4C3BA

Hrsv m2-1, p21 crystal form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
178
structure length
165
Chain Sequence
PLGSMSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDELDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX PROTEIN 2-1
publication title Crystal Structure of the Essential Transcription Antiterminator M2-1 Protein of Human Respiratory Syncytial Virus and Implications of its Phosphorylation.
pubmed doi rcsb
source organism Human respiratory syncytial virus
molecule tags Viral protein
total genus 56
structure length 165
sequence length 178
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06436 Pneumovirus_M2 Pneumovirus matrix protein 2 (M2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4c3bA00
4CS7A 4CS9C 4C3BA 4CSAA 4CS8C 4CS9A 4C3DA 4C3EA 4CS8A 4CSAC 2L9JA
chains in the Genus database with same CATH superfamily
1PCXA 2HV6A 4ULWA 4IWBA 4BJ1A 2OG2A 4MVOA 1Y6DA 5D91A 2J0WA 2ZXRA 3IQ6A 4IJJA 3ZQYA 1Z63A 4BJ5A 3W8IA 4RDAA 5F5FA 2L7AA 1U89A 2YLGA 4RBNA 4DJ9A 3EHMA 3EH2A 3SEOA 4MVQA 2Q9CA 3C7JA 1YYJA 1L7CA 1UG7A 2KGOA 2X51A 4FAPB 5KYXA 4DVYP 1I5NA 1J8MF 2ZXWC 1D0YA 2EIKC 2E87A 3CQZA 5JVEA 1Z5ZA 1FNTc 2DI3A 2NUPA 4PJJA 3UMHA 2QY9A 2XL6A 3K7DA 4N6CA 2A1DD 2NG1A 4JTAB 1ORJA 1NU9C 3RVZA 2J8WA 3AQCA 2OU6A 4U5CE 1T5OA 1CGNA 1SYQA 3ITFA 4PACA 4EIYA 1XZQA 4E17A 3QW1A 3T6BA 4J32B 2DB4A 2FFHA 2XLWA 3CEXA 4WGYA 2ZXPA 4I3MA 2HMZA 2LD6A 1NFNA 2XSEA 4HE8D 3RKOF 3QVZA 5L0JA 3SNHA 1EA8A 1ZHZA 1BR1A 3A11A 1GGQA 2I15A 2Y39A 3IQTA 4BJ6C 3IQCA 4DRIB 4OIOF 2W4BA 3V5YA 3JYYA 2H8AA 2P1AA 5F28E 4HFKB 2CYDA 3VYWA 4AE4B 4CS9A 1RMVA 3NMIA 1M2VA 3W4YA 5EGYA 5KYWA 2NUTA 3LEOA 5AC4A 4K7BA 3MYIA 3TQOA 3GEIA 4NY3A 4U9EA 2YL3A 3GANA 2P6VA 3ZDLA 4EBBA 5DS4A 2ZXOA 3I4UA 3B0VC 2BL2A 1BR4A 5A69A 1TFOB 4I1OB 5E3AA 1YZCA 2AVKA 2B0JA 4L6RA 3LAYA 5DQTA 3SZRA 1QVXA 3JYHA 2J46A 2NPUA 4CS8A 2PF4E 1LKXA 1A0BA 4KNWA 5DQZA 3N0TA 2L6HA 5BQGA 3KKBA 4N06A 1Q0MA 3Q7LA 5E33A 3C8GB 2BC5A 4KNVA 3RQEA 3C8ZA 4XPYA 3EG9A 2A69F 1D0ZA 2GDCA 2XM0A 3M79A 3TD7A 5T3TA 3B0PA 1A7DA 2IM8A 3OEOA 3SXZA 1WATA 5DLJA 3M4BA 3RH3A 4D4XA 4KI2A 1MMDA 2D5RB 4G7OF 3S28A 5L0HA 4PK4A 4CIPA 3H2VA 3AG2C 2J45A 2VASA 3US6A 3VRCA 3FVYA 1HY5A 3DM5A 1WASA 2IXPA 1CPRA 4U5DE 4U9DA 4DOZA 3UMKA 2EPNA 2DGJA 1SMYF 2B0HA 2J9BA 2WL8A 1R4TA 1J8YF 3MX3A 5AGFA 5JT4A 4YJWA 2C03A 1NBBA 1ZVZA 2R7SA 2YZSA 3KYIA 4ER9A 4JTCB 4AL1A 3Q6NA 2LP4A 2A6HF 2HSQA 4EBJA 4MVSA 2X0CA 4YK5A 4G78A 1VLTA 2CCYA 2BE5F 1EI7A 4MTFA 4O6MA 2HUJA 2OCCC 3EGDB 2LFDA 1Z7Qc 2YL7A 1TWAA 1Q0GA 3CZ6A 3EHNA 2GA0A 4NQFA 3KH2A 3C63A 1HMOA 3X1OA 4AX2A 1D1AA 2NSFA 3JZ0A 4IAOA 1AUEA 5A6JA 4XLNF 4JEAA 5D92A 1Q0DA 4OD5A 4FESA 1OXKA 1SZIA 3WHNA 3SXYA 5BUOA 4M63A 1VMAA 3B29A 4MS2A 1C02A 1BR2A 2KK1A 3FXHA 1M6TA 2M4EA 2Y3BA 4WJ0A 4YT5A 4CDAA 4C7OB 1FMVA 2R7XA 3ABLC 1OW8A 3HNKA 5COMA 1U6HA 3CAXA 4ANJA 1FR0A 3DZAA 1JMWA 3NYLA 1MNDA 1T9KA 1H9TA 4OD4A 3O6XA 2GFHA 2VC9A 4YL1A 4XEVA 4ZLDA 4U5FE 3B0UX 3LJBA 3WG7C 2Y3GA 1VOMA 4EBKA 2HFIA 3QZCA 2OEXA 2P61A 3AJMA 2YVKA 2A68F 1KTMA 3OWTA 3ATPA 2VB6A 3L8IA 4K1OA 1TWGA 3L1MA 1M56C 2W45A 2CNWD 4CDVA 4XEFA 3BEHA 3EZIA 3UNGC 3O55A 2J7PA 4JIOA 4YL3A 3IEEA 3EFOB 2G3KA 4CBEA 3FOPA 3BRJA 3JCUQ 3M1CB 4FX5A 5BQIA 5JS5A 5L0CA 3GWNA 4MW3A 3JTLO 4WABA 2H7OA 1RJ9B 1C17M 1SR2A 1NFOA 2YL0A 3O39A 1VTMP 3GORA 5A6KA 1YVIA 2EPLX 2ZPAA 3U3FA 5T1DB 3U8PA 1OKKA 2R7OA 2J9WA 4XWJA 5KYUA 1QQ3A 1OW7A 4QDLA 2LSEA 3RVYA 4E7ZA 5L3VA 2V3CC 2M64A 1LI5A 5HSWA 3EH1A 4CIHA 1M2OA 3AQBA 2JD3A 3POVA 2HJ3A 3U3BA 1V74B 1LS4A 1H7IA 2KYHA 1JAFA 1HE1A 1C03A 1I4YA 1OCOC 2PX3A 3U5SA 5L0GA 3DJUB 4IRUA 3R7CA 2QNLA 4DRHB 4Z9IA 5EK0A 4DXWA 3C18A 4JW1A 3DE9A 5TJ5E 1QSPA 5DS6A 5KYYB 1OCCC 4A2NB 3ASNC 3RIPA 1Q0KA 3DXJF 1ORYA 5DVWA 4DRJB 3U9JA 3I5PA 3U2LA 4QI0A 1AVOB 4C3DA 2XM4A 1E84A 3ZTZA 3DE8A 4MW8A 1N1CA 3LS1A 4ONSA 4P9FA 3UGPA 2WZFA 3GM2A 2R7WA 2WB7A 1S7ZA 1A7VA 2KW3C 4EKWA 3FDQA 1NZEA 4FWVA 3LLKA 4BJTA 3NRHA 2OJED 4NTBA 3I5QA 5FZTA 1ZHTA 3KMIA 3HNJA 2HV7A 3L34A 2EPOA 3EGXA 3JT1A 3DM9B 1A41A 4PR9A 1MMNA 2C04A 4LDKA 5K0IA 3DJNB 3TK0A 3IPMO 2HKVA 3B9QA 3K1IA 4OINF 1OQCA 4YT8A 3L8JA 1ST6A 1LI7A 3NG1A 4J7YA 4U5GA 4CJOA 2LQGA 3DD7A 3TOLA 4OIPF 1CGOA 3C8GD 3JRMO 1V55C 2EINC 4LLEA 3UR3C 1KNYA 1ORSC 3RFYA 3ZTMA 5KYXB 1O5HA 2VCAA 2J9UA 4XQ1A 2L9JA 2XLOA 2PP4A 2NUPB 1E2XA 2EIJC 4IAQA 1V54C 3SXKA 4BJ5C 4HEAJ 1IZMA 2OEVA 5JP7A 3AOUA 2RSEB 2YWAA 2ZD9A 3U8VA 2KJGA 1TKNA 1FFHA 2MHRA 1E85A 3AGTA 3V5ZA 4IB4A 4MVRA 1PD1A 4NCQA 4YT4A 3B71A 3K6BA 3FOOA 3GEEA 3M4CA 1YLMA 2MYSA 1AEPA 2YEVA 2Y3DA 1RKEA 3KL4A 3IHUA 3VM6A 4DVZA 5KYNA 5L0FA 4XPXA 2J0XA 4EWCA 4U5HA 2XS8A 1DOWA 4I44A 3QTHA 4JJGA 2R05A 2DYRC 3S29A 2YLIA 2VCBA 3RQGA 1Z3IX 1QLEC 1OCZC 1W2WA 2ASRA 2IXOA 4YWQA 1ZYRF 2P7VA 3ECSA 4Q7CA 2R7VA 4J30B 3RQFA 4AL0A 1BBHA 1MQVA 2I8BA 2WVOA 2XLMA 4MTGA 3U2MA 3ABMC 1M2VB 3QVYA 4H4KC 2CNWA 4QI2A 1TWCA 5CIVA 2V26A 1O87A 2H7VC 5L3QA 1T6IA 2WVQA 1YYXA 4F4BA 4CDYA 1ZHYA 1E86A 2FGYA 1QZXA 2HMQA 2XLDA 2FAPB 3HKKA 3ZQVA 5JRAA 2XLHA 4PFOA 3J06A 2WZGA 2YL1A 3ABKC 1OR3A 1LS1A 4PJLA 1ZU5A 2ETSA 3FMSA 1FMWA 4O6NA 3PDMP 1TQGA 1JOGA 1ZW3A 3DAFA 3HJCA 3Q7GA 4MQ9F 5E2QA 3MYFA 4BJ6A 4CS9C 3ZIBA 3DWWA 4DBQA 2XL8A 4WGZA 4AK9A 1BDJB 1YJGA 1LIHA 2Q9BA 1YZAA 1FFTC 5L0IA 1H9GA 1PD0A 1Q0FA 3AG4C 3X2QC 3E70C 1RCPA 3MLGA 3EG9B 5HV9A 5IY5C 4U5EE 3H65A 3VF0A 3U9MA 4Z9JA 1WN0A 4H54A 4JRZA 3TULA 5A6BD 2LIGA 4MVMA 4EHPA 3UGOA 1VK5A 3G50A 4CS8C 2RD9A 1I4ZA 1D1BA 2MWQA 1OW6A 2KQ9A 4GYTA 1YARO 3SYNA 1A7EA 1WOLA 4AE4A 2WZLA 2Y3HA 1ZHWA 3ASOC 4LACB 1QPUA 2G3VA 3T4RA 1V4AA 3GM1A 2QUPA 3GEHA 3MBGA 3PMRA 3RYLA 5F5HA 2PBEA 3JSEO 2R7TA 2XXAB 1OXBA 4OIQF 2QTVA 3M15A 2TMVP 1HMDA 1MNEA 1NU7D 3HNIA 4JCHA 3TJ6A 2UUIA 4CX9A 2R7UA 2OQMA 3F46A 3LEVA 4MNDA 5L0DA 1HW2A 1U0BB 3ZC4A 5CI8A 3N24A 2YLDA 1YA7O 3K33A 5T3WA 1Z23A 3T6GB 4ZLCA 1K04A 2HZ8A 1D1CA 1MMAA 2P0NA 3H2UA 5AC5A 2EPMX 1OCRC 2AWYA 4JTDB 4NTAA 2Q4FA 2OKUA 3K1HA 1CPQA 2CW0F 2XRHA 4YN0B 3S9OA 3TJ5A 1F1MA 3C8GA 2DYSC 5EHHA 5B1AC 1PV3A 2PFDA 3C62A 1GM5A 4KBLA 5JLIA 4RD9A 2CGEA 2Q00A 1Y4CA 2R02A 3G4ZA 2VH3A 3L0IA 1K40A 4J7TA 3JRTA 2Q9AA 4O6YA 5CI9A 4UDVA 4Q5SF 3MFNA 3K66A 4O79A 3LNMB 4JEBA 4MVUA 2KSFA 4JC7A 3AG1C 4Z9HA 2LCHA 2EPKX 1OR2A 2Q7RA 1HE9A 1LE2A 1M57C 3N2ZB 3QMKA 1S05A 4P9TA 1FTSA 4I1MA 4ULVA 3IQ5A 4MTOA 3WODF 1NSGB 4E0HA 2KNHA 1WWPA 4PFPA 2JPUA 1YAUO 1T6QA 1G5ZA 4KC9A 5JUAA 1O3UA 4R32A 3V7OA 1GQAA 2IXMA 1G4US 2A6EF 2L6GA 1LVKA 2YKZA 4GQHA 5FCLA 2L6FA 2H7BA 3DMDA 2EILC 2O9XA 2IBFA 2YQYA 3EPVA 3ZG1A 3HTKC 4BEMJ 3EGDA 2OJQA 4CSAC 3S27A 1JPNA 2L81A 1T01A 2UUHA 2A0UA 2J7PD 3FHDA 3OA1A 4GEHA 4E7SA 3ZVRA 4C3EA 1JPJA 1LM3B 3FAPB 3HLZA 2Y69C 1VB5A 2YHSA 3CSKA 3R2PA 3W2VA 2XLEA 3WAQA 1NLXA 3E9VA 3PCVA 4JURI 256BA 5COGA 3VAYA 3LS0A 4BPMA 1WTYA 4YT2A 1E83A 4G7HF 2PNOA 4E18A 3QW0A 1HW1A 1OKKD 3LLIA 2AP3A 3FAJA 4CJGA 4E0IA 5A6BA 4C7OA 3U0CA 2VCCA 1LE4A 3DI5A 5KYUB 2Z15A 2YRFA 3LNRA 4K0DA 2HS5A 3S84A 2A0BA 1UFBA 2QE9A 4XEKA 3DKAA 1JR8A 3LUTB 4HFFB 5JSLA 3NMKA 3T9OA 1G8XA 3V5XA 2IXNA 1QKRA 4O7GA 4PJNA 3GWLA 3S0XA 2QLAA 3LESA 1RXQA 2EIMC 4B6IA 3NDBB 3Q6MA 5B3SC 4JZAA 5BQHA 3RF3A 1ZHXA 2NSGA 4P6IC 1MMGA 3G4XA 2CDQA 1VLSA 3DAGA 2XLVA 4JJFA 4XLPF 4D4NA 4G7ZF 1TWHA 2R7RA 2ICWG 4EUKB 2LK4A 3NYJA 2GWWA 4IGGA 1K05A 2NUTB 4MVZA 4DBRA 1KU2A 4LLCA 2G62A 3EJNA 5KYWB 5A6AA 1R5ID 4X0RA 2XXAA 4BEJA 1SF8A 1B68A 3EFOA 5COFA 2IOQA 4N4WA 2R9RB 1YA9A 4OIRF 1VYKA 4C3BA 3O10A 1G4WR 3W8HA 4JKVA 3NKEA 1GS9A 1RJ9A 3PHF2 1LPEA 2W9YA 1FAPB 3EGXB 1NG1A 2J9VA 3ZSUA 3AG3C 2AWCA 4N6HA 4LERA 2R7QA 4NC3A 3AGUA 2D4UA 3A9CA 5E3CA 1CGME 2XL4A 1EQ1A 5DS5A 1TR2A 1RKCA 4NTFA 4YL0A 1WGWA 3NMJA 3GODA 4BG0A 3SXMA 4JVSA 1YDIA 1IW7F 3UMIA 5B1BC 3F47A 3W2WA 1DOVA 4JCZA 2XS1A 3KPHA 3EQLF 1BZ4A 4A4AA 2AU5A 4CS7A 4IARA 3T6JA 1XWJA 1ZU4A 3NYMA 4Q4ZF 1JRAA 3S90A 4W8PA 2W4MA 4JE9A 4LDQA 3ZWIA 5GPGB 3TOMA 3RW0A 5KYYA 1Z6AA 4LDRA 2JX0A 3HNLA 3K1IC 1T6UA 1TFKB 4PJMA 3SP1A 1VYIA 1D0XA 3EZHA 3KYJA 2R25A 2F22A 3GM3A 1APCA 4XPWA 5B3IA 4XTKA 1L3PA 2IYLD 1XZPA 2HSBA 3NKDA 4W8KA 1ZZPA 2OOCA 4CSAA 1RKEB 1EKYA 2Q3TA 3JSZA 1ZW2A 2KC3A 2PX0A 2GAQA 2LFFA 2R03A 2WVNA 4U5BE 2HJMA 4G0HA 1H6GA
chains in the Genus database with same CATH topology
1PCXA 2HV6A 4ULWA 4IWBA 4BJ1A 2OG2A 5D91A 2J0WA 2ZXRA 4IJJA 1Z63A 4BJ5A 3W8IA 4RDAA 4RBNA 3EHMA 3EH2A 3SEOA 2Q9CA 2KGOA 2X51A 5KYXA 4DVYP 1J8MF 2ZXWC 1D0YA 2EIKC 2E87A 3CQZA 1Z5ZA 4PJJA 2NUPA 2QY9A 3K7DA 2A1DD 2NG1A 1NU9C 3AQCA 4U5CE 3ITFA 3T6BA 4J32B 2FFHA 2ZXPA 4I3MA 2XSEA 4HE8D 3RKOF 3SNHA 1ZHZA 1BR1A 2Y39A 4BJ6C 4OIOF 2W4BA 4AE4B 4HFKB 3VYWA 4CS9A 1M2VA 5EGYA 5KYWA 2NUTA 4K7BA 4NY3A 3GANA 2P6VA 4EBBA 3B0VC 5DS4A 2ZXOA 3I4UA 1BR4A 4I1OB 5E3AA 2B0JA 3LAYA 5DQTA 3SZRA 3JYHA 2J46A 4CS8A 2PF4E 1LKXA 4KNWA 5DQZA 3N0TA 3KKBA 4N06A 3Q7LA 5E33A 4KNVA 3EG9A 2A69F 1D0ZA 3TD7A 5T3TA 3B0PA 3OEOA 4KI2A 5DLJA 3RH3A 1MMDA 2D5RB 4G7OF 3S28A 4PK4A 3AG2C 2J45A 2VASA 3FVYA 3DM5A 2IXPA 4U5DE 4DOZA 3UMKA 2DGJA 1SMYF 2WL8A 1J8YF 3MX3A 4YJWA 2C03A 2R7SA 2YZSA 3Q6NA 2A6HF 5DVWA 3UMHA 2BE5F 4O6MA 2OCCC 3EGDB 1TWAA 3CZ6A 3EHNA 3KH2A 3X1OA 4AX2A 1D1AA 4IAOA 4XLNF 5D92A 4OD5A 4FESA 1SZIA 5BUOA 4M63A 1VMAA 1BR2A 2M4EA 4WJ0A 2Y3BA 4YT5A 4C7OB 1FMVA 2R7XA 3ABLC 4ANJA 3DZAA 3NYLA 1MNDA 4OD4A 3O6XA 2GFHA 4ZLDA 4U5FE 3B0UX 3LJBA 3WG7C 2Y3GA 1VOMA 3QZCA 2A68F 3OWTA 2VB6A 1TWGA 1M56C 2W45A 2CNWD 3EZIA 3UNGC 2J7PA 3IEEA 3EFOB 2G3KA 4CBEA 3JCUQ 3M1CB 4FX5A 2H7OA 1RJ9B 3O39A 2ZPAA 5T1DB 1OKKA 2R7OA 2J9WA 4XWJA 5KYUA 4QDLA 2LSEA 4E7ZA 5L3VA 2V3CC 5HSWA 3EH1A 4CIHA 1M2OA 3AQBA 2JD3A 3POVA 1OCOC 2PX3A 3DJUB 4IRUA 4JW1A 5DS6A 5KYYB 1OCCC 4A2NB 3ASNC 3RIPA 3DXJF 3I5PA 4QI0A 4C3DA 1N1CA 3LS1A 3UGPA 2WZFA 2R7WA 2WB7A 1S7ZA 2KW3C 3FDQA 1NZEA 4FWVA 3LLKA 4BJTA 3NRHA 3I5QA 1ZHTA 3KMIA 2HV7A 3L34A 3EGXA 3JT1A 3DM9B 1MMNA 2C04A 3DJNB 3B9QA 4YT8A 4OINF 3NG1A 1ST6A 4U5GA 3DD7A 4OIPF 4LLEA 1V55C 2EINC 3UR3C 3RFYA 5KYXB 1O5HA 2J9UA 2PP4A 2NUPB 2EIJC 1V54C 4BJ5C 4HEAJ 1IZMA 2KJGA 1TKNA 1FFHA 1PD1A 4YT4A 3K6BA 2MYSA 2YEVA 4EWCA 3KL4A 2Y3DA 5KYNA 4DVZA 3PHF2 2J0XA 4U5HA 4I44A 4JJGA 2DYRC 3S29A 1Z3IX 1QLEC 1OCZC 1W2WA 2IXOA 4YWQA 1ZYRF 2P7VA 3ECSA 4Q7CA 2R7VA 4J30B 2WVOA 2I8BA 3ABMC 1M2VB 4H4KC 4QI2A 2CNWA 1TWCA 2V26A 1O87A 2H7VC 5L3QA 2WVQA 4F4BA 1ZHYA 2FGYA 1QZXA 4PFOA 2WZGA 3ABKC 1LS1A 4PJLA 1ZU5A 1FMWA 4O6NA 5E2QA 3DAFA 3HJCA 3Q7GA 4MQ9F 4BJ6A 4CS9C 3ZIBA 4DBQA 4AK9A 2Q9BA 1FFTC 3AG4C 1PD0A 3X2QC 3E70C 3MLGA 3EG9B 5IY5C 4U5EE 3H65A 3UGOA 1VK5A 4CS8C 1D1BA 2MWQA 2KQ9A 4GYTA 3SYNA 4AE4A 2WZLA 2Y3HA 1ZHWA 3ASOC 4LACB 2G3VA 3T4RA 3PMRA 3RYLA 2R7TA 5F5HA 2XXAB 4OIQF 2QTVA 1MNEA 1NU7D 5F5FA 4JCHA 2R7UA 3F46A 3LEVA 4MNDA 3ZC4A 5CI8A 3N24A 3K33A 5T3WA 1Z23A 4ZLCA 1D1CA 1MMAA 1OCRC 3K1HA 2CW0F 4YN0B 2XRHA 5EHHA 2DYSC 5B1AC 2PFDA 4KBLA 4RD9A 2CGEA 3L0IA 2VH3A 4O6YA 5CI9A 4Q5SF 3JRTA 2Q9AA 4O79A 3K66A 3AG1C 1M57C 3N2ZB 3QMKA 1FTSA 4I1MA 3WODF 2KNHA 4PFPA 4KC9A 3V7OA 2IXMA 2A6EF 1LVKA 5FCLA 2H7BA 3DMDA 2EILC 2O9XA 3EPVA 3ZG1A 3HTKC 3EGDA 4CSAC 3S27A 1JPNA 2L81A 2J7PD 3FHDA 3OA1A 4GEHA 4E7SA 3ZVRA 4C3EA 1JPJA 3HLZA 2Y69C 3CSKA 2YHSA 3W2VA 3E9VA 4JURI 3VAYA 3LS0A 4YT2A 4G7HF 1OKKD 3LLIA 3FAJA 4C7OA 5KYUB 2Z15A 3LNRA 4K0DA 4HFFB 1G8XA 2IXNA 4O7GA 4PJNA 3S0XA 3LESA 2EIMC 4B6IA 3NDBB 3Q6MA 5B3SC 4JZAA 1ZHXA 4P6IC 1MMGA 2CDQA 3DAGA 4JJFA 4XLPF 4G7ZF 1TWHA 2R7RA 3NYJA 4DBRA 5KYWB 2NUTB 1KU2A 4LLCA 2G62A 3EJNA 4X0RA 2XXAA 4BEJA 1SF8A 3EFOA 2IOQA 4OIRF 1VYKA 4C3BA 3W8HA 3NKEA 1RJ9A 2W9YA 3EGXB 1NG1A 2J9VA 3ZSUA 3AG3C 4LERA 2R7QA 5E3CA 2XL4A 5DS5A 1TR2A 1WGWA 3GODA 4BG0A 4JVSA 1IW7F 3UMIA 5B1BC 3F47A 3W2WA 3EQLF 4CS7A 4Q4ZF 3T6JA 1ZU4A 3NYMA 2W4MA 5KYYA 1Z6AA 4PJMA 3K1IC 3SP1A 1VYIA 1D0XA 3EZHA 4XTKA 2IYLD 4W8KA 3NKDA 4CSAA 2Q3TA 3JSZA 2PX0A 2WVNA 4U5BE 4G0HA 2L9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CS7 A;  4CS9 C;  4C3B A;  4CSA A;  4CS8 C;  4CS9 A;  4C3D A;  4C3E A;  4CS8 A;  4CSA C;  2L9J A; 
#chains in the Genus database with same CATH topology
 1PCX A;  2HV6 A;  4ULW A;  4IWB A;  4BJ1 A;  2OG2 A;  4MVO A;  1Y6D A;  5D91 A;  2J0W A;  2ZXR A;  3IQ6 A;  4IJJ A;  3ZQY A;  1Z63 A;  4BJ5 A;  3W8I A;  4RDA A;  5F5F A;  2L7A A;  1U89 A;  2YLG A;  4RBN A;  4DJ9 A;  3EHM A;  3EH2 A;  3SEO A;  4MVQ A;  2Q9C A;  3C7J A;  1YYJ A;  1L7C A;  1UG7 A;  2KGO A;  2X51 A;  4FAP B;  5KYX A;  4DVY P;  1I5N A;  1J8M F;  2ZXW C;  1D0Y A;  2EIK C;  2E87 A;  3CQZ A;  5JVE A;  1Z5Z A;  1FNT c;  2DI3 A;  2NUP A;  4PJJ A;  3UMH A;  2QY9 A;  2XL6 A;  3K7D A;  4N6C A;  2A1D D;  2NG1 A;  4JTA B;  1ORJ A;  1NU9 C;  3RVZ A;  2J8W A;  3AQC A;  2OU6 A;  4U5C E;  1T5O A;  1CGN A;  1SYQ A;  3ITF A;  4PAC A;  4EIY A;  1XZQ A;  4E17 A;  3QW1 A;  3T6B A;  4J32 B;  2DB4 A;  2FFH A;  2XLW A;  3CEX A;  4WGY A;  2ZXP A;  4I3M A;  2HMZ A;  2LD6 A;  1NFN A;  2XSE A;  4HE8 D;  3RKO F;  3QVZ A;  5L0J A;  3SNH A;  1EA8 A;  1ZHZ A;  1BR1 A;  3A11 A;  1GGQ A;  2I15 A;  2Y39 A;  3IQT A;  4BJ6 C;  3IQC A;  4DRI B;  4OIO F;  2W4B A;  3V5Y A;  3JYY A;  2H8A A;  2P1A A;  5F28 E;  4HFK B;  2CYD A;  3VYW A;  4AE4 B;  4CS9 A;  1RMV A;  3NMI A;  1M2V A;  3W4Y A;  5EGY A;  5KYW A;  2NUT A;  3LEO A;  5AC4 A;  4K7B A;  3MYI A;  3TQO A;  3GEI A;  4NY3 A;  4U9E A;  2YL3 A;  3GAN A;  2P6V A;  3ZDL A;  4EBB A;  5DS4 A;  2ZXO A;  3I4U A;  3B0V C;  2BL2 A;  1BR4 A;  5A69 A;  1TFO B;  4I1O B;  5E3A A;  1YZC A;  2AVK A;  2B0J A;  4L6R A;  3LAY A;  5DQT A;  3SZR A;  1QVX A;  3JYH A;  2J46 A;  2NPU A;  4CS8 A;  2PF4 E;  1LKX A;  1A0B A;  4KNW A;  5DQZ A;  3N0T A;  2L6H A;  5BQG A;  3KKB A;  4N06 A;  1Q0M A;  3Q7L A;  5E33 A;  3C8G B;  2BC5 A;  4KNV A;  3RQE A;  3C8Z A;  4XPY A;  3EG9 A;  2A69 F;  1D0Z A;  2GDC A;  2XM0 A;  3M79 A;  3TD7 A;  5T3T A;  3B0P A;  1A7D A;  2IM8 A;  3OEO A;  3SXZ A;  1WAT A;  5DLJ A;  3M4B A;  3RH3 A;  4D4X A;  4KI2 A;  1MMD A;  2D5R B;  4G7O F;  3S28 A;  5L0H A;  4PK4 A;  4CIP A;  3H2V A;  3AG2 C;  2J45 A;  2VAS A;  3US6 A;  3VRC A;  3FVY A;  1HY5 A;  3DM5 A;  1WAS A;  2IXP A;  1CPR A;  4U5D E;  4U9D A;  4DOZ A;  3UMK A;  2EPN A;  2DGJ A;  1SMY F;  2B0H A;  2J9B A;  2WL8 A;  1R4T A;  1J8Y F;  3MX3 A;  5AGF A;  5JT4 A;  4YJW A;  2C03 A;  1NBB A;  1ZVZ A;  2R7S A;  2YZS A;  3KYI A;  4ER9 A;  4JTC B;  4AL1 A;  3Q6N A;  2LP4 A;  2A6H F;  2HSQ A;  4EBJ A;  4MVS A;  2X0C A;  4YK5 A;  4G78 A;  1VLT A;  2CCY A;  2BE5 F;  1EI7 A;  4MTF A;  4O6M A;  2HUJ A;  2OCC C;  3EGD B;  2LFD A;  1Z7Q c;  2YL7 A;  1TWA A;  1Q0G A;  3CZ6 A;  3EHN A;  2GA0 A;  4NQF A;  3KH2 A;  3C63 A;  1HMO A;  3X1O A;  4AX2 A;  1D1A A;  2NSF A;  3JZ0 A;  4IAO A;  1AUE A;  5A6J A;  4XLN F;  4JEA A;  5D92 A;  1Q0D A;  4OD5 A;  4FES A;  1OXK A;  1SZI A;  3WHN A;  3SXY A;  5BUO A;  4M63 A;  1VMA A;  3B29 A;  4MS2 A;  1C02 A;  1BR2 A;  2KK1 A;  3FXH A;  1M6T A;  2M4E A;  2Y3B A;  4WJ0 A;  4YT5 A;  4CDA A;  4C7O B;  1FMV A;  2R7X A;  3ABL C;  1OW8 A;  3HNK A;  5COM A;  1U6H A;  3CAX A;  4ANJ A;  1FR0 A;  3DZA A;  1JMW A;  3NYL A;  1MND A;  1T9K A;  1H9T A;  4OD4 A;  3O6X A;  2GFH A;  2VC9 A;  4YL1 A;  4XEV A;  4ZLD A;  4U5F E;  3B0U X;  3LJB A;  3WG7 C;  2Y3G A;  1VOM A;  4EBK A;  2HFI A;  3QZC A;  2OEX A;  2P61 A;  3AJM A;  2YVK A;  2A68 F;  1KTM A;  3OWT A;  3ATP A;  2VB6 A;  3L8I A;  4K1O A;  1TWG A;  3L1M A;  1M56 C;  2W45 A;  2CNW D;  4CDV A;  4XEF A;  3BEH A;  3EZI A;  3UNG C;  3O55 A;  2J7P A;  4JIO A;  4YL3 A;  3IEE A;  3EFO B;  2G3K A;  4CBE A;  3FOP A;  3BRJ A;  3JCU Q;  3M1C B;  4FX5 A;  5BQI A;  5JS5 A;  5L0C A;  3GWN A;  4MW3 A;  3JTL O;  4WAB A;  2H7O A;  1RJ9 B;  1C17 M;  1SR2 A;  1NFO A;  2YL0 A;  3O39 A;  1VTM P;  3GOR A;  5A6K A;  1YVI A;  2EPL X;  2ZPA A;  3U3F A;  5T1D B;  3U8P A;  1OKK A;  2R7O A;  2J9W A;  4XWJ A;  5KYU A;  1QQ3 A;  1OW7 A;  4QDL A;  2LSE A;  3RVY A;  4E7Z A;  5L3V A;  2V3C C;  2M64 A;  1LI5 A;  5HSW A;  3EH1 A;  4CIH A;  1M2O A;  3AQB A;  2JD3 A;  3POV A;  2HJ3 A;  3U3B A;  1V74 B;  1LS4 A;  1H7I A;  2KYH A;  1JAF A;  1HE1 A;  1C03 A;  1I4Y A;  1OCO C;  2PX3 A;  3U5S A;  5L0G A;  3DJU B;  4IRU A;  3R7C A;  2QNL A;  4DRH B;  4Z9I A;  5EK0 A;  4DXW A;  3C18 A;  4JW1 A;  3DE9 A;  5TJ5 E;  1QSP A;  5DS6 A;  5KYY B;  1OCC C;  4A2N B;  3ASN C;  3RIP A;  1Q0K A;  3DXJ F;  1ORY A;  5DVW A;  4DRJ B;  3U9J A;  3I5P A;  3U2L A;  4QI0 A;  1AVO B;  4C3D A;  2XM4 A;  1E84 A;  3ZTZ A;  3DE8 A;  4MW8 A;  1N1C A;  3LS1 A;  4ONS A;  4P9F A;  3UGP A;  2WZF A;  3GM2 A;  2R7W A;  2WB7 A;  1S7Z A;  1A7V A;  2KW3 C;  4EKW A;  3FDQ A;  1NZE A;  4FWV A;  3LLK A;  4BJT A;  3NRH A;  2OJE D;  4NTB A;  3I5Q A;  5FZT A;  1ZHT A;  3KMI A;  3HNJ A;  2HV7 A;  3L34 A;  2EPO A;  3EGX A;  3JT1 A;  3DM9 B;  1A41 A;  4PR9 A;  1MMN A;  2C04 A;  4LDK A;  5K0I A;  3DJN B;  3TK0 A;  3IPM O;  2HKV A;  3B9Q A;  3K1I A;  4OIN F;  1OQC A;  4YT8 A;  3L8J A;  1ST6 A;  1LI7 A;  3NG1 A;  4J7Y A;  4U5G A;  4CJO A;  2LQG A;  3DD7 A;  3TOL A;  4OIP F;  1CGO A;  3C8G D;  3JRM O;  1V55 C;  2EIN C;  4LLE A;  3UR3 C;  1KNY A;  1ORS C;  3RFY A;  3ZTM A;  5KYX B;  1O5H A;  2VCA A;  2J9U A;  4XQ1 A;  2L9J A;  2XLO A;  2PP4 A;  2NUP B;  1E2X A;  2EIJ C;  4IAQ A;  1V54 C;  3SXK A;  4BJ5 C;  4HEA J;  1IZM A;  2OEV A;  5JP7 A;  3AOU A;  2RSE B;  2YWA A;  2ZD9 A;  3U8V A;  2KJG A;  1TKN A;  1FFH A;  2MHR A;  1E85 A;  3AGT A;  3V5Z A;  4IB4 A;  4MVR A;  1PD1 A;  4NCQ A;  4YT4 A;  3B71 A;  3K6B A;  3FOO A;  3GEE A;  3M4C A;  1YLM A;  2MYS A;  1AEP A;  2YEV A;  2Y3D A;  1RKE A;  3KL4 A;  3IHU A;  3VM6 A;  4DVZ A;  5KYN A;  5L0F A;  4XPX A;  2J0X A;  4EWC A;  4U5H A;  2XS8 A;  1DOW A;  4I44 A;  3QTH A;  4JJG A;  2R05 A;  2DYR C;  3S29 A;  2YLI A;  2VCB A;  3RQG A;  1Z3I X;  1QLE C;  1OCZ C;  1W2W A;  2ASR A;  2IXO A;  4YWQ A;  1ZYR F;  2P7V A;  3ECS A;  4Q7C A;  2R7V A;  4J30 B;  3RQF A;  4AL0 A;  1BBH A;  1MQV A;  2I8B A;  2WVO A;  2XLM A;  4MTG A;  3U2M A;  3ABM C;  1M2V B;  3QVY A;  4H4K C;  2CNW A;  4QI2 A;  1TWC A;  5CIV A;  2V26 A;  1O87 A;  2H7V C;  5L3Q A;  1T6I A;  2WVQ A;  1YYX A;  4F4B A;  4CDY A;  1ZHY A;  1E86 A;  2FGY A;  1QZX A;  2HMQ A;  2XLD A;  2FAP B;  3HKK A;  3ZQV A;  5JRA A;  2XLH A;  4PFO A;  3J06 A;  2WZG A;  2YL1 A;  3ABK C;  1OR3 A;  1LS1 A;  4PJL A;  1ZU5 A;  2ETS A;  3FMS A;  1FMW A;  4O6N A;  3PDM P;  1TQG A;  1JOG A;  1ZW3 A;  3DAF A;  3HJC A;  3Q7G A;  4MQ9 F;  5E2Q A;  3MYF A;  4BJ6 A;  4CS9 C;  3ZIB A;  3DWW A;  4DBQ A;  2XL8 A;  4WGZ A;  4AK9 A;  1BDJ B;  1YJG A;  1LIH A;  2Q9B A;  1YZA A;  1FFT C;  5L0I A;  1H9G A;  1PD0 A;  1Q0F A;  3AG4 C;  3X2Q C;  3E70 C;  1RCP A;  3MLG A;  3EG9 B;  5HV9 A;  5IY5 C;  4U5E E;  3H65 A;  3VF0 A;  3U9M A;  4Z9J A;  1WN0 A;  4H54 A;  4JRZ A;  3TUL A;  5A6B D;  2LIG A;  4MVM A;  4EHP A;  3UGO A;  1VK5 A;  3G50 A;  4CS8 C;  2RD9 A;  1I4Z A;  1D1B A;  2MWQ A;  1OW6 A;  2KQ9 A;  4GYT A;  1YAR O;  3SYN A;  1A7E A;  1WOL A;  4AE4 A;  2WZL A;  2Y3H A;  1ZHW A;  3ASO C;  4LAC B;  1QPU A;  2G3V A;  3T4R A;  1V4A A;  3GM1 A;  2QUP A;  3GEH A;  3MBG A;  3PMR A;  3RYL A;  5F5H A;  2PBE A;  3JSE O;  2R7T A;  2XXA B;  1OXB A;  4OIQ F;  2QTV A;  3M15 A;  2TMV P;  1HMD A;  1MNE A;  1NU7 D;  3HNI A;  4JCH A;  3TJ6 A;  2UUI A;  4CX9 A;  2R7U A;  2OQM A;  3F46 A;  3LEV A;  4MND A;  5L0D A;  1HW2 A;  1U0B B;  3ZC4 A;  5CI8 A;  3N24 A;  2YLD A;  1YA7 O;  3K33 A;  5T3W A;  1Z23 A;  3T6G B;  4ZLC A;  1K04 A;  2HZ8 A;  1D1C A;  1MMA A;  2P0N A;  3H2U A;  5AC5 A;  2EPM X;  1OCR C;  2AWY A;  4JTD B;  4NTA A;  2Q4F A;  2OKU A;  3K1H A;  1CPQ A;  2CW0 F;  2XRH A;  4YN0 B;  3S9O A;  3TJ5 A;  1F1M A;  3C8G A;  2DYS C;  5EHH A;  5B1A C;  1PV3 A;  2PFD A;  3C62 A;  1GM5 A;  4KBL A;  5JLI A;  4RD9 A;  2CGE A;  2Q00 A;  1Y4C A;  2R02 A;  3G4Z A;  2VH3 A;  3L0I A;  1K40 A;  4J7T A;  3JRT A;  2Q9A A;  4O6Y A;  5CI9 A;  4UDV A;  4Q5S F;  3MFN A;  3K66 A;  4O79 A;  3LNM B;  4JEB A;  4MVU A;  2KSF A;  4JC7 A;  3AG1 C;  4Z9H A;  2LCH A;  2EPK X;  1OR2 A;  2Q7R A;  1HE9 A;  1LE2 A;  1M57 C;  3N2Z B;  3QMK A;  1S05 A;  4P9T A;  1FTS A;  4I1M A;  4ULV A;  3IQ5 A;  4MTO A;  3WOD F;  1NSG B;  4E0H A;  2KNH A;  1WWP A;  4PFP A;  2JPU A;  1YAU O;  1T6Q A;  1G5Z A;  4KC9 A;  5JUA A;  1O3U A;  4R32 A;  3V7O A;  1GQA A;  2IXM A;  1G4U S;  2A6E F;  2L6G A;  1LVK A;  2YKZ A;  4GQH A;  5FCL A;  2L6F A;  2H7B A;  3DMD A;  2EIL C;  2O9X A;  2IBF A;  2YQY A;  3EPV A;  3ZG1 A;  3HTK C;  4BEM J;  3EGD A;  2OJQ A;  4CSA C;  3S27 A;  1JPN A;  2L81 A;  1T01 A;  2UUH A;  2A0U A;  2J7P D;  3FHD A;  3OA1 A;  4GEH A;  4E7S A;  3ZVR A;  4C3E A;  1JPJ A;  1LM3 B;  3FAP B;  3HLZ A;  2Y69 C;  1VB5 A;  2YHS A;  3CSK A;  3R2P A;  3W2V A;  2XLE A;  3WAQ A;  1NLX A;  3E9V A;  3PCV A;  4JUR I;  256B A;  5COG A;  3VAY A;  3LS0 A;  4BPM A;  1WTY A;  4YT2 A;  1E83 A;  4G7H F;  2PNO A;  4E18 A;  3QW0 A;  1HW1 A;  1OKK D;  3LLI A;  2AP3 A;  3FAJ A;  4CJG A;  4E0I A;  5A6B A;  4C7O A;  3U0C A;  2VCC A;  1LE4 A;  3DI5 A;  5KYU B;  2Z15 A;  2YRF A;  3LNR A;  4K0D A;  2HS5 A;  3S84 A;  2A0B A;  1UFB A;  2QE9 A;  4XEK A;  3DKA A;  1JR8 A;  3LUT B;  4HFF B;  5JSL A;  3NMK A;  3T9O A;  1G8X A;  3V5X A;  2IXN A;  1QKR A;  4O7G A;  4PJN A;  3GWL A;  3S0X A;  2QLA A;  3LES A;  1RXQ A;  2EIM C;  4B6I A;  3NDB B;  3Q6M A;  5B3S C;  4JZA A;  5BQH A;  3RF3 A;  1ZHX A;  2NSG A;  4P6I C;  1MMG A;  3G4X A;  2CDQ A;  1VLS A;  3DAG A;  2XLV A;  4JJF A;  4XLP F;  4D4N A;  4G7Z F;  1TWH A;  2R7R A;  2ICW G;  4EUK B;  2LK4 A;  3NYJ A;  2GWW A;  4IGG A;  1K05 A;  2NUT B;  4MVZ A;  4DBR A;  1KU2 A;  4LLC A;  2G62 A;  3EJN A;  5KYW B;  5A6A A;  1R5I D;  4X0R A;  2XXA A;  4BEJ A;  1SF8 A;  1B68 A;  3EFO A;  5COF A;  2IOQ A;  4N4W A;  2R9R B;  1YA9 A;  4OIR F;  1VYK A;  4C3B A;  3O10 A;  1G4W R;  3W8H A;  4JKV A;  3NKE A;  1GS9 A;  1RJ9 A;  3PHF 2;  1LPE A;  2W9Y A;  1FAP B;  3EGX B;  1NG1 A;  2J9V A;  3ZSU A;  3AG3 C;  2AWC A;  4N6H A;  4LER A;  2R7Q A;  4NC3 A;  3AGU A;  2D4U A;  3A9C A;  5E3C A;  1CGM E;  2XL4 A;  1EQ1 A;  5DS5 A;  1TR2 A;  1RKC A;  4NTF A;  4YL0 A;  1WGW A;  3NMJ A;  3GOD A;  4BG0 A;  3SXM A;  4JVS A;  1YDI A;  1IW7 F;  3UMI A;  5B1B C;  3F47 A;  3W2W A;  1DOV A;  4JCZ A;  2XS1 A;  3KPH A;  3EQL F;  1BZ4 A;  4A4A A;  2AU5 A;  4CS7 A;  4IAR A;  3T6J A;  1XWJ A;  1ZU4 A;  3NYM A;  4Q4Z F;  1JRA A;  3S90 A;  4W8P A;  2W4M A;  4JE9 A;  4LDQ A;  3ZWI A;  5GPG B;  3TOM A;  3RW0 A;  5KYY A;  1Z6A A;  4LDR A;  2JX0 A;  3HNL A;  3K1I C;  1T6U A;  1TFK B;  4PJM A;  3SP1 A;  1VYI A;  1D0X A;  3EZH A;  3KYJ A;  2R25 A;  2F22 A;  3GM3 A;  1APC A;  4XPW A;  5B3I A;  4XTK A;  1L3P A;  2IYL D;  1XZP A;  2HSB A;  3NKD A;  4W8K A;  1ZZP A;  2OOC A;  4CSA A;  1RKE B;  1EKY A;  2Q3T A;  3JSZ A;  1ZW2 A;  2KC3 A;  2PX0 A;  2GAQ A;  2LFF A;  2R03 A;  2WVN A;  4U5B E;  2HJM A;  4G0H A;  1H6G A; 
#chains in the Genus database with same CATH homology
 1PCX A;  2HV6 A;  4ULW A;  4IWB A;  4BJ1 A;  2OG2 A;  5D91 A;  2J0W A;  2ZXR A;  4IJJ A;  1Z63 A;  4BJ5 A;  3W8I A;  4RDA A;  4RBN A;  3EHM A;  3EH2 A;  3SEO A;  2Q9C A;  2KGO A;  2X51 A;  5KYX A;  4DVY P;  1J8M F;  2ZXW C;  1D0Y A;  2EIK C;  2E87 A;  3CQZ A;  1Z5Z A;  4PJJ A;  2NUP A;  2QY9 A;  3K7D A;  2A1D D;  2NG1 A;  1NU9 C;  3AQC A;  4U5C E;  3ITF A;  3T6B A;  4J32 B;  2FFH A;  2ZXP A;  4I3M A;  2XSE A;  4HE8 D;  3RKO F;  3SNH A;  1ZHZ A;  1BR1 A;  2Y39 A;  4BJ6 C;  4OIO F;  2W4B A;  4AE4 B;  4HFK B;  3VYW A;  4CS9 A;  1M2V A;  5EGY A;  5KYW A;  2NUT A;  4K7B A;  4NY3 A;  3GAN A;  2P6V A;  4EBB A;  3B0V C;  5DS4 A;  2ZXO A;  3I4U A;  1BR4 A;  4I1O B;  5E3A A;  2B0J A;  3LAY A;  5DQT A;  3SZR A;  3JYH A;  2J46 A;  4CS8 A;  2PF4 E;  1LKX A;  4KNW A;  5DQZ A;  3N0T A;  3KKB A;  4N06 A;  3Q7L A;  5E33 A;  4KNV A;  3EG9 A;  2A69 F;  1D0Z A;  3TD7 A;  5T3T A;  3B0P A;  3OEO A;  4KI2 A;  5DLJ A;  3RH3 A;  1MMD A;  2D5R B;  4G7O F;  3S28 A;  4PK4 A;  3AG2 C;  2J45 A;  2VAS A;  3FVY A;  3DM5 A;  2IXP A;  4U5D E;  4DOZ A;  3UMK A;  2DGJ A;  1SMY F;  2WL8 A;  1J8Y F;  3MX3 A;  4YJW A;  2C03 A;  2R7S A;  2YZS A;  3Q6N A;  2A6H F;  5DVW A;  3UMH A;  2BE5 F;  4O6M A;  2OCC C;  3EGD B;  1TWA A;  3CZ6 A;  3EHN A;  3KH2 A;  3X1O A;  4AX2 A;  1D1A A;  4IAO A;  4XLN F;  5D92 A;  4OD5 A;  4FES A;  1SZI A;  5BUO A;  4M63 A;  1VMA A;  1BR2 A;  2M4E A;  4WJ0 A;  2Y3B A;  4YT5 A;  4C7O B;  1FMV A;  2R7X A;  3ABL C;  4ANJ A;  3DZA A;  3NYL A;  1MND A;  4OD4 A;  3O6X A;  2GFH A;  4ZLD A;  4U5F E;  3B0U X;  3LJB A;  3WG7 C;  2Y3G A;  1VOM A;  3QZC A;  2A68 F;  3OWT A;  2VB6 A;  1TWG A;  1M56 C;  2W45 A;  2CNW D;  3EZI A;  3UNG C;  2J7P A;  3IEE A;  3EFO B;  2G3K A;  4CBE A;  3JCU Q;  3M1C B;  4FX5 A;  2H7O A;  1RJ9 B;  3O39 A;  2ZPA A;  5T1D B;  1OKK A;  2R7O A;  2J9W A;  4XWJ A;  5KYU A;  4QDL A;  2LSE A;  4E7Z A;  5L3V A;  2V3C C;  5HSW A;  3EH1 A;  4CIH A;  1M2O A;  3AQB A;  2JD3 A;  3POV A;  1OCO C;  2PX3 A;  3DJU B;  4IRU A;  4JW1 A;  5DS6 A;  5KYY B;  1OCC C;  4A2N B;  3ASN C;  3RIP A;  3DXJ F;  3I5P A;  4QI0 A;  4C3D A;  1N1C A;  3LS1 A;  3UGP A;  2WZF A;  2R7W A;  2WB7 A;  1S7Z A;  2KW3 C;  3FDQ A;  1NZE A;  4FWV A;  3LLK A;  4BJT A;  3NRH A;  3I5Q A;  1ZHT A;  3KMI A;  2HV7 A;  3L34 A;  3EGX A;  3JT1 A;  3DM9 B;  1MMN A;  2C04 A;  3DJN B;  3B9Q A;  4YT8 A;  4OIN F;  3NG1 A;  1ST6 A;  4U5G A;  3DD7 A;  4OIP F;  4LLE A;  1V55 C;  2EIN C;  3UR3 C;  3RFY A;  5KYX B;  1O5H A;  2J9U A;  2PP4 A;  2NUP B;  2EIJ C;  1V54 C;  4BJ5 C;  4HEA J;  1IZM A;  2KJG A;  1TKN A;  1FFH A;  1PD1 A;  4YT4 A;  3K6B A;  2MYS A;  2YEV A;  4EWC A;  3KL4 A;  2Y3D A;  5KYN A;  4DVZ A;  3PHF 2;  2J0X A;  4U5H A;  4I44 A;  4JJG A;  2DYR C;  3S29 A;  1Z3I X;  1QLE C;  1OCZ C;  1W2W A;  2IXO A;  4YWQ A;  1ZYR F;  2P7V A;  3ECS A;  4Q7C A;  2R7V A;  4J30 B;  2WVO A;  2I8B A;  3ABM C;  1M2V B;  4H4K C;  4QI2 A;  2CNW A;  1TWC A;  2V26 A;  1O87 A;  2H7V C;  5L3Q A;  2WVQ A;  4F4B A;  1ZHY A;  2FGY A;  1QZX A;  4PFO A;  2WZG A;  3ABK C;  1LS1 A;  4PJL A;  1ZU5 A;  1FMW A;  4O6N A;  5E2Q A;  3DAF A;  3HJC A;  3Q7G A;  4MQ9 F;  4BJ6 A;  4CS9 C;  3ZIB A;  4DBQ A;  4AK9 A;  2Q9B A;  1FFT C;  3AG4 C;  1PD0 A;  3X2Q C;  3E70 C;  3MLG A;  3EG9 B;  5IY5 C;  4U5E E;  3H65 A;  3UGO A;  1VK5 A;  4CS8 C;  1D1B A;  2MWQ A;  2KQ9 A;  4GYT A;  3SYN A;  4AE4 A;  2WZL A;  2Y3H A;  1ZHW A;  3ASO C;  4LAC B;  2G3V A;  3T4R A;  3PMR A;  3RYL A;  2R7T A;  5F5H A;  2XXA B;  4OIQ F;  2QTV A;  1MNE A;  1NU7 D;  5F5F A;  4JCH A;  2R7U A;  3F46 A;  3LEV A;  4MND A;  3ZC4 A;  5CI8 A;  3N24 A;  3K33 A;  5T3W A;  1Z23 A;  4ZLC A;  1D1C A;  1MMA A;  1OCR C;  3K1H A;  2CW0 F;  4YN0 B;  2XRH A;  5EHH A;  2DYS C;  5B1A C;  2PFD A;  4KBL A;  4RD9 A;  2CGE A;  3L0I A;  2VH3 A;  4O6Y A;  5CI9 A;  4Q5S F;  3JRT A;  2Q9A A;  4O79 A;  3K66 A;  3AG1 C;  1M57 C;  3N2Z B;  3QMK A;  1FTS A;  4I1M A;  3WOD F;  2KNH A;  4PFP A;  4KC9 A;  3V7O A;  2IXM A;  2A6E F;  1LVK A;  5FCL A;  2H7B A;  3DMD A;  2EIL C;  2O9X A;  3EPV A;  3ZG1 A;  3HTK C;  3EGD A;  4CSA C;  3S27 A;  1JPN A;  2L81 A;  2J7P D;  3FHD A;  3OA1 A;  4GEH A;  4E7S A;  3ZVR A;  4C3E A;  1JPJ A;  3HLZ A;  2Y69 C;  3CSK A;  2YHS A;  3W2V A;  3E9V A;  4JUR I;  3VAY A;  3LS0 A;  4YT2 A;  4G7H F;  1OKK D;  3LLI A;  3FAJ A;  4C7O A;  5KYU B;  2Z15 A;  3LNR A;  4K0D A;  4HFF B;  1G8X A;  2IXN A;  4O7G A;  4PJN A;  3S0X A;  3LES A;  2EIM C;  4B6I A;  3NDB B;  3Q6M A;  5B3S C;  4JZA A;  1ZHX A;  4P6I C;  1MMG A;  2CDQ A;  3DAG A;  4JJF A;  4XLP F;  4G7Z F;  1TWH A;  2R7R A;  3NYJ A;  4DBR A;  5KYW B;  2NUT B;  1KU2 A;  4LLC A;  2G62 A;  3EJN A;  4X0R A;  2XXA A;  4BEJ A;  1SF8 A;  3EFO A;  2IOQ A;  4OIR F;  1VYK A;  4C3B A;  3W8H A;  3NKE A;  1RJ9 A;  2W9Y A;  3EGX B;  1NG1 A;  2J9V A;  3ZSU A;  3AG3 C;  4LER A;  2R7Q A;  5E3C A;  2XL4 A;  5DS5 A;  1TR2 A;  1WGW A;  3GOD A;  4BG0 A;  4JVS A;  1IW7 F;  3UMI A;  5B1B C;  3F47 A;  3W2W A;  3EQL F;  4CS7 A;  4Q4Z F;  3T6J A;  1ZU4 A;  3NYM A;  2W4M A;  5KYY A;  1Z6A A;  4PJM A;  3K1I C;  3SP1 A;  1VYI A;  1D0X A;  3EZH A;  4XTK A;  2IYL D;  4W8K A;  3NKD A;  4CSA A;  2Q3T A;  3JSZ A;  2PX0 A;  2WVN A;  4U5B E;  4G0H A;  2L9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...