4HEAJ

Crystal structure of the entire respiratory complex i from thermus thermophilus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
160
Chain Sequence
b'MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGEIGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase subunit 1
publication title Crystal structure of the entire respiratory complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 52
structure length 160
sequence length 160
chains with identical sequence R
ec nomenclature ec 1.6.5.3: Transferred entry: 7.1.1.2.
pdb deposition date 2012-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00499 Oxidored_q3 NADH-ubiquinone/plastoquinone oxidoreductase chain 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1200 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4heaJ00
3RKOF 4HEAJ 4HE8D
chains in the Genus database with same CATH superfamily
3WG7C 4L6RA 3ASOC 3EG9B 3S29A 4X0RA 4BPMA 3FOPA 5TJ5E 4DOZA 1OKKD 1JOGA 2NUPB 3KMIA 4RDAA 1VYIA 3B71A 4EBKA 5A6BD 5KYYB 5A69A 3I4UA 3M4CA 3K6BA 5E2QA 4NTBA 1TR2A 1WOLA 4C7OA 4OD4A 2QNLA 2DYSC 1Q0GA 1A7DA 4CDAA 3K66A 2YLIA 3DAFA 4DRHB 3C8GA 3AQBA 4QI0A 4BEJA 4LDQA 1I4ZA 4KBLA 1I5NA 2KSFA 3E70C 4I3MA 2XL6A 2HSQA 5CI9A 2Q7RA 3LESA 3S27A 3FAPB 4ULVA 2KQ9A 2DI3A 2EPKX 2H7BA 3AG3C 5KYXA 4XQ1A 3SNHA 2XLHA 2PX3A 4AK9A 5JUAA 4O6YA 4U5GA 3QVZA 2PP4A 2J9VA 1BR1A 3SXMA 1SZIA 1KTMA 2PFDA 3R7CA 2VB6A 3H65A 1H9GA 1AUEA 3AGTA 3CSKA 4YT2A 1E85A 2NUTA 1R4TA 1U89A 2UUHA 2CYDA 3F46A 2HUJA 1N1CA 1ZU4A 3TK0A 4XEKA 2VH3A 1UG7A 1SR2A 1V4AA 2NG1A 1D0XA 3I5PA 4RBNA 2W45A 1NBBA 2GWWA 2Q9BA 3OA1A 4G7ZF 3FMSA 1H6GA 5CIVA 3HTKC 1D1AA 2R05A 5T3WA 3GM3A 3LUTB 2IYLD 1JPJA 4CIHA 3DJUB 1G4WR 2A69F 2XLVA 3LS0A 1H9TA 4BJ6A 2QTVA 2R7VA 4IAQA 3IQ6A 3DD7A 2ZXRA 3W8HA 3U8VA 4C3BA 1HW1A 2CW0F 4LLEA 3B0PA 3UR3C 2ICWG 3NYLA 3UMKA 4EIYA 2P61A 3SP1A 5L0IA 3FAJA 4B6IA 3C63A 3TQOA 4XPWA 5F5HA 3V7OA 5L0CA 3M4BA 3T6BA 3W2VA 2P1AA 1Q0DA 4BJ5A 1M2VA 2Y39A 3ZC4A 2V3CC 1IZMA 4JCHA 3SXZA 2XLWA 1M2OA 5HV9A 4NC3A 4ULWA 3JSEO 5A6JA 4I1MA 4PACA 3TOLA 4JVSA 1M57C 1PD1A 3AQCA 4QDLA 2IXMA 4E18A 1G4US 2DB4A 4JJGA 1HMOA 1ZHYA 1BR4A 2G3VA 3UMIA 4E7SA 3ABLC 1OW6A 4FAPB 4DRJB 2XXAA 2XLOA 3RH3A 2J9WA 1YA7O 3H2VA 3IPMO 3HNJA 3LLIA 1Q0KA 1R5ID 2JD3A 4G78A 2UUIA 3N2ZB 2AWYA 4WJ0A 3WODF 5B3IA 3UGOA 4JJFA 1T5OA 1Y6DA 4E0HA 5DQZA 1QLEC 1ST6A 5L0FA 4BJ1A 1OW8A 1ZU5A 2GA0A 3GM2A 1FMWA 4JKVA 4CBEA 1YLMA 2VCAA 2WVQA 3DM5A 3T4RA 3NRHA 5FZTA 2BC5A 3IQCA 2YL1A 2W4BA 3FVYA 1TWHA 3VF0A 3NYJA 2Q3TA 4YT4A 2P0NA 2WZLA 3FXHA 3KKBA 1UFBA 3M79A 4Q7CA 3B0VC 4E0IA 3ZSUA 5E3AA 2QUPA 3GEEA 3EGXA 4J7TA 1JAFA 4EBJA 1VYKA 3SZRA 4NCQA 1S05A 3RKOF 5JT4A 2OQMA 4N4WA 4C7OB 2CCYA 2L7AA 3BEHA 3M15A 5COFA 4Z9JA 2EPOA 3R2PA 3C8GB 3DE8A 5IY5C 2KJGA 1ZHXA 2ZXPA 1BR2A 2RD9A 2XLMA 3EGDA 3LNMB 3NMJA 3OWTA 1E84A 3ABKC 5BQGA 3RQEA 4MTFA 3S28A 2L9JA 5KYXB 5JSLA 2YL7A 2J7PA 3OEOA 4IAOA 2ASRA 4J32B 2FGYA 4P9TA 3MLGA 4JEBA 4JE9A 5KYUA 2XL8A 3GM1A 2OU6A 3AG2C 3AOUA 3H2UA 4ONSA 3UNGC 2YZSA 1HE1A 2YWAA 3KPHA 2GFHA 2DYRC 1PCXA 2BL2A 3X1OA 3MYFA 3LEOA 4NQFA 2Q4FA 3TOMA 4EBBA 4BG0A 1MMGA 1ORJA 2WVNA 3TJ5A 2X0CA 1I4YA 1WWPA 2AU5A 1HW2A 4J7YA 2NUTB 4YT8A 2C04A 2EIKC 4C3DA 1HY5A 1MMAA 1SYQA 4JIOA 2YKZA 3ZTMA 1B68A 3RW0A 2G62A 4MNDA 2CNWA 5K0IA 2MWQA 3S90A 3NKDA 2HZ8A 3LJBA 3ITFA 4JURI 3RF3A 2YLGA 2R7SA 1OKKA 3GEHA 1C03A 5HSWA 1QZXA 1TWAA 2XLDA 4O6MA 3JTLO 1D1CA 4OIOF 2R02A 3QTHA 1SF8A 1W2WA 3L0IA 1VOMA 3DXJF 3EPVA 3RVZA 3U2MA 1AEPA 1M56C 2YRFA 2IOQA 1VLTA 2QLAA 4U9DA 1ZHZA 5A6AA 1J8MF 5T1DB 4YK5A 3IQTA 2LFFA 3EQLF 3NKEA 4DVYP 3RQFA 1K04A 3W4YA 3A11A 1RJ9A 2D5RB 1CGME 1M2VB 3IQ5A 4CS9A 2OEXA 4CIPA 2Q9AA 1AVOB 4AE4A 2DGJA 4D4XA 1OCCC 4CDVA 5CI8A 2EIMC 2YLDA 5A6KA 1NU7D 1TKNA 3C8GD 3EZHA 4WABA 1TQGA 4EHPA 1RMVA 1TFKB 2JPUA 1EA8A 1YVIA 3T9OA 2Z15A 3C8ZA 4NTAA 1FNTc 3MX3A 1FMVA 2R7QA 1OR2A 2J9BA 2J45A 3IEEA 256BA 2A0BA 1L7CA 3C7JA 1F1MA 2ZXOA 4XTKA 2AP3A 3PHF2 2XXAB 3VRCA 1YYXA 2R7WA 1ZW3A 3O6XA 1NG1A 4Z9HA 2YL3A 4ZLCA 3FDQA 4OIPF 3ZIBA 1XZQA 3EFOA 5T3TA 4CS9C 3L34A 2KYHA 1A7EA 3EHNA 4FESA 4MVZA 4OINF 3DKAA 5F28E 4F4BA 4CS8C 2JX0A 1LI5A 3AG1C 2Y3BA 2AWCA 3U9MA 4YL3A 2W9YA 4JTAB 1WATA 1BZ4A 2PBEA 4HFFB 2KW3C 1C02A 1E2XA 4PR9A 4BEMJ 3QW1A 1GM5A 3ZTZA 1TWGA 5AC4A 1GGQA 1JPNA 2B0HA 3NMIA 1Q0FA 1C17M 3QMKA 5EHHA 4XLPF 3L8IA 3RVYA 3FHDA 3JT1A 3K33A 3SXKA 3HNLA 4LACB 1K40A 3JRMO 2W4MA 1V74B 1G5ZA 5L0DA 4G7HF 1CPQA 2LP4A 1LI7A 1OCRC 1Z6AA 3L8JA 1VB5A 2A68F 4OIRF 2LSEA 2F22A 4GQHA 2OCCC 2C03A 2OKUA 4LDKA 3AGUA 3HJCA 1FFHA 4MW8A 5D91A 3SYNA 4EKWA 2Q9CA 4GYTA 4K7BA 3U9JA 4DJ9A 2E87A 4PJMA 3N0TA 5KYWA 3EGDB 3ATPA 3LNRA 4AX2A 2PF4E 3Q7LA 1OCZC 1A0BA 2M64A 4NY3A 5COGA 2L81A 2WZFA 1KU2A 4NTFA 2M4EA 2YQYA 5KYUB 2J9UA 1ZVZA 2NSFA 4YL0A 1IW7F 1FTSA 1PD0A 3S9OA 1OW7A 3EJNA 3N24A 4MVOA 4JRZA 3ZWIA 4YT5A 2WL8A 3GWLA 1OQCA 1VLSA 4N6HA 2XS1A 3G4ZA 4HE8D 3JCUQ 1T6QA 2PNOA 4E7ZA 1NSGB 1XWJA 3HNIA 1K05A 3K1HA 4PK4A 4QI2A 4I44A 2MHRA 3DJNB 2X51A 3HNKA 3C62A 4BJTA 3GWNA 3BRJA 2GAQA 2EPLX 2LCHA 3QW0A 4MTOA 3CAXA 4K0DA 4M63A 2EPMX 3K1IA 4O6NA 2HV6A 4OIQF 1LE2A 1RXQA 2Y69C 3T6JA 3V5YA 2R03A 1QPUA 2ETSA 2J46A 2PX0A 3TJ6A 3U3BA 3FOOA 2LFDA 1TFOB 1LKXA 1RKEA 3Q7GA 3RFYA 4Z9IA 3HLZA 1YARO 3PCVA 5EGYA 2L6HA 3U8PA 3F47A 2QE9A 1NLXA 3LLKA 4HEAJ 4IWBA 3U2LA 4U5BE 2IBFA 2J0WA 5B1AC 1ZYRF 2I8BA 2R7XA 1RJ9B 3X2QC 5DQTA 3LEVA 3LAYA 3S0XA 3PDMP 1M6TA 3VM6A 4AE4B 3K1IC 1Z7Qc 2B0JA 1L3PA 3ABMC 1QVXA 2H7OA 2I15A 2XLEA 4ZLDA 3B29A 3LS1A 4N06A 2R7OA 2HMQA 1OXKA 3POVA 1SMYF 4IJJA 4ER9A 2IM8A 4DXWA 2BE5F 4AL1A 4MQ9F 2XRHA 2J7PD 1NZEA 3QVYA 3SEOA 3W8IA 1FR0A 2WZGA 1GS9A 1T6IA 1Q0MA 3GEIA 3V5ZA 2EILC 2H8AA 2R9RB 4I1OB 3NG1A 4XWJA 1T6UA 5A6BA 2J0XA 2XM4A 4KI2A 2ZXWC 1WTYA 3EFOB 3W2WA 1NU9C 2Y3HA 4MW3A 1QSPA 2HJMA 2D4UA 3US6A 4JEAA 5JP7A 5F5FA 1T01A 2J8WA 3MFNA 2HKVA 4MS2A 1PV3A 1XZPA 2RSEB 1VK5A 2YHSA 3GORA 4XEFA 4YWQA 1LS1A 2CNWD 2P7VA 2YVKA 2R7RA 5E3CA 1HMDA 4Q4ZF 3EHMA 3CQZA 4KC9A 4MVMA 1YZAA 4XEVA 1OR3A 4HFKB 4CS8A 3KYIA 4P6IC 4DVZA 3B0UX 1D1BA 2O9XA 2R7UA 2XM0A 3JYYA 1KNYA 5BQHA 1YJGA 1EQ1A 1NFOA 4A4AA 4JC7A 1FAPB 2EINC 3U5SA 3ZQVA 3VYWA 1OCOC 1YAUO 4CSAC 5JLIA 2EPNA 5JVEA 1V54C 3QZCA 1CGNA 1ZHWA 3WAQA 1Z63A 1ZZPA 3PMRA 3L1MA 1EI7A 1MMDA 2ZD9A 3ECSA 3ZQYA 4CX9A 4DBRA 5KYNA 1ORSC 5KYWB 2GDCA 4KNVA 4YL1A 4W8PA 3GODA 2LIGA 3HKKA 3NDBB 3O39A 2ZPAA 2LK4A 3EH2A 4MVSA 3U3FA 3DI5A 4MVRA 4W8KA 1Z23A 5JRAA 4MVUA 4YJWA 3KH2A 4IARA 2LD6A 5FCLA 3MYIA 1JMWA 4A2NB 3RQGA 3EG9A 4D4NA 2YEVA 3E9VA 1O5HA 4U5CE 2A1DD 5E33A 1A41A 3JSZA 1BDJB 4R32A 1Z5ZA 3O55A 3T6GB 2VCBA 4ANJA 2FAPB 2NUPA 1V55C 4PJJA 2Q00A 2EIJC 1MQVA 2CGEA 2G3KA 2HV7A 5KYYA 1U0BB 1LIHA 2R7TA 1EKYA 1D0ZA 1YZCA 3B9QA 1O87A 3JZ0A 4U5HA 1HE9A 3CZ6A 2V26A 4EUKB 5L3QA 3UMHA 2HS5A 3EGXB 4CDYA 1VMAA 1J8YF 1TWCA 3EZIA 3KL4A 3C18A 3KYJA 1QQ3A 4PFPA 4PFOA 4FWVA 2LQGA 4C3EA 5L0GA 5AC5A 4PJLA 3O10A 1U6HA 1O3UA 1WGWA 2A0UA 5L0JA 1ZW2A 3K7DA 1JRAA 5B1BC 1ZHTA 1Z3IX 5BUOA 2VASA 4YN0B 2H7VC 1RKEB 4GEHA 3SXYA 3JYHA 4KNWA 3DM9B 2OJED 5JS5A 2QY9A 1H7IA 1NFNA 1WASA 2OOCA 5B3SC 3AJMA 3V5XA 3DWWA 1LVKA 3GANA 1RCPA 4JZAA 1MNDA 1JR8A 4JTCB 3CEXA 3VAYA 1LS4A 5DVWA 4G0HA 4LERA 4BJ6C 2IXPA 3TULA 4RD9A 2R25A 1E83A 2Y3DA 2HJ3A 2KNHA 2Y3GA 3DZAA 1YDIA 2FFHA 1LM3B 3ZG1A 4N6CA 3DMDA 2TMVP 3EH1A 4FX5A 5DS6A 2NPUA 2NSGA 3MBGA 3IHUA 2OJQA 4H4KC 3ZDLA 4XPYA 4MVQA 4H54A 5DLJA 4IRUA 1GQAA 1DOWA 3G50A 3WHNA 2L6FA 5AGFA 4BJ5C 3I5QA 4CJGA 3AG4C 1A7VA 1WN0A 1LE4A 4OD5A 3U0CA 3ZVRA 5D92A 4P9FA 1VTMP 3J06A 1LPEA 2WVOA 5COMA 3TD7A 2MYSA 2HSBA 3JRTA 3DE9A 4JTDB 2YL0A 1CPRA 2AVKA 2IXOA 1G8XA 3Q6NA 4U5EE 1Y4CA 2XSEA 2WB7A 3NYMA 4XPXA 4U5FE 1APCA 3S84A 1YA9A 4U9EA 1DOVA 4UDVA 4WGYA 2VCCA 4MTGA 2KGOA 2KK1A 1T9KA 3DAGA 4JW1A 4IGGA 3ASNC 4WGZA 4CS7A 4AL0A 3UGPA 4LLCA 4K1OA 5DS4A 4JCZA 5BQIA 1MNEA 1OXBA 3M1CB 3NMKA 4CJOA 3A9CA 2HFIA 4U5DE 1QKRA 4DBQA 3RYLA 1YYJA 1CGOA 1RKCA 1FFTC 2CDQA 2P6VA 4O7GA 4IB4A 4LDRA 5GPGB 2IXNA 2KC3A 5EK0A 1D0YA 1ORYA 4PJNA 5DS5A 2XS8A 2A6EF 4Q5SF 2A6HF 4DRIB 5L3VA 4G7OF 2L6GA 2VC9A 3Q6MA 2OEVA 1MMNA 2OG2A 3G4XA 5L0HA 4J30B 1BBHA 4O79A 3RIPA 4EWCA 4CSAA 2HMZA 4XLNF 4E17A 1S7ZA 1E86A 2XL4A
chains in the Genus database with same CATH topology
3WG7C 3ASOC 3EG9B 3S29A 4X0RA 4DOZA 1OKKD 2NUPB 3KMIA 4RDAA 1VYIA 5KYYB 3I4UA 5E2QA 3K6BA 4C7OA 1TR2A 4OD4A 2DYSC 3K66A 3DAFA 4QI0A 3AQBA 4BEJA 4KBLA 3E70C 4I3MA 5CI9A 3LESA 3S27A 2KQ9A 2H7BA 3AG3C 5KYXA 3SNHA 2PX3A 4AK9A 4O6YA 4U5GA 2PP4A 2J9VA 1BR1A 1SZIA 2PFDA 2VB6A 3H65A 4YT2A 3CSKA 2NUTA 3F46A 1N1CA 1ZU4A 2VH3A 2NG1A 1D0XA 3I5PA 4RBNA 2W45A 2Q9BA 3OA1A 4G7ZF 3HTKC 1D1AA 5T3WA 2IYLD 1JPJA 4CIHA 3DJUB 2A69F 3LS0A 4BJ6A 2QTVA 2R7VA 3DD7A 2ZXRA 3W8HA 4C3BA 4LLEA 2CW0F 3B0PA 3UR3C 3NYLA 3UMKA 3SP1A 3FAJA 4B6IA 5F5HA 3V7OA 3T6BA 3W2VA 4BJ5A 1M2VA 2Y39A 3ZC4A 2V3CC 1IZMA 4JCHA 1M2OA 4ULWA 4I1MA 4JVSA 1M57C 1PD1A 3AQCA 4QDLA 2IXMA 4JJGA 1ZHYA 1BR4A 2G3VA 3UMIA 4E7SA 3ABLC 2XXAA 3RH3A 2J9WA 3LLIA 2JD3A 3N2ZB 4WJ0A 3WODF 3UGOA 4JJFA 5DQZA 1QLEC 1ST6A 4BJ1A 1ZU5A 1FMWA 4CBEA 2WVQA 3DM5A 3T4RA 3NRHA 2W4BA 3FVYA 1TWHA 3NYJA 2Q3TA 4YT4A 2WZLA 3KKBA 4Q7CA 3B0VC 3ZSUA 5E3AA 3EGXA 1VYKA 3SZRA 3RKOF 4C7OB 5IY5C 2KJGA 1ZHXA 2ZXPA 1BR2A 3OWTA 3EGDA 3ABKC 3S28A 5KYXB 2L9JA 2J7PA 3OEOA 4IAOA 4J32B 2FGYA 5KYUA 3MLGA 3AG2C 3UNGC 2YZSA 2GFHA 2DYRC 1PCXA 3X1OA 4EBBA 4BG0A 1MMGA 2WVNA 2NUTB 4YT8A 2C04A 2EIKC 4C3DA 1MMAA 2G62A 4MNDA 2CNWA 2MWQA 3NKDA 3LJBA 3ITFA 4JURI 2R7SA 1OKKA 5HSWA 1QZXA 1TWAA 4O6MA 1D1CA 4OIOF 1W2WA 1SF8A 3L0IA 1VOMA 3DXJF 3EPVA 1M56C 2IOQA 1ZHZA 1J8MF 5T1DB 3EQLF 3NKEA 4DVYP 1RJ9A 2D5RB 1M2VB 4CS9A 2Q9AA 4AE4A 2DGJA 1OCCC 5CI8A 2EIMC 1NU7D 1TKNA 3EZHA 2Z15A 3MX3A 1FMVA 2R7QA 3IEEA 2J45A 2ZXOA 4XTKA 3PHF2 2XXAB 2R7WA 3O6XA 1NG1A 4ZLCA 3FDQA 4OIPF 3ZIBA 3EFOA 5T3TA 4CS9C 3L34A 3EHNA 4FESA 4OINF 4F4BA 4CS8C 3AG1C 2Y3BA 2W9YA 4HFFB 2KW3C 1TWGA 1JPNA 3QMKA 5EHHA 4XLPF 3FHDA 3JT1A 3K33A 4LACB 2W4MA 4G7HF 1OCRC 1Z6AA 2A68F 4OIRF 2LSEA 2OCCC 2C03A 3HJCA 1FFHA 5D91A 3SYNA 2Q9CA 4GYTA 4K7BA 2E87A 4PJMA 3N0TA 5KYWA 3EGDB 3LNRA 4AX2A 2PF4E 3Q7LA 1OCZC 4NY3A 2L81A 2WZFA 1KU2A 2M4EA 5KYUB 2J9UA 1IW7F 1FTSA 1PD0A 3EJNA 3N24A 4YT5A 2WL8A 4HE8D 3JCUQ 4E7ZA 3K1HA 4PK4A 4QI2A 4I44A 3DJNB 2X51A 4BJTA 4K0DA 4M63A 4O6NA 2HV6A 4OIQF 3T6JA 2Y69C 2J46A 2PX0A 1LKXA 3Q7GA 3RFYA 3HLZA 5EGYA 3F47A 3LLKA 4HEAJ 4IWBA 4U5BE 2J0WA 5B1AC 1ZYRF 2I8BA 2R7XA 1RJ9B 3X2QC 5DQTA 3LEVA 3LAYA 3S0XA 4AE4B 3K1IC 2B0JA 3ABMC 2H7OA 4ZLDA 3LS1A 4N06A 2R7OA 3POVA 1SMYF 4IJJA 2BE5F 4MQ9F 2XRHA 2J7PD 1NZEA 3W8IA 3SEOA 2WZGA 2EILC 4I1OB 3NG1A 4XWJA 4KI2A 2J0XA 2ZXWC 3EFOB 3W2WA 1NU9C 2Y3HA 5F5FA 4YWQA 1VK5A 2YHSA 1LS1A 2CNWD 2P7VA 2R7RA 5E3CA 4Q4ZF 3EHMA 3CQZA 4KC9A 4HFKB 4CS8A 4P6IC 4DVZA 3B0UX 1D1BA 2O9XA 2R7UA 2EINC 3VYWA 1OCOC 4CSAC 1V54C 3QZCA 1ZHWA 1Z63A 3PMRA 1MMDA 3ECSA 4DBRA 5KYNA 5KYWB 4KNVA 3GODA 3NDBB 3O39A 2ZPAA 3EH2A 4W8KA 1Z23A 4YJWA 3KH2A 5FCLA 4A2NB 3EG9A 2YEVA 3E9VA 1O5HA 4U5CE 2A1DD 5E33A 3JSZA 1Z5ZA 4ANJA 2NUPA 1V55C 4PJJA 5KYYA 2EIJC 2G3KA 2CGEA 2HV7A 2R7TA 1D0ZA 3B9QA 1O87A 4U5HA 3CZ6A 2V26A 5L3QA 3UMHA 3EGXB 1VMAA 1J8YF 1TWCA 3EZIA 3KL4A 4PFPA 4PFOA 4FWVA 4C3EA 4PJLA 1WGWA 3K7DA 5B1BC 1ZHTA 1Z3IX 5BUOA 2VASA 4YN0B 2H7VC 4GEHA 3JYHA 4KNWA 3DM9B 2QY9A 5B3SC 1LVKA 3GANA 4JZAA 1MNDA 3VAYA 5DVWA 4G0HA 4LERA 4BJ6C 2IXPA 4RD9A 3DZAA 2KNHA 2Y3DA 2Y3GA 3ZG1A 2FFHA 3DMDA 3EH1A 4FX5A 5DS6A 4H4KC 5DLJA 4IRUA 4BJ5C 3I5QA 3AG4C 4OD5A 3ZVRA 5D92A 2WVOA 3TD7A 2MYSA 3JRTA 2IXOA 1G8XA 3Q6NA 4U5EE 2XSEA 2WB7A 3NYMA 4U5FE 2KGOA 3DAGA 4JW1A 3ASNC 4CS7A 3UGPA 4LLCA 5DS4A 1MNEA 3M1CB 4U5DE 4DBQA 3RYLA 2P6VA 1FFTC 2CDQA 4O7GA 2IXNA 1D0YA 4PJNA 5DS5A 2A6EF 4Q5SF 2A6HF 5L3VA 4G7OF 3Q6MA 1MMNA 2OG2A 4J30B 4O79A 3RIPA 4EWCA 4CSAA 4XLNF 1S7ZA 2XL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKO F;  4HEA J;  4HE8 D; 
#chains in the Genus database with same CATH topology
 3WG7 C;  4L6R A;  3ASO C;  3EG9 B;  3S29 A;  4X0R A;  4BPM A;  3FOP A;  5TJ5 E;  4DOZ A;  1OKK D;  1JOG A;  2NUP B;  3KMI A;  4RDA A;  1VYI A;  3B71 A;  4EBK A;  5A6B D;  5KYY B;  5A69 A;  3I4U A;  3M4C A;  3K6B A;  5E2Q A;  4NTB A;  1TR2 A;  1WOL A;  4C7O A;  4OD4 A;  2QNL A;  2DYS C;  1Q0G A;  1A7D A;  4CDA A;  3K66 A;  2YLI A;  3DAF A;  4DRH B;  3C8G A;  3AQB A;  4QI0 A;  4BEJ A;  4LDQ A;  1I4Z A;  4KBL A;  1I5N A;  2KSF A;  3E70 C;  4I3M A;  2XL6 A;  2HSQ A;  5CI9 A;  2Q7R A;  3LES A;  3S27 A;  3FAP B;  4ULV A;  2KQ9 A;  2DI3 A;  2EPK X;  2H7B A;  3AG3 C;  5KYX A;  4XQ1 A;  3SNH A;  2XLH A;  2PX3 A;  4AK9 A;  5JUA A;  4O6Y A;  4U5G A;  3QVZ A;  2PP4 A;  2J9V A;  1BR1 A;  3SXM A;  1SZI A;  1KTM A;  2PFD A;  3R7C A;  2VB6 A;  3H65 A;  1H9G A;  1AUE A;  3AGT A;  3CSK A;  4YT2 A;  1E85 A;  2NUT A;  1R4T A;  1U89 A;  2UUH A;  2CYD A;  3F46 A;  2HUJ A;  1N1C A;  1ZU4 A;  3TK0 A;  4XEK A;  2VH3 A;  1UG7 A;  1SR2 A;  1V4A A;  2NG1 A;  1D0X A;  3I5P A;  4RBN A;  2W45 A;  1NBB A;  2GWW A;  2Q9B A;  3OA1 A;  4G7Z F;  3FMS A;  1H6G A;  5CIV A;  3HTK C;  1D1A A;  2R05 A;  5T3W A;  3GM3 A;  3LUT B;  2IYL D;  1JPJ A;  4CIH A;  3DJU B;  1G4W R;  2A69 F;  2XLV A;  3LS0 A;  1H9T A;  4BJ6 A;  2QTV A;  2R7V A;  4IAQ A;  3IQ6 A;  3DD7 A;  2ZXR A;  3W8H A;  3U8V A;  4C3B A;  1HW1 A;  2CW0 F;  4LLE A;  3B0P A;  3UR3 C;  2ICW G;  3NYL A;  3UMK A;  4EIY A;  2P61 A;  3SP1 A;  5L0I A;  3FAJ A;  4B6I A;  3C63 A;  3TQO A;  4XPW A;  5F5H A;  3V7O A;  5L0C A;  3M4B A;  3T6B A;  3W2V A;  2P1A A;  1Q0D A;  4BJ5 A;  1M2V A;  2Y39 A;  3ZC4 A;  2V3C C;  1IZM A;  4JCH A;  3SXZ A;  2XLW A;  1M2O A;  5HV9 A;  4NC3 A;  4ULW A;  3JSE O;  5A6J A;  4I1M A;  4PAC A;  3TOL A;  4JVS A;  1M57 C;  1PD1 A;  3AQC A;  4QDL A;  2IXM A;  4E18 A;  1G4U S;  2DB4 A;  4JJG A;  1HMO A;  1ZHY A;  1BR4 A;  2G3V A;  3UMI A;  4E7S A;  3ABL C;  1OW6 A;  4FAP B;  4DRJ B;  2XXA A;  2XLO A;  3RH3 A;  2J9W A;  1YA7 O;  3H2V A;  3IPM O;  3HNJ A;  3LLI A;  1Q0K A;  1R5I D;  2JD3 A;  4G78 A;  2UUI A;  3N2Z B;  2AWY A;  4WJ0 A;  3WOD F;  5B3I A;  3UGO A;  4JJF A;  1T5O A;  1Y6D A;  4E0H A;  5DQZ A;  1QLE C;  1ST6 A;  5L0F A;  4BJ1 A;  1OW8 A;  1ZU5 A;  2GA0 A;  3GM2 A;  1FMW A;  4JKV A;  4CBE A;  1YLM A;  2VCA A;  2WVQ A;  3DM5 A;  3T4R A;  3NRH A;  5FZT A;  2BC5 A;  3IQC A;  2YL1 A;  2W4B A;  3FVY A;  1TWH A;  3VF0 A;  3NYJ A;  2Q3T A;  4YT4 A;  2P0N A;  2WZL A;  3FXH A;  3KKB A;  1UFB A;  3M79 A;  4Q7C A;  3B0V C;  4E0I A;  3ZSU A;  5E3A A;  2QUP A;  3GEE A;  3EGX A;  4J7T A;  1JAF A;  4EBJ A;  1VYK A;  3SZR A;  4NCQ A;  1S05 A;  3RKO F;  5JT4 A;  2OQM A;  4N4W A;  4C7O B;  2CCY A;  2L7A A;  3BEH A;  3M15 A;  5COF A;  4Z9J A;  2EPO A;  3R2P A;  3C8G B;  3DE8 A;  5IY5 C;  2KJG A;  1ZHX A;  2ZXP A;  1BR2 A;  2RD9 A;  2XLM A;  3EGD A;  3LNM B;  3NMJ A;  3OWT A;  1E84 A;  3ABK C;  5BQG A;  3RQE A;  4MTF A;  3S28 A;  2L9J A;  5KYX B;  5JSL A;  2YL7 A;  2J7P A;  3OEO A;  4IAO A;  2ASR A;  4J32 B;  2FGY A;  4P9T A;  3MLG A;  4JEB A;  4JE9 A;  5KYU A;  2XL8 A;  3GM1 A;  2OU6 A;  3AG2 C;  3AOU A;  3H2U A;  4ONS A;  3UNG C;  2YZS A;  1HE1 A;  2YWA A;  3KPH A;  2GFH A;  2DYR C;  1PCX A;  2BL2 A;  3X1O A;  3MYF A;  3LEO A;  4NQF A;  2Q4F A;  3TOM A;  4EBB A;  4BG0 A;  1MMG A;  1ORJ A;  2WVN A;  3TJ5 A;  2X0C A;  1I4Y A;  1WWP A;  2AU5 A;  1HW2 A;  4J7Y A;  2NUT B;  4YT8 A;  2C04 A;  2EIK C;  4C3D A;  1HY5 A;  1MMA A;  1SYQ A;  4JIO A;  2YKZ A;  3ZTM A;  1B68 A;  3RW0 A;  2G62 A;  4MND A;  2CNW A;  5K0I A;  2MWQ A;  3S90 A;  3NKD A;  2HZ8 A;  3LJB A;  3ITF A;  4JUR I;  3RF3 A;  2YLG A;  2R7S A;  1OKK A;  3GEH A;  1C03 A;  5HSW A;  1QZX A;  1TWA A;  2XLD A;  4O6M A;  3JTL O;  1D1C A;  4OIO F;  2R02 A;  3QTH A;  1SF8 A;  1W2W A;  3L0I A;  1VOM A;  3DXJ F;  3EPV A;  3RVZ A;  3U2M A;  1AEP A;  1M56 C;  2YRF A;  2IOQ A;  1VLT A;  2QLA A;  4U9D A;  1ZHZ A;  5A6A A;  1J8M F;  5T1D B;  4YK5 A;  3IQT A;  2LFF A;  3EQL F;  3NKE A;  4DVY P;  3RQF A;  1K04 A;  3W4Y A;  3A11 A;  1RJ9 A;  2D5R B;  1CGM E;  1M2V B;  3IQ5 A;  4CS9 A;  2OEX A;  4CIP A;  2Q9A A;  1AVO B;  4AE4 A;  2DGJ A;  4D4X A;  1OCC C;  4CDV A;  5CI8 A;  2EIM C;  2YLD A;  5A6K A;  1NU7 D;  1TKN A;  3C8G D;  3EZH A;  4WAB A;  1TQG A;  4EHP A;  1RMV A;  1TFK B;  2JPU A;  1EA8 A;  1YVI A;  3T9O A;  2Z15 A;  3C8Z A;  4NTA A;  1FNT c;  3MX3 A;  1FMV A;  2R7Q A;  1OR2 A;  2J9B A;  2J45 A;  3IEE A;  256B A;  2A0B A;  1L7C A;  3C7J A;  1F1M A;  2ZXO A;  4XTK A;  2AP3 A;  3PHF 2;  2XXA B;  3VRC A;  1YYX A;  2R7W A;  1ZW3 A;  3O6X A;  1NG1 A;  4Z9H A;  2YL3 A;  4ZLC A;  3FDQ A;  4OIP F;  3ZIB A;  1XZQ A;  3EFO A;  5T3T A;  4CS9 C;  3L34 A;  2KYH A;  1A7E A;  3EHN A;  4FES A;  4MVZ A;  4OIN F;  3DKA A;  5F28 E;  4F4B A;  4CS8 C;  2JX0 A;  1LI5 A;  3AG1 C;  2Y3B A;  2AWC A;  3U9M A;  4YL3 A;  2W9Y A;  4JTA B;  1WAT A;  1BZ4 A;  2PBE A;  4HFF B;  2KW3 C;  1C02 A;  1E2X A;  4PR9 A;  4BEM J;  3QW1 A;  1GM5 A;  3ZTZ A;  1TWG A;  5AC4 A;  1GGQ A;  1JPN A;  2B0H A;  3NMI A;  1Q0F A;  1C17 M;  3QMK A;  5EHH A;  4XLP F;  3L8I A;  3RVY A;  3FHD A;  3JT1 A;  3K33 A;  3SXK A;  3HNL A;  4LAC B;  1K40 A;  3JRM O;  2W4M A;  1V74 B;  1G5Z A;  5L0D A;  4G7H F;  1CPQ A;  2LP4 A;  1LI7 A;  1OCR C;  1Z6A A;  3L8J A;  1VB5 A;  2A68 F;  4OIR F;  2LSE A;  2F22 A;  4GQH A;  2OCC C;  2C03 A;  2OKU A;  4LDK A;  3AGU A;  3HJC A;  1FFH A;  4MW8 A;  5D91 A;  3SYN A;  4EKW A;  2Q9C A;  4GYT A;  4K7B A;  3U9J A;  4DJ9 A;  2E87 A;  4PJM A;  3N0T A;  5KYW A;  3EGD B;  3ATP A;  3LNR A;  4AX2 A;  2PF4 E;  3Q7L A;  1OCZ C;  1A0B A;  2M64 A;  4NY3 A;  5COG A;  2L81 A;  2WZF A;  1KU2 A;  4NTF A;  2M4E A;  2YQY A;  5KYU B;  2J9U A;  1ZVZ A;  2NSF A;  4YL0 A;  1IW7 F;  1FTS A;  1PD0 A;  3S9O A;  1OW7 A;  3EJN A;  3N24 A;  4MVO A;  4JRZ A;  3ZWI A;  4YT5 A;  2WL8 A;  3GWL A;  1OQC A;  1VLS A;  4N6H A;  2XS1 A;  3G4Z A;  4HE8 D;  3JCU Q;  1T6Q A;  2PNO A;  4E7Z A;  1NSG B;  1XWJ A;  3HNI A;  1K05 A;  3K1H A;  4PK4 A;  4QI2 A;  4I44 A;  2MHR A;  3DJN B;  2X51 A;  3HNK A;  3C62 A;  4BJT A;  3GWN A;  3BRJ A;  2GAQ A;  2EPL X;  2LCH A;  3QW0 A;  4MTO A;  3CAX A;  4K0D A;  4M63 A;  2EPM X;  3K1I A;  4O6N A;  2HV6 A;  4OIQ F;  1LE2 A;  1RXQ A;  2Y69 C;  3T6J A;  3V5Y A;  2R03 A;  1QPU A;  2ETS A;  2J46 A;  2PX0 A;  3TJ6 A;  3U3B A;  3FOO A;  2LFD A;  1TFO B;  1LKX A;  1RKE A;  3Q7G A;  3RFY A;  4Z9I A;  3HLZ A;  1YAR O;  3PCV A;  5EGY A;  2L6H A;  3U8P A;  3F47 A;  2QE9 A;  1NLX A;  3LLK A;  4HEA J;  4IWB A;  3U2L A;  4U5B E;  2IBF A;  2J0W A;  5B1A C;  1ZYR F;  2I8B A;  2R7X A;  1RJ9 B;  3X2Q C;  5DQT A;  3LEV A;  3LAY A;  3S0X A;  3PDM P;  1M6T A;  3VM6 A;  4AE4 B;  3K1I C;  1Z7Q c;  2B0J A;  1L3P A;  3ABM C;  1QVX A;  2H7O A;  2I15 A;  2XLE A;  4ZLD A;  3B29 A;  3LS1 A;  4N06 A;  2R7O A;  2HMQ A;  1OXK A;  3POV A;  1SMY F;  4IJJ A;  4ER9 A;  2IM8 A;  4DXW A;  2BE5 F;  4AL1 A;  4MQ9 F;  2XRH A;  2J7P D;  1NZE A;  3QVY A;  3SEO A;  3W8I A;  1FR0 A;  2WZG A;  1GS9 A;  1T6I A;  1Q0M A;  3GEI A;  3V5Z A;  2EIL C;  2H8A A;  2R9R B;  4I1O B;  3NG1 A;  4XWJ A;  1T6U A;  5A6B A;  2J0X A;  2XM4 A;  4KI2 A;  2ZXW C;  1WTY A;  3EFO B;  3W2W A;  1NU9 C;  2Y3H A;  4MW3 A;  1QSP A;  2HJM A;  2D4U A;  3US6 A;  4JEA A;  5JP7 A;  5F5F A;  1T01 A;  2J8W A;  3MFN A;  2HKV A;  4MS2 A;  1PV3 A;  1XZP A;  2RSE B;  1VK5 A;  2YHS A;  3GOR A;  4XEF A;  4YWQ A;  1LS1 A;  2CNW D;  2P7V A;  2YVK A;  2R7R A;  5E3C A;  1HMD A;  4Q4Z F;  3EHM A;  3CQZ A;  4KC9 A;  4MVM A;  1YZA A;  4XEV A;  1OR3 A;  4HFK B;  4CS8 A;  3KYI A;  4P6I C;  4DVZ A;  3B0U X;  1D1B A;  2O9X A;  2R7U A;  2XM0 A;  3JYY A;  1KNY A;  5BQH A;  1YJG A;  1EQ1 A;  1NFO A;  4A4A A;  4JC7 A;  1FAP B;  2EIN C;  3U5S A;  3ZQV A;  3VYW A;  1OCO C;  1YAU O;  4CSA C;  5JLI A;  2EPN A;  5JVE A;  1V54 C;  3QZC A;  1CGN A;  1ZHW A;  3WAQ A;  1Z63 A;  1ZZP A;  3PMR A;  3L1M A;  1EI7 A;  1MMD A;  2ZD9 A;  3ECS A;  3ZQY A;  4CX9 A;  4DBR A;  5KYN A;  1ORS C;  5KYW B;  2GDC A;  4KNV A;  4YL1 A;  4W8P A;  3GOD A;  2LIG A;  3HKK A;  3NDB B;  3O39 A;  2ZPA A;  2LK4 A;  3EH2 A;  4MVS A;  3U3F A;  3DI5 A;  4MVR A;  4W8K A;  1Z23 A;  5JRA A;  4MVU A;  4YJW A;  3KH2 A;  4IAR A;  2LD6 A;  5FCL A;  3MYI A;  1JMW A;  4A2N B;  3RQG A;  3EG9 A;  4D4N A;  2YEV A;  3E9V A;  1O5H A;  4U5C E;  2A1D D;  5E33 A;  1A41 A;  3JSZ A;  1BDJ B;  4R32 A;  1Z5Z A;  3O55 A;  3T6G B;  2VCB A;  4ANJ A;  2FAP B;  2NUP A;  1V55 C;  4PJJ A;  2Q00 A;  2EIJ C;  1MQV A;  2CGE A;  2G3K A;  2HV7 A;  5KYY A;  1U0B B;  1LIH A;  2R7T A;  1EKY A;  1D0Z A;  1YZC A;  3B9Q A;  1O87 A;  3JZ0 A;  4U5H A;  1HE9 A;  3CZ6 A;  2V26 A;  4EUK B;  5L3Q A;  3UMH A;  2HS5 A;  3EGX B;  4CDY A;  1VMA A;  1J8Y F;  1TWC A;  3EZI A;  3KL4 A;  3C18 A;  3KYJ A;  1QQ3 A;  4PFP A;  4PFO A;  4FWV A;  2LQG A;  4C3E A;  5L0G A;  5AC5 A;  4PJL A;  3O10 A;  1U6H A;  1O3U A;  1WGW A;  2A0U A;  5L0J A;  1ZW2 A;  3K7D A;  1JRA A;  5B1B C;  1ZHT A;  1Z3I X;  5BUO A;  2VAS A;  4YN0 B;  2H7V C;  1RKE B;  4GEH A;  3SXY A;  3JYH A;  4KNW A;  3DM9 B;  2OJE D;  5JS5 A;  2QY9 A;  1H7I A;  1NFN A;  1WAS A;  2OOC A;  5B3S C;  3AJM A;  3V5X A;  3DWW A;  1LVK A;  3GAN A;  1RCP A;  4JZA A;  1MND A;  1JR8 A;  4JTC B;  3CEX A;  3VAY A;  1LS4 A;  5DVW A;  4G0H A;  4LER A;  4BJ6 C;  2IXP A;  3TUL A;  4RD9 A;  2R25 A;  1E83 A;  2Y3D A;  2HJ3 A;  2KNH A;  2Y3G A;  3DZA A;  1YDI A;  2FFH A;  1LM3 B;  3ZG1 A;  4N6C A;  3DMD A;  2TMV P;  3EH1 A;  4FX5 A;  5DS6 A;  2NPU A;  2NSG A;  3MBG A;  3IHU A;  2OJQ A;  4H4K C;  3ZDL A;  4XPY A;  4MVQ A;  4H54 A;  5DLJ A;  4IRU A;  1GQA A;  1DOW A;  3G50 A;  3WHN A;  2L6F A;  5AGF A;  4BJ5 C;  3I5Q A;  4CJG A;  3AG4 C;  1A7V A;  1WN0 A;  1LE4 A;  4OD5 A;  3U0C A;  3ZVR A;  5D92 A;  4P9F A;  1VTM P;  3J06 A;  1LPE A;  2WVO A;  5COM A;  3TD7 A;  2MYS A;  2HSB A;  3JRT A;  3DE9 A;  4JTD B;  2YL0 A;  1CPR A;  2AVK A;  2IXO A;  1G8X A;  3Q6N A;  4U5E E;  1Y4C A;  2XSE A;  2WB7 A;  3NYM A;  4XPX A;  4U5F E;  1APC A;  3S84 A;  1YA9 A;  4U9E A;  1DOV A;  4UDV A;  4WGY A;  2VCC A;  4MTG A;  2KGO A;  2KK1 A;  1T9K A;  3DAG A;  4JW1 A;  4IGG A;  3ASN C;  4WGZ A;  4CS7 A;  4AL0 A;  3UGP A;  4LLC A;  4K1O A;  5DS4 A;  4JCZ A;  5BQI A;  1MNE A;  1OXB A;  3M1C B;  3NMK A;  4CJO A;  3A9C A;  2HFI A;  4U5D E;  1QKR A;  4DBQ A;  3RYL A;  1YYJ A;  1CGO A;  1RKC A;  1FFT C;  2CDQ A;  2P6V A;  4O7G A;  4IB4 A;  4LDR A;  5GPG B;  2IXN A;  2KC3 A;  5EK0 A;  1D0Y A;  1ORY A;  4PJN A;  5DS5 A;  2XS8 A;  2A6E F;  4Q5S F;  2A6H F;  4DRI B;  5L3V A;  4G7O F;  2L6G A;  2VC9 A;  3Q6M A;  2OEV A;  1MMN A;  2OG2 A;  3G4X A;  5L0H A;  4J30 B;  1BBH A;  4O79 A;  3RIP A;  4EWC A;  4CSA A;  2HMZ A;  4XLN F;  4E17 A;  1S7Z A;  1E86 A;  2XL4 A; 
#chains in the Genus database with same CATH homology
 3WG7 C;  3ASO C;  3EG9 B;  3S29 A;  4X0R A;  4DOZ A;  1OKK D;  2NUP B;  3KMI A;  4RDA A;  1VYI A;  5KYY B;  3I4U A;  5E2Q A;  3K6B A;  4C7O A;  1TR2 A;  4OD4 A;  2DYS C;  3K66 A;  3DAF A;  4QI0 A;  3AQB A;  4BEJ A;  4KBL A;  3E70 C;  4I3M A;  5CI9 A;  3LES A;  3S27 A;  2KQ9 A;  2H7B A;  3AG3 C;  5KYX A;  3SNH A;  2PX3 A;  4AK9 A;  4O6Y A;  4U5G A;  2PP4 A;  2J9V A;  1BR1 A;  1SZI A;  2PFD A;  2VB6 A;  3H65 A;  4YT2 A;  3CSK A;  2NUT A;  3F46 A;  1N1C A;  1ZU4 A;  2VH3 A;  2NG1 A;  1D0X A;  3I5P A;  4RBN A;  2W45 A;  2Q9B A;  3OA1 A;  4G7Z F;  3HTK C;  1D1A A;  5T3W A;  2IYL D;  1JPJ A;  4CIH A;  3DJU B;  2A69 F;  3LS0 A;  4BJ6 A;  2QTV A;  2R7V A;  3DD7 A;  2ZXR A;  3W8H A;  4C3B A;  4LLE A;  2CW0 F;  3B0P A;  3UR3 C;  3NYL A;  3UMK A;  3SP1 A;  3FAJ A;  4B6I A;  5F5H A;  3V7O A;  3T6B A;  3W2V A;  4BJ5 A;  1M2V A;  2Y39 A;  3ZC4 A;  2V3C C;  1IZM A;  4JCH A;  1M2O A;  4ULW A;  4I1M A;  4JVS A;  1M57 C;  1PD1 A;  3AQC A;  4QDL A;  2IXM A;  4JJG A;  1ZHY A;  1BR4 A;  2G3V A;  3UMI A;  4E7S A;  3ABL C;  2XXA A;  3RH3 A;  2J9W A;  3LLI A;  2JD3 A;  3N2Z B;  4WJ0 A;  3WOD F;  3UGO A;  4JJF A;  5DQZ A;  1QLE C;  1ST6 A;  4BJ1 A;  1ZU5 A;  1FMW A;  4CBE A;  2WVQ A;  3DM5 A;  3T4R A;  3NRH A;  2W4B A;  3FVY A;  1TWH A;  3NYJ A;  2Q3T A;  4YT4 A;  2WZL A;  3KKB A;  4Q7C A;  3B0V C;  3ZSU A;  5E3A A;  3EGX A;  1VYK A;  3SZR A;  3RKO F;  4C7O B;  5IY5 C;  2KJG A;  1ZHX A;  2ZXP A;  1BR2 A;  3OWT A;  3EGD A;  3ABK C;  3S28 A;  5KYX B;  2L9J A;  2J7P A;  3OEO A;  4IAO A;  4J32 B;  2FGY A;  5KYU A;  3MLG A;  3AG2 C;  3UNG C;  2YZS A;  2GFH A;  2DYR C;  1PCX A;  3X1O A;  4EBB A;  4BG0 A;  1MMG A;  2WVN A;  2NUT B;  4YT8 A;  2C04 A;  2EIK C;  4C3D A;  1MMA A;  2G62 A;  4MND A;  2CNW A;  2MWQ A;  3NKD A;  3LJB A;  3ITF A;  4JUR I;  2R7S A;  1OKK A;  5HSW A;  1QZX A;  1TWA A;  4O6M A;  1D1C A;  4OIO F;  1W2W A;  1SF8 A;  3L0I A;  1VOM A;  3DXJ F;  3EPV A;  1M56 C;  2IOQ A;  1ZHZ A;  1J8M F;  5T1D B;  3EQL F;  3NKE A;  4DVY P;  1RJ9 A;  2D5R B;  1M2V B;  4CS9 A;  2Q9A A;  4AE4 A;  2DGJ A;  1OCC C;  5CI8 A;  2EIM C;  1NU7 D;  1TKN A;  3EZH A;  2Z15 A;  3MX3 A;  1FMV A;  2R7Q A;  3IEE A;  2J45 A;  2ZXO A;  4XTK A;  3PHF 2;  2XXA B;  2R7W A;  3O6X A;  1NG1 A;  4ZLC A;  3FDQ A;  4OIP F;  3ZIB A;  3EFO A;  5T3T A;  4CS9 C;  3L34 A;  3EHN A;  4FES A;  4OIN F;  4F4B A;  4CS8 C;  3AG1 C;  2Y3B A;  2W9Y A;  4HFF B;  2KW3 C;  1TWG A;  1JPN A;  3QMK A;  5EHH A;  4XLP F;  3FHD A;  3JT1 A;  3K33 A;  4LAC B;  2W4M A;  4G7H F;  1OCR C;  1Z6A A;  2A68 F;  4OIR F;  2LSE A;  2OCC C;  2C03 A;  3HJC A;  1FFH A;  5D91 A;  3SYN A;  2Q9C A;  4GYT A;  4K7B A;  2E87 A;  4PJM A;  3N0T A;  5KYW A;  3EGD B;  3LNR A;  4AX2 A;  2PF4 E;  3Q7L A;  1OCZ C;  4NY3 A;  2L81 A;  2WZF A;  1KU2 A;  2M4E A;  5KYU B;  2J9U A;  1IW7 F;  1FTS A;  1PD0 A;  3EJN A;  3N24 A;  4YT5 A;  2WL8 A;  4HE8 D;  3JCU Q;  4E7Z A;  3K1H A;  4PK4 A;  4QI2 A;  4I44 A;  3DJN B;  2X51 A;  4BJT A;  4K0D A;  4M63 A;  4O6N A;  2HV6 A;  4OIQ F;  3T6J A;  2Y69 C;  2J46 A;  2PX0 A;  1LKX A;  3Q7G A;  3RFY A;  3HLZ A;  5EGY A;  3F47 A;  3LLK A;  4HEA J;  4IWB A;  4U5B E;  2J0W A;  5B1A C;  1ZYR F;  2I8B A;  2R7X A;  1RJ9 B;  3X2Q C;  5DQT A;  3LEV A;  3LAY A;  3S0X A;  4AE4 B;  3K1I C;  2B0J A;  3ABM C;  2H7O A;  4ZLD A;  3LS1 A;  4N06 A;  2R7O A;  3POV A;  1SMY F;  4IJJ A;  2BE5 F;  4MQ9 F;  2XRH A;  2J7P D;  1NZE A;  3W8I A;  3SEO A;  2WZG A;  2EIL C;  4I1O B;  3NG1 A;  4XWJ A;  4KI2 A;  2J0X A;  2ZXW C;  3EFO B;  3W2W A;  1NU9 C;  2Y3H A;  5F5F A;  4YWQ A;  1VK5 A;  2YHS A;  1LS1 A;  2CNW D;  2P7V A;  2R7R A;  5E3C A;  4Q4Z F;  3EHM A;  3CQZ A;  4KC9 A;  4HFK B;  4CS8 A;  4P6I C;  4DVZ A;  3B0U X;  1D1B A;  2O9X A;  2R7U A;  2EIN C;  3VYW A;  1OCO C;  4CSA C;  1V54 C;  3QZC A;  1ZHW A;  1Z63 A;  3PMR A;  1MMD A;  3ECS A;  4DBR A;  5KYN A;  5KYW B;  4KNV A;  3GOD A;  3NDB B;  3O39 A;  2ZPA A;  3EH2 A;  4W8K A;  1Z23 A;  4YJW A;  3KH2 A;  5FCL A;  4A2N B;  3EG9 A;  2YEV A;  3E9V A;  1O5H A;  4U5C E;  2A1D D;  5E33 A;  3JSZ A;  1Z5Z A;  4ANJ A;  2NUP A;  1V55 C;  4PJJ A;  5KYY A;  2EIJ C;  2G3K A;  2CGE A;  2HV7 A;  2R7T A;  1D0Z A;  3B9Q A;  1O87 A;  4U5H A;  3CZ6 A;  2V26 A;  5L3Q A;  3UMH A;  3EGX B;  1VMA A;  1J8Y F;  1TWC A;  3EZI A;  3KL4 A;  4PFP A;  4PFO A;  4FWV A;  4C3E A;  4PJL A;  1WGW A;  3K7D A;  5B1B C;  1ZHT A;  1Z3I X;  5BUO A;  2VAS A;  4YN0 B;  2H7V C;  4GEH A;  3JYH A;  4KNW A;  3DM9 B;  2QY9 A;  5B3S C;  1LVK A;  3GAN A;  4JZA A;  1MND A;  3VAY A;  5DVW A;  4G0H A;  4LER A;  4BJ6 C;  2IXP A;  4RD9 A;  3DZA A;  2KNH A;  2Y3D A;  2Y3G A;  3ZG1 A;  2FFH A;  3DMD A;  3EH1 A;  4FX5 A;  5DS6 A;  4H4K C;  5DLJ A;  4IRU A;  4BJ5 C;  3I5Q A;  3AG4 C;  4OD5 A;  3ZVR A;  5D92 A;  2WVO A;  3TD7 A;  2MYS A;  3JRT A;  2IXO A;  1G8X A;  3Q6N A;  4U5E E;  2XSE A;  2WB7 A;  3NYM A;  4U5F E;  2KGO A;  3DAG A;  4JW1 A;  3ASN C;  4CS7 A;  3UGP A;  4LLC A;  5DS4 A;  1MNE A;  3M1C B;  4U5D E;  4DBQ A;  3RYL A;  2P6V A;  1FFT C;  2CDQ A;  4O7G A;  2IXN A;  1D0Y A;  4PJN A;  5DS5 A;  2A6E F;  4Q5S F;  2A6H F;  5L3V A;  4G7O F;  3Q6M A;  1MMN A;  2OG2 A;  4J30 B;  4O79 A;  3RIP A;  4EWC A;  4CSA A;  4XLN F;  1S7Z A;  2XL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...