4HEAJ

Crystal structure of the entire respiratory complex i from thermus thermophilus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
160
Chain Sequence
MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGEIGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase subunit 1
publication title Crystal structure of the entire respiratory complex I.
pubmed doi rcsb
total genus 52
structure length 160
sequence length 160
chains with identical sequence R
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00499 Oxidored_q3 NADH-ubiquinone/plastoquinone oxidoreductase chain 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1200 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4heaJ00
4HEAJ 4HE8D 3RKOF
chains in the Genus database with same CATH superfamily
4MTOA 5DQTA 3ZQYA 1Z5ZA 4CX9A 4XEKA 3G50A 1QPUA 4JRZA 5KYWB 3EHMA 2Q3TA 4K7BA 2B0JA 2RSEB 5AC4A 3V7OA 4MW3A 3JTLO 4FX5A 3FVYA 1IZMA 3VM6A 4CS8C 2GWWA 2P61A 1ST6A 1VYIA 2OCCC 3ATPA 3S29A 4K0DA 1U6HA 1BBHA 2HMZA 4U9EA 3OA1A 2HKVA 3S27A 1CGME 4GQHA 4JKVA 3L8JA 3LEOA 4EBKA 2PP4A 2J0WA 1M56C 2BE5F 2XXAB 4ULVA 1OR3A 4J7YA 4D4XA 4P6IC 4CJOA 5L0JA 4MW8A 5BUOA 4Z9JA 3AOUA 2IOQA 4LDRA 3DM5A 3FMSA 4OIRF 4NY3A 4HEAJ 3SEOA 2EPMX 2XL6A 1BDJB 1OKKA 2X51A 4BJ1A 1R5ID 3SXKA 2DGJA 1TR2A 3S28A 1T6UA 3M4CA 3T6BA 4Z9HA 5DS6A 5JLIA 3DJNB 2PFDA 1SR2A 3V5ZA 5B3SC 1A41A 3S0XA 1J8YF 4O79A 3K66A 3US6A 3JSEO 4FWVA 4RDAA 3WAQA 2I8BA 1K40A 3LNRA 4YK5A 1LI5A 3T9OA 1MQVA 4JTCB 4QI0A 2VH3A 3B0VC 2QY9A 3S9OA 3K33A 4OIQF 3U8VA 2LCHA 3FOOA 3O6XA 2XS8A 1LPEA 1ORYA 2ZXPA 3NMIA 5BQIA 1ZW2A 3RH3A 5L0IA 4ULWA 2JPUA 1HW2A 1NU9C 3NMKA 3ECSA 4A2NB 1O3UA 3DM9B 5B1AC 1QKRA 2YL1A 1GQAA 3HTKC 1N1CA 1H7IA 2XLEA 2VC9A 2F22A 4LDQA 1LKXA 1JOGA 3DKAA 2R7TA 1ZHYA 2KSFA 1GM5A 3V5XA 3NMJA 1BR4A 4DJ9A 2O9XA 2YLDA 4O6YA 3RFYA 3OWTA 4U9DA 3IQCA 3M15A 4XEFA 4YT2A 4YT5A 3EGXA 2Y3HA 5EHHA 1I5NA 1XZQA 3SNHA 2EPNA 5KYUB 5KYYB 1FFHA 1RKEB 2XLMA 1V4AA 1IW7F 3W8IA 3AJMA 3H65A 3TOLA 4MNDA 1E84A 1QQ3A 4YT4A 4CSAA 4CDVA 3U3BA 3FOPA 3IQ6A 5A6JA 3EFOA 2IYLD 4JIOA 4XLNF 2OOCA 3ZG1A 1YLMA 2NPUA 3Q6NA 2W4MA 2XLOA 4ONSA 3RKOF 3SXMA 3U8PA 4C7OB 3NYLA 4PJNA 3N24A 3QW1A 4YT8A 2Q00A 1OW6A 2ETSA 2P1AA 3X2QC 2M64A 4PJJA 1LS1A 3TJ5A 5JUAA 2R7QA 2XM0A 4PACA 3DE8A 1TKNA 3C8ZA 2VCAA 3EGDB 1W2WA 1V74B 1VB5A 4B6IA 4MVUA 4MVOA 1JPNA 5EK0A 4AX2A 3C8GA 3KH2A 2EIKC 1H9GA 3MBGA 3M79A 3GM3A 1G5ZA 4XWJA 4UDVA 2ZXWC 3NG1A 1Q0GA 1Z6AA 1NSGB 1RCPA 2XL8A 3K1IA 4O6NA 4E7SA 1YA9A 5EGYA 2YVKA 3IPMO 3QVYA 1M2VB 2Y69C 1L3PA 1TFKB 3C63A 4M63A 1EKYA 2J45A 4HE8D 4NTBA 2EPKX 4LLCA 2OEVA 4LDKA 2MYSA 3CAXA 3RQFA 4DBRA 5K0IA 4CS7A 4NCQA 4NTAA 4ZLDA 1OXBA 2LD6A 3JZ0A 1QSPA 3EG9A 4J32B 5T3TA 4JVSA 5COGA 1WOLA 2LK4A 2NSFA 4IB4A 1OKKD 4JTDB 4G0HA 3U9MA 5CI8A 1TWGA 2NSGA 2J9VA 2ZXOA 4BJ6C 3GEHA 1XZPA 1OCRC 4U5EE 3RF3A 2TMVP 1ORSC 1BZ4A 4WJ0A 4ZLCA 5E3AA 3W8HA 4NQFA 2HMQA 3C62A 1ZU5A 1S05A 1Y4CA 2CNWA 2DI3A 4XPWA 3RYLA 4AE4A 1L7CA 2YL0A 1GS9A 3AG2C 1C02A 4MQ9F 3SZRA 2IM8A 5B1BC 2LSEA 2Y3DA 2J7PD 2CCYA 5DLJA 2A69F 2MWQA 4H54A 3JRMO 3QMKA 1SMYF 5L0FA 4AK9A 2LQGA 5A6AA 1S7ZA 1BR2A 2R7OA 2ASRA 1JAFA 2NUTA 4G78A 1OW8A 2KYHA 3GM2A 1WWPA 4NC3A 4U5DE 4E0IA 4U5GA 5HV9A 1VLTA 2IXOA 3AQCA 4W8PA 3QZCA 1ZHXA 1OCCC 2ZPAA 3S90A 4KC9A 4CJGA 1AEPA 4PJLA 1CGOA 1Z23A 2HV7A 2KNHA 1FMVA 2G3KA 2GAQA 3ASOC 1Y6DA 3ASNC 3I4UA 3EZHA 4KI2A 1RJ9A 2AU5A 1YJGA 2R7RA 2HV6A 5BQGA 5CIVA 4C3BA 5FZTA 3TQOA 5L3VA 4ANJA 2R7UA 3M4BA 4IAQA 5F5FA 3K6BA 1MMGA 4MVRA 1AVOB 3GWLA 1HW1A 1C17M 1PD0A 1YA7O 4EKWA 2JD3A 2Q9BA 3O39A 5L0HA 2OJQA 4MVMA 1A7VA 1SF8A 1QLEC 3L0IA 3LNMB 3C18A 3Q6MA 3R2PA 2DB4A 3QW0A 5JP7A 2NUPA 4U5HA 1BR1A 4N6CA 4Q5SF 3ZTZA 4N4WA 2Q9AA 2YHSA 2H7VC 3C8GD 1ORJA 1FAPB 1HE1A 2R03A 2ZD9A 2QE9A 3DAFA 4U5CE 1ZHZA 1T6IA 2FFHA 3PMRA 3PHF2 4I1MA 3ZWIA 2AWCA 3EFOB 1OCOC 5KYXA 1NG1A 1E85A 3POVA 2J7PA 4C3DA 2YLIA 3CSKA 3GM1A 4N06A 5IY5C 1K05A 2GFHA 2PX3A 3CEXA 1F1MA 3DZAA 4DBQA 5KYWA 2HS5A 1TWHA 2IXNA 1JR8A 3HLZA 4X0RA 1JPJA 4HFKB 3EQLF 3UGOA 1D0ZA 2FGYA 2J46A 2L6GA 1RKCA 4ER9A 3UGPA 3LAYA 1HMDA 4N6HA 3JT1A 2KJGA 2XLWA 3WG7C 2PBEA 3GEIA 3KYIA 4P9TA 3VRCA 1Z7Qc 1TFOB 1LVKA 3DI5A 4WABA 2D5RB 2YKZA 2RD9A 3H2UA 4E7ZA 1XWJA 2AP3A 3EHNA 3U2MA 1NU7D 4JEBA 2AVKA 3QVZA 3RQEA 2VCBA 4XQ1A 3RIPA 3CZ6A 2EIJC 3MYIA 4EBBA 1NZEA 5AGFA 3ITFA 1U0BB 4F4BA 3L34A 2EIMC 1RXQA 2CNWD 2MHRA 3Q7LA 2KW3C 1YZAA 4MVQA 3MYFA 2IXMA 2IBFA 1QVXA 4YWQA 1T5OA 2KGOA 1B68A 2WZFA 3I5PA 3EH1A 1PCXA 4JW1A 5COFA 2LFDA 4JTAB 2X0CA 3K1HA 3U9JA 4DRJB 1AUEA 3NKDA 2LP4A 2BL2A 2OKUA 4PR9A 2CDQA 4YL0A 2XLVA 1LE2A 3G4ZA 5DVWA 4QI2A 4BEJA 4DOZA 1M6TA 1H9TA 3GWNA 4MTFA 4Z9IA 2WZGA 1FR0A 3RVZA 1ZVZA 2L81A 1PD1A 2YEVA 1DOWA 1KU2A 1OR2A 4RD9A 3VYWA 2R7SA 3HNJA 3E9VA 3JRTA 2A1DD 3KL4A 4PFPA 3IQ5A 3U3FA 1T9KA 4DVZA 3O55A 3UR3C 4BEMJ 3LLIA 3WODF 2Y3BA 1SZIA 1EA8A 4CSAC 1HMOA 1FTSA 2HSQA 2ICWG 2A6HF 1Q0MA 2GA0A 4OINF 1ZZPA 4CDYA 1D1AA 1WN0A 2QTVA 1FFTC 2NG1A 4EUKB 3AG4C 2LIGA 4YL1A 4JCHA 1J8MF 1V55C 3LJBA 4EBJA 1O5HA 2V3CC 1K04A 4AL1A 1LIHA 5KYUA 5KYYA 1RKEA 2J9UA 2P6VA 4XPXA 2WVQA 3AGUA 4YJWA 5E2QA 5F5HA 2D4UA 4CS9C 4O7GA 4CIPA 4Q4ZF 2FAPB 4J7TA 2IXPA 3ABLC 1ZW3A 1MMAA 3BEHA 2R05A 4C7OA 1I4YA 1O87A 4CDAA 2OQMA 1R4TA 5D92A 2H7OA 1Z63A 3T6GB 1V54C 1A0BA 1HE9A 4MVSA 2L6HA 2WL8A 2R7XA 1G4US 3K1IC 1VTMP 2A0BA 4CS8A 2LFFA 2XM4A 2J8WA 2XRHA 3N0TA 2W9YA 3TD7A 4JC7A 4W8KA 4D4NA 3FAPB 4I1OB 4PFOA 3DAGA 1YYJA 2VB6A 3LEVA 1M57C 3JYHA 3O10A 2WB7A 2YRFA 5AC5A 2YL3A 3MX3A 3LS1A 2HFIA 4HFFB 4E0HA 5KYNA 2P7VA 1NBBA 1OXKA 4IWBA 1T01A 3SXZA 1YAUO 4JE9A 4CBEA 1Q0KA 3B9QA 1C03A 3IEEA 2AWYA 4JEAA 4P9FA 3VF0A 3H2VA 3T4RA 4XPYA 2R7VA 3DWWA 5KYXB 5JSLA 1MNDA 1ZHWA 2HSBA 1LI7A 1TQGA 4I3MA 5L3QA 1CGNA 2CW0F 1Q0DA 2DYSC 2OG2A 3MFNA 2EPOA 2PX0A 3K7DA 4OD4A 3EH2A 3ZQVA 3F47A 4MTGA 2B0HA 3ZSUA 3R7CA 1A7EA 4JZAA 3EPVA 3LUTB 3DXJF 4YN0B 2YWAA 4DRHB 3UMIA 1OW7A 1LM3B 1UFBA 2VCCA 3LLKA 3UMKA 2Q9CA 5JRAA 3OEOA 1RMVA 3B29A 4A4AA 1KTMA 3HNIA 4IGGA 2QNLA 1NFNA 1YARO 2A6EF 3EGXB 3QTHA 5GPGB 5DQZA 2I15A 5L0CA 2YL7A 4LERA 3KYJA 1CPRA 3MLGA 3SXYA 5FCLA 2WVNA 4IRUA 3DD7A 4IARA 2C03A 2W45A 2EINC 1M2OA 4PK4A 1NFOA 4EWCA 2KK1A 1JRAA 4JURI 2QUPA 4CIHA 3X1OA 2H8AA 1ZHTA 2HZ8A 4U5BE 1ZU4A 3DJUB 3IHUA 4XTKA 4XLPF 1MMNA 2GDCA 3ZTMA 4EHPA 2C04A 3U2LA 2P0NA 2KC3A 1Q0FA 3TK0A 2OU6A 2QLAA 4G7ZF 2J9BA 4OD5A 4NTFA 5A6KA 2Y3GA 4YL3A 4FESA 1MMDA 5A6BD 4EIYA 5E33A 3A11A 2V26A 2Y39A 3C8GB 3L8IA 1Z3IX 2KQ9A 1D0YA 3U5SA 2J9WA 2H7BA 1VK5A 4GEHA 5DS5A 2XXAA 3NKEA 4MS2A 4JJFA 1D1CA 3DMDA 2L6FA 4BG0A 2WZLA 3PDMP 1VMAA 3UNGC 4BJ5A 1YDIA 4BJTA 1OCZC 3NDBB 1WGWA 2YZSA 1ZYRF 4DXWA 3EJNA 3VAYA 4DRIB 5COMA 3V5YA 2UUIA 3U0CA 4U5FE 1VYKA 2PNOA 3HNLA 1I4ZA 2XSEA 2OEXA 1G8XA 3JSZA 3EZIA 1GGQA 3B71A 1PV3A 3KKBA 4FAPB 3EG9B 1TWCA 5JS5A 3BRJA 5T3WA 5JT4A 2A0UA 4GYTA 3KMIA 4H4KC 5CI9A 1YYXA 3DE9A 1D0XA 1NLXA 4XEVA 5T1DB 1OQCA 3E70C 2CGEA 4JJGA 4QDLA 2G62A 2XS1A 5BQHA 4G7OF 4DVYP 5B3IA 3NYJA 4KNWA 1FNTc 4J30B 1WTYA 2YLGA 3F46A 3HNKA 2DYRC 3JYYA 1MNEA 4BJ5C 2R9RB 4KNVA 1H6GA 2PF4E 3RQGA 4LLEA 3TOMA 3HJCA 2VASA 4Q7CA 4AE4B 1DOVA 3NRHA 5TJ5E 3LESA 4LACB 2W4BA 3AG3C 1A7DA 3AG1C 4OIPF 3G4XA 4BJ6A 3AQBA 1G4WR 5D91A 2XL4A 1SYQA 3ZC4A 3PCVA 4WGYA 2JX0A 4CS9A 4IAOA 3CQZA 3FHDA 2BC5A 3W4YA 2YQYA 1T6QA 5A6BA 3GEEA 3GODA 2R7WA 2R02A 4OIOF 2M4EA 2NUTB 2OJED 4L6RA 3W2WA 2Z15A 2G3VA 4C3EA 3B0UX 2UUHA 5L0GA 2E87A 4IJJA 3GORA 3RW0A 5L0DA 3ABMC 5DS4A 3FDQA 3ZDLA 1FMWA 3S84A 1EI7A 3FAJA 1YZCA 2HUJA 3T6JA 1EQ1A 2J0XA 4PJMA 4E18A 1LS4A 3ZVRA 3HKKA 3FXHA 3L1MA 1VOMA 1YVIA 1RJ9B 3RVYA 256BA 4KBLA 3ABKC 5F28E 3TJ6A 4AL0A 2A68F 2Q4FA 4RBNA 3B0PA 2L9JA 4I44A 1WASA 2ZXRA 2XLHA 4MVZA 3LS0A 2EPLX 4K1OA 3UMHA 1HY5A 2L7AA 3SYNA 1TWAA 3EGDA 1LE4A 1KNYA 1UG7A 3AGTA 3JCUQ 3M1CB 1VLSA 2Q7RA 3C7JA 1U89A 1WATA 3ZIBA 3IQTA 2WVOA 1APCA 3A9CA 4WGZA 3SP1A 2NUPB 3WHNA 5A69A 5HSWA 3J06A 3Q7GA 2EILC 1D1BA 3I5QA 3N2ZB 1E83A 1M2VA 1CPQA 2CYDA 3KPHA 4O6MA 1E86A 5JVEA 4G7HF 2HJMA 1E2XA 2HJ3A 2R25A 3NYMA 3W2VA 4JCZA 4E17A 1QZXA 2XLDA 3GANA 4R32A 4BPMA 3TULA 5E3CA 1JMWA
chains in the Genus database with same CATH topology
5DQTA 1Z5ZA 5KYWB 3EHMA 2Q3TA 4K7BA 2B0JA 3V7OA 4FX5A 3FVYA 1IZMA 4CS8C 1ST6A 1VYIA 2OCCC 3S29A 4K0DA 3OA1A 3S27A 2PP4A 2J0WA 1M56C 2BE5F 2XXAB 4P6IC 5BUOA 2IOQA 3DM5A 4OIRF 4NY3A 4HEAJ 3SEOA 1OKKA 2X51A 4BJ1A 2DGJA 1TR2A 3S28A 3T6BA 5DS6A 3DJNB 2PFDA 5B3SC 3S0XA 1J8YF 4O79A 3K66A 4RDAA 2I8BA 3LNRA 4QI0A 2VH3A 3B0VC 2QY9A 3K33A 4OIQF 3O6XA 2ZXPA 3RH3A 4ULWA 1NU9C 3ECSA 4A2NB 3DM9B 5B1AC 3HTKC 1N1CA 2R7TA 1LKXA 1ZHYA 1BR4A 2O9XA 4O6YA 3RFYA 3OWTA 4YT2A 4YT5A 3EGXA 2Y3HA 5EHHA 3SNHA 5KYUB 5KYYB 1FFHA 1IW7F 3W8IA 3H65A 4MNDA 4YT4A 4CSAA 3EFOA 2IYLD 4XLNF 3ZG1A 3Q6NA 2W4MA 4C7OB 3RKOF 3NYLA 4PJNA 3N24A 4YT8A 4PJJA 1LS1A 2R7QA 1TKNA 3EGDB 1W2WA 4B6IA 1JPNA 4AX2A 3KH2A 2EIKC 4XWJA 2ZXWC 3NG1A 1Z6AA 4O6NA 4E7SA 5EGYA 1M2VB 2Y69C 4M63A 2J45A 4HE8D 4LLCA 2MYSA 4DBRA 4CS7A 4ZLDA 5T3TA 3EG9A 4J32B 4JVSA 1OKKD 4G0HA 5CI8A 1TWGA 2J9VA 2ZXOA 4BJ6C 4U5EE 1OCRC 4WJ0A 4ZLCA 5E3AA 3W8HA 1ZU5A 2CNWA 3RYLA 4AE4A 3AG2C 4MQ9F 3SZRA 5B1BC 2LSEA 2Y3DA 2J7PD 5DLJA 2A69F 2MWQA 3QMKA 1SMYF 4AK9A 1S7ZA 1BR2A 2R7OA 2NUTA 4U5DE 4U5GA 2IXOA 3AQCA 3QZCA 1ZHXA 1OCCC 2ZPAA 4KC9A 4PJLA 1Z23A 2HV7A 2KNHA 1FMVA 2G3KA 3ASOC 3ASNC 3I4UA 3EZHA 4KI2A 1RJ9A 2R7RA 2HV6A 4C3BA 5L3VA 4ANJA 2R7UA 5F5FA 3K6BA 1MMGA 1PD0A 2JD3A 2Q9BA 3O39A 1SF8A 3L0IA 1QLEC 3Q6MA 2NUPA 4U5HA 1BR1A 4Q5SF 2Q9AA 2YHSA 2H7VC 3DAFA 4U5CE 1ZHZA 2FFHA 3PMRA 3PHF2 4I1MA 3EFOB 1OCOC 5KYXA 1NG1A 3POVA 2J7PA 4C3DA 5IY5C 3CSKA 4N06A 2GFHA 2PX3A 3DZAA 5KYWA 4DBQA 1TWHA 2IXNA 3HLZA 4X0RA 1JPJA 4HFKB 3EQLF 3UGOA 1D0ZA 2FGYA 2J46A 3UGPA 3LAYA 3JT1A 2KJGA 3WG7C 1LVKA 2D5RB 4E7ZA 3EHNA 1NU7D 3RIPA 3CZ6A 2EIJC 4EBBA 1NZEA 3ITFA 4F4BA 3L34A 2EIMC 2CNWD 3Q7LA 2KW3C 2IXMA 4YWQA 2WZFA 2KGOA 3I5PA 4JW1A 4BJ5C 3EH1A 1PCXA 3K1HA 3NKDA 2CDQA 5DVWA 4QI2A 4BEJA 4DOZA 2WZGA 2L81A 2YEVA 1PD1A 1KU2A 4RD9A 2R7SA 3VYWA 3E9VA 3JRTA 2A1DD 3KL4A 4PFPA 4DVZA 3UR3C 3LLIA 3WODF 2Y3BA 1SZIA 4CSAC 1FTSA 2A6HF 4OINF 1D1AA 2QTVA 1FFTC 2NG1A 3AG4C 4JCHA 1J8MF 1V55C 3LJBA 1O5HA 2V3CC 5KYUA 5KYYA 2J9UA 2P6VA 2WVQA 4YJWA 5E2QA 5F5HA 4CS9C 4Q4ZF 4O7GA 2IXPA 3ABLC 1MMAA 4C7OA 1O87A 1Z63A 5D92A 2H7OA 1V54C 2WL8A 2R7XA 3K1IC 4CS8A 2XRHA 3N0TA 2W9YA 3TD7A 4W8KA 4I1OB 4PFOA 3DAGA 2VB6A 3LEVA 1M57C 3JYHA 2WB7A 3MX3A 3LS1A 4HFFB 5KYNA 2P7VA 4IWBA 4CBEA 3B9QA 3IEEA 3T4RA 2R7VA 5KYXB 1MNDA 1ZHWA 4I3MA 5L3QA 2CW0F 2DYSC 2OG2A 4OD4A 3ZSUA 2PX0A 3K7DA 3EH2A 3F47A 4JZAA 3EPVA 4YN0B 3DXJF 3UMIA 3LLKA 3UMKA 2Q9CA 3OEOA 3EGXB 2A6EF 5DQZA 4LERA 3MLGA 5FCLA 2WVNA 4IRUA 3DD7A 2C03A 2W45A 2EINC 1M2OA 4PK4A 4EWCA 4JURI 4CIHA 3X1OA 1ZHTA 4U5BE 1ZU4A 3DJUB 4XTKA 4XLPF 1MMNA 2C04A 4G7ZF 4OD5A 2Y3GA 4FESA 1MMDA 5E33A 2V26A 2Y39A 1Z3IX 2KQ9A 1D0YA 5DS5A 2J9WA 2H7BA 1VK5A 4GEHA 2XXAA 3NKEA 4JJFA 1D1CA 3DMDA 4BG0A 2WZLA 1VMAA 3UNGC 4BJ5A 4BJTA 3NDBB 1OCZC 1WGWA 2YZSA 1ZYRF 3EJNA 3VAYA 4U5FE 1VYKA 2XSEA 1G8XA 3JSZA 3EZIA 3KKBA 3EG9B 1TWCA 5T3WA 4GYTA 3KMIA 4H4KC 5CI9A 1D0XA 5T1DB 3E70C 2CGEA 4JJGA 4QDLA 2G62A 4G7OF 4DVYP 3NYJA 4KNWA 4J30B 3F46A 2DYRC 1MNEA 4KNVA 2PF4E 4LLEA 3HJCA 2VASA 4Q7CA 4AE4B 3NRHA 3LESA 4LACB 2W4BA 3AG3C 3AG1C 4OIPF 4BJ6A 3AQBA 5D91A 2XL4A 3ZC4A 4CS9A 4IAOA 3CQZA 3FHDA 2R7WA 3GODA 4OIOF 2M4EA 2NUTB 3W2WA 2Z15A 2G3VA 4C3EA 3B0UX 2E87A 4IJJA 3ABMC 5DS4A 3FDQA 1FMWA 3T6JA 3FAJA 2J0XA 4PJMA 3ZVRA 1VOMA 1RJ9B 4KBLA 3ABKC 2A68F 4RBNA 3B0PA 2L9JA 4I44A 2ZXRA 3LS0A 3UMHA 3SYNA 3X2QC 1TWAA 3EGDA 3M1CB 3JCUQ 3ZIBA 2WVOA 3SP1A 2NUPB 5HSWA 3Q7GA 2EILC 1D1BA 3I5QA 3N2ZB 1M2VA 4G7HF 4O6MA 3W2VA 3NYMA 1QZXA 3GANA 5E3CA 4FWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HEA J;  4HE8 D;  3RKO F; 
#chains in the Genus database with same CATH topology
 4MTO A;  5DQT A;  3ZQY A;  1Z5Z A;  4CX9 A;  4XEK A;  3G50 A;  1QPU A;  4JRZ A;  5KYW B;  3EHM A;  2Q3T A;  4K7B A;  2B0J A;  2RSE B;  5AC4 A;  3V7O A;  4MW3 A;  3JTL O;  4FX5 A;  3FVY A;  1IZM A;  3VM6 A;  4CS8 C;  2GWW A;  2P61 A;  1ST6 A;  1VYI A;  2OCC C;  3ATP A;  3S29 A;  4K0D A;  1U6H A;  1BBH A;  2HMZ A;  4U9E A;  3OA1 A;  2HKV A;  3S27 A;  1CGM E;  4GQH A;  4JKV A;  3L8J A;  3LEO A;  4EBK A;  2PP4 A;  2J0W A;  1M56 C;  2BE5 F;  2XXA B;  4ULV A;  1OR3 A;  4J7Y A;  4D4X A;  4P6I C;  4CJO A;  5L0J A;  4MW8 A;  5BUO A;  4Z9J A;  3AOU A;  2IOQ A;  4LDR A;  3DM5 A;  3FMS A;  4OIR F;  4NY3 A;  4HEA J;  3SEO A;  2EPM X;  2XL6 A;  1BDJ B;  1OKK A;  2X51 A;  4BJ1 A;  1R5I D;  3SXK A;  2DGJ A;  1TR2 A;  3S28 A;  1T6U A;  3M4C A;  3T6B A;  4Z9H A;  5DS6 A;  5JLI A;  3DJN B;  2PFD A;  1SR2 A;  3V5Z A;  5B3S C;  1A41 A;  3S0X A;  1J8Y F;  4O79 A;  3K66 A;  3US6 A;  3JSE O;  4FWV A;  4RDA A;  3WAQ A;  2I8B A;  1K40 A;  3LNR A;  4YK5 A;  1LI5 A;  3T9O A;  1MQV A;  4JTC B;  4QI0 A;  2VH3 A;  3B0V C;  2QY9 A;  3S9O A;  3K33 A;  4OIQ F;  3U8V A;  2LCH A;  3FOO A;  3O6X A;  2XS8 A;  1LPE A;  1ORY A;  2ZXP A;  3NMI A;  5BQI A;  1ZW2 A;  3RH3 A;  5L0I A;  4ULW A;  2JPU A;  1HW2 A;  1NU9 C;  3NMK A;  3ECS A;  4A2N B;  1O3U A;  3DM9 B;  5B1A C;  1QKR A;  2YL1 A;  1GQA A;  3HTK C;  1N1C A;  1H7I A;  2XLE A;  2VC9 A;  2F22 A;  4LDQ A;  1LKX A;  1JOG A;  3DKA A;  2R7T A;  1ZHY A;  2KSF A;  1GM5 A;  3V5X A;  3NMJ A;  1BR4 A;  4DJ9 A;  2O9X A;  2YLD A;  4O6Y A;  3RFY A;  3OWT A;  4U9D A;  3IQC A;  3M15 A;  4XEF A;  4YT2 A;  4YT5 A;  3EGX A;  2Y3H A;  5EHH A;  1I5N A;  1XZQ A;  3SNH A;  2EPN A;  5KYU B;  5KYY B;  1FFH A;  1RKE B;  2XLM A;  1V4A A;  1IW7 F;  3W8I A;  3AJM A;  3H65 A;  3TOL A;  4MND A;  1E84 A;  1QQ3 A;  4YT4 A;  4CSA A;  4CDV A;  3U3B A;  3FOP A;  3IQ6 A;  5A6J A;  3EFO A;  2IYL D;  4JIO A;  4XLN F;  2OOC A;  3ZG1 A;  1YLM A;  2NPU A;  3Q6N A;  2W4M A;  2XLO A;  4ONS A;  3RKO F;  3SXM A;  3U8P A;  4C7O B;  3NYL A;  4PJN A;  3N24 A;  3QW1 A;  4YT8 A;  2Q00 A;  1OW6 A;  2ETS A;  2P1A A;  3X2Q C;  2M64 A;  4PJJ A;  1LS1 A;  3TJ5 A;  5JUA A;  2R7Q A;  2XM0 A;  4PAC A;  3DE8 A;  1TKN A;  3C8Z A;  2VCA A;  3EGD B;  1W2W A;  1V74 B;  1VB5 A;  4B6I A;  4MVU A;  4MVO A;  1JPN A;  5EK0 A;  4AX2 A;  3C8G A;  3KH2 A;  2EIK C;  1H9G A;  3MBG A;  3M79 A;  3GM3 A;  1G5Z A;  4XWJ A;  4UDV A;  2ZXW C;  3NG1 A;  1Q0G A;  1Z6A A;  1NSG B;  1RCP A;  2XL8 A;  3K1I A;  4O6N A;  4E7S A;  1YA9 A;  5EGY A;  2YVK A;  3IPM O;  3QVY A;  1M2V B;  2Y69 C;  1L3P A;  1TFK B;  3C63 A;  4M63 A;  1EKY A;  2J45 A;  4HE8 D;  4NTB A;  2EPK X;  4LLC A;  2OEV A;  4LDK A;  2MYS A;  3CAX A;  3RQF A;  4DBR A;  5K0I A;  4CS7 A;  4NCQ A;  4NTA A;  4ZLD A;  1OXB A;  2LD6 A;  3JZ0 A;  1QSP A;  3EG9 A;  4J32 B;  5T3T A;  4JVS A;  5COG A;  1WOL A;  2LK4 A;  2NSF A;  4IB4 A;  1OKK D;  4JTD B;  4G0H A;  3U9M A;  5CI8 A;  1TWG A;  2NSG A;  2J9V A;  2ZXO A;  4BJ6 C;  3GEH A;  1XZP A;  1OCR C;  4U5E E;  3RF3 A;  2TMV P;  1ORS C;  1BZ4 A;  4WJ0 A;  4ZLC A;  5E3A A;  3W8H A;  4NQF A;  2HMQ A;  3C62 A;  1ZU5 A;  1S05 A;  1Y4C A;  2CNW A;  2DI3 A;  4XPW A;  3RYL A;  4AE4 A;  1L7C A;  2YL0 A;  1GS9 A;  3AG2 C;  1C02 A;  4MQ9 F;  3SZR A;  2IM8 A;  5B1B C;  2LSE A;  2Y3D A;  2J7P D;  2CCY A;  5DLJ A;  2A69 F;  2MWQ A;  4H54 A;  3JRM O;  3QMK A;  1SMY F;  5L0F A;  4AK9 A;  2LQG A;  5A6A A;  1S7Z A;  1BR2 A;  2R7O A;  2ASR A;  1JAF A;  2NUT A;  4G78 A;  1OW8 A;  2KYH A;  3GM2 A;  1WWP A;  4NC3 A;  4U5D E;  4E0I A;  4U5G A;  5HV9 A;  1VLT A;  2IXO A;  3AQC A;  4W8P A;  3QZC A;  1ZHX A;  1OCC C;  2ZPA A;  3S90 A;  4KC9 A;  4CJG A;  1AEP A;  4PJL A;  1CGO A;  1Z23 A;  2HV7 A;  2KNH A;  1FMV A;  2G3K A;  2GAQ A;  3ASO C;  1Y6D A;  3ASN C;  3I4U A;  3EZH A;  4KI2 A;  1RJ9 A;  2AU5 A;  1YJG A;  2R7R A;  2HV6 A;  5BQG A;  5CIV A;  4C3B A;  5FZT A;  3TQO A;  5L3V A;  4ANJ A;  2R7U A;  3M4B A;  4IAQ A;  5F5F A;  3K6B A;  1MMG A;  4MVR A;  1AVO B;  3GWL A;  1HW1 A;  1C17 M;  1PD0 A;  1YA7 O;  4EKW A;  2JD3 A;  2Q9B A;  3O39 A;  5L0H A;  2OJQ A;  4MVM A;  1A7V A;  1SF8 A;  1QLE C;  3L0I A;  3LNM B;  3C18 A;  3Q6M A;  3R2P A;  2DB4 A;  3QW0 A;  5JP7 A;  2NUP A;  4U5H A;  1BR1 A;  4N6C A;  4Q5S F;  3ZTZ A;  4N4W A;  2Q9A A;  2YHS A;  2H7V C;  3C8G D;  1ORJ A;  1FAP B;  1HE1 A;  2R03 A;  2ZD9 A;  2QE9 A;  3DAF A;  4U5C E;  1ZHZ A;  1T6I A;  2FFH A;  3PMR A;  3PHF 2;  4I1M A;  3ZWI A;  2AWC A;  3EFO B;  1OCO C;  5KYX A;  1NG1 A;  1E85 A;  3POV A;  2J7P A;  4C3D A;  2YLI A;  3CSK A;  3GM1 A;  4N06 A;  5IY5 C;  1K05 A;  2GFH A;  2PX3 A;  3CEX A;  1F1M A;  3DZA A;  4DBQ A;  5KYW A;  2HS5 A;  1TWH A;  2IXN A;  1JR8 A;  3HLZ A;  4X0R A;  1JPJ A;  4HFK B;  3EQL F;  3UGO A;  1D0Z A;  2FGY A;  2J46 A;  2L6G A;  1RKC A;  4ER9 A;  3UGP A;  3LAY A;  1HMD A;  4N6H A;  3JT1 A;  2KJG A;  2XLW A;  3WG7 C;  2PBE A;  3GEI A;  3KYI A;  4P9T A;  3VRC A;  1Z7Q c;  1TFO B;  1LVK A;  3DI5 A;  4WAB A;  2D5R B;  2YKZ A;  2RD9 A;  3H2U A;  4E7Z A;  1XWJ A;  2AP3 A;  3EHN A;  3U2M A;  1NU7 D;  4JEB A;  2AVK A;  3QVZ A;  3RQE A;  2VCB A;  4XQ1 A;  3RIP A;  3CZ6 A;  2EIJ C;  3MYI A;  4EBB A;  1NZE A;  5AGF A;  3ITF A;  1U0B B;  4F4B A;  3L34 A;  2EIM C;  1RXQ A;  2CNW D;  2MHR A;  3Q7L A;  2KW3 C;  1YZA A;  4MVQ A;  3MYF A;  2IXM A;  2IBF A;  1QVX A;  4YWQ A;  1T5O A;  2KGO A;  1B68 A;  2WZF A;  3I5P A;  3EH1 A;  1PCX A;  4JW1 A;  5COF A;  2LFD A;  4JTA B;  2X0C A;  3K1H A;  3U9J A;  4DRJ B;  1AUE A;  3NKD A;  2LP4 A;  2BL2 A;  2OKU A;  4PR9 A;  2CDQ A;  4YL0 A;  2XLV A;  1LE2 A;  3G4Z A;  5DVW A;  4QI2 A;  4BEJ A;  4DOZ A;  1M6T A;  1H9T A;  3GWN A;  4MTF A;  4Z9I A;  2WZG A;  1FR0 A;  3RVZ A;  1ZVZ A;  2L81 A;  1PD1 A;  2YEV A;  1DOW A;  1KU2 A;  1OR2 A;  4RD9 A;  3VYW A;  2R7S A;  3HNJ A;  3E9V A;  3JRT A;  2A1D D;  3KL4 A;  4PFP A;  3IQ5 A;  3U3F A;  1T9K A;  4DVZ A;  3O55 A;  3UR3 C;  4BEM J;  3LLI A;  3WOD F;  2Y3B A;  1SZI A;  1EA8 A;  4CSA C;  1HMO A;  1FTS A;  2HSQ A;  2ICW G;  2A6H F;  1Q0M A;  2GA0 A;  4OIN F;  1ZZP A;  4CDY A;  1D1A A;  1WN0 A;  2QTV A;  1FFT C;  2NG1 A;  4EUK B;  3AG4 C;  2LIG A;  4YL1 A;  4JCH A;  1J8M F;  1V55 C;  3LJB A;  4EBJ A;  1O5H A;  2V3C C;  1K04 A;  4AL1 A;  1LIH A;  5KYU A;  5KYY A;  1RKE A;  2J9U A;  2P6V A;  4XPX A;  2WVQ A;  3AGU A;  4YJW A;  5E2Q A;  5F5H A;  2D4U A;  4CS9 C;  4O7G A;  4CIP A;  4Q4Z F;  2FAP B;  4J7T A;  2IXP A;  3ABL C;  1ZW3 A;  1MMA A;  3BEH A;  2R05 A;  4C7O A;  1I4Y A;  1O87 A;  4CDA A;  2OQM A;  1R4T A;  5D92 A;  2H7O A;  1Z63 A;  3T6G B;  1V54 C;  1A0B A;  1HE9 A;  4MVS A;  2L6H A;  2WL8 A;  2R7X A;  1G4U S;  3K1I C;  1VTM P;  2A0B A;  4CS8 A;  2LFF A;  2XM4 A;  2J8W A;  2XRH A;  3N0T A;  2W9Y A;  3TD7 A;  4JC7 A;  4W8K A;  4D4N A;  3FAP B;  4I1O B;  4PFO A;  3DAG A;  1YYJ A;  2VB6 A;  3LEV A;  1M57 C;  3JYH A;  3O10 A;  2WB7 A;  2YRF A;  5AC5 A;  2YL3 A;  3MX3 A;  3LS1 A;  2HFI A;  4HFF B;  4E0H A;  5KYN A;  2P7V A;  1NBB A;  1OXK A;  4IWB A;  1T01 A;  3SXZ A;  1YAU O;  4JE9 A;  4CBE A;  1Q0K A;  3B9Q A;  1C03 A;  3IEE A;  2AWY A;  4JEA A;  4P9F A;  3VF0 A;  3H2V A;  3T4R A;  4XPY A;  2R7V A;  3DWW A;  5KYX B;  5JSL A;  1MND A;  1ZHW A;  2HSB A;  1LI7 A;  1TQG A;  4I3M A;  5L3Q A;  1CGN A;  2CW0 F;  1Q0D A;  2DYS C;  2OG2 A;  3MFN A;  2EPO A;  2PX0 A;  3K7D A;  4OD4 A;  3EH2 A;  3ZQV A;  3F47 A;  4MTG A;  2B0H A;  3ZSU A;  3R7C A;  1A7E A;  4JZA A;  3EPV A;  3LUT B;  3DXJ F;  4YN0 B;  2YWA A;  4DRH B;  3UMI A;  1OW7 A;  1LM3 B;  1UFB A;  2VCC A;  3LLK A;  3UMK A;  2Q9C A;  5JRA A;  3OEO A;  1RMV A;  3B29 A;  4A4A A;  1KTM A;  3HNI A;  4IGG A;  2QNL A;  1NFN A;  1YAR O;  2A6E F;  3EGX B;  3QTH A;  5GPG B;  5DQZ A;  2I15 A;  5L0C A;  2YL7 A;  4LER A;  3KYJ A;  1CPR A;  3MLG A;  3SXY A;  5FCL A;  2WVN A;  4IRU A;  3DD7 A;  4IAR A;  2C03 A;  2W45 A;  2EIN C;  1M2O A;  4PK4 A;  1NFO A;  4EWC A;  2KK1 A;  1JRA A;  4JUR I;  2QUP A;  4CIH A;  3X1O A;  2H8A A;  1ZHT A;  2HZ8 A;  4U5B E;  1ZU4 A;  3DJU B;  3IHU A;  4XTK A;  4XLP F;  1MMN A;  2GDC A;  3ZTM A;  4EHP A;  2C04 A;  3U2L A;  2P0N A;  2KC3 A;  1Q0F A;  3TK0 A;  2OU6 A;  2QLA A;  4G7Z F;  2J9B A;  4OD5 A;  4NTF A;  5A6K A;  2Y3G A;  4YL3 A;  4FES A;  1MMD A;  5A6B D;  4EIY A;  5E33 A;  3A11 A;  2V26 A;  2Y39 A;  3C8G B;  3L8I A;  1Z3I X;  2KQ9 A;  1D0Y A;  3U5S A;  2J9W A;  2H7B A;  1VK5 A;  4GEH A;  5DS5 A;  2XXA A;  3NKE A;  4MS2 A;  4JJF A;  1D1C A;  3DMD A;  2L6F A;  4BG0 A;  2WZL A;  3PDM P;  1VMA A;  3UNG C;  4BJ5 A;  1YDI A;  4BJT A;  1OCZ C;  3NDB B;  1WGW A;  2YZS A;  1ZYR F;  4DXW A;  3EJN A;  3VAY A;  4DRI B;  5COM A;  3V5Y A;  2UUI A;  3U0C A;  4U5F E;  1VYK A;  2PNO A;  3HNL A;  1I4Z A;  2XSE A;  2OEX A;  1G8X A;  3JSZ A;  3EZI A;  1GGQ A;  3B71 A;  1PV3 A;  3KKB A;  4FAP B;  3EG9 B;  1TWC A;  5JS5 A;  3BRJ A;  5T3W A;  5JT4 A;  2A0U A;  4GYT A;  3KMI A;  4H4K C;  5CI9 A;  1YYX A;  3DE9 A;  1D0X A;  1NLX A;  4XEV A;  5T1D B;  1OQC A;  3E70 C;  2CGE A;  4JJG A;  4QDL A;  2G62 A;  2XS1 A;  5BQH A;  4G7O F;  4DVY P;  5B3I A;  3NYJ A;  4KNW A;  1FNT c;  4J30 B;  1WTY A;  2YLG A;  3F46 A;  3HNK A;  2DYR C;  3JYY A;  1MNE A;  4BJ5 C;  2R9R B;  4KNV A;  1H6G A;  2PF4 E;  3RQG A;  4LLE A;  3TOM A;  3HJC A;  2VAS A;  4Q7C A;  4AE4 B;  1DOV A;  3NRH A;  5TJ5 E;  3LES A;  4LAC B;  2W4B A;  3AG3 C;  1A7D A;  3AG1 C;  4OIP F;  3G4X A;  4BJ6 A;  3AQB A;  1G4W R;  5D91 A;  2XL4 A;  1SYQ A;  3ZC4 A;  3PCV A;  4WGY A;  2JX0 A;  4CS9 A;  4IAO A;  3CQZ A;  3FHD A;  2BC5 A;  3W4Y A;  2YQY A;  1T6Q A;  5A6B A;  3GEE A;  3GOD A;  2R7W A;  2R02 A;  4OIO F;  2M4E A;  2NUT B;  2OJE D;  4L6R A;  3W2W A;  2Z15 A;  2G3V A;  4C3E A;  3B0U X;  2UUH A;  5L0G A;  2E87 A;  4IJJ A;  3GOR A;  3RW0 A;  5L0D A;  3ABM C;  5DS4 A;  3FDQ A;  3ZDL A;  1FMW A;  3S84 A;  1EI7 A;  3FAJ A;  1YZC A;  2HUJ A;  3T6J A;  1EQ1 A;  2J0X A;  4PJM A;  4E18 A;  1LS4 A;  3ZVR A;  3HKK A;  3FXH A;  3L1M A;  1VOM A;  1YVI A;  1RJ9 B;  3RVY A;  256B A;  4KBL A;  3ABK C;  5F28 E;  3TJ6 A;  4AL0 A;  2A68 F;  2Q4F A;  4RBN A;  3B0P A;  2L9J A;  4I44 A;  1WAS A;  2ZXR A;  2XLH A;  4MVZ A;  3LS0 A;  2EPL X;  4K1O A;  3UMH A;  1HY5 A;  2L7A A;  3SYN A;  1TWA A;  3EGD A;  1LE4 A;  1KNY A;  1UG7 A;  3AGT A;  3JCU Q;  3M1C B;  1VLS A;  2Q7R A;  3C7J A;  1U89 A;  1WAT A;  3ZIB A;  3IQT A;  2WVO A;  1APC A;  3A9C A;  4WGZ A;  3SP1 A;  2NUP B;  3WHN A;  5A69 A;  5HSW A;  3J06 A;  3Q7G A;  2EIL C;  1D1B A;  3I5Q A;  3N2Z B;  1E83 A;  1M2V A;  1CPQ A;  2CYD A;  3KPH A;  4O6M A;  1E86 A;  5JVE A;  4G7H F;  2HJM A;  1E2X A;  2HJ3 A;  2R25 A;  3NYM A;  3W2V A;  4JCZ A;  4E17 A;  1QZX A;  2XLD A;  3GAN A;  4R32 A;  4BPM A;  3TUL A;  5E3C A;  1JMW A; 
#chains in the Genus database with same CATH homology
 5DQT A;  1Z5Z A;  5KYW B;  3EHM A;  2Q3T A;  4K7B A;  2B0J A;  3V7O A;  4FX5 A;  3FVY A;  1IZM A;  4CS8 C;  1ST6 A;  1VYI A;  2OCC C;  3S29 A;  4K0D A;  3OA1 A;  3S27 A;  2PP4 A;  2J0W A;  1M56 C;  2BE5 F;  2XXA B;  4P6I C;  5BUO A;  2IOQ A;  3DM5 A;  4OIR F;  4NY3 A;  4HEA J;  3SEO A;  1OKK A;  2X51 A;  4BJ1 A;  2DGJ A;  1TR2 A;  3S28 A;  3T6B A;  5DS6 A;  3DJN B;  2PFD A;  5B3S C;  3S0X A;  1J8Y F;  4O79 A;  3K66 A;  4RDA A;  2I8B A;  3LNR A;  4QI0 A;  2VH3 A;  3B0V C;  2QY9 A;  3K33 A;  4OIQ F;  3O6X A;  2ZXP A;  3RH3 A;  4ULW A;  1NU9 C;  3ECS A;  4A2N B;  3DM9 B;  5B1A C;  3HTK C;  1N1C A;  2R7T A;  1LKX A;  1ZHY A;  1BR4 A;  2O9X A;  4O6Y A;  3RFY A;  3OWT A;  4YT2 A;  4YT5 A;  3EGX A;  2Y3H A;  5EHH A;  3SNH A;  5KYU B;  5KYY B;  1FFH A;  1IW7 F;  3W8I A;  3H65 A;  4MND A;  4YT4 A;  4CSA A;  3EFO A;  2IYL D;  4XLN F;  3ZG1 A;  3Q6N A;  2W4M A;  4C7O B;  3RKO F;  3NYL A;  4PJN A;  3N24 A;  4YT8 A;  4PJJ A;  1LS1 A;  2R7Q A;  1TKN A;  3EGD B;  1W2W A;  4B6I A;  1JPN A;  4AX2 A;  3KH2 A;  2EIK C;  4XWJ A;  2ZXW C;  3NG1 A;  1Z6A A;  4O6N A;  4E7S A;  5EGY A;  1M2V B;  2Y69 C;  4M63 A;  2J45 A;  4HE8 D;  4LLC A;  2MYS A;  4DBR A;  4CS7 A;  4ZLD A;  5T3T A;  3EG9 A;  4J32 B;  4JVS A;  1OKK D;  4G0H A;  5CI8 A;  1TWG A;  2J9V A;  2ZXO A;  4BJ6 C;  4U5E E;  1OCR C;  4WJ0 A;  4ZLC A;  5E3A A;  3W8H A;  1ZU5 A;  2CNW A;  3RYL A;  4AE4 A;  3AG2 C;  4MQ9 F;  3SZR A;  5B1B C;  2LSE A;  2Y3D A;  2J7P D;  5DLJ A;  2A69 F;  2MWQ A;  3QMK A;  1SMY F;  4AK9 A;  1S7Z A;  1BR2 A;  2R7O A;  2NUT A;  4U5D E;  4U5G A;  2IXO A;  3AQC A;  3QZC A;  1ZHX A;  1OCC C;  2ZPA A;  4KC9 A;  4PJL A;  1Z23 A;  2HV7 A;  2KNH A;  1FMV A;  2G3K A;  3ASO C;  3ASN C;  3I4U A;  3EZH A;  4KI2 A;  1RJ9 A;  2R7R A;  2HV6 A;  4C3B A;  5L3V A;  4ANJ A;  2R7U A;  5F5F A;  3K6B A;  1MMG A;  1PD0 A;  2JD3 A;  2Q9B A;  3O39 A;  1SF8 A;  3L0I A;  1QLE C;  3Q6M A;  2NUP A;  4U5H A;  1BR1 A;  4Q5S F;  2Q9A A;  2YHS A;  2H7V C;  3DAF A;  4U5C E;  1ZHZ A;  2FFH A;  3PMR A;  3PHF 2;  4I1M A;  3EFO B;  1OCO C;  5KYX A;  1NG1 A;  3POV A;  2J7P A;  4C3D A;  5IY5 C;  3CSK A;  4N06 A;  2GFH A;  2PX3 A;  3DZA A;  5KYW A;  4DBQ A;  1TWH A;  2IXN A;  3HLZ A;  4X0R A;  1JPJ A;  4HFK B;  3EQL F;  3UGO A;  1D0Z A;  2FGY A;  2J46 A;  3UGP A;  3LAY A;  3JT1 A;  2KJG A;  3WG7 C;  1LVK A;  2D5R B;  4E7Z A;  3EHN A;  1NU7 D;  3RIP A;  3CZ6 A;  2EIJ C;  4EBB A;  1NZE A;  3ITF A;  4F4B A;  3L34 A;  2EIM C;  2CNW D;  3Q7L A;  2KW3 C;  2IXM A;  4YWQ A;  2WZF A;  2KGO A;  3I5P A;  4JW1 A;  4BJ5 C;  3EH1 A;  1PCX A;  3K1H A;  3NKD A;  2CDQ A;  5DVW A;  4QI2 A;  4BEJ A;  4DOZ A;  2WZG A;  2L81 A;  2YEV A;  1PD1 A;  1KU2 A;  4RD9 A;  2R7S A;  3VYW A;  3E9V A;  3JRT A;  2A1D D;  3KL4 A;  4PFP A;  4DVZ A;  3UR3 C;  3LLI A;  3WOD F;  2Y3B A;  1SZI A;  4CSA C;  1FTS A;  2A6H F;  4OIN F;  1D1A A;  2QTV A;  1FFT C;  2NG1 A;  3AG4 C;  4JCH A;  1J8M F;  1V55 C;  3LJB A;  1O5H A;  2V3C C;  5KYU A;  5KYY A;  2J9U A;  2P6V A;  2WVQ A;  4YJW A;  5E2Q A;  5F5H A;  4CS9 C;  4Q4Z F;  4O7G A;  2IXP A;  3ABL C;  1MMA A;  4C7O A;  1O87 A;  1Z63 A;  5D92 A;  2H7O A;  1V54 C;  2WL8 A;  2R7X A;  3K1I C;  4CS8 A;  2XRH A;  3N0T A;  2W9Y A;  3TD7 A;  4W8K A;  4I1O B;  4PFO A;  3DAG A;  2VB6 A;  3LEV A;  1M57 C;  3JYH A;  2WB7 A;  3MX3 A;  3LS1 A;  4HFF B;  5KYN A;  2P7V A;  4IWB A;  4CBE A;  3B9Q A;  3IEE A;  3T4R A;  2R7V A;  5KYX B;  1MND A;  1ZHW A;  4I3M A;  5L3Q A;  2CW0 F;  2DYS C;  2OG2 A;  4OD4 A;  3ZSU A;  2PX0 A;  3K7D A;  3EH2 A;  3F47 A;  4JZA A;  3EPV A;  4YN0 B;  3DXJ F;  3UMI A;  3LLK A;  3UMK A;  2Q9C A;  3OEO A;  3EGX B;  2A6E F;  5DQZ A;  4LER A;  3MLG A;  5FCL A;  2WVN A;  4IRU A;  3DD7 A;  2C03 A;  2W45 A;  2EIN C;  1M2O A;  4PK4 A;  4EWC A;  4JUR I;  4CIH A;  3X1O A;  1ZHT A;  4U5B E;  1ZU4 A;  3DJU B;  4XTK A;  4XLP F;  1MMN A;  2C04 A;  4G7Z F;  4OD5 A;  2Y3G A;  4FES A;  1MMD A;  5E33 A;  2V26 A;  2Y39 A;  1Z3I X;  2KQ9 A;  1D0Y A;  5DS5 A;  2J9W A;  2H7B A;  1VK5 A;  4GEH A;  2XXA A;  3NKE A;  4JJF A;  1D1C A;  3DMD A;  4BG0 A;  2WZL A;  1VMA A;  3UNG C;  4BJ5 A;  4BJT A;  3NDB B;  1OCZ C;  1WGW A;  2YZS A;  1ZYR F;  3EJN A;  3VAY A;  4U5F E;  1VYK A;  2XSE A;  1G8X A;  3JSZ A;  3EZI A;  3KKB A;  3EG9 B;  1TWC A;  5T3W A;  4GYT A;  3KMI A;  4H4K C;  5CI9 A;  1D0X A;  5T1D B;  3E70 C;  2CGE A;  4JJG A;  4QDL A;  2G62 A;  4G7O F;  4DVY P;  3NYJ A;  4KNW A;  4J30 B;  3F46 A;  2DYR C;  1MNE A;  4KNV A;  2PF4 E;  4LLE A;  3HJC A;  2VAS A;  4Q7C A;  4AE4 B;  3NRH A;  3LES A;  4LAC B;  2W4B A;  3AG3 C;  3AG1 C;  4OIP F;  4BJ6 A;  3AQB A;  5D91 A;  2XL4 A;  3ZC4 A;  4CS9 A;  4IAO A;  3CQZ A;  3FHD A;  2R7W A;  3GOD A;  4OIO F;  2M4E A;  2NUT B;  3W2W A;  2Z15 A;  2G3V A;  4C3E A;  3B0U X;  2E87 A;  4IJJ A;  3ABM C;  5DS4 A;  3FDQ A;  1FMW A;  3T6J A;  3FAJ A;  2J0X A;  4PJM A;  3ZVR A;  1VOM A;  1RJ9 B;  4KBL A;  3ABK C;  2A68 F;  4RBN A;  3B0P A;  2L9J A;  4I44 A;  2ZXR A;  3LS0 A;  3UMH A;  3SYN A;  3X2Q C;  1TWA A;  3EGD A;  3M1C B;  3JCU Q;  3ZIB A;  2WVO A;  3SP1 A;  2NUP B;  5HSW A;  3Q7G A;  2EIL C;  1D1B A;  3I5Q A;  3N2Z B;  1M2V A;  4G7H F;  4O6M A;  3W2V A;  3NYM A;  1QZX A;  3GAN A;  5E3C A;  4FWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...