1GS9A

Apolipoprotein e4, 22k domain
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
144
structure length
144
Chain Sequence
SGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the 22K Domain of Human Apolipoprotein E4
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords APOLIPOPROTEIN E
total genus 65
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2002-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1gs9A00
1BZ4A 1GS9A 1LPEA 1OR3A 1YA9A 3S84A 1B68A 1EA8A 2KC3A 1AEPA 1NFOA 1LE4A 1NFNA 1EQ1A 3R2PA 1H7IA 1OR2A 1LE2A 1LS4A
chains in the Genus database with same CATH superfamily
4CBEA 3HJCA 3WHNA 3BRJA 4DJ9A 1MMAA 2J8WA 3V7OA 4Z9JA 3FHDA 3LLKA 4AE4B 3PDMP 4GQHA 1T5OA 1V4AA 1S7ZA 1MQVA 2JD3A 1M57C 3U8PA 3MFNA 2R7RA 1MNEA 2OEVA 3OA1A 5BQGA 3RH3A 5A69A 1ZU5A 2Q7RA 2J7PD 3HTKC 1IZMA 2UUIA 4EWCA 1Q0MA 2PNOA 1M2OA 3W8HA 2UUHA 3SXKA 4PFPA 3T6BA 3GANA 2ETSA 2M4EA 1QZXA 3U3BA 4FX5A 3FAPB 4YT8A 1E85A 3FVYA 5L0GA 5B3IA 1A7VA 2G3KA 5COMA 2A0UA 2Q9AA 3MYFA 5E33A 5L0IA 4G7HF 5A6KA 2R7OA 3W2WA 1NFNA 2EINC 2ZXWC 2EIJC 1YJGA 3M4CA 5L0JA 1Y6DA 3LJBA 3IQCA 2ASRA 2WB7A 4YT2A 2R7XA 1BDJB 1EA8A 1JOGA 1MNDA 2A6EF 3SXZA 3UMKA 3B9QA 3C62A 4MS2A 4EUKB 1T9KA 2HFIA 2PX0A 3CSKA 3H2VA 3RKOF 4CS8A 3C8GA 4D4XA 1TWGA 3DJUB 3DKAA 3EG9B 3O10A 3U9JA 3X2QC 3ECSA 1YZCA 4J7YA 2KQ9A 4MVZA 4IB4A 3LNRA 4CX9A 2NSGA 3GWNA 1BR1A 2F22A 1KNYA 2HSBA 3TJ6A 5KYWB 4DVYP 3MLGA 4N4WA 1I5NA 1VLSA 1G8XA 4ONSA 2EPMX 4ULVA 3T4RA 2KC3A 4U5EE 4W8KA 3NKEA 1TWAA 5JP7A 3TULA 4YJWA 2X51A 3AOUA 4P6IC 3HNKA 1NZEA 2L6HA 3A9CA 4WABA 2H7BA 1MMDA 256BA 1G5ZA 4CS8C 1U0BB 4JC7A 1M2VB 3S27A 4PJMA 5D91A 1WATA 3E9VA 1E83A 3NMIA 4CS9A 4IWBA 1BBHA 1R4TA 2YQYA 4U5FE 3U3FA 1CGME 3QZCA 1E86A 2VC9A 5JRAA 3JSZA 1ZVZA 2PX3A 1ZU4A 1C03A 4IRUA 2XS1A 3A11A 4HFFB 1WN0A 4PR9A 3U2MA 5T3WA 4OD4A 1I4ZA 3EZHA 1OXKA 4YK5A 4Q7CA 4XPXA 1GS9A 1JAFA 1O5HA 2HMQA 3ZDLA 3IPMO 2R7WA 1ZHZA 1J8YF 1I4YA 1G4WR 1QLEC 1QSPA 1JR8A 2BC5A 2PP4A 4N6CA 2W45A 2J7PA 5T3TA 2J9VA 3LNMB 2CNWD 2XL8A 1JPNA 2MHRA 1YZAA 4AL0A 4C3BA 4JW1A 4H54A 4CS7A 1T6UA 1QVXA 5KYUA 3RVZA 3IQ6A 2GWWA 3QTHA 1GM5A 4DRJB 2A1DD 1VOMA 1T6QA 3EFOA 2P0NA 4NTBA 1HW2A 3K33A 3F46A 3EZIA 3HNLA 3UGOA 2JPUA 3O55A 5KYYA 4JTAB 3DWWA 5FZTA 1SYQA 3NDBB 4LERA 1TFOB 3HKKA 2ZPAA 2R7SA 1ZHWA 5F28E 3NRHA 2XRHA 2LSEA 2OOCA 4OIQF 3GODA 5CI8A 4XEFA 4OIRF 1IW7F 1J8MF 4P9FA 4QDLA 2VH3A 3V5ZA 2EPLX 2QLAA 3KH2A 3S84A 3C8ZA 3MX3A 3R7CA 3SYNA 2AVKA 4BJ6C 1S05A 3ASOC 1XWJA 2HS5A 3EGDA 3K66A 4JTDB 1CGNA 1N1CA 2XLMA 3EH1A 5AC5A 4YL0A 1LPEA 1ZHXA 1ORYA 1Z63A 4CDAA 4M63A 2NSFA 2VCAA 3H65A 4IAOA 3SXMA 2Q4FA 3K1IA 3PMRA 4KI2A 1FAPB 3JTLO 4YN0B 2J45A 1YA7O 2NUPB 3AGTA 2XLVA 3LESA 5A6JA 1YAUO 2IXPA 3K7DA 1EI7A 1OR3A 4NQFA 2J0WA 1OW6A 4LACB 3WAQA 4ZLCA 4XTKA 1C02A 2RSEB 2FGYA 3U5SA 3RQFA 2OEXA 2XM0A 3EGXA 3B29A 3JZ0A 2P6VA 3JYHA 3KPHA 3M4BA 1Z6AA 2BE5F 1TFKB 3UNGC 1HE9A 5E2QA 4JIOA 4O6MA 4E7ZA 4JEBA 1Q0KA 4XQ1A 2ZXPA 4MVSA 3VM6A 3ABMC 5JT4A 2DB4A 3G50A 4MTFA 5L0FA 1AEPA 2VCBA 4JVSA 4DBQA 1O87A 1Z23A 5JUAA 2GAQA 2RD9A 3J06A 3MBGA 2L9JA 3QMKA 3BEHA 4EBKA 1LKXA 1U89A 1VLTA 3N24A 4A2NB 1AVOB 4E0IA 5A6AA 1OKKD 1RJ9A 3JRTA 4CIHA 2L81A 2QE9A 4JJFA 4I44A 2PBEA 2IXMA 4NCQA 3GORA 4PJLA 1U6HA 4O7GA 2OU6A 5AC4A 2I15A 1OCZC 5T1DB 4BJ5A 4XPWA 4OIPF 1LM3B 1LS1A 4XLPF 3WG7C 4KBLA 5JSLA 4XPYA 4CSAC 2NUTA 4BJ1A 2KW3C 2WL8A 5BUOA 2J9UA 1K40A 3DAGA 1D1BA 2LFDA 1YARO 4LDRA 5FCLA 3SNHA 3DE8A 4W8PA 4ER9A 2A68F 3SP1A 4AE4A 2H7VC 2W4BA 2WVNA 2QUPA 4OD5A 3T9OA 1D1CA 2YLDA 2ZXOA 1GQAA 1RXQA 2LP4A 3ATPA 3KKBA 1SF8A 2R02A 4MVOA 4BEJA 1VMAA 3UMIA 3W2VA 4DVZA 3DAFA 3JCUQ 2I8BA 3RIPA 4E18A 4AL1A 1CGOA 2NG1A 2X0CA 4CJOA 3QW0A 3RF3A 3L1MA 2NUTB 1VTMP 4CSAA 4WGYA 3VAYA 2R7TA 3Q6NA 1O3UA 2GDCA 2OQMA 3QW1A 4BJ5C 1NG1A 2P7VA 2A0BA 2R05A 3L0IA 2LIGA 4B6IA 5K0IA 1APCA 3CQZA 1CPQA 1LVKA 3EGXB 1D0YA 2OCCC 2WVOA 2R7VA 1R5ID 2HKVA 2WVQA 1ZW2A 2YEVA 4G78A 3DE9A 1K04A 1LE4A 1MMNA 5EHHA 2WZGA 1T01A 2H8AA 2XM4A 5BQIA 2KSFA 1UFBA 1PCXA 2E87A 3O39A 4IJJA 3K1IC 1EKYA 1EQ1A 4L6RA 2V3CC 4J30B 4Q4ZF 2WZLA 4JURI 1XZQA 1ORSC 1ST6A 1YVIA 3PHF2 4ULWA 3B0UX 3NMJA 1JRAA 2Q3TA 4G7ZF 4A4AA 1OQCA 5L0CA 4HEAJ 2IXNA 4Q5SF 2HZ8A 1YDIA 5IY5C 4U9DA 3JRMO 2J0XA 2GA0A 1Z5ZA 4C3DA 2VB6A 3NYMA 5GPGB 3NYLA 2GFHA 5JS5A 1KTMA 3RW0A 2XS8A 4AK9A 2DGJA 2CNWA 3GEHA 4MTGA 1UG7A 2OG2A 4XEVA 1LE2A 3UMHA 3ZVRA 4E7SA 1FFTC 3Q7GA 5DVWA 2EILC 2ICWG 4WJ0A 5D92A 5E3AA 3ZQYA 3US6A 3HLZA 5DS5A 4CDVA 3AQCA 1YLMA 3DM5A 4K0DA 1TWCA 2YZSA 2D5RB 5L3VA 1Z3IX 1FFHA 1L3PA 2B0JA 4FWVA 4YT5A 4C7OA 4N06A 1D1AA 5DQZA 4BJTA 2OJED 2P61A 1OKKA 2EPOA 1CPRA 4JZAA 1VK5A 1ZHYA 4QI0A 5COGA 3TJ5A 4U5CE 5DS6A 5CIVA 3AG2C 4CS9C 4MW8A 1FMVA 1K05A 4CDYA 3AG4C 4G7OF 1D0ZA 1H6GA 2C04A 2YRFA 3DD7A 3S28A 1H9GA 1YA9A 4FAPB 2IYLD 2LD6A 2LFFA 2IBFA 1WOLA 4K7BA 1V74B 1DOVA 1H7IA 3EG9A 2FFHA 3ZQVA 3S0XA 2R7QA 1Q0DA 2G62A 3LLIA 1TKNA 3KL4A 3ZSUA 5DQTA 4D4NA 5KYWA 3S90A 3T6JA 4LLCA 3ITFA 3Q7LA 3B0VC 2KGOA 5L0HA 3M1CB 2QNLA 2IM8A 3ZTMA 5KYNA 2R9RB 3IHUA 2EPNA 4F4BA 3U0CA 3T6GB 3UR3C 3C18A 3PCVA 1HE1A 1OCRC 2V26A 4E0HA 2LK4A 4JCZA 4X0RA 3S29A 2KYHA 4U5DE 1NLXA 1A7EA 1G4US 2J9BA 3TK0A 2CCYA 1T6IA 3L8IA 1LIHA 1TR2A 1HY5A 4PK4A 2Y3HA 1W2WA 3QVZA 3EFOB 2QTVA 4DRHB 2Q00A 2Q9CA 4DXWA 2HUJA 2DI3A 2PF4E 4AX2A 2HSQA 3IEEA 5KYYB 2CGEA 2O9XA 3AQBA 3U8VA 1WASA 4MW3A 2HV7A 1TQGA 1FMWA 2XL6A 2OKUA 1BR4A 2W9YA 3B0PA 1M2VA 4RDAA 2L6GA 3AJMA 3U2LA 3HNJA 3R2PA 3ZTZA 2HMZA 2CYDA 1Y4CA 1BZ4A 2XSEA 1Z7Qc 1FTSA 3GWLA 3NMKA 4XEKA 1FR0A 2NPUA 3L8JA 3X1OA 2WZFA 3C8GB 2YWAA 4UDVA 3RQGA 4DOZA 5F5FA 4EBJA 3UGPA 4N6HA 3ZC4A 3ZG1A 3FDQA 1JMWA 1Q0GA 2P1AA 1M6TA 4LDKA 1A7DA 3GM2A 4JEAA 2A6HF 4LLEA 4PACA 2KK1A 5EK0A 2XLDA 2AWCA 3G4ZA 1TWHA 1SZIA 2Y69C 2LQGA 2EIMC 3I5QA 1VYKA 3KMIA 1QKRA 3QVYA 1RKEB 4MNDA 3DM9B 2MYSA 3VF0A 5A6BD 1E84A 1QQ3A 2TMVP 4OIOF 5COFA 2HJ3A 1PD1A 1QPUA 2NUPA 3N0TA 2G3VA 3EHMA 5AGFA 3RVYA 2B0HA 5JVEA 3ABKC 4MVRA 5F5HA 5DS4A 2QY9A 3AG1C 3M15A 2R03A 3VRCA 4YT4A 1F1MA 3CEXA 4HE8D 1WWPA 2BL2A 4HFKB 3H2UA 4IAQA 3O6XA 4MQ9F 4WGZA 4E17A 3WODF 2KJGA 3LEVA 2IXOA 1VYIA 2VCCA 3EHNA 3FAJA 5L3QA 1MMGA 1RKEA 3DMDA 2J9WA 3E70C 3SXYA 3SZRA 3V5XA 2XXAB 1GGQA 3GEIA 3N2ZB 1ORJA 2AU5A 4P9TA 3G4XA 2H7OA 1OCOC 3I4UA 3U9MA 1BR2A 1M56C 1OXBA 2YVKA 2J46A 3FOOA 2Y3GA 4GEHA 3DJNB 2CDQA 5B3SC 5JLIA 3NYJA 4YWQA 3EPVA 3TOMA 3RQEA 2EIKC 3C8GD 2JX0A 1YYJA 1KU2A 2L6FA 3C7JA 2FAPB 3GEEA 3DZAA 4IARA 3EJNA 4PJJA 4KC9A 1XZPA 2Y39A 4G0HA 4LDQA 3RFYA 4BEMJ 1LI5A 1H9TA 4QI2A 3VYWA 3W8IA 2ZD9A 1A41A 1SR2A 2Q9BA 1ZYRF 4PFOA 2AP3A 4RD9A 5A6BA 3MYIA 3K1HA 5KYUB 3FMSA 2PFDA 4IGGA 4I3MA 1WGWA 1VB5A 3POVA 4U5BE 3K6BA 4J7TA 3DI5A 4MVQA 2Y3DA 3TOLA 5E3CA 1PD0A 4H4KC 1L7CA 2DYSC 2YLGA 1SMYF 1NU7D 3LAYA 4MVMA 3RYLA 1B68A 4ANJA 4EIYA 5TJ5E 2CW0F 1NSGB 3V5YA 1ZW3A 1HW1A 4K1OA 3W4YA 1DOWA 1RKCA 2OJQA 3JSEO 4YL3A 4NTAA 2YL7A 3C63A 2A69F 1ZHTA 3JT1A 4O6YA 2YL1A 5L0DA 2Z15A 1AUEA 4CIPA 4JCHA 2R25A 1V55C 3NG1A 4BJ6A 1D0XA 2YKZA 3EGDB 3OWTA 3EH2A 2HJMA 4Z9IA 3ZIBA 3GM3A 4U5GA 2R7UA 4BG0A 4JE9A 2XLWA 4J32B 4OINF 1V54C 1RCPA 4U5HA 1RMVA 4DRIB 4XLNF 2DYRC 2ZXRA 2XXAA 3OEOA 1OR2A 4JTCB 3FOPA 2EPKX 3LUTB 4JJGA 4NTFA 1WTYA 4MVUA 1Q0FA 4O79A 4Z9HA 4ZLDA 1JPJA 2YL3A 3GM1A 3IQTA 1FNTc 1OCCC 1LI7A 4JKVA 1ZZPA 3LS0A 5KYXA 3B71A 2XLHA 3L34A 2YL0A 4EHPA 5HV9A 1NFOA 2C03A 3LS1A 2KNHA 2IOQA 4NC3A 4O6NA 1HMDA 4XWJA 3KYJA 3SEOA 5B1AC 1A0BA 1NBBA 3CAXA 4R32A 4C3EA 3AGUA 3M79A 4JRZA 1OW7A 4RBNA 5DLJA 2LCHA 3F47A 4DBRA 5CI9A 3LEOA 4YL1A 3ASNC 2W4MA 3DXJF 4GYTA 4BPMA 3TD7A 5EGYA 1E2XA 5B1BC 3JYYA 2YHSA 4MTOA 3Q6MA 3S9OA 4EKWA 5KYXB 5HSWA 1OW8A 3NKDA 2XL4A 2MWQA 3FXHA 4U9EA 3ABLC 2YLIA 3AG3C 4FESA 4EBBA 4I1OB 2HV6A 1PV3A 4C7OB 1RJ9B 2L7AA 3EQLF 4CJGA 1YYXA 1HMOA 2Y3BA 5BQHA 2AWYA 4PJNA 3ZWIA 1C17M 3I5PA 3IQ5A 4KNVA 2M64A 2XLEA 3KYIA 1LS4A 2D4UA 2VASA 3CZ6A 4I1MA 3TQOA 4KNWA 4NY3A 3HNIA 2XLOA 1NU9C
chains in the Genus database with same CATH topology
1BZ4A 1GS9A 1LPEA 1OR3A 1YA9A 3S84A 1B68A 1EA8A 2KC3A 1AEPA 1NFOA 1LE4A 1NFNA 1EQ1A 3R2PA 1H7IA 1OR2A 1LE2A 1LS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BZ4 A;  1GS9 A;  1LPE A;  1OR3 A;  1YA9 A;  3S84 A;  1B68 A;  1EA8 A;  2KC3 A;  1AEP A;  1NFO A;  1LE4 A;  1NFN A;  1EQ1 A;  3R2P A;  1H7I A;  1OR2 A;  1LE2 A;  1LS4 A; 
#chains in the Genus database with same CATH topology
 4CBE A;  3HJC A;  3WHN A;  3BRJ A;  4DJ9 A;  1MMA A;  2J8W A;  3V7O A;  4Z9J A;  3FHD A;  3LLK A;  4AE4 B;  3PDM P;  4GQH A;  1T5O A;  1V4A A;  1S7Z A;  1MQV A;  2JD3 A;  1M57 C;  3U8P A;  3MFN A;  2R7R A;  1MNE A;  2OEV A;  3OA1 A;  5BQG A;  3RH3 A;  5A69 A;  1ZU5 A;  2Q7R A;  2J7P D;  3HTK C;  1IZM A;  2UUI A;  4EWC A;  1Q0M A;  2PNO A;  1M2O A;  3W8H A;  2UUH A;  3SXK A;  4PFP A;  3T6B A;  3GAN A;  2ETS A;  2M4E A;  1QZX A;  3U3B A;  4FX5 A;  3FAP B;  4YT8 A;  1E85 A;  3FVY A;  5L0G A;  5B3I A;  1A7V A;  2G3K A;  5COM A;  2A0U A;  2Q9A A;  3MYF A;  5E33 A;  5L0I A;  4G7H F;  5A6K A;  2R7O A;  3W2W A;  1NFN A;  2EIN C;  2ZXW C;  2EIJ C;  1YJG A;  3M4C A;  5L0J A;  1Y6D A;  3LJB A;  3IQC A;  2ASR A;  2WB7 A;  4YT2 A;  2R7X A;  1BDJ B;  1EA8 A;  1JOG A;  1MND A;  2A6E F;  3SXZ A;  3UMK A;  3B9Q A;  3C62 A;  4MS2 A;  4EUK B;  1T9K A;  2HFI A;  2PX0 A;  3CSK A;  3H2V A;  3RKO F;  4CS8 A;  3C8G A;  4D4X A;  1TWG A;  3DJU B;  3DKA A;  3EG9 B;  3O10 A;  3U9J A;  3X2Q C;  3ECS A;  1YZC A;  4J7Y A;  2KQ9 A;  4MVZ A;  4IB4 A;  3LNR A;  4CX9 A;  2NSG A;  3GWN A;  1BR1 A;  2F22 A;  1KNY A;  2HSB A;  3TJ6 A;  5KYW B;  4DVY P;  3MLG A;  4N4W A;  1I5N A;  1VLS A;  1G8X A;  4ONS A;  2EPM X;  4ULV A;  3T4R A;  2KC3 A;  4U5E E;  4W8K A;  3NKE A;  1TWA A;  5JP7 A;  3TUL A;  4YJW A;  2X51 A;  3AOU A;  4P6I C;  3HNK A;  1NZE A;  2L6H A;  3A9C A;  4WAB A;  2H7B A;  1MMD A;  256B A;  1G5Z A;  4CS8 C;  1U0B B;  4JC7 A;  1M2V B;  3S27 A;  4PJM A;  5D91 A;  1WAT A;  3E9V A;  1E83 A;  3NMI A;  4CS9 A;  4IWB A;  1BBH A;  1R4T A;  2YQY A;  4U5F E;  3U3F A;  1CGM E;  3QZC A;  1E86 A;  2VC9 A;  5JRA A;  3JSZ A;  1ZVZ A;  2PX3 A;  1ZU4 A;  1C03 A;  4IRU A;  2XS1 A;  3A11 A;  4HFF B;  1WN0 A;  4PR9 A;  3U2M A;  5T3W A;  4OD4 A;  1I4Z A;  3EZH A;  1OXK A;  4YK5 A;  4Q7C A;  4XPX A;  1GS9 A;  1JAF A;  1O5H A;  2HMQ A;  3ZDL A;  3IPM O;  2R7W A;  1ZHZ A;  1J8Y F;  1I4Y A;  1G4W R;  1QLE C;  1QSP A;  1JR8 A;  2BC5 A;  2PP4 A;  4N6C A;  2W45 A;  2J7P A;  5T3T A;  2J9V A;  3LNM B;  2CNW D;  2XL8 A;  1JPN A;  2MHR A;  1YZA A;  4AL0 A;  4C3B A;  4JW1 A;  4H54 A;  4CS7 A;  1T6U A;  1QVX A;  5KYU A;  3RVZ A;  3IQ6 A;  2GWW A;  3QTH A;  1GM5 A;  4DRJ B;  2A1D D;  1VOM A;  1T6Q A;  3EFO A;  2P0N A;  4NTB A;  1HW2 A;  3K33 A;  3F46 A;  3EZI A;  3HNL A;  3UGO A;  2JPU A;  3O55 A;  5KYY A;  4JTA B;  3DWW A;  5FZT A;  1SYQ A;  3NDB B;  4LER A;  1TFO B;  3HKK A;  2ZPA A;  2R7S A;  1ZHW A;  5F28 E;  3NRH A;  2XRH A;  2LSE A;  2OOC A;  4OIQ F;  3GOD A;  5CI8 A;  4XEF A;  4OIR F;  1IW7 F;  1J8M F;  4P9F A;  4QDL A;  2VH3 A;  3V5Z A;  2EPL X;  2QLA A;  3KH2 A;  3S84 A;  3C8Z A;  3MX3 A;  3R7C A;  3SYN A;  2AVK A;  4BJ6 C;  1S05 A;  3ASO C;  1XWJ A;  2HS5 A;  3EGD A;  3K66 A;  4JTD B;  1CGN A;  1N1C A;  2XLM A;  3EH1 A;  5AC5 A;  4YL0 A;  1LPE A;  1ZHX A;  1ORY A;  1Z63 A;  4CDA A;  4M63 A;  2NSF A;  2VCA A;  3H65 A;  4IAO A;  3SXM A;  2Q4F A;  3K1I A;  3PMR A;  4KI2 A;  1FAP B;  3JTL O;  4YN0 B;  2J45 A;  1YA7 O;  2NUP B;  3AGT A;  2XLV A;  3LES A;  5A6J A;  1YAU O;  2IXP A;  3K7D A;  1EI7 A;  1OR3 A;  4NQF A;  2J0W A;  1OW6 A;  4LAC B;  3WAQ A;  4ZLC A;  4XTK A;  1C02 A;  2RSE B;  2FGY A;  3U5S A;  3RQF A;  2OEX A;  2XM0 A;  3EGX A;  3B29 A;  3JZ0 A;  2P6V A;  3JYH A;  3KPH A;  3M4B A;  1Z6A A;  2BE5 F;  1TFK B;  3UNG C;  1HE9 A;  5E2Q A;  4JIO A;  4O6M A;  4E7Z A;  4JEB A;  1Q0K A;  4XQ1 A;  2ZXP A;  4MVS A;  3VM6 A;  3ABM C;  5JT4 A;  2DB4 A;  3G50 A;  4MTF A;  5L0F A;  1AEP A;  2VCB A;  4JVS A;  4DBQ A;  1O87 A;  1Z23 A;  5JUA A;  2GAQ A;  2RD9 A;  3J06 A;  3MBG A;  2L9J A;  3QMK A;  3BEH A;  4EBK A;  1LKX A;  1U89 A;  1VLT A;  3N24 A;  4A2N B;  1AVO B;  4E0I A;  5A6A A;  1OKK D;  1RJ9 A;  3JRT A;  4CIH A;  2L81 A;  2QE9 A;  4JJF A;  4I44 A;  2PBE A;  2IXM A;  4NCQ A;  3GOR A;  4PJL A;  1U6H A;  4O7G A;  2OU6 A;  5AC4 A;  2I15 A;  1OCZ C;  5T1D B;  4BJ5 A;  4XPW A;  4OIP F;  1LM3 B;  1LS1 A;  4XLP F;  3WG7 C;  4KBL A;  5JSL A;  4XPY A;  4CSA C;  2NUT A;  4BJ1 A;  2KW3 C;  2WL8 A;  5BUO A;  2J9U A;  1K40 A;  3DAG A;  1D1B A;  2LFD A;  1YAR O;  4LDR A;  5FCL A;  3SNH A;  3DE8 A;  4W8P A;  4ER9 A;  2A68 F;  3SP1 A;  4AE4 A;  2H7V C;  2W4B A;  2WVN A;  2QUP A;  4OD5 A;  3T9O A;  1D1C A;  2YLD A;  2ZXO A;  1GQA A;  1RXQ A;  2LP4 A;  3ATP A;  3KKB A;  1SF8 A;  2R02 A;  4MVO A;  4BEJ A;  1VMA A;  3UMI A;  3W2V A;  4DVZ A;  3DAF A;  3JCU Q;  2I8B A;  3RIP A;  4E18 A;  4AL1 A;  1CGO A;  2NG1 A;  2X0C A;  4CJO A;  3QW0 A;  3RF3 A;  3L1M A;  2NUT B;  1VTM P;  4CSA A;  4WGY A;  3VAY A;  2R7T A;  3Q6N A;  1O3U A;  2GDC A;  2OQM A;  3QW1 A;  4BJ5 C;  1NG1 A;  2P7V A;  2A0B A;  2R05 A;  3L0I A;  2LIG A;  4B6I A;  5K0I A;  1APC A;  3CQZ A;  1CPQ A;  1LVK A;  3EGX B;  1D0Y A;  2OCC C;  2WVO A;  2R7V A;  1R5I D;  2HKV A;  2WVQ A;  1ZW2 A;  2YEV A;  4G78 A;  3DE9 A;  1K04 A;  1LE4 A;  1MMN A;  5EHH A;  2WZG A;  1T01 A;  2H8A A;  2XM4 A;  5BQI A;  2KSF A;  1UFB A;  1PCX A;  2E87 A;  3O39 A;  4IJJ A;  3K1I C;  1EKY A;  1EQ1 A;  4L6R A;  2V3C C;  4J30 B;  4Q4Z F;  2WZL A;  4JUR I;  1XZQ A;  1ORS C;  1ST6 A;  1YVI A;  3PHF 2;  4ULW A;  3B0U X;  3NMJ A;  1JRA A;  2Q3T A;  4G7Z F;  4A4A A;  1OQC A;  5L0C A;  4HEA J;  2IXN A;  4Q5S F;  2HZ8 A;  1YDI A;  5IY5 C;  4U9D A;  3JRM O;  2J0X A;  2GA0 A;  1Z5Z A;  4C3D A;  2VB6 A;  3NYM A;  5GPG B;  3NYL A;  2GFH A;  5JS5 A;  1KTM A;  3RW0 A;  2XS8 A;  4AK9 A;  2DGJ A;  2CNW A;  3GEH A;  4MTG A;  1UG7 A;  2OG2 A;  4XEV A;  1LE2 A;  3UMH A;  3ZVR A;  4E7S A;  1FFT C;  3Q7G A;  5DVW A;  2EIL C;  2ICW G;  4WJ0 A;  5D92 A;  5E3A A;  3ZQY A;  3US6 A;  3HLZ A;  5DS5 A;  4CDV A;  3AQC A;  1YLM A;  3DM5 A;  4K0D A;  1TWC A;  2YZS A;  2D5R B;  5L3V A;  1Z3I X;  1FFH A;  1L3P A;  2B0J A;  4FWV A;  4YT5 A;  4C7O A;  4N06 A;  1D1A A;  5DQZ A;  4BJT A;  2OJE D;  2P61 A;  1OKK A;  2EPO A;  1CPR A;  4JZA A;  1VK5 A;  1ZHY A;  4QI0 A;  5COG A;  3TJ5 A;  4U5C E;  5DS6 A;  5CIV A;  3AG2 C;  4CS9 C;  4MW8 A;  1FMV A;  1K05 A;  4CDY A;  3AG4 C;  4G7O F;  1D0Z A;  1H6G A;  2C04 A;  2YRF A;  3DD7 A;  3S28 A;  1H9G A;  1YA9 A;  4FAP B;  2IYL D;  2LD6 A;  2LFF A;  2IBF A;  1WOL A;  4K7B A;  1V74 B;  1DOV A;  1H7I A;  3EG9 A;  2FFH A;  3ZQV A;  3S0X A;  2R7Q A;  1Q0D A;  2G62 A;  3LLI A;  1TKN A;  3KL4 A;  3ZSU A;  5DQT A;  4D4N A;  5KYW A;  3S90 A;  3T6J A;  4LLC A;  3ITF A;  3Q7L A;  3B0V C;  2KGO A;  5L0H A;  3M1C B;  2QNL A;  2IM8 A;  3ZTM A;  5KYN A;  2R9R B;  3IHU A;  2EPN A;  4F4B A;  3U0C A;  3T6G B;  3UR3 C;  3C18 A;  3PCV A;  1HE1 A;  1OCR C;  2V26 A;  4E0H A;  2LK4 A;  4JCZ A;  4X0R A;  3S29 A;  2KYH A;  4U5D E;  1NLX A;  1A7E A;  1G4U S;  2J9B A;  3TK0 A;  2CCY A;  1T6I A;  3L8I A;  1LIH A;  1TR2 A;  1HY5 A;  4PK4 A;  2Y3H A;  1W2W A;  3QVZ A;  3EFO B;  2QTV A;  4DRH B;  2Q00 A;  2Q9C A;  4DXW A;  2HUJ A;  2DI3 A;  2PF4 E;  4AX2 A;  2HSQ A;  3IEE A;  5KYY B;  2CGE A;  2O9X A;  3AQB A;  3U8V A;  1WAS A;  4MW3 A;  2HV7 A;  1TQG A;  1FMW A;  2XL6 A;  2OKU A;  1BR4 A;  2W9Y A;  3B0P A;  1M2V A;  4RDA A;  2L6G A;  3AJM A;  3U2L A;  3HNJ A;  3R2P A;  3ZTZ A;  2HMZ A;  2CYD A;  1Y4C A;  1BZ4 A;  2XSE A;  1Z7Q c;  1FTS A;  3GWL A;  3NMK A;  4XEK A;  1FR0 A;  2NPU A;  3L8J A;  3X1O A;  2WZF A;  3C8G B;  2YWA A;  4UDV A;  3RQG A;  4DOZ A;  5F5F A;  4EBJ A;  3UGP A;  4N6H A;  3ZC4 A;  3ZG1 A;  3FDQ A;  1JMW A;  1Q0G A;  2P1A A;  1M6T A;  4LDK A;  1A7D A;  3GM2 A;  4JEA A;  2A6H F;  4LLE A;  4PAC A;  2KK1 A;  5EK0 A;  2XLD A;  2AWC A;  3G4Z A;  1TWH A;  1SZI A;  2Y69 C;  2LQG A;  2EIM C;  3I5Q A;  1VYK A;  3KMI A;  1QKR A;  3QVY A;  1RKE B;  4MND A;  3DM9 B;  2MYS A;  3VF0 A;  5A6B D;  1E84 A;  1QQ3 A;  2TMV P;  4OIO F;  5COF A;  2HJ3 A;  1PD1 A;  1QPU A;  2NUP A;  3N0T A;  2G3V A;  3EHM A;  5AGF A;  3RVY A;  2B0H A;  5JVE A;  3ABK C;  4MVR A;  5F5H A;  5DS4 A;  2QY9 A;  3AG1 C;  3M15 A;  2R03 A;  3VRC A;  4YT4 A;  1F1M A;  3CEX A;  4HE8 D;  1WWP A;  2BL2 A;  4HFK B;  3H2U A;  4IAQ A;  3O6X A;  4MQ9 F;  4WGZ A;  4E17 A;  3WOD F;  2KJG A;  3LEV A;  2IXO A;  1VYI A;  2VCC A;  3EHN A;  3FAJ A;  5L3Q A;  1MMG A;  1RKE A;  3DMD A;  2J9W A;  3E70 C;  3SXY A;  3SZR A;  3V5X A;  2XXA B;  1GGQ A;  3GEI A;  3N2Z B;  1ORJ A;  2AU5 A;  4P9T A;  3G4X A;  2H7O A;  1OCO C;  3I4U A;  3U9M A;  1BR2 A;  1M56 C;  1OXB A;  2YVK A;  2J46 A;  3FOO A;  2Y3G A;  4GEH A;  3DJN B;  2CDQ A;  5B3S C;  5JLI A;  3NYJ A;  4YWQ A;  3EPV A;  3TOM A;  3RQE A;  2EIK C;  3C8G D;  2JX0 A;  1YYJ A;  1KU2 A;  2L6F A;  3C7J A;  2FAP B;  3GEE A;  3DZA A;  4IAR A;  3EJN A;  4PJJ A;  4KC9 A;  1XZP A;  2Y39 A;  4G0H A;  4LDQ A;  3RFY A;  4BEM J;  1LI5 A;  1H9T A;  4QI2 A;  3VYW A;  3W8I A;  2ZD9 A;  1A41 A;  1SR2 A;  2Q9B A;  1ZYR F;  4PFO A;  2AP3 A;  4RD9 A;  5A6B A;  3MYI A;  3K1H A;  5KYU B;  3FMS A;  2PFD A;  4IGG A;  4I3M A;  1WGW A;  1VB5 A;  3POV A;  4U5B E;  3K6B A;  4J7T A;  3DI5 A;  4MVQ A;  2Y3D A;  3TOL A;  5E3C A;  1PD0 A;  4H4K C;  1L7C A;  2DYS C;  2YLG A;  1SMY F;  1NU7 D;  3LAY A;  4MVM A;  3RYL A;  1B68 A;  4ANJ A;  4EIY A;  5TJ5 E;  2CW0 F;  1NSG B;  3V5Y A;  1ZW3 A;  1HW1 A;  4K1O A;  3W4Y A;  1DOW A;  1RKC A;  2OJQ A;  3JSE O;  4YL3 A;  4NTA A;  2YL7 A;  3C63 A;  2A69 F;  1ZHT A;  3JT1 A;  4O6Y A;  2YL1 A;  5L0D A;  2Z15 A;  1AUE A;  4CIP A;  4JCH A;  2R25 A;  1V55 C;  3NG1 A;  4BJ6 A;  1D0X A;  2YKZ A;  3EGD B;  3OWT A;  3EH2 A;  2HJM A;  4Z9I A;  3ZIB A;  3GM3 A;  4U5G A;  2R7U A;  4BG0 A;  4JE9 A;  2XLW A;  4J32 B;  4OIN F;  1V54 C;  1RCP A;  4U5H A;  1RMV A;  4DRI B;  4XLN F;  2DYR C;  2ZXR A;  2XXA A;  3OEO A;  1OR2 A;  4JTC B;  3FOP A;  2EPK X;  3LUT B;  4JJG A;  4NTF A;  1WTY A;  4MVU A;  1Q0F A;  4O79 A;  4Z9H A;  4ZLD A;  1JPJ A;  2YL3 A;  3GM1 A;  3IQT A;  1FNT c;  1OCC C;  1LI7 A;  4JKV A;  1ZZP A;  3LS0 A;  5KYX A;  3B71 A;  2XLH A;  3L34 A;  2YL0 A;  4EHP A;  5HV9 A;  1NFO A;  2C03 A;  3LS1 A;  2KNH A;  2IOQ A;  4NC3 A;  4O6N A;  1HMD A;  4XWJ A;  3KYJ A;  3SEO A;  5B1A C;  1A0B A;  1NBB A;  3CAX A;  4R32 A;  4C3E A;  3AGU A;  3M79 A;  4JRZ A;  1OW7 A;  4RBN A;  5DLJ A;  2LCH A;  3F47 A;  4DBR A;  5CI9 A;  3LEO A;  4YL1 A;  3ASN C;  2W4M A;  3DXJ F;  4GYT A;  4BPM A;  3TD7 A;  5EGY A;  1E2X A;  5B1B C;  3JYY A;  2YHS A;  4MTO A;  3Q6M A;  3S9O A;  4EKW A;  5KYX B;  5HSW A;  1OW8 A;  3NKD A;  2XL4 A;  2MWQ A;  3FXH A;  4U9E A;  3ABL C;  2YLI A;  3AG3 C;  4FES A;  4EBB A;  4I1O B;  2HV6 A;  1PV3 A;  4C7O B;  1RJ9 B;  2L7A A;  3EQL F;  4CJG A;  1YYX A;  1HMO A;  2Y3B A;  5BQH A;  2AWY A;  4PJN A;  3ZWI A;  1C17 M;  3I5P A;  3IQ5 A;  4KNV A;  2M64 A;  2XLE A;  3KYI A;  1LS4 A;  2D4U A;  2VAS A;  3CZ6 A;  4I1M A;  3TQO A;  4KNW A;  4NY3 A;  3HNI A;  2XLO A;  1NU9 C; 
#chains in the Genus database with same CATH homology
 1BZ4 A;  1GS9 A;  1LPE A;  1OR3 A;  1YA9 A;  3S84 A;  1B68 A;  1EA8 A;  2KC3 A;  1AEP A;  1NFO A;  1LE4 A;  1NFN A;  1EQ1 A;  3R2P A;  1H7I A;  1OR2 A;  1LE2 A;  1LS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...