4C3BA

Hrsv m2-1, p21 crystal form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
178
structure length
165
Chain Sequence
PLGSMSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDELDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords MATRIX PROTEIN 2-1
publication title Crystal Structure of the Essential Transcription Antiterminator M2-1 Protein of Human Respiratory Syncytial Virus and Implications of its Phosphorylation.
pubmed doi rcsb
source organism Human respiratory syncytial virus
total genus 56
structure length 165
sequence length 178
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06436 Pneumovirus_M2 Pneumovirus matrix protein 2 (M2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4c3bA00
4CSAA 4CSAC 4CS9A 4CS9C 4CS8A 4CS7A 4CS8C 4C3BA 4C3DA 2L9JA 4C3EA
chains in the Genus database with same CATH superfamily
5B1BC 3UMKA 1YA9A 3CAXA 1E2XA 3JT1A 2OEVA 2VCAA 3Q7GA 4PR9A 1J8YF 3AGUA 4BEMJ 4CDYA 4DRJB 5KYNA 4XPWA 3FOOA 1T6UA 4NQFA 2XXAB 1FAPB 2XLVA 3A11A 4XEVA 2R9RB 4WABA 5KYUA 1QPUA 2Z15A 1PV3A 2EIMC 1I5NA 4JE9A 1YA7O 1ZVZA 1TQGA 1O3UA 2UUIA 4YWQA 4JZAA 3RQGA 1PCXA 5CI8A 3JSEO 3GODA 1ORSC 2D5RB 3C62A 2XL6A 3U0CA 1ZHYA 4CS9A 1KU2A 2YZSA 3EH2A 3H65A 3LUTB 1NLXA 4Q7CA 3C18A 2KJGA 4U5BE 5DVWA 3DJUB 1MMNA 2R7UA 3N2ZB 2OKUA 4JJFA 1K04A 2P7VA 2PP4A 4YT5A 2LP4A 2LIGA 3L8JA 1HW1A 3QZCA 3ABLC 4EBBA 3H2VA 3NMJA 2CYDA 2I15A 4PK4A 3QMKA 4Q4ZF 4ONSA 1WTYA 3ECSA 3RH3A 2TMVP 4YT8A 3KH2A 1JAFA 2IXOA 3UMHA 2O9XA 4CBEA 3DM5A 2BC5A 3KPHA 1MMAA 3EGDB 1UFBA 5E2QA 3KYJA 4BEJA 4CS7A 4BG0A 4ZLDA 1FFTC 1Z3IX 4JURI 3DXJF 256BA 3CZ6A 2HSQA 2R7XA 1GGQA 5A6BD 1OCRC 4I1MA 2XLMA 4Z9HA 4LDQA 1L3PA 4CJGA 3FMSA 2R7SA 4CX9A 3G4ZA 2C04A 1Q0MA 3WG7C 3E9VA 2XM0A 1A0BA 3ASNC 2L6GA 3DE9A 3AGTA 3KKBA 4C7OA 4J32B 1A41A 2OJQA 4R32A 4YL0A 1OXBA 1HY5A 1M6TA 1V74B 2F22A 4HE8D 1G4US 2KYHA 1QKRA 4IGGA 4JJGA 4RBNA 1KTMA 5JRAA 3CEXA 5DS6A 5HV9A 1LKXA 4MVZA 2GAQA 3RVZA 1YDIA 3Q7LA 5HSWA 4H54A 3QW0A 5JP7A 3GEEA 4G78A 3F47A 2R7TA 1VLTA 1AUEA 5DQZA 1F1MA 2R7WA 3ZTZA 3DM9B 4MVUA 1CGME 3IQ5A 4CSAA 3W2VA 1S7ZA 3TJ6A 4P9TA 3EG9B 2L81A 5A6KA 3EGXB 4DVYP 1RKEA 3W4YA 4G0HA 3PDMP 2HUJA 2LQGA 3M1CB 1A7VA 2WVNA 2WVQA 5D92A 4Z9IA 4PJNA 2WVOA 3VYWA 5KYYB 2J9BA 1WASA 2EPOA 1VLSA 5EK0A 4FX5A 3U5SA 5L0CA 3SP1A 2H7BA 3RKOF 3O39A 2AVKA 3NYJA 2XXAA 1M2OA 2R02A 5BQGA 4F4BA 3FDQA 4ER9A 3S90A 2YL1A 2NPUA 4XQ1A 2KNHA 1OW8A 1Y4CA 4D4NA 3ZQYA 2XLEA 3B0VC 4BJ6A 5F5HA 1BR4A 1AVOB 1Z5ZA 1LIHA 5K0IA 5A6BA 3EHNA 2LFFA 3B0UX 2VC9A 2L9JA 4CDAA 2CNWA 4CIHA 4DJ9A 3LNRA 2L6HA 4OIPF 3Q6MA 4G7OF 1ZW3A 3NRHA 3TULA 1YYXA 3NYLA 4ANJA 1YZCA 3AG3C 2YRFA 3MX3A 3PMRA 5DS4A 1T01A 1NFNA 2A68F 1Q0DA 5BUOA 2HFIA 2W4MA 4I1OB 4LLCA 4IWBA 3JTLO 1EQ1A 2A6EF 3S0XA 1H6GA 3ZC4A 3VF0A 2Q9BA 3K1IA 2QLAA 1ZHZA 1FR0A 2AWCA 3GORA 1JMWA 1V54C 2NUPB 4B6IA 2LD6A 1B68A 1OCOC 4DRHB 1H9GA 2YQYA 1J8MF 2YLDA 5B3SC 4QI2A 3LESA 3MLGA 2R7QA 1RXQA 3RW0A 3UNGC 3IQTA 2B0JA 2NSGA 2EPNA 3S29A 3PCVA 3B9QA 1HMOA 3DE8A 3SXMA 4NTFA 3MYIA 2YL0A 3FAJA 4IARA 4PJLA 4D4XA 5JS5A 5E33A 3VRCA 2D4UA 1M57C 2Q00A 3LNMB 2M4EA 5IY5C 2V26A 1OCZC 5JUAA 3U2LA 3K7DA 3U3FA 3X1OA 2WZGA 2ASRA 4IAQA 1A7DA 1BDJB 4AK9A 1TWAA 3C7JA 4KC9A 3IHUA 2IXMA 4NTBA 4PFPA 4BJ5A 5CIVA 4U5HA 3ATPA 2QE9A 4JEAA 1QZXA 3JCUQ 5TJ5E 4EUKB 1V4AA 2AU5A 5D91A 2AP3A 1FNTc 1BR2A 4I3MA 2IYLD 1JRAA 1LM3B 1XZPA 2YWAA 4DBQA 1OW7A 1XZQA 1BBHA 3AG4C 3EQLF 1VB5A 4JW1A 4MW3A 3RF3A 3WHNA 2Y39A 4CS8C 3AQCA 2YHSA 3EG9A 1RJ9A 1SYQA 2L6FA 5DS5A 3TQOA 4DXWA 3EGXA 3QW1A 3UGPA 3JRMO 4E18A 2QNLA 4YT2A 3T4RA 4Z9JA 4QDLA 5L0FA 2R05A 1CGNA 3L8IA 1MMGA 4MVQA 1OR2A 3DI5A 2W45A 1MMDA 4HFFB 4DVZA 2A6HF 1LE2A 1TWHA 2CDQA 5KYYA 2XLOA 2IXPA 2GWWA 1A7EA 1M2VA 2Y69C 1E83A 4XPYA 2HJ3A 2DYRC 2FFHA 2HMZA 5T1DB 4X0RA 3RQEA 3SEOA 4OD5A 1JPJA 1W2WA 1DOVA 1BR1A 3RQFA 3U8PA 3IQ6A 1VOMA 4MNDA 1C02A 1Y6DA 1Q0GA 1TFKB 3Q6NA 3ZQVA 3K66A 3SYNA 4XTKA 4G7ZF 1ZHTA 4C3BA 2J7PD 4BJ6C 4JRZA 1Z63A 3ABMC 2QY9A 4KNWA 1LE4A 3DJNB 1V55C 3IPMO 5B1AC 2LCHA 2XS8A 3U9MA 1HW2A 4GQHA 3DAFA 4YK5A 4HEAJ 4JCZA 1ZYRF 4C3DA 3CQZA 4C3EA 2DGJA 3GM1A 4LERA 4P6IC 3ZWIA 2OOCA 1NBBA 4LLEA 1ZZPA 3SNHA 4PFOA 2G3VA 4J30B 3W2WA 1QQ3A 3M4BA 2NUPA 4OIOF 1D0XA 4MTFA 3SXZA 5JVEA 5L0GA 2VB6A 2EINC 3T6GB 1OR3A 2VCCA 4E0IA 4EKWA 1ZHWA 4O6NA 4EWCA 1RMVA 3JSZA 1VTMP 1E86A 2CGEA 4OIRF 1MNEA 3NG1A 4E7SA 1LVKA 2G62A 4WGZA 1IW7F 2HZ8A 3LLIA 5F28E 2R7OA 1RJ9B 3ZG1A 3GEIA 4JEBA 3NKEA 3MYFA 5FZTA 2KK1A 3T6BA 2Q4FA 3C63A 2LSEA 4H4KC 1YVIA 2VH3A 3GANA 4GEHA 4M63A 2HS5A 4XWJA 4AL0A 3ZSUA 3JYHA 1FMVA 4EBKA 3S84A 4DBRA 2OG2A 1QVXA 1VYKA 1M2VB 4JC7A 4CDVA 2XLHA 1D1BA 3VM6A 1Z7Qc 5GPGB 3U9JA 3UR3C 3ZVRA 1NZEA 3VAYA 2M64A 3HLZA 4A4AA 3I4UA 1YZAA 3JZ0A 2LK4A 1E84A 4XLPF 1Q0FA 4JTAB 2HMQA 3MBGA 3MFNA 3LLKA 3SZRA 4CIPA 4L6RA 3B0PA 3GM3A 3DZAA 1YAUO 2I8BA 2MYSA 3K33A 2IXNA 3RIPA 4UDVA 5L0HA 4J7YA 4JTCB 1K40A 1IZMA 1LI7A 3LS0A 3O6XA 4IRUA 3FHDA 4YL3A 4YJWA 1O5HA 5A6JA 1Z23A 1LPEA 3G4XA 4AE4B 4CS9C 2X0CA 1OKKD 4FESA 2UUHA 3UGOA 4NY3A 3S27A 3AG1C 4U5FE 4MVMA 4N6HA 2HJMA 1ST6A 2JX0A 1YLMA 1RKCA 2R03A 2RSEB 3TJ5A 1RCPA 2EIJC 4DOZA 2C03A 1TR2A 1SZIA 2KC3A 1LS1A 2P1AA 2ZXPA 3V5YA 5JLIA 2AWYA 1C03A 2WL8A 4O79A 3FXHA 2ICWG 2CW0F 4JVSA 4N4WA 3RVYA 2DB4A 2HV6A 2J0XA 2Q9AA 4MTOA 1D1CA 2DYSC 3M15A 4JCHA 4NTAA 4YN0B 1ZU5A 2V3CC 3O55A 3C8GB 4KI2A 1E85A 4OIQF 4U5GA 1G4WR 2HV7A 2IM8A 4WGYA 2FAPB 3B29A 4ULVA 4KNVA 3WAQA 4AX2A 2PFDA 1O87A 1WN0A 1GS9A 2KW3C 4O6MA 2OEXA 2XL8A 2BL2A 1QSPA 2EPKX 2EPLX 3M4CA 4U9EA 3TD7A 3US6A 3HNIA 1YJGA 1YYJA 2XM4A 4E7ZA 3HNLA 1JPNA 3W8IA 1FFHA 3L1MA 2OJED 3N0TA 3FAPB 3BRJA 3HNKA 4U5DE 1H7IA 5JSLA 3CSKA 5KYUB 4RD9A 2H7VC 2W4BA 4A2NB 2L7AA 3DKAA 1EI7A 4CSAC 1YARO 3HNJA 2A0BA 3V5ZA 5L3VA 1NSGB 2YEVA 1OKKA 5DLJA 2R7VA 1FMWA 4K0DA 4WJ0A 1TWGA 3C8GD 5A6AA 2Y3BA 4DRIB 2B0HA 2PX0A 3I5PA 3NYMA 4MQ9F 4E0HA 3O10A 5JT4A 3ZDLA 1JOGA 3B71A 1WOLA 2J9UA 4PACA 3DD7A 4XEFA 1CPQA 2NUTB 3U3BA 2G3KA 5B3IA 3QVYA 4NCQA 2XLWA 1WGWA 5BQIA 3K6BA 2R7RA 2YKZA 3DAGA 1OXKA 2IBFA 4MVRA 1ORJA 4JTDB 4FWVA 1U89A 2JPUA 3G50A 4LACB 1ZHXA 3SXKA 3ZIBA 2PF4E 2P6VA 3TK0A 1GM5A 3EFOB 3NKDA 3JRTA 4EIYA 5EGYA 1QLEC 2W9YA 1T5OA 2J9WA 4BJTA 2MWQA 4LDKA 3BEHA 5E3CA 5KYXA 5KYWB 4U9DA 1APCA 1LS4A 2Y3DA 3R7CA 3GWLA 3HKKA 4AL1A 4U5EE 4O6YA 3UMIA 4AE4A 3A9CA 3KMIA 4G7HF 5COGA 2KGOA 1ORYA 4W8PA 4OINF 3L34A 2EILC 3EZIA 3H2UA 1MQVA 2A1DD 1NU7D 2E87A 3EH1A 1M56C 2VASA 4PJMA 4FAPB 3LS1A 3TOLA 2XSEA 3K1IC 3RYLA 3R2PA 4GYTA 1CGOA 2OU6A 2YVKA 3DWWA 2JD3A 1CPRA 2P61A 1WWPA 3NMIA 3FOPA 2EIKC 4MS2A 4LDRA 4N06A 4W8KA 2ZD9A 3EHMA 1D1AA 2XL4A 3IQCA 2J8WA 2EPMX 2CNWD 3EJNA 3IEEA 3T6JA 3NDBB 2ZXOA 2DI3A 2Q3TA 1VMAA 1DOWA 1S05A 3C8GA 4EBJA 4KBLA 1U6HA 3KL4A 4XPXA 1EA8A 1HE1A 1T6QA 2YLIA 2MHRA 3HJCA 4XEKA 1SR2A 2Y3GA 4HFKB 1N1CA 3EZHA 3ITFA 1TKNA 1MNDA 2CCYA 2ZXWC 3E70C 4I44A 3S28A 4CS8A 5L0JA 2GDCA 5E3AA 1G8XA 3U8VA 1FTSA 1GQAA 2IOQA 3K1HA 4MTGA 4BJ5C 4Q5SF 2X51A 4OD4A 3QTHA 2J45A 5L0IA 2XLDA 1KNYA 2BE5F 3RFYA 2J7PA 1PD1A 4EHPA 1I4ZA 1OQCA 3C8ZA 3V5XA 1WATA 2PNOA 1AEPA 4JKVA 4QI0A 1Q0KA 2NSFA 5FCLA 4U5CE 2J46A 3KYIA 5A69A 4E17A 3M79A 3NMKA 1L7CA 1XWJA 2HSBA 5CI9A 4XLNF 2Q7RA 5KYXB 3FVYA 3POVA 3EPVA 3WODF 1HMDA 4CJOA 1D0YA 3GWNA 2LFDA 2QUPA 2YL7A 1ZU4A 1Z6AA 4IAOA 1C17M 1NFOA 3OWTA 3T9OA 5AC4A 4MVOA 1U0BB 1R4TA 3LJBA 2A69F 3GEHA 2NUTA 3F46A 5L3QA 5BQHA 4ULWA 5DQTA 1D0ZA 3SXYA 2J9VA 3GM2A 2OQMA 5T3WA 2XRHA 3AOUA 1UG7A 1JR8A 5COMA 3V7OA 4ZLCA 3LEOA 1EKYA 2QTVA 3ASOC 3EFOA 3TOMA 1TWCA 2WZFA 3ABKC 3OEOA 2WZLA 5AGFA 1H9TA 5COFA 3AJMA 5T3TA 3S9OA 1G5ZA 1SMYF 1PD0A 4J7TA 5AC5A 5KYWA 3AQBA 3I5QA 2RD9A 3N24A 1NG1A 3X2QC 4IJJA 1LI5A 2P0NA 2Y3HA 4P9FA 4PJJA 2ZPAA 3U2MA 3OA1A 4C7OB 2GA0A 1BZ4A 3AG2C 4JIOA 1OCCC 1K05A 1T6IA 2YLGA 1ZW2A 1VK5A 3LEVA 5F5FA 2YL3A 2FGYA 1I4YA 3L0IA 3QVZA 3ZTMA 2R25A 2KSFA 3J06A 1NU9C 2XS1A 3EGDA 1TFOB 4MVSA 1SF8A 2PBEA 2KQ9A 4O7GA 4NC3A 4YT4A 5EHHA 2HKVA 1T9KA 1R5ID 3LAYA 2H8AA 2VCBA 3JYYA 4BJ1A 4YL1A 4BPMA 3PHF2 2NG1A 4K7BA 4N6CA 5L0DA 4MW8A 3DMDA 2J0WA 2Q9CA 1RKEB 4IB4A 4RDAA 2PX3A 3W8HA 2ETSA 2H7OA 2GFHA 2OCCC 1HE9A 1VYIA 2WB7A 2ZXRA 2A0UA 1OW6A 3HTKC 4K1OA
chains in the Genus database with same CATH topology
5B1BC 3UMKA 3JT1A 3Q7GA 1J8YF 5KYNA 2XXAB 5KYUA 2Z15A 2EIMC 4YWQA 4JZAA 1PCXA 5CI8A 3GODA 2D5RB 1ZHYA 4CS9A 1KU2A 2YZSA 3EH2A 3H65A 4Q7CA 5DVWA 2KJGA 4U5BE 2R7UA 3DJUB 1MMNA 3N2ZB 4JJFA 2P7VA 2PP4A 4YT5A 3QZCA 3ABLC 4EBBA 4PK4A 3QMKA 3ECSA 3RH3A 4YT8A 3KH2A 3UMHA 2IXOA 2O9XA 4CBEA 3DM5A 1MMAA 3EGDB 5E2QA 4BEJA 4CS7A 4ZLDA 4BG0A 1FFTC 1Z3IX 4JURI 3DXJF 3CZ6A 2R7XA 1OCRC 4I1MA 2R7SA 2C04A 3WG7C 3E9VA 3ASNC 4C7OA 3KKBA 4J32B 4YT4A 3SP1A 4HE8D 4RBNA 4JJGA 5DS6A 1LKXA 3Q7LA 5HSWA 3F47A 2R7TA 5DQZA 2R7WA 3DM9B 4CSAA 3W2VA 1S7ZA 3EG9B 2L81A 3EGXB 4DVYP 4G0HA 3M1CB 2WVNA 2WVQA 5D92A 4PJNA 2WVOA 3VYWA 5KYYB 4FX5A 2H7BA 3RKOF 3O39A 3NYJA 2XXAA 1M2OA 3FDQA 4F4BA 2KNHA 3B0VC 4BJ6A 5F5HA 1BR4A 1Z5ZA 3EHNA 3B0UX 2L9JA 4CIHA 2CNWA 3LNRA 4G7OF 4OIPF 3Q6MA 3NRHA 3NYLA 4ANJA 3AG3C 3MX3A 3PMRA 5DS4A 2A68F 5BUOA 2W4MA 4I1OB 4LLCA 4IWBA 2A6EF 3S0XA 3ZC4A 2Q9BA 1ZHZA 1V54C 2NUPB 4B6IA 1OCOC 1J8MF 5B3SC 4QI2A 3LESA 3MLGA 2R7QA 3UNGC 2B0JA 3S29A 3B9QA 3FAJA 4PJLA 5E33A 1M57C 2M4EA 5IY5C 2V26A 1OCZC 3K7DA 3X1OA 2WZGA 4AK9A 1TWAA 4KC9A 4BJ5A 4PFPA 2IXMA 4U5HA 1QZXA 3JCUQ 5D91A 1BR2A 4I3MA 2IYLD 4DBQA 3EQLF 3AG4C 4JW1A 2Y39A 4CS8C 3AQCA 2YHSA 3EG9A 1RJ9A 5DS5A 3EGXA 3UGPA 4YT2A 3T4RA 4QDLA 1MMGA 2W45A 1MMDA 4HFFB 4DVZA 2A6HF 5KYYA 1TWHA 2CDQA 2IXPA 1M2VA 2Y69C 2DYRC 2FFHA 5T1DB 4X0RA 3SEOA 4OD5A 1JPJA 1W2WA 1BR1A 1VOMA 4MNDA 3Q6NA 3K66A 3SYNA 4XTKA 4G7ZF 1ZHTA 4C3BA 2J7PD 4BJ6C 1Z63A 3ABMC 2QY9A 4KNWA 3DJNB 5B1AC 1V55C 3DAFA 4HEAJ 1ZYRF 4C3DA 3CQZA 4C3EA 2DGJA 4LERA 4P6IC 4LLEA 3SNHA 4PFOA 2G3VA 4J30B 3W2WA 2NUPA 4OIOF 1D0XA 2VB6A 2EINC 1ZHWA 4O6NA 4EWCA 3JSZA 2CGEA 4OIRF 1MNEA 3NG1A 4E7SA 1LVKA 2G62A 1IW7F 3LLIA 2R7OA 1RJ9B 3ZG1A 3NKEA 3T6BA 2LSEA 4H4KC 3GANA 2VH3A 4GEHA 4M63A 4XWJA 3ZSUA 3JYHA 1FMVA 4DBRA 2OG2A 1VYKA 1M2VB 1D1BA 3UR3C 3ZVRA 1NZEA 3VAYA 3HLZA 3I4UA 4XLPF 3SZRA 3LLKA 3B0PA 3DZAA 2I8BA 2MYSA 3K33A 3RIPA 2IXNA 1IZMA 3LS0A 3O6XA 4IRUA 3FHDA 4YJWA 1O5HA 1Z23A 4AE4B 4CS9C 1OKKD 4FESA 3UGOA 4NY3A 3S27A 3AG1C 4U5FE 1ST6A 4DOZA 2EIJC 2C03A 1TR2A 1SZIA 1LS1A 2ZXPA 2WL8A 4O79A 2CW0F 4JVSA 2HV6A 2J0XA 2Q9AA 1D1CA 2DYSC 4JCHA 4YN0B 2V3CC 1ZU5A 4KI2A 4OIQF 4U5GA 2HV7A 4AX2A 4KNVA 2PFDA 1O87A 2KW3C 4O6MA 3TD7A 4E7ZA 1JPNA 3W8IA 1FFHA 3N0TA 4U5DE 3CSKA 4RD9A 2H7VC 2W4BA 4A2NB 4CSAC 5L3VA 2YEVA 1OKKA 5DLJA 2R7VA 1FMWA 4K0DA 4WJ0A 1TWGA 2Y3BA 3NYMA 2PX0A 3I5PA 4MQ9F 2J9UA 3DD7A 2NUTB 2G3KA 1WGWA 3K6BA 2R7RA 3DAGA 4FWVA 3ZIBA 4LACB 1ZHXA 2PF4E 2P6VA 3EFOB 3NKDA 3JRTA 5EGYA 1QLEC 2W9YA 2J9WA 4BJTA 2MWQA 5KYXA 5E3CA 5KYWB 2Y3DA 4U5EE 4O6YA 3UMIA 4AE4A 3KMIA 4G7HF 2KGOA 4OINF 3L34A 2EILC 3EZIA 2A1DD 1NU7D 2E87A 3EH1A 1M56C 2VASA 4PJMA 3LS1A 2XSEA 3K1IC 3RYLA 4GYTA 2JD3A 2EIKC 4N06A 4W8KA 3EHMA 1D1AA 2XL4A 3IEEA 3EJNA 2CNWD 3T6JA 3NDBB 2ZXOA 2Q3TA 1VMAA 4KBLA 3KL4A 3HJCA 2Y3GA 4HFKB 1N1CA 3EZHA 3ITFA 1TKNA 1MNDA 2ZXWC 3E70C 4I44A 3S28A 4CS8A 5E3AA 1G8XA 4BJ5C 1FTSA 2IOQA 3K1HA 4Q5SF 2X51A 4OD4A 5KYUB 2J45A 3RFYA 2BE5F 2J7PA 1PD1A 4QI0A 5FCLA 4U5CE 2J46A 5CI9A 4XLNF 5KYXB 3FVYA 3POVA 3EPVA 3WODF 1D0YA 1ZU4A 1Z6AA 4IAOA 3OWTA 3LJBA 2A69F 2NUTA 5L3QA 3F46A 4ULWA 5DQTA 1D0ZA 2J9VA 2XRHA 3V7OA 4ZLCA 2QTVA 3ASOC 3EFOA 1TWCA 2WZFA 3ABKC 3OEOA 2WZLA 5T3TA 1SMYF 1PD0A 5KYWA 3AQBA 3I5QA 3N24A 1NG1A 3X2QC 4IJJA 2Y3HA 4PJJA 2ZPAA 3OA1A 4C7OB 3AG2C 1OCCC 1VK5A 3LEVA 5F5FA 2FGYA 3L0IA 1NU9C 3EGDA 4O7GA 1SF8A 2KQ9A 5EHHA 3LAYA 4BJ1A 3PHF2 2NG1A 4K7BA 3DMDA 2J0WA 2Q9CA 4RDAA 2PX3A 3W8HA 2H7OA 2GFHA 2OCCC 2WB7A 1VYIA 4Q4ZF 2ZXRA 3HTKC 5T3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CSA A;  4CSA C;  4CS9 A;  4CS9 C;  4CS8 A;  4CS7 A;  4CS8 C;  4C3B A;  4C3D A;  2L9J A;  4C3E A; 
#chains in the Genus database with same CATH topology
 5B1B C;  3UMK A;  1YA9 A;  3CAX A;  1E2X A;  3JT1 A;  2OEV A;  2VCA A;  3Q7G A;  4PR9 A;  1J8Y F;  3AGU A;  4BEM J;  4CDY A;  4DRJ B;  5KYN A;  4XPW A;  3FOO A;  1T6U A;  4NQF A;  2XXA B;  1FAP B;  2XLV A;  3A11 A;  4XEV A;  2R9R B;  4WAB A;  5KYU A;  1QPU A;  2Z15 A;  1PV3 A;  2EIM C;  1I5N A;  4JE9 A;  1YA7 O;  1ZVZ A;  1TQG A;  1O3U A;  2UUI A;  4YWQ A;  4JZA A;  3RQG A;  1PCX A;  5CI8 A;  3JSE O;  3GOD A;  1ORS C;  2D5R B;  3C62 A;  2XL6 A;  3U0C A;  1ZHY A;  4CS9 A;  1KU2 A;  2YZS A;  3EH2 A;  3H65 A;  3LUT B;  1NLX A;  4Q7C A;  3C18 A;  2KJG A;  4U5B E;  5DVW A;  3DJU B;  1MMN A;  2R7U A;  3N2Z B;  2OKU A;  4JJF A;  1K04 A;  2P7V A;  2PP4 A;  4YT5 A;  2LP4 A;  2LIG A;  3L8J A;  1HW1 A;  3QZC A;  3ABL C;  4EBB A;  3H2V A;  3NMJ A;  2CYD A;  2I15 A;  4PK4 A;  3QMK A;  4Q4Z F;  4ONS A;  1WTY A;  3ECS A;  3RH3 A;  2TMV P;  4YT8 A;  3KH2 A;  1JAF A;  2IXO A;  3UMH A;  2O9X A;  4CBE A;  3DM5 A;  2BC5 A;  3KPH A;  1MMA A;  3EGD B;  1UFB A;  5E2Q A;  3KYJ A;  4BEJ A;  4CS7 A;  4BG0 A;  4ZLD A;  1FFT C;  1Z3I X;  4JUR I;  3DXJ F;  256B A;  3CZ6 A;  2HSQ A;  2R7X A;  1GGQ A;  5A6B D;  1OCR C;  4I1M A;  2XLM A;  4Z9H A;  4LDQ A;  1L3P A;  4CJG A;  3FMS A;  2R7S A;  4CX9 A;  3G4Z A;  2C04 A;  1Q0M A;  3WG7 C;  3E9V A;  2XM0 A;  1A0B A;  3ASN C;  2L6G A;  3DE9 A;  3AGT A;  3KKB A;  4C7O A;  4J32 B;  1A41 A;  2OJQ A;  4R32 A;  4YL0 A;  1OXB A;  1HY5 A;  1M6T A;  1V74 B;  2F22 A;  4HE8 D;  1G4U S;  2KYH A;  1QKR A;  4IGG A;  4JJG A;  4RBN A;  1KTM A;  5JRA A;  3CEX A;  5DS6 A;  5HV9 A;  1LKX A;  4MVZ A;  2GAQ A;  3RVZ A;  1YDI A;  3Q7L A;  5HSW A;  4H54 A;  3QW0 A;  5JP7 A;  3GEE A;  4G78 A;  3F47 A;  2R7T A;  1VLT A;  1AUE A;  5DQZ A;  1F1M A;  2R7W A;  3ZTZ A;  3DM9 B;  4MVU A;  1CGM E;  3IQ5 A;  4CSA A;  3W2V A;  1S7Z A;  3TJ6 A;  4P9T A;  3EG9 B;  2L81 A;  5A6K A;  3EGX B;  4DVY P;  1RKE A;  3W4Y A;  4G0H A;  3PDM P;  2HUJ A;  2LQG A;  3M1C B;  1A7V A;  2WVN A;  2WVQ A;  5D92 A;  4Z9I A;  4PJN A;  2WVO A;  3VYW A;  5KYY B;  2J9B A;  1WAS A;  2EPO A;  1VLS A;  5EK0 A;  4FX5 A;  3U5S A;  5L0C A;  3SP1 A;  2H7B A;  3RKO F;  3O39 A;  2AVK A;  3NYJ A;  2XXA A;  1M2O A;  2R02 A;  5BQG A;  4F4B A;  3FDQ A;  4ER9 A;  3S90 A;  2YL1 A;  2NPU A;  4XQ1 A;  2KNH A;  1OW8 A;  1Y4C A;  4D4N A;  3ZQY A;  2XLE A;  3B0V C;  4BJ6 A;  5F5H A;  1BR4 A;  1AVO B;  1Z5Z A;  1LIH A;  5K0I A;  5A6B A;  3EHN A;  2LFF A;  3B0U X;  2VC9 A;  2L9J A;  4CDA A;  2CNW A;  4CIH A;  4DJ9 A;  3LNR A;  2L6H A;  4OIP F;  3Q6M A;  4G7O F;  1ZW3 A;  3NRH A;  3TUL A;  1YYX A;  3NYL A;  4ANJ A;  1YZC A;  3AG3 C;  2YRF A;  3MX3 A;  3PMR A;  5DS4 A;  1T01 A;  1NFN A;  2A68 F;  1Q0D A;  5BUO A;  2HFI A;  2W4M A;  4I1O B;  4LLC A;  4IWB A;  3JTL O;  1EQ1 A;  2A6E F;  3S0X A;  1H6G A;  3ZC4 A;  3VF0 A;  2Q9B A;  3K1I A;  2QLA A;  1ZHZ A;  1FR0 A;  2AWC A;  3GOR A;  1JMW A;  1V54 C;  2NUP B;  4B6I A;  2LD6 A;  1B68 A;  1OCO C;  4DRH B;  1H9G A;  2YQY A;  1J8M F;  2YLD A;  5B3S C;  4QI2 A;  3LES A;  3MLG A;  2R7Q A;  1RXQ A;  3RW0 A;  3UNG C;  3IQT A;  2B0J A;  2NSG A;  2EPN A;  3S29 A;  3PCV A;  3B9Q A;  1HMO A;  3DE8 A;  3SXM A;  4NTF A;  3MYI A;  2YL0 A;  3FAJ A;  4IAR A;  4PJL A;  4D4X A;  5JS5 A;  5E33 A;  3VRC A;  2D4U A;  1M57 C;  2Q00 A;  3LNM B;  2M4E A;  5IY5 C;  2V26 A;  1OCZ C;  5JUA A;  3U2L A;  3K7D A;  3U3F A;  3X1O A;  2WZG A;  2ASR A;  4IAQ A;  1A7D A;  1BDJ B;  4AK9 A;  1TWA A;  3C7J A;  4KC9 A;  3IHU A;  2IXM A;  4NTB A;  4PFP A;  4BJ5 A;  5CIV A;  4U5H A;  3ATP A;  2QE9 A;  4JEA A;  1QZX A;  3JCU Q;  5TJ5 E;  4EUK B;  1V4A A;  2AU5 A;  5D91 A;  2AP3 A;  1FNT c;  1BR2 A;  4I3M A;  2IYL D;  1JRA A;  1LM3 B;  1XZP A;  2YWA A;  4DBQ A;  1OW7 A;  1XZQ A;  1BBH A;  3AG4 C;  3EQL F;  1VB5 A;  4JW1 A;  4MW3 A;  3RF3 A;  3WHN A;  2Y39 A;  4CS8 C;  3AQC A;  2YHS A;  3EG9 A;  1RJ9 A;  1SYQ A;  2L6F A;  5DS5 A;  3TQO A;  4DXW A;  3EGX A;  3QW1 A;  3UGP A;  3JRM O;  4E18 A;  2QNL A;  4YT2 A;  3T4R A;  4Z9J A;  4QDL A;  5L0F A;  2R05 A;  1CGN A;  3L8I A;  1MMG A;  4MVQ A;  1OR2 A;  3DI5 A;  2W45 A;  1MMD A;  4HFF B;  4DVZ A;  2A6H F;  1LE2 A;  1TWH A;  2CDQ A;  5KYY A;  2XLO A;  2IXP A;  2GWW A;  1A7E A;  1M2V A;  2Y69 C;  1E83 A;  4XPY A;  2HJ3 A;  2DYR C;  2FFH A;  2HMZ A;  5T1D B;  4X0R A;  3RQE A;  3SEO A;  4OD5 A;  1JPJ A;  1W2W A;  1DOV A;  1BR1 A;  3RQF A;  3U8P A;  3IQ6 A;  1VOM A;  4MND A;  1C02 A;  1Y6D A;  1Q0G A;  1TFK B;  3Q6N A;  3ZQV A;  3K66 A;  3SYN A;  4XTK A;  4G7Z F;  1ZHT A;  4C3B A;  2J7P D;  4BJ6 C;  4JRZ A;  1Z63 A;  3ABM C;  2QY9 A;  4KNW A;  1LE4 A;  3DJN B;  1V55 C;  3IPM O;  5B1A C;  2LCH A;  2XS8 A;  3U9M A;  1HW2 A;  4GQH A;  3DAF A;  4YK5 A;  4HEA J;  4JCZ A;  1ZYR F;  4C3D A;  3CQZ A;  4C3E A;  2DGJ A;  3GM1 A;  4LER A;  4P6I C;  3ZWI A;  2OOC A;  1NBB A;  4LLE A;  1ZZP A;  3SNH A;  4PFO A;  2G3V A;  4J30 B;  3W2W A;  1QQ3 A;  3M4B A;  2NUP A;  4OIO F;  1D0X A;  4MTF A;  3SXZ A;  5JVE A;  5L0G A;  2VB6 A;  2EIN C;  3T6G B;  1OR3 A;  2VCC A;  4E0I A;  4EKW A;  1ZHW A;  4O6N A;  4EWC A;  1RMV A;  3JSZ A;  1VTM P;  1E86 A;  2CGE A;  4OIR F;  1MNE A;  3NG1 A;  4E7S A;  1LVK A;  2G62 A;  4WGZ A;  1IW7 F;  2HZ8 A;  3LLI A;  5F28 E;  2R7O A;  1RJ9 B;  3ZG1 A;  3GEI A;  4JEB A;  3NKE A;  3MYF A;  5FZT A;  2KK1 A;  3T6B A;  2Q4F A;  3C63 A;  2LSE A;  4H4K C;  1YVI A;  2VH3 A;  3GAN A;  4GEH A;  4M63 A;  2HS5 A;  4XWJ A;  4AL0 A;  3ZSU A;  3JYH A;  1FMV A;  4EBK A;  3S84 A;  4DBR A;  2OG2 A;  1QVX A;  1VYK A;  1M2V B;  4JC7 A;  4CDV A;  2XLH A;  1D1B A;  3VM6 A;  1Z7Q c;  5GPG B;  3U9J A;  3UR3 C;  3ZVR A;  1NZE A;  3VAY A;  2M64 A;  3HLZ A;  4A4A A;  3I4U A;  1YZA A;  3JZ0 A;  2LK4 A;  1E84 A;  4XLP F;  1Q0F A;  4JTA B;  2HMQ A;  3MBG A;  3MFN A;  3LLK A;  3SZR A;  4CIP A;  4L6R A;  3B0P A;  3GM3 A;  3DZA A;  1YAU O;  2I8B A;  2MYS A;  3K33 A;  2IXN A;  3RIP A;  4UDV A;  5L0H A;  4J7Y A;  4JTC B;  1K40 A;  1IZM A;  1LI7 A;  3LS0 A;  3O6X A;  4IRU A;  3FHD A;  4YL3 A;  4YJW A;  1O5H A;  5A6J A;  1Z23 A;  1LPE A;  3G4X A;  4AE4 B;  4CS9 C;  2X0C A;  1OKK D;  4FES A;  2UUH A;  3UGO A;  4NY3 A;  3S27 A;  3AG1 C;  4U5F E;  4MVM A;  4N6H A;  2HJM A;  1ST6 A;  2JX0 A;  1YLM A;  1RKC A;  2R03 A;  2RSE B;  3TJ5 A;  1RCP A;  2EIJ C;  4DOZ A;  2C03 A;  1TR2 A;  1SZI A;  2KC3 A;  1LS1 A;  2P1A A;  2ZXP A;  3V5Y A;  5JLI A;  2AWY A;  1C03 A;  2WL8 A;  4O79 A;  3FXH A;  2ICW G;  2CW0 F;  4JVS A;  4N4W A;  3RVY A;  2DB4 A;  2HV6 A;  2J0X A;  2Q9A A;  4MTO A;  1D1C A;  2DYS C;  3M15 A;  4JCH A;  4NTA A;  4YN0 B;  1ZU5 A;  2V3C C;  3O55 A;  3C8G B;  4KI2 A;  1E85 A;  4OIQ F;  4U5G A;  1G4W R;  2HV7 A;  2IM8 A;  4WGY A;  2FAP B;  3B29 A;  4ULV A;  4KNV A;  3WAQ A;  4AX2 A;  2PFD A;  1O87 A;  1WN0 A;  1GS9 A;  2KW3 C;  4O6M A;  2OEX A;  2XL8 A;  2BL2 A;  1QSP A;  2EPK X;  2EPL X;  3M4C A;  4U9E A;  3TD7 A;  3US6 A;  3HNI A;  1YJG A;  1YYJ A;  2XM4 A;  4E7Z A;  3HNL A;  1JPN A;  3W8I A;  1FFH A;  3L1M A;  2OJE D;  3N0T A;  3FAP B;  3BRJ A;  3HNK A;  4U5D E;  1H7I A;  5JSL A;  3CSK A;  5KYU B;  4RD9 A;  2H7V C;  2W4B A;  4A2N B;  2L7A A;  3DKA A;  1EI7 A;  4CSA C;  1YAR O;  3HNJ A;  2A0B A;  3V5Z A;  5L3V A;  1NSG B;  2YEV A;  1OKK A;  5DLJ A;  2R7V A;  1FMW A;  4K0D A;  4WJ0 A;  1TWG A;  3C8G D;  5A6A A;  2Y3B A;  4DRI B;  2B0H A;  2PX0 A;  3I5P A;  3NYM A;  4MQ9 F;  4E0H A;  3O10 A;  5JT4 A;  3ZDL A;  1JOG A;  3B71 A;  1WOL A;  2J9U A;  4PAC A;  3DD7 A;  4XEF A;  1CPQ A;  2NUT B;  3U3B A;  2G3K A;  5B3I A;  3QVY A;  4NCQ A;  2XLW A;  1WGW A;  5BQI A;  3K6B A;  2R7R A;  2YKZ A;  3DAG A;  1OXK A;  2IBF A;  4MVR A;  1ORJ A;  4JTD B;  4FWV A;  1U89 A;  2JPU A;  3G50 A;  4LAC B;  1ZHX A;  3SXK A;  3ZIB A;  2PF4 E;  2P6V A;  3TK0 A;  1GM5 A;  3EFO B;  3NKD A;  3JRT A;  4EIY A;  5EGY A;  1QLE C;  2W9Y A;  1T5O A;  2J9W A;  4BJT A;  2MWQ A;  4LDK A;  3BEH A;  5E3C A;  5KYX A;  5KYW B;  4U9D A;  1APC A;  1LS4 A;  2Y3D A;  3R7C A;  3GWL A;  3HKK A;  4AL1 A;  4U5E E;  4O6Y A;  3UMI A;  4AE4 A;  3A9C A;  3KMI A;  4G7H F;  5COG A;  2KGO A;  1ORY A;  4W8P A;  4OIN F;  3L34 A;  2EIL C;  3EZI A;  3H2U A;  1MQV A;  2A1D D;  1NU7 D;  2E87 A;  3EH1 A;  1M56 C;  2VAS A;  4PJM A;  4FAP B;  3LS1 A;  3TOL A;  2XSE A;  3K1I C;  3RYL A;  3R2P A;  4GYT A;  1CGO A;  2OU6 A;  2YVK A;  3DWW A;  2JD3 A;  1CPR A;  2P61 A;  1WWP A;  3NMI A;  3FOP A;  2EIK C;  4MS2 A;  4LDR A;  4N06 A;  4W8K A;  2ZD9 A;  3EHM A;  1D1A A;  2XL4 A;  3IQC A;  2J8W A;  2EPM X;  2CNW D;  3EJN A;  3IEE A;  3T6J A;  3NDB B;  2ZXO A;  2DI3 A;  2Q3T A;  1VMA A;  1DOW A;  1S05 A;  3C8G A;  4EBJ A;  4KBL A;  1U6H A;  3KL4 A;  4XPX A;  1EA8 A;  1HE1 A;  1T6Q A;  2YLI A;  2MHR A;  3HJC A;  4XEK A;  1SR2 A;  2Y3G A;  4HFK B;  1N1C A;  3EZH A;  3ITF A;  1TKN A;  1MND A;  2CCY A;  2ZXW C;  3E70 C;  4I44 A;  3S28 A;  4CS8 A;  5L0J A;  2GDC A;  5E3A A;  1G8X A;  3U8V A;  1FTS A;  1GQA A;  2IOQ A;  3K1H A;  4MTG A;  4BJ5 C;  4Q5S F;  2X51 A;  4OD4 A;  3QTH A;  2J45 A;  5L0I A;  2XLD A;  1KNY A;  2BE5 F;  3RFY A;  2J7P A;  1PD1 A;  4EHP A;  1I4Z A;  1OQC A;  3C8Z A;  3V5X A;  1WAT A;  2PNO A;  1AEP A;  4JKV A;  4QI0 A;  1Q0K A;  2NSF A;  5FCL A;  4U5C E;  2J46 A;  3KYI A;  5A69 A;  4E17 A;  3M79 A;  3NMK A;  1L7C A;  1XWJ A;  2HSB A;  5CI9 A;  4XLN F;  2Q7R A;  5KYX B;  3FVY A;  3POV A;  3EPV A;  3WOD F;  1HMD A;  4CJO A;  1D0Y A;  3GWN A;  2LFD A;  2QUP A;  2YL7 A;  1ZU4 A;  1Z6A A;  4IAO A;  1C17 M;  1NFO A;  3OWT A;  3T9O A;  5AC4 A;  4MVO A;  1U0B B;  1R4T A;  3LJB A;  2A69 F;  3GEH A;  2NUT A;  3F46 A;  5L3Q A;  5BQH A;  4ULW A;  5DQT A;  1D0Z A;  3SXY A;  2J9V A;  3GM2 A;  2OQM A;  5T3W A;  2XRH A;  3AOU A;  1UG7 A;  1JR8 A;  5COM A;  3V7O A;  4ZLC A;  3LEO A;  1EKY A;  2QTV A;  3ASO C;  3EFO A;  3TOM A;  1TWC A;  2WZF A;  3ABK C;  3OEO A;  2WZL A;  5AGF A;  1H9T A;  5COF A;  3AJM A;  5T3T A;  3S9O A;  1G5Z A;  1SMY F;  1PD0 A;  4J7T A;  5AC5 A;  5KYW A;  3AQB A;  3I5Q A;  2RD9 A;  3N24 A;  1NG1 A;  3X2Q C;  4IJJ A;  1LI5 A;  2P0N A;  2Y3H A;  4P9F A;  4PJJ A;  2ZPA A;  3U2M A;  3OA1 A;  4C7O B;  2GA0 A;  1BZ4 A;  3AG2 C;  4JIO A;  1OCC C;  1K05 A;  1T6I A;  2YLG A;  1ZW2 A;  1VK5 A;  3LEV A;  5F5F A;  2YL3 A;  2FGY A;  1I4Y A;  3L0I A;  3QVZ A;  3ZTM A;  2R25 A;  2KSF A;  3J06 A;  1NU9 C;  2XS1 A;  3EGD A;  1TFO B;  4MVS A;  1SF8 A;  2PBE A;  2KQ9 A;  4O7G A;  4NC3 A;  4YT4 A;  5EHH A;  2HKV A;  1T9K A;  1R5I D;  3LAY A;  2H8A A;  2VCB A;  3JYY A;  4BJ1 A;  4YL1 A;  4BPM A;  3PHF 2;  2NG1 A;  4K7B A;  4N6C A;  5L0D A;  4MW8 A;  3DMD A;  2J0W A;  2Q9C A;  1RKE B;  4IB4 A;  4RDA A;  2PX3 A;  3W8H A;  2ETS A;  2H7O A;  2GFH A;  2OCC C;  1HE9 A;  1VYI A;  2WB7 A;  2ZXR A;  2A0U A;  1OW6 A;  3HTK C;  4K1O A; 
#chains in the Genus database with same CATH homology
 5B1B C;  3UMK A;  3JT1 A;  3Q7G A;  1J8Y F;  5KYN A;  2XXA B;  5KYU A;  2Z15 A;  2EIM C;  4YWQ A;  4JZA A;  1PCX A;  5CI8 A;  3GOD A;  2D5R B;  1ZHY A;  4CS9 A;  1KU2 A;  2YZS A;  3EH2 A;  3H65 A;  4Q7C A;  5DVW A;  2KJG A;  4U5B E;  2R7U A;  3DJU B;  1MMN A;  3N2Z B;  4JJF A;  2P7V A;  2PP4 A;  4YT5 A;  3QZC A;  3ABL C;  4EBB A;  4PK4 A;  3QMK A;  3ECS A;  3RH3 A;  4YT8 A;  3KH2 A;  3UMH A;  2IXO A;  2O9X A;  4CBE A;  3DM5 A;  1MMA A;  3EGD B;  5E2Q A;  4BEJ A;  4CS7 A;  4ZLD A;  4BG0 A;  1FFT C;  1Z3I X;  4JUR I;  3DXJ F;  3CZ6 A;  2R7X A;  1OCR C;  4I1M A;  2R7S A;  2C04 A;  3WG7 C;  3E9V A;  3ASN C;  4C7O A;  3KKB A;  4J32 B;  4YT4 A;  3SP1 A;  4HE8 D;  4RBN A;  4JJG A;  5DS6 A;  1LKX A;  3Q7L A;  5HSW A;  3F47 A;  2R7T A;  5DQZ A;  2R7W A;  3DM9 B;  4CSA A;  3W2V A;  1S7Z A;  3EG9 B;  2L81 A;  3EGX B;  4DVY P;  4G0H A;  3M1C B;  2WVN A;  2WVQ A;  5D92 A;  4PJN A;  2WVO A;  3VYW A;  5KYY B;  4FX5 A;  2H7B A;  3RKO F;  3O39 A;  3NYJ A;  2XXA A;  1M2O A;  3FDQ A;  4F4B A;  2KNH A;  3B0V C;  4BJ6 A;  5F5H A;  1BR4 A;  1Z5Z A;  3EHN A;  3B0U X;  2L9J A;  4CIH A;  2CNW A;  3LNR A;  4G7O F;  4OIP F;  3Q6M A;  3NRH A;  3NYL A;  4ANJ A;  3AG3 C;  3MX3 A;  3PMR A;  5DS4 A;  2A68 F;  5BUO A;  2W4M A;  4I1O B;  4LLC A;  4IWB A;  2A6E F;  3S0X A;  3ZC4 A;  2Q9B A;  1ZHZ A;  1V54 C;  2NUP B;  4B6I A;  1OCO C;  1J8M F;  5B3S C;  4QI2 A;  3LES A;  3MLG A;  2R7Q A;  3UNG C;  2B0J A;  3S29 A;  3B9Q A;  3FAJ A;  4PJL A;  5E33 A;  1M57 C;  2M4E A;  5IY5 C;  2V26 A;  1OCZ C;  3K7D A;  3X1O A;  2WZG A;  4AK9 A;  1TWA A;  4KC9 A;  4BJ5 A;  4PFP A;  2IXM A;  4U5H A;  1QZX A;  3JCU Q;  5D91 A;  1BR2 A;  4I3M A;  2IYL D;  4DBQ A;  3EQL F;  3AG4 C;  4JW1 A;  2Y39 A;  4CS8 C;  3AQC A;  2YHS A;  3EG9 A;  1RJ9 A;  5DS5 A;  3EGX A;  3UGP A;  4YT2 A;  3T4R A;  4QDL A;  1MMG A;  2W45 A;  1MMD A;  4HFF B;  4DVZ A;  2A6H F;  5KYY A;  1TWH A;  2CDQ A;  2IXP A;  1M2V A;  2Y69 C;  2DYR C;  2FFH A;  5T1D B;  4X0R A;  3SEO A;  4OD5 A;  1JPJ A;  1W2W A;  1BR1 A;  1VOM A;  4MND A;  3Q6N A;  3K66 A;  3SYN A;  4XTK A;  4G7Z F;  1ZHT A;  4C3B A;  2J7P D;  4BJ6 C;  1Z63 A;  3ABM C;  2QY9 A;  4KNW A;  3DJN B;  5B1A C;  1V55 C;  3DAF A;  4HEA J;  1ZYR F;  4C3D A;  3CQZ A;  4C3E A;  2DGJ A;  4LER A;  4P6I C;  4LLE A;  3SNH A;  4PFO A;  2G3V A;  4J30 B;  3W2W A;  2NUP A;  4OIO F;  1D0X A;  2VB6 A;  2EIN C;  1ZHW A;  4O6N A;  4EWC A;  3JSZ A;  2CGE A;  4OIR F;  1MNE A;  3NG1 A;  4E7S A;  1LVK A;  2G62 A;  1IW7 F;  3LLI A;  2R7O A;  1RJ9 B;  3ZG1 A;  3NKE A;  3T6B A;  2LSE A;  4H4K C;  3GAN A;  2VH3 A;  4GEH A;  4M63 A;  4XWJ A;  3ZSU A;  3JYH A;  1FMV A;  4DBR A;  2OG2 A;  1VYK A;  1M2V B;  1D1B A;  3UR3 C;  3ZVR A;  1NZE A;  3VAY A;  3HLZ A;  3I4U A;  4XLP F;  3SZR A;  3LLK A;  3B0P A;  3DZA A;  2I8B A;  2MYS A;  3K33 A;  3RIP A;  2IXN A;  1IZM A;  3LS0 A;  3O6X A;  4IRU A;  3FHD A;  4YJW A;  1O5H A;  1Z23 A;  4AE4 B;  4CS9 C;  1OKK D;  4FES A;  3UGO A;  4NY3 A;  3S27 A;  3AG1 C;  4U5F E;  1ST6 A;  4DOZ A;  2EIJ C;  2C03 A;  1TR2 A;  1SZI A;  1LS1 A;  2ZXP A;  2WL8 A;  4O79 A;  2CW0 F;  4JVS A;  2HV6 A;  2J0X A;  2Q9A A;  1D1C A;  2DYS C;  4JCH A;  4YN0 B;  2V3C C;  1ZU5 A;  4KI2 A;  4OIQ F;  4U5G A;  2HV7 A;  4AX2 A;  4KNV A;  2PFD A;  1O87 A;  2KW3 C;  4O6M A;  3TD7 A;  4E7Z A;  1JPN A;  3W8I A;  1FFH A;  3N0T A;  4U5D E;  3CSK A;  4RD9 A;  2H7V C;  2W4B A;  4A2N B;  4CSA C;  5L3V A;  2YEV A;  1OKK A;  5DLJ A;  2R7V A;  1FMW A;  4K0D A;  4WJ0 A;  1TWG A;  2Y3B A;  3NYM A;  2PX0 A;  3I5P A;  4MQ9 F;  2J9U A;  3DD7 A;  2NUT B;  2G3K A;  1WGW A;  3K6B A;  2R7R A;  3DAG A;  4FWV A;  3ZIB A;  4LAC B;  1ZHX A;  2PF4 E;  2P6V A;  3EFO B;  3NKD A;  3JRT A;  5EGY A;  1QLE C;  2W9Y A;  2J9W A;  4BJT A;  2MWQ A;  5KYX A;  5E3C A;  5KYW B;  2Y3D A;  4U5E E;  4O6Y A;  3UMI A;  4AE4 A;  3KMI A;  4G7H F;  2KGO A;  4OIN F;  3L34 A;  2EIL C;  3EZI A;  2A1D D;  1NU7 D;  2E87 A;  3EH1 A;  1M56 C;  2VAS A;  4PJM A;  3LS1 A;  2XSE A;  3K1I C;  3RYL A;  4GYT A;  2JD3 A;  2EIK C;  4N06 A;  4W8K A;  3EHM A;  1D1A A;  2XL4 A;  3IEE A;  3EJN A;  2CNW D;  3T6J A;  3NDB B;  2ZXO A;  2Q3T A;  1VMA A;  4KBL A;  3KL4 A;  3HJC A;  2Y3G A;  4HFK B;  1N1C A;  3EZH A;  3ITF A;  1TKN A;  1MND A;  2ZXW C;  3E70 C;  4I44 A;  3S28 A;  4CS8 A;  5E3A A;  1G8X A;  4BJ5 C;  1FTS A;  2IOQ A;  3K1H A;  4Q5S F;  2X51 A;  4OD4 A;  5KYU B;  2J45 A;  3RFY A;  2BE5 F;  2J7P A;  1PD1 A;  4QI0 A;  5FCL A;  4U5C E;  2J46 A;  5CI9 A;  4XLN F;  5KYX B;  3FVY A;  3POV A;  3EPV A;  3WOD F;  1D0Y A;  1ZU4 A;  1Z6A A;  4IAO A;  3OWT A;  3LJB A;  2A69 F;  2NUT A;  5L3Q A;  3F46 A;  4ULW A;  5DQT A;  1D0Z A;  2J9V A;  2XRH A;  3V7O A;  4ZLC A;  2QTV A;  3ASO C;  3EFO A;  1TWC A;  2WZF A;  3ABK C;  3OEO A;  2WZL A;  5T3T A;  1SMY F;  1PD0 A;  5KYW A;  3AQB A;  3I5Q A;  3N24 A;  1NG1 A;  3X2Q C;  4IJJ A;  2Y3H A;  4PJJ A;  2ZPA A;  3OA1 A;  4C7O B;  3AG2 C;  1OCC C;  1VK5 A;  3LEV A;  5F5F A;  2FGY A;  3L0I A;  1NU9 C;  3EGD A;  4O7G A;  1SF8 A;  2KQ9 A;  5EHH A;  3LAY A;  4BJ1 A;  3PHF 2;  2NG1 A;  4K7B A;  3DMD A;  2J0W A;  2Q9C A;  4RDA A;  2PX3 A;  3W8H A;  2H7O A;  2GFH A;  2OCC C;  2WB7 A;  1VYI A;  4Q4Z F;  2ZXR A;  3HTK C;  5T3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...