4C3BA

Hrsv m2-1, p21 crystal form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
178
structure length
165
Chain Sequence
PLGSMSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDELDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Essential Transcription Antiterminator M2-1 Protein of Human Respiratory Syncytial Virus and Implications of its Phosphorylation.
pubmed doi rcsb
source organism Human respiratory syncytial virus
molecule tags Viral protein
molecule keywords MATRIX PROTEIN 2-1
total genus 56
structure length 165
sequence length 178
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06436 Pneumovirus_M2 Pneumovirus matrix protein 2 (M2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4c3bA00
4CS9A 4C3BA 4CS7A 4CS9C 2L9JA 4CSAA 4C3DA 4CS8C 4CS8A 4CSAC 4C3EA
chains in the Genus database with same CATH superfamily
4CX9A 1TWAA 1RCPA 1ZU4A 3C8GB 4LLCA 3W8IA 3MX3A 1E83A 3GODA 1R4TA 5T3TA 4JJFA 4WGZA 4BG0A 2EINC 3HJCA 4BEJA 3RF3A 4NTAA 4Q7CA 3X1OA 1OW6A 1UG7A 2GDCA 2HMZA 3EG9B 3F46A 1OQCA 2PBEA 2LSEA 3US6A 1H9TA 3LS1A 4BJ1A 2YWAA 5B3IA 3C63A 4HFKB 1LS4A 4C3BA 1ZW3A 3J06A 1Q0DA 1VOMA 1E85A 4EIYA 2P6VA 3C8GA 4NTBA 2R05A 2KK1A 1S7ZA 3O6XA 4X0RA 4ER9A 2VCAA 4XEKA 4DVYP 4U5EE 1Z6AA 2J9VA 3NKEA 5L0JA 3RQGA 3FDQA 2YZSA 2PP4A 1A7DA 1MMDA 1YVIA 1TWCA 2IBFA 1ST6A 3DJUB 5GPGB 1A7EA 4LERA 5AC4A 4J7TA 3G50A 4JJGA 5CI8A 3ZC4A 4YL1A 3JYHA 2I8BA 1OR3A 1YYXA 2J0WA 4KC9A 1FTSA 1I5NA 4G0HA 2HSBA 4CJGA 4DRJB 1SYQA 2XLOA 2EIKC 4DBRA 5EGYA 1D0XA 2PX0A 1LPEA 3KL4A 1W2WA 1OCOC 1YDIA 2FGYA 3FMSA 3A11A 4CS7A 1LE4A 2G3VA 3LESA 3FVYA 1D0ZA 4DXWA 3SXMA 2YL0A 4N6HA 2NG1A 2PFDA 1D1AA 5DS6A 3RIPA 1QZXA 4O6NA 3U8VA 3JSZA 4WABA 4IRUA 1M2OA 3JZ0A 3CZ6A 2DGJA 1Z5ZA 2YL7A 3PDMP 3GM3A 3K7DA 4GYTA 2L6GA 4PR9A 3JCUQ 4XPXA 5F5HA 3ZQVA 5KYWB 2GA0A 4PK4A 4BJ5C 1C17M 4KI2A 3GEHA 2R7UA 1APCA 1OCZC 3ZTZA 3DWWA 2EPOA 2EIMC 1HE1A 1GQAA 1MMNA 2KNHA 2XL6A 3HNIA 4MVUA 5E33A 3T6JA 4EBBA 3NYLA 5KYUB 4W8PA 2UUHA 1BR2A 2P1AA 5E3AA 4EBKA 1I4ZA 1ZVZA 3U5SA 2OEXA 3JRTA 4FX5A 2NUTA 2CCYA 4O6YA 4P6IC 4HEAJ 1H6GA 3TJ5A 2XSEA 3M1CB 5JUAA 2PF4E 2NUPA 4KNVA 4OD5A 1Z63A 1JPJA 1WASA 1Q0MA 3DE8A 2A0UA 1BR4A 1VLTA 1VYKA 1MMGA 3LAYA 3U3BA 1ZYRF 1XZPA 2LFDA 3AG4C 3H2UA 4ANJA 1U89A 4RDAA 2J7PA 1T5OA 3G4ZA 1QQ3A 2L9JA 5DS5A 5COGA 1U6HA 4K7BA 5EHHA 1TFOB 1L7CA 1PV3A 2XS8A 2F22A 2HJMA 2WVNA 1Z23A 5K0IA 1IW7F 1SMYF 4MTGA 5A69A 2A69F 4XLPF 3Q7LA 2AVKA 2FFHA 1KTMA 1RMVA 3JYYA 3HNLA 1YYJA 2LQGA 3DD7A 3NYJA 3ABMC 4G7ZF 4DRIB 2KSFA 2JPUA 3N2ZB 4YT8A 4Q4ZF 4U9EA 2YKZA 2RSEB 3B0PA 1EQ1A 2Y3GA 3T6BA 1K04A 1T01A 2ASRA 4C7OB 1KNYA 2HUJA 2Q4FA 4XTKA 5KYNA 2OEVA 2NPUA 4OIPF 3M15A 5A6AA 1EKYA 4XEFA 1JAFA 5BQIA 4YJWA 4YL3A 3S28A 2JD3A 3V5XA 1J8YF 5L3VA 2YL1A 3DAFA 1U0BB 3SXKA 2PNOA 2OKUA 3BEHA 3HTKC 4MVMA 1D0YA 4PJJA 4MVOA 3VM6A 5E3CA 2XL8A 1QSPA 3AGUA 2VC9A 1OCCC 3KYIA 5F28E 1HY5A 2Y39A 3K33A 3HLZA 3DKAA 3ATPA 2XLVA 2EPLX 3LS0A 3ZQYA 2HV6A 2VASA 1NU9C 3H65A 4OIOF 3S9OA 2Z15A 1E2XA 1CGNA 2XLMA 5KYYA 1TR2A 2I15A 2C04A 3RVYA 4L6RA 4HFFB 1OR2A 1RKCA 2Q00A 2ZPAA 3DMDA 1HE9A 1C02A 2KYHA 4U5CE 3SP1A 1YLMA 4JE9A 3DJNB 4XQ1A 4N6CA 2HMQA 4H4KC 4CS8A 4I3MA 3ASNC 5DVWA 3WG7C 3SZRA 2QY9A 1TKNA 1WTYA 1YA9A 3EH1A 4MW3A 4PJLA 1ZHTA 2GFHA 2E87A 3I4UA 3RQEA 3UGOA 4K0DA 4CSAC 4PJNA 5AC5A 3POVA 5FCLA 1J8MF 2XLEA 3ZG1A 4AX2A 1NLXA 1V74B 4CS8C 2YLGA 3C7JA 3DM9B 2IXMA 3EHNA 3K1IA 3QW0A 4DJ9A 3ZDLA 1E86A 4D4XA 4YT4A 1A7VA 3NMJA 5L0CA 1JR8A 1VYIA 4YL0A 3U2MA 2XXAA 1H7IA 3OEOA 2H7VC 4MS2A 3JRMO 5KYUA 2DI3A 2J9BA 4F4BA 2W9YA 2NSGA 5DS4A 5B1BC 4CBEA 4LDQA 1M57C 4P9TA 1ZHXA 4YWQA 3MBGA 1I4YA 3JT1A 4QI2A 3M4CA 2A6HF 2OQMA 2BL2A 5T3WA 3GWLA 2Q9AA 4ONSA 1CGME 4MW8A 1YAUO 4DOZA 1G8XA 4BEMJ 3BRJA 2G3KA 2HS5A 1Y6DA 3QW1A 2Q9CA 3V7OA 3L34A 5B1AC 1ZU5A 2A0BA 3GM1A 3O10A 5COFA 4EWCA 1PD1A 1HW1A 5A6BD 3EHMA 3IPMO 2Q7RA 2B0JA 1MNEA 4PFPA 4G78A 2J45A 2BE5F 3JSEO 3EG9A 2PX3A 2Y3BA 2AWYA 3LLIA 4CDYA 1L3PA 2MYSA 3LJBA 2WL8A 1E84A 4BJ5A 1JMWA 2P61A 4J30B 1OW8A 2Y3HA 3FXHA 2Q9BA 2L7AA 1LM3B 2QNLA 3WODF 1TQGA 4CDAA 4EUKB 2J7PD 2HJ3A 4ULVA 1DOVA 4IAQA 4CIPA 2A68F 1CPRA 5JT4A 5JSLA 2ICWG 4E0HA 4IGGA 3EGXB 3K1HA 4M63A 1EA8A 3B71A 3TOLA 5BQHA 1T9KA 2YRFA 4Z9HA 4P9FA 4DRHB 2YHSA 3AG3C 2OOCA 4U5GA 4MTOA 5D91A 1G5ZA 2L81A 4KBLA 2P7VA 3U2LA 4OD4A 2W45A 3IQTA 5L0IA 1YARO 3GORA 3AQCA 2C03A 2KW3C 3HKKA 1QKRA 2B0HA 4ZLCA 4IAOA 1M2VB 5AGFA 4E0IA 5CI9A 1RKEB 3E70C 4AE4A 1Q0GA 1YZCA 2R25A 3A9CA 4KNWA 4OIRF 2UUIA 3EFOA 3KYJA 4XPYA 4CIHA 2NUTB 2EIJC 3EZIA 2XL4A 3EFOB 2ZXOA 3SEOA 4FAPB 2KQ9A 1T6QA 1S05A 3C62A 3RW0A 4U5FE 3WHNA 3X2QC 4CS9A 2H7OA 2H8AA 1LVKA 1G4US 1QVXA 1T6UA 2VCCA 3EJNA 4RBNA 3SYNA 3V5YA 4JC7A 3RKOF 4AL0A 1G4WR 1M2VA 2L6HA 3IHUA 1MMAA 1XZQA 3AG2C 4JRZA 2V26A 4JKVA 4NTFA 2XXAB 1V4AA 2CNWD 2BC5A 4I1OB 5D92A 3S29A 3L1MA 4FWVA 2WVOA 5L0GA 1FAPB 3LNMB 4AL1A 2LP4A 3KH2A 1BBHA 3W2WA 5DQZA 3T9OA 3UMKA 1ORYA 3N24A 4PACA 2R7RA 4B6IA 1NG1A 3V5ZA 4BPMA 4JEAA 1V54C 2IM8A 3GEIA 3LLKA 3UMIA 1RJ9B 2R7VA 5BQGA 1C03A 3TULA 4A4AA 2R7XA 4MVSA 2ZXWC 1SF8A 4EBJA 1ZZPA 2WZLA 3SXYA 3ZSUA 3LEOA 1JPNA 2OJED 4RD9A 3IQCA 3G4XA 4YN0B 3GEEA 3NDBB 2W4BA 3LUTB 3GANA 2R02A 3KKBA 4A2NB 2V3CC 2IYLD 4XPWA 1SZIA 3QVYA 4MTFA 4CJOA 2H7BA 5BUOA 4XWJA 1GS9A 2IXOA 1OW7A 2D5RB 2IXPA 2EPMX 1O87A 3LNRA 2EILC 4IWBA 4O6MA 5L0FA 5KYYB 3B0VC 2J8WA 3KMIA 2R7QA 4W8KA 4U5DE 3S84A 1NFNA 2IXNA 3MFNA 1NU7D 3CQZA 4NC3A 3AQBA 3NMKA 4JZAA 5HSWA 2X0CA 3B9QA 1R5ID 1WOLA 1Q0KA 2XLDA 2QUPA 4IARA 1WATA 1FNTc 4LLEA 1N1CA 3N0TA 2J9WA 5DQTA 2EPKX 3IQ5A 4U5HA 4U5BE 1PD0A 1Q0FA 1TWHA 2MHRA 3E9VA 3KPHA 4JCZA 2YLDA 1DOWA 1AEPA 3ITFA 4JEBA 1MNDA 4JURI 3VYWA 3S27A 1TFKB 3UMHA 1NBBA 2KC3A 4H54A 2OG2A 4OIQF 2AP3A 1F1MA 4BJ6A 3CAXA 3UNGC 4DBQA 1ZHYA 5HV9A 2YVKA 1O3UA 1XWJA 2ZXRA 1OKKD 2Q3TA 1VB5A 3W2VA 4BJTA 5IY5C 1CGOA 1ORSC 4WGYA 1M6TA 2XM4A 4I1MA 4N4WA 4EHPA 1RKEA 1ZHZA 5JP7A 1WGWA 3IQ6A 3NMIA 1BR1A 3SXZA 4CDVA 2CYDA 3DE9A 4UDVA 2LFFA 1OCRC 3DAGA 5KYXB 4G7OF 1Z7Qc 5FZTA 2R7WA 1UFBA 3UGPA 4MQ9F 4R32A 3I5PA 1A41A 2NSFA 2WVQA 3EGDB 4J32B 2Y3DA 4XLNF 3R7CA 2G62A 5DLJA 3RFYA 3TQOA 2CDQA 3FOOA 4GQHA 5A6JA 1MQVA 1LE2A 3HNJA 2HV7A 4JVSA 3PHF2 2HSQA 4LACB 4IB4A 3R2PA 1WN0A 4LDKA 1LIHA 4QI0A 3AJMA 3VAYA 256BA 1HMOA 3EQLF 2QTVA 5KYXA 1NZEA 4WJ0A 3FAJA 2X51A 1AVOB 3FAPB 5L3QA 1RXQA 1V55C 2QE9A 2XS1A 3M79A 2TMVP 3O39A 3OWTA 3PCVA 5A6BA 2YL3A 3MYIA 3HNKA 1HMDA 3FOPA 1JRAA 5JRAA 2VH3A 1LI5A 2VCBA 3DM5A 3ZVRA 3ECSA 2ZD9A 3C8GD 4DVZA 2QLAA 2EPNA 4AE4B 4C3EA 1HW2A 4XEVA 3UR3C 4MVZA 2M64A 2YLIA 3GM2A 4EKWA 4OINF 3L0IA 2GAQA 2HFIA 3K66A 4D4NA 3TD7A 2L6FA 3U9MA 3NRHA 1NFOA 3ABKC 3Q7GA 3EGDA 1B68A 5L0DA 2OU6A 2YQYA 2XLWA 1YA7O 5L0HA 1OXKA 2R9RB 2CNWA 1FMWA 2XLHA 1YZAA 3FHDA 2CW0F 3RH3A 2GWWA 3T4RA 4MNDA 3AG1C 3K1IC 3W8HA 3MLGA 3B0UX 1FFHA 4YK5A 1GM5A 4JTCB 3TOMA 2LD6A 2W4MA 3NYMA 4J7YA 3U9JA 3ABLC 3O55A 1ORJA 1NSGB 3U0CA 3ZTMA 3QZCA 3DI5A 4PFOA 1Y4CA 3CEXA 2LIGA 2R7OA 3MYFA 2R7TA 3AGTA 4LDRA 2M4EA 4JTDB 4Z9JA 3RQFA 4E7SA 4CS9C 1WWPA 4GEHA 4NQFA 3T6GB 4JW1A 5KYWA 5T1DB 4JTAB 2KGOA 4MVRA 3U3FA 3GWNA 1FR0A 5JVEA 4Q5SF 5COMA 1O5HA 3B29A 1RJ9A 2A1DD 2KJGA 1FMVA 4IJJA 2R03A 3U8PA 1VK5A 2J9UA 2A6EF 5B3SC 3F47A 1LI7A 3JTLO 5EK0A 1LS1A 1BDJB 4O79A 2WZGA 2ZXPA 1AUEA 2ETSA 1ZHWA 3CSKA 2NUPB 4PJMA 3TK0A 3SNHA 4BJ6C 3VRCA 3OA1A 3QTHA 3ZIBA 1VTMP 3DXJF 1H9GA 2CGEA 2RD9A 3QMKA 1CPQA 3I5QA 1EI7A 1OXBA 2WB7A 3S0XA 4NCQA 2FAPB 1QPUA 2AU5A 2JX0A 2Y69C 1BZ4A 2D4UA 3PMRA 4O7GA 2DYRC 1IZMA 2LCHA 2OJQA 3DZAA 2P0NA 5JS5A 2O9XA 4Z9IA 2VB6A 4MVQA 3NG1A 1K05A 2LK4A 3IEEA 2AWCA 3K6BA 4G7HF 2IOQA 1K40A 3QVZA 4JIOA 4FESA 2HKVA 3TJ6A 1JOGA 3EH2A 3NKDA 2J46A 4NY3A 5F5FA 3ASOC 3L8JA 3C8ZA 4YT5A 5TJ5E 5A6KA 4I44A 3ZWIA 3Q6MA 4YT2A 2DYSC 4JCHA 4N06A 5E2QA 1OKKA 3VF0A 3Q6NA 1A0BA 4AK9A 1SR2A 1QLEC 1FFTC 5JLIA 1YJGA 2DB4A 2OCCC 1VMAA 2XM0A 4ULWA 4E17A 4U9DA 4CSAA 1D1CA 1KU2A 1GGQA 3EGXA 3L8IA 3WAQA 4C7OA 1LKXA 3LEVA 2MWQA 2R7SA 2HZ8A 3H2VA 3AOUA 3S90A 4ZLDA 1TWGA 4E18A 1PCXA 2WZFA 3W4YA 2YEVA 1D1BA 3EPVA 4QDLA 3RYLA 4K1OA 1VLSA 3RVZA 4HE8D 4C3DA 2XRHA 3M4BA 1M56C 1T6IA 1ZW2A 2J0XA 3EZHA 1Z3IX 3C18A 4E7ZA 5CIVA
chains in the Genus database with same CATH topology
1TWAA 1ZU4A 4LLCA 3W8IA 3MX3A 3GODA 5T3TA 4JJFA 4BG0A 2EINC 3HJCA 4BEJA 4Q7CA 3X1OA 3F46A 3EG9B 2LSEA 3LS1A 4BJ1A 4HFKB 4C3BA 1VOMA 2P6VA 1S7ZA 3O6XA 4X0RA 4U5EE 1Z6AA 2J9VA 3NKEA 3FDQA 3B0VC 2YZSA 2PP4A 1MMDA 1TWCA 3DJUB 1ST6A 4OIQF 4LERA 4JJGA 5CI8A 3ZC4A 3JYHA 2I8BA 2J0WA 4KC9A 1FTSA 4G0HA 2EIKC 4DBRA 5EGYA 1D0XA 2PX0A 3KL4A 1W2WA 1OCOC 2FGYA 4CS7A 2G3VA 3LESA 3FVYA 1D0ZA 2NG1A 2PFDA 1D1AA 3RIPA 1QZXA 4O6NA 3JSZA 4IRUA 1M2OA 3CZ6A 2DGJA 1Z5ZA 5F5HA 3K7DA 4GYTA 5KYWB 3JCUQ 4PK4A 4BJ5C 2R7UA 1OCZC 1MMNA 2EIMC 2KNHA 5E33A 3T6JA 4EBBA 3NYLA 5KYUB 1BR2A 5E3AA 4FX5A 3JRTA 2NUTA 4O6YA 4P6IC 4HEAJ 2XSEA 3M1CB 2PF4E 2NUPA 4KNVA 4OD5A 1Z63A 1JPJA 1BR4A 1VYKA 1MMGA 3LAYA 1ZYRF 3AG4C 4ANJA 4RDAA 2J7PA 2L9JA 5DS5A 4K7BA 5EHHA 2WVNA 1Z23A 1IW7F 1SMYF 2A69F 4XLPF 3Q7LA 2FFHA 3DD7A 3NYJA 3ABMC 4G7ZF 3N2ZB 4YT8A 4Q4ZF 3B0PA 2Y3GA 3T6BA 4C7OB 4XTKA 5KYNA 4OIPF 4YJWA 3S28A 2JD3A 1J8YF 5L3VA 3DAFA 3HTKC 4PJJA 1D0YA 5E3CA 1OCCC 2Y39A 3K33A 3HLZA 3LS0A 4OIOF 2HV6A 2VASA 1NU9C 3H65A 2Z15A 5KYYA 1TR2A 2C04A 4HFFB 2ZPAA 3DMDA 3SP1A 4U5CE 3DJNB 4H4KC 4CS8A 4I3MA 3ASNC 5DVWA 3WG7C 3SZRA 2QY9A 1TKNA 3EH1A 4PJLA 1ZHTA 2GFHA 2E87A 3I4UA 3UGOA 4K0DA 4CSAC 4PJNA 3POVA 5FCLA 1J8MF 3ZG1A 4AX2A 4CS8C 4QI2A 3EHNA 3DM9B 2R7WA 2IXMA 4YT4A 1VYIA 2XXAA 3OEOA 2H7VC 5KYUA 4F4BA 2W9YA 5DS4A 5B1BC 4CBEA 1M57C 1ZHXA 3JT1A 2A6HF 5T3WA 2Q9AA 4DOZA 1G8XA 2G3KA 2Q9CA 3V7OA 3L34A 5B1AC 1ZU5A 4EWCA 1PD1A 3EHMA 2B0JA 1MNEA 4PFPA 2J45A 2BE5F 3EG9A 2PX3A 2Y3BA 3LLIA 2MYSA 3LJBA 2WL8A 4BJ5A 4J30B 2Y3HA 2Q9BA 3WODF 2J7PD 2A68F 3EGXB 3K1HA 4M63A 2YHSA 3AG3C 4U5GA 5D91A 2L81A 4KBLA 2P7VA 4OD4A 2W45A 3AQCA 2C03A 2KW3C 4ZLCA 4IAOA 1M2VB 5CI9A 3E70C 4AE4A 4KNWA 4OIRF 3EFOA 4CIHA 2NUTB 2EIJC 3EZIA 2XL4A 3EFOB 2ZXOA 3SEOA 2KQ9A 4CS9A 4U5FE 3X2QC 2H7OA 1LVKA 4YWQA 3EJNA 3SYNA 4RBNA 4DVYP 5DS6A 3RKOF 5KYWA 1M2VA 1MMAA 3AG2C 2V26A 2XXAB 2CNWD 4I1OB 5D92A 3S29A 4FWVA 2WVOA 3KH2A 3W2WA 5DQZA 3UMKA 3N24A 2R7RA 4B6IA 1NG1A 1V54C 3LLKA 3UMIA 1RJ9B 2R7VA 2R7XA 2ZXWC 1SF8A 3ZSUA 2WZLA 1JPNA 4RD9A 4YN0B 3NDBB 2W4BA 3GANA 3KKBA 4A2NB 2V3CC 2IYLD 1SZIA 2H7BA 5BUOA 4XWJA 2IXOA 2D5RB 3LNRA 2IXPA 4O6MA 1O87A 4IWBA 2EILC 5KYYB 3KMIA 2R7QA 4W8KA 4U5DE 2IXNA 1NU7D 3CQZA 3AQBA 4JZAA 5HSWA 3B9QA 4LLEA 1N1CA 3N0TA 2J9WA 5DQTA 4U5HA 4U5BE 1PD0A 1TWHA 3E9VA 3ITFA 1MNDA 4JURI 3VYWA 3S27A 3UMHA 2OG2A 4BJ6A 3UNGC 4DBQA 1ZHYA 2ZXRA 1OKKD 2Q3TA 3W2VA 4BJTA 5IY5C 4I1MA 1ZHZA 1WGWA 1BR1A 1OCRC 3DAGA 5KYXB 4G7OF 3UGPA 4MQ9F 3I5PA 2WVQA 4XLNF 4J32B 3EGDB 2Y3DA 2G62A 5DLJA 3RFYA 2CDQA 2HV7A 4JVSA 3PHF2 4LACB 4QI0A 3VAYA 3EQLF 2QTVA 5KYXA 1NZEA 4WJ0A 3FAJA 2X51A 5L3QA 1V55C 3O39A 3OWTA 2VH3A 3DM5A 3ZVRA 3ECSA 4DVZA 4AE4B 4C3EA 3UR3C 4OINF 3L0IA 3K66A 3TD7A 3NRHA 3ABKC 3Q7GA 3EGDA 3FHDA 3RH3A 2CNWA 1FMWA 3T4RA 2CW0F 4MNDA 3AG1C 3K1IC 3W8HA 3MLGA 3B0UX 1FFHA 2W4MA 3NYMA 3ABLC 3QZCA 4PFOA 2R7TA 2R7OA 2M4EA 4E7SA 4CS9C 4GEHA 4JW1A 5T1DB 2KGOA 4Q5SF 1O5HA 1RJ9A 2A1DD 2KJGA 1FMVA 4IJJA 1VK5A 2J9UA 2A6EF 5B3SC 3F47A 1LS1A 4O79A 2WZGA 2ZXPA 1ZHWA 3CSKA 2NUPB 4PJMA 4BJ6C 3SNHA 3OA1A 3ZIBA 3DXJF 2CGEA 3QMKA 3I5QA 3S0XA 2WB7A 2Y69C 3PMRA 4O7GA 2DYRC 1IZMA 3DZAA 2O9XA 4KI2A 2VB6A 3NG1A 4G7HF 3IEEA 3K6BA 2IOQA 4FESA 3NKDA 3EH2A 2J46A 4NY3A 5F5FA 3ASOC 4YT5A 4I44A 3Q6MA 4YT2A 2DYSC 4JCHA 4N06A 5E2QA 1OKKA 3Q6NA 4AK9A 1QLEC 1FFTC 2OCCC 1VMAA 4ULWA 4CSAA 1D1CA 1KU2A 3EGXA 4C7OA 1LKXA 3LEVA 2MWQA 2R7SA 4ZLDA 1TWGA 1PCXA 2WZFA 2YEVA 1D1BA 3EPVA 4QDLA 3RYLA 4HE8D 4C3DA 2XRHA 1M56C 3EZHA 2J0XA 1Z3IX 4E7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CS9 A;  4C3B A;  4CS7 A;  4CS9 C;  2L9J A;  4CSA A;  4C3D A;  4CS8 C;  4CS8 A;  4CSA C;  4C3E A; 
#chains in the Genus database with same CATH topology
 4CX9 A;  1TWA A;  1RCP A;  1ZU4 A;  3C8G B;  4LLC A;  3W8I A;  3MX3 A;  1E83 A;  3GOD A;  1R4T A;  5T3T A;  4JJF A;  4WGZ A;  4BG0 A;  2EIN C;  3HJC A;  4BEJ A;  3RF3 A;  4NTA A;  4Q7C A;  3X1O A;  1OW6 A;  1UG7 A;  2GDC A;  2HMZ A;  3EG9 B;  3F46 A;  1OQC A;  2PBE A;  2LSE A;  3US6 A;  1H9T A;  3LS1 A;  4BJ1 A;  2YWA A;  5B3I A;  3C63 A;  4HFK B;  1LS4 A;  4C3B A;  1ZW3 A;  3J06 A;  1Q0D A;  1VOM A;  1E85 A;  4EIY A;  2P6V A;  3C8G A;  4NTB A;  2R05 A;  2KK1 A;  1S7Z A;  3O6X A;  4X0R A;  4ER9 A;  2VCA A;  4XEK A;  4DVY P;  4U5E E;  1Z6A A;  2J9V A;  3NKE A;  5L0J A;  3RQG A;  3FDQ A;  2YZS A;  2PP4 A;  1A7D A;  1MMD A;  1YVI A;  1TWC A;  2IBF A;  1ST6 A;  3DJU B;  5GPG B;  1A7E A;  4LER A;  5AC4 A;  4J7T A;  3G50 A;  4JJG A;  5CI8 A;  3ZC4 A;  4YL1 A;  3JYH A;  2I8B A;  1OR3 A;  1YYX A;  2J0W A;  4KC9 A;  1FTS A;  1I5N A;  4G0H A;  2HSB A;  4CJG A;  4DRJ B;  1SYQ A;  2XLO A;  2EIK C;  4DBR A;  5EGY A;  1D0X A;  2PX0 A;  1LPE A;  3KL4 A;  1W2W A;  1OCO C;  1YDI A;  2FGY A;  3FMS A;  3A11 A;  4CS7 A;  1LE4 A;  2G3V A;  3LES A;  3FVY A;  1D0Z A;  4DXW A;  3SXM A;  2YL0 A;  4N6H A;  2NG1 A;  2PFD A;  1D1A A;  5DS6 A;  3RIP A;  1QZX A;  4O6N A;  3U8V A;  3JSZ A;  4WAB A;  4IRU A;  1M2O A;  3JZ0 A;  3CZ6 A;  2DGJ A;  1Z5Z A;  2YL7 A;  3PDM P;  3GM3 A;  3K7D A;  4GYT A;  2L6G A;  4PR9 A;  3JCU Q;  4XPX A;  5F5H A;  3ZQV A;  5KYW B;  2GA0 A;  4PK4 A;  4BJ5 C;  1C17 M;  4KI2 A;  3GEH A;  2R7U A;  1APC A;  1OCZ C;  3ZTZ A;  3DWW A;  2EPO A;  2EIM C;  1HE1 A;  1GQA A;  1MMN A;  2KNH A;  2XL6 A;  3HNI A;  4MVU A;  5E33 A;  3T6J A;  4EBB A;  3NYL A;  5KYU B;  4W8P A;  2UUH A;  1BR2 A;  2P1A A;  5E3A A;  4EBK A;  1I4Z A;  1ZVZ A;  3U5S A;  2OEX A;  3JRT A;  4FX5 A;  2NUT A;  2CCY A;  4O6Y A;  4P6I C;  4HEA J;  1H6G A;  3TJ5 A;  2XSE A;  3M1C B;  5JUA A;  2PF4 E;  2NUP A;  4KNV A;  4OD5 A;  1Z63 A;  1JPJ A;  1WAS A;  1Q0M A;  3DE8 A;  2A0U A;  1BR4 A;  1VLT A;  1VYK A;  1MMG A;  3LAY A;  3U3B A;  1ZYR F;  1XZP A;  2LFD A;  3AG4 C;  3H2U A;  4ANJ A;  1U89 A;  4RDA A;  2J7P A;  1T5O A;  3G4Z A;  1QQ3 A;  2L9J A;  5DS5 A;  5COG A;  1U6H A;  4K7B A;  5EHH A;  1TFO B;  1L7C A;  1PV3 A;  2XS8 A;  2F22 A;  2HJM A;  2WVN A;  1Z23 A;  5K0I A;  1IW7 F;  1SMY F;  4MTG A;  5A69 A;  2A69 F;  4XLP F;  3Q7L A;  2AVK A;  2FFH A;  1KTM A;  1RMV A;  3JYY A;  3HNL A;  1YYJ A;  2LQG A;  3DD7 A;  3NYJ A;  3ABM C;  4G7Z F;  4DRI B;  2KSF A;  2JPU A;  3N2Z B;  4YT8 A;  4Q4Z F;  4U9E A;  2YKZ A;  2RSE B;  3B0P A;  1EQ1 A;  2Y3G A;  3T6B A;  1K04 A;  1T01 A;  2ASR A;  4C7O B;  1KNY A;  2HUJ A;  2Q4F A;  4XTK A;  5KYN A;  2OEV A;  2NPU A;  4OIP F;  3M15 A;  5A6A A;  1EKY A;  4XEF A;  1JAF A;  5BQI A;  4YJW A;  4YL3 A;  3S28 A;  2JD3 A;  3V5X A;  1J8Y F;  5L3V A;  2YL1 A;  3DAF A;  1U0B B;  3SXK A;  2PNO A;  2OKU A;  3BEH A;  3HTK C;  4MVM A;  1D0Y A;  4PJJ A;  4MVO A;  3VM6 A;  5E3C A;  2XL8 A;  1QSP A;  3AGU A;  2VC9 A;  1OCC C;  3KYI A;  5F28 E;  1HY5 A;  2Y39 A;  3K33 A;  3HLZ A;  3DKA A;  3ATP A;  2XLV A;  2EPL X;  3LS0 A;  3ZQY A;  2HV6 A;  2VAS A;  1NU9 C;  3H65 A;  4OIO F;  3S9O A;  2Z15 A;  1E2X A;  1CGN A;  2XLM A;  5KYY A;  1TR2 A;  2I15 A;  2C04 A;  3RVY A;  4L6R A;  4HFF B;  1OR2 A;  1RKC A;  2Q00 A;  2ZPA A;  3DMD A;  1HE9 A;  1C02 A;  2KYH A;  4U5C E;  3SP1 A;  1YLM A;  4JE9 A;  3DJN B;  4XQ1 A;  4N6C A;  2HMQ A;  4H4K C;  4CS8 A;  4I3M A;  3ASN C;  5DVW A;  3WG7 C;  3SZR A;  2QY9 A;  1TKN A;  1WTY A;  1YA9 A;  3EH1 A;  4MW3 A;  4PJL A;  1ZHT A;  2GFH A;  2E87 A;  3I4U A;  3RQE A;  3UGO A;  4K0D A;  4CSA C;  4PJN A;  5AC5 A;  3POV A;  5FCL A;  1J8M F;  2XLE A;  3ZG1 A;  4AX2 A;  1NLX A;  1V74 B;  4CS8 C;  2YLG A;  3C7J A;  3DM9 B;  2IXM A;  3EHN A;  3K1I A;  3QW0 A;  4DJ9 A;  3ZDL A;  1E86 A;  4D4X A;  4YT4 A;  1A7V A;  3NMJ A;  5L0C A;  1JR8 A;  1VYI A;  4YL0 A;  3U2M A;  2XXA A;  1H7I A;  3OEO A;  2H7V C;  4MS2 A;  3JRM O;  5KYU A;  2DI3 A;  2J9B A;  4F4B A;  2W9Y A;  2NSG A;  5DS4 A;  5B1B C;  4CBE A;  4LDQ A;  1M57 C;  4P9T A;  1ZHX A;  4YWQ A;  3MBG A;  1I4Y A;  3JT1 A;  4QI2 A;  3M4C A;  2A6H F;  2OQM A;  2BL2 A;  5T3W A;  3GWL A;  2Q9A A;  4ONS A;  1CGM E;  4MW8 A;  1YAU O;  4DOZ A;  1G8X A;  4BEM J;  3BRJ A;  2G3K A;  2HS5 A;  1Y6D A;  3QW1 A;  2Q9C A;  3V7O A;  3L34 A;  5B1A C;  1ZU5 A;  2A0B A;  3GM1 A;  3O10 A;  5COF A;  4EWC A;  1PD1 A;  1HW1 A;  5A6B D;  3EHM A;  3IPM O;  2Q7R A;  2B0J A;  1MNE A;  4PFP A;  4G78 A;  2J45 A;  2BE5 F;  3JSE O;  3EG9 A;  2PX3 A;  2Y3B A;  2AWY A;  3LLI A;  4CDY A;  1L3P A;  2MYS A;  3LJB A;  2WL8 A;  1E84 A;  4BJ5 A;  1JMW A;  2P61 A;  4J30 B;  1OW8 A;  2Y3H A;  3FXH A;  2Q9B A;  2L7A A;  1LM3 B;  2QNL A;  3WOD F;  1TQG A;  4CDA A;  4EUK B;  2J7P D;  2HJ3 A;  4ULV A;  1DOV A;  4IAQ A;  4CIP A;  2A68 F;  1CPR A;  5JT4 A;  5JSL A;  2ICW G;  4E0H A;  4IGG A;  3EGX B;  3K1H A;  4M63 A;  1EA8 A;  3B71 A;  3TOL A;  5BQH A;  1T9K A;  2YRF A;  4Z9H A;  4P9F A;  4DRH B;  2YHS A;  3AG3 C;  2OOC A;  4U5G A;  4MTO A;  5D91 A;  1G5Z A;  2L81 A;  4KBL A;  2P7V A;  3U2L A;  4OD4 A;  2W45 A;  3IQT A;  5L0I A;  1YAR O;  3GOR A;  3AQC A;  2C03 A;  2KW3 C;  3HKK A;  1QKR A;  2B0H A;  4ZLC A;  4IAO A;  1M2V B;  5AGF A;  4E0I A;  5CI9 A;  1RKE B;  3E70 C;  4AE4 A;  1Q0G A;  1YZC A;  2R25 A;  3A9C A;  4KNW A;  4OIR F;  2UUI A;  3EFO A;  3KYJ A;  4XPY A;  4CIH A;  2NUT B;  2EIJ C;  3EZI A;  2XL4 A;  3EFO B;  2ZXO A;  3SEO A;  4FAP B;  2KQ9 A;  1T6Q A;  1S05 A;  3C62 A;  3RW0 A;  4U5F E;  3WHN A;  3X2Q C;  4CS9 A;  2H7O A;  2H8A A;  1LVK A;  1G4U S;  1QVX A;  1T6U A;  2VCC A;  3EJN A;  4RBN A;  3SYN A;  3V5Y A;  4JC7 A;  3RKO F;  4AL0 A;  1G4W R;  1M2V A;  2L6H A;  3IHU A;  1MMA A;  1XZQ A;  3AG2 C;  4JRZ A;  2V26 A;  4JKV A;  4NTF A;  2XXA B;  1V4A A;  2CNW D;  2BC5 A;  4I1O B;  5D92 A;  3S29 A;  3L1M A;  4FWV A;  2WVO A;  5L0G A;  1FAP B;  3LNM B;  4AL1 A;  2LP4 A;  3KH2 A;  1BBH A;  3W2W A;  5DQZ A;  3T9O A;  3UMK A;  1ORY A;  3N24 A;  4PAC A;  2R7R A;  4B6I A;  1NG1 A;  3V5Z A;  4BPM A;  4JEA A;  1V54 C;  2IM8 A;  3GEI A;  3LLK A;  3UMI A;  1RJ9 B;  2R7V A;  5BQG A;  1C03 A;  3TUL A;  4A4A A;  2R7X A;  4MVS A;  2ZXW C;  1SF8 A;  4EBJ A;  1ZZP A;  2WZL A;  3SXY A;  3ZSU A;  3LEO A;  1JPN A;  2OJE D;  4RD9 A;  3IQC A;  3G4X A;  4YN0 B;  3GEE A;  3NDB B;  2W4B A;  3LUT B;  3GAN A;  2R02 A;  3KKB A;  4A2N B;  2V3C C;  2IYL D;  4XPW A;  1SZI A;  3QVY A;  4MTF A;  4CJO A;  2H7B A;  5BUO A;  4XWJ A;  1GS9 A;  2IXO A;  1OW7 A;  2D5R B;  2IXP A;  2EPM X;  1O87 A;  3LNR A;  2EIL C;  4IWB A;  4O6M A;  5L0F A;  5KYY B;  3B0V C;  2J8W A;  3KMI A;  2R7Q A;  4W8K A;  4U5D E;  3S84 A;  1NFN A;  2IXN A;  3MFN A;  1NU7 D;  3CQZ A;  4NC3 A;  3AQB A;  3NMK A;  4JZA A;  5HSW A;  2X0C A;  3B9Q A;  1R5I D;  1WOL A;  1Q0K A;  2XLD A;  2QUP A;  4IAR A;  1WAT A;  1FNT c;  4LLE A;  1N1C A;  3N0T A;  2J9W A;  5DQT A;  2EPK X;  3IQ5 A;  4U5H A;  4U5B E;  1PD0 A;  1Q0F A;  1TWH A;  2MHR A;  3E9V A;  3KPH A;  4JCZ A;  2YLD A;  1DOW A;  1AEP A;  3ITF A;  4JEB A;  1MND A;  4JUR I;  3VYW A;  3S27 A;  1TFK B;  3UMH A;  1NBB A;  2KC3 A;  4H54 A;  2OG2 A;  4OIQ F;  2AP3 A;  1F1M A;  4BJ6 A;  3CAX A;  3UNG C;  4DBQ A;  1ZHY A;  5HV9 A;  2YVK A;  1O3U A;  1XWJ A;  2ZXR A;  1OKK D;  2Q3T A;  1VB5 A;  3W2V A;  4BJT A;  5IY5 C;  1CGO A;  1ORS C;  4WGY A;  1M6T A;  2XM4 A;  4I1M A;  4N4W A;  4EHP A;  1RKE A;  1ZHZ A;  5JP7 A;  1WGW A;  3IQ6 A;  3NMI A;  1BR1 A;  3SXZ A;  4CDV A;  2CYD A;  3DE9 A;  4UDV A;  2LFF A;  1OCR C;  3DAG A;  5KYX B;  4G7O F;  1Z7Q c;  5FZT A;  2R7W A;  1UFB A;  3UGP A;  4MQ9 F;  4R32 A;  3I5P A;  1A41 A;  2NSF A;  2WVQ A;  3EGD B;  4J32 B;  2Y3D A;  4XLN F;  3R7C A;  2G62 A;  5DLJ A;  3RFY A;  3TQO A;  2CDQ A;  3FOO A;  4GQH A;  5A6J A;  1MQV A;  1LE2 A;  3HNJ A;  2HV7 A;  4JVS A;  3PHF 2;  2HSQ A;  4LAC B;  4IB4 A;  3R2P A;  1WN0 A;  4LDK A;  1LIH A;  4QI0 A;  3AJM A;  3VAY A;  256B A;  1HMO A;  3EQL F;  2QTV A;  5KYX A;  1NZE A;  4WJ0 A;  3FAJ A;  2X51 A;  1AVO B;  3FAP B;  5L3Q A;  1RXQ A;  1V55 C;  2QE9 A;  2XS1 A;  3M79 A;  2TMV P;  3O39 A;  3OWT A;  3PCV A;  5A6B A;  2YL3 A;  3MYI A;  3HNK A;  1HMD A;  3FOP A;  1JRA A;  5JRA A;  2VH3 A;  1LI5 A;  2VCB A;  3DM5 A;  3ZVR A;  3ECS A;  2ZD9 A;  3C8G D;  4DVZ A;  2QLA A;  2EPN A;  4AE4 B;  4C3E A;  1HW2 A;  4XEV A;  3UR3 C;  4MVZ A;  2M64 A;  2YLI A;  3GM2 A;  4EKW A;  4OIN F;  3L0I A;  2GAQ A;  2HFI A;  3K66 A;  4D4N A;  3TD7 A;  2L6F A;  3U9M A;  3NRH A;  1NFO A;  3ABK C;  3Q7G A;  3EGD A;  1B68 A;  5L0D A;  2OU6 A;  2YQY A;  2XLW A;  1YA7 O;  5L0H A;  1OXK A;  2R9R B;  2CNW A;  1FMW A;  2XLH A;  1YZA A;  3FHD A;  2CW0 F;  3RH3 A;  2GWW A;  3T4R A;  4MND A;  3AG1 C;  3K1I C;  3W8H A;  3MLG A;  3B0U X;  1FFH A;  4YK5 A;  1GM5 A;  4JTC B;  3TOM A;  2LD6 A;  2W4M A;  3NYM A;  4J7Y A;  3U9J A;  3ABL C;  3O55 A;  1ORJ A;  1NSG B;  3U0C A;  3ZTM A;  3QZC A;  3DI5 A;  4PFO A;  1Y4C A;  3CEX A;  2LIG A;  2R7O A;  3MYF A;  2R7T A;  3AGT A;  4LDR A;  2M4E A;  4JTD B;  4Z9J A;  3RQF A;  4E7S A;  4CS9 C;  1WWP A;  4GEH A;  4NQF A;  3T6G B;  4JW1 A;  5KYW A;  5T1D B;  4JTA B;  2KGO A;  4MVR A;  3U3F A;  3GWN A;  1FR0 A;  5JVE A;  4Q5S F;  5COM A;  1O5H A;  3B29 A;  1RJ9 A;  2A1D D;  2KJG A;  1FMV A;  4IJJ A;  2R03 A;  3U8P A;  1VK5 A;  2J9U A;  2A6E F;  5B3S C;  3F47 A;  1LI7 A;  3JTL O;  5EK0 A;  1LS1 A;  1BDJ B;  4O79 A;  2WZG A;  2ZXP A;  1AUE A;  2ETS A;  1ZHW A;  3CSK A;  2NUP B;  4PJM A;  3TK0 A;  3SNH A;  4BJ6 C;  3VRC A;  3OA1 A;  3QTH A;  3ZIB A;  1VTM P;  3DXJ F;  1H9G A;  2CGE A;  2RD9 A;  3QMK A;  1CPQ A;  3I5Q A;  1EI7 A;  1OXB A;  2WB7 A;  3S0X A;  4NCQ A;  2FAP B;  1QPU A;  2AU5 A;  2JX0 A;  2Y69 C;  1BZ4 A;  2D4U A;  3PMR A;  4O7G A;  2DYR C;  1IZM A;  2LCH A;  2OJQ A;  3DZA A;  2P0N A;  5JS5 A;  2O9X A;  4Z9I A;  2VB6 A;  4MVQ A;  3NG1 A;  1K05 A;  2LK4 A;  3IEE A;  2AWC A;  3K6B A;  4G7H F;  2IOQ A;  1K40 A;  3QVZ A;  4JIO A;  4FES A;  2HKV A;  3TJ6 A;  1JOG A;  3EH2 A;  3NKD A;  2J46 A;  4NY3 A;  5F5F A;  3ASO C;  3L8J A;  3C8Z A;  4YT5 A;  5TJ5 E;  5A6K A;  4I44 A;  3ZWI A;  3Q6M A;  4YT2 A;  2DYS C;  4JCH A;  4N06 A;  5E2Q A;  1OKK A;  3VF0 A;  3Q6N A;  1A0B A;  4AK9 A;  1SR2 A;  1QLE C;  1FFT C;  5JLI A;  1YJG A;  2DB4 A;  2OCC C;  1VMA A;  2XM0 A;  4ULW A;  4E17 A;  4U9D A;  4CSA A;  1D1C A;  1KU2 A;  1GGQ A;  3EGX A;  3L8I A;  3WAQ A;  4C7O A;  1LKX A;  3LEV A;  2MWQ A;  2R7S A;  2HZ8 A;  3H2V A;  3AOU A;  3S90 A;  4ZLD A;  1TWG A;  4E18 A;  1PCX A;  2WZF A;  3W4Y A;  2YEV A;  1D1B A;  3EPV A;  4QDL A;  3RYL A;  4K1O A;  1VLS A;  3RVZ A;  4HE8 D;  4C3D A;  2XRH A;  3M4B A;  1M56 C;  1T6I A;  1ZW2 A;  2J0X A;  3EZH A;  1Z3I X;  3C18 A;  4E7Z A;  5CIV A; 
#chains in the Genus database with same CATH homology
 1TWA A;  1ZU4 A;  4LLC A;  3W8I A;  3MX3 A;  3GOD A;  5T3T A;  4JJF A;  4BG0 A;  2EIN C;  3HJC A;  4BEJ A;  4Q7C A;  3X1O A;  3F46 A;  3EG9 B;  2LSE A;  3LS1 A;  4BJ1 A;  4HFK B;  4C3B A;  1VOM A;  2P6V A;  1S7Z A;  3O6X A;  4X0R A;  4U5E E;  1Z6A A;  2J9V A;  3NKE A;  3FDQ A;  3B0V C;  2YZS A;  2PP4 A;  1MMD A;  1TWC A;  3DJU B;  1ST6 A;  4OIQ F;  4LER A;  4JJG A;  5CI8 A;  3ZC4 A;  3JYH A;  2I8B A;  2J0W A;  4KC9 A;  1FTS A;  4G0H A;  2EIK C;  4DBR A;  5EGY A;  1D0X A;  2PX0 A;  3KL4 A;  1W2W A;  1OCO C;  2FGY A;  4CS7 A;  2G3V A;  3LES A;  3FVY A;  1D0Z A;  2NG1 A;  2PFD A;  1D1A A;  3RIP A;  1QZX A;  4O6N A;  3JSZ A;  4IRU A;  1M2O A;  3CZ6 A;  2DGJ A;  1Z5Z A;  5F5H A;  3K7D A;  4GYT A;  5KYW B;  3JCU Q;  4PK4 A;  4BJ5 C;  2R7U A;  1OCZ C;  1MMN A;  2EIM C;  2KNH A;  5E33 A;  3T6J A;  4EBB A;  3NYL A;  5KYU B;  1BR2 A;  5E3A A;  4FX5 A;  3JRT A;  2NUT A;  4O6Y A;  4P6I C;  4HEA J;  2XSE A;  3M1C B;  2PF4 E;  2NUP A;  4KNV A;  4OD5 A;  1Z63 A;  1JPJ A;  1BR4 A;  1VYK A;  1MMG A;  3LAY A;  1ZYR F;  3AG4 C;  4ANJ A;  4RDA A;  2J7P A;  2L9J A;  5DS5 A;  4K7B A;  5EHH A;  2WVN A;  1Z23 A;  1IW7 F;  1SMY F;  2A69 F;  4XLP F;  3Q7L A;  2FFH A;  3DD7 A;  3NYJ A;  3ABM C;  4G7Z F;  3N2Z B;  4YT8 A;  4Q4Z F;  3B0P A;  2Y3G A;  3T6B A;  4C7O B;  4XTK A;  5KYN A;  4OIP F;  4YJW A;  3S28 A;  2JD3 A;  1J8Y F;  5L3V A;  3DAF A;  3HTK C;  4PJJ A;  1D0Y A;  5E3C A;  1OCC C;  2Y39 A;  3K33 A;  3HLZ A;  3LS0 A;  4OIO F;  2HV6 A;  2VAS A;  1NU9 C;  3H65 A;  2Z15 A;  5KYY A;  1TR2 A;  2C04 A;  4HFF B;  2ZPA A;  3DMD A;  3SP1 A;  4U5C E;  3DJN B;  4H4K C;  4CS8 A;  4I3M A;  3ASN C;  5DVW A;  3WG7 C;  3SZR A;  2QY9 A;  1TKN A;  3EH1 A;  4PJL A;  1ZHT A;  2GFH A;  2E87 A;  3I4U A;  3UGO A;  4K0D A;  4CSA C;  4PJN A;  3POV A;  5FCL A;  1J8M F;  3ZG1 A;  4AX2 A;  4CS8 C;  4QI2 A;  3EHN A;  3DM9 B;  2R7W A;  2IXM A;  4YT4 A;  1VYI A;  2XXA A;  3OEO A;  2H7V C;  5KYU A;  4F4B A;  2W9Y A;  5DS4 A;  5B1B C;  4CBE A;  1M57 C;  1ZHX A;  3JT1 A;  2A6H F;  5T3W A;  2Q9A A;  4DOZ A;  1G8X A;  2G3K A;  2Q9C A;  3V7O A;  3L34 A;  5B1A C;  1ZU5 A;  4EWC A;  1PD1 A;  3EHM A;  2B0J A;  1MNE A;  4PFP A;  2J45 A;  2BE5 F;  3EG9 A;  2PX3 A;  2Y3B A;  3LLI A;  2MYS A;  3LJB A;  2WL8 A;  4BJ5 A;  4J30 B;  2Y3H A;  2Q9B A;  3WOD F;  2J7P D;  2A68 F;  3EGX B;  3K1H A;  4M63 A;  2YHS A;  3AG3 C;  4U5G A;  5D91 A;  2L81 A;  4KBL A;  2P7V A;  4OD4 A;  2W45 A;  3AQC A;  2C03 A;  2KW3 C;  4ZLC A;  4IAO A;  1M2V B;  5CI9 A;  3E70 C;  4AE4 A;  4KNW A;  4OIR F;  3EFO A;  4CIH A;  2NUT B;  2EIJ C;  3EZI A;  2XL4 A;  3EFO B;  2ZXO A;  3SEO A;  2KQ9 A;  4CS9 A;  4U5F E;  3X2Q C;  2H7O A;  1LVK A;  4YWQ A;  3EJN A;  3SYN A;  4RBN A;  4DVY P;  5DS6 A;  3RKO F;  5KYW A;  1M2V A;  1MMA A;  3AG2 C;  2V26 A;  2XXA B;  2CNW D;  4I1O B;  5D92 A;  3S29 A;  4FWV A;  2WVO A;  3KH2 A;  3W2W A;  5DQZ A;  3UMK A;  3N24 A;  2R7R A;  4B6I A;  1NG1 A;  1V54 C;  3LLK A;  3UMI A;  1RJ9 B;  2R7V A;  2R7X A;  2ZXW C;  1SF8 A;  3ZSU A;  2WZL A;  1JPN A;  4RD9 A;  4YN0 B;  3NDB B;  2W4B A;  3GAN A;  3KKB A;  4A2N B;  2V3C C;  2IYL D;  1SZI A;  2H7B A;  5BUO A;  4XWJ A;  2IXO A;  2D5R B;  3LNR A;  2IXP A;  4O6M A;  1O87 A;  4IWB A;  2EIL C;  5KYY B;  3KMI A;  2R7Q A;  4W8K A;  4U5D E;  2IXN A;  1NU7 D;  3CQZ A;  3AQB A;  4JZA A;  5HSW A;  3B9Q A;  4LLE A;  1N1C A;  3N0T A;  2J9W A;  5DQT A;  4U5H A;  4U5B E;  1PD0 A;  1TWH A;  3E9V A;  3ITF A;  1MND A;  4JUR I;  3VYW A;  3S27 A;  3UMH A;  2OG2 A;  4BJ6 A;  3UNG C;  4DBQ A;  1ZHY A;  2ZXR A;  1OKK D;  2Q3T A;  3W2V A;  4BJT A;  5IY5 C;  4I1M A;  1ZHZ A;  1WGW A;  1BR1 A;  1OCR C;  3DAG A;  5KYX B;  4G7O F;  3UGP A;  4MQ9 F;  3I5P A;  2WVQ A;  4XLN F;  4J32 B;  3EGD B;  2Y3D A;  2G62 A;  5DLJ A;  3RFY A;  2CDQ A;  2HV7 A;  4JVS A;  3PHF 2;  4LAC B;  4QI0 A;  3VAY A;  3EQL F;  2QTV A;  5KYX A;  1NZE A;  4WJ0 A;  3FAJ A;  2X51 A;  5L3Q A;  1V55 C;  3O39 A;  3OWT A;  2VH3 A;  3DM5 A;  3ZVR A;  3ECS A;  4DVZ A;  4AE4 B;  4C3E A;  3UR3 C;  4OIN F;  3L0I A;  3K66 A;  3TD7 A;  3NRH A;  3ABK C;  3Q7G A;  3EGD A;  3FHD A;  3RH3 A;  2CNW A;  1FMW A;  3T4R A;  2CW0 F;  4MND A;  3AG1 C;  3K1I C;  3W8H A;  3MLG A;  3B0U X;  1FFH A;  2W4M A;  3NYM A;  3ABL C;  3QZC A;  4PFO A;  2R7T A;  2R7O A;  2M4E A;  4E7S A;  4CS9 C;  4GEH A;  4JW1 A;  5T1D B;  2KGO A;  4Q5S F;  1O5H A;  1RJ9 A;  2A1D D;  2KJG A;  1FMV A;  4IJJ A;  1VK5 A;  2J9U A;  2A6E F;  5B3S C;  3F47 A;  1LS1 A;  4O79 A;  2WZG A;  2ZXP A;  1ZHW A;  3CSK A;  2NUP B;  4PJM A;  4BJ6 C;  3SNH A;  3OA1 A;  3ZIB A;  3DXJ F;  2CGE A;  3QMK A;  3I5Q A;  3S0X A;  2WB7 A;  2Y69 C;  3PMR A;  4O7G A;  2DYR C;  1IZM A;  3DZA A;  2O9X A;  4KI2 A;  2VB6 A;  3NG1 A;  4G7H F;  3IEE A;  3K6B A;  2IOQ A;  4FES A;  3NKD A;  3EH2 A;  2J46 A;  4NY3 A;  5F5F A;  3ASO C;  4YT5 A;  4I44 A;  3Q6M A;  4YT2 A;  2DYS C;  4JCH A;  4N06 A;  5E2Q A;  1OKK A;  3Q6N A;  4AK9 A;  1QLE C;  1FFT C;  2OCC C;  1VMA A;  4ULW A;  4CSA A;  1D1C A;  1KU2 A;  3EGX A;  4C7O A;  1LKX A;  3LEV A;  2MWQ A;  2R7S A;  4ZLD A;  1TWG A;  1PCX A;  2WZF A;  2YEV A;  1D1B A;  3EPV A;  4QDL A;  3RYL A;  4HE8 D;  4C3D A;  2XRH A;  1M56 C;  3EZH A;  2J0X A;  1Z3I X;  4E7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...