2YLGA

Cytochrome c prime from alcaligenes xylosoxidans: ascorbate and carbon monooxide bound l16a variant at 1.05 a resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 51
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2ylgA00
1NBBA 1APCA 1JAFA 2YKZA 3DE9A 3DE8A 1A7VA 2YLIA 2CCYA 4JKVA 3M4BA 1CGOA 2J9BA 1CPQA 2J8WA 3QW0A 2XM0A 2XL8A 4WGYA 1QPUA 2YL1A 2YLGA 3TOLA 4IB4A 3M79A 3NMKA 5JUAA 3HNJA 3L1MA 2XLMA 1EKYA 3HNIA 3U8PA 3ZQVA 5JVEA 4IAQA 4U9EA 4CX9A 1LM3B 4CDVA 2XL6A 5AGFA 1E83A 2XLOA 1YYXA 4CJOA 4JEAA 2YL7A 1RCPA 4NC3A 3IQ5A 5B3IA 3M15A 3ZTMA 4CDAA 4ULVA 1GQAA 1E85A 3FOOA 3ZQYA 5JP7A 1MQVA 3QVYA 1YZCA 1YYJA 2YLDA 4D4NA 3NMJA 2XLDA 2YL0A 3C62A 4U9DA 2XLHA 5JS5A 2XLWA 3ZWIA 1M6TA 4JE9A 4N4WA 3M4CA 5JLIA 5JRAA 2XLVA 3IQ6A 3QVZA 3C63A 4IARA 1BBHA 3ZTZA 2YL3A 4CJGA 3VRCA 3HNKA 4ER9A 2XM4A 4CDYA 4D4XA 2QLAA 4N6HA 5JSLA 4CIPA 1CGNA 2XLEA 1S05A 5JT4A 256BA 3FOPA 4JEBA 2BC5A 1YZAA 1E84A 4L6RA 3QW1A 3HNLA 1E86A 3NMIA 4WGZA 1QQ3A 4EIYA 1CPRA 3TOMA
chains in the Genus database with same CATH superfamily
2L7AA 5CIVA 1NBBA 1RJ9B 4YN0B 2OKUA 1B68A 2KC3A 2WZGA 3TULA 2AWYA 3FAPB 2DYRC 4MVZA 2MYSA 2ZPAA 1TKNA 3EG9A 2Q9BA 2XXAB 1QLEC 4AK9A 4O6NA 2JX0A 1VYKA 3LEOA 3E70C 1RKEB 2IYLD 1YAUO 1I5NA 4IAOA 4NCQA 4I44A 2CCYA 1OCOC 3L8IA 4JKVA 1NSGB 2J0XA 1CGOA 2WZFA 2Y69C 3SP1A 2W9YA 2CYDA 3PDMP 2L9JA 3U2MA 3L34A 1LPEA 3GM2A 1MMGA 1T9KA 1CPQA 2H7VC 3EFOB 1ZVZA 1C02A 2XM0A 1ZHWA 2O9XA 3C8ZA 3K33A 2ZXOA 4H54A 1UG7A 1D0ZA 2P6VA 1RXQA 1TWCA 2LSEA 4IB4A 2X51A 3JYYA 2R7XA 3DJUB 3O39A 1DOVA 1LE4A 1H7IA 1D1AA 3ZIBA 1L3PA 2Q00A 1ORYA 2QY9A 3ITFA 4KBLA 3ZC4A 2G3VA 2WB7A 3EGXB 2J46A 3ZQVA 5DQTA 5JVEA 2V3CC 4MNDA 2R7UA 2VH3A 4U9EA 4EBJA 5BQHA 4O7GA 2CNWA 3HLZA 4CDVA 2XL6A 2QE9A 1PV3A 1YYXA 2R7WA 2A6HF 2PF4E 1NZEA 4DRJB 1O87A 3DMDA 2YL7A 3C18A 1YA7O 2XRHA 4LLEA 2OJED 4WJ0A 1OXBA 2J7PA 3RQEA 1K04A 3EZIA 1JMWA 4H4KC 5L0IA 1SYQA 4W8PA 4EBKA 1A41A 4DRHB 1WOLA 2B0HA 1XZQA 4EKWA 4Q5SF 1LIHA 4LLCA 5D92A 1TR2A 1A0BA 3EZHA 5KYNA 2HS5A 4JZAA 1HMOA 4PJJA 3DWWA 4B6IA 2H7OA 4G7ZF 1M57C 4I1OB 4EUKB 5T3WA 4MTFA 1JPJA 1M56C 5CI9A 4JJFA 1OCZC 4CBEA 1OW6A 3FHDA 2R7RA 5KYUA 2I15A 4NQFA 2GFHA 2NG1A 2Q9CA 4C3BA 5A69A 5A6BD 4YT4A 2R05A 2YLDA 3U9MA 2LCHA 2H8AA 2A68F 2RSEB 4JURI 1LS4A 1NFNA 1ZYRF 2HKVA 4FWVA 1EQ1A 1ZHZA 2G62A 2XSEA 4JW1A 4JE9A 1JR8A 2D5RB 3M4CA 2Q3TA 1NFOA 3AQBA 3IEEA 1OR3A 3TD7A 4UDVA 1QKRA 3K6BA 2ETSA 2WVOA 2BE5F 3KL4A 2R03A 1VLSA 4IARA 4IRUA 4MS2A 3GM1A 2YL3A 3GM3A 4CJGA 3J06A 4YT5A 4FESA 3ASNC 4ULWA 1J8MF 3HNKA 3RQFA 4XEVA 4U5FE 4Z9HA 2A69F 3QTHA 4XWJA 2NSFA 5COGA 4AL0A 4DVYP 2DI3A 2HSQA 5JSLA 1A7DA 3VM6A 2R7TA 3OEOA 2XLEA 2W4BA 2KYHA 4ONSA 3FOPA 4XPWA 5L0JA 2FAPB 4X0RA 5BUOA 4M63A 1I4YA 1ZW3A 3AG4C 2NSGA 3E9VA 1D1BA 3QW1A 1EI7A 4KC9A 5E33A 3RH3A 4Q7CA 1LKXA 3NMIA 3OWTA 4BEJA 2NPUA 5KYWA 3N24A 2A6EF 3GODA 4JCZA 4JJGA 3W8IA 5HSWA 3G50A 3WAQA 1AUEA 3U0CA 2LIGA 1APCA 1Q0GA 4CS9A 3S28A 1H9TA 4YT8A 2YZSA 3SXMA 5DQZA 2DB4A 4CSAC 3DE9A 4DVZA 5COMA 2PNOA 3DE8A 2CNWD 4FX5A 3U3BA 1R4TA 5KYYA 1OQCA 2VCBA 2DYSC 2Y39A 2QNLA 4PACA 5DVWA 4U5CE 2X0CA 2Q4FA 5BQGA 4ZLCA 2DGJA 4CSAA 1TFKB 1RMVA 3U9JA 3IHUA 1FAPB 2IXMA 2ICWG 2XL8A 3BRJA 3MYFA 4R32A 4AE4B 3CSKA 1QPUA 3MBGA 2YLGA 4E18A 3MLGA 3TOLA 4P6IC 3RW0A 3QZCA 3RIPA 4MVSA 4LDQA 3T4RA 4YT2A 3L1MA 1VB5A 5E2QA 2XLMA 3W8HA 3B0UX 1ORSC 2WVQA 4C7OA 3UMKA 1LE2A 4XEKA 5B1BC 1C17M 3IQTA 1Y6DA 2JPUA 4XPXA 4G0HA 4QI0A 5KYXA 5HV9A 2VB6A 4JIOA 2XLOA 3VYWA 5A6JA 3AJMA 2OCCC 2HJ3A 2L6HA 4U5HA 3EG9B 2EPLX 1RKCA 3O6XA 4MW3A 3FVYA 1C03A 3TJ6A 1BR2A 1MNDA 2LK4A 1QSPA 3DXJF 3DM9B 4NC3A 4NTFA 1WASA 3R7CA 4XTKA 1UFBA 1LS1A 1HE9A 1NU9C 3ZTMA 4PFPA 4CS7A 1GQAA 5DS5A 2OQMA 3ZVRA 3I5PA 5L3VA 1E85A 2XS8A 1K05A 2CDQA 4JRZA 3ZQYA 1YARO 3LEVA 5A6AA 3KKBA 3S9OA 2P1AA 2NUPA 2NUTB 3DM5A 5DLJA 2M4EA 4Z9IA 3K1IA 3OA1A 3ABKC 1YZCA 4J7YA 4K0DA 4DBQA 4U5EE 1GM5A 4HEAJ 5COFA 1HY5A 3NG1A 1SF8A 2KNHA 3UR3C 3N0TA 5L3QA 4D4NA 2Q7RA 2R7SA 1CGME 1YA9A 4MVUA 4W8KA 5CI8A 1JOGA 2Y3GA 2KJGA 3RVYA 5JRAA 2D4UA 4LACB 2XS1A 2YEVA 1BBHA 1JPNA 5D91A 2MHRA 3HKKA 3ZTZA 4DXWA 3KYJA 2AWCA 1EA8A 2R7OA 1WGWA 1N1CA 3VRCA 4JTCB 1Q0KA 3V5YA 4PR9A 2QLAA 2HFIA 2IM8A 1T6UA 4MW8A 2J0WA 4G7OF 3GORA 3DKAA 2IXOA 3S29A 3RVZA 1F1MA 1Z63A 1VYIA 4EWCA 4KI2A 5AC5A 2OU6A 4YK5A 1H6GA 2ASRA 4MTOA 3U8VA 1ST6A 1SMYF 3JRTA 2C04A 3AGUA 5TJ5E 3HNLA 4CIHA 3X1OA 2LP4A 2PX0A 5L0DA 1OR2A 1MMDA 2EILC 1GGQA 5KYUB 1E86A 3CQZA 4EIYA 1HE1A 2OEXA 3TOMA 4NY3A 3LNMB 3FXHA 4PJMA 4F4BA 4XLPF 2HJMA 1OKKA 1S7ZA 1ZHYA 3KH2A 3LNRA 3U3FA 3C8GA 1XWJA 2YKZA 2LQGA 1M2VB 2HMZA 1Z23A 1Y4CA 2VCCA 3S84A 1A7VA 4CX9A 3KPHA 1U0BB 2LFFA 1I4ZA 1U6HA 1E2XA 2EINC 3DD7A 1DOWA 3NYLA 3O10A 4BJTA 1Z6AA 3M4BA 2CGEA 3Q6NA 3JZ0A 1QZXA 1YLMA 1ZU4A 2J9BA 2HV7A 5F5FA 4A4AA 1R5ID 4EHPA 3KYIA 3QW0A 2I8BA 4I3MA 1LVKA 1SZIA 3EGDA 3HTKC 3AG2C 4MQ9F 2LD6A 3RKOF 1BR4A 5F28E 2YL1A 2J45A 1XZPA 2OEVA 4CS9C 5L0HA 3H2VA 3M79A 3NMKA 5JUAA 2A1DD 3HNJA 2PBEA 5GPGB 4BEMJ 1KTMA 4MVRA 2BL2A 1PD0A 3B0VC 3POVA 2A0BA 3HNIA 1TWAA 4MVMA 2AU5A 3U8PA 3MYIA 2AVKA 5KYWB 2EPKX 2OG2A 1WN0A 3BEHA 3G4XA 4JTAB 3U2LA 3ZDLA 4JCHA 3B9QA 2KGOA 4U5BE 3QMKA 1V55C 2ZXWC 1Z3IX 3AGTA 3V7OA 3R2PA 4PJLA 4FAPB 3ABLC 3RYLA 2J9UA 2UUHA 3WHNA 4JC7A 3PMRA 3O55A 2C03A 2L81A 3EH1A 4GYTA 3EQLF 3TJ5A 5FZTA 1TQGA 3LS1A 3LESA 1M2OA 2J7PD 1Q0MA 5KYYB 4HFFB 3IQ5A 4OIQF 2J9VA 2GWWA 5B3IA 3JRMO 4BPMA 3ASOC 1G4WR 1AEPA 1A7EA 2L6FA 3M15A 2HSBA 4A2NB 4CDAA 3LAYA 1MNEA 2WVNA 4BJ5C 3MFNA 1VK5A 3NKEA 3Q6MA 5EHHA 1T6QA 4NTAA 3SXYA 4J32B 3GANA 3RFYA 3V5ZA 4PK4A 2HUJA 3F47A 3NKDA 4BJ5A 1T5OA 4XLNF 4AE4A 3JSEO 5L0CA 2KQ9A 2QUPA 2KK1A 1BR1A 4C7OB 3Q7GA 4Z9JA 3VAYA 4EBBA 1T6IA 3NMJA 4E7ZA 4OIOF 1IZMA 1GS9A 2YL0A 5A6KA 4OIPF 1RJ9A 2XLHA 5JS5A 1MMAA 2XLWA 1AVOB 3KMIA 2A0UA 1ZU5A 2H7BA 3GEEA 3L0IA 4HE8D 4N06A 1G4US 4G78A 4N4WA 1PCXA 2XLVA 3CAXA 3DZAA 2VCAA 1VTMP 3C63A 2EPMX 3QVZA 2J9WA 2XXAA 3AOUA 1NU7D 1OCRC 1OKKD 2KSFA 2E87A 3ABMC 4J7TA 3C8GD 1RKEA 3GWNA 2MWQA 3K1IC 1FNTc 2XM4A 3JCUQ 4CDYA 3EPVA 1V74B 3UMHA 4D4XA 3ATPA 3T6GB 5K0IA 4N6HA 1ZHXA 5B1AC 3UMIA 4DRIB 1VMAA 1CGNA 3EFOA 4AX2A 4E0IA 1SR2A 5T1DB 256BA 4JEBA 2B0JA 3AG1C 1MMNA 3F46A 3TK0A 3C7JA 1Z7Qc 1D1CA 2BC5A 1YZAA 1OW7A 3AG3C 3EHMA 4L6RA 2V26A 2EIKC 2NUPB 3B29A 1W2WA 2WL8A 2R25A 3LLKA 3T9OA 5BQIA 3US6A 2GAQA 4WGZA 2P0NA 3FAJA 5AC4A 1QVXA 1QQ3A 2HV6A 2PX3A 3RF3A 5B3SC 4K7BA 1OXKA 1WATA 3EGXA 1O3UA 1ORJA 1FTSA 2IOQA 2NUTA 4C3EA 1D0YA 3LJBA 1TFOB 2VC9A 2VASA 1FFHA 1TWGA 1L7CA 1HW1A 4OD5A 4XEFA 2YQYA 1TWHA 2EIJC 3EJNA 3JT1A 4Q4ZF 4CS8C 2WZLA 5L0FA 1JAFA 1YJGA 2L6GA 2PP4A 4IGGA 3B71A 3S27A 2GDCA 3SNHA 3GEHA 2KW3C 1VOMA 1FMWA 2YLIA 2GA0A 4CS8A 5EK0A 3EHNA 3Q7LA 3GEIA 2Q9AA 3CEXA 2XL4A 4GEHA 4LERA 4YJWA 4BJ6C 4YL3A 2W45A 2FGYA 3A11A 2HZ8A 4JTDB 2J8WA 4DJ9A 2Y3HA 4DOZA 2IXNA 3K7DA 3EH2A 3NYMA 2P61A 4WGYA 1BZ4A 4BJ6A 4RD9A 4ZLDA 2R9RB 2R7QA 3SZRA 2ZXPA 4K1OA 2AP3A 1U89A 4WABA 1D0XA 3NYJA 2OOCA 4RDAA 2YVKA 4MVQA 2QTVA 5DS6A 3DAGA 2Y3DA 1EKYA 1K40A 1Z5ZA 3MX3A 3DI5A 4NTBA 4I1MA 1Q0DA 2F22A 3FMSA 1WTYA 3SYNA 3M1CB 4IAQA 4O6YA 3TQOA 1Q0FA 4JVSA 3V5XA 3JSZA 3W2WA 1LM3B 1PD1A 1V4AA 3GWLA 3JYHA 1FMVA 3ZG1A 2YRFA 4KNWA 4N6CA 5AGFA 5T3TA 1E83A 3JTLO 2TMVP 2PFDA 3C8GB 4GQHA 4CJOA 4JEAA 4AL1A 2UUIA 2CW0F 2ZD9A 2G3KA 3H65A 3I4UA 3IQCA 4E17A 1RCPA 3NRHA 3UNGC 3DJNB 3HJCA 1ZZPA 4BG0A 2OJQA 1M2VA 5E3AA 1LI5A 2LFDA 4O79A 3PCVA 5L0GA 2ZXRA 4J30B 4QDLA 5EGYA 2EPNA 4ULVA 3DAFA 3U5SA 3S0XA 3AQCA 3WODF 1HMDA 4U5GA 3EGDB 2EPOA 3FOOA 2EIMC 5DS4A 3L8JA 4E0HA 3T6BA 3SXZA 4LDRA 3I5QA 3LLIA 3LUTB 4XPYA 1FFTC 1YDIA 2YHSA 3SEOA 5JP7A 3N2ZB 4P9FA 3NDBB 1MQVA 1WWPA 3LS0A 3QVYA 1OW8A 5FCLA 1KNYA 1YYJA 4HFKB 2IBFA 2M64A 4MVOA 3H2UA 4YL0A 3RQGA 2XLDA 3K1HA 3B0PA 3C62A 4U9DA 5E3CA 1JRAA 2FFHA 4RBNA 4O6MA 4QI2A 3S90A 3ZWIA 4YWQA 1O5HA 1M6TA 1ZW2A 2R02A 2Z15A 5JLIA 3UGPA 3SXKA 4OIRF 3IQ6A 4MTGA 1VLTA 3VF0A 3W2VA 4ANJA 1G5ZA 4PJNA 4C3DA 3PHF2 2RD9A 3T6JA 2P7VA 3ZSUA 4OINF 4YL1A 1NG1A 1IW7F 3IPMO 1J8YF 4ER9A 4G7HF 4E7SA 2HMQA 4IJJA 3UGOA 3FDQA 4DBRA 4CIPA 4P9TA 5IY5C 1S05A 5JT4A 1T01A 1OCCC 3W4YA 5A6BA 3X2QC 1G8XA 4LDKA 3G4ZA 1FR0A 1E84A 1ZHTA 3K66A 5F5HA 4PFOA 1HW2A 2W4MA 3CZ6A 4XQ1A 1KU2A 2YWAA 1V54C 2IXPA 2JD3A 4OD4A 2Y3BA 4BJ1A 3A9CA 1YVIA 5KYXB 1H9GA 1NLXA 3ECSA 4IWBA 1LI7A 2R7VA 3WG7C 4KNVA 1BDJB 1CPRA 4U5DE
chains in the Genus database with same CATH topology
1NBBA 1APCA 1JAFA 2YKZA 3DE9A 3DE8A 1A7VA 2YLIA 2CCYA 4JKVA 3M4BA 1CGOA 2J9BA 1CPQA 2J8WA 3QW0A 2XM0A 2XL8A 4WGYA 1QPUA 2YL1A 2YLGA 3TOLA 4IB4A 3M79A 3NMKA 5JUAA 3HNJA 3L1MA 2XLMA 1EKYA 3HNIA 3U8PA 3ZQVA 5JVEA 4IAQA 4U9EA 4CX9A 1LM3B 4CDVA 2XL6A 5AGFA 1E83A 2XLOA 1YYXA 4CJOA 4JEAA 2YL7A 1RCPA 4NC3A 3IQ5A 5B3IA 3M15A 3ZTMA 4CDAA 4ULVA 1GQAA 1E85A 3FOOA 3ZQYA 5JP7A 1MQVA 3QVYA 1YZCA 1YYJA 2YLDA 4D4NA 3NMJA 2XLDA 2YL0A 3C62A 4U9DA 2XLHA 5JS5A 2XLWA 3ZWIA 1M6TA 4JE9A 4N4WA 3M4CA 5JLIA 5JRAA 2XLVA 3IQ6A 3QVZA 3C63A 4IARA 1BBHA 3ZTZA 2YL3A 4CJGA 3VRCA 3HNKA 4ER9A 2XM4A 4CDYA 4D4XA 2QLAA 4N6HA 5JSLA 4CIPA 1CGNA 2XLEA 1S05A 5JT4A 256BA 3FOPA 4JEBA 2BC5A 1YZAA 1E84A 4L6RA 3QW1A 3HNLA 1E86A 3NMIA 4WGZA 1QQ3A 4EIYA 1CPRA 3TOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NBB A;  1APC A;  1JAF A;  2YKZ A;  3DE9 A;  3DE8 A;  1A7V A;  2YLI A;  2CCY A;  4JKV A;  3M4B A;  1CGO A;  2J9B A;  1CPQ A;  2J8W A;  3QW0 A;  2XM0 A;  2XL8 A;  4WGY A;  1QPU A;  2YL1 A;  2YLG A;  3TOL A;  4IB4 A;  3M79 A;  3NMK A;  5JUA A;  3HNJ A;  3L1M A;  2XLM A;  1EKY A;  3HNI A;  3U8P A;  3ZQV A;  5JVE A;  4IAQ A;  4U9E A;  4CX9 A;  1LM3 B;  4CDV A;  2XL6 A;  5AGF A;  1E83 A;  2XLO A;  1YYX A;  4CJO A;  4JEA A;  2YL7 A;  1RCP A;  4NC3 A;  3IQ5 A;  5B3I A;  3M15 A;  3ZTM A;  4CDA A;  4ULV A;  1GQA A;  1E85 A;  3FOO A;  3ZQY A;  5JP7 A;  1MQV A;  3QVY A;  1YZC A;  1YYJ A;  2YLD A;  4D4N A;  3NMJ A;  2XLD A;  2YL0 A;  3C62 A;  4U9D A;  2XLH A;  5JS5 A;  2XLW A;  3ZWI A;  1M6T A;  4JE9 A;  4N4W A;  3M4C A;  5JLI A;  5JRA A;  2XLV A;  3IQ6 A;  3QVZ A;  3C63 A;  4IAR A;  1BBH A;  3ZTZ A;  2YL3 A;  4CJG A;  3VRC A;  3HNK A;  4ER9 A;  2XM4 A;  4CDY A;  4D4X A;  2QLA A;  4N6H A;  5JSL A;  4CIP A;  1CGN A;  2XLE A;  1S05 A;  5JT4 A;  256B A;  3FOP A;  4JEB A;  2BC5 A;  1YZA A;  1E84 A;  4L6R A;  3QW1 A;  3HNL A;  1E86 A;  3NMI A;  4WGZ A;  1QQ3 A;  4EIY A;  1CPR A;  3TOM A; 
#chains in the Genus database with same CATH topology
 2L7A A;  5CIV A;  1NBB A;  1RJ9 B;  4YN0 B;  2OKU A;  1B68 A;  2KC3 A;  2WZG A;  3TUL A;  2AWY A;  3FAP B;  2DYR C;  4MVZ A;  2MYS A;  2ZPA A;  1TKN A;  3EG9 A;  2Q9B A;  2XXA B;  1QLE C;  4AK9 A;  4O6N A;  2JX0 A;  1VYK A;  3LEO A;  3E70 C;  1RKE B;  2IYL D;  1YAU O;  1I5N A;  4IAO A;  4NCQ A;  4I44 A;  2CCY A;  1OCO C;  3L8I A;  4JKV A;  1NSG B;  2J0X A;  1CGO A;  2WZF A;  2Y69 C;  3SP1 A;  2W9Y A;  2CYD A;  3PDM P;  2L9J A;  3U2M A;  3L34 A;  1LPE A;  3GM2 A;  1MMG A;  1T9K A;  1CPQ A;  2H7V C;  3EFO B;  1ZVZ A;  1C02 A;  2XM0 A;  1ZHW A;  2O9X A;  3C8Z A;  3K33 A;  2ZXO A;  4H54 A;  1UG7 A;  1D0Z A;  2P6V A;  1RXQ A;  1TWC A;  2LSE A;  4IB4 A;  2X51 A;  3JYY A;  2R7X A;  3DJU B;  3O39 A;  1DOV A;  1LE4 A;  1H7I A;  1D1A A;  3ZIB A;  1L3P A;  2Q00 A;  1ORY A;  2QY9 A;  3ITF A;  4KBL A;  3ZC4 A;  2G3V A;  2WB7 A;  3EGX B;  2J46 A;  3ZQV A;  5DQT A;  5JVE A;  2V3C C;  4MND A;  2R7U A;  2VH3 A;  4U9E A;  4EBJ A;  5BQH A;  4O7G A;  2CNW A;  3HLZ A;  4CDV A;  2XL6 A;  2QE9 A;  1PV3 A;  1YYX A;  2R7W A;  2A6H F;  2PF4 E;  1NZE A;  4DRJ B;  1O87 A;  3DMD A;  2YL7 A;  3C18 A;  1YA7 O;  2XRH A;  4LLE A;  2OJE D;  4WJ0 A;  1OXB A;  2J7P A;  3RQE A;  1K04 A;  3EZI A;  1JMW A;  4H4K C;  5L0I A;  1SYQ A;  4W8P A;  4EBK A;  1A41 A;  4DRH B;  1WOL A;  2B0H A;  1XZQ A;  4EKW A;  4Q5S F;  1LIH A;  4LLC A;  5D92 A;  1TR2 A;  1A0B A;  3EZH A;  5KYN A;  2HS5 A;  4JZA A;  1HMO A;  4PJJ A;  3DWW A;  4B6I A;  2H7O A;  4G7Z F;  1M57 C;  4I1O B;  4EUK B;  5T3W A;  4MTF A;  1JPJ A;  1M56 C;  5CI9 A;  4JJF A;  1OCZ C;  4CBE A;  1OW6 A;  3FHD A;  2R7R A;  5KYU A;  2I15 A;  4NQF A;  2GFH A;  2NG1 A;  2Q9C A;  4C3B A;  5A69 A;  5A6B D;  4YT4 A;  2R05 A;  2YLD A;  3U9M A;  2LCH A;  2H8A A;  2A68 F;  2RSE B;  4JUR I;  1LS4 A;  1NFN A;  1ZYR F;  2HKV A;  4FWV A;  1EQ1 A;  1ZHZ A;  2G62 A;  2XSE A;  4JW1 A;  4JE9 A;  1JR8 A;  2D5R B;  3M4C A;  2Q3T A;  1NFO A;  3AQB A;  3IEE A;  1OR3 A;  3TD7 A;  4UDV A;  1QKR A;  3K6B A;  2ETS A;  2WVO A;  2BE5 F;  3KL4 A;  2R03 A;  1VLS A;  4IAR A;  4IRU A;  4MS2 A;  3GM1 A;  2YL3 A;  3GM3 A;  4CJG A;  3J06 A;  4YT5 A;  4FES A;  3ASN C;  4ULW A;  1J8M F;  3HNK A;  3RQF A;  4XEV A;  4U5F E;  4Z9H A;  2A69 F;  3QTH A;  4XWJ A;  2NSF A;  5COG A;  4AL0 A;  4DVY P;  2DI3 A;  2HSQ A;  5JSL A;  1A7D A;  3VM6 A;  2R7T A;  3OEO A;  2XLE A;  2W4B A;  2KYH A;  4ONS A;  3FOP A;  4XPW A;  5L0J A;  2FAP B;  4X0R A;  5BUO A;  4M63 A;  1I4Y A;  1ZW3 A;  3AG4 C;  2NSG A;  3E9V A;  1D1B A;  3QW1 A;  1EI7 A;  4KC9 A;  5E33 A;  3RH3 A;  4Q7C A;  1LKX A;  3NMI A;  3OWT A;  4BEJ A;  2NPU A;  5KYW A;  3N24 A;  2A6E F;  3GOD A;  4JCZ A;  4JJG A;  3W8I A;  5HSW A;  3G50 A;  3WAQ A;  1AUE A;  3U0C A;  2LIG A;  1APC A;  1Q0G A;  4CS9 A;  3S28 A;  1H9T A;  4YT8 A;  2YZS A;  3SXM A;  5DQZ A;  2DB4 A;  4CSA C;  3DE9 A;  4DVZ A;  5COM A;  2PNO A;  3DE8 A;  2CNW D;  4FX5 A;  3U3B A;  1R4T A;  5KYY A;  1OQC A;  2VCB A;  2DYS C;  2Y39 A;  2QNL A;  4PAC A;  5DVW A;  4U5C E;  2X0C A;  2Q4F A;  5BQG A;  4ZLC A;  2DGJ A;  4CSA A;  1TFK B;  1RMV A;  3U9J A;  3IHU A;  1FAP B;  2IXM A;  2ICW G;  2XL8 A;  3BRJ A;  3MYF A;  4R32 A;  4AE4 B;  3CSK A;  1QPU A;  3MBG A;  2YLG A;  4E18 A;  3MLG A;  3TOL A;  4P6I C;  3RW0 A;  3QZC A;  3RIP A;  4MVS A;  4LDQ A;  3T4R A;  4YT2 A;  3L1M A;  1VB5 A;  5E2Q A;  2XLM A;  3W8H A;  3B0U X;  1ORS C;  2WVQ A;  4C7O A;  3UMK A;  1LE2 A;  4XEK A;  5B1B C;  1C17 M;  3IQT A;  1Y6D A;  2JPU A;  4XPX A;  4G0H A;  4QI0 A;  5KYX A;  5HV9 A;  2VB6 A;  4JIO A;  2XLO A;  3VYW A;  5A6J A;  3AJM A;  2OCC C;  2HJ3 A;  2L6H A;  4U5H A;  3EG9 B;  2EPL X;  1RKC A;  3O6X A;  4MW3 A;  3FVY A;  1C03 A;  3TJ6 A;  1BR2 A;  1MND A;  2LK4 A;  1QSP A;  3DXJ F;  3DM9 B;  4NC3 A;  4NTF A;  1WAS A;  3R7C A;  4XTK A;  1UFB A;  1LS1 A;  1HE9 A;  1NU9 C;  3ZTM A;  4PFP A;  4CS7 A;  1GQA A;  5DS5 A;  2OQM A;  3ZVR A;  3I5P A;  5L3V A;  1E85 A;  2XS8 A;  1K05 A;  2CDQ A;  4JRZ A;  3ZQY A;  1YAR O;  3LEV A;  5A6A A;  3KKB A;  3S9O A;  2P1A A;  2NUP A;  2NUT B;  3DM5 A;  5DLJ A;  2M4E A;  4Z9I A;  3K1I A;  3OA1 A;  3ABK C;  1YZC A;  4J7Y A;  4K0D A;  4DBQ A;  4U5E E;  1GM5 A;  4HEA J;  5COF A;  1HY5 A;  3NG1 A;  1SF8 A;  2KNH A;  3UR3 C;  3N0T A;  5L3Q A;  4D4N A;  2Q7R A;  2R7S A;  1CGM E;  1YA9 A;  4MVU A;  4W8K A;  5CI8 A;  1JOG A;  2Y3G A;  2KJG A;  3RVY A;  5JRA A;  2D4U A;  4LAC B;  2XS1 A;  2YEV A;  1BBH A;  1JPN A;  5D91 A;  2MHR A;  3HKK A;  3ZTZ A;  4DXW A;  3KYJ A;  2AWC A;  1EA8 A;  2R7O A;  1WGW A;  1N1C A;  3VRC A;  4JTC B;  1Q0K A;  3V5Y A;  4PR9 A;  2QLA A;  2HFI A;  2IM8 A;  1T6U A;  4MW8 A;  2J0W A;  4G7O F;  3GOR A;  3DKA A;  2IXO A;  3S29 A;  3RVZ A;  1F1M A;  1Z63 A;  1VYI A;  4EWC A;  4KI2 A;  5AC5 A;  2OU6 A;  4YK5 A;  1H6G A;  2ASR A;  4MTO A;  3U8V A;  1ST6 A;  1SMY F;  3JRT A;  2C04 A;  3AGU A;  5TJ5 E;  3HNL A;  4CIH A;  3X1O A;  2LP4 A;  2PX0 A;  5L0D A;  1OR2 A;  1MMD A;  2EIL C;  1GGQ A;  5KYU B;  1E86 A;  3CQZ A;  4EIY A;  1HE1 A;  2OEX A;  3TOM A;  4NY3 A;  3LNM B;  3FXH A;  4PJM A;  4F4B A;  4XLP F;  2HJM A;  1OKK A;  1S7Z A;  1ZHY A;  3KH2 A;  3LNR A;  3U3F A;  3C8G A;  1XWJ A;  2YKZ A;  2LQG A;  1M2V B;  2HMZ A;  1Z23 A;  1Y4C A;  2VCC A;  3S84 A;  1A7V A;  4CX9 A;  3KPH A;  1U0B B;  2LFF A;  1I4Z A;  1U6H A;  1E2X A;  2EIN C;  3DD7 A;  1DOW A;  3NYL A;  3O10 A;  4BJT A;  1Z6A A;  3M4B A;  2CGE A;  3Q6N A;  3JZ0 A;  1QZX A;  1YLM A;  1ZU4 A;  2J9B A;  2HV7 A;  5F5F A;  4A4A A;  1R5I D;  4EHP A;  3KYI A;  3QW0 A;  2I8B A;  4I3M A;  1LVK A;  1SZI A;  3EGD A;  3HTK C;  3AG2 C;  4MQ9 F;  2LD6 A;  3RKO F;  1BR4 A;  5F28 E;  2YL1 A;  2J45 A;  1XZP A;  2OEV A;  4CS9 C;  5L0H A;  3H2V A;  3M79 A;  3NMK A;  5JUA A;  2A1D D;  3HNJ A;  2PBE A;  5GPG B;  4BEM J;  1KTM A;  4MVR A;  2BL2 A;  1PD0 A;  3B0V C;  3POV A;  2A0B A;  3HNI A;  1TWA A;  4MVM A;  2AU5 A;  3U8P A;  3MYI A;  2AVK A;  5KYW B;  2EPK X;  2OG2 A;  1WN0 A;  3BEH A;  3G4X A;  4JTA B;  3U2L A;  3ZDL A;  4JCH A;  3B9Q A;  2KGO A;  4U5B E;  3QMK A;  1V55 C;  2ZXW C;  1Z3I X;  3AGT A;  3V7O A;  3R2P A;  4PJL A;  4FAP B;  3ABL C;  3RYL A;  2J9U A;  2UUH A;  3WHN A;  4JC7 A;  3PMR A;  3O55 A;  2C03 A;  2L81 A;  3EH1 A;  4GYT A;  3EQL F;  3TJ5 A;  5FZT A;  1TQG A;  3LS1 A;  3LES A;  1M2O A;  2J7P D;  1Q0M A;  5KYY B;  4HFF B;  3IQ5 A;  4OIQ F;  2J9V A;  2GWW A;  5B3I A;  3JRM O;  4BPM A;  3ASO C;  1G4W R;  1AEP A;  1A7E A;  2L6F A;  3M15 A;  2HSB A;  4A2N B;  4CDA A;  3LAY A;  1MNE A;  2WVN A;  4BJ5 C;  3MFN A;  1VK5 A;  3NKE A;  3Q6M A;  5EHH A;  1T6Q A;  4NTA A;  3SXY A;  4J32 B;  3GAN A;  3RFY A;  3V5Z A;  4PK4 A;  2HUJ A;  3F47 A;  3NKD A;  4BJ5 A;  1T5O A;  4XLN F;  4AE4 A;  3JSE O;  5L0C A;  2KQ9 A;  2QUP A;  2KK1 A;  1BR1 A;  4C7O B;  3Q7G A;  4Z9J A;  3VAY A;  4EBB A;  1T6I A;  3NMJ A;  4E7Z A;  4OIO F;  1IZM A;  1GS9 A;  2YL0 A;  5A6K A;  4OIP F;  1RJ9 A;  2XLH A;  5JS5 A;  1MMA A;  2XLW A;  1AVO B;  3KMI A;  2A0U A;  1ZU5 A;  2H7B A;  3GEE A;  3L0I A;  4HE8 D;  4N06 A;  1G4U S;  4G78 A;  4N4W A;  1PCX A;  2XLV A;  3CAX A;  3DZA A;  2VCA A;  1VTM P;  3C63 A;  2EPM X;  3QVZ A;  2J9W A;  2XXA A;  3AOU A;  1NU7 D;  1OCR C;  1OKK D;  2KSF A;  2E87 A;  3ABM C;  4J7T A;  3C8G D;  1RKE A;  3GWN A;  2MWQ A;  3K1I C;  1FNT c;  2XM4 A;  3JCU Q;  4CDY A;  3EPV A;  1V74 B;  3UMH A;  4D4X A;  3ATP A;  3T6G B;  5K0I A;  4N6H A;  1ZHX A;  5B1A C;  3UMI A;  4DRI B;  1VMA A;  1CGN A;  3EFO A;  4AX2 A;  4E0I A;  1SR2 A;  5T1D B;  256B A;  4JEB A;  2B0J A;  3AG1 C;  1MMN A;  3F46 A;  3TK0 A;  3C7J A;  1Z7Q c;  1D1C A;  2BC5 A;  1YZA A;  1OW7 A;  3AG3 C;  3EHM A;  4L6R A;  2V26 A;  2EIK C;  2NUP B;  3B29 A;  1W2W A;  2WL8 A;  2R25 A;  3LLK A;  3T9O A;  5BQI A;  3US6 A;  2GAQ A;  4WGZ A;  2P0N A;  3FAJ A;  5AC4 A;  1QVX A;  1QQ3 A;  2HV6 A;  2PX3 A;  3RF3 A;  5B3S C;  4K7B A;  1OXK A;  1WAT A;  3EGX A;  1O3U A;  1ORJ A;  1FTS A;  2IOQ A;  2NUT A;  4C3E A;  1D0Y A;  3LJB A;  1TFO B;  2VC9 A;  2VAS A;  1FFH A;  1TWG A;  1L7C A;  1HW1 A;  4OD5 A;  4XEF A;  2YQY A;  1TWH A;  2EIJ C;  3EJN A;  3JT1 A;  4Q4Z F;  4CS8 C;  2WZL A;  5L0F A;  1JAF A;  1YJG A;  2L6G A;  2PP4 A;  4IGG A;  3B71 A;  3S27 A;  2GDC A;  3SNH A;  3GEH A;  2KW3 C;  1VOM A;  1FMW A;  2YLI A;  2GA0 A;  4CS8 A;  5EK0 A;  3EHN A;  3Q7L A;  3GEI A;  2Q9A A;  3CEX A;  2XL4 A;  4GEH A;  4LER A;  4YJW A;  4BJ6 C;  4YL3 A;  2W45 A;  2FGY A;  3A11 A;  2HZ8 A;  4JTD B;  2J8W A;  4DJ9 A;  2Y3H A;  4DOZ A;  2IXN A;  3K7D A;  3EH2 A;  3NYM A;  2P61 A;  4WGY A;  1BZ4 A;  4BJ6 A;  4RD9 A;  4ZLD A;  2R9R B;  2R7Q A;  3SZR A;  2ZXP A;  4K1O A;  2AP3 A;  1U89 A;  4WAB A;  1D0X A;  3NYJ A;  2OOC A;  4RDA A;  2YVK A;  4MVQ A;  2QTV A;  5DS6 A;  3DAG A;  2Y3D A;  1EKY A;  1K40 A;  1Z5Z A;  3MX3 A;  3DI5 A;  4NTB A;  4I1M A;  1Q0D A;  2F22 A;  3FMS A;  1WTY A;  3SYN A;  3M1C B;  4IAQ A;  4O6Y A;  3TQO A;  1Q0F A;  4JVS A;  3V5X A;  3JSZ A;  3W2W A;  1LM3 B;  1PD1 A;  1V4A A;  3GWL A;  3JYH A;  1FMV A;  3ZG1 A;  2YRF A;  4KNW A;  4N6C A;  5AGF A;  5T3T A;  1E83 A;  3JTL O;  2TMV P;  2PFD A;  3C8G B;  4GQH A;  4CJO A;  4JEA A;  4AL1 A;  2UUI A;  2CW0 F;  2ZD9 A;  2G3K A;  3H65 A;  3I4U A;  3IQC A;  4E17 A;  1RCP A;  3NRH A;  3UNG C;  3DJN B;  3HJC A;  1ZZP A;  4BG0 A;  2OJQ A;  1M2V A;  5E3A A;  1LI5 A;  2LFD A;  4O79 A;  3PCV A;  5L0G A;  2ZXR A;  4J30 B;  4QDL A;  5EGY A;  2EPN A;  4ULV A;  3DAF A;  3U5S A;  3S0X A;  3AQC A;  3WOD F;  1HMD A;  4U5G A;  3EGD B;  2EPO A;  3FOO A;  2EIM C;  5DS4 A;  3L8J A;  4E0H A;  3T6B A;  3SXZ A;  4LDR A;  3I5Q A;  3LLI A;  3LUT B;  4XPY A;  1FFT C;  1YDI A;  2YHS A;  3SEO A;  5JP7 A;  3N2Z B;  4P9F A;  3NDB B;  1MQV A;  1WWP A;  3LS0 A;  3QVY A;  1OW8 A;  5FCL A;  1KNY A;  1YYJ A;  4HFK B;  2IBF A;  2M64 A;  4MVO A;  3H2U A;  4YL0 A;  3RQG A;  2XLD A;  3K1H A;  3B0P A;  3C62 A;  4U9D A;  5E3C A;  1JRA A;  2FFH A;  4RBN A;  4O6M A;  4QI2 A;  3S90 A;  3ZWI A;  4YWQ A;  1O5H A;  1M6T A;  1ZW2 A;  2R02 A;  2Z15 A;  5JLI A;  3UGP A;  3SXK A;  4OIR F;  3IQ6 A;  4MTG A;  1VLT A;  3VF0 A;  3W2V A;  4ANJ A;  1G5Z A;  4PJN A;  4C3D A;  3PHF 2;  2RD9 A;  3T6J A;  2P7V A;  3ZSU A;  4OIN F;  4YL1 A;  1NG1 A;  1IW7 F;  3IPM O;  1J8Y F;  4ER9 A;  4G7H F;  4E7S A;  2HMQ A;  4IJJ A;  3UGO A;  3FDQ A;  4DBR A;  4CIP A;  4P9T A;  5IY5 C;  1S05 A;  5JT4 A;  1T01 A;  1OCC C;  3W4Y A;  5A6B A;  3X2Q C;  1G8X A;  4LDK A;  3G4Z A;  1FR0 A;  1E84 A;  1ZHT A;  3K66 A;  5F5H A;  4PFO A;  1HW2 A;  2W4M A;  3CZ6 A;  4XQ1 A;  1KU2 A;  2YWA A;  1V54 C;  2IXP A;  2JD3 A;  4OD4 A;  2Y3B A;  4BJ1 A;  3A9C A;  1YVI A;  5KYX B;  1H9G A;  1NLX A;  3ECS A;  4IWB A;  1LI7 A;  2R7V A;  3WG7 C;  4KNV A;  1BDJ B;  1CPR A;  4U5D E; 
#chains in the Genus database with same CATH homology
 1NBB A;  1APC A;  1JAF A;  2YKZ A;  3DE9 A;  3DE8 A;  1A7V A;  2YLI A;  2CCY A;  4JKV A;  3M4B A;  1CGO A;  2J9B A;  1CPQ A;  2J8W A;  3QW0 A;  2XM0 A;  2XL8 A;  4WGY A;  1QPU A;  2YL1 A;  2YLG A;  3TOL A;  4IB4 A;  3M79 A;  3NMK A;  5JUA A;  3HNJ A;  3L1M A;  2XLM A;  1EKY A;  3HNI A;  3U8P A;  3ZQV A;  5JVE A;  4IAQ A;  4U9E A;  4CX9 A;  1LM3 B;  4CDV A;  2XL6 A;  5AGF A;  1E83 A;  2XLO A;  1YYX A;  4CJO A;  4JEA A;  2YL7 A;  1RCP A;  4NC3 A;  3IQ5 A;  5B3I A;  3M15 A;  3ZTM A;  4CDA A;  4ULV A;  1GQA A;  1E85 A;  3FOO A;  3ZQY A;  5JP7 A;  1MQV A;  3QVY A;  1YZC A;  1YYJ A;  2YLD A;  4D4N A;  3NMJ A;  2XLD A;  2YL0 A;  3C62 A;  4U9D A;  2XLH A;  5JS5 A;  2XLW A;  3ZWI A;  1M6T A;  4JE9 A;  4N4W A;  3M4C A;  5JLI A;  5JRA A;  2XLV A;  3IQ6 A;  3QVZ A;  3C63 A;  4IAR A;  1BBH A;  3ZTZ A;  2YL3 A;  4CJG A;  3VRC A;  3HNK A;  4ER9 A;  2XM4 A;  4CDY A;  4D4X A;  2QLA A;  4N6H A;  5JSL A;  4CIP A;  1CGN A;  2XLE A;  1S05 A;  5JT4 A;  256B A;  3FOP A;  4JEB A;  2BC5 A;  1YZA A;  1E84 A;  4L6R A;  3QW1 A;  3HNL A;  1E86 A;  3NMI A;  4WGZ A;  1QQ3 A;  4EIY A;  1CPR A;  3TOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...