2YLGA

Cytochrome c prime from alcaligenes xylosoxidans: ascorbate and carbon monooxide bound l16a variant at 1.05 a resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 51
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2ylgA00
1LM3B 1CPRA 5B3IA 3M4BA 3M4CA 2YL1A 4IARA 3DE9A 2J9BA 4U9EA 3TOMA 4CX9A 4CJOA 1APCA 3ZQVA 1M6TA 2J8WA 1BBHA 1YZAA 3QVZA 4CDYA 2CCYA 4CJGA 4JKVA 3NMJA 3C62A 5JUAA 3C63A 1MQVA 3ZWIA 4WGYA 4D4XA 5JP7A 1YYJA 2YKZA 2XLWA 256BA 5JSLA 1E83A 2XLMA 4IAQA 5AGFA 1S05A 3FOPA 2XL8A 2XLHA 4U9DA 2YLIA 2YL7A 4JEBA 1RCPA 3HNLA 4EIYA 1QQ3A 5JT4A 2XM4A 2YL3A 2QLAA 2BC5A 1JAFA 4CDVA 4N6HA 3ZQYA 4CDAA 3IQ6A 2XLVA 3FOOA 4ULVA 1CGNA 1CPQA 5JRAA 3M79A 1A7VA 2XLDA 2XM0A 1CGOA 1QPUA 1E84A 3U8PA 4JEAA 3TOLA 4WGZA 2YL0A 4L6RA 4D4NA 2YLDA 3M15A 1YZCA 2XLEA 1NBBA 3QVYA 2XL6A 3IQ5A 4JE9A 2YLGA 3ZTMA 5JS5A 5JLIA 4CIPA 3DE8A 4NC3A 3QW0A 4ER9A 3HNKA 5JVEA 3L1MA 3NMIA 1GQAA 3NMKA 3QW1A 4N4WA 4IB4A 3VRCA 2XLOA 3HNIA 3ZTZA 3HNJA 1E85A 1YYXA 1E86A 1EKYA
chains in the Genus database with same CATH superfamily
1LM3B 4YT4A 3H2UA 5DS5A 4OIQF 3ZIBA 4K1OA 2R9RB 2KC3A 3LLKA 4JZAA 1G4WR 3ITFA 2J9UA 1EQ1A 2YL1A 3PMRA 3NYMA 4MVOA 3EGXB 1OCCC 1T9KA 4XPWA 3DMDA 4MVQA 1BDJB 4O79A 5L0GA 1T6QA 3H65A 5KYUB 2R25A 2A69F 4CX9A 4A2NB 3ABKC 1HE9A 3F46A 3Q6NA 1APCA 3S27A 1M6TA 1OCOC 1TWGA 1G4US 2VCBA 2UUIA 2Z15A 2J8WA 3MFNA 4DXWA 3UMHA 1HY5A 4K0DA 1BBHA 3RVZA 3AG4C 2F22A 4GQHA 2HV6A 1T01A 4JCZA 1Q0GA 4PACA 3M1CB 4G78A 4CS7A 1YA7O 2J7PD 1VLTA 3DWWA 2XL4A 4JKVA 1AVOB 3GEHA 2LSEA 5E3CA 3B0PA 2AWCA 1NFNA 4QDLA 4DVZA 1DOVA 1CGME 1NU7D 1TR2A 1A7DA 4WGYA 3AGTA 1G8XA 2OOCA 3E9VA 4KNWA 1HE1A 1OW7A 3NYJA 3POVA 2MWQA 2YKZA 5L0CA 1FNTc 1Z6AA 2A68F 2Y39A 4MVUA 1LI5A 256BA 4O6MA 4CS8A 2HMQA 5JSLA 3PHF2 2YVKA 1FMWA 4LERA 3V5YA 2Y69C 4E7ZA 3T6BA 3EQLF 1H9GA 3TQOA 3NYLA 3NDBB 5E2QA 3EHNA 3GODA 3ZC4A 1A7EA 4JTDB 4YT5A 3MLGA 3J06A 2MYSA 2XL8A 1C17M 2XLHA 4PK4A 1LI7A 2J9WA 3U3BA 2HS5A 1RKCA 3KH2A 2LD6A 3DAGA 3U8VA 5AC4A 1UG7A 3C8GA 3HLZA 5K0IA 1OXKA 2DYRC 2MHRA 2XLVA 3GWNA 3LNRA 4YL0A 4A4AA 1CGNA 1YVIA 2IYLD 3U2MA 5F5HA 4CS8C 3ZVRA 1XWJA 2C03A 4P6IC 4DJ9A 4PFPA 4MW8A 1K40A 2AWYA 3X2QC 5DVWA 2JX0A 1V74B 4JTCB 2A0UA 1QZXA 1NZEA 2ASRA 4PJMA 4BJ5A 5BQGA 1WATA 4DBQA 4QI2A 3KKBA 5EGYA 3SXZA 3IQTA 3C18A 3LLIA 2KQ9A 5FZTA 5L3VA 1JPJA 4LLEA 1TFOB 3SP1A 4XQ1A 3FDQA 1V54C 2AVKA 2YL0A 4HE8D 4U5GA 2YEVA 2ZXPA 3T4RA 3ECSA 2B0HA 3RFYA 5DQTA 2H7BA 2WVNA 3WAQA 5F5FA 1ZVZA 3QTHA 2YLGA 4MW3A 2JPUA 1MMNA 3ZTMA 5JS5A 1VTMP 4EBJA 2J45A 4BPMA 2QUPA 1K04A 2P0NA 3AQBA 1Z3IX 2A1DD 3H2VA 2XRHA 3S0XA 4FX5A 1OKKA 1H6GA 3LS0A 1WTYA 3HNKA 3O6XA 4JCHA 4BJ5C 3C8GB 1EI7A 1PV3A 2HUJA 3NMKA 4IAOA 1R4TA 2NSFA 3DAFA 3QW1A 4NTFA 3JCUQ 3UGOA 1NFOA 3QZCA 3DKAA 3JT1A 4IB4A 2EIJC 2XLOA 1T6IA 3HNIA 2ZXOA 4NTBA 3GEIA 3IEEA 2IXOA 3HNJA 2IBFA 4YJWA 3V7OA 2QE9A 3EGDA 3LUTB 1H9TA 3GORA 4J32B 3SXMA 5HV9A 1JR8A 3KMIA 4W8KA 3VM6A 3EH1A 5B3IA 4IRUA 5L0IA 3DM9B 3NRHA 1F1MA 5D91A 3W2VA 4IARA 5D92A 4LLCA 4ONSA 1A41A 4YL1A 3DE9A 4DRIB 1HW1A 3L34A 2R7QA 2WVOA 3N0TA 4EBKA 3AG1C 2A6EF 3O55A 5EHHA 2G3VA 3ZSUA 1ZU5A 3Q7LA 3ZQVA 2NUTA 3FAPB 1I4ZA 4JVSA 5A6JA 4C3BA 3UMIA 4Q5SF 1M2OA 3U2LA 2GWWA 5T1DB 4BG0A 5L0DA 2R7WA 2J0WA 1Q0MA 1YZAA 3ASNC 4J7YA 4Z9IA 3TJ6A 4CDYA 3B0UX 1PD0A 4ULWA 2DB4A 1TWAA 2P7VA 4JJFA 2P61A 3U9MA 2HV7A 3HJCA 5JUAA 3EJNA 3B71A 1U6HA 3IPMO 3AG3C 3HTKC 2IXNA 2IXPA 2KSFA 1D1BA 1LE4A 2LQGA 2WZFA 1JOGA 3EGDB 4D4XA 2NUPA 4F4BA 4C3DA 4FAPB 4HFKB 4IWBA 1FR0A 5AC5A 5BQHA 3TD7A 4YT8A 1BZ4A 2L6FA 3EHMA 4AX2A 2J9VA 3RYLA 1U0BB 1Z63A 2LFFA 3WG7C 3QMKA 4N6CA 1W2WA 1L3PA 3S9OA 4IGGA 5AGFA 4FWVA 4UDVA 5E33A 4MVZA 3EH2A 4RD9A 1BR4A 1ORYA 2JD3A 1RKEA 2OKUA 2YLIA 5T3WA 3W8IA 4XLPF 2NUTB 3RF3A 2Y3GA 1MMDA 2HSBA 1TKNA 1FMVA 5A6BD 3G4XA 4M63A 2YL3A 3ABMC 5T3TA 4CDVA 3ZQYA 3SNHA 3PCVA 1WOLA 1LS4A 1L7CA 1OR3A 2EILC 3EPVA 1CPQA 4XLNF 3WHNA 2QTVA 3DM5A 1LKXA 3FXHA 4NY3A 5JRAA 3L8JA 1K05A 2NG1A 4I44A 2KGOA 3LJBA 2H8AA 3T6JA 2XLDA 3W4YA 3RVYA 4MNDA 1N1CA 2R7OA 2NUPB 2PFDA 4NQFA 3ABLC 2VCCA 2VCAA 3I4UA 5KYWA 4OD5A 1J8YF 2EIMC 2FAPB 4O6YA 4L6RA 3TOLA 1LVKA 5COFA 2YHSA 2YLDA 2ICWG 1NBBA 2BL2A 4I1OB 3HKKA 3TK0A 2OEVA 1VOMA 2RSEB 2XL6A 3ZG1A 4JE9A 2OJQA 2H7OA 4RDAA 1KNYA 3LEOA 2B0JA 2IM8A 1A0BA 2V26A 4IJJA 4U5EE 1DOWA 1RKEB 5JLIA 2CNWA 4X0RA 5COMA 2R7TA 1OR2A 1QKRA 2V3CC 3O39A 2P1AA 2Q00A 4OIRF 2EPNA 3TJ5A 3NMIA 1GQAA 2PX0A 4R32A 4KBLA 1R5ID 4CBEA 2HMZA 2PF4E 4BJ6A 1ST6A 3EG9A 3U9JA 3UNGC 5DLJA 2KYHA 3ASOC 3LS1A 4HFFB 3ZTZA 2FGYA 2O9XA 5KYNA 2R7VA 2XXAA 1ZZPA 1I4YA 4FESA 2DYSC 5HSWA 2J0XA 1UFBA 2Y3BA 4MTGA 1ZHYA 3ZDLA 4JIOA 1FFTC 4YT2A 1E86A 1XZQA 3C8ZA 1JMWA 5CI9A 1SMYF 4CIHA 2LFDA 5KYWB 1ZHXA 4OIOF 4LDRA 3U3FA 2HKVA 3M4BA 1Z7Qc 3M4CA 3FMSA 2L7AA 3VAYA 3DZAA 3SXKA 4YN0B 2CGEA 3SYNA 4PJNA 1NG1A 3K6BA 4YK5A 3SZRA 1D1CA 1IZMA 2J9BA 2PX3A 4N06A 4U9EA 4BJ6C 4CJOA 4EHPA 2DGJA 4Z9JA 2DI3A 4CSAA 4LACB 3I5PA 3C8GD 3W8HA 1RMVA 4OD4A 4ANJA 2IXMA 2GDCA 3CEXA 1Q0DA 4PJJA 4RBNA 3QVZA 4PFOA 1VYKA 4MVSA 4OIPF 4YWQA 2NPUA 2CCYA 3F47A 4OINF 3UR3C 4ZLDA 1QVXA 1VLSA 3EG9B 4O6NA 3B0VC 2OCCC 1ZHZA 3C62A 3JSZA 3NMJA 3OWTA 1XZPA 3C63A 3CSKA 4E0HA 2XXAB 3OEOA 2OQMA 2YRFA 1MQVA 4J7TA 4BEJA 4U5FE 1OW8A 5JP7A 4CSAC 2W4MA 2X51A 5L0JA 4I3MA 4C7OA 2GA0A 1LS1A 3GANA 3O10A 1WASA 2D5RB 2LCHA 4NCQA 5L0HA 2XLWA 2OEXA 1IW7F 4E0IA 1ZHWA 2VB6A 1D1AA 2FFHA 4E17A 1MNDA 3VYWA 4EKWA 1TQGA 3DI5A 5CIVA 1YJGA 3LNMB 2PP4A 1ZW2A 3K7DA 2NSGA 4AL1A 1S05A 1OKKD 2ZPAA 4DRHB 3FVYA 4JJGA 4DRJB 4DOZA 2LK4A 1BR1A 2YL7A 2YZSA 1ZU4A 3S90A 1SR2A 3L8IA 1S7ZA 1T5OA 3AG2C 1RCPA 3LAYA 4XEKA 3B9QA 1QQ3A 3KL4A 1T6UA 4P9TA 2BC5A 3A11A 4N6HA 4CDAA 1Y6DA 1TWCA 1GGQA 3FOOA 3MX3A 1VMAA 4XTKA 3RQFA 3T9OA 4WABA 2R03A 2EIKC 1RXQA 2KNHA 3JSEO 1YARO 3KYJA 3MYFA 4GYTA 1QSPA 1LIHA 3MBGA 2GAQA 1A7VA 1Q0FA 1YAUO 3TULA 1I5NA 2J7PA 3JRMO 1PD1A 5L0FA 5BQIA 3V5ZA 1HMOA 1O87A 2HJMA 4MTOA 3Q7GA 1E84A 2HZ8A 3RKOF 1LE2A 4E18A 1FFHA 3T6GB 3U8PA 4C7OB 4JEAA 4WGZA 3CZ6A 3JRTA 3M15A 2L9JA 5EK0A 1YZCA 4I1MA 4HEAJ 1ORSC 2XLEA 3AJMA 3QVYA 5FCLA 2L81A 3LEVA 2ZXWC 1D0ZA 4XWJA 3IQ5A 2EPKX 2L6HA 2HSQA 1VK5A 4JRZA 3DXJF 4JC7A 4KNVA 1MMAA 4AL0A 4DBRA 4CIPA 2Q4FA 3DJNB 3C7JA 2W4BA 3AGUA 3BEHA 3CAXA 4U5BE 2CYDA 3GM1A 4DVYP 4ER9A 5DS4A 2QY9A 3L1MA 1SZIA 1WN0A 4J30B 1VB5A 3K1IA 3SXYA 4N4WA 2R7UA 1MNEA 3U5SA 3Q6MA 3N24A 1NSGB 2P6VA 1GS9A 1VYIA 1GM5A 5B1BC 2PBEA 2G3KA 1E2XA 4BJ1A 3R2PA 3NKDA 1NLXA 1Q0KA 3BRJA 1E85A 1WGWA 1YYXA 4KI2A 2I8BA 2M64A 1ZW3A 2E87A 1G5ZA 2L6GA 2LP4A 3DD7A 3K33A 3KYIA 1M2VA 1CPRA 5TJ5E 4CS9A 4U5HA 2G62A 2Q7RA 5A6AA 3R7CA 1D0YA 2EPOA 4EWCA 2R02A 1H7IA 4MVMA 4E7SA 2Q9AA 2ZD9A 1RJ9A 2W9YA 2IOQA 3K1IC 1OCZC 3TOMA 1ZHTA 3GM2A 2VC9A 4H54A 1OCRC 1M56C 1C03A 4BEMJ 2HJ3A 4ZLCA 5DQZA 3JZ0A 2WB7A 4Q4ZF 4XEFA 5GPGB 2OJED 2WL8A 1EKYA 3FAJA 3IHUA 4CS9C 4PR9A 4AK9A 4CJGA 1Z23A 1JPNA 3JTLO 3X1OA 5L3QA 3S84A 3U0CA 5KYXA 1WWPA 4Q7CA 2Q9CA 2A6HF 4MVRA 3ZWIA 1BR2A 2CDQA 2I15A 5DS6A 1M57C 1OXBA 1Y4CA 2GFHA 4QI0A 3G50A 5B3SC 2R7RA 1YYJA 1ZYRF 1M2VB 2Y3DA 1AUEA 1KU2A 1TWHA 2W45A 1U89A 4AE4A 2WZGA 4H4KC 4JW1A 1E83A 2XLMA 1SYQA 2Y3HA 2YQYA 4P9FA 3RIPA 3RQEA 1NU9C 1OW6A 3EFOA 1MMGA 4IAQA 1V4AA 5A6KA 1RJ9B 3B29A 5KYXB 2EPLX 1JRAA 2CNWD 3S28A 3FOPA 5E3AA 2AU5A 4U9DA 1B68A 4JEBA 3EZHA 4U5DE 2ETSA 3PDMP 4EIYA 3HNLA 3SEOA 5JT4A 5KYYA 3UGPA 2XM4A 2ZXRA 2QLAA 1ORJA 3KPHA 3WODF 1JAFA 4C3EA 3AQCA 3JYYA 5IY5C 1PCXA 3IQ6A 2QNLA 2YWAA 3A9CA 3MYIA 1EA8A 4B6IA 4ULVA 1TFKB 5CI8A 3OA1A 2VH3A 4WJ0A 4GEHA 2AP3A 2EPMX 4G0HA 4G7OF 3NKEA 3M79A 2H7VC 2A0BA 1FTSA 1Z5ZA 2BE5F 3EZIA 4XPXA 2Q3TA 1SF8A 1HMDA 1AEPA 5COGA 5BUOA 1HW2A 2R7XA 2XM0A 4NTAA 2XS1A 1CGOA 1V55C 3DJUB 1QPUA 2XSEA 3VF0A 4EUKB 3S29A 4MQ9F 1YLMA 4BJTA 5A69A 2CW0F 2EINC 2X0CA 4PJLA 1D0XA 3LESA 2PNOA 2D4UA 3GEEA 4D4NA 2UUHA 4AE4B 3AOUA 2R05A 3EGXA 4YL3A 3RW0A 1YA9A 2OG2A 3JYHA 4K7BA 3GM3A 3EFOB 1OQCA 5KYUA 3RH3A 4XPYA 2HFIA 2Q9BA 1C02A 2OU6A 3K66A 1J8MF 1O5HA 2WZLA 3GWLA 3IQCA 4G7HF 4JTAB 3DE8A 4NC3A 3CQZA 3QW0A 1FAPB 2J46A 3UMKA 2KW3C 2RD9A 4JURI 5JVEA 3L0IA 5KYYB 3RQGA 4G7ZF 2TMVP 4EBBA 4U5CE 2XS8A 2R7SA 2VASA 2M4EA 3ATPA 4W8PA 5A6BA 3VRCA 4LDKA 3FHDA 3K1HA 5F28E 3W2WA 1KTMA 4Z9HA 3US6A 1LPEA 2KK1A 4LDQA 4XEVA 2WVQA 3NG1A 4MTFA 2KJGA 1QLEC 2LIGA 3I5QA 5B1AC 4O7GA 3G4ZA 1O3UA 3E70C 2C04A 3V5XA 4KC9A 3N2ZB 1YDIA 4MS2A
chains in the Genus database with same CATH topology
1LM3B 1CPRA 5B3IA 3M4BA 3M4CA 2YL1A 4IARA 3DE9A 2J9BA 4U9EA 3TOMA 4CX9A 4CJOA 1APCA 3ZQVA 1M6TA 2J8WA 1BBHA 1YZAA 3QVZA 4CDYA 2CCYA 4CJGA 4JKVA 3NMJA 3C62A 5JUAA 3C63A 1MQVA 3ZWIA 4WGYA 4D4XA 5JP7A 1YYJA 2YKZA 2XLWA 256BA 5JSLA 1E83A 2XLMA 4IAQA 5AGFA 1S05A 3FOPA 2XL8A 2XLHA 4U9DA 2YLIA 2YL7A 4JEBA 1RCPA 3HNLA 4EIYA 1QQ3A 5JT4A 2XM4A 2YL3A 2QLAA 2BC5A 1JAFA 4CDVA 4N6HA 3ZQYA 4CDAA 3IQ6A 2XLVA 3FOOA 4ULVA 1CGNA 1CPQA 5JRAA 3M79A 1A7VA 2XLDA 2XM0A 1CGOA 1QPUA 1E84A 3U8PA 4JEAA 3TOLA 4WGZA 2YL0A 4L6RA 4D4NA 2YLDA 3M15A 1YZCA 2XLEA 1NBBA 3QVYA 2XL6A 3IQ5A 4JE9A 2YLGA 3ZTMA 5JS5A 5JLIA 4CIPA 3DE8A 4NC3A 3QW0A 4ER9A 3HNKA 5JVEA 3L1MA 3NMIA 1GQAA 3NMKA 3QW1A 4N4WA 4IB4A 3VRCA 2XLOA 3HNIA 3ZTZA 3HNJA 1E85A 1YYXA 1E86A 1EKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LM3 B;  1CPR A;  5B3I A;  3M4B A;  3M4C A;  2YL1 A;  4IAR A;  3DE9 A;  2J9B A;  4U9E A;  3TOM A;  4CX9 A;  4CJO A;  1APC A;  3ZQV A;  1M6T A;  2J8W A;  1BBH A;  1YZA A;  3QVZ A;  4CDY A;  2CCY A;  4CJG A;  4JKV A;  3NMJ A;  3C62 A;  5JUA A;  3C63 A;  1MQV A;  3ZWI A;  4WGY A;  4D4X A;  5JP7 A;  1YYJ A;  2YKZ A;  2XLW A;  256B A;  5JSL A;  1E83 A;  2XLM A;  4IAQ A;  5AGF A;  1S05 A;  3FOP A;  2XL8 A;  2XLH A;  4U9D A;  2YLI A;  2YL7 A;  4JEB A;  1RCP A;  3HNL A;  4EIY A;  1QQ3 A;  5JT4 A;  2XM4 A;  2YL3 A;  2QLA A;  2BC5 A;  1JAF A;  4CDV A;  4N6H A;  3ZQY A;  4CDA A;  3IQ6 A;  2XLV A;  3FOO A;  4ULV A;  1CGN A;  1CPQ A;  5JRA A;  3M79 A;  1A7V A;  2XLD A;  2XM0 A;  1CGO A;  1QPU A;  1E84 A;  3U8P A;  4JEA A;  3TOL A;  4WGZ A;  2YL0 A;  4L6R A;  4D4N A;  2YLD A;  3M15 A;  1YZC A;  2XLE A;  1NBB A;  3QVY A;  2XL6 A;  3IQ5 A;  4JE9 A;  2YLG A;  3ZTM A;  5JS5 A;  5JLI A;  4CIP A;  3DE8 A;  4NC3 A;  3QW0 A;  4ER9 A;  3HNK A;  5JVE A;  3L1M A;  3NMI A;  1GQA A;  3NMK A;  3QW1 A;  4N4W A;  4IB4 A;  3VRC A;  2XLO A;  3HNI A;  3ZTZ A;  3HNJ A;  1E85 A;  1YYX A;  1E86 A;  1EKY A; 
#chains in the Genus database with same CATH topology
 1LM3 B;  4YT4 A;  3H2U A;  5DS5 A;  4OIQ F;  3ZIB A;  4K1O A;  2R9R B;  2KC3 A;  3LLK A;  4JZA A;  1G4W R;  3ITF A;  2J9U A;  1EQ1 A;  2YL1 A;  3PMR A;  3NYM A;  4MVO A;  3EGX B;  1OCC C;  1T9K A;  4XPW A;  3DMD A;  4MVQ A;  1BDJ B;  4O79 A;  5L0G A;  1T6Q A;  3H65 A;  5KYU B;  2R25 A;  2A69 F;  4CX9 A;  4A2N B;  3ABK C;  1HE9 A;  3F46 A;  3Q6N A;  1APC A;  3S27 A;  1M6T A;  1OCO C;  1TWG A;  1G4U S;  2VCB A;  2UUI A;  2Z15 A;  2J8W A;  3MFN A;  4DXW A;  3UMH A;  1HY5 A;  4K0D A;  1BBH A;  3RVZ A;  3AG4 C;  2F22 A;  4GQH A;  2HV6 A;  1T01 A;  4JCZ A;  1Q0G A;  4PAC A;  3M1C B;  4G78 A;  4CS7 A;  1YA7 O;  2J7P D;  1VLT A;  3DWW A;  2XL4 A;  4JKV A;  1AVO B;  3GEH A;  2LSE A;  5E3C A;  3B0P A;  2AWC A;  1NFN A;  4QDL A;  4DVZ A;  1DOV A;  1CGM E;  1NU7 D;  1TR2 A;  1A7D A;  4WGY A;  3AGT A;  1G8X A;  2OOC A;  3E9V A;  4KNW A;  1HE1 A;  1OW7 A;  3NYJ A;  3POV A;  2MWQ A;  2YKZ A;  5L0C A;  1FNT c;  1Z6A A;  2A68 F;  2Y39 A;  4MVU A;  1LI5 A;  256B A;  4O6M A;  4CS8 A;  2HMQ A;  5JSL A;  3PHF 2;  2YVK A;  1FMW A;  4LER A;  3V5Y A;  2Y69 C;  4E7Z A;  3T6B A;  3EQL F;  1H9G A;  3TQO A;  3NYL A;  3NDB B;  5E2Q A;  3EHN A;  3GOD A;  3ZC4 A;  1A7E A;  4JTD B;  4YT5 A;  3MLG A;  3J06 A;  2MYS A;  2XL8 A;  1C17 M;  2XLH A;  4PK4 A;  1LI7 A;  2J9W A;  3U3B A;  2HS5 A;  1RKC A;  3KH2 A;  2LD6 A;  3DAG A;  3U8V A;  5AC4 A;  1UG7 A;  3C8G A;  3HLZ A;  5K0I A;  1OXK A;  2DYR C;  2MHR A;  2XLV A;  3GWN A;  3LNR A;  4YL0 A;  4A4A A;  1CGN A;  1YVI A;  2IYL D;  3U2M A;  5F5H A;  4CS8 C;  3ZVR A;  1XWJ A;  2C03 A;  4P6I C;  4DJ9 A;  4PFP A;  4MW8 A;  1K40 A;  2AWY A;  3X2Q C;  5DVW A;  2JX0 A;  1V74 B;  4JTC B;  2A0U A;  1QZX A;  1NZE A;  2ASR A;  4PJM A;  4BJ5 A;  5BQG A;  1WAT A;  4DBQ A;  4QI2 A;  3KKB A;  5EGY A;  3SXZ A;  3IQT A;  3C18 A;  3LLI A;  2KQ9 A;  5FZT A;  5L3V A;  1JPJ A;  4LLE A;  1TFO B;  3SP1 A;  4XQ1 A;  3FDQ A;  1V54 C;  2AVK A;  2YL0 A;  4HE8 D;  4U5G A;  2YEV A;  2ZXP A;  3T4R A;  3ECS A;  2B0H A;  3RFY A;  5DQT A;  2H7B A;  2WVN A;  3WAQ A;  5F5F A;  1ZVZ A;  3QTH A;  2YLG A;  4MW3 A;  2JPU A;  1MMN A;  3ZTM A;  5JS5 A;  1VTM P;  4EBJ A;  2J45 A;  4BPM A;  2QUP A;  1K04 A;  2P0N A;  3AQB A;  1Z3I X;  2A1D D;  3H2V A;  2XRH A;  3S0X A;  4FX5 A;  1OKK A;  1H6G A;  3LS0 A;  1WTY A;  3HNK A;  3O6X A;  4JCH A;  4BJ5 C;  3C8G B;  1EI7 A;  1PV3 A;  2HUJ A;  3NMK A;  4IAO A;  1R4T A;  2NSF A;  3DAF A;  3QW1 A;  4NTF A;  3JCU Q;  3UGO A;  1NFO A;  3QZC A;  3DKA A;  3JT1 A;  4IB4 A;  2EIJ C;  2XLO A;  1T6I A;  3HNI A;  2ZXO A;  4NTB A;  3GEI A;  3IEE A;  2IXO A;  3HNJ A;  2IBF A;  4YJW A;  3V7O A;  2QE9 A;  3EGD A;  3LUT B;  1H9T A;  3GOR A;  4J32 B;  3SXM A;  5HV9 A;  1JR8 A;  3KMI A;  4W8K A;  3VM6 A;  3EH1 A;  5B3I A;  4IRU A;  5L0I A;  3DM9 B;  3NRH A;  1F1M A;  5D91 A;  3W2V A;  4IAR A;  5D92 A;  4LLC A;  4ONS A;  1A41 A;  4YL1 A;  3DE9 A;  4DRI B;  1HW1 A;  3L34 A;  2R7Q A;  2WVO A;  3N0T A;  4EBK A;  3AG1 C;  2A6E F;  3O55 A;  5EHH A;  2G3V A;  3ZSU A;  1ZU5 A;  3Q7L A;  3ZQV A;  2NUT A;  3FAP B;  1I4Z A;  4JVS A;  5A6J A;  4C3B A;  3UMI A;  4Q5S F;  1M2O A;  3U2L A;  2GWW A;  5T1D B;  4BG0 A;  5L0D A;  2R7W A;  2J0W A;  1Q0M A;  1YZA A;  3ASN C;  4J7Y A;  4Z9I A;  3TJ6 A;  4CDY A;  3B0U X;  1PD0 A;  4ULW A;  2DB4 A;  1TWA A;  2P7V A;  4JJF A;  2P61 A;  3U9M A;  2HV7 A;  3HJC A;  5JUA A;  3EJN A;  3B71 A;  1U6H A;  3IPM O;  3AG3 C;  3HTK C;  2IXN A;  2IXP A;  2KSF A;  1D1B A;  1LE4 A;  2LQG A;  2WZF A;  1JOG A;  3EGD B;  4D4X A;  2NUP A;  4F4B A;  4C3D A;  4FAP B;  4HFK B;  4IWB A;  1FR0 A;  5AC5 A;  5BQH A;  3TD7 A;  4YT8 A;  1BZ4 A;  2L6F A;  3EHM A;  4AX2 A;  2J9V A;  3RYL A;  1U0B B;  1Z63 A;  2LFF A;  3WG7 C;  3QMK A;  4N6C A;  1W2W A;  1L3P A;  3S9O A;  4IGG A;  5AGF A;  4FWV A;  4UDV A;  5E33 A;  4MVZ A;  3EH2 A;  4RD9 A;  1BR4 A;  1ORY A;  2JD3 A;  1RKE A;  2OKU A;  2YLI A;  5T3W A;  3W8I A;  4XLP F;  2NUT B;  3RF3 A;  2Y3G A;  1MMD A;  2HSB A;  1TKN A;  1FMV A;  5A6B D;  3G4X A;  4M63 A;  2YL3 A;  3ABM C;  5T3T A;  4CDV A;  3ZQY A;  3SNH A;  3PCV A;  1WOL A;  1LS4 A;  1L7C A;  1OR3 A;  2EIL C;  3EPV A;  1CPQ A;  4XLN F;  3WHN A;  2QTV A;  3DM5 A;  1LKX A;  3FXH A;  4NY3 A;  5JRA A;  3L8J A;  1K05 A;  2NG1 A;  4I44 A;  2KGO A;  3LJB A;  2H8A A;  3T6J A;  2XLD A;  3W4Y A;  3RVY A;  4MND A;  1N1C A;  2R7O A;  2NUP B;  2PFD A;  4NQF A;  3ABL C;  2VCC A;  2VCA A;  3I4U A;  5KYW A;  4OD5 A;  1J8Y F;  2EIM C;  2FAP B;  4O6Y A;  4L6R A;  3TOL A;  1LVK A;  5COF A;  2YHS A;  2YLD A;  2ICW G;  1NBB A;  2BL2 A;  4I1O B;  3HKK A;  3TK0 A;  2OEV A;  1VOM A;  2RSE B;  2XL6 A;  3ZG1 A;  4JE9 A;  2OJQ A;  2H7O A;  4RDA A;  1KNY A;  3LEO A;  2B0J A;  2IM8 A;  1A0B A;  2V26 A;  4IJJ A;  4U5E E;  1DOW A;  1RKE B;  5JLI A;  2CNW A;  4X0R A;  5COM A;  2R7T A;  1OR2 A;  1QKR A;  2V3C C;  3O39 A;  2P1A A;  2Q00 A;  4OIR F;  2EPN A;  3TJ5 A;  3NMI A;  1GQA A;  2PX0 A;  4R32 A;  4KBL A;  1R5I D;  4CBE A;  2HMZ A;  2PF4 E;  4BJ6 A;  1ST6 A;  3EG9 A;  3U9J A;  3UNG C;  5DLJ A;  2KYH A;  3ASO C;  3LS1 A;  4HFF B;  3ZTZ A;  2FGY A;  2O9X A;  5KYN A;  2R7V A;  2XXA A;  1ZZP A;  1I4Y A;  4FES A;  2DYS C;  5HSW A;  2J0X A;  1UFB A;  2Y3B A;  4MTG A;  1ZHY A;  3ZDL A;  4JIO A;  1FFT C;  4YT2 A;  1E86 A;  1XZQ A;  3C8Z A;  1JMW A;  5CI9 A;  1SMY F;  4CIH A;  2LFD A;  5KYW B;  1ZHX A;  4OIO F;  4LDR A;  3U3F A;  2HKV A;  3M4B A;  1Z7Q c;  3M4C A;  3FMS A;  2L7A A;  3VAY A;  3DZA A;  3SXK A;  4YN0 B;  2CGE A;  3SYN A;  4PJN A;  1NG1 A;  3K6B A;  4YK5 A;  3SZR A;  1D1C A;  1IZM A;  2J9B A;  2PX3 A;  4N06 A;  4U9E A;  4BJ6 C;  4CJO A;  4EHP A;  2DGJ A;  4Z9J A;  2DI3 A;  4CSA A;  4LAC B;  3I5P A;  3C8G D;  3W8H A;  1RMV A;  4OD4 A;  4ANJ A;  2IXM A;  2GDC A;  3CEX A;  1Q0D A;  4PJJ A;  4RBN A;  3QVZ A;  4PFO A;  1VYK A;  4MVS A;  4OIP F;  4YWQ A;  2NPU A;  2CCY A;  3F47 A;  4OIN F;  3UR3 C;  4ZLD A;  1QVX A;  1VLS A;  3EG9 B;  4O6N A;  3B0V C;  2OCC C;  1ZHZ A;  3C62 A;  3JSZ A;  3NMJ A;  3OWT A;  1XZP A;  3C63 A;  3CSK A;  4E0H A;  2XXA B;  3OEO A;  2OQM A;  2YRF A;  1MQV A;  4J7T A;  4BEJ A;  4U5F E;  1OW8 A;  5JP7 A;  4CSA C;  2W4M A;  2X51 A;  5L0J A;  4I3M A;  4C7O A;  2GA0 A;  1LS1 A;  3GAN A;  3O10 A;  1WAS A;  2D5R B;  2LCH A;  4NCQ A;  5L0H A;  2XLW A;  2OEX A;  1IW7 F;  4E0I A;  1ZHW A;  2VB6 A;  1D1A A;  2FFH A;  4E17 A;  1MND A;  3VYW A;  4EKW A;  1TQG A;  3DI5 A;  5CIV A;  1YJG A;  3LNM B;  2PP4 A;  1ZW2 A;  3K7D A;  2NSG A;  4AL1 A;  1S05 A;  1OKK D;  2ZPA A;  4DRH B;  3FVY A;  4JJG A;  4DRJ B;  4DOZ A;  2LK4 A;  1BR1 A;  2YL7 A;  2YZS A;  1ZU4 A;  3S90 A;  1SR2 A;  3L8I A;  1S7Z A;  1T5O A;  3AG2 C;  1RCP A;  3LAY A;  4XEK A;  3B9Q A;  1QQ3 A;  3KL4 A;  1T6U A;  4P9T A;  2BC5 A;  3A11 A;  4N6H A;  4CDA A;  1Y6D A;  1TWC A;  1GGQ A;  3FOO A;  3MX3 A;  1VMA A;  4XTK A;  3RQF A;  3T9O A;  4WAB A;  2R03 A;  2EIK C;  1RXQ A;  2KNH A;  3JSE O;  1YAR O;  3KYJ A;  3MYF A;  4GYT A;  1QSP A;  1LIH A;  3MBG A;  2GAQ A;  1A7V A;  1Q0F A;  1YAU O;  3TUL A;  1I5N A;  2J7P A;  3JRM O;  1PD1 A;  5L0F A;  5BQI A;  3V5Z A;  1HMO A;  1O87 A;  2HJM A;  4MTO A;  3Q7G A;  1E84 A;  2HZ8 A;  3RKO F;  1LE2 A;  4E18 A;  1FFH A;  3T6G B;  3U8P A;  4C7O B;  4JEA A;  4WGZ A;  3CZ6 A;  3JRT A;  3M15 A;  2L9J A;  5EK0 A;  1YZC A;  4I1M A;  4HEA J;  1ORS C;  2XLE A;  3AJM A;  3QVY A;  5FCL A;  2L81 A;  3LEV A;  2ZXW C;  1D0Z A;  4XWJ A;  3IQ5 A;  2EPK X;  2L6H A;  2HSQ A;  1VK5 A;  4JRZ A;  3DXJ F;  4JC7 A;  4KNV A;  1MMA A;  4AL0 A;  4DBR A;  4CIP A;  2Q4F A;  3DJN B;  3C7J A;  2W4B A;  3AGU A;  3BEH A;  3CAX A;  4U5B E;  2CYD A;  3GM1 A;  4DVY P;  4ER9 A;  5DS4 A;  2QY9 A;  3L1M A;  1SZI A;  1WN0 A;  4J30 B;  1VB5 A;  3K1I A;  3SXY A;  4N4W A;  2R7U A;  1MNE A;  3U5S A;  3Q6M A;  3N24 A;  1NSG B;  2P6V A;  1GS9 A;  1VYI A;  1GM5 A;  5B1B C;  2PBE A;  2G3K A;  1E2X A;  4BJ1 A;  3R2P A;  3NKD A;  1NLX A;  1Q0K A;  3BRJ A;  1E85 A;  1WGW A;  1YYX A;  4KI2 A;  2I8B A;  2M64 A;  1ZW3 A;  2E87 A;  1G5Z A;  2L6G A;  2LP4 A;  3DD7 A;  3K33 A;  3KYI A;  1M2V A;  1CPR A;  5TJ5 E;  4CS9 A;  4U5H A;  2G62 A;  2Q7R A;  5A6A A;  3R7C A;  1D0Y A;  2EPO A;  4EWC A;  2R02 A;  1H7I A;  4MVM A;  4E7S A;  2Q9A A;  2ZD9 A;  1RJ9 A;  2W9Y A;  2IOQ A;  3K1I C;  1OCZ C;  3TOM A;  1ZHT A;  3GM2 A;  2VC9 A;  4H54 A;  1OCR C;  1M56 C;  1C03 A;  4BEM J;  2HJ3 A;  4ZLC A;  5DQZ A;  3JZ0 A;  2WB7 A;  4Q4Z F;  4XEF A;  5GPG B;  2OJE D;  2WL8 A;  1EKY A;  3FAJ A;  3IHU A;  4CS9 C;  4PR9 A;  4AK9 A;  4CJG A;  1Z23 A;  1JPN A;  3JTL O;  3X1O A;  5L3Q A;  3S84 A;  3U0C A;  5KYX A;  1WWP A;  4Q7C A;  2Q9C A;  2A6H F;  4MVR A;  3ZWI A;  1BR2 A;  2CDQ A;  2I15 A;  5DS6 A;  1M57 C;  1OXB A;  1Y4C A;  2GFH A;  4QI0 A;  3G50 A;  5B3S C;  2R7R A;  1YYJ A;  1ZYR F;  1M2V B;  2Y3D A;  1AUE A;  1KU2 A;  1TWH A;  2W45 A;  1U89 A;  4AE4 A;  2WZG A;  4H4K C;  4JW1 A;  1E83 A;  2XLM A;  1SYQ A;  2Y3H A;  2YQY A;  4P9F A;  3RIP A;  3RQE A;  1NU9 C;  1OW6 A;  3EFO A;  1MMG A;  4IAQ A;  1V4A A;  5A6K A;  1RJ9 B;  3B29 A;  5KYX B;  2EPL X;  1JRA A;  2CNW D;  3S28 A;  3FOP A;  5E3A A;  2AU5 A;  4U9D A;  1B68 A;  4JEB A;  3EZH A;  4U5D E;  2ETS A;  3PDM P;  4EIY A;  3HNL A;  3SEO A;  5JT4 A;  5KYY A;  3UGP A;  2XM4 A;  2ZXR A;  2QLA A;  1ORJ A;  3KPH A;  3WOD F;  1JAF A;  4C3E A;  3AQC A;  3JYY A;  5IY5 C;  1PCX A;  3IQ6 A;  2QNL A;  2YWA A;  3A9C A;  3MYI A;  1EA8 A;  4B6I A;  4ULV A;  1TFK B;  5CI8 A;  3OA1 A;  2VH3 A;  4WJ0 A;  4GEH A;  2AP3 A;  2EPM X;  4G0H A;  4G7O F;  3NKE A;  3M79 A;  2H7V C;  2A0B A;  1FTS A;  1Z5Z A;  2BE5 F;  3EZI A;  4XPX A;  2Q3T A;  1SF8 A;  1HMD A;  1AEP A;  5COG A;  5BUO A;  1HW2 A;  2R7X A;  2XM0 A;  4NTA A;  2XS1 A;  1CGO A;  1V55 C;  3DJU B;  1QPU A;  2XSE A;  3VF0 A;  4EUK B;  3S29 A;  4MQ9 F;  1YLM A;  4BJT A;  5A69 A;  2CW0 F;  2EIN C;  2X0C A;  4PJL A;  1D0X A;  3LES A;  2PNO A;  2D4U A;  3GEE A;  4D4N A;  2UUH A;  4AE4 B;  3AOU A;  2R05 A;  3EGX A;  4YL3 A;  3RW0 A;  1YA9 A;  2OG2 A;  3JYH A;  4K7B A;  3GM3 A;  3EFO B;  1OQC A;  5KYU A;  3RH3 A;  4XPY A;  2HFI A;  2Q9B A;  1C02 A;  2OU6 A;  3K66 A;  1J8M F;  1O5H A;  2WZL A;  3GWL A;  3IQC A;  4G7H F;  4JTA B;  3DE8 A;  4NC3 A;  3CQZ A;  3QW0 A;  1FAP B;  2J46 A;  3UMK A;  2KW3 C;  2RD9 A;  4JUR I;  5JVE A;  3L0I A;  5KYY B;  3RQG A;  4G7Z F;  2TMV P;  4EBB A;  4U5C E;  2XS8 A;  2R7S A;  2VAS A;  2M4E A;  3ATP A;  4W8P A;  5A6B A;  3VRC A;  4LDK A;  3FHD A;  3K1H A;  5F28 E;  3W2W A;  1KTM A;  4Z9H A;  3US6 A;  1LPE A;  2KK1 A;  4LDQ A;  4XEV A;  2WVQ A;  3NG1 A;  4MTF A;  2KJG A;  1QLE C;  2LIG A;  3I5Q A;  5B1A C;  4O7G A;  3G4Z A;  1O3U A;  3E70 C;  2C04 A;  3V5X A;  4KC9 A;  3N2Z B;  1YDI A;  4MS2 A; 
#chains in the Genus database with same CATH homology
 1LM3 B;  1CPR A;  5B3I A;  3M4B A;  3M4C A;  2YL1 A;  4IAR A;  3DE9 A;  2J9B A;  4U9E A;  3TOM A;  4CX9 A;  4CJO A;  1APC A;  3ZQV A;  1M6T A;  2J8W A;  1BBH A;  1YZA A;  3QVZ A;  4CDY A;  2CCY A;  4CJG A;  4JKV A;  3NMJ A;  3C62 A;  5JUA A;  3C63 A;  1MQV A;  3ZWI A;  4WGY A;  4D4X A;  5JP7 A;  1YYJ A;  2YKZ A;  2XLW A;  256B A;  5JSL A;  1E83 A;  2XLM A;  4IAQ A;  5AGF A;  1S05 A;  3FOP A;  2XL8 A;  2XLH A;  4U9D A;  2YLI A;  2YL7 A;  4JEB A;  1RCP A;  3HNL A;  4EIY A;  1QQ3 A;  5JT4 A;  2XM4 A;  2YL3 A;  2QLA A;  2BC5 A;  1JAF A;  4CDV A;  4N6H A;  3ZQY A;  4CDA A;  3IQ6 A;  2XLV A;  3FOO A;  4ULV A;  1CGN A;  1CPQ A;  5JRA A;  3M79 A;  1A7V A;  2XLD A;  2XM0 A;  1CGO A;  1QPU A;  1E84 A;  3U8P A;  4JEA A;  3TOL A;  4WGZ A;  2YL0 A;  4L6R A;  4D4N A;  2YLD A;  3M15 A;  1YZC A;  2XLE A;  1NBB A;  3QVY A;  2XL6 A;  3IQ5 A;  4JE9 A;  2YLG A;  3ZTM A;  5JS5 A;  5JLI A;  4CIP A;  3DE8 A;  4NC3 A;  3QW0 A;  4ER9 A;  3HNK A;  5JVE A;  3L1M A;  3NMI A;  1GQA A;  3NMK A;  3QW1 A;  4N4W A;  4IB4 A;  3VRC A;  2XLO A;  3HNI A;  3ZTZ A;  3HNJ A;  1E85 A;  1YYX A;  1E86 A;  1EKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...