2YLGA

Cytochrome c prime from alcaligenes xylosoxidans: ascorbate and carbon monooxide bound l16a variant at 1.05 a resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 51
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2ylgA00
4D4NA 3QW1A 2BC5A 3IQ6A 1BBHA 3TOLA 2J8WA 2XLEA 3ZTZA 3M15A 4N6HA 3HNJA 4IB4A 2CCYA 3L1MA 256BA 4U9EA 3VRCA 3DE8A 1YZAA 1NBBA 2XLDA 4L6RA 5JS5A 3NMKA 3FOPA 1YZCA 1CGOA 1YYJA 1QQ3A 1CPQA 2J9BA 5JSLA 5AGFA 1YYXA 3HNIA 4WGZA 1E84A 5JLIA 5JT4A 3FOOA 2YL0A 1JAFA 3ZWIA 4CDVA 4CIPA 3HNKA 2YL3A 3QW0A 2XLMA 1QPUA 3ZQYA 1EKYA 1E86A 3IQ5A 3M79A 3C63A 2XM0A 2QLAA 3ZTMA 4JKVA 4ULVA 2XL6A 3QVYA 3U8PA 3M4CA 3M4BA 1E83A 3NMJA 3HNLA 2XLHA 4IAQA 4CDYA 4CDAA 4U9DA 2YL1A 1APCA 1S05A 2XLOA 4NC3A 1MQVA 5JUAA 4ER9A 2XL8A 4IARA 3TOMA 2YKZA 3QVZA 1GQAA 4CX9A 4D4XA 4JEBA 3ZQVA 1CPRA 2XLWA 3NMIA 2XM4A 4JEAA 4CJOA 2XLVA 4CJGA 5JP7A 5JRAA 4WGYA 5JVEA 2YLGA 1A7VA 3DE9A 4EIYA 4JE9A 5B3IA 2YL7A 1E85A 4N4WA 1CGNA 1RCPA 2YLIA 1M6TA 2YLDA 1LM3B 3C62A
chains in the Genus database with same CATH superfamily
1ZHWA 1OQCA 2BC5A 3ABMC 3TOLA 2CNWD 2QY9A 2WZLA 2MHRA 3ZTZA 4N6HA 1ZVZA 3ZG1A 3WODF 3EH2A 1Q0DA 2ZXPA 2CCYA 2JX0A 3L1MA 4MVUA 3MYFA 4CS9A 4CIHA 1RJ9B 5KYUB 2DI3A 3UNGC 3UGPA 4P6IC 3JT1A 3O55A 3Q6NA 3DAGA 3J06A 3DD7A 2UUHA 3HKKA 1YZCA 1HMDA 3LEOA 3RIPA 1T9KA 1QQ3A 2DB4A 3PHF2 3W4YA 3FHDA 2BE5F 2J9BA 2A68F 1JR8A 3EG9B 4YT8A 2R03A 1ZHZA 4OIOF 1Q0KA 4YT2A 4ULWA 3O10A 4J7YA 1T5OA 1J8MF 3KMIA 4XEVA 1JPNA 4FAPB 4E7ZA 1ZHTA 1HMOA 4WJ0A 5JLIA 4CSAA 4E0HA 1R5ID 1JAFA 4CDVA 2AWCA 3MYIA 3QZCA 3GODA 1FMWA 2L7AA 3QW0A 1NLXA 2WZFA 1BZ4A 2AU5A 3FVYA 2R05A 2KK1A 4JTAB 3LEVA 1M2OA 4OINF 3NKDA 1E86A 1WN0A 2YHSA 4N6CA 1EKYA 2XM0A 4NY3A 1XZPA 3IEEA 5DS5A 2OCCC 1G8XA 1JMWA 2XL6A 3QVYA 1YA7O 3AQBA 4YT5A 2CGEA 5DS4A 3RKOF 1JRAA 2FGYA 3M4BA 5CI8A 2YZSA 1LPEA 4JCZA 4MVOA 4JURI 5A6KA 2KJGA 5L3QA 1RMVA 1ZHYA 1LIHA 1K40A 3KKBA 3PMRA 4JVSA 3HNLA 5BQGA 5HV9A 5CIVA 4OD5A 2YRFA 3T6JA 1YJGA 2W9YA 3TD7A 2G3KA 4CBEA 1SZIA 2R02A 2YWAA 3ZVRA 2IBFA 1HE1A 1ZU5A 2D4UA 3EFOA 4O6MA 1T6IA 3PCVA 1HY5A 1C17M 2LD6A 2XL8A 3KYJA 4U5DE 3SEOA 4EBBA 4ER9A 5DVWA 1H9TA 2ZXWC 5A6JA 4G0HA 4IARA 2HJMA 3TOMA 1C03A 2OOCA 2Y39A 3E9VA 5D91A 2IXNA 2G3VA 3X2QC 2YKZA 3MLGA 1GQAA 1Z6AA 3QVZA 3C7JA 1NFOA 4O6YA 4EHPA 4AE4A 2R25A 1YDIA 1NG1A 3W2VA 4KBLA 2MYSA 1ZHXA 3I5PA 2DGJA 3GEHA 3JTLO 1H6GA 1Z23A 2R7UA 1F1MA 2L6HA 1QLEC 1A7EA 2AVKA 2HSQA 2L9JA 3RQGA 2R7XA 2A1DD 1WTYA 3B71A 2XM4A 5DQTA 1OCZC 1YAUO 3A9CA 2RD9A 3DJUB 3DM5A 3S29A 4CJOA 4O7GA 5KYWB 4CS8A 1Q0MA 5T3TA 3PDMP 3FDQA 4GEHA 4I44A 1YARO 4RD9A 4NTBA 5B1AC 4QI0A 5L0JA 2J0XA 1IW7F 3K7DA 1L3PA 1JOGA 3EGDA 1OKKA 3EGXB 3HLZA 4GQHA 2EPOA 1LS1A 5K0IA 2MWQA 1HE9A 3GWLA 2XSEA 2X0CA 4K7BA 1JPJA 1RXQA 2XL4A 4JJFA 1BR2A 3AG3C 1MMNA 1CGME 3X1OA 2PNOA 3C8ZA 3NDBB 1M56C 3C8GA 4WABA 2FAPB 4XQ1A 2VCBA 4LDKA 4YL3A 4W8KA 5KYWA 1LI5A 2R7TA 1NZEA 4PJMA 4U5EE 4BG0A 2Q9BA 2OJQA 4P9TA 2PF4E 2XS1A 2Z15A 2R9RB 3UMKA 3NG1A 2KQ9A 5E33A 1TFKB 3DJNB 2HSBA 1D0ZA 1T6QA 3IQTA 4PR9A 4MTOA 1VK5A 4U9EA 3LJBA 3AQCA 2FFHA 2H7OA 2PX3A 3UR3C 2XLDA 3VRCA 2LIGA 4C3BA 3EZHA 2EPMX 4XLPF 3B0PA 5FCLA 2GA0A 3FOPA 4XTKA 4PJJA 1YYJA 3VYWA 3OWTA 3L8IA 3S90A 2KSFA 4DBRA 3MBGA 1BDJB 1WASA 2VCAA 4XWJA 2EILC 2P1AA 3T6BA 3ECSA 1J8YF 1I4YA 5AGFA 4JTCB 4YK5A 1VLTA 4HFFB 4R32A 3W8HA 4B6IA 4ONSA 2Q9CA 5L0CA 2J45A 1SYQA 5F5FA 2LFFA 4WGZA 4XLNF 2Q4FA 4J30B 1E84A 5KYNA 3RVZA 2KYHA 3FOOA 2YL0A 2WL8A 4C3DA 3GEEA 2A69F 2D5RB 3C18A 2YL3A 2J7PD 3E70C 4M63A 2Y3BA 2EPKX 1V54C 2J7PA 2OG2A 4MTGA 3N24A 3H65A 1RKEA 3ZQYA 1V74B 1OCCC 2HMZA 5BQHA 3B0UX 2GFHA 3T9OA 2QLAA 1OR2A 3JSEO 4JKVA 2CDQA 2HJ3A 3ZIBA 3ASNC 4YWQA 4ULVA 5KYXA 1D1BA 1M57C 3U8PA 3W8IA 4BJ6C 3M1CB 3SXKA 1E83A 2X51A 1IZMA 4AL1A 4GYTA 4MS2A 4MQ9F 2EIKC 5A6AA 3JRTA 3RF3A 3AG1C 2XLHA 1OW8A 4JJGA 3KH2A 1PD1A 3RW0A 4U9DA 3VAYA 1GGQA 5A6BA 1DOWA 1R4TA 2CNWA 1TWGA 3L0IA 5D92A 4XPXA 3SYNA 2XLOA 1SMYF 2C03A 1MQVA 2L81A 3RH3A 2PFDA 3MX3A 3SNHA 1WGWA 5F28E 1FFTC 3U2MA 2LQGA 2VC9A 1YA9A 3R7CA 1UG7A 3RQEA 3POVA 2OEVA 1S7ZA 4YT4A 3S0XA 1TWAA 1LI7A 3K33A 3U2LA 2IXMA 2L6GA 2Y3DA 4K1OA 4EBKA 4CX9A 2NSGA 3SZRA 1VOMA 4PJNA 4E18A 5E3CA 4JRZA 3SXYA 5KYXB 2LK4A 1RJ9A 3UGOA 2VCCA 3OEOA 2QE9A 1PD0A 2G62A 1EI7A 3ITFA 2QTVA 4I1MA 3U3BA 2EINC 1QSPA 3B29A 1G5ZA 4U5HA 4Z9IA 2ZPAA 4MVMA 4LDRA 1HW1A 4U5BE 2ICWG 4CJGA 1RKCA 3S9OA 3NRHA 3DKAA 5GPGB 3U8VA 3S28A 5JVEA 4KNWA 3K6BA 4PFOA 4X0RA 4YL1A 3Q7LA 1Z63A 4MVSA 2F22A 2LSEA 1AVOB 2GWWA 3O6XA 2R7WA 1A7VA 3JYYA 2I15A 5CI9A 3LNRA 3WHNA 2ZD9A 1EQ1A 3HJCA 4AX2A 2A6EF 2H7BA 4FX5A 4BJ5C 2J9VA 2WVOA 1L7CA 3DE9A 3I4UA 2H7VC 3LLIA 4LLCA 1BR4A 3K1IA 4J7TA 3V5YA 4DJ9A 1ZW2A 5L0FA 4OIPF 1E85A 4JIOA 4XPYA 4CSAC 2VB6A 1RCPA 1LKXA 2GDCA 3ABKC 3BEHA 3H2UA 2YVKA 5L0IA 2Y3HA 4F4BA 2HMQA 3QW1A 2HV7A 2XXAB 1BBHA 4JW1A 4CS8C 2J8WA 3EZIA 1FAPB 3IPMO 3OA1A 3M15A 4MNDA 2WB7A 3QTHA 3T6GB 4DRJB 2V3CC 4EBJA 1D0YA 1C02A 2NUPB 3ABLC 3HNJA 1MMGA 1V4AA 5E3AA 3K1HA 4W8PA 1KU2A 2YEVA 2RSEB 3DE8A 5BQIA 3DWWA 1YZAA 1NBBA 2KNHA 2DYRC 1ORYA 4L6RA 5EK0A 3V7OA 3NYJA 1VLSA 3TQOA 1CGOA 2W45A 3DI5A 1FFHA 3EPVA 3S27A 5COGA 4BJTA 2ZXOA 4KI2A 2R7SA 2LCHA 4PK4A 1CPQA 5EHHA 4IWBA 1MMDA 1OXKA 3IHUA 4N06A 5JSLA 4DOZA 3UMHA 2XRHA 1VTMP 4MVRA 2Q7RA 3HNIA 2I8BA 5L0HA 4JCHA 1RKEB 2OU6A 1ST6A 2JPUA 5JT4A 1LE2A 3DZAA 3GM1A 3HTKC 3ZWIA 3TK0A 2VH3A 3MFNA 4A2NB 1SR2A 1KTMA 3FMSA 4J32B 3CZ6A 4NTAA 1Z7Qc 1D1CA 4AL0A 1B68A 3F47A 1M2VB 3M79A 3FXHA 2P6VA 2BL2A 1QKRA 3SXZA 3WAQA 1WOLA 3NYLA 1VYIA 2EPNA 4K0DA 3U9JA 1I4ZA 3SP1A 3ZDLA 1Z3IX 4Q7CA 4MVQA 3FAJA 3M4CA 2HFIA 2CYDA 3NMJA 4U5GA 1KNYA 4A4AA 5IY5C 2QNLA 3R2PA 5T3WA 1ZU4A 4IAQA 4Z9HA 1G4US 4CDAA 2KGOA 4YJWA 1OKKD 2EPLX 4PACA 2H8AA 3AGUA 3RYLA 4EUKB 2ETSA 4QDLA 2UUIA 4P9FA 4LERA 3LLKA 4C7OB 5DLJA 4G7HF 1FNTc 2L6FA 2Q3TA 4MW3A 3L8JA 3Q7GA 1TKNA 3C8GD 2OKUA 4H4KC 1MNEA 1ORJA 3RQFA 5A6BD 3C8GB 1Q0GA 2AP3A 2AWYA 3EJNA 4G78A 5L3VA 1O5HA 3AOUA 4D4XA 4DRHB 3S84A 3DXJF 4IGGA 1T6UA 3JSZA 2J9WA 1CPRA 3TJ5A 1OXBA 2Q00A 1WATA 2Q9AA 5L0GA 4DRIB 3EGDB 1LE4A 3EGXA 2J46A 4OIRF 4JC7A 3QMKA 4U5CE 2WVNA 1PV3A 3CSKA 3NKEA 2IM8A 2J9UA 4BPMA 4NQFA 2XLVA 3LNMB 4LDQA 5COMA 3FAPB 2E87A 2O9XA 4O6NA 4PFPA 3EQLF 3TJ6A 4NTFA 3I5QA 2ZXRA 5HSWA 2HV6A 2EIMC 3RFYA 2HKVA 4LLEA 1OR3A 1BR1A 2LP4A 2OQMA 3GANA 1MMAA 3JCUQ 2GAQA 3LUTB 2KW3C 1OW7A 1YVIA 1AUEA 1TWHA 4JE9A 3KYIA 1OCOC 2OJED 2YL7A 5T1DB 4AE4B 1H7IA 1YLMA 3KPHA 3O39A 1O3UA 1CGNA 3LAYA 4N4WA 1QVXA 2IOQA 2YLIA 3VF0A 3CQZA 1K04A 4H54A 1OW6A 1S05A 1EA8A 4ANJA 4DVZA 4D4NA 3GEIA 2Y3GA 2WVQA 2Y69C 3IQ6A 3ZSUA 1ZW3A 1Y6DA 2XLEA 2YQYA 4BEJA 3EFOB 3DM9B 4AK9A 2A0UA 1ORSC 4IB4A 4CS9C 3US6A 1LS4A 256BA 3L34A 2WZGA 3AG4C 5JS5A 1A7DA 3VM6A 1A41A 4Z9JA 5B3SC 1T01A 3NMKA 2PBEA 2R7OA 2P61A 4FWVA 1PCXA 4U5FE 3TULA 3AJMA 5L0DA 3LESA 3G50A 3JYHA 1E2XA 2A0BA 2ASRA 1YYXA 4O79A 4JTDB 1SF8A 3JRMO 3KL4A 4C7OA 1G4WR 3V5XA 4BEMJ 4EKWA 2LFDA 3AGTA 3WG7C 3N0TA 4EWCA 4CIPA 1O87A 3HNKA 3T4RA 3U3FA 2P0NA 4XEFA 3EHMA 2XLMA 3BRJA 1QPUA 4FESA 5A69A 5B1BC 1A0BA 1WWPA 3GM3A 2W4BA 1LVKA 3IQ5A 3C63A 2NG1A 3NYMA 3RVYA 3ZTMA 2W4MA 4I3MA 3EG9A 1NU9C 1FTSA 3U0CA 3SXMA 1TQGA 1Q0FA 4LACB 4BJ5A 4E0IA 3A11A 1M2VA 3GWNA 4YN0B 3H2VA 1U0BB 2A6HF 3B9QA 2B0JA 4I1OB 3UMIA 1AEPA 1TR2A 4JZAA 4CDYA 2IYLD 1I5NA 1NFNA 1U89A 1VYKA 1W2WA 2CW0F 1V55C 2YL1A 1ZZPA 3F46A 5KYUA 2HZ8A 4RBNA 1HW2A 4E7SA 1APCA 1D1AA 2C04A 2P7VA 2QUPA 4MVZA 2HS5A 4NC3A 2R7QA 3CAXA 5JUAA 2HUJA 2PX0A 2IXOA 4IAOA 4BJ1A 5DS6A 1OCRC 3GM2A 4CS7A 1GS9A 2M64A 2IXPA 3EH1A 4RDAA 1FR0A 5AC5A 1TWCA 3GORA 1NSGB 4KNVA 4MTFA 5F5HA 4DBQA 5EGYA 2NUTA 3JZ0A 3ZC4A 1DOVA 2R7VA 3EHNA 4IRUA 4JEBA 3W2WA 3ZQVA 1FMVA 1GM5A 5KYYA 4OD4A 1Z5ZA 3V5ZA 2XS8A 1VB5A 2NUPA 3B0VC 4Q5SF 1XWJA 2EIJC 3ASOC 3LS1A 4MW8A 4HFKB 3ATPA 2XLWA 4PJLA 5COFA 3NMIA 4ZLCA 4G7ZF 3G4ZA 3IQCA 4XPWA 4OIQF 2XXAA 3U5SA 2R7RA 4E17A 4JEAA 5AC4A 2J0WA 1UFBA 5FZTA 5JP7A 2JD3A 5JRAA 2TMVP 1MNDA 4DXWA 4ZLDA 4WGYA 4HE8D 4Q4ZF 1K05A 2M4EA 1N1CA 5E2QA 1VMAA 2YLGA 1NU7D 4KC9A 5BUOA 4UDVA 2V26A 1QZXA 1XZQA 3N2ZB 3CEXA 4C3EA 4YL0A 4IJJA 4XEKA 5DQZA 4G7OF 2VASA 2OEXA 1U6HA 4NCQA 5TJ5E 4BJ6A 4EIYA 5KYYB 2NSFA 3Q6MA 1TFOB 2B0HA 1Y4CA 3DMDA 2NPUA 4HEAJ 5B3IA 1ZYRF 3AG2C 2NUTB 3U9MA 2PP4A 3G4XA 1M6TA 3K66A 2YLDA 1H9GA 2DYSC 1LM3B 3LS0A 4DVYP 4QI2A 3DAFA 3C62A 2KC3A 3K1IC 1D0XA
chains in the Genus database with same CATH topology
4D4NA 3QW1A 2BC5A 3IQ6A 1BBHA 3TOLA 2J8WA 2XLEA 3ZTZA 3M15A 4N6HA 3HNJA 4IB4A 2CCYA 3L1MA 256BA 4U9EA 3VRCA 3DE8A 1YZAA 1NBBA 2XLDA 4L6RA 5JS5A 3NMKA 3FOPA 1YZCA 1CGOA 1YYJA 1QQ3A 1CPQA 2J9BA 5JSLA 5AGFA 1YYXA 3HNIA 4WGZA 1E84A 5JLIA 5JT4A 3FOOA 2YL0A 1JAFA 3ZWIA 4CDVA 4CIPA 3HNKA 2YL3A 3QW0A 2XLMA 1QPUA 3ZQYA 1EKYA 1E86A 3IQ5A 3M79A 3C63A 2XM0A 2QLAA 3ZTMA 4JKVA 4ULVA 2XL6A 3QVYA 3U8PA 3M4CA 3M4BA 1E83A 3NMJA 3HNLA 2XLHA 4IAQA 4CDYA 4CDAA 4U9DA 2YL1A 1APCA 1S05A 2XLOA 4NC3A 1MQVA 5JUAA 4ER9A 2XL8A 4IARA 3TOMA 2YKZA 3QVZA 1GQAA 4CX9A 4D4XA 4JEBA 3ZQVA 1CPRA 2XLWA 3NMIA 2XM4A 4JEAA 4CJOA 2XLVA 4CJGA 5JP7A 5JRAA 4WGYA 5JVEA 2YLGA 1A7VA 3DE9A 4EIYA 4JE9A 5B3IA 2YL7A 1E85A 4N4WA 1CGNA 1RCPA 2YLIA 1M6TA 2YLDA 1LM3B 3C62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D4N A;  3QW1 A;  2BC5 A;  3IQ6 A;  1BBH A;  3TOL A;  2J8W A;  2XLE A;  3ZTZ A;  3M15 A;  4N6H A;  3HNJ A;  4IB4 A;  2CCY A;  3L1M A;  256B A;  4U9E A;  3VRC A;  3DE8 A;  1YZA A;  1NBB A;  2XLD A;  4L6R A;  5JS5 A;  3NMK A;  3FOP A;  1YZC A;  1CGO A;  1YYJ A;  1QQ3 A;  1CPQ A;  2J9B A;  5JSL A;  5AGF A;  1YYX A;  3HNI A;  4WGZ A;  1E84 A;  5JLI A;  5JT4 A;  3FOO A;  2YL0 A;  1JAF A;  3ZWI A;  4CDV A;  4CIP A;  3HNK A;  2YL3 A;  3QW0 A;  2XLM A;  1QPU A;  3ZQY A;  1EKY A;  1E86 A;  3IQ5 A;  3M79 A;  3C63 A;  2XM0 A;  2QLA A;  3ZTM A;  4JKV A;  4ULV A;  2XL6 A;  3QVY A;  3U8P A;  3M4C A;  3M4B A;  1E83 A;  3NMJ A;  3HNL A;  2XLH A;  4IAQ A;  4CDY A;  4CDA A;  4U9D A;  2YL1 A;  1APC A;  1S05 A;  2XLO A;  4NC3 A;  1MQV A;  5JUA A;  4ER9 A;  2XL8 A;  4IAR A;  3TOM A;  2YKZ A;  3QVZ A;  1GQA A;  4CX9 A;  4D4X A;  4JEB A;  3ZQV A;  1CPR A;  2XLW A;  3NMI A;  2XM4 A;  4JEA A;  4CJO A;  2XLV A;  4CJG A;  5JP7 A;  5JRA A;  4WGY A;  5JVE A;  2YLG A;  1A7V A;  3DE9 A;  4EIY A;  4JE9 A;  5B3I A;  2YL7 A;  1E85 A;  4N4W A;  1CGN A;  1RCP A;  2YLI A;  1M6T A;  2YLD A;  1LM3 B;  3C62 A; 
#chains in the Genus database with same CATH topology
 1ZHW A;  1OQC A;  2BC5 A;  3ABM C;  3TOL A;  2CNW D;  2QY9 A;  2WZL A;  2MHR A;  3ZTZ A;  4N6H A;  1ZVZ A;  3ZG1 A;  3WOD F;  3EH2 A;  1Q0D A;  2ZXP A;  2CCY A;  2JX0 A;  3L1M A;  4MVU A;  3MYF A;  4CS9 A;  4CIH A;  1RJ9 B;  5KYU B;  2DI3 A;  3UNG C;  3UGP A;  4P6I C;  3JT1 A;  3O55 A;  3Q6N A;  3DAG A;  3J06 A;  3DD7 A;  2UUH A;  3HKK A;  1YZC A;  1HMD A;  3LEO A;  3RIP A;  1T9K A;  1QQ3 A;  2DB4 A;  3PHF 2;  3W4Y A;  3FHD A;  2BE5 F;  2J9B A;  2A68 F;  1JR8 A;  3EG9 B;  4YT8 A;  2R03 A;  1ZHZ A;  4OIO F;  1Q0K A;  4YT2 A;  4ULW A;  3O10 A;  4J7Y A;  1T5O A;  1J8M F;  3KMI A;  4XEV A;  1JPN A;  4FAP B;  4E7Z A;  1ZHT A;  1HMO A;  4WJ0 A;  5JLI A;  4CSA A;  4E0H A;  1R5I D;  1JAF A;  4CDV A;  2AWC A;  3MYI A;  3QZC A;  3GOD A;  1FMW A;  2L7A A;  3QW0 A;  1NLX A;  2WZF A;  1BZ4 A;  2AU5 A;  3FVY A;  2R05 A;  2KK1 A;  4JTA B;  3LEV A;  1M2O A;  4OIN F;  3NKD A;  1E86 A;  1WN0 A;  2YHS A;  4N6C A;  1EKY A;  2XM0 A;  4NY3 A;  1XZP A;  3IEE A;  5DS5 A;  2OCC C;  1G8X A;  1JMW A;  2XL6 A;  3QVY A;  1YA7 O;  3AQB A;  4YT5 A;  2CGE A;  5DS4 A;  3RKO F;  1JRA A;  2FGY A;  3M4B A;  5CI8 A;  2YZS A;  1LPE A;  4JCZ A;  4MVO A;  4JUR I;  5A6K A;  2KJG A;  5L3Q A;  1RMV A;  1ZHY A;  1LIH A;  1K40 A;  3KKB A;  3PMR A;  4JVS A;  3HNL A;  5BQG A;  5HV9 A;  5CIV A;  4OD5 A;  2YRF A;  3T6J A;  1YJG A;  2W9Y A;  3TD7 A;  2G3K A;  4CBE A;  1SZI A;  2R02 A;  2YWA A;  3ZVR A;  2IBF A;  1HE1 A;  1ZU5 A;  2D4U A;  3EFO A;  4O6M A;  1T6I A;  3PCV A;  1HY5 A;  1C17 M;  2LD6 A;  2XL8 A;  3KYJ A;  4U5D E;  3SEO A;  4EBB A;  4ER9 A;  5DVW A;  1H9T A;  2ZXW C;  5A6J A;  4G0H A;  4IAR A;  2HJM A;  3TOM A;  1C03 A;  2OOC A;  2Y39 A;  3E9V A;  5D91 A;  2IXN A;  2G3V A;  3X2Q C;  2YKZ A;  3MLG A;  1GQA A;  1Z6A A;  3QVZ A;  3C7J A;  1NFO A;  4O6Y A;  4EHP A;  4AE4 A;  2R25 A;  1YDI A;  1NG1 A;  3W2V A;  4KBL A;  2MYS A;  1ZHX A;  3I5P A;  2DGJ A;  3GEH A;  3JTL O;  1H6G A;  1Z23 A;  2R7U A;  1F1M A;  2L6H A;  1QLE C;  1A7E A;  2AVK A;  2HSQ A;  2L9J A;  3RQG A;  2R7X A;  2A1D D;  1WTY A;  3B71 A;  2XM4 A;  5DQT A;  1OCZ C;  1YAU O;  3A9C A;  2RD9 A;  3DJU B;  3DM5 A;  3S29 A;  4CJO A;  4O7G A;  5KYW B;  4CS8 A;  1Q0M A;  5T3T A;  3PDM P;  3FDQ A;  4GEH A;  4I44 A;  1YAR O;  4RD9 A;  4NTB A;  5B1A C;  4QI0 A;  5L0J A;  2J0X A;  1IW7 F;  3K7D A;  1L3P A;  1JOG A;  3EGD A;  1OKK A;  3EGX B;  3HLZ A;  4GQH A;  2EPO A;  1LS1 A;  5K0I A;  2MWQ A;  1HE9 A;  3GWL A;  2XSE A;  2X0C A;  4K7B A;  1JPJ A;  1RXQ A;  2XL4 A;  4JJF A;  1BR2 A;  3AG3 C;  1MMN A;  1CGM E;  3X1O A;  2PNO A;  3C8Z A;  3NDB B;  1M56 C;  3C8G A;  4WAB A;  2FAP B;  4XQ1 A;  2VCB A;  4LDK A;  4YL3 A;  4W8K A;  5KYW A;  1LI5 A;  2R7T A;  1NZE A;  4PJM A;  4U5E E;  4BG0 A;  2Q9B A;  2OJQ A;  4P9T A;  2PF4 E;  2XS1 A;  2Z15 A;  2R9R B;  3UMK A;  3NG1 A;  2KQ9 A;  5E33 A;  1TFK B;  3DJN B;  2HSB A;  1D0Z A;  1T6Q A;  3IQT A;  4PR9 A;  4MTO A;  1VK5 A;  4U9E A;  3LJB A;  3AQC A;  2FFH A;  2H7O A;  2PX3 A;  3UR3 C;  2XLD A;  3VRC A;  2LIG A;  4C3B A;  3EZH A;  2EPM X;  4XLP F;  3B0P A;  5FCL A;  2GA0 A;  3FOP A;  4XTK A;  4PJJ A;  1YYJ A;  3VYW A;  3OWT A;  3L8I A;  3S90 A;  2KSF A;  4DBR A;  3MBG A;  1BDJ B;  1WAS A;  2VCA A;  4XWJ A;  2EIL C;  2P1A A;  3T6B A;  3ECS A;  1J8Y F;  1I4Y A;  5AGF A;  4JTC B;  4YK5 A;  1VLT A;  4HFF B;  4R32 A;  3W8H A;  4B6I A;  4ONS A;  2Q9C A;  5L0C A;  2J45 A;  1SYQ A;  5F5F A;  2LFF A;  4WGZ A;  4XLN F;  2Q4F A;  4J30 B;  1E84 A;  5KYN A;  3RVZ A;  2KYH A;  3FOO A;  2YL0 A;  2WL8 A;  4C3D A;  3GEE A;  2A69 F;  2D5R B;  3C18 A;  2YL3 A;  2J7P D;  3E70 C;  4M63 A;  2Y3B A;  2EPK X;  1V54 C;  2J7P A;  2OG2 A;  4MTG A;  3N24 A;  3H65 A;  1RKE A;  3ZQY A;  1V74 B;  1OCC C;  2HMZ A;  5BQH A;  3B0U X;  2GFH A;  3T9O A;  2QLA A;  1OR2 A;  3JSE O;  4JKV A;  2CDQ A;  2HJ3 A;  3ZIB A;  3ASN C;  4YWQ A;  4ULV A;  5KYX A;  1D1B A;  1M57 C;  3U8P A;  3W8I A;  4BJ6 C;  3M1C B;  3SXK A;  1E83 A;  2X51 A;  1IZM A;  4AL1 A;  4GYT A;  4MS2 A;  4MQ9 F;  2EIK C;  5A6A A;  3JRT A;  3RF3 A;  3AG1 C;  2XLH A;  1OW8 A;  4JJG A;  3KH2 A;  1PD1 A;  3RW0 A;  4U9D A;  3VAY A;  1GGQ A;  5A6B A;  1DOW A;  1R4T A;  2CNW A;  1TWG A;  3L0I A;  5D92 A;  4XPX A;  3SYN A;  2XLO A;  1SMY F;  2C03 A;  1MQV A;  2L81 A;  3RH3 A;  2PFD A;  3MX3 A;  3SNH A;  1WGW A;  5F28 E;  1FFT C;  3U2M A;  2LQG A;  2VC9 A;  1YA9 A;  3R7C A;  1UG7 A;  3RQE A;  3POV A;  2OEV A;  1S7Z A;  4YT4 A;  3S0X A;  1TWA A;  1LI7 A;  3K33 A;  3U2L A;  2IXM A;  2L6G A;  2Y3D A;  4K1O A;  4EBK A;  4CX9 A;  2NSG A;  3SZR A;  1VOM A;  4PJN A;  4E18 A;  5E3C A;  4JRZ A;  3SXY A;  5KYX B;  2LK4 A;  1RJ9 A;  3UGO A;  2VCC A;  3OEO A;  2QE9 A;  1PD0 A;  2G62 A;  1EI7 A;  3ITF A;  2QTV A;  4I1M A;  3U3B A;  2EIN C;  1QSP A;  3B29 A;  1G5Z A;  4U5H A;  4Z9I A;  2ZPA A;  4MVM A;  4LDR A;  1HW1 A;  4U5B E;  2ICW G;  4CJG A;  1RKC A;  3S9O A;  3NRH A;  3DKA A;  5GPG B;  3U8V A;  3S28 A;  5JVE A;  4KNW A;  3K6B A;  4PFO A;  4X0R A;  4YL1 A;  3Q7L A;  1Z63 A;  4MVS A;  2F22 A;  2LSE A;  1AVO B;  2GWW A;  3O6X A;  2R7W A;  1A7V A;  3JYY A;  2I15 A;  5CI9 A;  3LNR A;  3WHN A;  2ZD9 A;  1EQ1 A;  3HJC A;  4AX2 A;  2A6E F;  2H7B A;  4FX5 A;  4BJ5 C;  2J9V A;  2WVO A;  1L7C A;  3DE9 A;  3I4U A;  2H7V C;  3LLI A;  4LLC A;  1BR4 A;  3K1I A;  4J7T A;  3V5Y A;  4DJ9 A;  1ZW2 A;  5L0F A;  4OIP F;  1E85 A;  4JIO A;  4XPY A;  4CSA C;  2VB6 A;  1RCP A;  1LKX A;  2GDC A;  3ABK C;  3BEH A;  3H2U A;  2YVK A;  5L0I A;  2Y3H A;  4F4B A;  2HMQ A;  3QW1 A;  2HV7 A;  2XXA B;  1BBH A;  4JW1 A;  4CS8 C;  2J8W A;  3EZI A;  1FAP B;  3IPM O;  3OA1 A;  3M15 A;  4MND A;  2WB7 A;  3QTH A;  3T6G B;  4DRJ B;  2V3C C;  4EBJ A;  1D0Y A;  1C02 A;  2NUP B;  3ABL C;  3HNJ A;  1MMG A;  1V4A A;  5E3A A;  3K1H A;  4W8P A;  1KU2 A;  2YEV A;  2RSE B;  3DE8 A;  5BQI A;  3DWW A;  1YZA A;  1NBB A;  2KNH A;  2DYR C;  1ORY A;  4L6R A;  5EK0 A;  3V7O A;  3NYJ A;  1VLS A;  3TQO A;  1CGO A;  2W45 A;  3DI5 A;  1FFH A;  3EPV A;  3S27 A;  5COG A;  4BJT A;  2ZXO A;  4KI2 A;  2R7S A;  2LCH A;  4PK4 A;  1CPQ A;  5EHH A;  4IWB A;  1MMD A;  1OXK A;  3IHU A;  4N06 A;  5JSL A;  4DOZ A;  3UMH A;  2XRH A;  1VTM P;  4MVR A;  2Q7R A;  3HNI A;  2I8B A;  5L0H A;  4JCH A;  1RKE B;  2OU6 A;  1ST6 A;  2JPU A;  5JT4 A;  1LE2 A;  3DZA A;  3GM1 A;  3HTK C;  3ZWI A;  3TK0 A;  2VH3 A;  3MFN A;  4A2N B;  1SR2 A;  1KTM A;  3FMS A;  4J32 B;  3CZ6 A;  4NTA A;  1Z7Q c;  1D1C A;  4AL0 A;  1B68 A;  3F47 A;  1M2V B;  3M79 A;  3FXH A;  2P6V A;  2BL2 A;  1QKR A;  3SXZ A;  3WAQ A;  1WOL A;  3NYL A;  1VYI A;  2EPN A;  4K0D A;  3U9J A;  1I4Z A;  3SP1 A;  3ZDL A;  1Z3I X;  4Q7C A;  4MVQ A;  3FAJ A;  3M4C A;  2HFI A;  2CYD A;  3NMJ A;  4U5G A;  1KNY A;  4A4A A;  5IY5 C;  2QNL A;  3R2P A;  5T3W A;  1ZU4 A;  4IAQ A;  4Z9H A;  1G4U S;  4CDA A;  2KGO A;  4YJW A;  1OKK D;  2EPL X;  4PAC A;  2H8A A;  3AGU A;  3RYL A;  4EUK B;  2ETS A;  4QDL A;  2UUI A;  4P9F A;  4LER A;  3LLK A;  4C7O B;  5DLJ A;  4G7H F;  1FNT c;  2L6F A;  2Q3T A;  4MW3 A;  3L8J A;  3Q7G A;  1TKN A;  3C8G D;  2OKU A;  4H4K C;  1MNE A;  1ORJ A;  3RQF A;  5A6B D;  3C8G B;  1Q0G A;  2AP3 A;  2AWY A;  3EJN A;  4G78 A;  5L3V A;  1O5H A;  3AOU A;  4D4X A;  4DRH B;  3S84 A;  3DXJ F;  4IGG A;  1T6U A;  3JSZ A;  2J9W A;  1CPR A;  3TJ5 A;  1OXB A;  2Q00 A;  1WAT A;  2Q9A A;  5L0G A;  4DRI B;  3EGD B;  1LE4 A;  3EGX A;  2J46 A;  4OIR F;  4JC7 A;  3QMK A;  4U5C E;  2WVN A;  1PV3 A;  3CSK A;  3NKE A;  2IM8 A;  2J9U A;  4BPM A;  4NQF A;  2XLV A;  3LNM B;  4LDQ A;  5COM A;  3FAP B;  2E87 A;  2O9X A;  4O6N A;  4PFP A;  3EQL F;  3TJ6 A;  4NTF A;  3I5Q A;  2ZXR A;  5HSW A;  2HV6 A;  2EIM C;  3RFY A;  2HKV A;  4LLE A;  1OR3 A;  1BR1 A;  2LP4 A;  2OQM A;  3GAN A;  1MMA A;  3JCU Q;  2GAQ A;  3LUT B;  2KW3 C;  1OW7 A;  1YVI A;  1AUE A;  1TWH A;  4JE9 A;  3KYI A;  1OCO C;  2OJE D;  2YL7 A;  5T1D B;  4AE4 B;  1H7I A;  1YLM A;  3KPH A;  3O39 A;  1O3U A;  1CGN A;  3LAY A;  4N4W A;  1QVX A;  2IOQ A;  2YLI A;  3VF0 A;  3CQZ A;  1K04 A;  4H54 A;  1OW6 A;  1S05 A;  1EA8 A;  4ANJ A;  4DVZ A;  4D4N A;  3GEI A;  2Y3G A;  2WVQ A;  2Y69 C;  3IQ6 A;  3ZSU A;  1ZW3 A;  1Y6D A;  2XLE A;  2YQY A;  4BEJ A;  3EFO B;  3DM9 B;  4AK9 A;  2A0U A;  1ORS C;  4IB4 A;  4CS9 C;  3US6 A;  1LS4 A;  256B A;  3L34 A;  2WZG A;  3AG4 C;  5JS5 A;  1A7D A;  3VM6 A;  1A41 A;  4Z9J A;  5B3S C;  1T01 A;  3NMK A;  2PBE A;  2R7O A;  2P61 A;  4FWV A;  1PCX A;  4U5F E;  3TUL A;  3AJM A;  5L0D A;  3LES A;  3G50 A;  3JYH A;  1E2X A;  2A0B A;  2ASR A;  1YYX A;  4O79 A;  4JTD B;  1SF8 A;  3JRM O;  3KL4 A;  4C7O A;  1G4W R;  3V5X A;  4BEM J;  4EKW A;  2LFD A;  3AGT A;  3WG7 C;  3N0T A;  4EWC A;  4CIP A;  1O87 A;  3HNK A;  3T4R A;  3U3F A;  2P0N A;  4XEF A;  3EHM A;  2XLM A;  3BRJ A;  1QPU A;  4FES A;  5A69 A;  5B1B C;  1A0B A;  1WWP A;  3GM3 A;  2W4B A;  1LVK A;  3IQ5 A;  3C63 A;  2NG1 A;  3NYM A;  3RVY A;  3ZTM A;  2W4M A;  4I3M A;  3EG9 A;  1NU9 C;  1FTS A;  3U0C A;  3SXM A;  1TQG A;  1Q0F A;  4LAC B;  4BJ5 A;  4E0I A;  3A11 A;  1M2V A;  3GWN A;  4YN0 B;  3H2V A;  1U0B B;  2A6H F;  3B9Q A;  2B0J A;  4I1O B;  3UMI A;  1AEP A;  1TR2 A;  4JZA A;  4CDY A;  2IYL D;  1I5N A;  1NFN A;  1U89 A;  1VYK A;  1W2W A;  2CW0 F;  1V55 C;  2YL1 A;  1ZZP A;  3F46 A;  5KYU A;  2HZ8 A;  4RBN A;  1HW2 A;  4E7S A;  1APC A;  1D1A A;  2C04 A;  2P7V A;  2QUP A;  4MVZ A;  2HS5 A;  4NC3 A;  2R7Q A;  3CAX A;  5JUA A;  2HUJ A;  2PX0 A;  2IXO A;  4IAO A;  4BJ1 A;  5DS6 A;  1OCR C;  3GM2 A;  4CS7 A;  1GS9 A;  2M64 A;  2IXP A;  3EH1 A;  4RDA A;  1FR0 A;  5AC5 A;  1TWC A;  3GOR A;  1NSG B;  4KNV A;  4MTF A;  5F5H A;  4DBQ A;  5EGY A;  2NUT A;  3JZ0 A;  3ZC4 A;  1DOV A;  2R7V A;  3EHN A;  4IRU A;  4JEB A;  3W2W A;  3ZQV A;  1FMV A;  1GM5 A;  5KYY A;  4OD4 A;  1Z5Z A;  3V5Z A;  2XS8 A;  1VB5 A;  2NUP A;  3B0V C;  4Q5S F;  1XWJ A;  2EIJ C;  3ASO C;  3LS1 A;  4MW8 A;  4HFK B;  3ATP A;  2XLW A;  4PJL A;  5COF A;  3NMI A;  4ZLC A;  4G7Z F;  3G4Z A;  3IQC A;  4XPW A;  4OIQ F;  2XXA A;  3U5S A;  2R7R A;  4E17 A;  4JEA A;  5AC4 A;  2J0W A;  1UFB A;  5FZT A;  5JP7 A;  2JD3 A;  5JRA A;  2TMV P;  1MND A;  4DXW A;  4ZLD A;  4WGY A;  4HE8 D;  4Q4Z F;  1K05 A;  2M4E A;  1N1C A;  5E2Q A;  1VMA A;  2YLG A;  1NU7 D;  4KC9 A;  5BUO A;  4UDV A;  2V26 A;  1QZX A;  1XZQ A;  3N2Z B;  3CEX A;  4C3E A;  4YL0 A;  4IJJ A;  4XEK A;  5DQZ A;  4G7O F;  2VAS A;  2OEX A;  1U6H A;  4NCQ A;  5TJ5 E;  4BJ6 A;  4EIY A;  5KYY B;  2NSF A;  3Q6M A;  1TFO B;  2B0H A;  1Y4C A;  3DMD A;  2NPU A;  4HEA J;  5B3I A;  1ZYR F;  3AG2 C;  2NUT B;  3U9M A;  2PP4 A;  3G4X A;  1M6T A;  3K66 A;  2YLD A;  1H9G A;  2DYS C;  1LM3 B;  3LS0 A;  4DVY P;  4QI2 A;  3DAF A;  3C62 A;  2KC3 A;  3K1I C;  1D0X A; 
#chains in the Genus database with same CATH homology
 4D4N A;  3QW1 A;  2BC5 A;  3IQ6 A;  1BBH A;  3TOL A;  2J8W A;  2XLE A;  3ZTZ A;  3M15 A;  4N6H A;  3HNJ A;  4IB4 A;  2CCY A;  3L1M A;  256B A;  4U9E A;  3VRC A;  3DE8 A;  1YZA A;  1NBB A;  2XLD A;  4L6R A;  5JS5 A;  3NMK A;  3FOP A;  1YZC A;  1CGO A;  1YYJ A;  1QQ3 A;  1CPQ A;  2J9B A;  5JSL A;  5AGF A;  1YYX A;  3HNI A;  4WGZ A;  1E84 A;  5JLI A;  5JT4 A;  3FOO A;  2YL0 A;  1JAF A;  3ZWI A;  4CDV A;  4CIP A;  3HNK A;  2YL3 A;  3QW0 A;  2XLM A;  1QPU A;  3ZQY A;  1EKY A;  1E86 A;  3IQ5 A;  3M79 A;  3C63 A;  2XM0 A;  2QLA A;  3ZTM A;  4JKV A;  4ULV A;  2XL6 A;  3QVY A;  3U8P A;  3M4C A;  3M4B A;  1E83 A;  3NMJ A;  3HNL A;  2XLH A;  4IAQ A;  4CDY A;  4CDA A;  4U9D A;  2YL1 A;  1APC A;  1S05 A;  2XLO A;  4NC3 A;  1MQV A;  5JUA A;  4ER9 A;  2XL8 A;  4IAR A;  3TOM A;  2YKZ A;  3QVZ A;  1GQA A;  4CX9 A;  4D4X A;  4JEB A;  3ZQV A;  1CPR A;  2XLW A;  3NMI A;  2XM4 A;  4JEA A;  4CJO A;  2XLV A;  4CJG A;  5JP7 A;  5JRA A;  4WGY A;  5JVE A;  2YLG A;  1A7V A;  3DE9 A;  4EIY A;  4JE9 A;  5B3I A;  2YL7 A;  1E85 A;  4N4W A;  1CGN A;  1RCP A;  2YLI A;  1M6T A;  2YLD A;  1LM3 B;  3C62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...