1GS9A

Apolipoprotein e4, 22k domain
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
144
structure length
144
Chain Sequence
SGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPROTEIN E
publication title Crystal Structure of the 22K Domain of Human Apolipoprotein E4
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 65
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2002-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1gs9A00
1NFOA 1EA8A 1LS4A 2KC3A 1BZ4A 1YA9A 1H7IA 1LPEA 1OR2A 3R2PA 1LE4A 1AEPA 1OR3A 1LE2A 1GS9A 1B68A 1EQ1A 3S84A 1NFNA
chains in the Genus database with same CATH superfamily
1VLTA 2VC9A 2YL3A 4WGZA 3ZTMA 5KYYA 3JRMO 2E87A 1J8MF 3EGXB 2EIMC 4ULVA 1HE9A 4C3EA 3FAJA 4JW1A 5L0CA 1O5HA 1ZU4A 4IAOA 3KPHA 5HSWA 4QI2A 3HNLA 3S0XA 1OCOC 1V55C 1E84A 4P9FA 4U5GA 1WTYA 3M15A 2D5RB 2R7SA 4HEAJ 3FAPB 3NDBB 2CYDA 4XPWA 1ZW2A 4BEJA 2G3VA 2WVQA 4UDVA 2HSBA 4U5EE 4MVSA 5DS4A 1E83A 4XEFA 2FFHA 2XL4A 4YJWA 3ZWIA 5IY5C 4Z9IA 1I5NA 1V74B 4BJ1A 2NG1A 4ZLCA 1VYKA 3DJNB 3U3FA 1Y6DA 2G62A 3IQ6A 4AL0A 1LS1A 3DM9B 4W8KA 3TJ5A 4EBJA 5KYWB 2Y69C 2V3CC 1G4WR 4LDQA 3QVYA 3CQZA 4E7SA 4R32A 2VCBA 5F5FA 3C7JA 1G5ZA 1K05A 3Q6MA 3I4UA 4PJMA 3L1MA 4KI2A 4JRZA 2CNWD 4BEMJ 1TWGA 3GODA 2R7RA 1HMOA 1HW1A 1FTSA 3AJMA 2YWAA 2KW3C 3T6GB 2NSGA 2Y3HA 4MNDA 3KYIA 1BR1A 2P1AA 1A7DA 1F1MA 1YARO 4MVMA 3UR3C 1A7VA 1D1AA 2PNOA 4PJNA 1RKEB 2J8WA 1T9KA 4JEBA 2W45A 3N24A 2QTVA 3JZ0A 3Q7GA 1OW8A 2AWYA 2MWQA 4CDAA 5L0DA 1PCXA 2HS5A 5KYXA 2R02A 2UUHA 3NRHA 1HE1A 1BR2A 1MNDA 3H2UA 3NMKA 3AG3C 3K33A 4E0HA 4EBBA 1IZMA 4LLEA 4BJ5C 4LLCA 2XXAB 2NPUA 2DYRC 2Y3GA 3CZ6A 2EPKX 4G0HA 3UMKA 3UGPA 1D0XA 3SXYA 2OQMA 3K66A 3DAFA 3DE9A 3N2ZB 2QY9A 3LNMB 2QUPA 2R7UA 1S05A 1ORSC 1Y4CA 3DKAA 2BE5F 2X0CA 3JSEO 4IGGA 1M2OA 5A6BD 4K7BA 4X0RA 2IXPA 3DE8A 4BJ5A 1H9TA 1ORYA 1AVOB 1OCCC 3S84A 5B1AC 1A0BA 4K1OA 1O87A 1M6TA 1MMNA 3EJNA 3KYJA 3ITFA 5A6JA 3K6BA 4G7OF 2WL8A 1Z7Qc 2R7TA 2IYLD 4W8PA 2LFDA 5EK0A 1VLSA 3BRJA 1OQCA 2L6FA 2JPUA 3C8GA 4J7TA 4MS2A 3GORA 3NMIA 1NSGB 2EPLX 3RH3A 2XLWA 2C04A 2I15A 5KYUA 2HKVA 4YT2A 3IHUA 3EGDA 3AQCA 3U8PA 3GM2A 1SZIA 1D0YA 3TJ6A 2NUPA 3SP1A 3SNHA 2PF4E 2YRFA 4YL0A 2TMVP 2VH3A 5TJ5E 5D91A 3W8HA 1UFBA 3SZRA 1VYIA 5COGA 2LSEA 2G3KA 3L0IA 3NKDA 3RIPA 4AK9A 4DRHB 4EIYA 4YL1A 3X2QC 1JPNA 4MTGA 1AUEA 1Z6AA 3HNIA 1QZXA 3O6XA 3U2LA 4JKVA 3T9OA 1OW7A 1TR2A 2AU5A 1OCZC 1SF8A 2YHSA 5B3SC 4PACA 3Q7LA 4YK5A 4CDYA 1TQGA 3AQBA 3DJUB 4FWVA 4NTFA 1JOGA 2RD9A 2L6GA 2KC3A 3L8JA 3POVA 2C03A 4Q5SF 3LESA 4Q7CA 3QW0A 3LS1A 3EG9A 2XS8A 3A11A 1HMDA 3G4ZA 3G4XA 4BJTA 4AE4A 2EPMX 3SYNA 4I1MA 2PFDA 3RQEA 1EKYA 3B29A 1YYXA 2IXMA 4N6HA 2XS1A 3K1IC 3ZTZA 1U6HA 1YVIA 2KSFA 2PBEA 5A6KA 1LE2A 4C7OB 1FFTC 1TFOB 1LVKA 4NC3A 2OKUA 5CI8A 3L8IA 2WZLA 1Z3IX 2W4MA 3S9OA 3FOOA 3K1HA 3ZQYA 2NUTA 1Q0DA 3BEHA 1YZAA 4DBQA 2H7BA 3JYYA 1ZHYA 3TOMA 2ZPAA 2AWCA 3KMIA 4JCHA 2J46A 3FVYA 3EHMA 2B0HA 3K1IA 2CCYA 1RJ9B 3ZQVA 4JCZA 3PHF2 1YA7O 3HLZA 1QKRA 1ZYRF 3ZIBA 1QVXA 2H8AA 3S90A 4JZAA 1ZHXA 1YYJA 2OJQA 3NMJA 1VOMA 1SR2A 1A7EA 1YZCA 3IQTA 4YL3A 4U9DA 3B0UX 1AEPA 2EPOA 4DOZA 1D0ZA 4JE9A 3EQLF 1LI7A 3H2VA 4LACB 5B3IA 4BG0A 5KYYB 4CBEA 1PD0A 3MLGA 3HTKC 3T6JA 1ZU5A 1PD1A 3MBGA 3ZG1A 5GPGB 1ST6A 2R7VA 1EA8A 1C03A 3U0CA 3ZSUA 1ZZPA 4DXWA 2HMZA 1OXKA 2BL2A 4MTFA 4CIPA 4CJOA 2YL0A 4MW8A 3QMKA 3EZIA 2AVKA 3B0PA 3UMHA 4IWBA 3RF3A 3VYWA 5F28E 5E3CA 256BA 4FESA 4ONSA 1Z5ZA 2ZXPA 3RVZA 3CEXA 3RFYA 3VF0A 2ICWG 5KYWA 1RMVA 2H7VC 1NBBA 2OCCC 3V5XA 1VTMP 4PR9A 1TWAA 2M64A 2WVNA 3JT1A 4MVRA 4N4WA 3ABKC 1EQ1A 4LDRA 4Q4ZF 4O6YA 2OEVA 3K7DA 2VB6A 1MNEA 4JVSA 2A0BA 4DVYP 2DGJA 4CX9A 3JTLO 1OW6A 3FDQA 1R4TA 4QI0A 3ZDLA 2GFHA 4GYTA 3U8VA 4MVZA 1E85A 4Z9JA 4A2NB 3LUTB 2XM0A 3M4CA 3C62A 4IAQA 2QNLA 3DAGA 3U9MA 2EILC 1O3UA 1Z63A 2Q3TA 3S27A 2R7OA 3H65A 3RYLA 3WAQA 4CS9C 5JLIA 2R9RB 5JSLA 3DWWA 1XZPA 2LK4A 4LDKA 3T4RA 1TKNA 1HY5A 2DYSC 4K0DA 4EHPA 5KYXB 4O7GA 2J9WA 3JRTA 2M4EA 4MVOA 1ZHWA 1M2VA 2XRHA 1G4US 4LERA 1E86A 5E2QA 3U3BA 1CGOA 2XLOA 1ORJA 4CS9A 3DZAA 1L3PA 3LJBA 3MFNA 3TOLA 3PCVA 1Q0KA 5A69A 1J8YF 2ZD9A 2VASA 4YT8A 3I5PA 3NYMA 1T01A 3W8IA 4DVZA 5L0HA 3HJCA 1ZW3A 1JRAA 1BZ4A 1SMYF 2B0JA 2XM4A 3V7OA 3TULA 4NY3A 1U0BB 3AGUA 1Z23A 2A69F 1Q0FA 1D1CA 3CAXA 1FMWA 4HFKB 3ZVRA 3OEOA 3QTHA 1RXQA 2P7VA 2XLEA 1CGME 1YDIA 3DD7A 1LE4A 1VMAA 3ABMC 3FMSA 3W2WA 2YLIA 3RQGA 1T6QA 4ULWA 1N1CA 3US6A 1OR3A 2LIGA 3EHNA 3GWNA 4ANJA 1APCA 4C3BA 5L0JA 5L0FA 2Q9CA 5JP7A 2PX0A 1FNTc 2HFIA 3C8GB 2RSEB 4XEKA 1MMGA 1NFNA 1QSPA 1R5ID 3ZC4A 3C18A 3EGDB 2ZXRA 2J9UA 2WZGA 4EBKA 4YT4A 3OWTA 2F22A 4KNVA 4YN0B 2L81A 1T5OA 2NUPB 3JSZA 3EPVA 3M79A 2CNWA 1OKKA 2HJ3A 2D4UA 3GM1A 4XTKA 1NU9C 2KQ9A 5DLJA 4YWQA 2JX0A 1WGWA 1V54C 2HSQA 2PX3A 2J9VA 2KNHA 2VCCA 3DMDA 2L9JA 2XLDA 4C3DA 4I44A 3O39A 3EFOA 2Q00A 3L34A 3E9VA 4H4KC 4JTDB 5T3WA 4F4BA 2KK1A 2Q9BA 3V5ZA 3QW1A 4CJGA 1VB5A 4DJ9A 5A6BA 1Q0MA 4QDLA 1WN0A 3S28A 5D92A 2DB4A 4JJFA 5COFA 2LD6A 3AG4C 5JRAA 1I4ZA 4PFPA 4O79A 4EKWA 2W4BA 3CSKA 4I3MA 4KBLA 1KTMA 2IOQA 2L7AA 2LQGA 3ATPA 2FAPB 2OOCA 5DVWA 1NFOA 4C7OA 3EG9B 4Z9HA 4KC9A 4U5CE 2IBFA 4G7ZF 2CW0F 3RW0A 4AE4B 1LKXA 1JMWA 2PP4A 4XQ1A 4E0IA 4U5BE 5HV9A 3LEVA 2ETSA 2O9XA 3LS0A 2GDCA 2OEXA 1D1BA 1KNYA 3R7CA 2QLAA 3PDMP 2HV7A 3O55A 4CDVA 4PJLA 4A4AA 1TWCA 2WVOA 3EGXA 1FMVA 3EH1A 2KGOA 3G50A 1NLXA 2UUIA 2LP4A 1UG7A 3GEHA 3LLIA 3UGOA 3A9CA 2NUTB 2GA0A 2P6VA 3JYHA 1Q0GA 3NKEA 1FAPB 4E17A 1OXBA 1QPUA 3AG2C 3RKOF 3QVZA 1ZHTA 5L0GA 2Q7RA 3LEOA 2FGYA 2Y3BA 2CGEA 1NU7D 2R05A 4N6CA 3E70C 2GWWA 3AGTA 5CIVA 1W2WA 2A6HF 3VRCA 1BR4A 1CGNA 3TD7A 5BUOA 1FR0A 4H54A 3FHDA 3UNGC 4E18A 2L6HA 3J06A 2Z15A 2NSFA 3V5YA 5BQGA 3RQFA 2KYHA 3ASNC 3KL4A 1PV3A 3LAYA 1FFHA 4OIQF 3VM6A 5L3QA 1IW7F 4MVQA 4RD9A 4OIPF 2BC5A 4HFFB 1L7CA 3WG7C 4BJ6C 5EHHA 1XWJA 1JAFA 2P0NA 3C8GD 5F5HA 4G78A 4ER9A 1CPQA 3NG1A 4CIHA 5L3VA 2DI3A 4MTOA 3MYIA 2Y39A 5DQZA 2A68F 2YL1A 2QE9A 4XEVA 3WODF 2XSEA 1MMDA 1LI5A 1WOLA 4FX5A 5COMA 4OD4A 4CSAC 5A6AA 2WB7A 3QZCA 3TQOA 3W4YA 4O6MA 1OCRC 1GGQA 2A0UA 4BJ6A 1NG1A 4JTAB 4MVUA 3GM3A 5DS5A 3B0VC 1WATA 4G7HF 5CI9A 2Q4FA 3B71A 2J7PA 2EPNA 1LS4A 2YVKA 1RKEA 3TK0A 2J0WA 2YZSA 4IB4A 5E33A 4D4NA 1VK5A 2HMQA 1WASA 3LLKA 3SEOA 5JVEA 2ZXWC 4CSAA 1YA9A 3Q6NA 5JUAA 2ASRA 4D4XA 1K04A 2J45A 4L6RA 5E3AA 5BQIA 1OKKD 1ZVZA 4OINF 3HKKA 5AGFA 4JJGA 5BQHA 1U89A 4WGYA 3I5QA 1M57C 3SXMA 5KYNA 3OA1A 4M63A 1JPJA 2XXAA 3IPMO 3C8ZA 2R03A 4OD5A 2A6EF 3F47A 4U5HA 1GQAA 2OJED 1XZQA 1TFKB 3NYLA 3FXHA 3GEEA 1T6UA 4HE8D 2YKZA 4NTAA 3F46A 2P61A 3JCUQ 4P9TA 4XWJA 2HJMA 2XLMA 4U9EA 4NQFA 4B6IA 3M1CB 4EWCA 4RDAA 2J9BA 1DOVA 2JD3A 3HNKA 3PMRA 5B1BC 1C17M 3RVYA 3DM5A 2X51A 1H6GA 1LM3B 1YJGA 3ECSA 4N06A 3GANA 2XLVA 4U5FE 4YT5A 3U2MA 3EZHA 3FOPA 4PFOA 3ASOC 1M2VB 2J0XA 4JTCB 2OU6A 1QQ3A 1EI7A 5T3TA 4OIRF 4XLPF 2LCHA 2R7XA 1A41A 2I8BA 3C63A 2OG2A 3MYFA 2R7WA 2GAQA 1V4AA 3MX3A 1GM5A 4AL1A 5AC4A 3SXZA 3IQCA 4EUKB 1GS9A 2R7QA 2KJGA 3KKBA 2H7OA 4P6IC 4GQHA 3T6BA 1T6IA 2YLDA 5DS6A 1RCPA 5KYUB 2YLGA 1NZEA 2LFFA 5AC5A 1E2XA 3DXJF 4GEHA 3S29A 1KU2A 3ABLC 1C02A 3VAYA 5JT4A 4MQ9F 4JEAA 1WWPA 2Q9AA 2XL8A 3N0TA 1TWHA 1MQVA 2YEVA 4J7YA 4U5DE 4RBNA 2HZ8A 4FAPB 4O6NA 3AOUA 4J30B 5L0IA 4MW3A 3IEEA 3GWLA 4CS8C 3KH2A 1OR2A 3R2PA 3WHNA 3GEIA 1QLEC 3U9JA 4IARA 4PJJA 1RKCA 2Y3DA 3X1OA 4DRIB 2A1DD 4J32B 3UMIA 4AX2A 4JURI 2IXNA 1B68A 2HV6A 2V26A 1I4YA 1H9GA 3NYJA 1DOWA 2R25A 4IRUA 1K40A 2IXOA 4PK4A 3IQ5A 4XPYA 5DQTA 5FZTA 4JC7A 4CS7A 4CS8A 2VCAA 2AP3A 4JIOA 2MYSA 3HNJA 1S7ZA 3DI5A 1M56C 3EFOB 3LNRA 3W2VA 1YLMA 2EIKC 1YAUO 3AG1C 2XLHA 4BPMA 4DBRA 1ZHZA 4KNWA 4XLNF 5EGYA 1G8XA 1MMAA 1H7IA 2J7PD 4I1OB 2ZXOA 3M4BA 4WABA 1LPEA 2IM8A 1CPRA 1BBHA 2EINC 1LIHA 5K0IA 2MHRA 5T1DB 1RJ9A 2YL7A 4ZLDA 2HUJA 1JR8A 4WJ0A 2CDQA 3U5SA 1HW2A 5JS5A 3SXKA 3O10A 4NTBA 4DRJB 4NCQA 4IJJA 4E7ZA 5FCLA 3EH2A 2YQYA 1SYQA 2XL6A 2W9YA 1BDJB 2EIJC 3B9QA 4XPXA 4OIOF 2WZFA
chains in the Genus database with same CATH topology
1NFOA 1EA8A 1LS4A 2KC3A 1BZ4A 1YA9A 1H7IA 1LPEA 1OR2A 3R2PA 1LE4A 1AEPA 1OR3A 1LE2A 1GS9A 1B68A 1EQ1A 3S84A 1NFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NFO A;  1EA8 A;  1LS4 A;  2KC3 A;  1BZ4 A;  1YA9 A;  1H7I A;  1LPE A;  1OR2 A;  3R2P A;  1LE4 A;  1AEP A;  1OR3 A;  1LE2 A;  1GS9 A;  1B68 A;  1EQ1 A;  3S84 A;  1NFN A; 
#chains in the Genus database with same CATH topology
 1VLT A;  2VC9 A;  2YL3 A;  4WGZ A;  3ZTM A;  5KYY A;  3JRM O;  2E87 A;  1J8M F;  3EGX B;  2EIM C;  4ULV A;  1HE9 A;  4C3E A;  3FAJ A;  4JW1 A;  5L0C A;  1O5H A;  1ZU4 A;  4IAO A;  3KPH A;  5HSW A;  4QI2 A;  3HNL A;  3S0X A;  1OCO C;  1V55 C;  1E84 A;  4P9F A;  4U5G A;  1WTY A;  3M15 A;  2D5R B;  2R7S A;  4HEA J;  3FAP B;  3NDB B;  2CYD A;  4XPW A;  1ZW2 A;  4BEJ A;  2G3V A;  2WVQ A;  4UDV A;  2HSB A;  4U5E E;  4MVS A;  5DS4 A;  1E83 A;  4XEF A;  2FFH A;  2XL4 A;  4YJW A;  3ZWI A;  5IY5 C;  4Z9I A;  1I5N A;  1V74 B;  4BJ1 A;  2NG1 A;  4ZLC A;  1VYK A;  3DJN B;  3U3F A;  1Y6D A;  2G62 A;  3IQ6 A;  4AL0 A;  1LS1 A;  3DM9 B;  4W8K A;  3TJ5 A;  4EBJ A;  5KYW B;  2Y69 C;  2V3C C;  1G4W R;  4LDQ A;  3QVY A;  3CQZ A;  4E7S A;  4R32 A;  2VCB A;  5F5F A;  3C7J A;  1G5Z A;  1K05 A;  3Q6M A;  3I4U A;  4PJM A;  3L1M A;  4KI2 A;  4JRZ A;  2CNW D;  4BEM J;  1TWG A;  3GOD A;  2R7R A;  1HMO A;  1HW1 A;  1FTS A;  3AJM A;  2YWA A;  2KW3 C;  3T6G B;  2NSG A;  2Y3H A;  4MND A;  3KYI A;  1BR1 A;  2P1A A;  1A7D A;  1F1M A;  1YAR O;  4MVM A;  3UR3 C;  1A7V A;  1D1A A;  2PNO A;  4PJN A;  1RKE B;  2J8W A;  1T9K A;  4JEB A;  2W45 A;  3N24 A;  2QTV A;  3JZ0 A;  3Q7G A;  1OW8 A;  2AWY A;  2MWQ A;  4CDA A;  5L0D A;  1PCX A;  2HS5 A;  5KYX A;  2R02 A;  2UUH A;  3NRH A;  1HE1 A;  1BR2 A;  1MND A;  3H2U A;  3NMK A;  3AG3 C;  3K33 A;  4E0H A;  4EBB A;  1IZM A;  4LLE A;  4BJ5 C;  4LLC A;  2XXA B;  2NPU A;  2DYR C;  2Y3G A;  3CZ6 A;  2EPK X;  4G0H A;  3UMK A;  3UGP A;  1D0X A;  3SXY A;  2OQM A;  3K66 A;  3DAF A;  3DE9 A;  3N2Z B;  2QY9 A;  3LNM B;  2QUP A;  2R7U A;  1S05 A;  1ORS C;  1Y4C A;  3DKA A;  2BE5 F;  2X0C A;  3JSE O;  4IGG A;  1M2O A;  5A6B D;  4K7B A;  4X0R A;  2IXP A;  3DE8 A;  4BJ5 A;  1H9T A;  1ORY A;  1AVO B;  1OCC C;  3S84 A;  5B1A C;  1A0B A;  4K1O A;  1O87 A;  1M6T A;  1MMN A;  3EJN A;  3KYJ A;  3ITF A;  5A6J A;  3K6B A;  4G7O F;  2WL8 A;  1Z7Q c;  2R7T A;  2IYL D;  4W8P A;  2LFD A;  5EK0 A;  1VLS A;  3BRJ A;  1OQC A;  2L6F A;  2JPU A;  3C8G A;  4J7T A;  4MS2 A;  3GOR A;  3NMI A;  1NSG B;  2EPL X;  3RH3 A;  2XLW A;  2C04 A;  2I15 A;  5KYU A;  2HKV A;  4YT2 A;  3IHU A;  3EGD A;  3AQC A;  3U8P A;  3GM2 A;  1SZI A;  1D0Y A;  3TJ6 A;  2NUP A;  3SP1 A;  3SNH A;  2PF4 E;  2YRF A;  4YL0 A;  2TMV P;  2VH3 A;  5TJ5 E;  5D91 A;  3W8H A;  1UFB A;  3SZR A;  1VYI A;  5COG A;  2LSE A;  2G3K A;  3L0I A;  3NKD A;  3RIP A;  4AK9 A;  4DRH B;  4EIY A;  4YL1 A;  3X2Q C;  1JPN A;  4MTG A;  1AUE A;  1Z6A A;  3HNI A;  1QZX A;  3O6X A;  3U2L A;  4JKV A;  3T9O A;  1OW7 A;  1TR2 A;  2AU5 A;  1OCZ C;  1SF8 A;  2YHS A;  5B3S C;  4PAC A;  3Q7L A;  4YK5 A;  4CDY A;  1TQG A;  3AQB A;  3DJU B;  4FWV A;  4NTF A;  1JOG A;  2RD9 A;  2L6G A;  2KC3 A;  3L8J A;  3POV A;  2C03 A;  4Q5S F;  3LES A;  4Q7C A;  3QW0 A;  3LS1 A;  3EG9 A;  2XS8 A;  3A11 A;  1HMD A;  3G4Z A;  3G4X A;  4BJT A;  4AE4 A;  2EPM X;  3SYN A;  4I1M A;  2PFD A;  3RQE A;  1EKY A;  3B29 A;  1YYX A;  2IXM A;  4N6H A;  2XS1 A;  3K1I C;  3ZTZ A;  1U6H A;  1YVI A;  2KSF A;  2PBE A;  5A6K A;  1LE2 A;  4C7O B;  1FFT C;  1TFO B;  1LVK A;  4NC3 A;  2OKU A;  5CI8 A;  3L8I A;  2WZL A;  1Z3I X;  2W4M A;  3S9O A;  3FOO A;  3K1H A;  3ZQY A;  2NUT A;  1Q0D A;  3BEH A;  1YZA A;  4DBQ A;  2H7B A;  3JYY A;  1ZHY A;  3TOM A;  2ZPA A;  2AWC A;  3KMI A;  4JCH A;  2J46 A;  3FVY A;  3EHM A;  2B0H A;  3K1I A;  2CCY A;  1RJ9 B;  3ZQV A;  4JCZ A;  3PHF 2;  1YA7 O;  3HLZ A;  1QKR A;  1ZYR F;  3ZIB A;  1QVX A;  2H8A A;  3S90 A;  4JZA A;  1ZHX A;  1YYJ A;  2OJQ A;  3NMJ A;  1VOM A;  1SR2 A;  1A7E A;  1YZC A;  3IQT A;  4YL3 A;  4U9D A;  3B0U X;  1AEP A;  2EPO A;  4DOZ A;  1D0Z A;  4JE9 A;  3EQL F;  1LI7 A;  3H2V A;  4LAC B;  5B3I A;  4BG0 A;  5KYY B;  4CBE A;  1PD0 A;  3MLG A;  3HTK C;  3T6J A;  1ZU5 A;  1PD1 A;  3MBG A;  3ZG1 A;  5GPG B;  1ST6 A;  2R7V A;  1EA8 A;  1C03 A;  3U0C A;  3ZSU A;  1ZZP A;  4DXW A;  2HMZ A;  1OXK A;  2BL2 A;  4MTF A;  4CIP A;  4CJO A;  2YL0 A;  4MW8 A;  3QMK A;  3EZI A;  2AVK A;  3B0P A;  3UMH A;  4IWB A;  3RF3 A;  3VYW A;  5F28 E;  5E3C A;  256B A;  4FES A;  4ONS A;  1Z5Z A;  2ZXP A;  3RVZ A;  3CEX A;  3RFY A;  3VF0 A;  2ICW G;  5KYW A;  1RMV A;  2H7V C;  1NBB A;  2OCC C;  3V5X A;  1VTM P;  4PR9 A;  1TWA A;  2M64 A;  2WVN A;  3JT1 A;  4MVR A;  4N4W A;  3ABK C;  1EQ1 A;  4LDR A;  4Q4Z F;  4O6Y A;  2OEV A;  3K7D A;  2VB6 A;  1MNE A;  4JVS A;  2A0B A;  4DVY P;  2DGJ A;  4CX9 A;  3JTL O;  1OW6 A;  3FDQ A;  1R4T A;  4QI0 A;  3ZDL A;  2GFH A;  4GYT A;  3U8V A;  4MVZ A;  1E85 A;  4Z9J A;  4A2N B;  3LUT B;  2XM0 A;  3M4C A;  3C62 A;  4IAQ A;  2QNL A;  3DAG A;  3U9M A;  2EIL C;  1O3U A;  1Z63 A;  2Q3T A;  3S27 A;  2R7O A;  3H65 A;  3RYL A;  3WAQ A;  4CS9 C;  5JLI A;  2R9R B;  5JSL A;  3DWW A;  1XZP A;  2LK4 A;  4LDK A;  3T4R A;  1TKN A;  1HY5 A;  2DYS C;  4K0D A;  4EHP A;  5KYX B;  4O7G A;  2J9W A;  3JRT A;  2M4E A;  4MVO A;  1ZHW A;  1M2V A;  2XRH A;  1G4U S;  4LER A;  1E86 A;  5E2Q A;  3U3B A;  1CGO A;  2XLO A;  1ORJ A;  4CS9 A;  3DZA A;  1L3P A;  3LJB A;  3MFN A;  3TOL A;  3PCV A;  1Q0K A;  5A69 A;  1J8Y F;  2ZD9 A;  2VAS A;  4YT8 A;  3I5P A;  3NYM A;  1T01 A;  3W8I A;  4DVZ A;  5L0H A;  3HJC A;  1ZW3 A;  1JRA A;  1BZ4 A;  1SMY F;  2B0J A;  2XM4 A;  3V7O A;  3TUL A;  4NY3 A;  1U0B B;  3AGU A;  1Z23 A;  2A69 F;  1Q0F A;  1D1C A;  3CAX A;  1FMW A;  4HFK B;  3ZVR A;  3OEO A;  3QTH A;  1RXQ A;  2P7V A;  2XLE A;  1CGM E;  1YDI A;  3DD7 A;  1LE4 A;  1VMA A;  3ABM C;  3FMS A;  3W2W A;  2YLI A;  3RQG A;  1T6Q A;  4ULW A;  1N1C A;  3US6 A;  1OR3 A;  2LIG A;  3EHN A;  3GWN A;  4ANJ A;  1APC A;  4C3B A;  5L0J A;  5L0F A;  2Q9C A;  5JP7 A;  2PX0 A;  1FNT c;  2HFI A;  3C8G B;  2RSE B;  4XEK A;  1MMG A;  1NFN A;  1QSP A;  1R5I D;  3ZC4 A;  3C18 A;  3EGD B;  2ZXR A;  2J9U A;  2WZG A;  4EBK A;  4YT4 A;  3OWT A;  2F22 A;  4KNV A;  4YN0 B;  2L81 A;  1T5O A;  2NUP B;  3JSZ A;  3EPV A;  3M79 A;  2CNW A;  1OKK A;  2HJ3 A;  2D4U A;  3GM1 A;  4XTK A;  1NU9 C;  2KQ9 A;  5DLJ A;  4YWQ A;  2JX0 A;  1WGW A;  1V54 C;  2HSQ A;  2PX3 A;  2J9V A;  2KNH A;  2VCC A;  3DMD A;  2L9J A;  2XLD A;  4C3D A;  4I44 A;  3O39 A;  3EFO A;  2Q00 A;  3L34 A;  3E9V A;  4H4K C;  4JTD B;  5T3W A;  4F4B A;  2KK1 A;  2Q9B A;  3V5Z A;  3QW1 A;  4CJG A;  1VB5 A;  4DJ9 A;  5A6B A;  1Q0M A;  4QDL A;  1WN0 A;  3S28 A;  5D92 A;  2DB4 A;  4JJF A;  5COF A;  2LD6 A;  3AG4 C;  5JRA A;  1I4Z A;  4PFP A;  4O79 A;  4EKW A;  2W4B A;  3CSK A;  4I3M A;  4KBL A;  1KTM A;  2IOQ A;  2L7A A;  2LQG A;  3ATP A;  2FAP B;  2OOC A;  5DVW A;  1NFO A;  4C7O A;  3EG9 B;  4Z9H A;  4KC9 A;  4U5C E;  2IBF A;  4G7Z F;  2CW0 F;  3RW0 A;  4AE4 B;  1LKX A;  1JMW A;  2PP4 A;  4XQ1 A;  4E0I A;  4U5B E;  5HV9 A;  3LEV A;  2ETS A;  2O9X A;  3LS0 A;  2GDC A;  2OEX A;  1D1B A;  1KNY A;  3R7C A;  2QLA A;  3PDM P;  2HV7 A;  3O55 A;  4CDV A;  4PJL A;  4A4A A;  1TWC A;  2WVO A;  3EGX A;  1FMV A;  3EH1 A;  2KGO A;  3G50 A;  1NLX A;  2UUI A;  2LP4 A;  1UG7 A;  3GEH A;  3LLI A;  3UGO A;  3A9C A;  2NUT B;  2GA0 A;  2P6V A;  3JYH A;  1Q0G A;  3NKE A;  1FAP B;  4E17 A;  1OXB A;  1QPU A;  3AG2 C;  3RKO F;  3QVZ A;  1ZHT A;  5L0G A;  2Q7R A;  3LEO A;  2FGY A;  2Y3B A;  2CGE A;  1NU7 D;  2R05 A;  4N6C A;  3E70 C;  2GWW A;  3AGT A;  5CIV A;  1W2W A;  2A6H F;  3VRC A;  1BR4 A;  1CGN A;  3TD7 A;  5BUO A;  1FR0 A;  4H54 A;  3FHD A;  3UNG C;  4E18 A;  2L6H A;  3J06 A;  2Z15 A;  2NSF A;  3V5Y A;  5BQG A;  3RQF A;  2KYH A;  3ASN C;  3KL4 A;  1PV3 A;  3LAY A;  1FFH A;  4OIQ F;  3VM6 A;  5L3Q A;  1IW7 F;  4MVQ A;  4RD9 A;  4OIP F;  2BC5 A;  4HFF B;  1L7C A;  3WG7 C;  4BJ6 C;  5EHH A;  1XWJ A;  1JAF A;  2P0N A;  3C8G D;  5F5H A;  4G78 A;  4ER9 A;  1CPQ A;  3NG1 A;  4CIH A;  5L3V A;  2DI3 A;  4MTO A;  3MYI A;  2Y39 A;  5DQZ A;  2A68 F;  2YL1 A;  2QE9 A;  4XEV A;  3WOD F;  2XSE A;  1MMD A;  1LI5 A;  1WOL A;  4FX5 A;  5COM A;  4OD4 A;  4CSA C;  5A6A A;  2WB7 A;  3QZC A;  3TQO A;  3W4Y A;  4O6M A;  1OCR C;  1GGQ A;  2A0U A;  4BJ6 A;  1NG1 A;  4JTA B;  4MVU A;  3GM3 A;  5DS5 A;  3B0V C;  1WAT A;  4G7H F;  5CI9 A;  2Q4F A;  3B71 A;  2J7P A;  2EPN A;  1LS4 A;  2YVK A;  1RKE A;  3TK0 A;  2J0W A;  2YZS A;  4IB4 A;  5E33 A;  4D4N A;  1VK5 A;  2HMQ A;  1WAS A;  3LLK A;  3SEO A;  5JVE A;  2ZXW C;  4CSA A;  1YA9 A;  3Q6N A;  5JUA A;  2ASR A;  4D4X A;  1K04 A;  2J45 A;  4L6R A;  5E3A A;  5BQI A;  1OKK D;  1ZVZ A;  4OIN F;  3HKK A;  5AGF A;  4JJG A;  5BQH A;  1U89 A;  4WGY A;  3I5Q A;  1M57 C;  3SXM A;  5KYN A;  3OA1 A;  4M63 A;  1JPJ A;  2XXA A;  3IPM O;  3C8Z A;  2R03 A;  4OD5 A;  2A6E F;  3F47 A;  4U5H A;  1GQA A;  2OJE D;  1XZQ A;  1TFK B;  3NYL A;  3FXH A;  3GEE A;  1T6U A;  4HE8 D;  2YKZ A;  4NTA A;  3F46 A;  2P61 A;  3JCU Q;  4P9T A;  4XWJ A;  2HJM A;  2XLM A;  4U9E A;  4NQF A;  4B6I A;  3M1C B;  4EWC A;  4RDA A;  2J9B A;  1DOV A;  2JD3 A;  3HNK A;  3PMR A;  5B1B C;  1C17 M;  3RVY A;  3DM5 A;  2X51 A;  1H6G A;  1LM3 B;  1YJG A;  3ECS A;  4N06 A;  3GAN A;  2XLV A;  4U5F E;  4YT5 A;  3U2M A;  3EZH A;  3FOP A;  4PFO A;  3ASO C;  1M2V B;  2J0X A;  4JTC B;  2OU6 A;  1QQ3 A;  1EI7 A;  5T3T A;  4OIR F;  4XLP F;  2LCH A;  2R7X A;  1A41 A;  2I8B A;  3C63 A;  2OG2 A;  3MYF A;  2R7W A;  2GAQ A;  1V4A A;  3MX3 A;  1GM5 A;  4AL1 A;  5AC4 A;  3SXZ A;  3IQC A;  4EUK B;  1GS9 A;  2R7Q A;  2KJG A;  3KKB A;  2H7O A;  4P6I C;  4GQH A;  3T6B A;  1T6I A;  2YLD A;  5DS6 A;  1RCP A;  5KYU B;  2YLG A;  1NZE A;  2LFF A;  5AC5 A;  1E2X A;  3DXJ F;  4GEH A;  3S29 A;  1KU2 A;  3ABL C;  1C02 A;  3VAY A;  5JT4 A;  4MQ9 F;  4JEA A;  1WWP A;  2Q9A A;  2XL8 A;  3N0T A;  1TWH A;  1MQV A;  2YEV A;  4J7Y A;  4U5D E;  4RBN A;  2HZ8 A;  4FAP B;  4O6N A;  3AOU A;  4J30 B;  5L0I A;  4MW3 A;  3IEE A;  3GWL A;  4CS8 C;  3KH2 A;  1OR2 A;  3R2P A;  3WHN A;  3GEI A;  1QLE C;  3U9J A;  4IAR A;  4PJJ A;  1RKC A;  2Y3D A;  3X1O A;  4DRI B;  2A1D D;  4J32 B;  3UMI A;  4AX2 A;  4JUR I;  2IXN A;  1B68 A;  2HV6 A;  2V26 A;  1I4Y A;  1H9G A;  3NYJ A;  1DOW A;  2R25 A;  4IRU A;  1K40 A;  2IXO A;  4PK4 A;  3IQ5 A;  4XPY A;  5DQT A;  5FZT A;  4JC7 A;  4CS7 A;  4CS8 A;  2VCA A;  2AP3 A;  4JIO A;  2MYS A;  3HNJ A;  1S7Z A;  3DI5 A;  1M56 C;  3EFO B;  3LNR A;  3W2V A;  1YLM A;  2EIK C;  1YAU O;  3AG1 C;  2XLH A;  4BPM A;  4DBR A;  1ZHZ A;  4KNW A;  4XLN F;  5EGY A;  1G8X A;  1MMA A;  1H7I A;  2J7P D;  4I1O B;  2ZXO A;  3M4B A;  4WAB A;  1LPE A;  2IM8 A;  1CPR A;  1BBH A;  2EIN C;  1LIH A;  5K0I A;  2MHR A;  5T1D B;  1RJ9 A;  2YL7 A;  4ZLD A;  2HUJ A;  1JR8 A;  4WJ0 A;  2CDQ A;  3U5S A;  1HW2 A;  5JS5 A;  3SXK A;  3O10 A;  4NTB A;  4DRJ B;  4NCQ A;  4IJJ A;  4E7Z A;  5FCL A;  3EH2 A;  2YQY A;  1SYQ A;  2XL6 A;  2W9Y A;  1BDJ B;  2EIJ C;  3B9Q A;  4XPX A;  4OIO F;  2WZF A; 
#chains in the Genus database with same CATH homology
 1NFO A;  1EA8 A;  1LS4 A;  2KC3 A;  1BZ4 A;  1YA9 A;  1H7I A;  1LPE A;  1OR2 A;  3R2P A;  1LE4 A;  1AEP A;  1OR3 A;  1LE2 A;  1GS9 A;  1B68 A;  1EQ1 A;  3S84 A;  1NFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...