1GS9A

Apolipoprotein e4, 22k domain
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
144
structure length
144
Chain Sequence
SGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPROTEIN E
publication title Crystal Structure of the 22K Domain of Human Apolipoprotein E4
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 65
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2002-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1gs9A00
1GS9A 1EQ1A 2KC3A 1NFNA 1LPEA 1LE2A 1NFOA 1OR2A 1LS4A 3S84A 1EA8A 1B68A 1YA9A 1H7IA 1BZ4A 1OR3A 1AEPA 1LE4A 3R2PA
chains in the Genus database with same CATH superfamily
3EHMA 2I15A 3HJCA 1WTYA 1WATA 1MNEA 4XWJA 1WN0A 3KYIA 2UUHA 3S9OA 3KYJA 3EG9B 2VASA 3I4UA 4G0HA 1HE1A 4XTKA 5F5HA 1TWCA 2LFFA 4IARA 3VRCA 4U5BE 1D0ZA 2NPUA 4ZLCA 2MWQA 4MVMA 5L0GA 1W2WA 1E83A 4AX2A 1T01A 3GANA 3S84A 1LI5A 3FHDA 2CNWD 2E87A 4MTGA 2EIMC 4OIRF 1AUEA 3UR3C 5AGFA 4I44A 4O79A 3B71A 3O55A 5JSLA 3EG9A 1BZ4A 4U9DA 2OU6A 3R7CA 2QY9A 1Z7Qc 1WASA 3E9VA 3UMHA 3W2WA 4AL0A 3FDQA 3RFYA 2CCYA 1SF8A 2VH3A 3S0XA 1LS1A 2DYSC 4H54A 3ASNC 1D1BA 3QW1A 5DS4A 1KTMA 4BJ6A 4D4NA 2PFDA 2FFHA 4ULWA 2Q7RA 4MW3A 2Z15A 2ASRA 2J45A 3LESA 2IBFA 4JJFA 4LACB 4P6IC 1WOLA 4K1OA 5DQTA 4EHPA 1N1CA 4DOZA 1JPJA 3C63A 1RMVA 2IXPA 2H7OA 4PK4A 1ST6A 1HE9A 3HNIA 3QVZA 5L0CA 1YJGA 3LAYA 3W2VA 1XWJA 2XXAA 2VCAA 3NDBB 4LDKA 5AC4A 2W4BA 1VMAA 4O7GA 4Q5SF 3A9CA 3JYYA 1JPNA 4QDLA 3DJUB 3EZHA 2R7TA 3B0PA 3QTHA 4JCZA 3WAQA 3V5ZA 4DBRA 1K04A 1A7VA 3EGDB 3UMKA 1QPUA 5A6AA 1H9GA 1C03A 1ZW2A 2ZXWC 1FNTc 2KC3A 1NFNA 2VCCA 3TOMA 1ORSC 4JKVA 2XL6A 3ATPA 2IOQA 2HMQA 3EGXB 4RBNA 1CGME 2R7WA 5KYXA 5T3WA 3L0IA 2X0CA 3IQ6A 4BEMJ 1LS4A 2Q3TA 4JRZA 3RF3A 4G7OF 1JAFA 3GORA 2ETSA 4KC9A 3IQCA 3GEHA 3SZRA 3US6A 1JMWA 3ZG1A 5K0IA 2CYDA 5KYYB 3EGDA 1JOGA 2LK4A 2XLOA 3VAYA 3L8IA 3SP1A 3RYLA 3TD7A 4FAPB 3JSZA 2XXAB 3IEEA 2XS1A 4W8KA 4OIOF 4FWVA 2R7UA 4JTDB 1VTMP 1VOMA 3EQLF 4LDQA 2EPMX 4YT2A 1HW2A 3DE9A 4HFFB 1QVXA 1EQ1A 5EK0A 1Y4CA 2F22A 1E86A 3Q7GA 1NBBA 3HKKA 5DQZA 4XLPF 1YLMA 5KYYA 3NKEA 2ZXRA 3AG1C 3SXYA 1I4ZA 2HJMA 5KYUB 2BE5F 2FAPB 2AVKA 4KNVA 3KH2A 4X0RA 2M64A 2VCBA 2HS5A 3QMKA 4FESA 4JEBA 4M63A 2YWAA 3T6JA 4G78A 4LLCA 4CS8C 4E0HA 4DVZA 2L6HA 3RQFA 5L0JA 3V5XA 3HNLA 2UUIA 3PMRA 4I1MA 3PDMP 4NQFA 4JTCB 2PX0A 5JT4A 1G5ZA 4EBBA 3AOUA 4CX9A 4U5GA 4GYTA 5L0HA 2EPKX 1BR2A 3W8IA 1J8YF 3N2ZB 3QZCA 4Z9JA 1Z63A 4CS7A 1GQAA 1OCCC 1TFOB 2HV6A 1BBHA 3IPMO 4DBQA 2XLDA 4QI0A 1K05A 2KK1A 2HKVA 4U9EA 2GAQA 2WZFA 3HNJA 1YYJA 4A2NB 4IRUA 1FTSA 1C02A 1OR2A 1MMNA 1YARO 2HFIA 2WZGA 4GEHA 4OD5A 5CI9A 5A6BA 4CIHA 3MLGA 3GM3A 2Y3DA 1K40A 2GFHA 2R03A 3NMJA 1D0YA 4XPYA 3C8ZA 4KI2A 2QNLA 3O6XA 1OCZC 1A7EA 1OW8A 2R25A 2YLDA 1RKCA 4MNDA 1Z3IX 2YKZA 2MYSA 4A4AA 5A6BD 2D4UA 2NUPA 2Y69C 4PJMA 3GWLA 5BQIA 1APCA 1O87A 2J9UA 3K7DA 3VYWA 1SR2A 2KQ9A 4O6NA 1A0BA 2OG2A 3R2PA 4Z9HA 2EIKC 3AG4C 4NY3A 3FMSA 3RH3A 1PD1A 2XLHA 4DRHB 2VB6A 3AG3C 1DOVA 1WWPA 3DI5A 3M4BA 2V3CC 4O6YA 3WG7C 4CS9A 1ZHTA 2Q9AA 1NFOA 1GGQA 1WGWA 4NTFA 4PFPA 4CIPA 1D1AA 2WVNA 4U5HA 2NUTB 1OQCA 5COFA 4DXWA 1UFBA 4N06A 3SXKA 3W8HA 5CI8A 1LI7A 4CDYA 1XZPA 4LERA 2R7RA 3JZ0A 4OIPF 2JD3A 3U3BA 4IWBA 1G8XA 1OKKA 2Q4FA 5A6JA 1T9KA 3JSEO 3U2LA 1NU7D 2A0UA 1R4TA 3C18A 4PJNA 2YZSA 4BJTA 4E7ZA 5DLJA 2Q9CA 1GS9A 4GQHA 4JIOA 5E33A 4HFKB 3U8PA 2OOCA 3GWNA 2NUTA 1OKKD 1HMDA 1MQVA 2ZPAA 2W45A 4KNWA 2J9VA 1TR2A 4Z9IA 3CAXA 4DRIB 1CPRA 3ITFA 2A69F 2OJED 1ZHZA 4K7BA 4BJ6C 2YLIA 4XPWA 2L6FA 2XLMA 3GODA 3PHF2 2EPLX 2GWWA 2IXMA 2PBEA 2YEVA 2A68F 3DXJF 2P6VA 5E2QA 3LS1A 4BG0A 3EJNA 3L1MA 1JRAA 1ORYA 1RJ9B 5KYXB 4PFOA 4CBEA 2CGEA 2RSEB 3F47A 3G4ZA 4DJ9A 3FAPB 2R9RB 1V74B 2HMZA 3ABLC 4E0IA 1E84A 1I4YA 3IQTA 4MS2A 4OD4A 3KKBA 2OEXA 3AQCA 2Q9BA 3FOOA 1S05A 5JRAA 2XM4A 3DD7A 2WL8A 3U3FA 5DS5A 5COMA 3K33A 4MVOA 3ZQVA 4CJGA 4FX5A 2R7QA 1TWGA 4C3DA 3OWTA 3ABKC 1RJ9A 4BJ5A 5JUAA 2CDQA 2J7PA 3NYLA 3AG2C 1D1CA 3TJ6A 3EZIA 1ZHWA 3NKDA 2LIGA 2XM0A 2XL8A 2ZXPA 3KMIA 5E3AA 1M2VB 2J7PD 4YK5A 3PCVA 1M56C 1M57C 1XZQA 2L6GA 4BPMA 4CJOA 1EKYA 3K1HA 1HMOA 1PV3A 4I1OB 3GEEA 4CDVA 4J7TA 1LM3B 1LE4A 3L34A 1U0BB 4ZLDA 1L7CA 3H2VA 3MBGA 3U9MA 1TWAA 2GDCA 1MMGA 2XLWA 3B29A 2PNOA 3POVA 2D5RB 4G7ZF 1H9TA 2VC9A 1M2VA 3SXMA 1FMWA 3TQOA 4XPXA 5KYNA 1ZU4A 1V4AA 1Z5ZA 3LJBA 2YVKA 1BDJB 1Z23A 3MFNA 4Q4ZF 2R7SA 2W9YA 3LS0A 2EPNA 2ZXOA 5FZTA 4G7HF 3N0TA 2H8AA 3HLZA 1FFTC 1ORJA 3TOLA 1DOWA 1OW6A 2PP4A 2BL2A 2W4MA 1OXKA 3OEOA 3K1IA 4K0DA 5B1BC 1FR0A 1J8MF 3AJMA 1AEPA 1F1MA 1FMVA 1YAUO 2X51A 1TWHA 1Q0GA 5EHHA 3U2MA 1I5NA 3KL4A 4ULVA 4OIQF 4D4XA 3NMKA 1NSGB 4JVSA 2EIJC 1YVIA 2NUPB 3FXHA 4JZAA 3FAJA 3S29A 4EKWA 1ZZPA 3QW0A 5TJ5E 1LIHA 2J0WA 2KSFA 5F28E 3SYNA 5EGYA 4R32A 1ZU5A 4CSAA 2J9WA 3RIPA 3TJ5A 2P7VA 3NYMA 4C7OA 3QVYA 2IXNA 4JCHA 4WABA 2AWYA 2LCHA 4BEJA 3FOPA 3M79A 3HNKA 2YL7A 3KPHA 3ZTZA 3LNRA 2OCCC 1YZAA 3LEVA 1QQ3A 2YQYA 1QKRA 3SNHA 5CIVA 4P9FA 2KGOA 5L0DA 5L3QA 1VK5A 3H65A 1JR8A 2TMVP 3W4YA 1CGOA 1NLXA 1E2XA 2A6EF 3M4CA 3O10A 1GM5A 1O5HA 5T3TA 4AL1A 4EIYA 2KNHA 5AC5A 1U6HA 3ZIBA 4YT4A 2KW3C 4MVZA 2G62A 1VLTA 4HE8D 2DB4A 1LE2A 2J8WA 4O6MA 1QLEC 3ABMC 3T4RA 1YA7O 3ZWIA 4ANJA 3WHNA 1YYXA 1T6IA 2XSEA 4EUKB 4CS9C 4ER9A 2OEVA 1A41A 1MNDA 2M4EA 4WJ0A 2R05A 2KJGA 2P0NA 1Q0KA 1O3UA 4NTBA 4F4BA 1YA9A 1OCOC 4JEAA 5IY5C 5L3VA 3BEHA 4QI2A 1HY5A 2OQMA 4YT5A 2C03A 3EH1A 2Y39A 4I3MA 3DE8A 2YL3A 1T6UA 4KBLA 4YL0A 3T6BA 2J46A 4BJ1A 1QZXA 1SMYF 5HV9A 4IGGA 1VB5A 3CQZA 2A6HF 4N6CA 5JLIA 4PACA 4XEFA 4MTOA 1VYKA 4IB4A 2CNWA 1NZEA 3O39A 3LLIA 1S7ZA 3EPVA 3JRTA 4P9TA 1NG1A 2RD9A 5BQHA 3F46A 5KYWA 4UDVA 5T1DB 1YZCA 1Z6AA 2IM8A 3C8GB 1YDIA 3M15A 4RDAA 3K6BA 2IYLD 3NYJA 2HUJA 1PCXA 1VLSA 4LDRA 1BR4A 3EFOB 4NTAA 5B1AC 1C17M 1RKEB 1NU9C 4E17A 5JVEA 2KYHA 3UGPA 2LD6A 1TKNA 1V55C 1SZIA 3I5PA 3C7JA 3DJNB 2YL1A 5E3CA 3ZQYA 2GA0A 3ZVRA 4EBJA 2G3KA 1H7IA 1CGNA 1FAPB 2O9XA 5JP7A 2Q00A 3UGOA 2DYRC 2WVOA 4AK9A 2ICWG 2R7OA 2WVQA 3AQBA 2Y3GA 3V5YA 3WODF 2Y3BA 3U9JA 3C8GA 4LLEA 3S28A 3ZC4A 2A0BA 2NG1A 5B3SC 3E70C 2NSGA 1CPQA 3DMDA 4C3EA 1KNYA 1TQGA 2EILC 3G4XA 2AP3A 3EFOA 4DRJB 1RKEA 3CEXA 3ZTMA 3U0CA 2IXOA 3I5QA 4N4WA 3J06A 1Q0DA 3C8GD 3ECSA 3SEOA 2YLGA 3NRHA 2WZLA 1TFKB 2EPOA 1RCPA 4YT8A 1ZYRF 2DGJA 1IW7F 2HJ3A 2OKUA 2I8BA 3MYIA 3JCUQ 3Q6MA 3AGUA 4HEAJ 3RVZA 1Y6DA 4MVSA 4E18A 4BJ5C 1M2OA 2PF4E 4ONSA 4C3BA 3X1OA 3Q6NA 5F5FA 2XLEA 4JW1A 1OXBA 1ZHYA 3L8JA 4J30B 1EI7A 1KU2A 1OR3A 2HV7A 2J0XA 3UMIA 2R7XA 4NCQA 1BR1A 5DS6A 3JT1A 3B9QA 1RXQA 1FFHA 3EHNA 4JC7A 1OCRC 4JTAB 5DVWA 1UG7A 2XL4A 5HSWA 4WGZA 4XEVA 5FCLA 4RD9A 3BRJA 2H7BA 4PJLA 3X2QC 1Q0FA 1G4US 1VYIA 2B0HA 2QE9A 3AGTA 3LEOA 4IJJA 4MVQA 4MW8A 4U5EE 5L0IA 1IZMA 3C62A 3DWWA 5L0FA 3RQEA 5A69A 3DAGA 4JE9A 1V54C 4JURI 2AWCA 3ZSUA 4CDAA 2NSFA 2XLVA 4MTFA 3DM5A 1U89A 1B68A 2ZD9A 3NMIA 2CW0F 3Q7LA 1L3PA 3VM6A 2P61A 1SYQA 3EGXA 3JYHA 1ZW3A 3MYFA 4Q7CA 4WGYA 1H6GA 1HW1A 5D92A 2LFDA 3S27A 3N24A 3UNGC 3TK0A 4MVUA 2L9JA 5B3IA 2XS8A 2AU5A 2FGYA 2L81A 4JJGA 4C7OB 3K66A 3GEIA 2JX0A 3GM2A 4H4KC 4PR9A 4YJWA 5BQGA 2XRHA 1MMAA 3RVYA 2YHSA 3K1IC 3RW0A 4CS8A 2OJQA 4NC3A 4YL1A 3DM9B 1LPEA 3HTKC 3OA1A 2LP4A 4XQ1A 2C04A 2DI3A 2HSBA 3SXZA 4AE4B 3U8VA 2LSEA 4PJJA 5JS5A 1M6TA 2R02A 4YL3A 4J7YA 3VF0A 5BUOA 1T5OA 2QLAA 4U5CE 4YN0B 256BA 3DZAA 3LUTB 2YRFA 3NG1A 2Y3HA 3S90A 2BC5A 1LKXA 2QTVA 3DKAA 4J32B 3T6GB 4CSAC 2EINC 2G3VA 1R5ID 5COGA 3T9OA 2HSQA 3GM1A 4U5FE 3A11A 5KYUA 3LLKA 4MVRA 2R7VA 1QSPA 2MHRA 4IAQA 4L6RA 1D0XA 4AE4A 2P1AA 4XLNF 4EBKA 4IAOA 2PX3A 3U5SA 4EWCA 1LVKA 3CZ6A 3B0VC 3ASOC 3EH2A 3H2UA 4OINF 1MMDA 3RKOF 3V7OA 3G50A 2WB7A 1OW7A 5GPGB 3RQGA 2YL0A 1PD0A 2L7AA 2LQGA 3FVYA 3B0UX 2JPUA 4MQ9F 3MX3A 3M1CB 2A1DD 3TULA 4U5DE 4W8PA 2HZ8A 1AVOB 3ZDLA 2J9BA 1EA8A 1T6QA 3IQ5A 3CSKA 4B6IA 2QUPA 5KYWB 1A7DA 3DAFA 3IHUA 3JTLO 4DVYP 1E85A 1Q0MA 1ZHXA 4N6HA 2B0JA 3JRMO 5D91A 4E7SA 5A6KA 2V26A 4XEKA 3LNMB 2H7VC 1ZVZA 1G4WR 4YWQA
chains in the Genus database with same CATH topology
1GS9A 1EQ1A 2KC3A 1NFNA 1LPEA 1LE2A 1NFOA 1OR2A 1LS4A 3S84A 1EA8A 1B68A 1YA9A 1H7IA 1BZ4A 1OR3A 1AEPA 1LE4A 3R2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GS9 A;  1EQ1 A;  2KC3 A;  1NFN A;  1LPE A;  1LE2 A;  1NFO A;  1OR2 A;  1LS4 A;  3S84 A;  1EA8 A;  1B68 A;  1YA9 A;  1H7I A;  1BZ4 A;  1OR3 A;  1AEP A;  1LE4 A;  3R2P A; 
#chains in the Genus database with same CATH topology
 3EHM A;  2I15 A;  3HJC A;  1WTY A;  1WAT A;  1MNE A;  4XWJ A;  1WN0 A;  3KYI A;  2UUH A;  3S9O A;  3KYJ A;  3EG9 B;  2VAS A;  3I4U A;  4G0H A;  1HE1 A;  4XTK A;  5F5H A;  1TWC A;  2LFF A;  4IAR A;  3VRC A;  4U5B E;  1D0Z A;  2NPU A;  4ZLC A;  2MWQ A;  4MVM A;  5L0G A;  1W2W A;  1E83 A;  4AX2 A;  1T01 A;  3GAN A;  3S84 A;  1LI5 A;  3FHD A;  2CNW D;  2E87 A;  4MTG A;  2EIM C;  4OIR F;  1AUE A;  3UR3 C;  5AGF A;  4I44 A;  4O79 A;  3B71 A;  3O55 A;  5JSL A;  3EG9 A;  1BZ4 A;  4U9D A;  2OU6 A;  3R7C A;  2QY9 A;  1Z7Q c;  1WAS A;  3E9V A;  3UMH A;  3W2W A;  4AL0 A;  3FDQ A;  3RFY A;  2CCY A;  1SF8 A;  2VH3 A;  3S0X A;  1LS1 A;  2DYS C;  4H54 A;  3ASN C;  1D1B A;  3QW1 A;  5DS4 A;  1KTM A;  4BJ6 A;  4D4N A;  2PFD A;  2FFH A;  4ULW A;  2Q7R A;  4MW3 A;  2Z15 A;  2ASR A;  2J45 A;  3LES A;  2IBF A;  4JJF A;  4LAC B;  4P6I C;  1WOL A;  4K1O A;  5DQT A;  4EHP A;  1N1C A;  4DOZ A;  1JPJ A;  3C63 A;  1RMV A;  2IXP A;  2H7O A;  4PK4 A;  1ST6 A;  1HE9 A;  3HNI A;  3QVZ A;  5L0C A;  1YJG A;  3LAY A;  3W2V A;  1XWJ A;  2XXA A;  2VCA A;  3NDB B;  4LDK A;  5AC4 A;  2W4B A;  1VMA A;  4O7G A;  4Q5S F;  3A9C A;  3JYY A;  1JPN A;  4QDL A;  3DJU B;  3EZH A;  2R7T A;  3B0P A;  3QTH A;  4JCZ A;  3WAQ A;  3V5Z A;  4DBR A;  1K04 A;  1A7V A;  3EGD B;  3UMK A;  1QPU A;  5A6A A;  1H9G A;  1C03 A;  1ZW2 A;  2ZXW C;  1FNT c;  2KC3 A;  1NFN A;  2VCC A;  3TOM A;  1ORS C;  4JKV A;  2XL6 A;  3ATP A;  2IOQ A;  2HMQ A;  3EGX B;  4RBN A;  1CGM E;  2R7W A;  5KYX A;  5T3W A;  3L0I A;  2X0C A;  3IQ6 A;  4BEM J;  1LS4 A;  2Q3T A;  4JRZ A;  3RF3 A;  4G7O F;  1JAF A;  3GOR A;  2ETS A;  4KC9 A;  3IQC A;  3GEH A;  3SZR A;  3US6 A;  1JMW A;  3ZG1 A;  5K0I A;  2CYD A;  5KYY B;  3EGD A;  1JOG A;  2LK4 A;  2XLO A;  3VAY A;  3L8I A;  3SP1 A;  3RYL A;  3TD7 A;  4FAP B;  3JSZ A;  2XXA B;  3IEE A;  2XS1 A;  4W8K A;  4OIO F;  4FWV A;  2R7U A;  4JTD B;  1VTM P;  1VOM A;  3EQL F;  4LDQ A;  2EPM X;  4YT2 A;  1HW2 A;  3DE9 A;  4HFF B;  1QVX A;  1EQ1 A;  5EK0 A;  1Y4C A;  2F22 A;  1E86 A;  3Q7G A;  1NBB A;  3HKK A;  5DQZ A;  4XLP F;  1YLM A;  5KYY A;  3NKE A;  2ZXR A;  3AG1 C;  3SXY A;  1I4Z A;  2HJM A;  5KYU B;  2BE5 F;  2FAP B;  2AVK A;  4KNV A;  3KH2 A;  4X0R A;  2M64 A;  2VCB A;  2HS5 A;  3QMK A;  4FES A;  4JEB A;  4M63 A;  2YWA A;  3T6J A;  4G78 A;  4LLC A;  4CS8 C;  4E0H A;  4DVZ A;  2L6H A;  3RQF A;  5L0J A;  3V5X A;  3HNL A;  2UUI A;  3PMR A;  4I1M A;  3PDM P;  4NQF A;  4JTC B;  2PX0 A;  5JT4 A;  1G5Z A;  4EBB A;  3AOU A;  4CX9 A;  4U5G A;  4GYT A;  5L0H A;  2EPK X;  1BR2 A;  3W8I A;  1J8Y F;  3N2Z B;  3QZC A;  4Z9J A;  1Z63 A;  4CS7 A;  1GQA A;  1OCC C;  1TFO B;  2HV6 A;  1BBH A;  3IPM O;  4DBQ A;  2XLD A;  4QI0 A;  1K05 A;  2KK1 A;  2HKV A;  4U9E A;  2GAQ A;  2WZF A;  3HNJ A;  1YYJ A;  4A2N B;  4IRU A;  1FTS A;  1C02 A;  1OR2 A;  1MMN A;  1YAR O;  2HFI A;  2WZG A;  4GEH A;  4OD5 A;  5CI9 A;  5A6B A;  4CIH A;  3MLG A;  3GM3 A;  2Y3D A;  1K40 A;  2GFH A;  2R03 A;  3NMJ A;  1D0Y A;  4XPY A;  3C8Z A;  4KI2 A;  2QNL A;  3O6X A;  1OCZ C;  1A7E A;  1OW8 A;  2R25 A;  2YLD A;  1RKC A;  4MND A;  1Z3I X;  2YKZ A;  2MYS A;  4A4A A;  5A6B D;  2D4U A;  2NUP A;  2Y69 C;  4PJM A;  3GWL A;  5BQI A;  1APC A;  1O87 A;  2J9U A;  3K7D A;  3VYW A;  1SR2 A;  2KQ9 A;  4O6N A;  1A0B A;  2OG2 A;  3R2P A;  4Z9H A;  2EIK C;  3AG4 C;  4NY3 A;  3FMS A;  3RH3 A;  1PD1 A;  2XLH A;  4DRH B;  2VB6 A;  3AG3 C;  1DOV A;  1WWP A;  3DI5 A;  3M4B A;  2V3C C;  4O6Y A;  3WG7 C;  4CS9 A;  1ZHT A;  2Q9A A;  1NFO A;  1GGQ A;  1WGW A;  4NTF A;  4PFP A;  4CIP A;  1D1A A;  2WVN A;  4U5H A;  2NUT B;  1OQC A;  5COF A;  4DXW A;  1UFB A;  4N06 A;  3SXK A;  3W8H A;  5CI8 A;  1LI7 A;  4CDY A;  1XZP A;  4LER A;  2R7R A;  3JZ0 A;  4OIP F;  2JD3 A;  3U3B A;  4IWB A;  1G8X A;  1OKK A;  2Q4F A;  5A6J A;  1T9K A;  3JSE O;  3U2L A;  1NU7 D;  2A0U A;  1R4T A;  3C18 A;  4PJN A;  2YZS A;  4BJT A;  4E7Z A;  5DLJ A;  2Q9C A;  1GS9 A;  4GQH A;  4JIO A;  5E33 A;  4HFK B;  3U8P A;  2OOC A;  3GWN A;  2NUT A;  1OKK D;  1HMD A;  1MQV A;  2ZPA A;  2W45 A;  4KNW A;  2J9V A;  1TR2 A;  4Z9I A;  3CAX A;  4DRI B;  1CPR A;  3ITF A;  2A69 F;  2OJE D;  1ZHZ A;  4K7B A;  4BJ6 C;  2YLI A;  4XPW A;  2L6F A;  2XLM A;  3GOD A;  3PHF 2;  2EPL X;  2GWW A;  2IXM A;  2PBE A;  2YEV A;  2A68 F;  3DXJ F;  2P6V A;  5E2Q A;  3LS1 A;  4BG0 A;  3EJN A;  3L1M A;  1JRA A;  1ORY A;  1RJ9 B;  5KYX B;  4PFO A;  4CBE A;  2CGE A;  2RSE B;  3F47 A;  3G4Z A;  4DJ9 A;  3FAP B;  2R9R B;  1V74 B;  2HMZ A;  3ABL C;  4E0I A;  1E84 A;  1I4Y A;  3IQT A;  4MS2 A;  4OD4 A;  3KKB A;  2OEX A;  3AQC A;  2Q9B A;  3FOO A;  1S05 A;  5JRA A;  2XM4 A;  3DD7 A;  2WL8 A;  3U3F A;  5DS5 A;  5COM A;  3K33 A;  4MVO A;  3ZQV A;  4CJG A;  4FX5 A;  2R7Q A;  1TWG A;  4C3D A;  3OWT A;  3ABK C;  1RJ9 A;  4BJ5 A;  5JUA A;  2CDQ A;  2J7P A;  3NYL A;  3AG2 C;  1D1C A;  3TJ6 A;  3EZI A;  1ZHW A;  3NKD A;  2LIG A;  2XM0 A;  2XL8 A;  2ZXP A;  3KMI A;  5E3A A;  1M2V B;  2J7P D;  4YK5 A;  3PCV A;  1M56 C;  1M57 C;  1XZQ A;  2L6G A;  4BPM A;  4CJO A;  1EKY A;  3K1H A;  1HMO A;  1PV3 A;  4I1O B;  3GEE A;  4CDV A;  4J7T A;  1LM3 B;  1LE4 A;  3L34 A;  1U0B B;  4ZLD A;  1L7C A;  3H2V A;  3MBG A;  3U9M A;  1TWA A;  2GDC A;  1MMG A;  2XLW A;  3B29 A;  2PNO A;  3POV A;  2D5R B;  4G7Z F;  1H9T A;  2VC9 A;  1M2V A;  3SXM A;  1FMW A;  3TQO A;  4XPX A;  5KYN A;  1ZU4 A;  1V4A A;  1Z5Z A;  3LJB A;  2YVK A;  1BDJ B;  1Z23 A;  3MFN A;  4Q4Z F;  2R7S A;  2W9Y A;  3LS0 A;  2EPN A;  2ZXO A;  5FZT A;  4G7H F;  3N0T A;  2H8A A;  3HLZ A;  1FFT C;  1ORJ A;  3TOL A;  1DOW A;  1OW6 A;  2PP4 A;  2BL2 A;  2W4M A;  1OXK A;  3OEO A;  3K1I A;  4K0D A;  5B1B C;  1FR0 A;  1J8M F;  3AJM A;  1AEP A;  1F1M A;  1FMV A;  1YAU O;  2X51 A;  1TWH A;  1Q0G A;  5EHH A;  3U2M A;  1I5N A;  3KL4 A;  4ULV A;  4OIQ F;  4D4X A;  3NMK A;  1NSG B;  4JVS A;  2EIJ C;  1YVI A;  2NUP B;  3FXH A;  4JZA A;  3FAJ A;  3S29 A;  4EKW A;  1ZZP A;  3QW0 A;  5TJ5 E;  1LIH A;  2J0W A;  2KSF A;  5F28 E;  3SYN A;  5EGY A;  4R32 A;  1ZU5 A;  4CSA A;  2J9W A;  3RIP A;  3TJ5 A;  2P7V A;  3NYM A;  4C7O A;  3QVY A;  2IXN A;  4JCH A;  4WAB A;  2AWY A;  2LCH A;  4BEJ A;  3FOP A;  3M79 A;  3HNK A;  2YL7 A;  3KPH A;  3ZTZ A;  3LNR A;  2OCC C;  1YZA A;  3LEV A;  1QQ3 A;  2YQY A;  1QKR A;  3SNH A;  5CIV A;  4P9F A;  2KGO A;  5L0D A;  5L3Q A;  1VK5 A;  3H65 A;  1JR8 A;  2TMV P;  3W4Y A;  1CGO A;  1NLX A;  1E2X A;  2A6E F;  3M4C A;  3O10 A;  1GM5 A;  1O5H A;  5T3T A;  4AL1 A;  4EIY A;  2KNH A;  5AC5 A;  1U6H A;  3ZIB A;  4YT4 A;  2KW3 C;  4MVZ A;  2G62 A;  1VLT A;  4HE8 D;  2DB4 A;  1LE2 A;  2J8W A;  4O6M A;  1QLE C;  3ABM C;  3T4R A;  1YA7 O;  3ZWI A;  4ANJ A;  3WHN A;  1YYX A;  1T6I A;  2XSE A;  4EUK B;  4CS9 C;  4ER9 A;  2OEV A;  1A41 A;  1MND A;  2M4E A;  4WJ0 A;  2R05 A;  2KJG A;  2P0N A;  1Q0K A;  1O3U A;  4NTB A;  4F4B A;  1YA9 A;  1OCO C;  4JEA A;  5IY5 C;  5L3V A;  3BEH A;  4QI2 A;  1HY5 A;  2OQM A;  4YT5 A;  2C03 A;  3EH1 A;  2Y39 A;  4I3M A;  3DE8 A;  2YL3 A;  1T6U A;  4KBL A;  4YL0 A;  3T6B A;  2J46 A;  4BJ1 A;  1QZX A;  1SMY F;  5HV9 A;  4IGG A;  1VB5 A;  3CQZ A;  2A6H F;  4N6C A;  5JLI A;  4PAC A;  4XEF A;  4MTO A;  1VYK A;  4IB4 A;  2CNW A;  1NZE A;  3O39 A;  3LLI A;  1S7Z A;  3EPV A;  3JRT A;  4P9T A;  1NG1 A;  2RD9 A;  5BQH A;  3F46 A;  5KYW A;  4UDV A;  5T1D B;  1YZC A;  1Z6A A;  2IM8 A;  3C8G B;  1YDI A;  3M15 A;  4RDA A;  3K6B A;  2IYL D;  3NYJ A;  2HUJ A;  1PCX A;  1VLS A;  4LDR A;  1BR4 A;  3EFO B;  4NTA A;  5B1A C;  1C17 M;  1RKE B;  1NU9 C;  4E17 A;  5JVE A;  2KYH A;  3UGP A;  2LD6 A;  1TKN A;  1V55 C;  1SZI A;  3I5P A;  3C7J A;  3DJN B;  2YL1 A;  5E3C A;  3ZQY A;  2GA0 A;  3ZVR A;  4EBJ A;  2G3K A;  1H7I A;  1CGN A;  1FAP B;  2O9X A;  5JP7 A;  2Q00 A;  3UGO A;  2DYR C;  2WVO A;  4AK9 A;  2ICW G;  2R7O A;  2WVQ A;  3AQB A;  2Y3G A;  3V5Y A;  3WOD F;  2Y3B A;  3U9J A;  3C8G A;  4LLE A;  3S28 A;  3ZC4 A;  2A0B A;  2NG1 A;  5B3S C;  3E70 C;  2NSG A;  1CPQ A;  3DMD A;  4C3E A;  1KNY A;  1TQG A;  2EIL C;  3G4X A;  2AP3 A;  3EFO A;  4DRJ B;  1RKE A;  3CEX A;  3ZTM A;  3U0C A;  2IXO A;  3I5Q A;  4N4W A;  3J06 A;  1Q0D A;  3C8G D;  3ECS A;  3SEO A;  2YLG A;  3NRH A;  2WZL A;  1TFK B;  2EPO A;  1RCP A;  4YT8 A;  1ZYR F;  2DGJ A;  1IW7 F;  2HJ3 A;  2OKU A;  2I8B A;  3MYI A;  3JCU Q;  3Q6M A;  3AGU A;  4HEA J;  3RVZ A;  1Y6D A;  4MVS A;  4E18 A;  4BJ5 C;  1M2O A;  2PF4 E;  4ONS A;  4C3B A;  3X1O A;  3Q6N A;  5F5F A;  2XLE A;  4JW1 A;  1OXB A;  1ZHY A;  3L8J A;  4J30 B;  1EI7 A;  1KU2 A;  1OR3 A;  2HV7 A;  2J0X A;  3UMI A;  2R7X A;  4NCQ A;  1BR1 A;  5DS6 A;  3JT1 A;  3B9Q A;  1RXQ A;  1FFH A;  3EHN A;  4JC7 A;  1OCR C;  4JTA B;  5DVW A;  1UG7 A;  2XL4 A;  5HSW A;  4WGZ A;  4XEV A;  5FCL A;  4RD9 A;  3BRJ A;  2H7B A;  4PJL A;  3X2Q C;  1Q0F A;  1G4U S;  1VYI A;  2B0H A;  2QE9 A;  3AGT A;  3LEO A;  4IJJ A;  4MVQ A;  4MW8 A;  4U5E E;  5L0I A;  1IZM A;  3C62 A;  3DWW A;  5L0F A;  3RQE A;  5A69 A;  3DAG A;  4JE9 A;  1V54 C;  4JUR I;  2AWC A;  3ZSU A;  4CDA A;  2NSF A;  2XLV A;  4MTF A;  3DM5 A;  1U89 A;  1B68 A;  2ZD9 A;  3NMI A;  2CW0 F;  3Q7L A;  1L3P A;  3VM6 A;  2P61 A;  1SYQ A;  3EGX A;  3JYH A;  1ZW3 A;  3MYF A;  4Q7C A;  4WGY A;  1H6G A;  1HW1 A;  5D92 A;  2LFD A;  3S27 A;  3N24 A;  3UNG C;  3TK0 A;  4MVU A;  2L9J A;  5B3I A;  2XS8 A;  2AU5 A;  2FGY A;  2L81 A;  4JJG A;  4C7O B;  3K66 A;  3GEI A;  2JX0 A;  3GM2 A;  4H4K C;  4PR9 A;  4YJW A;  5BQG A;  2XRH A;  1MMA A;  3RVY A;  2YHS A;  3K1I C;  3RW0 A;  4CS8 A;  2OJQ A;  4NC3 A;  4YL1 A;  3DM9 B;  1LPE A;  3HTK C;  3OA1 A;  2LP4 A;  4XQ1 A;  2C04 A;  2DI3 A;  2HSB A;  3SXZ A;  4AE4 B;  3U8V A;  2LSE A;  4PJJ A;  5JS5 A;  1M6T A;  2R02 A;  4YL3 A;  4J7Y A;  3VF0 A;  5BUO A;  1T5O A;  2QLA A;  4U5C E;  4YN0 B;  256B A;  3DZA A;  3LUT B;  2YRF A;  3NG1 A;  2Y3H A;  3S90 A;  2BC5 A;  1LKX A;  2QTV A;  3DKA A;  4J32 B;  3T6G B;  4CSA C;  2EIN C;  2G3V A;  1R5I D;  5COG A;  3T9O A;  2HSQ A;  3GM1 A;  4U5F E;  3A11 A;  5KYU A;  3LLK A;  4MVR A;  2R7V A;  1QSP A;  2MHR A;  4IAQ A;  4L6R A;  1D0X A;  4AE4 A;  2P1A A;  4XLN F;  4EBK A;  4IAO A;  2PX3 A;  3U5S A;  4EWC A;  1LVK A;  3CZ6 A;  3B0V C;  3ASO C;  3EH2 A;  3H2U A;  4OIN F;  1MMD A;  3RKO F;  3V7O A;  3G50 A;  2WB7 A;  1OW7 A;  5GPG B;  3RQG A;  2YL0 A;  1PD0 A;  2L7A A;  2LQG A;  3FVY A;  3B0U X;  2JPU A;  4MQ9 F;  3MX3 A;  3M1C B;  2A1D D;  3TUL A;  4U5D E;  4W8P A;  2HZ8 A;  1AVO B;  3ZDL A;  2J9B A;  1EA8 A;  1T6Q A;  3IQ5 A;  3CSK A;  4B6I A;  2QUP A;  5KYW B;  1A7D A;  3DAF A;  3IHU A;  3JTL O;  4DVY P;  1E85 A;  1Q0M A;  1ZHX A;  4N6H A;  2B0J A;  3JRM O;  5D91 A;  4E7S A;  5A6K A;  2V26 A;  4XEK A;  3LNM B;  2H7V C;  1ZVZ A;  1G4W R;  4YWQ A; 
#chains in the Genus database with same CATH homology
 1GS9 A;  1EQ1 A;  2KC3 A;  1NFN A;  1LPE A;  1LE2 A;  1NFO A;  1OR2 A;  1LS4 A;  3S84 A;  1EA8 A;  1B68 A;  1YA9 A;  1H7I A;  1BZ4 A;  1OR3 A;  1AEP A;  1LE4 A;  3R2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...