1GS9A

Apolipoprotein e4, 22k domain
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
144
structure length
144
Chain Sequence
SGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the 22K Domain of Human Apolipoprotein E4
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords APOLIPOPROTEIN E
total genus 65
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2002-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1gs9A00
1OR3A 1BZ4A 3R2PA 1LPEA 2KC3A 1LS4A 1EQ1A 1OR2A 1EA8A 1B68A 1H7IA 1LE2A 3S84A 1GS9A 1LE4A 1YA9A 1AEPA 1NFNA 1NFOA
chains in the Genus database with same CATH superfamily
3DMDA 1R5ID 4BJ1A 1HW1A 1NZEA 3HLZA 2R02A 1I4YA 2NSFA 3Q6MA 1BBHA 2J9VA 1NLXA 4W8PA 2XM4A 5A6BA 2X0CA 4BEMJ 1HE9A 4OINF 3MLGA 4Q7CA 4CJGA 2V3CC 2OJED 1T6UA 1NFNA 4L6RA 2OOCA 4RDAA 1J8YF 3E70C 1ZU4A 4JIOA 2EPMX 3BEHA 1DOWA 4YK5A 3ZG1A 1V55C 3LJBA 3U3FA 4D4NA 4JW1A 3NMJA 3T6BA 3U9MA 5FZTA 1H9GA 5DS4A 2YKZA 2HSQA 5CIVA 3QW1A 4JEBA 5L3QA 2R7XA 1D0YA 1UG7A 2IM8A 3RQEA 3GM2A 1F1MA 1V74B 1CPQA 1VYIA 2P61A 3JSZA 2KC3A 2J9BA 3B0VC 1TWAA 4MTGA 1OR2A 5F5FA 1BDJB 1JPNA 4IJJA 3UMHA 4JCZA 3SXZA 2IXNA 4XPYA 4I44A 4NTBA 1M2VA 4IRUA 2HMQA 5KYUA 2J7PA 2QNLA 3EQLF 4NQFA 1OQCA 4CDAA 2KGOA 1K05A 2XL8A 3G50A 2VC9A 1G5ZA 1ORJA 2ZD9A 3Q7GA 3DM5A 3RVYA 5DLJA 1HW2A 1JRAA 3RFYA 1T6QA 3QTHA 2R7UA 3Q7LA 2HFIA 3EHMA 2XXAA 1YYJA 5TJ5E 5JUAA 1C17M 1SYQA 2YLDA 4K7BA 5COFA 4CSAA 3C8ZA 1CGME 4DBRA 1A7EA 2UUHA 3H2VA 3IQCA 4AX2A 1L7CA 1LKXA 2V26A 256BA 2PX0A 2EPOA 4M63A 5JSLA 2ICWG 3F47A 1C02A 2PX3A 4BG0A 4XLPF 4BJ6A 2WVOA 1OW7A 2J9WA 2EINC 2A69F 1SF8A 4JVSA 2NUPA 3X2QC 1PCXA 4PK4A 2R05A 3CZ6A 4C3EA 4YJWA 4K0DA 3BRJA 1WTYA 4PJJA 1NBBA 2D4UA 1Q0DA 1YA7O 2IXMA 3C63A 4CDVA 2L7AA 4DBQA 4G7ZF 3CQZA 1Z3IX 1GGQA 2Q7RA 2OEVA 1U0BB 3RW0A 2RSEB 2AWCA 1TFKB 3EGDA 3SXKA 3PDMP 4IARA 1OXBA 3U2MA 1JR8A 4BJ5A 4DJ9A 3FDQA 1EKYA 2M64A 1FFTC 3NYLA 5JS5A 3R2PA 4DVZA 2P1AA 2R03A 3GM3A 4JE9A 4LLEA 2R7VA 1B68A 2ZPAA 4W8KA 1GS9A 2Y39A 5BQIA 1E83A 3DZAA 3L8JA 2HMZA 2WZLA 2XM0A 3TJ6A 3GEIA 1A41A 1V4AA 1IZMA 1C03A 1O87A 3L34A 4EUKB 3EJNA 4MW8A 3S27A 2EIKC 3LS0A 5B3SC 3HNKA 3DAGA 2PF4E 2R25A 5L3VA 2JPUA 3KYIA 4HFKB 3RVZA 1BR4A 5KYWB 4H4KC 1A7DA 2NSGA 2A6EF 1OW8A 3U5SA 4ER9A 4EWCA 2QLAA 3LNRA 3C7JA 3PCVA 2WZGA 2Y69C 1TFOB 2Y3BA 1PD0A 2Q3TA 4JJFA 1SZIA 5EHHA 3H2UA 1AVOB 2XLWA 1UFBA 2RD9A 1DOVA 3VF0A 3UNGC 2NUTA 2WZFA 3EG9B 2DYSC 5IY5C 1NSGB 1VLSA 1TWHA 5BUOA 5A6BD 2LCHA 4QI0A 4KNWA 3T4RA 4U5HA 1YZAA 3EGXB 4PFOA 3ZVRA 2H7BA 5T1DB 3LS1A 1TKNA 3T6JA 1BZ4A 2LFFA 2EIJC 5KYNA 1TR2A 1I4ZA 4O6NA 4HEAJ 4O7GA 2D5RB 3JSEO 1RKCA 4RD9A 4FWVA 2G62A 1FFHA 4CS8A 4JURI 1XZPA 3ZQYA 3EZHA 3SZRA 5L0JA 2WVNA 2L6HA 1JAFA 4LDKA 2EPNA 3EFOB 2A0UA 3UMKA 2CCYA 2IXPA 3LAYA 4JKVA 4EBKA 5D92A 2F22A 3U2LA 4C3DA 2EILC 4CIHA 4Z9JA 5AGFA 1G4WR 4MVSA 2DB4A 3W2VA 3ZWIA 4H54A 4XEFA 2CNWA 4CDYA 3NMIA 1LI7A 1S7ZA 4DOZA 5JLIA 4MS2A 2ZXWC 3CAXA 3JZ0A 1D1AA 2LD6A 3ZDLA 4E0IA 1YDIA 3SYNA 2R7RA 4A4AA 2FGYA 4NY3A 4BPMA 4E17A 4YL3A 4XEVA 1YVIA 2GWWA 1APCA 3I5QA 4J7YA 1LS4A 3L8IA 5HSWA 1Z7Qc 1ZVZA 4ANJA 5COMA 3AQBA 1WOLA 1JOGA 2G3VA 3KYJA 3VAYA 5HV9A 1H9TA 3QW0A 1CPRA 2A1DD 3LEOA 3T9OA 2J0XA 1VB5A 2IYLD 3LLIA 4G78A 5COGA 2R7TA 2FAPB 5AC5A 1BR2A 4D4XA 1ZHXA 1H7IA 4U9EA 1A0BA 2H8AA 2ZXOA 2NPUA 2OEXA 4LLCA 1RJ9B 3AJMA 2YL7A 1RKEB 5DVWA 4MTFA 2XL4A 3C8GB 3B9QA 3EPVA 4PR9A 2C03A 3IQ5A 3LESA 4N6HA 1QPUA 4AE4A 3RQGA 3AG1C 3S29A 2NG1A 2DI3A 4DXWA 4KC9A 3SEOA 3S0XA 3AG4C 3U8VA 3R7CA 1CGOA 1T9KA 2A0BA 3SP1A 3DJUB 3E9VA 5DS5A 3NMKA 1ZYRF 3IHUA 3RH3A 5B1AC 2YL3A 5A69A 2PNOA 3AGTA 2YWAA 2YHSA 3SXYA 1JPJA 1O3UA 2XLVA 4LDQA 3EZIA 1YA9A 3PMRA 4XQ1A 1L3PA 1LM3B 2LQGA 3NRHA 3MX3A 2R7WA 4E0HA 3M4CA 1TQGA 4DRHB 2EPLX 2VASA 2OG2A 1GQAA 3L0IA 2J9UA 5B1BC 4JTDB 1NFOA 1VMAA 3S84A 2R7SA 1ZHTA 3X1OA 2J45A 4FX5A 1U89A 2E87A 3EH1A 5L0CA 1I5NA 2ASRA 4JTCB 2FFHA 2CW0F 3GEEA 4WJ0A 2YLIA 5L0FA 3EH2A 1FMVA 1NG1A 3ITFA 3TJ5A 4EKWA 2L81A 1D0XA 2HKVA 2ZXRA 3W2WA 4YT8A 4ZLCA 1Y4CA 2AU5A 2CYDA 2R9RB 2XRHA 4MVRA 2Q9AA 4YL0A 3T6GB 3NKDA 2I15A 2GA0A 4IAQA 4MVUA 4ONSA 2XXAB 4KBLA 1S05A 3S28A 3CEXA 4OD5A 2A68F 1D1BA 4YWQA 2KYHA 2QTVA 4EBJA 4XLNF 5A6AA 1IW7F 2Q00A 4BEJA 4MVOA 2XLHA 1FNTc 3W4YA 4YT2A 2KSFA 4CX9A 3N2ZB 4UDVA 1M2VB 1FAPB 4IB4A 4OIOF 4IGGA 3S9OA 4A2NB 3WAQA 3O55A 2PP4A 2G3KA 4Z9IA 3C8GA 3FOPA 4J7TA 3K1IC 1RJ9A 3JYYA 5L0HA 5L0IA 4DRJB 2W4BA 1Q0GA 2AP3A 2J8WA 3HJCA 3I4UA 2CDQA 1G8XA 1O5HA 2QE9A 5F28E 2JX0A 1QKRA 4PJMA 2OCCC 1KTMA 1ZHYA 3FHDA 2Z15A 3O10A 3UMIA 2B0JA 3B0UX 1T5OA 4JC7A 3U9JA 2HZ8A 1HE1A 5JT4A 3ZIBA 1KU2A 4GYTA 3DI5A 2ETSA 1Q0MA 2HSBA 4U5GA 4BJ5C 3AQCA 5L0GA 2EIMC 2LP4A 1R4TA 3KPHA 2YQYA 3DKAA 4FAPB 2Y3GA 1LVKA 2GFHA 2YL1A 2KW3C 4DRIB 3K1HA 3FXHA 4I1OB 4HFFB 3RKOF 3US6A 3N24A 3GWNA 1WATA 5D91A 2KNHA 3CSKA 2EPKX 3QVZA 5CI8A 1SMYF 4U9DA 3WG7C 4FESA 4XPXA 3QZCA 2OJQA 4KNVA 3ZTMA 2XS8A 3HKKA 4J30B 1MMDA 3TOLA 1QLEC 1ST6A 4ULVA 5L0DA 3ASOC 5B3IA 1FR0A 1FMWA 1M57C 5T3WA 3DM9B 5E3CA 3OA1A 1M2OA 4NCQA 4OIRF 4C7OB 1CGNA 4JRZA 2MHRA 2GDCA 1PD1A 1YLMA 3KMIA 2OQMA 1QVXA 3A11A 3OWTA 4LERA 1M6TA 3JYHA 3L1MA 1N1CA 4NTAA 1YAUO 3GM1A 4J32B 2VH3A 4C3BA 2XLEA 1WWPA 5A6KA 5CI9A 2XSEA 4I3MA 2Y3HA 3IQTA 4EBBA 4E7ZA 4X0RA 3H65A 2Y3DA 5JP7A 3DWWA 3KL4A 1OKKD 4I1MA 1K04A 1AEPA 3EG9A 3MYFA 4N4WA 1OKKA 4PJLA 1MMNA 4U5EE 3DD7A 1YYXA 2HJMA 2HV7A 3FVYA 3MFNA 2IOQA 3EGDB 3ZSUA 1PV3A 1K40A 2XL6A 3M79A 3IEEA 3MBGA 4PACA 4CS7A 1OR3A 3MYIA 3NYJA 4P9FA 2YZSA 1OXKA 3G4ZA 3O6XA 2BL2A 2P0NA 3PHF2 3AG2C 3M4BA 1OW6A 1MNDA 4N06A 2NUPB 4YT4A 1HMDA 2AWYA 2VCBA 4AK9A 2WVQA 2CGEA 4E7SA 3GEHA 4OD4A 3V5YA 1RMVA 1ZHZA 3GODA 3GWLA 4MVMA 1ZU5A 3K66A 3KH2A 4QDLA 4F4BA 3C8GD 1OCRC 3U3BA 1VLTA 2YRFA 1YARO 1ZHWA 3M1CB 3LUTB 3ABMC 3NYMA 1QQ3A 4GEHA 4N6CA 3UR3C 3NG1A 4Z9HA 2XS1A 4CS9C 2P6VA 2XLOA 2XLMA 3AG3C 2Q9CA 2J0WA 2L6GA 2OU6A 2W4MA 2PBEA 4O6MA 2W45A 2VB6A 3JRTA 4YT5A 4WGYA 3HNIA 4JCHA 3RYLA 4CSAC 3NDBB 3OEOA 2QY9A 3A9CA 4P6IC 3W8HA 1HMOA 2PFDA 4MNDA 3GANA 1YZCA 3TD7A 4BJ6C 3LNMB 1NU9C 4O79A 1Z5ZA 3RQFA 3WODF 1Q0FA 4P9TA 4AE4B 5FCLA 2CNWD 5KYYA 4OIQF 1ORSC 1AUEA 3M15A 4WGZA 5GPGB 3V5XA 3UGPA 5KYYB 1ZZPA 5BQGA 3SNHA 2LK4A 1RKEA 3DXJF 2R7QA 4JZAA 3AGUA 3K33A 3TQOA 4MTOA 1Q0KA 3S90A 3VM6A 3V7OA 2B0HA 1WN0A 2VCAA 2H7OA 2WL8A 3QMKA 4MQ9F 4CBEA 1GM5A 3N0TA 3ZTZA 5KYXB 4JEAA 2HV6A 4ULWA 4IAOA 5KYXA 1E84A 2BC5A 5KYUB 1VK5A 4Q4ZF 2LFDA 2JD3A 1Z63A 1MQVA 4K1OA 4U5BE 3ASNC 5BQHA 1D0ZA 2AVKA 4U5FE 3UGOA 5DQTA 4PJNA 3K6BA 1LPEA 5E3AA 4CIPA 1RXQA 5DS6A 1OCCC 3RF3A 2MYSA 5EK0A 4EIYA 2X51A 1MNEA 4O6YA 3POVA 1Y6DA 2DGJA 3ABLC 4JJGA 3ABKC 1MMAA 2MWQA 1SR2A 1XZQA 1NU7D 3GORA 3JT1A 1J8MF 3SXMA 1FTSA 1VYKA 4MVQA 1LE2A 3WHNA 2VCCA 1ZW2A 4LDRA 3AOUA 1XWJA 3HNLA 5T3TA 2DYRC 2OKUA 4YN0B 4AL1A 2I8BA 4CS8C 3EFOA 2H7VC 3LEVA 4NC3A 3FMSA 1LE4A 4EHPA 5JVEA 1BR1A 5E33A 4OIPF 4MVZA 1EI7A 3O39A 3ZQVA 4XEKA 3EHNA 5AC4A 1VTMP 3U8PA 4QI2A 3DE8A 4HE8D 4R32A 3IQ6A 1M56C 1OCOC 3RIPA 3TULA 2J7PD 3IPMO 2Q4FA 3VRCA 3V5ZA 4CS9A 2A6HF 1OCZC 1G4US 2C04A 2HUJA 3HTKC 5EGYA 2M4EA 4MW3A 5F5HA 3JRMO 1TWCA 4IWBA 3FAJA 5E2QA 1HY5A 3ATPA 3F46A 4RBNA 3U0CA 1ORYA 4B6IA 4LACB 4C7OA 3NKEA 1JMWA 3C18A 3EGXA 2Q9BA 3B71A 2YVKA 3QVYA 2IBFA 1LIHA 4Q5SF 3JCUQ 4KI2A 2UUIA 1D1CA 2LSEA 4BJTA 3DE9A 4NTFA 1MMGA 5A6JA 1QSPA 3G4XA 1VOMA 1U6HA 1TWGA 3B29A 4PFPA 1KNYA 3TOMA 4E18A 3LLKA 2KJGA 3ZC4A 5JRAA 2ZXPA 2KK1A 2HJ3A 3JTLO 1LS1A 3K7DA 4U5DE 3VYWA 1RCPA 3FOOA 5DQZA 5KYWA 1YJGA 3K1IA 2J46A 2QUPA 3B0PA 3DJNB 2W9YA 4XTKA 1V54C 1W2WA 2XLDA 1WASA 1Z23A 2HS5A 2YL0A 1E2XA 2P7VA 4CJOA 2L9JA 4G0HA 3W8IA 2GAQA 5K0IA 3Q6NA 4DVYP 3TK0A 2R7OA 1E86A 2O9XA 2YLGA 4GQHA 1T6IA 1E85A 3FAPB 3HNJA 1H6GA 2BE5F 1QZXA 4ZLDA 3KKBA 3I5PA 3J06A 2WB7A 2LIGA 1Z6AA 2TMVP 2NUTB 4XWJA 3ECSA 1LI5A 2YEVA 2L6FA 2IXOA 4G7HF 4G7OF 2KQ9A 3DAFA 1EQ1A 1T01A 4U5CE 1A7VA 1EA8A 1WGWA 3C62A 1ZW3A 4WABA 4YL1A 4XPWA 4JTAB 4AL0A
chains in the Genus database with same CATH topology
1OR3A 1BZ4A 3R2PA 1LPEA 2KC3A 1LS4A 1EQ1A 1OR2A 1EA8A 1B68A 1H7IA 1LE2A 3S84A 1GS9A 1LE4A 1YA9A 1AEPA 1NFNA 1NFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OR3 A;  1BZ4 A;  3R2P A;  1LPE A;  2KC3 A;  1LS4 A;  1EQ1 A;  1OR2 A;  1EA8 A;  1B68 A;  1H7I A;  1LE2 A;  3S84 A;  1GS9 A;  1LE4 A;  1YA9 A;  1AEP A;  1NFN A;  1NFO A; 
#chains in the Genus database with same CATH topology
 3DMD A;  1R5I D;  4BJ1 A;  1HW1 A;  1NZE A;  3HLZ A;  2R02 A;  1I4Y A;  2NSF A;  3Q6M A;  1BBH A;  2J9V A;  1NLX A;  4W8P A;  2XM4 A;  5A6B A;  2X0C A;  4BEM J;  1HE9 A;  4OIN F;  3MLG A;  4Q7C A;  4CJG A;  2V3C C;  2OJE D;  1T6U A;  1NFN A;  4L6R A;  2OOC A;  4RDA A;  1J8Y F;  3E70 C;  1ZU4 A;  4JIO A;  2EPM X;  3BEH A;  1DOW A;  4YK5 A;  3ZG1 A;  1V55 C;  3LJB A;  3U3F A;  4D4N A;  4JW1 A;  3NMJ A;  3T6B A;  3U9M A;  5FZT A;  1H9G A;  5DS4 A;  2YKZ A;  2HSQ A;  5CIV A;  3QW1 A;  4JEB A;  5L3Q A;  2R7X A;  1D0Y A;  1UG7 A;  2IM8 A;  3RQE A;  3GM2 A;  1F1M A;  1V74 B;  1CPQ A;  1VYI A;  2P61 A;  3JSZ A;  2KC3 A;  2J9B A;  3B0V C;  1TWA A;  4MTG A;  1OR2 A;  5F5F A;  1BDJ B;  1JPN A;  4IJJ A;  3UMH A;  4JCZ A;  3SXZ A;  2IXN A;  4XPY A;  4I44 A;  4NTB A;  1M2V A;  4IRU A;  2HMQ A;  5KYU A;  2J7P A;  2QNL A;  3EQL F;  4NQF A;  1OQC A;  4CDA A;  2KGO A;  1K05 A;  2XL8 A;  3G50 A;  2VC9 A;  1G5Z A;  1ORJ A;  2ZD9 A;  3Q7G A;  3DM5 A;  3RVY A;  5DLJ A;  1HW2 A;  1JRA A;  3RFY A;  1T6Q A;  3QTH A;  2R7U A;  3Q7L A;  2HFI A;  3EHM A;  2XXA A;  1YYJ A;  5TJ5 E;  5JUA A;  1C17 M;  1SYQ A;  2YLD A;  4K7B A;  5COF A;  4CSA A;  3C8Z A;  1CGM E;  4DBR A;  1A7E A;  2UUH A;  3H2V A;  3IQC A;  4AX2 A;  1L7C A;  1LKX A;  2V26 A;  256B A;  2PX0 A;  2EPO A;  4M63 A;  5JSL A;  2ICW G;  3F47 A;  1C02 A;  2PX3 A;  4BG0 A;  4XLP F;  4BJ6 A;  2WVO A;  1OW7 A;  2J9W A;  2EIN C;  2A69 F;  1SF8 A;  4JVS A;  2NUP A;  3X2Q C;  1PCX A;  4PK4 A;  2R05 A;  3CZ6 A;  4C3E A;  4YJW A;  4K0D A;  3BRJ A;  1WTY A;  4PJJ A;  1NBB A;  2D4U A;  1Q0D A;  1YA7 O;  2IXM A;  3C63 A;  4CDV A;  2L7A A;  4DBQ A;  4G7Z F;  3CQZ A;  1Z3I X;  1GGQ A;  2Q7R A;  2OEV A;  1U0B B;  3RW0 A;  2RSE B;  2AWC A;  1TFK B;  3EGD A;  3SXK A;  3PDM P;  4IAR A;  1OXB A;  3U2M A;  1JR8 A;  4BJ5 A;  4DJ9 A;  3FDQ A;  1EKY A;  2M64 A;  1FFT C;  3NYL A;  5JS5 A;  3R2P A;  4DVZ A;  2P1A A;  2R03 A;  3GM3 A;  4JE9 A;  4LLE A;  2R7V A;  1B68 A;  2ZPA A;  4W8K A;  1GS9 A;  2Y39 A;  5BQI A;  1E83 A;  3DZA A;  3L8J A;  2HMZ A;  2WZL A;  2XM0 A;  3TJ6 A;  3GEI A;  1A41 A;  1V4A A;  1IZM A;  1C03 A;  1O87 A;  3L34 A;  4EUK B;  3EJN A;  4MW8 A;  3S27 A;  2EIK C;  3LS0 A;  5B3S C;  3HNK A;  3DAG A;  2PF4 E;  2R25 A;  5L3V A;  2JPU A;  3KYI A;  4HFK B;  3RVZ A;  1BR4 A;  5KYW B;  4H4K C;  1A7D A;  2NSG A;  2A6E F;  1OW8 A;  3U5S A;  4ER9 A;  4EWC A;  2QLA A;  3LNR A;  3C7J A;  3PCV A;  2WZG A;  2Y69 C;  1TFO B;  2Y3B A;  1PD0 A;  2Q3T A;  4JJF A;  1SZI A;  5EHH A;  3H2U A;  1AVO B;  2XLW A;  1UFB A;  2RD9 A;  1DOV A;  3VF0 A;  3UNG C;  2NUT A;  2WZF A;  3EG9 B;  2DYS C;  5IY5 C;  1NSG B;  1VLS A;  1TWH A;  5BUO A;  5A6B D;  2LCH A;  4QI0 A;  4KNW A;  3T4R A;  4U5H A;  1YZA A;  3EGX B;  4PFO A;  3ZVR A;  2H7B A;  5T1D B;  3LS1 A;  1TKN A;  3T6J A;  1BZ4 A;  2LFF A;  2EIJ C;  5KYN A;  1TR2 A;  1I4Z A;  4O6N A;  4HEA J;  4O7G A;  2D5R B;  3JSE O;  1RKC A;  4RD9 A;  4FWV A;  2G62 A;  1FFH A;  4CS8 A;  4JUR I;  1XZP A;  3ZQY A;  3EZH A;  3SZR A;  5L0J A;  2WVN A;  2L6H A;  1JAF A;  4LDK A;  2EPN A;  3EFO B;  2A0U A;  3UMK A;  2CCY A;  2IXP A;  3LAY A;  4JKV A;  4EBK A;  5D92 A;  2F22 A;  3U2L A;  4C3D A;  2EIL C;  4CIH A;  4Z9J A;  5AGF A;  1G4W R;  4MVS A;  2DB4 A;  3W2V A;  3ZWI A;  4H54 A;  4XEF A;  2CNW A;  4CDY A;  3NMI A;  1LI7 A;  1S7Z A;  4DOZ A;  5JLI A;  4MS2 A;  2ZXW C;  3CAX A;  3JZ0 A;  1D1A A;  2LD6 A;  3ZDL A;  4E0I A;  1YDI A;  3SYN A;  2R7R A;  4A4A A;  2FGY A;  4NY3 A;  4BPM A;  4E17 A;  4YL3 A;  4XEV A;  1YVI A;  2GWW A;  1APC A;  3I5Q A;  4J7Y A;  1LS4 A;  3L8I A;  5HSW A;  1Z7Q c;  1ZVZ A;  4ANJ A;  5COM A;  3AQB A;  1WOL A;  1JOG A;  2G3V A;  3KYJ A;  3VAY A;  5HV9 A;  1H9T A;  3QW0 A;  1CPR A;  2A1D D;  3LEO A;  3T9O A;  2J0X A;  1VB5 A;  2IYL D;  3LLI A;  4G78 A;  5COG A;  2R7T A;  2FAP B;  5AC5 A;  1BR2 A;  4D4X A;  1ZHX A;  1H7I A;  4U9E A;  1A0B A;  2H8A A;  2ZXO A;  2NPU A;  2OEX A;  4LLC A;  1RJ9 B;  3AJM A;  2YL7 A;  1RKE B;  5DVW A;  4MTF A;  2XL4 A;  3C8G B;  3B9Q A;  3EPV A;  4PR9 A;  2C03 A;  3IQ5 A;  3LES A;  4N6H A;  1QPU A;  4AE4 A;  3RQG A;  3AG1 C;  3S29 A;  2NG1 A;  2DI3 A;  4DXW A;  4KC9 A;  3SEO A;  3S0X A;  3AG4 C;  3U8V A;  3R7C A;  1CGO A;  1T9K A;  2A0B A;  3SP1 A;  3DJU B;  3E9V A;  5DS5 A;  3NMK A;  1ZYR F;  3IHU A;  3RH3 A;  5B1A C;  2YL3 A;  5A69 A;  2PNO A;  3AGT A;  2YWA A;  2YHS A;  3SXY A;  1JPJ A;  1O3U A;  2XLV A;  4LDQ A;  3EZI A;  1YA9 A;  3PMR A;  4XQ1 A;  1L3P A;  1LM3 B;  2LQG A;  3NRH A;  3MX3 A;  2R7W A;  4E0H A;  3M4C A;  1TQG A;  4DRH B;  2EPL X;  2VAS A;  2OG2 A;  1GQA A;  3L0I A;  2J9U A;  5B1B C;  4JTD B;  1NFO A;  1VMA A;  3S84 A;  2R7S A;  1ZHT A;  3X1O A;  2J45 A;  4FX5 A;  1U89 A;  2E87 A;  3EH1 A;  5L0C A;  1I5N A;  2ASR A;  4JTC B;  2FFH A;  2CW0 F;  3GEE A;  4WJ0 A;  2YLI A;  5L0F A;  3EH2 A;  1FMV A;  1NG1 A;  3ITF A;  3TJ5 A;  4EKW A;  2L81 A;  1D0X A;  2HKV A;  2ZXR A;  3W2W A;  4YT8 A;  4ZLC A;  1Y4C A;  2AU5 A;  2CYD A;  2R9R B;  2XRH A;  4MVR A;  2Q9A A;  4YL0 A;  3T6G B;  3NKD A;  2I15 A;  2GA0 A;  4IAQ A;  4MVU A;  4ONS A;  2XXA B;  4KBL A;  1S05 A;  3S28 A;  3CEX A;  4OD5 A;  2A68 F;  1D1B A;  4YWQ A;  2KYH A;  2QTV A;  4EBJ A;  4XLN F;  5A6A A;  1IW7 F;  2Q00 A;  4BEJ A;  4MVO A;  2XLH A;  1FNT c;  3W4Y A;  4YT2 A;  2KSF A;  4CX9 A;  3N2Z B;  4UDV A;  1M2V B;  1FAP B;  4IB4 A;  4OIO F;  4IGG A;  3S9O A;  4A2N B;  3WAQ A;  3O55 A;  2PP4 A;  2G3K A;  4Z9I A;  3C8G A;  3FOP A;  4J7T A;  3K1I C;  1RJ9 A;  3JYY A;  5L0H A;  5L0I A;  4DRJ B;  2W4B A;  1Q0G A;  2AP3 A;  2J8W A;  3HJC A;  3I4U A;  2CDQ A;  1G8X A;  1O5H A;  2QE9 A;  5F28 E;  2JX0 A;  1QKR A;  4PJM A;  2OCC C;  1KTM A;  1ZHY A;  3FHD A;  2Z15 A;  3O10 A;  3UMI A;  2B0J A;  3B0U X;  1T5O A;  4JC7 A;  3U9J A;  2HZ8 A;  1HE1 A;  5JT4 A;  3ZIB A;  1KU2 A;  4GYT A;  3DI5 A;  2ETS A;  1Q0M A;  2HSB A;  4U5G A;  4BJ5 C;  3AQC A;  5L0G A;  2EIM C;  2LP4 A;  1R4T A;  3KPH A;  2YQY A;  3DKA A;  4FAP B;  2Y3G A;  1LVK A;  2GFH A;  2YL1 A;  2KW3 C;  4DRI B;  3K1H A;  3FXH A;  4I1O B;  4HFF B;  3RKO F;  3US6 A;  3N24 A;  3GWN A;  1WAT A;  5D91 A;  2KNH A;  3CSK A;  2EPK X;  3QVZ A;  5CI8 A;  1SMY F;  4U9D A;  3WG7 C;  4FES A;  4XPX A;  3QZC A;  2OJQ A;  4KNV A;  3ZTM A;  2XS8 A;  3HKK A;  4J30 B;  1MMD A;  3TOL A;  1QLE C;  1ST6 A;  4ULV A;  5L0D A;  3ASO C;  5B3I A;  1FR0 A;  1FMW A;  1M57 C;  5T3W A;  3DM9 B;  5E3C A;  3OA1 A;  1M2O A;  4NCQ A;  4OIR F;  4C7O B;  1CGN A;  4JRZ A;  2MHR A;  2GDC A;  1PD1 A;  1YLM A;  3KMI A;  2OQM A;  1QVX A;  3A11 A;  3OWT A;  4LER A;  1M6T A;  3JYH A;  3L1M A;  1N1C A;  4NTA A;  1YAU O;  3GM1 A;  4J32 B;  2VH3 A;  4C3B A;  2XLE A;  1WWP A;  5A6K A;  5CI9 A;  2XSE A;  4I3M A;  2Y3H A;  3IQT A;  4EBB A;  4E7Z A;  4X0R A;  3H65 A;  2Y3D A;  5JP7 A;  3DWW A;  3KL4 A;  1OKK D;  4I1M A;  1K04 A;  1AEP A;  3EG9 A;  3MYF A;  4N4W A;  1OKK A;  4PJL A;  1MMN A;  4U5E E;  3DD7 A;  1YYX A;  2HJM A;  2HV7 A;  3FVY A;  3MFN A;  2IOQ A;  3EGD B;  3ZSU A;  1PV3 A;  1K40 A;  2XL6 A;  3M79 A;  3IEE A;  3MBG A;  4PAC A;  4CS7 A;  1OR3 A;  3MYI A;  3NYJ A;  4P9F A;  2YZS A;  1OXK A;  3G4Z A;  3O6X A;  2BL2 A;  2P0N A;  3PHF 2;  3AG2 C;  3M4B A;  1OW6 A;  1MND A;  4N06 A;  2NUP B;  4YT4 A;  1HMD A;  2AWY A;  2VCB A;  4AK9 A;  2WVQ A;  2CGE A;  4E7S A;  3GEH A;  4OD4 A;  3V5Y A;  1RMV A;  1ZHZ A;  3GOD A;  3GWL A;  4MVM A;  1ZU5 A;  3K66 A;  3KH2 A;  4QDL A;  4F4B A;  3C8G D;  1OCR C;  3U3B A;  1VLT A;  2YRF A;  1YAR O;  1ZHW A;  3M1C B;  3LUT B;  3ABM C;  3NYM A;  1QQ3 A;  4GEH A;  4N6C A;  3UR3 C;  3NG1 A;  4Z9H A;  2XS1 A;  4CS9 C;  2P6V A;  2XLO A;  2XLM A;  3AG3 C;  2Q9C A;  2J0W A;  2L6G A;  2OU6 A;  2W4M A;  2PBE A;  4O6M A;  2W45 A;  2VB6 A;  3JRT A;  4YT5 A;  4WGY A;  3HNI A;  4JCH A;  3RYL A;  4CSA C;  3NDB B;  3OEO A;  2QY9 A;  3A9C A;  4P6I C;  3W8H A;  1HMO A;  2PFD A;  4MND A;  3GAN A;  1YZC A;  3TD7 A;  4BJ6 C;  3LNM B;  1NU9 C;  4O79 A;  1Z5Z A;  3RQF A;  3WOD F;  1Q0F A;  4P9T A;  4AE4 B;  5FCL A;  2CNW D;  5KYY A;  4OIQ F;  1ORS C;  1AUE A;  3M15 A;  4WGZ A;  5GPG B;  3V5X A;  3UGP A;  5KYY B;  1ZZP A;  5BQG A;  3SNH A;  2LK4 A;  1RKE A;  3DXJ F;  2R7Q A;  4JZA A;  3AGU A;  3K33 A;  3TQO A;  4MTO A;  1Q0K A;  3S90 A;  3VM6 A;  3V7O A;  2B0H A;  1WN0 A;  2VCA A;  2H7O A;  2WL8 A;  3QMK A;  4MQ9 F;  4CBE A;  1GM5 A;  3N0T A;  3ZTZ A;  5KYX B;  4JEA A;  2HV6 A;  4ULW A;  4IAO A;  5KYX A;  1E84 A;  2BC5 A;  5KYU B;  1VK5 A;  4Q4Z F;  2LFD A;  2JD3 A;  1Z63 A;  1MQV A;  4K1O A;  4U5B E;  3ASN C;  5BQH A;  1D0Z A;  2AVK A;  4U5F E;  3UGO A;  5DQT A;  4PJN A;  3K6B A;  1LPE A;  5E3A A;  4CIP A;  1RXQ A;  5DS6 A;  1OCC C;  3RF3 A;  2MYS A;  5EK0 A;  4EIY A;  2X51 A;  1MNE A;  4O6Y A;  3POV A;  1Y6D A;  2DGJ A;  3ABL C;  4JJG A;  3ABK C;  1MMA A;  2MWQ A;  1SR2 A;  1XZQ A;  1NU7 D;  3GOR A;  3JT1 A;  1J8M F;  3SXM A;  1FTS A;  1VYK A;  4MVQ A;  1LE2 A;  3WHN A;  2VCC A;  1ZW2 A;  4LDR A;  3AOU A;  1XWJ A;  3HNL A;  5T3T A;  2DYR C;  2OKU A;  4YN0 B;  4AL1 A;  2I8B A;  4CS8 C;  3EFO A;  2H7V C;  3LEV A;  4NC3 A;  3FMS A;  1LE4 A;  4EHP A;  5JVE A;  1BR1 A;  5E33 A;  4OIP F;  4MVZ A;  1EI7 A;  3O39 A;  3ZQV A;  4XEK A;  3EHN A;  5AC4 A;  1VTM P;  3U8P A;  4QI2 A;  3DE8 A;  4HE8 D;  4R32 A;  3IQ6 A;  1M56 C;  1OCO C;  3RIP A;  3TUL A;  2J7P D;  3IPM O;  2Q4F A;  3VRC A;  3V5Z A;  4CS9 A;  2A6H F;  1OCZ C;  1G4U S;  2C04 A;  2HUJ A;  3HTK C;  5EGY A;  2M4E A;  4MW3 A;  5F5H A;  3JRM O;  1TWC A;  4IWB A;  3FAJ A;  5E2Q A;  1HY5 A;  3ATP A;  3F46 A;  4RBN A;  3U0C A;  1ORY A;  4B6I A;  4LAC B;  4C7O A;  3NKE A;  1JMW A;  3C18 A;  3EGX A;  2Q9B A;  3B71 A;  2YVK A;  3QVY A;  2IBF A;  1LIH A;  4Q5S F;  3JCU Q;  4KI2 A;  2UUI A;  1D1C A;  2LSE A;  4BJT A;  3DE9 A;  4NTF A;  1MMG A;  5A6J A;  1QSP A;  3G4X A;  1VOM A;  1U6H A;  1TWG A;  3B29 A;  4PFP A;  1KNY A;  3TOM A;  4E18 A;  3LLK A;  2KJG A;  3ZC4 A;  5JRA A;  2ZXP A;  2KK1 A;  2HJ3 A;  3JTL O;  1LS1 A;  3K7D A;  4U5D E;  3VYW A;  1RCP A;  3FOO A;  5DQZ A;  5KYW A;  1YJG A;  3K1I A;  2J46 A;  2QUP A;  3B0P A;  3DJN B;  2W9Y A;  4XTK A;  1V54 C;  1W2W A;  2XLD A;  1WAS A;  1Z23 A;  2HS5 A;  2YL0 A;  1E2X A;  2P7V A;  4CJO A;  2L9J A;  4G0H A;  3W8I A;  2GAQ A;  5K0I A;  3Q6N A;  4DVY P;  3TK0 A;  2R7O A;  1E86 A;  2O9X A;  2YLG A;  4GQH A;  1T6I A;  1E85 A;  3FAP B;  3HNJ A;  1H6G A;  2BE5 F;  1QZX A;  4ZLD A;  3KKB A;  3I5P A;  3J06 A;  2WB7 A;  2LIG A;  1Z6A A;  2TMV P;  2NUT B;  4XWJ A;  3ECS A;  1LI5 A;  2YEV A;  2L6F A;  2IXO A;  4G7H F;  4G7O F;  2KQ9 A;  3DAF A;  1EQ1 A;  1T01 A;  4U5C E;  1A7V A;  1EA8 A;  1WGW A;  3C62 A;  1ZW3 A;  4WAB A;  4YL1 A;  4XPW A;  4JTA B;  4AL0 A; 
#chains in the Genus database with same CATH homology
 1OR3 A;  1BZ4 A;  3R2P A;  1LPE A;  2KC3 A;  1LS4 A;  1EQ1 A;  1OR2 A;  1EA8 A;  1B68 A;  1H7I A;  1LE2 A;  3S84 A;  1GS9 A;  1LE4 A;  1YA9 A;  1AEP A;  1NFN A;  1NFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...