A 3DJUB 3ABKC 4ULVA 2CW0F 3RFYA 4JC7A 3SXZA 5CI9A 1VYKA 1L7CA 4K1OA 3QZCA 3X1OA 1G4US 4MTOA 2YKZA 3L34A 1OCRC 1CPQA 2C03A 1LVKA 3LNMB 5L0GA 3LEVA 4KI2A 2KK1A 1S05A 1JR8A 3F47A 1A41A 1Q0DA 1WOLA 1I4ZA 1O87A 1KNYA 3QVZA 5JP7A 4EHPA 5KYYB 1M2VB 2MYSA 3QVYA 2A0BA 4XEFA 4RDAA 1JAFA 3DWWA 3RVZA 3ZSUA 3T6GB 3U3BA 1SF8A 4E17A 3AGUA 1ZHWA 3GEEA 2WZFA 4YL0A 3E9VA 4A2NB 3DMDA 3HNKA 4CDYA 5A6KA 1Z3IX 2IOQA 2X0CA 4U9EA 1I4YA 1EI7A 4PJLA 3AGTA 4BEJA 1PCXA 3L0IA 1OQCA 3UR3C 1RJ9B 5L3VA 2G62A 3EGXA 4IAQA 4P9FA 4NY3A 4EBKA 2VCBA 5DQZA 2CDQA 1TWGA 3TQOA 4CS9A 3H65A 1QVXA 5B1AC 5BQHA 1ZZPA 3K7DA 2QUPA 3S9OA 1D0ZA 2OG2A 3N0TA 4GQHA 4CSAC 5DVWA 2WB7A 1YJGA 1VB5A 2B0HA 1GM5A 3NYLA 3ZDLA 3ZWIA 2YLDA 4HFKB 1OXBA 2XLDA 3F46A 4NTAA 1Y4CA 3KH2A 2C04A 2CNWA 3T4RA 3C8GA 3LS1A 3POVA 3C63A 1AUEA 2HUJA 3FOPA 4BJ6C 4U5CE 3EQLF 4J32B 4AL1A 5HV9A 1E2XA 3DAFA 1OW8A 1TFOB 3OEOA 1D1BA 3BRJA 3SXYA 1IZMA 1V74B 3UMKA 3KKBA 1V4AA 2HV6A 1MMAA 4FWVA 3S28A 3TK0A 3GANA 3T9OA 4KC9A 3CQZA 4C7OB 4I3MA 3JYYA 1NSGB 1M57C 3U5SA 2D4UA 3RW0A 3GORA 3PHF2 1T5OA 4JW1A 3S0XA 2KQ9A 2DYRC 2P6VA 4W8KA 5L0DA 2FAPB 4XPXA 3MBGA 4XPYA 4U5BE 1ORJA 2GAQA 2OEXA 2R02A 3JRMO 4GEHA 2Y3HA 2Q7RA 3MYFA 1VYIA 1HW1A 3FVYA 3JYHA 4G7ZF 1JOGA 2PP4A 3FMSA 1RKCA 3IQ5A 3DAGA 3T6JA 3SXMA 3GWLA 2VCAA 2GA0A 4MQ9F 4OIOF 4JCHA 4OD5A 2KYHA 2CGEA 4XPWA 5KYYA 5KYNA 1M2VA 1NFOA 3H2VA 4JURI 1HMDA 2WL8A 4NTFA 2B0JA 2XXAB 4BJTA 4LDQA 5L0CA 4U5EE 1G4WR 3QW0A 4BPMA 2IYLD 3GEHA 5F5FA 3JSZA 3LNRA 4JVSA 5AGFA 1LM3B 3ZQYA 3K1IC 4YT2A 4OIPF 1T9KA 1TWCA 2R7OA 4IWBA 1F1MA 1YA7O 3L8IA 3AG4C 3PCVA 4I44A 3U2LA 4DRHB 2ZXWC 2EILC 4ZLCA 5JLIA 3T6BA 3HKKA 2YEVA 3LJBA 3V5ZA 2J9UA 2R05A 2EPMX 3IPMO 4ULWA 4NCQA 2YHSA 1VMAA 5JSLA 1QPUA 2Q3TA 1CGOA 3DKAA 3AQBA 3EJNA 3FOOA 4CS8A 2J0WA 2YL1A 1UG7A 4LLCA 1LE2A 3Q6MA 5EK0A 2UUIA 3TOLA 2A68F 1SR2A 1VLSA 3W8IA 3EHMA 1ZU5A 2XLVA 2YLIA 5KYUB 4EWCA 4DRIB 2OEVA 1VTMP 1LIHA 3KYJA 3NMIA 2FFHA 4U5DE 1WASA 2P7VA 4JIOA 4DOZA 3UMHA 1BZ4A 3BEHA 1RKEB 4BEMJ 4YK5A 4JCZA 3N24A 2RD9A 3M15A 3TD7A 3ABLC 1D0XA 5F28E 3AG3C 5A6BD 1Q0MA 4MVUA 2OJQA 1NFNA 3NKEA 2I8BA 1QQ3A 4EUKB 2M64A 4C7OA 3B29A 3L8JA 3WG7C 2LD6A 4CBEA 2XRHA 3Q7LA 4XTKA 3S90A 1C17M 4PFPA 2L81A 4R32A 1BR2A 5K0IA 2DGJA 5L0JA 1LS1A 2R7RA 1JMWA 4PJMA 5T1DB 5T3WA 1IW7F 3VF0A 4O79A 3KYIA 3S27A 2Y69C 3ZVRA 4L6RA 4MVMA 2YLGA 3QW1A 4DVYP 2NSFA 1HE1A 4YT4A 4YL3A 4CDAA 1YDIA 2R25A 1SYQA 4HE8D 2L6GA 4U5HA 3IHUA 3M79A 1E86A 2XXAA 1D1CA 3I5QA 3QTHA 4J7TA 2ZD9A 1A7EA 1CGNA 3ASOC 4XQ1A 4YL1A 3LAYA 5D91A 3TJ6A 2AP3A 3K33A 4D4XA 5L0FA 3UGPA 3LEOA 2XS1A 4BJ6A 3DI5A 3R2PA 1WN0A 2WZLA 4I1MA 4FAPB 5JVEA 1FAPB 1T6UA 2A0UA 2MWQA 3WODF 3U3FA 1TQGA 3JRTA 2Y39A 2UUHA 3UGOA 4MNDA 4PR9A 4N6HA 3RF3A 4XLPF 1DOVA 4MTGA 1NU7D 1XZPA 4RBNA 3G50A 1OCCC 4M63A 5BQIA 3EH1A 1WGWA 1M56C 1MNEA 2H7VC 2J7PA 1PV3A 2A1DD 2YWAA 2JPUA 3U8VA 1E84A 1O3UA 1T6QA 2KW3C 2OJED 1K05A 1QKRA 2J9WA 2YRFA 1VLTA 2VCCA 4XLNF 4Z9HA 4DRJB 2Q00A 4LDKA 5KYUA 3M1CB 4U9DA 2DI3A 3RKOF 2LSEA 5JS5A 2R7XA 3C8ZA 2L6HA 2KSFA 3GM1A 3IQ6A 5DS5A 1QZXA 4O6NA 4BJ5C 3HTKC 2R7TA 2PF4E 1H9GA 1MNDA 2GDCA 1OCZC 1ZHXA 4EKWA 2J9VA 3LESA 1M2OA 5E33A 3O39A 2NUPB 3IEEA 2L6FA 4LERA 4IAOA 3NYJA 2PX3A 3DM5A 1AVOB 1BR1A 2JX0A 5CIVA 4N06A 3E70C 5JRAA 1FR0A 5COMA 3HLZA 1YLMA 3SP1A 2HSBA 4AE4B 1BDJB 1APCA 3HNLA 2X51A 1D1AA 2XSEA 2XS8A 3NKDA 1SMYF 1G8XA 4O6YA 1ZHZA 3O10A 1B68A 1YZAA 1AEPA 1JPJA 2J46A 2J8WA 1LPEA 2I15A 3B9QA 2HSQA 3N2ZB 1K04A 5B3SC 4O7GA 4OD4A 2CNWD 3TJ5A 4KNWA 4BJ1A 3C8GD 2KJGA 2R7QA 1Q0KA 3U9MA 3V5YA 1D0YA 4NTBA 4PK4A 4CJOA 4XEKA 3NG1A 3I5PA 4WGYA 4IJJA 3CSKA 2HMQA 3FHDA 3RQGA 4Q4ZF 4YN0B 2Q9BA 2XLHA 3FAPB 4JKVA 2NG1A 2WVOA 1OCOC 2IM8A 1HY5A 2LK4A 3AOUA 5FZTA 4Q5SF 2QLAA 3G4XA 2XLWA 2VB6A 4DBRA 4E0IA 2E87A 4F4BA 5A6AA 2LIGA 3X2QC 1Q0FA 4E18A 1MMNA 2KC3A 3L1MA 1G5ZA 4J30B 4CJGA 4JTCB 2CYDA 3AG2C 3JCUQ 4MW8A 4PACA 4WJ0A 2YVKA 1WATA 4A4AA 1CGME 2TMVP 1Q0GA 3EZHA 2ZXPA 4RD9A 1RMVA 3JT1A 3MFNA 2VH3A 4K0DA 4QI2A 4QDLA 5E3AA 4UDVA 1RJ9A 2KGOA 4MTFA 5KYWB 4JEBA 4HFFB 2QTVA 1OXKA 4G0HA 3V7OA 2D5RB 2W45A 3Q6NA 4IB4A 3KPHA 4EBBA 3K66A 3TOMA 2W9YA 2YZSA 4ONSA 4WABA 4BG0A 4CDVA 4ER9A 4CS9C 4JEAA 4OIRF 4G7OF 1Z5ZA 2L7AA 2XM0A 1XZQA 2L9JA 2NUPA 3G4ZA 1L3PA 4JJGA 2PX0A 5FCLA 2AU5A 2F22A 3ZIBA 3SXKA 2VASA 1R4TA 3OWTA 4C3EA 2H8AA 5KYXB 1I5NA 5DS6A 4AE4A 4IRUA 4E0HA 4H54A 2Q9AA 3SNHA 2HS5A 3GM3A 1FTSA 4LDRA 4CIPA 2EPNA 3EPVA 1H7IA 4G7HF 2BE5F 1ZHTA 1YAUO 2WVQA 3C18A 3B0UX 1LS4A 1ORSC 1TWHA 2LFDA 3ZQVA 2IXOA 4KNVA 3VAYA 1C03A 3W2WA 2EIMC 1OKKA 1A7DA 2FGYA 3W4YA 1RXQA 2EIJC 1EKYA 3Q7GA 3EH2A 1NG1A 2PFDA 5D92A 4ANJA 4I1OB 2A69F 4Z9IA 1V54C 1EA8A 2BL2A 3DM9B 2JD3A 3OA1A 3GWNA 1QLEC 3EGXB 4FESA 4JZAA 4WGZA 4CIHA 1Z63A 2HZ8A 3JZ0A 2W4MA 2QE9A 2EIKC 2XLEA 3B0VC 3U0CA 1ZYRF 2O9XA 2Z15A 1PD0A 2OOCA 3DE8A 3HJCA 4JRZA 5F5HA 3ZTZA 1YZCA 5A69A 1K40A 4CSAA 5COGA 5EGYA 1GS9A 3EGDB 2ZXRA 1NZEA 5A6JA 2OCCC 2XLOA 3DE9A 1CPRA 1FMVA 2YL3A 3W8HA 1HW2A 1M6TA 2BC5A 2Q9CA 2Q4FA 3FDQA 3FAJA 1ZW2A 1YVIA 3NDBB 3C8GB 4JE9A 3NMKA 3WHNA 3VYWA 2HJMA 4Q7CA 4PJJA 4MW3A 4XWJA 1FFHA 1LE4A 1WWPA 2WZGA 2Y3DA 1KU2A 1NU9C 2A6HF 2XLMA 2YL7A 3LS0A 3MYIA 4P6IC 2J0XA 3RVYA 2QY9A 5KYWA 4YJWA 2A6EF 3KMIA 1VK5A 2HJ3A 3PMRA 1OW6A 3SYNA 3LLKA 2EPKX 2R7VA 1N1CA 3ZTMA 2AWCA 3U9JA 2W4BA 4AL0A 2HMZA 3FXHA 1H9TA 1FMWA 3SZRA 2GWWA 4NC3A 4CS8C 4AX2A 5DS4A 1LI7A 2H7BA 4YWQA 1SZIA 3KL4A 1A0BA 1MMDA 1V55C 5KYXA 1R5ID 3HNIA 4JTDB 3RQEA 4JTAB 2J7PD 5B1BC 2WVNA 3US6A 3S84A 2Y3GA 1A7VA 1RKEA 1YA9A 2OQMA 3ITFA 5AC5A 1J8YF 2NUTB 5DLJA 2G3VA 3GODA 3PDMP 3JTLO 1JRAA 3IQCA 256BA 3K1IA 3DJNB 4ZLDA 1DOWA 3ATPA 2H7OA 2AVKA 1JPNA 4C3DA 2AWYA 3GEIA 3JSEO 1U89A 2ZXOA 3VM6A 3TULA 1RCPA 2DYSC 4MS2A 1OR3A 2XL8A 3EFOB 3AQCA 3R7CA 3U2MA 1TWAA 3QMKA 3CZ6A 4EIYA 2ASRA 4IGGA 4MVRA 4G78A 1MQVA 2XM4A 1W2WA 3CEXA 3H2UA 3SEOA 4JJFA 4Z9JA 2NSGA 2P1AA 3EGDA 2OU6A 2HFIA 3DD7A 1Y6DA 4PJNA 5B3IA 5BQGA 3I4UA 5CI8A 2HKVA 1ST6A 3NMJA 1T01A 1FNTc 2IXNA 3EHNA 4E7ZA 2EINC 4U5FE 3A11A 2XL6A 3M4BA 2QNLA 1HE9A 2LFFA 2V26A 3MLGA 1ORYA 4N6CA 3ABMC 3W2VA 5L0HA 3M4CA 2IXMA 3DZAA 3LUTB 4H4KC 1H6GA 2LCHA 3O6XA 1TKNA 2IXPA 1ZHYA 4KBLA 1BBHA 4IARA 1NLXA 1TFKB 4YT5A 3C7JA 5AC4A 2R03A 4EBJA 3WAQA 4DVZA 2VC9A 3CAXA 3ZG1A 1Z6AA 4J7YA 1U6HA 5IY5C 1KTMA 1VOMA 2P61A 4DJ9A 3B0PA 2ZPAA 2RSEB 3NYMA 1QSPA 5JT4A 4MVOA 1E85A 3NRHA 1S7ZA 3EG9B 3RYLA 3VRCA 3O55A 2EPLX 3A9CA 1UFBA 1XWJA 2NUTA 5BUOA 2KNHA 5E3CA 4LLEA 5JUAA 3DXJF 1O5HA 1J8MF 1YARO 4GYTA 1E83A 2P0NA 1PD1A 1LI5A 4YT8A 5L3QA 4OIQF 3RH3A 3EZIA 1OR2A 4AK9A 1ZVZA 1U0BB 2EPOA 2IBFA 4K7BA 5GPGB 2ETSA 5T3TA 4CX9A 3K6BA 2LQGA 4NQFA 3J06A 3EFOA 4N4WA 2R7SA 1YYJA 2GFHA 2Y3BA 4O6MA 2DB4A 2MHRA 3HNJA 5L0IA 4D4NA 4FX5A 4MVZA 1FFTC 1EQ1A 1YYXA 1MMGA 1ZW3A 3U8PA 2G3KA 1TR2A 1ZU4A 2YL0A 4QI0A 1C02A 2HV7A 4OINF 5DQTA 2PBEA 4B6IA 3V5XA 3UMIA 3GM2A 2YQYA 3LLIA 5A6BA 5EHHA 2CCYA 4C3BA 1OKKD 4XEVA 4BJ5A
chains in the Genus database with same CATH topology
2J45A 3ZC4A 4E7SA 2XL4A 1LKXA 4HEAJ 1BR4A 1Z23A 2R7UA 3MX3A 2M4EA 2V3CC 3UNGC 5HSWA 2R7WA 4CS7A 3ASNC 3AG1C 4LACB 3RIPA 4DBQA 3ECSA 3EG9A 5E2QA 3K1HA 4PFOA 4U5GA 4X0RA 3S29A 3DJUB 3ABKC 2CW0F 3RFYA 5CI9A 1VYKA 3QZCA 3X1OA 3L34A 1OCRC 2C03A 1LVKA 3LEVA 4KI2A 3F47A 1O87A 5KYYB 1M2VB 2MYSA 4RDAA 3ZSUA 1SF8A 1ZHWA 2WZFA 3E9VA 4A2NB 3DMDA 1Z3IX 2IOQA 4PJLA 4BEJA 1PCXA 3L0IA 3UR3C 1RJ9B 2G62A 3EGXA 4NY3A 5DQZA 2CDQA 1TWGA 4CS9A 3H65A 5B1AC 3K7DA 1D0ZA 2OG2A 3N0TA 4CSAC 5DVWA 2WB7A 3NYLA 4HFKB 3F46A 3T4RA 3KH2A 2C04A 2CNWA 3LS1A 3POVA 4BJ6C 4U5CE 3EQLF 4J32B 3DAFA 3OEOA 1D1BA 1IZMA 3UMKA 3KKBA 2HV6A 1MMAA 4FWVA 3S28A 3GANA 4KC9A 3CQZA 4C7OB 4I3MA 1M57C 3PHF2 4JW1A 3S0XA 2KQ9A 2DYRC 2P6VA 4W8KA 4U5BE 4GEHA 2Y3HA 1VYIA 4G7ZF 3FVYA 3JYHA 2PP4A 3T6JA 4OIOF 3DAGA 4MQ9F 4JCHA 4OD5A 2CGEA 5KYYA 5KYNA 1M2VA 4JURI 2WL8A 2XXAB 2B0JA 4BJTA 4U5EE 2IYLD 5F5FA 3JSZA 3LNRA 4JVSA 3K1IC 4YT2A 4OIPF 2R7OA 1TWCA 4IWBA 3AG4C 4I44A 2ZXWC 2EILC 4ZLCA 3T6BA 2YEVA 3LJBA 2J9UA 4ULWA 2YHSA 1VMAA 2Q3TA 3EJNA 4CS8A 3AQBA 2J0WA 4LLCA 3Q6MA 2A68F 3W8IA 3EHMA 1ZU5A 5KYUB 4EWCA 4U5DE 2FFHA 2P7VA 4DOZA 3UMHA 3N24A 3TD7A 3ABLC 1D0XA 3AG3C 3NKEA 2I8BA 4C7OA 3WG7C 4CBEA 2XRHA 3Q7LA 4XTKA 4PFPA 2L81A 1BR2A 2R7RA 2DGJA 1LS1A 4PJMA 5T1DB 5T3WA 1IW7F 4O79A 3S27A 2Y69C 3ZVRA 4DVYP 5L3VA 4YT4A 4HE8D 4U5HA 2XXAA 1D1CA 3I5QA 5D91A 3ASOC 3LAYA 3UGPA 3K33A 4BJ6A 2WZLA 4I1MA 2MWQA 3WODF 3JRTA 2Y39A 3UGOA 4MNDA 4XLPF 1NU7D 4RBNA 1OCCC 4M63A 3EH1A 1WGWA 1M56C 1MNEA 2H7VC 2J7PA 2A1DD 2KW3C 4XLNF 2J9WA 5KYUA 3M1CB 3RKOF 2LSEA 2R7XA 5DS5A 1QZXA 4O6NA 4BJ5C 3HTKC 2R7TA 2PF4E 1MNDA 1OCZC 1ZHXA 2J9VA 3LESA 1M2OA 5E33A 3O39A 2NUPB 3IEEA 4LERA 4IAOA 3NYJA 2PX3A 3DM5A 1BR1A 4N06A 3E70C 3HLZA 3SP1A 4AE4B 3NKDA 2X51A 1D1AA 2XSEA 1SMYF 1G8XA 4O6YA 1ZHZA 1JPJA 2J46A 3B9QA 3N2ZB 5B3SC 4O7GA 4OD4A 2CNWD 4KNWA 4BJ1A 2KJGA 2R7QA 1D0YA 4PK4A 3NG1A 3I5PA 4IJJA 3CSKA 3FHDA 4Q4ZF 4YN0B 2Q9BA 2NG1A 2WVOA 1OCOC 4Q5SF 4DBRA 2VB6A 4F4BA 2E87A 3X2QC 1MMNA 4J30B 3JCUQ 3AG2C 4WJ0A 3EZHA 2ZXPA 4RD9A 3JT1A 2VH3A 4K0DA 4QI2A 4QDLA 5E3AA 1RJ9A 2KGOA 5KYWB 4HFFB 2QTVA 4G0HA 3V7OA 2D5RB 2W45A 3Q6NA 4EBBA 3K66A 2W9YA 2YZSA 4BG0A 4CS9C 4OIRF 4G7OF 1Z5ZA 2L9JA 2NUPA 4JJGA 2PX0A 5FCLA 3ZIBA 4C3EA 2VASA 3OWTA 5KYXB 5DS6A 4AE4A 4IRUA 2Q9AA 3SNHA 1FTSA 3EPVA 4G7HF 2BE5F 1ZHTA 2WVQA 3B0UX 1TWHA 2IXOA 4KNVA 3VAYA 3W2WA 2EIMC 1OKKA 2FGYA 2EIJC 3Q7GA 3EH2A 1NG1A 2PFDA 5D92A 4ANJA 4I1OB 2A69F 1V54C 3DM9B 2JD3A 3OA1A 1QLEC 3EGXB 4FESA 4JZAA 4CIHA 1Z63A 2W4MA 2EIKC 3B0VC 1ZYRF 2O9XA 2Z15A 1PD0A 5F5HA 3HJCA 4CSAA 5EGYA 3EGDB 2ZXRA 1NZEA 2OCCC 1FMVA 3W8HA 2Q9CA 3FDQA 3FAJA 3NDBB 3VYWA 4PJJA 4Q7CA 4XWJA 2Y3DA 1FFHA 2WZGA 1KU2A 3LS0A 1NU9C 2A6HF 5KYWA 4P6IC 2J0XA 2QY9A 4YJWA 2A6EF 3KMIA 1VK5A 3PMRA 3SYNA 3LLKA 2R7VA 1N1CA 2W4BA 1FMWA 3SZRA 4CS8C 4AX2A 5DS4A 2H7BA 4YWQA 1SZIA 3KL4A 1MMDA 1V55C 5KYXA 2J7PD 5B1BC 2WVNA 2Y3GA 3ITFA 1J8YF 2NUTB 5DLJA 2G3VA 3GODA 3DJNB 4ZLDA 2H7OA 4C3DA 1JPNA 2ZXOA 2DYSC 3EFOB 3AQCA 1TWAA 3QMKA 3CZ6A 1W2WA 3SEOA 4JJFA 3EGDA 3DD7A 4PJNA 3I4UA 5CI8A 1ST6A 2IXNA 3EHNA 4E7ZA 2EINC 4U5FE 2V26A 3MLGA 3ABMC 3W2VA 2IXMA 3DZAA 4H4KC 3O6XA 1TKNA 2IXPA 1ZHYA 4KBLA 4YT5A 4DVZA 3ZG1A 1Z6AA 5IY5C 1VOMA 3B0PA 2ZPAA 3NYMA 3NRHA 1S7ZA 3EG9B 3RYLA 5BUOA 2NUTA 2KNHA 5E3CA 4LLEA 3DXJF 1O5HA 1J8MF 4GYTA 1PD1A 4YT8A 5L3QA 4OIQF 3RH3A 3EZIA 4AK9A 4K7BA 5T3TA 3K6BA 3EFOA 2R7SA 2GFHA 2Y3BA 4O6MA 4FX5A 1FFTC 1MMGA 2G3KA 1TR2A 1ZU4A 4QI0A 2HV7A 4OINF 5DQTA 4B6IA 3UMIA 3LLIA 5EHHA 4C3BA 1OKKD 4BJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q3T A;  1VK5 A;  3GAN A; 
#chains in the Genus database with same CATH topology
 4P9T A;  2J45 A;  5TJ5 E;  1OW7 A;  3RQF A;  3AJM A;  3ZC4 A;  4E7S A;  1WTY A;  2XL4 A;  2ICW G;  4W8P A;  1LKX A;  2PNO A;  4DXW A;  4HEA J;  4MVQ A;  1T6I A;  1BR4 A;  1NBB A;  2R9R B;  1Z23 A;  2R7U A;  3MX3 A;  2M4E A;  2LP4 A;  3C62 A;  2V3C C;  3UNG C;  5HSW A;  2R7W A;  2OKU A;  5COF A;  4CS7 A;  3ASN C;  3AG1 C;  3IQT A;  3B71 A;  1Z7Q c;  2NPU A;  4LAC B;  3RIP A;  4MVS A;  4DBQ A;  1HMO A;  1GGQ A;  3ECS A;  3EG9 A;  1GQA A;  5E2Q A;  3K1H A;  4PFO A;  2J9B A;  4U5G A;  4X0R A;  3S29 A;  3DJU B;  3ABK C;  4ULV A;  2CW0 F;  3RFY A;  4JC7 A;  3SXZ A;  5CI9 A;  1VYK A;  1L7C A;  4K1O A;  3QZC A;  3X1O A;  1G4U S;  4MTO A;  2YKZ A;  3L34 A;  1OCR C;  1CPQ A;  2C03 A;  1LVK A;  3LNM B;  5L0G A;  3LEV A;  4KI2 A;  2KK1 A;  1S05 A;  1JR8 A;  3F47 A;  1A41 A;  1Q0D A;  1WOL A;  1I4Z A;  1O87 A;  1KNY A;  3QVZ A;  5JP7 A;  4EHP A;  5KYY B;  1M2V B;  2MYS A;  3QVY A;  2A0B A;  4XEF A;  4RDA A;  1JAF A;  3DWW A;  3RVZ A;  3ZSU A;  3T6G B;  3U3B A;  1SF8 A;  4E17 A;  3AGU A;  1ZHW A;  3GEE A;  2WZF A;  4YL0 A;  3E9V A;  4A2N B;  3DMD A;  3HNK A;  4CDY A;  5A6K A;  1Z3I X;  2IOQ A;  2X0C A;  4U9E A;  1I4Y A;  1EI7 A;  4PJL A;  3AGT A;  4BEJ A;  1PCX A;  3L0I A;  1OQC A;  3UR3 C;  1RJ9 B;  5L3V A;  2G62 A;  3EGX A;  4IAQ A;  4P9F A;  4NY3 A;  4EBK A;  2VCB A;  5DQZ A;  2CDQ A;  1TWG A;  3TQO A;  4CS9 A;  3H65 A;  1QVX A;  5B1A C;  5BQH A;  1ZZP A;  3K7D A;  2QUP A;  3S9O A;  1D0Z A;  2OG2 A;  3N0T A;  4GQH A;  4CSA C;  5DVW A;  2WB7 A;  1YJG A;  1VB5 A;  2B0H A;  1GM5 A;  3NYL A;  3ZDL A;  3ZWI A;  2YLD A;  4HFK B;  1OXB A;  2XLD A;  3F46 A;  4NTA A;  1Y4C A;  3KH2 A;  2C04 A;  2CNW A;  3T4R A;  3C8G A;  3LS1 A;  3POV A;  3C63 A;  1AUE A;  2HUJ A;  3FOP A;  4BJ6 C;  4U5C E;  3EQL F;  4J32 B;  4AL1 A;  5HV9 A;  1E2X A;  3DAF A;  1OW8 A;  1TFO B;  3OEO A;  1D1B A;  3BRJ A;  3SXY A;  1IZM A;  1V74 B;  3UMK A;  3KKB A;  1V4A A;  2HV6 A;  1MMA A;  4FWV A;  3S28 A;  3TK0 A;  3GAN A;  3T9O A;  4KC9 A;  3CQZ A;  4C7O B;  4I3M A;  3JYY A;  1NSG B;  1M57 C;  3U5S A;  2D4U A;  3RW0 A;  3GOR A;  3PHF 2;  1T5O A;  4JW1 A;  3S0X A;  2KQ9 A;  2DYR C;  2P6V A;  4W8K A;  5L0D A;  2FAP B;  4XPX A;  3MBG A;  4XPY A;  4U5B E;  1ORJ A;  2GAQ A;  2OEX A;  2R02 A;  3JRM O;  4GEH A;  2Y3H A;  2Q7R A;  3MYF A;  1VYI A;  1HW1 A;  3FVY A;  3JYH A;  4G7Z F;  1JOG A;  2PP4 A;  3FMS A;  1RKC A;  3IQ5 A;  3DAG A;  3T6J A;  3SXM A;  3GWL A;  2VCA A;  2GA0 A;  4MQ9 F;  4OIO F;  4JCH A;  4OD5 A;  2KYH A;  2CGE A;  4XPW A;  5KYY A;  5KYN A;  1M2V A;  1NFO A;  3H2V A;  4JUR I;  1HMD A;  2WL8 A;  4NTF A;  2B0J A;  2XXA B;  4BJT A;  4LDQ A;  5L0C A;  4U5E E;  1G4W R;  3QW0 A;  4BPM A;  2IYL D;  3GEH A;  5F5F A;  3JSZ A;  3LNR A;  4JVS A;  5AGF A;  1LM3 B;  3ZQY A;  3K1I C;  4YT2 A;  4OIP F;  1T9K A;  1TWC A;  2R7O A;  4IWB A;  1F1M A;  1YA7 O;  3L8I A;  3AG4 C;  3PCV A;  4I44 A;  3U2L A;  4DRH B;  2ZXW C;  2EIL C;  4ZLC A;  5JLI A;  3T6B A;  3HKK A;  2YEV A;  3LJB A;  3V5Z A;  2J9U A;  2R05 A;  2EPM X;  3IPM O;  4ULW A;  4NCQ A;  2YHS A;  1VMA A;  5JSL A;  1QPU A;  2Q3T A;  1CGO A;  3DKA A;  3AQB A;  3EJN A;  3FOO A;  4CS8 A;  2J0W A;  2YL1 A;  1UG7 A;  4LLC A;  1LE2 A;  3Q6M A;  5EK0 A;  2UUI A;  3TOL A;  2A68 F;  1SR2 A;  1VLS A;  3W8I A;  3EHM A;  1ZU5 A;  2XLV A;  2YLI A;  5KYU B;  4EWC A;  4DRI B;  2OEV A;  1VTM P;  1LIH A;  3KYJ A;  3NMI A;  2FFH A;  4U5D E;  1WAS A;  2P7V A;  4JIO A;  4DOZ A;  3UMH A;  1BZ4 A;  3BEH A;  1RKE B;  4BEM J;  4YK5 A;  4JCZ A;  3N24 A;  2RD9 A;  3M15 A;  3TD7 A;  3ABL C;  1D0X A;  5F28 E;  3AG3 C;  5A6B D;  1Q0M A;  4MVU A;  2OJQ A;  1NFN A;  3NKE A;  2I8B A;  1QQ3 A;  4EUK B;  2M64 A;  4C7O A;  3B29 A;  3L8J A;  3WG7 C;  2LD6 A;  4CBE A;  2XRH A;  3Q7L A;  4XTK A;  3S90 A;  1C17 M;  4PFP A;  2L81 A;  4R32 A;  1BR2 A;  5K0I A;  2DGJ A;  5L0J A;  1LS1 A;  2R7R A;  1JMW A;  4PJM A;  5T1D B;  5T3W A;  1IW7 F;  3VF0 A;  4O79 A;  3KYI A;  3S27 A;  2Y69 C;  3ZVR A;  4L6R A;  4MVM A;  2YLG A;  3QW1 A;  4DVY P;  2NSF A;  1HE1 A;  4YT4 A;  4YL3 A;  4CDA A;  1YDI A;  2R25 A;  1SYQ A;  4HE8 D;  2L6G A;  4U5H A;  3IHU A;  3M79 A;  1E86 A;  2XXA A;  1D1C A;  3I5Q A;  3QTH A;  4J7T A;  2ZD9 A;  1A7E A;  1CGN A;  3ASO C;  4XQ1 A;  4YL1 A;  3LAY A;  5D91 A;  3TJ6 A;  2AP3 A;  3K33 A;  4D4X A;  5L0F A;  3UGP A;  3LEO A;  2XS1 A;  4BJ6 A;  3DI5 A;  3R2P A;  1WN0 A;  2WZL A;  4I1M A;  4FAP B;  5JVE A;  1FAP B;  1T6U A;  2A0U A;  2MWQ A;  3WOD F;  3U3F A;  1TQG A;  3JRT A;  2Y39 A;  2UUH A;  3UGO A;  4MND A;  4PR9 A;  4N6H A;  3RF3 A;  4XLP F;  1DOV A;  4MTG A;  1NU7 D;  1XZP A;  4RBN A;  3G50 A;  1OCC C;  4M63 A;  5BQI A;  3EH1 A;  1WGW A;  1M56 C;  1MNE A;  2H7V C;  2J7P A;  1PV3 A;  2A1D D;  2YWA A;  2JPU A;  3U8V A;  1E84 A;  1O3U A;  1T6Q A;  2KW3 C;  2OJE D;  1K05 A;  1QKR A;  2J9W A;  2YRF A;  1VLT A;  2VCC A;  4XLN F;  4Z9H A;  4DRJ B;  2Q00 A;  4LDK A;  5KYU A;  3M1C B;  4U9D A;  2DI3 A;  3RKO F;  2LSE A;  5JS5 A;  2R7X A;  3C8Z A;  2L6H A;  2KSF A;  3GM1 A;  3IQ6 A;  5DS5 A;  1QZX A;  4O6N A;  4BJ5 C;  3HTK C;  2R7T A;  2PF4 E;  1H9G A;  1MND A;  2GDC A;  1OCZ C;  1ZHX A;  4EKW A;  2J9V A;  3LES A;  1M2O A;  5E33 A;  3O39 A;  2NUP B;  3IEE A;  2L6F A;  4LER A;  4IAO A;  3NYJ A;  2PX3 A;  3DM5 A;  1AVO B;  1BR1 A;  2JX0 A;  5CIV A;  4N06 A;  3E70 C;  5JRA A;  1FR0 A;  5COM A;  3HLZ A;  1YLM A;  3SP1 A;  2HSB A;  4AE4 B;  1BDJ B;  1APC A;  3HNL A;  2X51 A;  1D1A A;  2XSE A;  2XS8 A;  3NKD A;  1SMY F;  1G8X A;  4O6Y A;  1ZHZ A;  3O10 A;  1B68 A;  1YZA A;  1AEP A;  1JPJ A;  2J46 A;  2J8W A;  1LPE A;  2I15 A;  3B9Q A;  2HSQ A;  3N2Z B;  1K04 A;  5B3S C;  4O7G A;  4OD4 A;  2CNW D;  3TJ5 A;  4KNW A;  4BJ1 A;  3C8G D;  2KJG A;  2R7Q A;  1Q0K A;  3U9M A;  3V5Y A;  1D0Y A;  4NTB A;  4PK4 A;  4CJO A;  4XEK A;  3NG1 A;  3I5P A;  4WGY A;  4IJJ A;  3CSK A;  2HMQ A;  3FHD A;  3RQG A;  4Q4Z F;  4YN0 B;  2Q9B A;  2XLH A;  3FAP B;  4JKV A;  2NG1 A;  2WVO A;  1OCO C;  2IM8 A;  1HY5 A;  2LK4 A;  3AOU A;  5FZT A;  4Q5S F;  2QLA A;  3G4X A;  2XLW A;  2VB6 A;  4DBR A;  4E0I A;  2E87 A;  4F4B A;  5A6A A;  2LIG A;  3X2Q C;  1Q0F A;  4E18 A;  1MMN A;  2KC3 A;  3L1M A;  1G5Z A;  4J30 B;  4CJG A;  4JTC B;  2CYD A;  3AG2 C;  3JCU Q;  4MW8 A;  4PAC A;  4WJ0 A;  2YVK A;  1WAT A;  4A4A A;  1CGM E;  2TMV P;  1Q0G A;  3EZH A;  2ZXP A;  4RD9 A;  1RMV A;  3JT1 A;  3MFN A;  2VH3 A;  4K0D A;  4QI2 A;  4QDL A;  5E3A A;  4UDV A;  1RJ9 A;  2KGO A;  4MTF A;  5KYW B;  4JEB A;  4HFF B;  2QTV A;  1OXK A;  4G0H A;  3V7O A;  2D5R B;  2W45 A;  3Q6N A;  4IB4 A;  3KPH A;  4EBB A;  3K66 A;  3TOM A;  2W9Y A;  2YZS A;  4ONS A;  4WAB A;  4BG0 A;  4CDV A;  4ER9 A;  4CS9 C;  4JEA A;  4OIR F;  4G7O F;  1Z5Z A;  2L7A A;  2XM0 A;  1XZQ A;  2L9J A;  2NUP A;  3G4Z A;  1L3P A;  4JJG A;  2PX0 A;  5FCL A;  2AU5 A;  2F22 A;  3ZIB A;  3SXK A;  2VAS A;  1R4T A;  3OWT A;  4C3E A;  2H8A A;  5KYX B;  1I5N A;  5DS6 A;  4AE4 A;  4IRU A;  4E0H A;  4H54 A;  2Q9A A;  3SNH A;  2HS5 A;  3GM3 A;  1FTS A;  4LDR A;  4CIP A;  2EPN A;  3EPV A;  1H7I A;  4G7H F;  2BE5 F;  1ZHT A;  1YAU O;  2WVQ A;  3C18 A;  3B0U X;  1LS4 A;  1ORS C;  1TWH A;  2LFD A;  3ZQV A;  2IXO A;  4KNV A;  3VAY A;  1C03 A;  3W2W A;  2EIM C;  1OKK A;  1A7D A;  2FGY A;  3W4Y A;  1RXQ A;  2EIJ C;  1EKY A;  3Q7G A;  3EH2 A;  1NG1 A;  2PFD A;  5D92 A;  4ANJ A;  4I1O B;  2A69 F;  4Z9I A;  1V54 C;  1EA8 A;  2BL2 A;  3DM9 B;  2JD3 A;  3OA1 A;  3GWN A;  1QLE C;  3EGX B;  4FES A;  4JZA A;  4WGZ A;  4CIH A;  1Z63 A;  2HZ8 A;  3JZ0 A;  2W4M A;  2QE9 A;  2EIK C;  2XLE A;  3B0V C;  3U0C A;  1ZYR F;  2O9X A;  2Z15 A;  1PD0 A;  2OOC A;  3DE8 A;  3HJC A;  4JRZ A;  5F5H A;  3ZTZ A;  1YZC A;  5A69 A;  1K40 A;  4CSA A;  5COG A;  5EGY A;  1GS9 A;  3EGD B;  2ZXR A;  1NZE A;  5A6J A;  2OCC C;  2XLO A;  3DE9 A;  1CPR A;  1FMV A;  2YL3 A;  3W8H A;  1HW2 A;  1M6T A;  2BC5 A;  2Q9C A;  2Q4F A;  3FDQ A;  3FAJ A;  1ZW2 A;  1YVI A;  3NDB B;  3C8G B;  4JE9 A;  3NMK A;  3WHN A;  3VYW A;  2HJM A;  4Q7C A;  4PJJ A;  4MW3 A;  4XWJ A;  1FFH A;  1LE4 A;  1WWP A;  2WZG A;  2Y3D A;  1KU2 A;  1NU9 C;  2A6H F;  2XLM A;  2YL7 A;  3LS0 A;  3MYI A;  4P6I C;  2J0X A;  3RVY A;  2QY9 A;  5KYW A;  4YJW A;  2A6E F;  3KMI A;  1VK5 A;  2HJ3 A;  3PMR A;  1OW6 A;  3SYN A;  3LLK A;  2EPK X;  2R7V A;  1N1C A;  3ZTM A;  2AWC A;  3U9J A;  2W4B A;  4AL0 A;  2HMZ A;  3FXH A;  1H9T A;  1FMW A;  3SZR A;  2GWW A;  4NC3 A;  4CS8 C;  4AX2 A;  5DS4 A;  1LI7 A;  2H7B A;  4YWQ A;  1SZI A;  3KL4 A;  1A0B A;  1MMD A;  1V55 C;  5KYX A;  1R5I D;  3HNI A;  4JTD B;  3RQE A;  4JTA B;  2J7P D;  5B1B C;  2WVN A;  3US6 A;  3S84 A;  2Y3G A;  1A7V A;  1RKE A;  1YA9 A;  2OQM A;  3ITF A;  5AC5 A;  1J8Y F;  2NUT B;  5DLJ A;  2G3V A;  3GOD A;  3PDM P;  3JTL O;  1JRA A;  3IQC A;  256B A;  3K1I A;  3DJN B;  4ZLD A;  1DOW A;  3ATP A;  2H7O A;  2AVK A;  1JPN A;  4C3D A;  2AWY A;  3GEI A;  3JSE O;  1U89 A;  2ZXO A;  3VM6 A;  3TUL A;  1RCP A;  2DYS C;  4MS2 A;  1OR3 A;  2XL8 A;  3EFO B;  3AQC A;  3R7C A;  3U2M A;  1TWA A;  3QMK A;  3CZ6 A;  4EIY A;  2ASR A;  4IGG A;  4MVR A;  4G78 A;  1MQV A;  2XM4 A;  1W2W A;  3CEX A;  3H2U A;  3SEO A;  4JJF A;  4Z9J A;  2NSG A;  2P1A A;  3EGD A;  2OU6 A;  2HFI A;  3DD7 A;  1Y6D A;  4PJN A;  5B3I A;  5BQG A;  3I4U A;  5CI8 A;  2HKV A;  1ST6 A;  3NMJ A;  1T01 A;  1FNT c;  2IXN A;  3EHN A;  4E7Z A;  2EIN C;  4U5F E;  3A11 A;  2XL6 A;  3M4B A;  2QNL A;  1HE9 A;  2LFF A;  2V26 A;  3MLG A;  1ORY A;  4N6C A;  3ABM C;  3W2V A;  5L0H A;  3M4C A;  2IXM A;  3DZA A;  3LUT B;  4H4K C;  1H6G A;  2LCH A;  3O6X A;  1TKN A;  2IXP A;  1ZHY A;  4KBL A;  1BBH A;  4IAR A;  1NLX A;  1TFK B;  4YT5 A;  3C7J A;  5AC4 A;  2R03 A;  4EBJ A;  3WAQ A;  4DVZ A;  2VC9 A;  3CAX A;  3ZG1 A;  1Z6A A;  4J7Y A;  1U6H A;  5IY5 C;  1KTM A;  1VOM A;  2P61 A;  4DJ9 A;  3B0P A;  2ZPA A;  2RSE B;  3NYM A;  1QSP A;  5JT4 A;  4MVO A;  1E85 A;  3NRH A;  1S7Z A;  3EG9 B;  3RYL A;  3VRC A;  3O55 A;  2EPL X;  3A9C A;  1UFB A;  1XWJ A;  2NUT A;  5BUO A;  2KNH A;  5E3C A;  4LLE A;  5JUA A;  3DXJ F;  1O5H A;  1J8M F;  1YAR O;  4GYT A;  1E83 A;  2P0N A;  1PD1 A;  1LI5 A;  4YT8 A;  5L3Q A;  4OIQ F;  3RH3 A;  3EZI A;  1OR2 A;  4AK9 A;  1ZVZ A;  1U0B B;  2EPO A;  2IBF A;  4K7B A;  5GPG B;  2ETS A;  5T3T A;  4CX9 A;  3K6B A;  2LQG A;  4NQF A;  3J06 A;  3EFO A;  4N4W A;  2R7S A;  1YYJ A;  2GFH A;  2Y3B A;  4O6M A;  2DB4 A;  2MHR A;  3HNJ A;  5L0I A;  4D4N A;  4FX5 A;  4MVZ A;  1FFT C;  1EQ1 A;  1YYX A;  1MMG A;  1ZW3 A;  3U8P A;  2G3K A;  1TR2 A;  1ZU4 A;  2YL0 A;  4QI0 A;  1C02 A;  2HV7 A;  4OIN F;  5DQT A;  2PBE A;  4B6I A;  3V5X A;  3UMI A;  3GM2 A;  2YQY A;  3LLI A;  5A6B A;  5EHH A;  2CCY A;  4C3B A;  1OKK D;  4XEV A;  4BJ5 A; 
#chains in the Genus database with same CATH homology
 2J45 A;  3ZC4 A;  4E7S A;  2XL4 A;  1LKX A;  4HEA J;  1BR4 A;  1Z23 A;  2R7U A;  3MX3 A;  2M4E A;  2V3C C;  3UNG C;  5HSW A;  2R7W A;  4CS7 A;  3ASN C;  3AG1 C;  4LAC B;  3RIP A;  4DBQ A;  3ECS A;  3EG9 A;  5E2Q A;  3K1H A;  4PFO A;  4U5G A;  4X0R A;  3S29 A;  3DJU B;  3ABK C;  2CW0 F;  3RFY A;  5CI9 A;  1VYK A;  3QZC A;  3X1O A;  3L34 A;  1OCR C;  2C03 A;  1LVK A;  3LEV A;  4KI2 A;  3F47 A;  1O87 A;  5KYY B;  1M2V B;  2MYS A;  4RDA A;  3ZSU A;  1SF8 A;  1ZHW A;  2WZF A;  3E9V A;  4A2N B;  3DMD A;  1Z3I X;  2IOQ A;  4PJL A;  4BEJ A;  1PCX A;  3L0I A;  3UR3 C;  1RJ9 B;  2G62 A;  3EGX A;  4NY3 A;  5DQZ A;  2CDQ A;  1TWG A;  4CS9 A;  3H65 A;  5B1A C;  3K7D A;  1D0Z A;  2OG2 A;  3N0T A;  4CSA C;  5DVW A;  2WB7 A;  3NYL A;  4HFK B;  3F46 A;  3T4R A;  3KH2 A;  2C04 A;  2CNW A;  3LS1 A;  3POV A;  4BJ6 C;  4U5C E;  3EQL F;  4J32 B;  3DAF A;  3OEO A;  1D1B A;  1IZM A;  3UMK A;  3KKB A;  2HV6 A;  1MMA A;  4FWV A;  3S28 A;  3GAN A;  4KC9 A;  3CQZ A;  4C7O B;  4I3M A;  1M57 C;  3PHF 2;  4JW1 A;  3S0X A;  2KQ9 A;  2DYR C;  2P6V A;  4W8K A;  4U5B E;  4GEH A;  2Y3H A;  1VYI A;  4G7Z F;  3FVY A;  3JYH A;  2PP4 A;  3T6J A;  4OIO F;  3DAG A;  4MQ9 F;  4JCH A;  4OD5 A;  2CGE A;  5KYY A;  5KYN A;  1M2V A;  4JUR I;  2WL8 A;  2XXA B;  2B0J A;  4BJT A;  4U5E E;  2IYL D;  5F5F A;  3JSZ A;  3LNR A;  4JVS A;  3K1I C;  4YT2 A;  4OIP F;  2R7O A;  1TWC A;  4IWB A;  3AG4 C;  4I44 A;  2ZXW C;  2EIL C;  4ZLC A;  3T6B A;  2YEV A;  3LJB A;  2J9U A;  4ULW A;  2YHS A;  1VMA A;  2Q3T A;  3EJN A;  4CS8 A;  3AQB A;  2J0W A;  4LLC A;  3Q6M A;  2A68 F;  3W8I A;  3EHM A;  1ZU5 A;  5KYU B;  4EWC A;  4U5D E;  2FFH A;  2P7V A;  4DOZ A;  3UMH A;  3N24 A;  3TD7 A;  3ABL C;  1D0X A;  3AG3 C;  3NKE A;  2I8B A;  4C7O A;  3WG7 C;  4CBE A;  2XRH A;  3Q7L A;  4XTK A;  4PFP A;  2L81 A;  1BR2 A;  2R7R A;  2DGJ A;  1LS1 A;  4PJM A;  5T1D B;  5T3W A;  1IW7 F;  4O79 A;  3S27 A;  2Y69 C;  3ZVR A;  4DVY P;  5L3V A;  4YT4 A;  4HE8 D;  4U5H A;  2XXA A;  1D1C A;  3I5Q A;  5D91 A;  3ASO C;  3LAY A;  3UGP A;  3K33 A;  4BJ6 A;  2WZL A;  4I1M A;  2MWQ A;  3WOD F;  3JRT A;  2Y39 A;  3UGO A;  4MND A;  4XLP F;  1NU7 D;  4RBN A;  1OCC C;  4M63 A;  3EH1 A;  1WGW A;  1M56 C;  1MNE A;  2H7V C;  2J7P A;  2A1D D;  2KW3 C;  4XLN F;  2J9W A;  5KYU A;  3M1C B;  3RKO F;  2LSE A;  2R7X A;  5DS5 A;  1QZX A;  4O6N A;  4BJ5 C;  3HTK C;  2R7T A;  2PF4 E;  1MND A;  1OCZ C;  1ZHX A;  2J9V A;  3LES A;  1M2O A;  5E33 A;  3O39 A;  2NUP B;  3IEE A;  4LER A;  4IAO A;  3NYJ A;  2PX3 A;  3DM5 A;  1BR1 A;  4N06 A;  3E70 C;  3HLZ A;  3SP1 A;  4AE4 B;  3NKD A;  2X51 A;  1D1A A;  2XSE A;  1SMY F;  1G8X A;  4O6Y A;  1ZHZ A;  1JPJ A;  2J46 A;  3B9Q A;  3N2Z B;  5B3S C;  4O7G A;  4OD4 A;  2CNW D;  4KNW A;  4BJ1 A;  2KJG A;  2R7Q A;  1D0Y A;  4PK4 A;  3NG1 A;  3I5P A;  4IJJ A;  3CSK A;  3FHD A;  4Q4Z F;  4YN0 B;  2Q9B A;  2NG1 A;  2WVO A;  1OCO C;  4Q5S F;  4DBR A;  2VB6 A;  4F4B A;  2E87 A;  3X2Q C;  1MMN A;  4J30 B;  3JCU Q;  3AG2 C;  4WJ0 A;  3EZH A;  2ZXP A;  4RD9 A;  3JT1 A;  2VH3 A;  4K0D A;  4QI2 A;  4QDL A;  5E3A A;  1RJ9 A;  2KGO A;  5KYW B;  4HFF B;  2QTV A;  4G0H A;  3V7O A;  2D5R B;  2W45 A;  3Q6N A;  4EBB A;  3K66 A;  2W9Y A;  2YZS A;  4BG0 A;  4CS9 C;  4OIR F;  4G7O F;  1Z5Z A;  2L9J A;  2NUP A;  4JJG A;  2PX0 A;  5FCL A;  3ZIB A;  4C3E A;  2VAS A;  3OWT A;  5KYX B;  5DS6 A;  4AE4 A;  4IRU A;  2Q9A A;  3SNH A;  1FTS A;  3EPV A;  4G7H F;  2BE5 F;  1ZHT A;  2WVQ A;  3B0U X;  1TWH A;  2IXO A;  4KNV A;  3VAY A;  3W2W A;  2EIM C;  1OKK A;  2FGY A;  2EIJ C;  3Q7G A;  3EH2 A;  1NG1 A;  2PFD A;  5D92 A;  4ANJ A;  4I1O B;  2A69 F;  1V54 C;  3DM9 B;  2JD3 A;  3OA1 A;  1QLE C;  3EGX B;  4FES A;  4JZA A;  4CIH A;  1Z63 A;  2W4M A;  2EIK C;  3B0V C;  1ZYR F;  2O9X A;  2Z15 A;  1PD0 A;  5F5H A;  3HJC A;  4CSA A;  5EGY A;  3EGD B;  2ZXR A;  1NZE A;  2OCC C;  1FMV A;  3W8H A;  2Q9C A;  3FDQ A;  3FAJ A;  3NDB B;  3VYW A;  4PJJ A;  4Q7C A;  4XWJ A;  2Y3D A;  1FFH A;  2WZG A;  1KU2 A;  3LS0 A;  1NU9 C;  2A6H F;  5KYW A;  4P6I C;  2J0X A;  2QY9 A;  4YJW A;  2A6E F;  3KMI A;  1VK5 A;  3PMR A;  3SYN A;  3LLK A;  2R7V A;  1N1C A;  2W4B A;  1FMW A;  3SZR A;  4CS8 C;  4AX2 A;  5DS4 A;  2H7B A;  4YWQ A;  1SZI A;  3KL4 A;  1MMD A;  1V55 C;  5KYX A;  2J7P D;  5B1B C;  2WVN A;  2Y3G A;  3ITF A;  1J8Y F;  2NUT B;  5DLJ A;  2G3V A;  3GOD A;  3DJN B;  4ZLD A;  2H7O A;  4C3D A;  1JPN A;  2ZXO A;  2DYS C;  3EFO B;  3AQC A;  1TWA A;  3QMK A;  3CZ6 A;  1W2W A;  3SEO A;  4JJF A;  3EGD A;  3DD7 A;  4PJN A;  3I4U A;  5CI8 A;  1ST6 A;  2IXN A;  3EHN A;  4E7Z A;  2EIN C;  4U5F E;  2V26 A;  3MLG A;  3ABM C;  3W2V A;  2IXM A;  3DZA A;  4H4K C;  3O6X A;  1TKN A;  2IXP A;  1ZHY A;  4KBL A;  4YT5 A;  4DVZ A;  3ZG1 A;  1Z6A A;  5IY5 C;  1VOM A;  3B0P A;  2ZPA A;  3NYM A;  3NRH A;  1S7Z A;  3EG9 B;  3RYL A;  5BUO A;  2NUT A;  2KNH A;  5E3C A;  4LLE A;  3DXJ F;  1O5H A;  1J8M F;  4GYT A;  1PD1 A;  4YT8 A;  5L3Q A;  4OIQ F;  3RH3 A;  3EZI A;  4AK9 A;  4K7B A;  5T3T A;  3K6B A;  3EFO A;  2R7S A;  2GFH A;  2Y3B A;  4O6M A;  4FX5 A;  1FFT C;  1MMG A;  2G3K A;  1TR2 A;  1ZU4 A;  4QI0 A;  2HV7 A;  4OIN F;  5DQT A;  4B6I A;  3UMI A;  3LLI A;  5EHH A;  4C3B A;  1OKK D;  4BJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...