4HEAJ

Crystal structure of the entire respiratory complex i from thermus thermophilus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
160
Chain Sequence
b'MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGEIGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase subunit 1
publication title Crystal structure of the entire respiratory complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 52
structure length 160
sequence length 160
chains with identical sequence R
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00499 Oxidored_q3 NADH-ubiquinone/plastoquinone oxidoreductase chain 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1200 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4heaJ00
3RKOF 4HE8D 4HEAJ
chains in the Genus database with same CATH superfamily
4MQ9F 2XXAA 2XL8A 3W8HA 1SR2A 4G78A 3Q6MA 1LS1A 1A7VA 3NDBB 5EK0A 3FDQA 4U5BE 5JT4A 1YAUO 5GPGB 3AQCA 4MTGA 1U89A 4DRIB 5KYYA 1K40A 2IOQA 2PNOA 3ZSUA 3JZ0A 5KYWA 4EBBA 3POVA 2R7SA 2YLGA 3DI5A 1ORJA 1A7DA 3DJUB 2H7BA 2QUPA 4ULVA 3QW0A 3TJ6A 1WWPA 2EILC 1NBBA 3MLGA 4O79A 2CNWD 1YA9A 1OQCA 5L0FA 2I8BA 1KU2A 1GS9A 4KC9A 2XSEA 1K05A 3QW1A 2EPOA 4K1OA 4YL0A 3SZRA 4CS7A 5L0DA 4E0IA 2L9JA 2LK4A 5TJ5E 1YYXA 3B29A 3LESA 3MYFA 1G4US 4U9EA 2HV6A 4AX2A 2Y3GA 4J7YA 4JURI 4N6HA 3E9VA 1VTMP 2XM4A 4U5FE 2LSEA 2XRHA 2HV7A 4OD4A 3SP1A 3DKAA 3S90A 5FZTA 4XQ1A 1KNYA 1WOLA 2LCHA 2NPUA 2AWYA 3VAYA 1RJ9A 2P1AA 1C03A 1TWAA 3PDMP 1M56C 4OD5A 4XLPF 4YT4A 4IWBA 2CNWA 1EQ1A 1GQAA 3RFYA 3O39A 3QVZA 1MMDA 3UR3C 4EBJA 3SXYA 4CDAA 2DYRC 3U0CA 2WZFA 1QZXA 1YVIA 3EFOA 4JE9A 3W4YA 2X51A 4KBLA 2IM8A 3CAXA 4R32A 3ZQVA 1JR8A 3L8JA 4NTAA 3VM6A 3TQOA 2FGYA 1SF8A 3EGXB 2YRFA 2IXPA 3M79A 3UMHA 2EPMX 3W2WA 4BEJA 3C62A 3H65A 4FX5A 3RQGA 3B0PA 3C8GD 3IQTA 3ZC4A 4G7HF 4XPWA 5JSLA 5HSWA 4XEKA 1E86A 4K7BA 3ITFA 2OKUA 4EKWA 3B71A 4L6RA 1SYQA 3DAFA 4CS9A 2OG2A 1FTSA 2XLVA 3K7DA 4DXWA 3JT1A 5CI8A 1E2XA 3N24A 3U9MA 3CZ6A 3EJNA 4JEAA 4CSAA 4W8KA 5KYUB 1Z63A 2YL0A 1GGQA 2IBFA 5IY5C 3K33A 3PCVA 3TOLA 3BRJA 4Z9JA 2KGOA 5AC4A 1MMGA 5D91A 1O3UA 2MHRA 3ASNC 3C8GA 3DAGA 1VB5A 3E70C 2YLDA 3LAYA 1ORYA 3OEOA 2VB6A 2G62A 2AWCA 1HW2A 2HJ3A 3F47A 1MNEA 1HY5A 1TFKB 1LE2A 3O55A 3B9QA 3VF0A 3FMSA 2NUPA 3C18A 2GDCA 4AE4A 2YLIA 3C7JA 5B1AC 2L6GA 3U2LA 1N1CA 4X0RA 4HFFB 5K0IA 2YHSA 1Q0GA 3JSZA 4AL1A 3M1CB 4JRZA 1BR1A 4LERA 1VOMA 3NG1A 4DRJB 3C63A 1JRAA 1AUEA 3LS1A 4U5GA 5DS5A 2V26A 2VCAA 4H4KC 2Q9CA 2OOCA 4OIRF 1ZU5A 3FOOA 3JCUQ 3GEIA 5E3AA 4C3DA 2KQ9A 1XZQA 3GEEA 4YL1A 2P0NA 2NUTA 1XWJA 1V54C 1S7ZA 5FCLA 2HMQA 3AQBA 4JZAA 4XEVA 4D4NA 5A6KA 1Z5ZA 2D5RB 2XLEA 4ULWA 3EHNA 4DBQA 4YT2A 1CPRA 4N6CA 5L0IA 2KK1A 3HKKA 1PCXA 4E18A 3PHF2 1NFNA 2EPLX 4ZLCA 1ZYRF 1L7CA 1TFOB 1ZVZA 2JPUA 1CGOA 4I1OB 4LLCA 4M63A 4BJ5A 3ZWIA 2EIKC 4XPYA 4RDAA 2XLOA 3L0IA 5DS6A 1DOWA 4C7OA 4DVYP 4PJNA 4YK5A 2X0CA 1OW7A 1QVXA 3RQEA 4Q7CA 1HMDA 2VCBA 1YYJA 3TULA 1WGWA 3RW0A 1NSGB 2R05A 2WZLA 4PJLA 4CBEA 4O6MA 4U5HA 5T1DB 2ETSA 3WG7C 4U9DA 5D92A 3U3BA 1PV3A 2OEVA 2YQYA 3AG2C 4ER9A 1BR4A 3DZAA 2HFIA 4O7GA 4EHPA 5BUOA 2J9BA 4J32B 5COMA 2J7PD 2R7XA 2W45A 2A6EF 3DE8A 1M2VA 1YJGA 3MFNA 1PD0A 1YZAA 4U5DE 5AC5A 4GQHA 1Q0MA 2G3VA 1NLXA 5L0JA 4JKVA 3GORA 4E7SA 2J9WA 3GANA 3JTLO 2LFFA 1LM3B 4IARA 2XM0A 2XS1A 2ZXWC 3OA1A 4MW8A 4NQFA 2R7QA 1WN0A 4MTOA 2CCYA 3M4CA 3EQLF 3G4ZA 4KNVA 5COFA 3F46A 1OCRC 2TMVP 1BZ4A 2L6FA 3T6GB 3TK0A 2ASRA 3I5QA 2LP4A 3DWWA 1F1MA 3NMJA 3W2VA 1U6HA 2CW0F 1UFBA 2B0JA 1H7IA 3QMKA 1M2OA 2WB7A 1BBHA 4JIOA 1EA8A 4D4XA 2ZPAA 2YL7A 5JVEA 4GYTA 1T01A 1APCA 1OCCC 2Q4FA 4I44A 4CS9C 3B0VC 4NY3A 3U5SA 3EG9A 1RKEA 2L81A 2FAPB 3K1HA 1SMYF 3KL4A 3UNGC 5KYXA 2OJQA 5E2QA 2QNLA 2MYSA 2HJMA 5T3TA 5E33A 3GM2A 1VYKA 3GODA 4Q5SF 3RVYA 1T9KA 1UG7A 2HZ8A 2Y69C 3SXMA 4AK9A 1A0BA 2R7RA 1Z23A 2V3CC 2RSEB 3EPVA 1OW8A 5DS4A 1BR2A 2W9YA 3EGDB 4CX9A 4DRHB 4BJTA 3Q7GA 1TQGA 3NMIA 1OR2A 3HLZA 4PK4A 1FR0A 3GEHA 2A69F 3ABMC 1H6GA 3G50A 3WAQA 2RD9A 1D0XA 2GWWA 2A68F 3NYMA 2J0WA 2YVKA 5B1BC 4XPXA 1C17M 1HW1A 2F22A 3V7OA 5EGYA 3S0XA 3U9JA 1LI7A 1DOVA 4W8PA 2PP4A 1JAFA 3M4BA 2DYSC 1NZEA 3N0TA 3Q7LA 5A6JA 3I5PA 1TWGA 4LDQA 1ORSC 2ZXRA 5CIVA 5F5FA 3OWTA 1HE1A 4H54A 3DMDA 1LVKA 2DI3A 2W4BA 4F4BA 4E7ZA 5L0CA 3FAJA 4IRUA 2PX3A 3S29A 4CDVA 256BA 2HS5A 2R25A 2R02A 1U0BB 1WASA 1YA7O 3UMKA 2NG1A 2VCCA 1TKNA 1YDIA 4O6YA 1TWHA 2QTVA 2XLMA 2P7VA 2KC3A 3AOUA 3FOPA 4XEFA 4Z9HA 3RIPA 4A2NB 1ZU4A 2IXMA 4NC3A 3B0UX 1Z3IX 3UGPA 2H7OA 3K6BA 4UDVA 4DJ9A 3LEOA 1Y6DA 4CS8A 3RH3A 1G4WR 2YEVA 1B68A 3NRHA 1A41A 3NYJA 4JTCB 1CGNA 4C3EA 1L3PA 2BC5A 4CDYA 1LIHA 1NU9C 3FVYA 3K66A 2WVOA 2PBEA 4MVOA 5JRAA 2VH3A 4MTFA 3GM3A 1GM5A 1RCPA 3T6BA 3EGXA 3ZVRA 1OCZC 2XL6A 3L1MA 2R7WA 3JRMO 2HSQA 4YN0B 4CIHA 5JLIA 4ZLDA 3NKEA 4P9FA 5DQTA 4XLNF 4BPMA 3M15A 1M6TA 3GWNA 1RKCA 1AEPA 1D0ZA 5E3CA 1E83A 2A6HF 1LPEA 1LI5A 1S05A 3W8IA 3ZTMA 1XZPA 1T6QA 4EIYA 1IZMA 1YLMA 4MVRA 1O5HA 2HSBA 4OIPF 1M57C 4YT5A 3U8VA 2C03A 4J30B 1ZW3A 2A1DD 2Y39A 4YJWA 2ZD9A 4YWQA 3DE9A 2XXAB 1MMAA 4BJ6A 4I3MA 4NCQA 2MWQA 3KYIA 2P6VA 1OXBA 1FFTC 1YZCA 1OXKA 1JPJA 2NSFA 3L8IA 5KYUA 2A0UA 3JRTA 1QPUA 1T5OA 2LD6A 3HNIA 3MYIA 5F28E 4CJGA 1CPQA 4MS2A 5KYYB 2QY9A 4PFPA 2XLDA 5KYWB 2QLAA 4O6NA 1G5ZA 1TWCA 5A6BD 2LQGA 1ZZPA 3IQCA 1NU7D 2KSFA 3LEVA 3I4UA 2YKZA 5F5HA 2GFHA 5BQHA 5DLJA 1FNTc 2R7UA 1EKYA 1Y4CA 3FAPB 4HE8D 4NTFA 5T3WA 4N06A 5A6AA 3Q6NA 1K04A 1V55C 3ECSA 4MVSA 4PJMA 1BDJB 2JX0A 3AJMA 1T6UA 2I15A 2EIMC 4JC7A 2YWAA 1ZHZA 1OR3A 1G8XA 2KYHA 2M4EA 4MVZA 1NFOA 2WVQA 1MNDA 2C04A 2WZGA 3MX3A 4C3BA 2UUHA 1RMVA 4EWCA 1LKXA 4JW1A 1RJ9B 4A4AA 5A6BA 3HJCA 3ZIBA 2DGJA 3DJNB 2W4MA 3IQ5A 3NYLA 1VYIA 1I5NA 4WABA 3R7CA 1ZHTA 1H9GA 4JTAB 4BJ1A 3EHMA 3EFOB 3JYHA 4Z9IA 2QE9A 2J7PA 3CEXA 3GWLA 4DOZA 1E85A 2H7VC 4NTBA 3GM1A 4PACA 3H2VA 1VMAA 2Q3TA 1ZHXA 4IJJA 1LS4A 4WGZA 1I4ZA 2WVNA 3EH1A 1WATA 2VC9A 3A11A 3AG4C 2P61A 2PX0A 3SYNA 4CSAC 2ZXPA 3R2PA 3ATPA 4PFOA 4QDLA 3RVZA 2BL2A 2Q9AA 4JEBA 4BG0A 4I1MA 3KKBA 1JOGA 3S84A 1PD1A 2M64A 4HFKB 1YARO 3NKDA 4N4WA 4MVUA 5HV9A 4JTDB 2Z15A 1LE4A 1QLEC 2A0BA 3H2UA 3K1IA 3U8PA 5EHHA 2KW3C 4MVMA 1QQ3A 1J8MF 4CS8C 1IW7F 1Q0FA 2J46A 2LFDA 2LIGA 1CGME 2L6HA 3O6XA 2AVKA 4PJJA 2IXNA 2DB4A 3TJ5A 3C8GB 5JP7A 1ZW2A 2J45A 3PMRA 4QI0A 4WGYA 4P9TA 2WL8A 1J8YF 3ABLC 3HNJA 2UUIA 4RD9A 5L3VA 2NUPB 1A7EA 2R7VA 3V5XA 3HTKC 4AE4B 1HMOA 1V74B 3RKOF 3ZDLA 5L0GA 3VRCA 2EPKX 2O9XA 3LS0A 3SNHA 3L34A 2H8AA 3KYJA 4P6IC 1SZIA 3RYLA 4Q4ZF 1ZHWA 3AG1C 4U5CE 4JCHA 3RF3A 1R5ID 3LLKA 3N2ZB 4B6IA 3X1OA 4GEHA 1MQVA 3G4XA 1OKKD 2J9VA 3DM9B 3QTHA 2YZSA 3T9OA 4BEMJ 1D1CA 4EBKA 1T6IA 2HKVA 3KMIA 2Q7RA 3DD7A 1TR2A 3DM5A 1I4YA 3FHDA 4K0DA 1ZHYA 3A9CA 2EIJC 4OINF 3EZHA 1WTYA 4HEAJ 4JJFA 2CYDA 4MVQA 3SXZA 3ZQYA 1OW6A 2NUTB 4BJ6C 3O10A 4BJ5C 5L3QA 3IEEA 5B3IA 2GA0A 4AL0A 2XLHA 2YL1A 4XWJA 4FAPB 4OIOF 3JSEO 2AP3A 3RQFA 4WJ0A 1C02A 2EPNA 5DVWA 4MNDA 2XS8A 3CSKA 3UMIA 1OKKA 3U2MA 2G3KA 1RXQA 4DBRA 4LLEA 3T4RA 2CDQA 2KJGA 4G0HA 3EGDA 3UGOA 2PF4E 3SEOA 2Y3DA 2OJED 2PFDA 3V5YA 4C7OB 4KNWA 1W2WA 5A69A 2VASA 4IAQA 3QZCA 3ABKC 2OU6A 3LLIA 2YL3A 5L0HA 2OCCC 1R4TA 2Y3BA 1Q0KA 2IYLD 2Q9BA 2HMZA 2B0HA 2R7OA 1V4AA 2L7AA 3AG3C 2IXOA 3CQZA 1Z7Qc 1Q0DA 1JMWA 3BEHA 2GAQA 5JUAA 4IAOA 3LUTB 4ONSA 3J06A 2Y3HA 2R7TA 3X2QC 3LJBA 2J8WA 4LDKA 3ZTZA 1M2VB 3QVYA 3VYWA 4DVZA 1Z6AA 1QSPA 2E87A 2KNHA 1NG1A 4KI2A 2OEXA 1VK5A 1JPNA 3DXJF 5CI9A 4YT8A 1KTMA 2AU5A 2CGEA 5KYNA 1D1AA 2BE5F 3IHUA 4MW3A 3WODF 1FAPB 5DQZA 2EINC 3TOMA 4IB4A 3C8ZA 3ASOC 4FESA 3S28A 2XL4A 3SXKA 3S27A 2FFHA 2J9UA 3EH2A 1VLTA 1MMNA 1O87A 4YL3A 5BQIA 2HUJA 3WHNA 1HE9A 3IPMO 2XLWA 4PR9A 3T6JA 1OCOC 3TD7A 4G7ZF 3JYYA 3KPHA 4XTKA 1EI7A 2Q00A 3EZIA 4ANJA 5B3SC 4JCZA 3NMKA 1D0YA 3FXHA 4E0HA 4G7OF 1FMVA 3K1IC 4FWVA 1FMWA 2ICWG 2J0XA 3EG9B 3LNRA 1VLSA 1QKRA 1RKEB 4OIQF 5KYXB 5JS5A 3KH2A 1FFHA 1H9TA 3AGUA 4EUKB 3HNLA 2D4UA 3MBGA 4RBNA 1D1BA 3HNKA 3U3FA 3V5ZA 1E84A 1AVOB 4QI2A 3US6A 4LACB 2ZXOA 3S9OA 2R9RB 3IQ6A 4JJGA 4E17A 1ST6A 5COGA 4J7TA 4CJOA 2JD3A 3AGTA 4CIPA 5AGFA 2NSGA 3LNMB 4JVSA 2OQMA 5BQGA 2R03A 4IGGA 3ZG1A 4LDRA 4U5EE
chains in the Genus database with same CATH topology
4MQ9F 2XXAA 3W8HA 3Q6MA 1LS1A 3NDBB 3FDQA 4U5BE 3AQCA 5KYYA 2IOQA 3ZSUA 5KYWA 4EBBA 3POVA 2R7SA 3DJUB 2H7BA 2EILC 3MLGA 4O79A 2CNWD 2I8BA 1KU2A 4KC9A 3SZRA 2XSEA 4CS7A 2L9JA 3LESA 2HV6A 4AX2A 2Y3GA 4JURI 3E9VA 4U5FE 2LSEA 2XRHA 2HV7A 4OD4A 3SP1A 3VAYA 1RJ9A 1TWAA 1M56C 4OD5A 4XLPF 4YT4A 4IWBA 2CNWA 3RFYA 3O39A 3UR3C 1MMDA 2DYRC 2WZFA 1QZXA 3EFOA 2X51A 4KBLA 2FGYA 1SF8A 3EGXB 3UMHA 2IXPA 3W2WA 4BEJA 3H65A 4FX5A 3B0PA 3ZC4A 4G7HF 5HSWA 4K7BA 3ITFA 3DAFA 4CS9A 3K7DA 1FTSA 2OG2A 3JT1A 5CI8A 3N24A 3CZ6A 3EJNA 4CSAA 4W8KA 1Z63A 5IY5C 3K33A 2KGOA 1MMGA 5D91A 3DAGA 5KYUB 3ASNC 3E70C 3LAYA 3OEOA 2VB6A 2G62A 3F47A 1MNEA 3B9QA 2NUPA 4AE4A 5B1AC 1N1CA 4X0RA 4HFFB 2YHSA 3JSZA 3M1CB 1BR1A 4LERA 1VOMA 3NG1A 3LS1A 4U5GA 5DS5A 2V26A 4H4KC 2Q9CA 4OIRF 1ZU5A 3JCUQ 5E3AA 4C3DA 2KQ9A 2NUTA 1V54C 1S7ZA 5FCLA 3AQBA 4JZAA 1Z5ZA 2D5RB 4ULWA 4DBQA 3EHNA 4YT2A 1PCXA 3PHF2 4ZLCA 1ZYRF 4I1OB 4LLCA 4M63A 4BJ5A 2EIKC 4RDAA 3L0IA 5DS6A 4C7OA 4DVYP 4PJNA 4Q7CA 1WGWA 2WZLA 4PJLA 4O6MA 4U5HA 5T1DB 3WG7C 5D92A 3AG2C 1BR4A 3DZAA 4O7GA 5BUOA 4J32B 2J7PD 2R7XA 2W45A 2A6EF 1M2VA 1PD0A 4U5DE 2G3VA 4E7SA 2J9WA 3GANA 3OA1A 2ZXWC 2R7QA 3EQLF 4KNVA 3F46A 1OCRC 3I5QA 3W2VA 2CW0F 2B0JA 3QMKA 1M2OA 2WB7A 2ZPAA 4GYTA 4I44A 1OCCC 4CS9C 3B0VC 4NY3A 3EG9A 2L81A 3UNGC 3K1HA 1SMYF 3KL4A 5KYXA 5E2QA 2MYSA 5T3TA 5E33A 1VYKA 3GODA 4Q5SF 4AK9A 2Y69C 2R7RA 1Z23A 2V3CC 3EPVA 5DS4A 3EGDB 1BR2A 2W9YA 4BJTA 3Q7GA 3HLZA 4PK4A 2A69F 3ABMC 1D0XA 2A68F 3NYMA 2J0WA 5B1BC 3V7OA 3S0XA 5EGYA 2PP4A 3N0TA 2DYSC 1NZEA 3Q7LA 3I5PA 1TWGA 2ZXRA 5F5FA 3OWTA 3DMDA 1LVKA 2W4BA 4F4BA 4E7ZA 3FAJA 4IRUA 2PX3A 3S29A 3UMKA 2NG1A 1TKNA 4O6YA 1TWHA 2QTVA 2P7VA 3RIPA 4A2NB 1ZU4A 2IXMA 3B0UX 1Z3IX 3UGPA 2H7OA 3K6BA 4CS8A 3RH3A 2YEVA 3NRHA 3NYJA 4C3EA 1NU9C 3FVYA 3K66A 2WVOA 2VH3A 3T6BA 3EGXA 3ZVRA 1OCZC 2R7WA 4YN0B 4CIHA 4ZLDA 3NKEA 5DQTA 4XLNF 1D0ZA 5E3CA 2A6HF 3W8IA 1IZMA 1O5HA 4OIPF 1M57C 4YT5A 2C03A 4J30B 2Y39A 2A1DD 4YJWA 4YWQA 2XXAB 1MMAA 4BJ6A 4I3MA 2MWQA 2P6VA 1FFTC 4CBEA 1JPJA 5KYUA 3JRTA 5KYYB 2QY9A 4PFPA 5KYWB 4O6NA 1TWCA 1NU7D 3LEVA 2R7UA 3I4UA 5F5HA 2GFHA 5DLJA 4HE8D 5T3WA 4N06A 3Q6NA 3ECSA 1V55C 4PJMA 2EIMC 1ZHZA 1G8XA 2M4EA 2WVQA 1MNDA 2C04A 2WZGA 3MX3A 4C3BA 4EWCA 1LKXA 4JW1A 1RJ9B 3HJCA 3ZIBA 2DGJA 3DJNB 2W4MA 3NYLA 1VYIA 1ZHTA 4BJ1A 3EHMA 3EFOB 3JYHA 2J7PA 4DOZA 2H7VC 1VMAA 2Q3TA 1ZHXA 4IJJA 2WVNA 3EH1A 3AG4C 2PX0A 3SYNA 4CSAC 2ZXPA 4PFOA 4QDLA 2Q9AA 4BG0A 4I1MA 3KKBA 1PD1A 4HFKB 3NKDA 2Z15A 1QLEC 5EHHA 2KW3C 1J8MF 4CS8C 1IW7F 2J46A 3O6XA 4PJJA 2IXNA 3PMRA 2J45A 4QI0A 2WL8A 1J8YF 3ABLC 4RD9A 5L3VA 2NUPB 2R7VA 3HTKC 4AE4B 3RKOF 2O9XA 3LS0A 3SNHA 3L34A 4Q4ZF 4P6IC 1SZIA 3RYLA 1ZHWA 3AG1C 4U5CE 4JCHA 3N2ZB 3LLKA 4B6IA 3X1OA 4GEHA 1OKKD 2J9VA 3DM9B 2YZSA 1D1CA 3KMIA 3DD7A 1TR2A 3DM5A 3FHDA 4K0DA 1ZHYA 2EIJC 4OINF 3EZHA 4HEAJ 4JJFA 2NUTB 4BJ6C 5L3QA 4BJ5C 3IEEA 4XWJA 4OIOF 4WJ0A 5DVWA 4MNDA 3CSKA 3UMIA 1OKKA 2G3KA 4DBRA 4LLEA 3T4RA 2CDQA 2KJGA 4G0HA 3EGDA 3UGOA 2PF4E 3SEOA 2Y3DA 2PFDA 4C7OB 4KNWA 1W2WA 2VASA 3QZCA 3ABKC 3LLIA 2OCCC 2Y3BA 2IYLD 2Q9BA 2R7OA 3CQZA 3AG3C 2IXOA 4IAOA 2Y3HA 2R7TA 3X2QC 3LJBA 1M2VB 3VYWA 4DVZA 1Z6AA 2E87A 2KNHA 1NG1A 4KI2A 1VK5A 1JPNA 3DXJF 5CI9A 4YT8A 2CGEA 5KYNA 1D1AA 2BE5F 3WODF 5DQZA 2EINC 4FESA 3ASOC 3S28A 2XL4A 3S27A 2FFHA 2J9UA 3EH2A 1MMNA 1O87A 3T6JA 1OCOC 3TD7A 4G7ZF 4XTKA 3EZIA 4ANJA 5B3SC 1D0YA 4G7OF 1FMVA 3K1IC 4FWVA 1FMWA 3LNRA 2J0XA 3EG9B 4OIQF 5KYXB 3KH2A 1FFHA 4RBNA 1D1BA 4QI2A 4LACB 2ZXOA 4JJGA 1ST6A 2JD3A 4JVSA 3ZG1A 4U5EE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKO F;  4HE8 D;  4HEA J; 
#chains in the Genus database with same CATH topology
 4MQ9 F;  2XXA A;  2XL8 A;  3W8H A;  1SR2 A;  4G78 A;  3Q6M A;  1LS1 A;  1A7V A;  3NDB B;  5EK0 A;  3FDQ A;  4U5B E;  5JT4 A;  1YAU O;  5GPG B;  3AQC A;  4MTG A;  1U89 A;  4DRI B;  5KYY A;  1K40 A;  2IOQ A;  2PNO A;  3ZSU A;  3JZ0 A;  5KYW A;  4EBB A;  3POV A;  2R7S A;  2YLG A;  3DI5 A;  1ORJ A;  1A7D A;  3DJU B;  2H7B A;  2QUP A;  4ULV A;  3QW0 A;  3TJ6 A;  1WWP A;  2EIL C;  1NBB A;  3MLG A;  4O79 A;  2CNW D;  1YA9 A;  1OQC A;  5L0F A;  2I8B A;  1KU2 A;  1GS9 A;  4KC9 A;  2XSE A;  1K05 A;  3QW1 A;  2EPO A;  4K1O A;  4YL0 A;  3SZR A;  4CS7 A;  5L0D A;  4E0I A;  2L9J A;  2LK4 A;  5TJ5 E;  1YYX A;  3B29 A;  3LES A;  3MYF A;  1G4U S;  4U9E A;  2HV6 A;  4AX2 A;  2Y3G A;  4J7Y A;  4JUR I;  4N6H A;  3E9V A;  1VTM P;  2XM4 A;  4U5F E;  2LSE A;  2XRH A;  2HV7 A;  4OD4 A;  3SP1 A;  3DKA A;  3S90 A;  5FZT A;  4XQ1 A;  1KNY A;  1WOL A;  2LCH A;  2NPU A;  2AWY A;  3VAY A;  1RJ9 A;  2P1A A;  1C03 A;  1TWA A;  3PDM P;  1M56 C;  4OD5 A;  4XLP F;  4YT4 A;  4IWB A;  2CNW A;  1EQ1 A;  1GQA A;  3RFY A;  3O39 A;  3QVZ A;  1MMD A;  3UR3 C;  4EBJ A;  3SXY A;  4CDA A;  2DYR C;  3U0C A;  2WZF A;  1QZX A;  1YVI A;  3EFO A;  4JE9 A;  3W4Y A;  2X51 A;  4KBL A;  2IM8 A;  3CAX A;  4R32 A;  3ZQV A;  1JR8 A;  3L8J A;  4NTA A;  3VM6 A;  3TQO A;  2FGY A;  1SF8 A;  3EGX B;  2YRF A;  2IXP A;  3M79 A;  3UMH A;  2EPM X;  3W2W A;  4BEJ A;  3C62 A;  3H65 A;  4FX5 A;  3RQG A;  3B0P A;  3C8G D;  3IQT A;  3ZC4 A;  4G7H F;  4XPW A;  5JSL A;  5HSW A;  4XEK A;  1E86 A;  4K7B A;  3ITF A;  2OKU A;  4EKW A;  3B71 A;  4L6R A;  1SYQ A;  3DAF A;  4CS9 A;  2OG2 A;  1FTS A;  2XLV A;  3K7D A;  4DXW A;  3JT1 A;  5CI8 A;  1E2X A;  3N24 A;  3U9M A;  3CZ6 A;  3EJN A;  4JEA A;  4CSA A;  4W8K A;  5KYU B;  1Z63 A;  2YL0 A;  1GGQ A;  2IBF A;  5IY5 C;  3K33 A;  3PCV A;  3TOL A;  3BRJ A;  4Z9J A;  2KGO A;  5AC4 A;  1MMG A;  5D91 A;  1O3U A;  2MHR A;  3ASN C;  3C8G A;  3DAG A;  1VB5 A;  3E70 C;  2YLD A;  3LAY A;  1ORY A;  3OEO A;  2VB6 A;  2G62 A;  2AWC A;  1HW2 A;  2HJ3 A;  3F47 A;  1MNE A;  1HY5 A;  1TFK B;  1LE2 A;  3O55 A;  3B9Q A;  3VF0 A;  3FMS A;  2NUP A;  3C18 A;  2GDC A;  4AE4 A;  2YLI A;  3C7J A;  5B1A C;  2L6G A;  3U2L A;  1N1C A;  4X0R A;  4HFF B;  5K0I A;  2YHS A;  1Q0G A;  3JSZ A;  4AL1 A;  3M1C B;  4JRZ A;  1BR1 A;  4LER A;  1VOM A;  3NG1 A;  4DRJ B;  3C63 A;  1JRA A;  1AUE A;  3LS1 A;  4U5G A;  5DS5 A;  2V26 A;  2VCA A;  4H4K C;  2Q9C A;  2OOC A;  4OIR F;  1ZU5 A;  3FOO A;  3JCU Q;  3GEI A;  5E3A A;  4C3D A;  2KQ9 A;  1XZQ A;  3GEE A;  4YL1 A;  2P0N A;  2NUT A;  1XWJ A;  1V54 C;  1S7Z A;  5FCL A;  2HMQ A;  3AQB A;  4JZA A;  4XEV A;  4D4N A;  5A6K A;  1Z5Z A;  2D5R B;  2XLE A;  4ULW A;  3EHN A;  4DBQ A;  4YT2 A;  1CPR A;  4N6C A;  5L0I A;  2KK1 A;  3HKK A;  1PCX A;  4E18 A;  3PHF 2;  1NFN A;  2EPL X;  4ZLC A;  1ZYR F;  1L7C A;  1TFO B;  1ZVZ A;  2JPU A;  1CGO A;  4I1O B;  4LLC A;  4M63 A;  4BJ5 A;  3ZWI A;  2EIK C;  4XPY A;  4RDA A;  2XLO A;  3L0I A;  5DS6 A;  1DOW A;  4C7O A;  4DVY P;  4PJN A;  4YK5 A;  2X0C A;  1OW7 A;  1QVX A;  3RQE A;  4Q7C A;  1HMD A;  2VCB A;  1YYJ A;  3TUL A;  1WGW A;  3RW0 A;  1NSG B;  2R05 A;  2WZL A;  4PJL A;  4CBE A;  4O6M A;  4U5H A;  5T1D B;  2ETS A;  3WG7 C;  4U9D A;  5D92 A;  3U3B A;  1PV3 A;  2OEV A;  2YQY A;  3AG2 C;  4ER9 A;  1BR4 A;  3DZA A;  2HFI A;  4O7G A;  4EHP A;  5BUO A;  2J9B A;  4J32 B;  5COM A;  2J7P D;  2R7X A;  2W45 A;  2A6E F;  3DE8 A;  1M2V A;  1YJG A;  3MFN A;  1PD0 A;  1YZA A;  4U5D E;  5AC5 A;  4GQH A;  1Q0M A;  2G3V A;  1NLX A;  5L0J A;  4JKV A;  3GOR A;  4E7S A;  2J9W A;  3GAN A;  3JTL O;  2LFF A;  1LM3 B;  4IAR A;  2XM0 A;  2XS1 A;  2ZXW C;  3OA1 A;  4MW8 A;  4NQF A;  2R7Q A;  1WN0 A;  4MTO A;  2CCY A;  3M4C A;  3EQL F;  3G4Z A;  4KNV A;  5COF A;  3F46 A;  1OCR C;  2TMV P;  1BZ4 A;  2L6F A;  3T6G B;  3TK0 A;  2ASR A;  3I5Q A;  2LP4 A;  3DWW A;  1F1M A;  3NMJ A;  3W2V A;  1U6H A;  2CW0 F;  1UFB A;  2B0J A;  1H7I A;  3QMK A;  1M2O A;  2WB7 A;  1BBH A;  4JIO A;  1EA8 A;  4D4X A;  2ZPA A;  2YL7 A;  5JVE A;  4GYT A;  1T01 A;  1APC A;  1OCC C;  2Q4F A;  4I44 A;  4CS9 C;  3B0V C;  4NY3 A;  3U5S A;  3EG9 A;  1RKE A;  2L81 A;  2FAP B;  3K1H A;  1SMY F;  3KL4 A;  3UNG C;  5KYX A;  2OJQ A;  5E2Q A;  2QNL A;  2MYS A;  2HJM A;  5T3T A;  5E33 A;  3GM2 A;  1VYK A;  3GOD A;  4Q5S F;  3RVY A;  1T9K A;  1UG7 A;  2HZ8 A;  2Y69 C;  3SXM A;  4AK9 A;  1A0B A;  2R7R A;  1Z23 A;  2V3C C;  2RSE B;  3EPV A;  1OW8 A;  5DS4 A;  1BR2 A;  2W9Y A;  3EGD B;  4CX9 A;  4DRH B;  4BJT A;  3Q7G A;  1TQG A;  3NMI A;  1OR2 A;  3HLZ A;  4PK4 A;  1FR0 A;  3GEH A;  2A69 F;  3ABM C;  1H6G A;  3G50 A;  3WAQ A;  2RD9 A;  1D0X A;  2GWW A;  2A68 F;  3NYM A;  2J0W A;  2YVK A;  5B1B C;  4XPX A;  1C17 M;  1HW1 A;  2F22 A;  3V7O A;  5EGY A;  3S0X A;  3U9J A;  1LI7 A;  1DOV A;  4W8P A;  2PP4 A;  1JAF A;  3M4B A;  2DYS C;  1NZE A;  3N0T A;  3Q7L A;  5A6J A;  3I5P A;  1TWG A;  4LDQ A;  1ORS C;  2ZXR A;  5CIV A;  5F5F A;  3OWT A;  1HE1 A;  4H54 A;  3DMD A;  1LVK A;  2DI3 A;  2W4B A;  4F4B A;  4E7Z A;  5L0C A;  3FAJ A;  4IRU A;  2PX3 A;  3S29 A;  4CDV A;  256B A;  2HS5 A;  2R25 A;  2R02 A;  1U0B B;  1WAS A;  1YA7 O;  3UMK A;  2NG1 A;  2VCC A;  1TKN A;  1YDI A;  4O6Y A;  1TWH A;  2QTV A;  2XLM A;  2P7V A;  2KC3 A;  3AOU A;  3FOP A;  4XEF A;  4Z9H A;  3RIP A;  4A2N B;  1ZU4 A;  2IXM A;  4NC3 A;  3B0U X;  1Z3I X;  3UGP A;  2H7O A;  3K6B A;  4UDV A;  4DJ9 A;  3LEO A;  1Y6D A;  4CS8 A;  3RH3 A;  1G4W R;  2YEV A;  1B68 A;  3NRH A;  1A41 A;  3NYJ A;  4JTC B;  1CGN A;  4C3E A;  1L3P A;  2BC5 A;  4CDY A;  1LIH A;  1NU9 C;  3FVY A;  3K66 A;  2WVO A;  2PBE A;  4MVO A;  5JRA A;  2VH3 A;  4MTF A;  3GM3 A;  1GM5 A;  1RCP A;  3T6B A;  3EGX A;  3ZVR A;  1OCZ C;  2XL6 A;  3L1M A;  2R7W A;  3JRM O;  2HSQ A;  4YN0 B;  4CIH A;  5JLI A;  4ZLD A;  3NKE A;  4P9F A;  5DQT A;  4XLN F;  4BPM A;  3M15 A;  1M6T A;  3GWN A;  1RKC A;  1AEP A;  1D0Z A;  5E3C A;  1E83 A;  2A6H F;  1LPE A;  1LI5 A;  1S05 A;  3W8I A;  3ZTM A;  1XZP A;  1T6Q A;  4EIY A;  1IZM A;  1YLM A;  4MVR A;  1O5H A;  2HSB A;  4OIP F;  1M57 C;  4YT5 A;  3U8V A;  2C03 A;  4J30 B;  1ZW3 A;  2A1D D;  2Y39 A;  4YJW A;  2ZD9 A;  4YWQ A;  3DE9 A;  2XXA B;  1MMA A;  4BJ6 A;  4I3M A;  4NCQ A;  2MWQ A;  3KYI A;  2P6V A;  1OXB A;  1FFT C;  1YZC A;  1OXK A;  1JPJ A;  2NSF A;  3L8I A;  5KYU A;  2A0U A;  3JRT A;  1QPU A;  1T5O A;  2LD6 A;  3HNI A;  3MYI A;  5F28 E;  4CJG A;  1CPQ A;  4MS2 A;  5KYY B;  2QY9 A;  4PFP A;  2XLD A;  5KYW B;  2QLA A;  4O6N A;  1G5Z A;  1TWC A;  5A6B D;  2LQG A;  1ZZP A;  3IQC A;  1NU7 D;  2KSF A;  3LEV A;  3I4U A;  2YKZ A;  5F5H A;  2GFH A;  5BQH A;  5DLJ A;  1FNT c;  2R7U A;  1EKY A;  1Y4C A;  3FAP B;  4HE8 D;  4NTF A;  5T3W A;  4N06 A;  5A6A A;  3Q6N A;  1K04 A;  1V55 C;  3ECS A;  4MVS A;  4PJM A;  1BDJ B;  2JX0 A;  3AJM A;  1T6U A;  2I15 A;  2EIM C;  4JC7 A;  2YWA A;  1ZHZ A;  1OR3 A;  1G8X A;  2KYH A;  2M4E A;  4MVZ A;  1NFO A;  2WVQ A;  1MND A;  2C04 A;  2WZG A;  3MX3 A;  4C3B A;  2UUH A;  1RMV A;  4EWC A;  1LKX A;  4JW1 A;  1RJ9 B;  4A4A A;  5A6B A;  3HJC A;  3ZIB A;  2DGJ A;  3DJN B;  2W4M A;  3IQ5 A;  3NYL A;  1VYI A;  1I5N A;  4WAB A;  3R7C A;  1ZHT A;  1H9G A;  4JTA B;  4BJ1 A;  3EHM A;  3EFO B;  3JYH A;  4Z9I A;  2QE9 A;  2J7P A;  3CEX A;  3GWL A;  4DOZ A;  1E85 A;  2H7V C;  4NTB A;  3GM1 A;  4PAC A;  3H2V A;  1VMA A;  2Q3T A;  1ZHX A;  4IJJ A;  1LS4 A;  4WGZ A;  1I4Z A;  2WVN A;  3EH1 A;  1WAT A;  2VC9 A;  3A11 A;  3AG4 C;  2P61 A;  2PX0 A;  3SYN A;  4CSA C;  2ZXP A;  3R2P A;  3ATP A;  4PFO A;  4QDL A;  3RVZ A;  2BL2 A;  2Q9A A;  4JEB A;  4BG0 A;  4I1M A;  3KKB A;  1JOG A;  3S84 A;  1PD1 A;  2M64 A;  4HFK B;  1YAR O;  3NKD A;  4N4W A;  4MVU A;  5HV9 A;  4JTD B;  2Z15 A;  1LE4 A;  1QLE C;  2A0B A;  3H2U A;  3K1I A;  3U8P A;  5EHH A;  2KW3 C;  4MVM A;  1QQ3 A;  1J8M F;  4CS8 C;  1IW7 F;  1Q0F A;  2J46 A;  2LFD A;  2LIG A;  1CGM E;  2L6H A;  3O6X A;  2AVK A;  4PJJ A;  2IXN A;  2DB4 A;  3TJ5 A;  3C8G B;  5JP7 A;  1ZW2 A;  2J45 A;  3PMR A;  4QI0 A;  4WGY A;  4P9T A;  2WL8 A;  1J8Y F;  3ABL C;  3HNJ A;  2UUI A;  4RD9 A;  5L3V A;  2NUP B;  1A7E A;  2R7V A;  3V5X A;  3HTK C;  4AE4 B;  1HMO A;  1V74 B;  3RKO F;  3ZDL A;  5L0G A;  3VRC A;  2EPK X;  2O9X A;  3LS0 A;  3SNH A;  3L34 A;  2H8A A;  3KYJ A;  4P6I C;  1SZI A;  3RYL A;  4Q4Z F;  1ZHW A;  3AG1 C;  4U5C E;  4JCH A;  3RF3 A;  1R5I D;  3LLK A;  3N2Z B;  4B6I A;  3X1O A;  4GEH A;  1MQV A;  3G4X A;  1OKK D;  2J9V A;  3DM9 B;  3QTH A;  2YZS A;  3T9O A;  4BEM J;  1D1C A;  4EBK A;  1T6I A;  2HKV A;  3KMI A;  2Q7R A;  3DD7 A;  1TR2 A;  3DM5 A;  1I4Y A;  3FHD A;  4K0D A;  1ZHY A;  3A9C A;  2EIJ C;  4OIN F;  3EZH A;  1WTY A;  4HEA J;  4JJF A;  2CYD A;  4MVQ A;  3SXZ A;  3ZQY A;  1OW6 A;  2NUT B;  4BJ6 C;  3O10 A;  4BJ5 C;  5L3Q A;  3IEE A;  5B3I A;  2GA0 A;  4AL0 A;  2XLH A;  2YL1 A;  4XWJ A;  4FAP B;  4OIO F;  3JSE O;  2AP3 A;  3RQF A;  4WJ0 A;  1C02 A;  2EPN A;  5DVW A;  4MND A;  2XS8 A;  3CSK A;  3UMI A;  1OKK A;  3U2M A;  2G3K A;  1RXQ A;  4DBR A;  4LLE A;  3T4R A;  2CDQ A;  2KJG A;  4G0H A;  3EGD A;  3UGO A;  2PF4 E;  3SEO A;  2Y3D A;  2OJE D;  2PFD A;  3V5Y A;  4C7O B;  4KNW A;  1W2W A;  5A69 A;  2VAS A;  4IAQ A;  3QZC A;  3ABK C;  2OU6 A;  3LLI A;  2YL3 A;  5L0H A;  2OCC C;  1R4T A;  2Y3B A;  1Q0K A;  2IYL D;  2Q9B A;  2HMZ A;  2B0H A;  2R7O A;  1V4A A;  2L7A A;  3AG3 C;  2IXO A;  3CQZ A;  1Z7Q c;  1Q0D A;  1JMW A;  3BEH A;  2GAQ A;  5JUA A;  4IAO A;  3LUT B;  4ONS A;  3J06 A;  2Y3H A;  2R7T A;  3X2Q C;  3LJB A;  2J8W A;  4LDK A;  3ZTZ A;  1M2V B;  3QVY A;  3VYW A;  4DVZ A;  1Z6A A;  1QSP A;  2E87 A;  2KNH A;  1NG1 A;  4KI2 A;  2OEX A;  1VK5 A;  1JPN A;  3DXJ F;  5CI9 A;  4YT8 A;  1KTM A;  2AU5 A;  2CGE A;  5KYN A;  1D1A A;  2BE5 F;  3IHU A;  4MW3 A;  3WOD F;  1FAP B;  5DQZ A;  2EIN C;  3TOM A;  4IB4 A;  3C8Z A;  3ASO C;  4FES A;  3S28 A;  2XL4 A;  3SXK A;  3S27 A;  2FFH A;  2J9U A;  3EH2 A;  1VLT A;  1MMN A;  1O87 A;  4YL3 A;  5BQI A;  2HUJ A;  3WHN A;  1HE9 A;  3IPM O;  2XLW A;  4PR9 A;  3T6J A;  1OCO C;  3TD7 A;  4G7Z F;  3JYY A;  3KPH A;  4XTK A;  1EI7 A;  2Q00 A;  3EZI A;  4ANJ A;  5B3S C;  4JCZ A;  3NMK A;  1D0Y A;  3FXH A;  4E0H A;  4G7O F;  1FMV A;  3K1I C;  4FWV A;  1FMW A;  2ICW G;  2J0X A;  3EG9 B;  3LNR A;  1VLS A;  1QKR A;  1RKE B;  4OIQ F;  5KYX B;  5JS5 A;  3KH2 A;  1FFH A;  1H9T A;  3AGU A;  4EUK B;  3HNL A;  2D4U A;  3MBG A;  4RBN A;  1D1B A;  3HNK A;  3U3F A;  3V5Z A;  1E84 A;  1AVO B;  4QI2 A;  3US6 A;  4LAC B;  2ZXO A;  3S9O A;  2R9R B;  3IQ6 A;  4JJG A;  4E17 A;  1ST6 A;  5COG A;  4J7T A;  4CJO A;  2JD3 A;  3AGT A;  4CIP A;  5AGF A;  2NSG A;  3LNM B;  4JVS A;  2OQM A;  5BQG A;  2R03 A;  4IGG A;  3ZG1 A;  4LDR A;  4U5E E; 
#chains in the Genus database with same CATH homology
 4MQ9 F;  2XXA A;  3W8H A;  3Q6M A;  1LS1 A;  3NDB B;  3FDQ A;  4U5B E;  3AQC A;  5KYY A;  2IOQ A;  3ZSU A;  5KYW A;  4EBB A;  3POV A;  2R7S A;  3DJU B;  2H7B A;  2EIL C;  3MLG A;  4O79 A;  2CNW D;  2I8B A;  1KU2 A;  4KC9 A;  3SZR A;  2XSE A;  4CS7 A;  2L9J A;  3LES A;  2HV6 A;  4AX2 A;  2Y3G A;  4JUR I;  3E9V A;  4U5F E;  2LSE A;  2XRH A;  2HV7 A;  4OD4 A;  3SP1 A;  3VAY A;  1RJ9 A;  1TWA A;  1M56 C;  4OD5 A;  4XLP F;  4YT4 A;  4IWB A;  2CNW A;  3RFY A;  3O39 A;  3UR3 C;  1MMD A;  2DYR C;  2WZF A;  1QZX A;  3EFO A;  2X51 A;  4KBL A;  2FGY A;  1SF8 A;  3EGX B;  3UMH A;  2IXP A;  3W2W A;  4BEJ A;  3H65 A;  4FX5 A;  3B0P A;  3ZC4 A;  4G7H F;  5HSW A;  4K7B A;  3ITF A;  3DAF A;  4CS9 A;  3K7D A;  1FTS A;  2OG2 A;  3JT1 A;  5CI8 A;  3N24 A;  3CZ6 A;  3EJN A;  4CSA A;  4W8K A;  1Z63 A;  5IY5 C;  3K33 A;  2KGO A;  1MMG A;  5D91 A;  3DAG A;  5KYU B;  3ASN C;  3E70 C;  3LAY A;  3OEO A;  2VB6 A;  2G62 A;  3F47 A;  1MNE A;  3B9Q A;  2NUP A;  4AE4 A;  5B1A C;  1N1C A;  4X0R A;  4HFF B;  2YHS A;  3JSZ A;  3M1C B;  1BR1 A;  4LER A;  1VOM A;  3NG1 A;  3LS1 A;  4U5G A;  5DS5 A;  2V26 A;  4H4K C;  2Q9C A;  4OIR F;  1ZU5 A;  3JCU Q;  5E3A A;  4C3D A;  2KQ9 A;  2NUT A;  1V54 C;  1S7Z A;  5FCL A;  3AQB A;  4JZA A;  1Z5Z A;  2D5R B;  4ULW A;  4DBQ A;  3EHN A;  4YT2 A;  1PCX A;  3PHF 2;  4ZLC A;  1ZYR F;  4I1O B;  4LLC A;  4M63 A;  4BJ5 A;  2EIK C;  4RDA A;  3L0I A;  5DS6 A;  4C7O A;  4DVY P;  4PJN A;  4Q7C A;  1WGW A;  2WZL A;  4PJL A;  4O6M A;  4U5H A;  5T1D B;  3WG7 C;  5D92 A;  3AG2 C;  1BR4 A;  3DZA A;  4O7G A;  5BUO A;  4J32 B;  2J7P D;  2R7X A;  2W45 A;  2A6E F;  1M2V A;  1PD0 A;  4U5D E;  2G3V A;  4E7S A;  2J9W A;  3GAN A;  3OA1 A;  2ZXW C;  2R7Q A;  3EQL F;  4KNV A;  3F46 A;  1OCR C;  3I5Q A;  3W2V A;  2CW0 F;  2B0J A;  3QMK A;  1M2O A;  2WB7 A;  2ZPA A;  4GYT A;  4I44 A;  1OCC C;  4CS9 C;  3B0V C;  4NY3 A;  3EG9 A;  2L81 A;  3UNG C;  3K1H A;  1SMY F;  3KL4 A;  5KYX A;  5E2Q A;  2MYS A;  5T3T A;  5E33 A;  1VYK A;  3GOD A;  4Q5S F;  4AK9 A;  2Y69 C;  2R7R A;  1Z23 A;  2V3C C;  3EPV A;  5DS4 A;  3EGD B;  1BR2 A;  2W9Y A;  4BJT A;  3Q7G A;  3HLZ A;  4PK4 A;  2A69 F;  3ABM C;  1D0X A;  2A68 F;  3NYM A;  2J0W A;  5B1B C;  3V7O A;  3S0X A;  5EGY A;  2PP4 A;  3N0T A;  2DYS C;  1NZE A;  3Q7L A;  3I5P A;  1TWG A;  2ZXR A;  5F5F A;  3OWT A;  3DMD A;  1LVK A;  2W4B A;  4F4B A;  4E7Z A;  3FAJ A;  4IRU A;  2PX3 A;  3S29 A;  3UMK A;  2NG1 A;  1TKN A;  4O6Y A;  1TWH A;  2QTV A;  2P7V A;  3RIP A;  4A2N B;  1ZU4 A;  2IXM A;  3B0U X;  1Z3I X;  3UGP A;  2H7O A;  3K6B A;  4CS8 A;  3RH3 A;  2YEV A;  3NRH A;  3NYJ A;  4C3E A;  1NU9 C;  3FVY A;  3K66 A;  2WVO A;  2VH3 A;  3T6B A;  3EGX A;  3ZVR A;  1OCZ C;  2R7W A;  4YN0 B;  4CIH A;  4ZLD A;  3NKE A;  5DQT A;  4XLN F;  1D0Z A;  5E3C A;  2A6H F;  3W8I A;  1IZM A;  1O5H A;  4OIP F;  1M57 C;  4YT5 A;  2C03 A;  4J30 B;  2Y39 A;  2A1D D;  4YJW A;  4YWQ A;  2XXA B;  1MMA A;  4BJ6 A;  4I3M A;  2MWQ A;  2P6V A;  1FFT C;  4CBE A;  1JPJ A;  5KYU A;  3JRT A;  5KYY B;  2QY9 A;  4PFP A;  5KYW B;  4O6N A;  1TWC A;  1NU7 D;  3LEV A;  2R7U A;  3I4U A;  5F5H A;  2GFH A;  5DLJ A;  4HE8 D;  5T3W A;  4N06 A;  3Q6N A;  3ECS A;  1V55 C;  4PJM A;  2EIM C;  1ZHZ A;  1G8X A;  2M4E A;  2WVQ A;  1MND A;  2C04 A;  2WZG A;  3MX3 A;  4C3B A;  4EWC A;  1LKX A;  4JW1 A;  1RJ9 B;  3HJC A;  3ZIB A;  2DGJ A;  3DJN B;  2W4M A;  3NYL A;  1VYI A;  1ZHT A;  4BJ1 A;  3EHM A;  3EFO B;  3JYH A;  2J7P A;  4DOZ A;  2H7V C;  1VMA A;  2Q3T A;  1ZHX A;  4IJJ A;  2WVN A;  3EH1 A;  3AG4 C;  2PX0 A;  3SYN A;  4CSA C;  2ZXP A;  4PFO A;  4QDL A;  2Q9A A;  4BG0 A;  4I1M A;  3KKB A;  1PD1 A;  4HFK B;  3NKD A;  2Z15 A;  1QLE C;  5EHH A;  2KW3 C;  1J8M F;  4CS8 C;  1IW7 F;  2J46 A;  3O6X A;  4PJJ A;  2IXN A;  3PMR A;  2J45 A;  4QI0 A;  2WL8 A;  1J8Y F;  3ABL C;  4RD9 A;  5L3V A;  2NUP B;  2R7V A;  3HTK C;  4AE4 B;  3RKO F;  2O9X A;  3LS0 A;  3SNH A;  3L34 A;  4Q4Z F;  4P6I C;  1SZI A;  3RYL A;  1ZHW A;  3AG1 C;  4U5C E;  4JCH A;  3N2Z B;  3LLK A;  4B6I A;  3X1O A;  4GEH A;  1OKK D;  2J9V A;  3DM9 B;  2YZS A;  1D1C A;  3KMI A;  3DD7 A;  1TR2 A;  3DM5 A;  3FHD A;  4K0D A;  1ZHY A;  2EIJ C;  4OIN F;  3EZH A;  4HEA J;  4JJF A;  2NUT B;  4BJ6 C;  5L3Q A;  4BJ5 C;  3IEE A;  4XWJ A;  4OIO F;  4WJ0 A;  5DVW A;  4MND A;  3CSK A;  3UMI A;  1OKK A;  2G3K A;  4DBR A;  4LLE A;  3T4R A;  2CDQ A;  2KJG A;  4G0H A;  3EGD A;  3UGO A;  2PF4 E;  3SEO A;  2Y3D A;  2PFD A;  4C7O B;  4KNW A;  1W2W A;  2VAS A;  3QZC A;  3ABK C;  3LLI A;  2OCC C;  2Y3B A;  2IYL D;  2Q9B A;  2R7O A;  3CQZ A;  3AG3 C;  2IXO A;  4IAO A;  2Y3H A;  2R7T A;  3X2Q C;  3LJB A;  1M2V B;  3VYW A;  4DVZ A;  1Z6A A;  2E87 A;  2KNH A;  1NG1 A;  4KI2 A;  1VK5 A;  1JPN A;  3DXJ F;  5CI9 A;  4YT8 A;  2CGE A;  5KYN A;  1D1A A;  2BE5 F;  3WOD F;  5DQZ A;  2EIN C;  4FES A;  3ASO C;  3S28 A;  2XL4 A;  3S27 A;  2FFH A;  2J9U A;  3EH2 A;  1MMN A;  1O87 A;  3T6J A;  1OCO C;  3TD7 A;  4G7Z F;  4XTK A;  3EZI A;  4ANJ A;  5B3S C;  1D0Y A;  4G7O F;  1FMV A;  3K1I C;  4FWV A;  1FMW A;  3LNR A;  2J0X A;  3EG9 B;  4OIQ F;  5KYX B;  3KH2 A;  1FFH A;  4RBN A;  1D1B A;  4QI2 A;  4LAC B;  2ZXO A;  4JJG A;  1ST6 A;  2JD3 A;  4JVS A;  3ZG1 A;  4U5E E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...