1GS9A

Apolipoprotein e4, 22k domain
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
144
structure length
144
Chain Sequence
SGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords APOLIPOPROTEIN E
publication title Crystal Structure of the 22K Domain of Human Apolipoprotein E4
rcsb
source organism Homo sapiens
total genus 65
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2002-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1gs9A00
1NFOA 1B68A 1LS4A 3S84A 1YA9A 2KC3A 1H7IA 1EQ1A 1LE4A 3R2PA 1EA8A 1OR2A 1GS9A 1AEPA 1BZ4A 1LPEA 1NFNA 1LE2A 1OR3A
chains in the Genus database with same CATH superfamily
4GEHA 2HJ3A 2H7BA 2Y3GA 2Z15A 4JRZA 3U3BA 4AL1A 3EH1A 2IYLD 3TULA 2V3CC 1ZVZA 1HW2A 4WGYA 2GWWA 4EBJA 4G7OF 1M57C 4DRHB 4YL1A 3V7OA 1LS1A 2G62A 3BRJA 2LFDA 3LEVA 4D4XA 5A6BA 4OIQF 2Y69C 1N1CA 2CGEA 2KJGA 1D1CA 3LLIA 1AUEA 2OEVA 3LS1A 2R7SA 1T6UA 2KGOA 2HV7A 2LSEA 4XEKA 5FZTA 3UMHA 1V55C 1LE4A 4BJ1A 1R4TA 3NMIA 1BBHA 5AC4A 2ZD9A 2YHSA 2XLMA 4IJJA 3UMKA 4IARA 3V5YA 2EIMC 4ULWA 1TWCA 4XLPF 5KYXB 2IOQA 2NUTA 1ZHZA 5CI8A 5A6KA 1H9TA 3ZVRA 1L7CA 3AG2C 5BUOA 1HY5A 2DB4A 3QVZA 4Z9HA 3CZ6A 4UDVA 1Z6AA 3S84A 1OW6A 5KYUB 2XXAB 4NTBA 4AE4B 5EGYA 1QKRA 1HMOA 1C03A 3GORA 2HMQA 1G8XA 3U2MA 2NUPB 1BDJB 3Q7LA 2HJMA 5AC5A 5TJ5E 2IXOA 4ANJA 2BL2A 4C7OB 1FMWA 5T3WA 1MMDA 3N0TA 4H4KC 4MTOA 3TJ5A 3UMIA 4WABA 4YT2A 1TKNA 4KI2A 3RW0A 3KYIA 5A6BD 2ICWG 1OR2A 1M56C 1G4WR 3LNRA 4MVUA 1E85A 1M2OA 3Q6NA 2R7UA 1MQVA 2OJQA 2A6HF 2KW3C 1ORSC 4C3DA 1PD1A 4MQ9F 4EBBA 1R5ID 2YLDA 2RSEB 4JIOA 5BQIA 2AU5A 4EBKA 3KMIA 1EI7A 2EPOA 3SEOA 2YL7A 5KYWB 1ZU4A 2QY9A 1PCXA 1Z3IX 1MMAA 2KYHA 4DRIB 2YWAA 4ONSA 2J8WA 1RKEA 1OXBA 4E0HA 3EGDA 3JT1A 4NCQA 4J7YA 4NY3A 4OD4A 2JX0A 3GM3A 2OJED 1O3UA 2EILC 1XZQA 3QW0A 1ZYRF 3NYJA 3SP1A 1YAUO 4JC7A 2JD3A 1UG7A 4GYTA 3RYLA 4E17A 2EPNA 4PACA 1D1BA 4IAOA 4MS2A 1W2WA 4PR9A 2WZGA 2ZXPA 3DM9B 4CS9C 5L3QA 4EKWA 2C04A 2R03A 3H2UA 5CI9A 3ZWIA 4E7SA 3UGPA 5A6AA 3W2WA 4DBQA 1M2VB 3SZRA 1FNTc 2I15A 2VH3A 3I4UA 5L0GA 1Q0KA 2D4UA 2Q4FA 3Q6MA 3U9JA 3EGXA 1BR1A 4I44A 3IEEA 1ZW2A 1SF8A 3ZTMA 4BG0A 1VOMA 4BJ6C 4YT4A 4JCZA 5L0JA 5KYXA 3EZIA 3GEHA 3NYLA 2PX0A 3KKBA 1S7ZA 1GGQA 2LD6A 1U89A 4NQFA 2KQ9A 5B1AC 4P6IC 2DGJA 1OCOC 3LNMB 1CGNA 2XXAA 4JW1A 3K7DA 4AE4A 3RFYA 3AG1C 1M6TA 2OCCC 3LESA 1C02A 2PX3A 4JJFA 3A11A 2NUPA 5T3TA 3SXKA 3LS0A 1RKCA 2EIJC 2W45A 4ZLCA 3C8ZA 4C7OA 1KU2A 2OEXA 3JYYA 1HE1A 1TWHA 4FWVA 4LLCA 1T6IA 2Q9BA 3ABKC 3JTLO 3TD7A 2XS8A 4PK4A 1VK5A 1GQAA 1OCCC 2KC3A 2YL0A 1WATA 4YL3A 5L0IA 5L3VA 1VLTA 2M4EA 5DVWA 4U5GA 3TOLA 3ZIBA 3VAYA 1YJGA 3IHUA 2QE9A 3UNGC 2DYRC 3GANA 3DI5A 5A6JA 4XWJA 4AX2A 1LM3B 2J0WA 4OD5A 4CS8A 1Y4CA 4BPMA 1ZZPA 5KYWA 3NDBB 2YRFA 3EH2A 4DBRA 1NU9C 3AQCA 3DE9A 3I5QA 2VB6A 2XM4A 3KL4A 1BR2A 1E83A 3ZQYA 2FGYA 3MYIA 4J7TA 5HSWA 4JVSA 3FOPA 5DQTA 4MVQA 5IY5C 1RKEB 1VYIA 2F22A 4Q5SF 3EGDB 1FFTC 4YWQA 2XS1A 4NC3A 4CJOA 1LS4A 3GM1A 5F5FA 4X0RA 1YZAA 2OQMA 1HE9A 3DZAA 2EPLX 3T6GB 3H65A 3VM6A 4BJTA 1VLSA 3C63A 3DMDA 5COGA 1ORYA 3AGTA 1EKYA 1M2VA 2EPMX 1T5OA 1Y6DA 3IQTA 5AGFA 2J9VA 1CGOA 1FMVA 3SXZA 3U0CA 2AVKA 2MYSA 3FVYA 4W8KA 1VB5A 2XRHA 4IGGA 4DVZA 2AP3A 2R7QA 2H7OA 3ABLC 2IXNA 3BEHA 3EGXB 4LERA 3S29A 1I4ZA 4ZLDA 2Y3DA 1V4AA 2TMVP 4J32B 3H2VA 4KNVA 2GFHA 4IRUA 1B68A 1K05A 3C8GA 2J9UA 3E70C 2PNOA 3L0IA 4HFFB 1NZEA 4JZAA 1JPNA 3G4XA 3MBGA 2DYSC 2HSQA 2XLDA 3RVZA 3ZDLA 1QQ3A 2YLGA 2CNWA 3UR3C 3VRCA 1K04A 2Q7RA 3WG7C 1ZW3A 3NKDA 3TOMA 1Z5ZA 1VYKA 1QVXA 3AJMA 4FX5A 5L0FA 3SYNA 2KNHA 2OKUA 4P9TA 3FHDA 5JRAA 1CGME 3ABMC 3V5ZA 2NSGA 3HLZA 3B71A 2CCYA 1FTSA 1MNDA 2O9XA 3RH3A 1DOVA 3S90A 5COFA 1NSGB 3FAPB 3EPVA 4P9FA 1LI5A 1PD0A 3NKEA 3OEOA 5F28E 2UUHA 5DQZA 1IW7F 3QMKA 1IZMA 2QNLA 3K33A 1TFOB 2ETSA 2Y3HA 2Q3TA 4U5FE 1OW8A 3X2QC 4RBNA 1MNEA 1H6GA 1OXKA 2LQGA 3O55A 1ST6A 2VASA 4LDKA 3HKKA 1A7DA 2GDCA 1JAFA 4JE9A 3IQCA 2A68F 5L0CA 4GQHA 1TWAA 3IQ5A 3MYFA 3PMRA 4A4AA 2WB7A 3ECSA 1SMYF 4H54A 1EQ1A 3TK0A 2P6VA 1NBBA 3ZTZA 4WGZA 3ASNC 5DLJA 3ZSUA 3FMSA 2A0BA 2VCBA 4MVMA 1OW7A 2W9YA 5D91A 2X51A 2HS5A 4PJNA 3N2ZB 1WTYA 3O39A 4G7ZF 3W8IA 2AWCA 3C8GD 2A69F 5T1DB 3EZHA 3S27A 1HMDA 2EINC 3MX3A 3WODF 4U5HA 5GPGB 2CNWD 4BEJA 5KYYB 2CDQA 5HV9A 4KC9A 1NFNA 2J9BA 1SR2A 2XM0A 3ATPA 3GODA 5E33A 4CS9A 1Z23A 4YJWA 2QUPA 3KH2A 3ZC4A 1J8YF 2LK4A 1APCA 2EPKX 3F46A 3K1IC 4KBLA 2WVNA 4LDQA 3LEOA 4CSAA 3F47A 2OOCA 2EIKC 4N4WA 3X1OA 1JOGA 2H7VC 3Q7GA 3PHF2 3FOOA 3HJCA 4CIHA 3GWLA 4O6YA 3J06A 5CIVA 1TFKB 3B0PA 2PP4A 2B0HA 2H8AA 2HV6A 4BJ6A 4DJ9A 5DS4A 4EUKB 3FDQA 2PF4E 1Z7Qc 3C7JA 4M63A 2R25A 2R02A 3M4BA 2XLVA 5D92A 3EJNA 2A1DD 3B9QA 3C62A 3C8GB 4XQ1A 2YEVA 3SXMA 3T9OA 5E3AA 4MW8A 1A41A 3A9CA 5JT4A 3L8IA 1LVKA 3HNKA 4WJ0A 1LKXA 2RD9A 4CX9A 2NSFA 2I8BA 3AG3C 2LIGA 1NLXA 5COMA 4AL0A 2WVQA 4RD9A 1H9GA 5E3CA 1TWGA 3EHNA 2FFHA 2R7WA 2YLIA 1T9KA 2HKVA 4HE8D 4O6NA 1JRAA 4A2NB 3EG9B 2YVKA 1C17M 2CW0F 5BQGA 4E18A 2G3KA 2HSBA 2Y3BA 1JPJA 1KNYA 2LCHA 2JPUA 1Q0FA 1FFHA 4I1OB 4R32A 1MMNA 4MVRA 1T01A 1YA7O 1YYJA 1RCPA 4AK9A 2L6GA 4CDVA 1U0BB 4XPWA 4C3EA 3U3FA 4BJ5C 4YN0B 4OINF 3T6BA 3B29A 2WZFA 4I3MA 4CDAA 3O10A 4JJGA 1HW1A 4IAQA 2XLEA 3U9MA 1NG1A 3U8PA 3B0VC 4W8PA 3JCUQ 4JURI 3MFNA 5A69A 1TQGA 5DS6A 2IBFA 2KK1A 4EIYA 5KYYA 3L1MA 3M1CB 2YKZA 3NMKA 2J45A 5JUAA 3ASOC 5EK0A 4N6CA 5FCLA 3OWTA 3PDMP 1D1AA 1WN0A 4DVYP 3UGOA 1CPQA 2IXMA 1F1MA 2DI3A 2YL1A 3EQLF 2R9RB 1WOLA 3R2PA 1Q0MA 3CQZA 5B3SC 3CEXA 4L6RA 1K40A 4MNDA 1YVIA 3VF0A 5JVEA 1L3PA 1ZHTA 3RF3A 2Q9CA 2G3VA 4XLNF 2MWQA 2XLOA 2YQYA 4U5EE 4YT8A 3ZQVA 3KYJA 3DD7A 3T6JA 1WGWA 1NU7D 1RJ9B 1NFOA 2HMZA 2YZSA 3LJBA 2XLWA 4YL0A 4QDLA 3S0XA 5DS5A 1YDIA 4PFOA 2L9JA 2YL3A 3FXHA 3JSEO 3QTHA 3T4RA 4DRJB 1OQCA 1O87A 4N6HA 2QLAA 2A0UA 3IPMO 3SNHA 1ZHWA 5L0HA 1BR4A 3LUTB 4O79A 2IXPA 1XWJA 4K0DA 1S05A 3WAQA 3AG4C 3HTKC 4JEAA 4U5BE 4HEAJ 4MVZA 4XEVA 3DM5A 4Z9JA 2CYDA 3QW1A 3EHMA 3K1HA 4HFKB 1D0YA 2GA0A 3K6BA 4U5CE 4IWBA 3DWWA 2VCAA 1QPUA 3NMJA 5F5HA 1RXQA 1OCZC 3NRHA 1I4YA 2L7AA 3V5XA 1T6QA 3EG9A 3B0UX 2L6HA 3DAGA 4PJJA 3MLGA 2R7XA 1GS9A 4XEFA 4PJMA 1BZ4A 2WL8A 2X0CA 2J7PD 3HNJA 4EHPA 3C18A 3U5SA 3AGUA 3RIPA 3CAXA 4Z9IA 3GEIA 2R7RA 2PFDA 3EFOA 3M79A 2WZLA 3TJ6A 1ZHYA 1ZHXA 4XTKA 1V74B 3I5PA 2W4BA 2UUIA 1YA9A 4PFPA 1A7VA 1GM5A 5E2QA 4CJGA 2BE5F 1YZCA 1QLEC 4PJLA 3RQEA 3W8HA 2ZXOA 1Q0DA 3GEEA 1G4US 4DXWA 3R7CA 4QI2A 1A7EA 5B1BC 3O6XA 2NPUA 4U9DA 3JSZA 4Q7CA 1RMVA 5JSLA 1OKKA 1WWPA 3PCVA 1XZPA 1FAPB 4EWCA 3L8JA 3ITFA 1D0ZA 4MTFA 4LDRA 3US6A 2OG2A 2HUJA 4JTDB 4JTAB 4N06A 4U9EA 4B6IA 1LE2A 1V54C 4JTCB 3K1IA 2L81A 4KNWA 2LP4A 4U5DE 2Y39A 1Q0GA 4NTAA 2P0NA 3HNIA 5K0IA 3NG1A 3HNLA 2Q9AA 1SZIA 2ZPAA 3JRMO 3G50A 3L34A 4IB4A 3DAFA 1CPRA 4QI0A 4C3BA 3M15A 2GAQA 5JLIA 1DOWA 4RDAA 2BC5A 2MHRA 4G0HA 4G78A 3S28A 5BQHA 4ULVA 2PBEA 3JYHA 4MW3A 3S9OA 1ORJA 1RJ9A 1SYQA 2M64A 1A0BA 3DKAA 4G7HF 4Q4ZF 3AQBA 3U2LA 4DOZA 5B3IA 3JRTA 1VMAA 4YK5A 4O6MA 4E7ZA 4OIPF 1EA8A 3W2VA 2ASRA 2A6EF 3LAYA 4K1OA 5JP7A 3WHNA 1E86A 4JKVA 3SXYA 3FAJA 1VTMP 1J8MF 3K66A 2ZXWC 1YYXA 2NG1A 3GWNA 3VYWA 2P61A 3POVA 4LLEA 3G4ZA 1Z63A 3NYMA 1QZXA 1G5ZA 4OIOF 4CSAC 3QVYA 4MVOA 2XLHA 1OKKD 2ZXRA 3TQOA 2WVOA 1D0XA 3RVYA 2W4MA 1YLMA 3JZ0A 2OU6A 2Q00A 1H7IA 4CBEA 2B0JA 1I5NA 5JS5A 2C03A 2NUTB 2J46A 4MTGA 4CS7A 2VC9A 2D5RB 1OCRC 5KYUA 3U8VA 3E9VA 4BJ5A 3EFOB 1UFBA 4CIPA 3RKOF 1FR0A 2E87A 4YT5A 5EHHA 2J0XA 4I1MA 1JR8A 3CSKA 2R7TA 1LPEA 1QSPA 4FAPB 2XL6A 2P7VA 3KPHA 1OR3A 2FAPB 3DJUB 3RQGA 2KSFA 4F4BA 1MMGA 3AOUA 3QZCA 1PV3A 2R7VA 2HZ8A 2XSEA 3DXJF 1JMWA 2IM8A 4OIRF 1E84A 256BA 2J9WA 2V26A 2LFFA 2XL8A 3LLKA 4JEBA 4JCHA 2J7PA 1ZU5A 2QTVA 3DJNB 3DE8A 3IQ6A 4MVSA 1AVOB 4XPXA 4ER9A 3RQFA 1YARO 4CDYA 3ZG1A 2VCCA 1LI7A 3M4CA 2L6FA 4NTFA 4D4NA 4K7BA 4O7GA 1E2XA 1LIHA 2R7OA 4LACB 3GM2A 1TR2A 1U6HA 2R05A 4FESA 4CS8C 1KTMA 4J30B 1AEPA 1O5HA 4BEMJ 4E0IA 2XL4A 5L0DA 5KYNA 3N24A 3W4YA 3OA1A 4XPYA 2P1AA 1WASA 2HFIA 2AWYA
chains in the Genus database with same CATH topology
1NFOA 1B68A 1LS4A 3S84A 1YA9A 2KC3A 1H7IA 1EQ1A 1LE4A 3R2PA 1EA8A 1OR2A 1GS9A 1AEPA 1BZ4A 1LPEA 1NFNA 1LE2A 1OR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NFO A;  1B68 A;  1LS4 A;  3S84 A;  1YA9 A;  2KC3 A;  1H7I A;  1EQ1 A;  1LE4 A;  3R2P A;  1EA8 A;  1OR2 A;  1GS9 A;  1AEP A;  1BZ4 A;  1LPE A;  1NFN A;  1LE2 A;  1OR3 A; 
#chains in the Genus database with same CATH topology
 4GEH A;  2HJ3 A;  2H7B A;  2Y3G A;  2Z15 A;  4JRZ A;  3U3B A;  4AL1 A;  3EH1 A;  2IYL D;  3TUL A;  2V3C C;  1ZVZ A;  1HW2 A;  4WGY A;  2GWW A;  4EBJ A;  4G7O F;  1M57 C;  4DRH B;  4YL1 A;  3V7O A;  1LS1 A;  2G62 A;  3BRJ A;  2LFD A;  3LEV A;  4D4X A;  5A6B A;  4OIQ F;  2Y69 C;  1N1C A;  2CGE A;  2KJG A;  1D1C A;  3LLI A;  1AUE A;  2OEV A;  3LS1 A;  2R7S A;  1T6U A;  2KGO A;  2HV7 A;  2LSE A;  4XEK A;  5FZT A;  3UMH A;  1V55 C;  1LE4 A;  4BJ1 A;  1R4T A;  3NMI A;  1BBH A;  5AC4 A;  2ZD9 A;  2YHS A;  2XLM A;  4IJJ A;  3UMK A;  4IAR A;  3V5Y A;  2EIM C;  4ULW A;  1TWC A;  4XLP F;  5KYX B;  2IOQ A;  2NUT A;  1ZHZ A;  5CI8 A;  5A6K A;  1H9T A;  3ZVR A;  1L7C A;  3AG2 C;  5BUO A;  1HY5 A;  2DB4 A;  3QVZ A;  4Z9H A;  3CZ6 A;  4UDV A;  1Z6A A;  3S84 A;  1OW6 A;  5KYU B;  2XXA B;  4NTB A;  4AE4 B;  5EGY A;  1QKR A;  1HMO A;  1C03 A;  3GOR A;  2HMQ A;  1G8X A;  3U2M A;  2NUP B;  1BDJ B;  3Q7L A;  2HJM A;  5AC5 A;  5TJ5 E;  2IXO A;  4ANJ A;  2BL2 A;  4C7O B;  1FMW A;  5T3W A;  1MMD A;  3N0T A;  4H4K C;  4MTO A;  3TJ5 A;  3UMI A;  4WAB A;  4YT2 A;  1TKN A;  4KI2 A;  3RW0 A;  3KYI A;  5A6B D;  2ICW G;  1OR2 A;  1M56 C;  1G4W R;  3LNR A;  4MVU A;  1E85 A;  1M2O A;  3Q6N A;  2R7U A;  1MQV A;  2OJQ A;  2A6H F;  2KW3 C;  1ORS C;  4C3D A;  1PD1 A;  4MQ9 F;  4EBB A;  1R5I D;  2YLD A;  2RSE B;  4JIO A;  5BQI A;  2AU5 A;  4EBK A;  3KMI A;  1EI7 A;  2EPO A;  3SEO A;  2YL7 A;  5KYW B;  1ZU4 A;  2QY9 A;  1PCX A;  1Z3I X;  1MMA A;  2KYH A;  4DRI B;  2YWA A;  4ONS A;  2J8W A;  1RKE A;  1OXB A;  4E0H A;  3EGD A;  3JT1 A;  4NCQ A;  4J7Y A;  4NY3 A;  4OD4 A;  2JX0 A;  3GM3 A;  2OJE D;  1O3U A;  2EIL C;  1XZQ A;  3QW0 A;  1ZYR F;  3NYJ A;  3SP1 A;  1YAU O;  4JC7 A;  2JD3 A;  1UG7 A;  4GYT A;  3RYL A;  4E17 A;  2EPN A;  4PAC A;  1D1B A;  4IAO A;  4MS2 A;  1W2W A;  4PR9 A;  2WZG A;  2ZXP A;  3DM9 B;  4CS9 C;  5L3Q A;  4EKW A;  2C04 A;  2R03 A;  3H2U A;  5CI9 A;  3ZWI A;  4E7S A;  3UGP A;  5A6A A;  3W2W A;  4DBQ A;  1M2V B;  3SZR A;  1FNT c;  2I15 A;  2VH3 A;  3I4U A;  5L0G A;  1Q0K A;  2D4U A;  2Q4F A;  3Q6M A;  3U9J A;  3EGX A;  1BR1 A;  4I44 A;  3IEE A;  1ZW2 A;  1SF8 A;  3ZTM A;  4BG0 A;  1VOM A;  4BJ6 C;  4YT4 A;  4JCZ A;  5L0J A;  5KYX A;  3EZI A;  3GEH A;  3NYL A;  2PX0 A;  3KKB A;  1S7Z A;  1GGQ A;  2LD6 A;  1U89 A;  4NQF A;  2KQ9 A;  5B1A C;  4P6I C;  2DGJ A;  1OCO C;  3LNM B;  1CGN A;  2XXA A;  4JW1 A;  3K7D A;  4AE4 A;  3RFY A;  3AG1 C;  1M6T A;  2OCC C;  3LES A;  1C02 A;  2PX3 A;  4JJF A;  3A11 A;  2NUP A;  5T3T A;  3SXK A;  3LS0 A;  1RKC A;  2EIJ C;  2W45 A;  4ZLC A;  3C8Z A;  4C7O A;  1KU2 A;  2OEX A;  3JYY A;  1HE1 A;  1TWH A;  4FWV A;  4LLC A;  1T6I A;  2Q9B A;  3ABK C;  3JTL O;  3TD7 A;  2XS8 A;  4PK4 A;  1VK5 A;  1GQA A;  1OCC C;  2KC3 A;  2YL0 A;  1WAT A;  4YL3 A;  5L0I A;  5L3V A;  1VLT A;  2M4E A;  5DVW A;  4U5G A;  3TOL A;  3ZIB A;  3VAY A;  1YJG A;  3IHU A;  2QE9 A;  3UNG C;  2DYR C;  3GAN A;  3DI5 A;  5A6J A;  4XWJ A;  4AX2 A;  1LM3 B;  2J0W A;  4OD5 A;  4CS8 A;  1Y4C A;  4BPM A;  1ZZP A;  5KYW A;  3NDB B;  2YRF A;  3EH2 A;  4DBR A;  1NU9 C;  3AQC A;  3DE9 A;  3I5Q A;  2VB6 A;  2XM4 A;  3KL4 A;  1BR2 A;  1E83 A;  3ZQY A;  2FGY A;  3MYI A;  4J7T A;  5HSW A;  4JVS A;  3FOP A;  5DQT A;  4MVQ A;  5IY5 C;  1RKE B;  1VYI A;  2F22 A;  4Q5S F;  3EGD B;  1FFT C;  4YWQ A;  2XS1 A;  4NC3 A;  4CJO A;  1LS4 A;  3GM1 A;  5F5F A;  4X0R A;  1YZA A;  2OQM A;  1HE9 A;  3DZA A;  2EPL X;  3T6G B;  3H65 A;  3VM6 A;  4BJT A;  1VLS A;  3C63 A;  3DMD A;  5COG A;  1ORY A;  3AGT A;  1EKY A;  1M2V A;  2EPM X;  1T5O A;  1Y6D A;  3IQT A;  5AGF A;  2J9V A;  1CGO A;  1FMV A;  3SXZ A;  3U0C A;  2AVK A;  2MYS A;  3FVY A;  4W8K A;  1VB5 A;  2XRH A;  4IGG A;  4DVZ A;  2AP3 A;  2R7Q A;  2H7O A;  3ABL C;  2IXN A;  3BEH A;  3EGX B;  4LER A;  3S29 A;  1I4Z A;  4ZLD A;  2Y3D A;  1V4A A;  2TMV P;  4J32 B;  3H2V A;  4KNV A;  2GFH A;  4IRU A;  1B68 A;  1K05 A;  3C8G A;  2J9U A;  3E70 C;  2PNO A;  3L0I A;  4HFF B;  1NZE A;  4JZA A;  1JPN A;  3G4X A;  3MBG A;  2DYS C;  2HSQ A;  2XLD A;  3RVZ A;  3ZDL A;  1QQ3 A;  2YLG A;  2CNW A;  3UR3 C;  3VRC A;  1K04 A;  2Q7R A;  3WG7 C;  1ZW3 A;  3NKD A;  3TOM A;  1Z5Z A;  1VYK A;  1QVX A;  3AJM A;  4FX5 A;  5L0F A;  3SYN A;  2KNH A;  2OKU A;  4P9T A;  3FHD A;  5JRA A;  1CGM E;  3ABM C;  3V5Z A;  2NSG A;  3HLZ A;  3B71 A;  2CCY A;  1FTS A;  1MND A;  2O9X A;  3RH3 A;  1DOV A;  3S90 A;  5COF A;  1NSG B;  3FAP B;  3EPV A;  4P9F A;  1LI5 A;  1PD0 A;  3NKE A;  3OEO A;  5F28 E;  2UUH A;  5DQZ A;  1IW7 F;  3QMK A;  1IZM A;  2QNL A;  3K33 A;  1TFO B;  2ETS A;  2Y3H A;  2Q3T A;  4U5F E;  1OW8 A;  3X2Q C;  4RBN A;  1MNE A;  1H6G A;  1OXK A;  2LQG A;  3O55 A;  1ST6 A;  2VAS A;  4LDK A;  3HKK A;  1A7D A;  2GDC A;  1JAF A;  4JE9 A;  3IQC A;  2A68 F;  5L0C A;  4GQH A;  1TWA A;  3IQ5 A;  3MYF A;  3PMR A;  4A4A A;  2WB7 A;  3ECS A;  1SMY F;  4H54 A;  1EQ1 A;  3TK0 A;  2P6V A;  1NBB A;  3ZTZ A;  4WGZ A;  3ASN C;  5DLJ A;  3ZSU A;  3FMS A;  2A0B A;  2VCB A;  4MVM A;  1OW7 A;  2W9Y A;  5D91 A;  2X51 A;  2HS5 A;  4PJN A;  3N2Z B;  1WTY A;  3O39 A;  4G7Z F;  3W8I A;  2AWC A;  3C8G D;  2A69 F;  5T1D B;  3EZH A;  3S27 A;  1HMD A;  2EIN C;  3MX3 A;  3WOD F;  4U5H A;  5GPG B;  2CNW D;  4BEJ A;  5KYY B;  2CDQ A;  5HV9 A;  4KC9 A;  1NFN A;  2J9B A;  1SR2 A;  2XM0 A;  3ATP A;  3GOD A;  5E33 A;  4CS9 A;  1Z23 A;  4YJW A;  2QUP A;  3KH2 A;  3ZC4 A;  1J8Y F;  2LK4 A;  1APC A;  2EPK X;  3F46 A;  3K1I C;  4KBL A;  2WVN A;  4LDQ A;  3LEO A;  4CSA A;  3F47 A;  2OOC A;  2EIK C;  4N4W A;  3X1O A;  1JOG A;  2H7V C;  3Q7G A;  3PHF 2;  3FOO A;  3HJC A;  4CIH A;  3GWL A;  4O6Y A;  3J06 A;  5CIV A;  1TFK B;  3B0P A;  2PP4 A;  2B0H A;  2H8A A;  2HV6 A;  4BJ6 A;  4DJ9 A;  5DS4 A;  4EUK B;  3FDQ A;  2PF4 E;  1Z7Q c;  3C7J A;  4M63 A;  2R25 A;  2R02 A;  3M4B A;  2XLV A;  5D92 A;  3EJN A;  2A1D D;  3B9Q A;  3C62 A;  3C8G B;  4XQ1 A;  2YEV A;  3SXM A;  3T9O A;  5E3A A;  4MW8 A;  1A41 A;  3A9C A;  5JT4 A;  3L8I A;  1LVK A;  3HNK A;  4WJ0 A;  1LKX A;  2RD9 A;  4CX9 A;  2NSF A;  2I8B A;  3AG3 C;  2LIG A;  1NLX A;  5COM A;  4AL0 A;  2WVQ A;  4RD9 A;  1H9G A;  5E3C A;  1TWG A;  3EHN A;  2FFH A;  2R7W A;  2YLI A;  1T9K A;  2HKV A;  4HE8 D;  4O6N A;  1JRA A;  4A2N B;  3EG9 B;  2YVK A;  1C17 M;  2CW0 F;  5BQG A;  4E18 A;  2G3K A;  2HSB A;  2Y3B A;  1JPJ A;  1KNY A;  2LCH A;  2JPU A;  1Q0F A;  1FFH A;  4I1O B;  4R32 A;  1MMN A;  4MVR A;  1T01 A;  1YA7 O;  1YYJ A;  1RCP A;  4AK9 A;  2L6G A;  4CDV A;  1U0B B;  4XPW A;  4C3E A;  3U3F A;  4BJ5 C;  4YN0 B;  4OIN F;  3T6B A;  3B29 A;  2WZF A;  4I3M A;  4CDA A;  3O10 A;  4JJG A;  1HW1 A;  4IAQ A;  2XLE A;  3U9M A;  1NG1 A;  3U8P A;  3B0V C;  4W8P A;  3JCU Q;  4JUR I;  3MFN A;  5A69 A;  1TQG A;  5DS6 A;  2IBF A;  2KK1 A;  4EIY A;  5KYY A;  3L1M A;  3M1C B;  2YKZ A;  3NMK A;  2J45 A;  5JUA A;  3ASO C;  5EK0 A;  4N6C A;  5FCL A;  3OWT A;  3PDM P;  1D1A A;  1WN0 A;  4DVY P;  3UGO A;  1CPQ A;  2IXM A;  1F1M A;  2DI3 A;  2YL1 A;  3EQL F;  2R9R B;  1WOL A;  3R2P A;  1Q0M A;  3CQZ A;  5B3S C;  3CEX A;  4L6R A;  1K40 A;  4MND A;  1YVI A;  3VF0 A;  5JVE A;  1L3P A;  1ZHT A;  3RF3 A;  2Q9C A;  2G3V A;  4XLN F;  2MWQ A;  2XLO A;  2YQY A;  4U5E E;  4YT8 A;  3ZQV A;  3KYJ A;  3DD7 A;  3T6J A;  1WGW A;  1NU7 D;  1RJ9 B;  1NFO A;  2HMZ A;  2YZS A;  3LJB A;  2XLW A;  4YL0 A;  4QDL A;  3S0X A;  5DS5 A;  1YDI A;  4PFO A;  2L9J A;  2YL3 A;  3FXH A;  3JSE O;  3QTH A;  3T4R A;  4DRJ B;  1OQC A;  1O87 A;  4N6H A;  2QLA A;  2A0U A;  3IPM O;  3SNH A;  1ZHW A;  5L0H A;  1BR4 A;  3LUT B;  4O79 A;  2IXP A;  1XWJ A;  4K0D A;  1S05 A;  3WAQ A;  3AG4 C;  3HTK C;  4JEA A;  4U5B E;  4HEA J;  4MVZ A;  4XEV A;  3DM5 A;  4Z9J A;  2CYD A;  3QW1 A;  3EHM A;  3K1H A;  4HFK B;  1D0Y A;  2GA0 A;  3K6B A;  4U5C E;  4IWB A;  3DWW A;  2VCA A;  1QPU A;  3NMJ A;  5F5H A;  1RXQ A;  1OCZ C;  3NRH A;  1I4Y A;  2L7A A;  3V5X A;  1T6Q A;  3EG9 A;  3B0U X;  2L6H A;  3DAG A;  4PJJ A;  3MLG A;  2R7X A;  1GS9 A;  4XEF A;  4PJM A;  1BZ4 A;  2WL8 A;  2X0C A;  2J7P D;  3HNJ A;  4EHP A;  3C18 A;  3U5S A;  3AGU A;  3RIP A;  3CAX A;  4Z9I A;  3GEI A;  2R7R A;  2PFD A;  3EFO A;  3M79 A;  2WZL A;  3TJ6 A;  1ZHY A;  1ZHX A;  4XTK A;  1V74 B;  3I5P A;  2W4B A;  2UUI A;  1YA9 A;  4PFP A;  1A7V A;  1GM5 A;  5E2Q A;  4CJG A;  2BE5 F;  1YZC A;  1QLE C;  4PJL A;  3RQE A;  3W8H A;  2ZXO A;  1Q0D A;  3GEE A;  1G4U S;  4DXW A;  3R7C A;  4QI2 A;  1A7E A;  5B1B C;  3O6X A;  2NPU A;  4U9D A;  3JSZ A;  4Q7C A;  1RMV A;  5JSL A;  1OKK A;  1WWP A;  3PCV A;  1XZP A;  1FAP B;  4EWC A;  3L8J A;  3ITF A;  1D0Z A;  4MTF A;  4LDR A;  3US6 A;  2OG2 A;  2HUJ A;  4JTD B;  4JTA B;  4N06 A;  4U9E A;  4B6I A;  1LE2 A;  1V54 C;  4JTC B;  3K1I A;  2L81 A;  4KNW A;  2LP4 A;  4U5D E;  2Y39 A;  1Q0G A;  4NTA A;  2P0N A;  3HNI A;  5K0I A;  3NG1 A;  3HNL A;  2Q9A A;  1SZI A;  2ZPA A;  3JRM O;  3G50 A;  3L34 A;  4IB4 A;  3DAF A;  1CPR A;  4QI0 A;  4C3B A;  3M15 A;  2GAQ A;  5JLI A;  1DOW A;  4RDA A;  2BC5 A;  2MHR A;  4G0H A;  4G78 A;  3S28 A;  5BQH A;  4ULV A;  2PBE A;  3JYH A;  4MW3 A;  3S9O A;  1ORJ A;  1RJ9 A;  1SYQ A;  2M64 A;  1A0B A;  3DKA A;  4G7H F;  4Q4Z F;  3AQB A;  3U2L A;  4DOZ A;  5B3I A;  3JRT A;  1VMA A;  4YK5 A;  4O6M A;  4E7Z A;  4OIP F;  1EA8 A;  3W2V A;  2ASR A;  2A6E F;  3LAY A;  4K1O A;  5JP7 A;  3WHN A;  1E86 A;  4JKV A;  3SXY A;  3FAJ A;  1VTM P;  1J8M F;  3K66 A;  2ZXW C;  1YYX A;  2NG1 A;  3GWN A;  3VYW A;  2P61 A;  3POV A;  4LLE A;  3G4Z A;  1Z63 A;  3NYM A;  1QZX A;  1G5Z A;  4OIO F;  4CSA C;  3QVY A;  4MVO A;  2XLH A;  1OKK D;  2ZXR A;  3TQO A;  2WVO A;  1D0X A;  3RVY A;  2W4M A;  1YLM A;  3JZ0 A;  2OU6 A;  2Q00 A;  1H7I A;  4CBE A;  2B0J A;  1I5N A;  5JS5 A;  2C03 A;  2NUT B;  2J46 A;  4MTG A;  4CS7 A;  2VC9 A;  2D5R B;  1OCR C;  5KYU A;  3U8V A;  3E9V A;  4BJ5 A;  3EFO B;  1UFB A;  4CIP A;  3RKO F;  1FR0 A;  2E87 A;  4YT5 A;  5EHH A;  2J0X A;  4I1M A;  1JR8 A;  3CSK A;  2R7T A;  1LPE A;  1QSP A;  4FAP B;  2XL6 A;  2P7V A;  3KPH A;  1OR3 A;  2FAP B;  3DJU B;  3RQG A;  2KSF A;  4F4B A;  1MMG A;  3AOU A;  3QZC A;  1PV3 A;  2R7V A;  2HZ8 A;  2XSE A;  3DXJ F;  1JMW A;  2IM8 A;  4OIR F;  1E84 A;  256B A;  2J9W A;  2V26 A;  2LFF A;  2XL8 A;  3LLK A;  4JEB A;  4JCH A;  2J7P A;  1ZU5 A;  2QTV A;  3DJN B;  3DE8 A;  3IQ6 A;  4MVS A;  1AVO B;  4XPX A;  4ER9 A;  3RQF A;  1YAR O;  4CDY A;  3ZG1 A;  2VCC A;  1LI7 A;  3M4C A;  2L6F A;  4NTF A;  4D4N A;  4K7B A;  4O7G A;  1E2X A;  1LIH A;  2R7O A;  4LAC B;  3GM2 A;  1TR2 A;  1U6H A;  2R05 A;  4FES A;  4CS8 C;  1KTM A;  4J30 B;  1AEP A;  1O5H A;  4BEM J;  4E0I A;  2XL4 A;  5L0D A;  5KYN A;  3N24 A;  3W4Y A;  3OA1 A;  4XPY A;  2P1A A;  1WAS A;  2HFI A;  2AWY A; 
#chains in the Genus database with same CATH homology
 1NFO A;  1B68 A;  1LS4 A;  3S84 A;  1YA9 A;  2KC3 A;  1H7I A;  1EQ1 A;  1LE4 A;  3R2P A;  1EA8 A;  1OR2 A;  1GS9 A;  1AEP A;  1BZ4 A;  1LPE A;  1NFN A;  1LE2 A;  1OR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...