2YLGA

Cytochrome c prime from alcaligenes xylosoxidans: ascorbate and carbon monooxide bound l16a variant at 1.05 a resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSAATLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 51
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2ylgA00
5JRAA 4CX9A 4L6RA 1M6TA 3NMJA 3HNJA 1QQ3A 3TOLA 5JUAA 1CGNA 4JEBA 4EIYA 3FOOA 4CDVA 1QPUA 5B3IA 2J8WA 4IAQA 4CJGA 2QLAA 5AGFA 5JLIA 2YL0A 1MQVA 2YKZA 2XLHA 4WGZA 5JP7A 1BBHA 256BA 2YLGA 3FOPA 2YLDA 5JVEA 2XLOA 1YYJA 3TOMA 3VRCA 4CDAA 3C62A 1LM3B 1APCA 2XLEA 3NMIA 3HNIA 4IB4A 3NMKA 2XLMA 2YL3A 3ZTZA 1YZCA 3DE9A 3QVZA 1CGOA 4U9EA 3ZWIA 4WGYA 3M4BA 2XM4A 2YL1A 4JEAA 2YL7A 4NC3A 1CPQA 1A7VA 3U8PA 3ZQYA 4D4XA 1JAFA 1GQAA 4CDYA 1E85A 1YYXA 5JS5A 3IQ6A 2XLWA 3ZQVA 4CIPA 1RCPA 4D4NA 3M15A 3M79A 4N6HA 3DE8A 1S05A 4JE9A 2XM0A 3L1MA 4ER9A 4CJOA 1NBBA 1EKYA 2BC5A 4U9DA 3HNKA 3C63A 2CCYA 2XLVA 3M4CA 3IQ5A 2XL6A 4ULVA 4N4WA 5JSLA 4IARA 3ZTMA 4JKVA 1E84A 3QW0A 1E86A 2XL8A 5JT4A 2XLDA 3HNLA 1CPRA 2YLIA 2J9BA 3QW1A 1YZAA 3QVYA 1E83A
chains in the Genus database with same CATH superfamily
5JRAA 4JVSA 4JCHA 4MTGA 3PHF2 3EZIA 1XZPA 1FFHA 1UG7A 5BQGA 3ZSUA 4E0HA 3NYLA 1TR2A 3KKBA 3H2VA 1SF8A 2M4EA 3K7DA 1WOLA 4JEBA 4JTAB 2ETSA 5L0GA 3S90A 2J9WA 3DZAA 5A6AA 4YT4A 3UGPA 3N2ZB 1FMVA 4CDVA 1NZEA 1QPUA 3HJCA 4MVQA 3VAYA 4KBLA 1A41A 5FCLA 2JD3A 4OIQF 2ZXRA 1T6UA 1G4US 1TQGA 1U6HA 2R03A 2YL0A 3K66A 5CI8A 1F1MA 2Q3TA 1LPEA 4LERA 2WL8A 3C18A 3K1IC 4XPXA 4MQ9F 4NTBA 1HY5A 1AVOB 1HW2A 1WTYA 5T3TA 2VASA 4WGZA 4Q5SF 3JCUQ 3EH2A 4ONSA 1BBHA 3FOPA 4NQFA 2Q9AA 3GM1A 2LCHA 2PBEA 2Q7RA 3EZHA 3G50A 2J9UA 2EIMC 3PMRA 4EHPA 1H9GA 2LSEA 2WVQA 1YYJA 2HZ8A 3ASOC 3EGDA 4JZAA 3KPHA 5F5HA 4H54A 1LIHA 4CS8A 2BL2A 1APCA 4E18A 3U9MA 3HNIA 1KNYA 1B68A 1N1CA 4JTCB 4YK5A 5L0JA 2L6FA 5T1DB 1RKEA 1SZIA 4JW1A 2AWCA 2YHSA 2YL3A 1YZCA 3CAXA 5DS6A 2A6EF 1TWHA 3U2MA 5KYXB 3LNRA 4K7BA 4CBEA 1AEPA 3ZWIA 5L0IA 1A7DA 2JX0A 1ZHTA 4MVZA 3LS1A 1ORSC 3SNHA 1K40A 2KK1A 3AQBA 4DBRA 2YL1A 1U0BB 4C3DA 4CS7A 1Q0FA 1D0ZA 3ZQYA 2HJ3A 1JAFA 4OIOF 4JURI 2ZXPA 1E85A 5CIVA 2LFDA 4UDVA 2L6GA 3L8IA 5DS4A 2OCCC 2JPUA 2W4MA 3IQ6A 4O6MA 2XLWA 3UR3C 3ZDLA 2R7VA 1JRAA 1YDIA 1WN0A 4YJWA 1LVKA 2J7PD 2V26A 3US6A 3M79A 5A6BD 2DYSC 2L7AA 3AOUA 3G4XA 3IHUA 4CSAC 1XWJA 3DJNB 1SR2A 4WJ0A 4BJ5A 4A2NB 1AUEA 1YAUO 2OOCA 3PCVA 4R32A 5GPGB 4ER9A 2QUPA 3T9OA 4CJOA 2P1AA 2EPOA 4FWVA 3GEEA 5AC4A 1EKYA 3S27A 3C7JA 2P61A 1O3UA 3SXMA 1QVXA 4RBNA 5KYYB 1NU7D 3TJ6A 1QLEC 3GORA 3JSZA 4KNWA 3U8VA 4IAOA 1J8MF 1M2VB 1RJ9A 3ABMC 2Y3BA 5EK0A 4W8KA 3GWLA 2R7OA 3JTLO 5BQIA 4YL0A 1A0BA 5BUOA 3J06A 1M57C 1BR2A 3OEOA 4O6NA 2WZFA 2C04A 5FZTA 2VCBA 4YT5A 3I5PA 4BEJA 1YARO 3TK0A 2EINC 2KNHA 3GANA 4DRIB 2AWYA 1T6IA 3UMKA 4AE4B 4E0IA 4MNDA 2NG1A 1IZMA 4L6RA 2XS1A 3NMJA 3EGXA 5COFA 2A1DD 1LKXA 1QQ3A 4MVSA 2IOQA 3U3FA 4BJ1A 1JPNA 4PACA 4QDLA 2UUHA 1ORYA 4LDQA 1C02A 2J45A 2L81A 4JJFA 2NPUA 5T3WA 4EIYA 2ZXOA 3EPVA 3T6GB 5DS5A 1M2OA 1BDJB 3ASNC 3MLGA 1Z63A 2FGYA 1GM5A 1U89A 2LFFA 5A69A 1NSGB 4GYTA 3EFOA 4HEAJ 2J46A 3N24A 1PCXA 2P7VA 3S28A 3IQCA 3QZCA 3DD7A 2EPLX 1MMDA 3DAFA 1KU2A 5AGFA 2HS5A 3PDMP 5DQTA 2KGOA 2LP4A 3X2QC 4G7ZF 3LLIA 5E2QA 2XS8A 2C03A 1NG1A 3JRMO 5JP7A 3EJNA 5KYWB 2CGEA 3DM9B 4OIRF 2YLDA 3TQOA 5JVEA 1A7EA 2G62A 4I1MA 3DI5A 3LUTB 2XLOA 5F28E 3ABLC 3B9QA 2MHRA 2R02A 2ZPAA 3O6XA 1D1AA 4E7ZA 2HJMA 5B3SC 4OIPF 1Z3IX 2H7BA 1QSPA 2KC3A 1Y4CA 3RKOF 4PK4A 4NCQA 5E33A 1I5NA 2RD9A 2YVKA 4FESA 2G3VA 4U5DE 3RQGA 2AU5A 4IB4A 3E9VA 4FX5A 3RQEA 3NMKA 4PFOA 3ZC4A 3MBGA 1LE2A 2FFHA 3O55A 2FAPB 2VC9A 3AGUA 3DE9A 4E17A 3QVZA 1PD0A 1CGOA 4ANJA 2R7QA 1VB5A 3TULA 1H9TA 3DWWA 2XXAB 3POVA 4U9EA 2WB7A 3GM3A 4H4KC 1D0XA 3SEOA 3K6BA 3JYHA 1BZ4A 2ASRA 3F46A 2EPKX 2IXOA 4K0DA 4M63A 4MTFA 4U5FE 3IPMO 2YL7A 1NFNA 1TWAA 4KNVA 2R05A 4NC3A 4MW8A 4O79A 1A7VA 1UFBA 5IY5C 1ORJA 3Q7LA 3ATPA 1NFOA 1ZW3A 4DBQA 3B0UX 3NG1A 5COGA 4C7OB 2O9XA 1TWCA 2MYSA 1OXKA 3KH2A 4CDYA 1MMAA 1MMNA 1G4WR 3E70C 3L0IA 4IRUA 3SYNA 4EWCA 1VK5A 5K0IA 4CIPA 1RCPA 3FAPB 3RF3A 1SMYF 4MW3A 3U9JA 4MVRA 4Z9IA 3DE8A 4JE9A 3L34A 1BR1A 2H7OA 3WG7C 1OQCA 2E87A 3KMIA 4I3MA 4F4BA 3WAQA 2DGJA 2VH3A 4YT8A 1GS9A 2B0JA 1Z7Qc 4A4AA 5L0CA 3X1OA 2BC5A 2L9JA 2M64A 3HKKA 4W8PA 4EUKB 2VB6A 3O10A 4JCZA 4MS2A 4ZLDA 4BJ5C 4DVYP 3FDQA 2XLVA 2YZSA 1ZW2A 4PR9A 2R7UA 2OEVA 3K1IA 2EPNA 5AC5A 4PJJA 3EQLF 3S0XA 1LI5A 3H2UA 4N4WA 2Q9BA 2KW3C 5JSLA 3U5SA 1OCOC 2XL4A 1PV3A 3QW0A 2QTVA 3AQCA 1FR0A 1ST6A 1LI7A 2XLDA 3LS0A 2KJGA 2HSQA 3RIPA 1T6QA 4GEHA 4O7GA 2Q9CA 3S84A 4E7SA 1V55C 3RYLA 1OW6A 3FAJA 1TKNA 1ZVZA 3DKAA 5DQZA 1E83A 4HE8D 4CX9A 1GGQA 3U0CA 2OKUA 3GM2A 3DAGA 1L7CA 3NKDA 1LS1A 4NY3A 4AX2A 5F5FA 1M6TA 4XEKA 3QTHA 2YQYA 1WWPA 5E3CA 2GDCA 2HMZA 2PFDA 2Y3DA 1VLSA 3TD7A 1OKKA 1C17M 3I5QA 1K05A 5JUAA 5TJ5E 1E2XA 1O5HA 3MYFA 1RKCA 1OXBA 1QKRA 3BEHA 4C3BA 4CIHA 2QY9A 3SXYA 5KYUB 5KYYA 3ITFA 3UMHA 1FTSA 2NUPB 2CYDA 3FOOA 1XZQA 3GEIA 4U5HA 3C8GB 5B1AC 3WODF 2IXMA 4LACB 2IXPA 5B3IA 2R7RA 4BEMJ 5L3VA 1M2VA 1VOMA 4JIOA 1T5OA 4U5EE 3ZG1A 1PD1A 4XPYA 2J0WA 3S29A 4DJ9A 4G7HF 1L3PA 2EIKC 1ZZPA 5JLIA 3SXZA 3GWNA 3VF0A 3AG2C 1MQVA 3LNMB 3Q6MA 1TFOB 1W2WA 5L0HA 4PJLA 3VM6A 2WVOA 5COMA 3V7OA 2DYRC 5EHHA 3HTKC 2OEXA 3R2PA 5A6JA 1RJ9B 1VYIA 3W2WA 4FAPB 5D92A 256BA 3V5ZA 3V5XA 4BG0A 4XTKA 4B6IA 4WABA 3B29A 3UGOA 5DVWA 2R9RB 4AE4A 4CSAA 1OKKD 5L0DA 3NYMA 1MNEA 4CS9C 3MYIA 3CSKA 3ECSA 2AVKA 3EG9B 2A69F 2I8BA 4O6YA 3AG3C 3VRCA 1LM3B 4CDAA 1VTMP 2Y39A 4NTFA 3AJMA 4JRZA 2PF4E 3RQFA 2XLEA 1LS4A 4AK9A 1HW1A 4MVMA 3U2LA 2MWQA 1Q0KA 1WASA 1OCZC 1YJGA 4MVOA 2B0HA 2A6HF 4G78A 2Y3HA 3MX3A 2GA0A 4Q4ZF 2IYLD 2YEVA 4J7YA 2D5RB 4N06A 2OQMA 4EBKA 1OW7A 3A11A 3ABKC 3KYIA 5HSWA 5CI9A 2EIJC 3IEEA 4BJ6A 4U5GA 4C3EA 2Y3GA 3M4BA 1H6GA 1Q0MA 2XM4A 1TWGA 2D4UA 2VCAA 2PNOA 3LEOA 4OD5A 2OG2A 3WHNA 1JR8A 3U8PA 4D4XA 5D91A 3OWTA 2OU6A 2ICWG 2ZXWC 1ZHZA 2IBFA 4AL1A 5A6KA 1FMWA 1ZU4A 2KQ9A 2KSFA 2QE9A 1EQ1A 1OCRC 2GAQA 4XLPF 2J9VA 3ZQVA 1ZYRF 2NUTB 3EHMA 2BE5F 2LK4A 3K33A 2IXNA 2Q00A 2LD6A 2Z15A 3SP1A 2HV6A 1HE9A 3NDBB 2ZD9A 2NSFA 2CDQA 2G3KA 3H65A 1YVIA 4J7TA 3HLZA 4MTOA 4YL3A 4CS8C 2GWWA 1DOVA 3LJBA 1V4AA 3VYWA 4KI2A 2YWAA 4Q7CA 4DRHB 1V74B 3JRTA 2XXAA 3RFYA 3T4RA 3KL4A 4U9DA 1H7IA 2A68F 2UUIA 3HNKA 3B0VC 4U5CE 3W8IA 2CCYA 4HFFB 3M4CA 3IQ5A 3I4UA 4JTDB 3RVZA 5DLJA 5L3QA 1C03A 4I1OB 2X0CA 1MMGA 3AG4C 3EH1A 2PX3A 1QZXA 3LEVA 1YLMA 4JKVA 1D0YA 4DXWA 4C7OA 2R7TA 1RXQA 1WGWA 3C8ZA 4J32B 4OD4A 3HNLA 2W45A 1CPRA 2YLIA 4YL1A 3CZ6A 3GODA 2J9BA 2PP4A 1YZAA 3QVYA 4N6CA 4XWJA 4HFKB 4BPMA 4YT2A 3O39A 4IWBA 1D1BA 2X51A 4U5BE 4XPWA 5KYNA 3EGDB 4P9TA 3DMDA 3FXHA 1YA7O 3AG1C 3Q6NA 4PJMA 5KYXA 1IW7F 3HNJA 3LAYA 4LLEA 4NTAA 3TOLA 2OJED 4G0HA 4I44A 4XEVA 3W4YA 3TJ5A 1CGNA 3KYJA 1OCCC 2WZGA 1RKEB 3N0TA 1YA9A 2VCCA 1FFTC 2J7PA 4J30B 2J8WA 4IAQA 3W2VA 5A6BA 1ZHWA 3B0PA 4CJGA 5BQHA 3JT1A 4BJTA 3JSEO 3DJUB 2W4BA 2QLAA 3A9CA 3ZVRA 5EGYA 5HV9A 1Q0DA 4PJNA 1Y6DA 5L0FA 4P9FA 2YKZA 1MNDA 1OR3A 2XSEA 4MVUA 4XEFA 2XLHA 3RVYA 3ZIBA 2R7WA 2Q4FA 4KC9A 2J0XA 2HUJA 4JC7A 4YN0B 1G5ZA 1WATA 3L8JA 2V3CC 1VYKA 2YLGA 5E3AA 2CNWA 3SXKA 3UNGC 3LESA 4DVZA 4EBJA 1ZHXA 1R4TA 3EHNA 1NU9C 1S7ZA 1VLTA 4XQ1A 3SZRA 3IQTA 3TOMA 4ULWA 1R5ID 3JZ0A 4K1OA 4LDKA 3C62A 1Q0GA 4Z9HA 2I15A 4JJGA 4PFPA 3FVYA 3LLKA 3NMIA 1FAPB 5KYUA 4DRJB 1FNTc 1EA8A 3MFNA 2XLMA 2PX0A 3ZTZA 2NUPA 3R7CA 3C8GA 4Z9JA 1OR2A 3GEHA 4QI2A 1JPJA 1HE1A 3M1CB 4X0RA 4WGYA 2EPMX 2RSEB 2R7SA 1Z5ZA 3BRJA 1G8XA 1KTMA 4GQHA 1NLXA 1Z23A 1T01A 2XRHA 3G4ZA 2CNWD 4JEAA 3RW0A 4RDAA 2HFIA 1CPQA 2EILC 2HKVA 1GQAA 4YWQA 4BJ6C 3B71A 1YYXA 3NKEA 5JS5A 2NSGA 1TFKB 1J8YF 2KYHA 2QNLA 2F22A 3CQZA 3OA1A 4IGGA 4LDRA 2YRFA 3S9OA 2GFHA 4IJJA 4ZLCA 2DI3A 3EG9A 4D4NA 3M15A 4N6HA 1Z6AA 4QI0A 3U3BA 1S05A 1EI7A 2R25A 2W9YA 2A0UA 2XM0A 1O87A 3C8GD 4DOZA 3QMKA 3W8HA 1I4ZA 2Y69C 2DB4A 3DM5A 3EGXB 2P0NA 3FMSA 3L1MA 3NYJA 4RD9A 2HSBA 2HMQA 2OJQA 3UMIA 3V5YA 1NBBA 1DOWA 3FHDA 3AGTA 1V54C 3JYYA 1BR4A 2H7VC 4G7OF 1D1CA 4LLCA 4XLNF 1JMWA 2AP3A 4AL0A 3Q7GA 3C63A 1M56C 3NRHA 3RH3A 1VMAA 1RMVA 3EFOB 1OW8A 3CEXA 4EKWA 2XL6A 1ZU5A 3DXJF 4ULVA 3T6BA 5KYWA 2R7XA 1T9KA 1JOGA 1ZHYA 2LQGA 2WVNA 2P6VA 4IARA 5B1BC 3ZTMA 1E84A 1E86A 2HV7A 2XL8A 5JT4A 2IM8A 3T6JA 2L6HA 1K04A 1CGME 2H8AA 1HMOA 3QW1A 1HMDA 1LE4A 2A0BA 2CW0F 1I4YA 3F47A 1SYQA 2LIGA 4P6IC 2NUTA 3K1HA 4CS9A 4EBBA 2TMVP 2WZLA 4OINF
chains in the Genus database with same CATH topology
5JRAA 4CX9A 4L6RA 1M6TA 3NMJA 3HNJA 1QQ3A 3TOLA 5JUAA 1CGNA 4JEBA 4EIYA 3FOOA 4CDVA 1QPUA 5B3IA 2J8WA 4IAQA 4CJGA 2QLAA 5AGFA 5JLIA 2YL0A 1MQVA 2YKZA 2XLHA 4WGZA 5JP7A 1BBHA 256BA 2YLGA 3FOPA 2YLDA 5JVEA 2XLOA 1YYJA 3TOMA 3VRCA 4CDAA 3C62A 1LM3B 1APCA 2XLEA 3NMIA 3HNIA 4IB4A 3NMKA 2XLMA 2YL3A 3ZTZA 1YZCA 3DE9A 3QVZA 1CGOA 4U9EA 3ZWIA 4WGYA 3M4BA 2XM4A 2YL1A 4JEAA 2YL7A 4NC3A 1CPQA 1A7VA 3U8PA 3ZQYA 4D4XA 1JAFA 1GQAA 4CDYA 1E85A 1YYXA 5JS5A 3IQ6A 2XLWA 3ZQVA 4CIPA 1RCPA 4D4NA 3M15A 3M79A 4N6HA 3DE8A 1S05A 4JE9A 2XM0A 3L1MA 4ER9A 4CJOA 1NBBA 1EKYA 2BC5A 4U9DA 3HNKA 3C63A 2CCYA 2XLVA 3M4CA 3IQ5A 2XL6A 4ULVA 4N4WA 5JSLA 4IARA 3ZTMA 4JKVA 1E84A 3QW0A 1E86A 2XL8A 5JT4A 2XLDA 3HNLA 1CPRA 2YLIA 2J9BA 3QW1A 1YZAA 3QVYA 1E83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRA A;  4CX9 A;  4L6R A;  1M6T A;  3NMJ A;  3HNJ A;  1QQ3 A;  3TOL A;  5JUA A;  1CGN A;  4JEB A;  4EIY A;  3FOO A;  4CDV A;  1QPU A;  5B3I A;  2J8W A;  4IAQ A;  4CJG A;  2QLA A;  5AGF A;  5JLI A;  2YL0 A;  1MQV A;  2YKZ A;  2XLH A;  4WGZ A;  5JP7 A;  1BBH A;  256B A;  2YLG A;  3FOP A;  2YLD A;  5JVE A;  2XLO A;  1YYJ A;  3TOM A;  3VRC A;  4CDA A;  3C62 A;  1LM3 B;  1APC A;  2XLE A;  3NMI A;  3HNI A;  4IB4 A;  3NMK A;  2XLM A;  2YL3 A;  3ZTZ A;  1YZC A;  3DE9 A;  3QVZ A;  1CGO A;  4U9E A;  3ZWI A;  4WGY A;  3M4B A;  2XM4 A;  2YL1 A;  4JEA A;  2YL7 A;  4NC3 A;  1CPQ A;  1A7V A;  3U8P A;  3ZQY A;  4D4X A;  1JAF A;  1GQA A;  4CDY A;  1E85 A;  1YYX A;  5JS5 A;  3IQ6 A;  2XLW A;  3ZQV A;  4CIP A;  1RCP A;  4D4N A;  3M15 A;  3M79 A;  4N6H A;  3DE8 A;  1S05 A;  4JE9 A;  2XM0 A;  3L1M A;  4ER9 A;  4CJO A;  1NBB A;  1EKY A;  2BC5 A;  4U9D A;  3HNK A;  3C63 A;  2CCY A;  2XLV A;  3M4C A;  3IQ5 A;  2XL6 A;  4ULV A;  4N4W A;  5JSL A;  4IAR A;  3ZTM A;  4JKV A;  1E84 A;  3QW0 A;  1E86 A;  2XL8 A;  5JT4 A;  2XLD A;  3HNL A;  1CPR A;  2YLI A;  2J9B A;  3QW1 A;  1YZA A;  3QVY A;  1E83 A; 
#chains in the Genus database with same CATH topology
 5JRA A;  4JVS A;  4JCH A;  4MTG A;  3PHF 2;  3EZI A;  1XZP A;  1FFH A;  1UG7 A;  5BQG A;  3ZSU A;  4E0H A;  3NYL A;  1TR2 A;  3KKB A;  3H2V A;  1SF8 A;  2M4E A;  3K7D A;  1WOL A;  4JEB A;  4JTA B;  2ETS A;  5L0G A;  3S90 A;  2J9W A;  3DZA A;  5A6A A;  4YT4 A;  3UGP A;  3N2Z B;  1FMV A;  4CDV A;  1NZE A;  1QPU A;  3HJC A;  4MVQ A;  3VAY A;  4KBL A;  1A41 A;  5FCL A;  2JD3 A;  4OIQ F;  2ZXR A;  1T6U A;  1G4U S;  1TQG A;  1U6H A;  2R03 A;  2YL0 A;  3K66 A;  5CI8 A;  1F1M A;  2Q3T A;  1LPE A;  4LER A;  2WL8 A;  3C18 A;  3K1I C;  4XPX A;  4MQ9 F;  4NTB A;  1HY5 A;  1AVO B;  1HW2 A;  1WTY A;  5T3T A;  2VAS A;  4WGZ A;  4Q5S F;  3JCU Q;  3EH2 A;  4ONS A;  1BBH A;  3FOP A;  4NQF A;  2Q9A A;  3GM1 A;  2LCH A;  2PBE A;  2Q7R A;  3EZH A;  3G50 A;  2J9U A;  2EIM C;  3PMR A;  4EHP A;  1H9G A;  2LSE A;  2WVQ A;  1YYJ A;  2HZ8 A;  3ASO C;  3EGD A;  4JZA A;  3KPH A;  5F5H A;  4H54 A;  1LIH A;  4CS8 A;  2BL2 A;  1APC A;  4E18 A;  3U9M A;  3HNI A;  1KNY A;  1B68 A;  1N1C A;  4JTC B;  4YK5 A;  5L0J A;  2L6F A;  5T1D B;  1RKE A;  1SZI A;  4JW1 A;  2AWC A;  2YHS A;  2YL3 A;  1YZC A;  3CAX A;  5DS6 A;  2A6E F;  1TWH A;  3U2M A;  5KYX B;  3LNR A;  4K7B A;  4CBE A;  1AEP A;  3ZWI A;  5L0I A;  1A7D A;  2JX0 A;  1ZHT A;  4MVZ A;  3LS1 A;  1ORS C;  3SNH A;  1K40 A;  2KK1 A;  3AQB A;  4DBR A;  2YL1 A;  1U0B B;  4C3D A;  4CS7 A;  1Q0F A;  1D0Z A;  3ZQY A;  2HJ3 A;  1JAF A;  4OIO F;  4JUR I;  2ZXP A;  1E85 A;  5CIV A;  2LFD A;  4UDV A;  2L6G A;  3L8I A;  5DS4 A;  2OCC C;  2JPU A;  2W4M A;  3IQ6 A;  4O6M A;  2XLW A;  3UR3 C;  3ZDL A;  2R7V A;  1JRA A;  1YDI A;  1WN0 A;  4YJW A;  1LVK A;  2J7P D;  2V26 A;  3US6 A;  3M79 A;  5A6B D;  2DYS C;  2L7A A;  3AOU A;  3G4X A;  3IHU A;  4CSA C;  1XWJ A;  3DJN B;  1SR2 A;  4WJ0 A;  4BJ5 A;  4A2N B;  1AUE A;  1YAU O;  2OOC A;  3PCV A;  4R32 A;  5GPG B;  4ER9 A;  2QUP A;  3T9O A;  4CJO A;  2P1A A;  2EPO A;  4FWV A;  3GEE A;  5AC4 A;  1EKY A;  3S27 A;  3C7J A;  2P61 A;  1O3U A;  3SXM A;  1QVX A;  4RBN A;  5KYY B;  1NU7 D;  3TJ6 A;  1QLE C;  3GOR A;  3JSZ A;  4KNW A;  3U8V A;  4IAO A;  1J8M F;  1M2V B;  1RJ9 A;  3ABM C;  2Y3B A;  5EK0 A;  4W8K A;  3GWL A;  2R7O A;  3JTL O;  5BQI A;  4YL0 A;  1A0B A;  5BUO A;  3J06 A;  1M57 C;  1BR2 A;  3OEO A;  4O6N A;  2WZF A;  2C04 A;  5FZT A;  2VCB A;  4YT5 A;  3I5P A;  4BEJ A;  1YAR O;  3TK0 A;  2EIN C;  2KNH A;  3GAN A;  4DRI B;  2AWY A;  1T6I A;  3UMK A;  4AE4 B;  4E0I A;  4MND A;  2NG1 A;  1IZM A;  4L6R A;  2XS1 A;  3NMJ A;  3EGX A;  5COF A;  2A1D D;  1LKX A;  1QQ3 A;  4MVS A;  2IOQ A;  3U3F A;  4BJ1 A;  1JPN A;  4PAC A;  4QDL A;  2UUH A;  1ORY A;  4LDQ A;  1C02 A;  2J45 A;  2L81 A;  4JJF A;  2NPU A;  5T3W A;  4EIY A;  2ZXO A;  3EPV A;  3T6G B;  5DS5 A;  1M2O A;  1BDJ B;  3ASN C;  3MLG A;  1Z63 A;  2FGY A;  1GM5 A;  1U89 A;  2LFF A;  5A69 A;  1NSG B;  4GYT A;  3EFO A;  4HEA J;  2J46 A;  3N24 A;  1PCX A;  2P7V A;  3S28 A;  3IQC A;  3QZC A;  3DD7 A;  2EPL X;  1MMD A;  3DAF A;  1KU2 A;  5AGF A;  2HS5 A;  3PDM P;  5DQT A;  2KGO A;  2LP4 A;  3X2Q C;  4G7Z F;  3LLI A;  5E2Q A;  2XS8 A;  2C03 A;  1NG1 A;  3JRM O;  5JP7 A;  3EJN A;  5KYW B;  2CGE A;  3DM9 B;  4OIR F;  2YLD A;  3TQO A;  5JVE A;  1A7E A;  2G62 A;  4I1M A;  3DI5 A;  3LUT B;  2XLO A;  5F28 E;  3ABL C;  3B9Q A;  2MHR A;  2R02 A;  2ZPA A;  3O6X A;  1D1A A;  4E7Z A;  2HJM A;  5B3S C;  4OIP F;  1Z3I X;  2H7B A;  1QSP A;  2KC3 A;  1Y4C A;  3RKO F;  4PK4 A;  4NCQ A;  5E33 A;  1I5N A;  2RD9 A;  2YVK A;  4FES A;  2G3V A;  4U5D E;  3RQG A;  2AU5 A;  4IB4 A;  3E9V A;  4FX5 A;  3RQE A;  3NMK A;  4PFO A;  3ZC4 A;  3MBG A;  1LE2 A;  2FFH A;  3O55 A;  2FAP B;  2VC9 A;  3AGU A;  3DE9 A;  4E17 A;  3QVZ A;  1PD0 A;  1CGO A;  4ANJ A;  2R7Q A;  1VB5 A;  3TUL A;  1H9T A;  3DWW A;  2XXA B;  3POV A;  4U9E A;  2WB7 A;  3GM3 A;  4H4K C;  1D0X A;  3SEO A;  3K6B A;  3JYH A;  1BZ4 A;  2ASR A;  3F46 A;  2EPK X;  2IXO A;  4K0D A;  4M63 A;  4MTF A;  4U5F E;  3IPM O;  2YL7 A;  1NFN A;  1TWA A;  4KNV A;  2R05 A;  4NC3 A;  4MW8 A;  4O79 A;  1A7V A;  1UFB A;  5IY5 C;  1ORJ A;  3Q7L A;  3ATP A;  1NFO A;  1ZW3 A;  4DBQ A;  3B0U X;  3NG1 A;  5COG A;  4C7O B;  2O9X A;  1TWC A;  2MYS A;  1OXK A;  3KH2 A;  4CDY A;  1MMA A;  1MMN A;  1G4W R;  3E70 C;  3L0I A;  4IRU A;  3SYN A;  4EWC A;  1VK5 A;  5K0I A;  4CIP A;  1RCP A;  3FAP B;  3RF3 A;  1SMY F;  4MW3 A;  3U9J A;  4MVR A;  4Z9I A;  3DE8 A;  4JE9 A;  3L34 A;  1BR1 A;  2H7O A;  3WG7 C;  1OQC A;  2E87 A;  3KMI A;  4I3M A;  4F4B A;  3WAQ A;  2DGJ A;  2VH3 A;  4YT8 A;  1GS9 A;  2B0J A;  1Z7Q c;  4A4A A;  5L0C A;  3X1O A;  2BC5 A;  2L9J A;  2M64 A;  3HKK A;  4W8P A;  4EUK B;  2VB6 A;  3O10 A;  4JCZ A;  4MS2 A;  4ZLD A;  4BJ5 C;  4DVY P;  3FDQ A;  2XLV A;  2YZS A;  1ZW2 A;  4PR9 A;  2R7U A;  2OEV A;  3K1I A;  2EPN A;  5AC5 A;  4PJJ A;  3EQL F;  3S0X A;  1LI5 A;  3H2U A;  4N4W A;  2Q9B A;  2KW3 C;  5JSL A;  3U5S A;  1OCO C;  2XL4 A;  1PV3 A;  3QW0 A;  2QTV A;  3AQC A;  1FR0 A;  1ST6 A;  1LI7 A;  2XLD A;  3LS0 A;  2KJG A;  2HSQ A;  3RIP A;  1T6Q A;  4GEH A;  4O7G A;  2Q9C A;  3S84 A;  4E7S A;  1V55 C;  3RYL A;  1OW6 A;  3FAJ A;  1TKN A;  1ZVZ A;  3DKA A;  5DQZ A;  1E83 A;  4HE8 D;  4CX9 A;  1GGQ A;  3U0C A;  2OKU A;  3GM2 A;  3DAG A;  1L7C A;  3NKD A;  1LS1 A;  4NY3 A;  4AX2 A;  5F5F A;  1M6T A;  4XEK A;  3QTH A;  2YQY A;  1WWP A;  5E3C A;  2GDC A;  2HMZ A;  2PFD A;  2Y3D A;  1VLS A;  3TD7 A;  1OKK A;  1C17 M;  3I5Q A;  1K05 A;  5JUA A;  5TJ5 E;  1E2X A;  1O5H A;  3MYF A;  1RKC A;  1OXB A;  1QKR A;  3BEH A;  4C3B A;  4CIH A;  2QY9 A;  3SXY A;  5KYU B;  5KYY A;  3ITF A;  3UMH A;  1FTS A;  2NUP B;  2CYD A;  3FOO A;  1XZQ A;  3GEI A;  4U5H A;  3C8G B;  5B1A C;  3WOD F;  2IXM A;  4LAC B;  2IXP A;  5B3I A;  2R7R A;  4BEM J;  5L3V A;  1M2V A;  1VOM A;  4JIO A;  1T5O A;  4U5E E;  3ZG1 A;  1PD1 A;  4XPY A;  2J0W A;  3S29 A;  4DJ9 A;  4G7H F;  1L3P A;  2EIK C;  1ZZP A;  5JLI A;  3SXZ A;  3GWN A;  3VF0 A;  3AG2 C;  1MQV A;  3LNM B;  3Q6M A;  1TFO B;  1W2W A;  5L0H A;  4PJL A;  3VM6 A;  2WVO A;  5COM A;  3V7O A;  2DYR C;  5EHH A;  3HTK C;  2OEX A;  3R2P A;  5A6J A;  1RJ9 B;  1VYI A;  3W2W A;  4FAP B;  5D92 A;  256B A;  3V5Z A;  3V5X A;  4BG0 A;  4XTK A;  4B6I A;  4WAB A;  3B29 A;  3UGO A;  5DVW A;  2R9R B;  4AE4 A;  4CSA A;  1OKK D;  5L0D A;  3NYM A;  1MNE A;  4CS9 C;  3MYI A;  3CSK A;  3ECS A;  2AVK A;  3EG9 B;  2A69 F;  2I8B A;  4O6Y A;  3AG3 C;  3VRC A;  1LM3 B;  4CDA A;  1VTM P;  2Y39 A;  4NTF A;  3AJM A;  4JRZ A;  2PF4 E;  3RQF A;  2XLE A;  1LS4 A;  4AK9 A;  1HW1 A;  4MVM A;  3U2L A;  2MWQ A;  1Q0K A;  1WAS A;  1OCZ C;  1YJG A;  4MVO A;  2B0H A;  2A6H F;  4G78 A;  2Y3H A;  3MX3 A;  2GA0 A;  4Q4Z F;  2IYL D;  2YEV A;  4J7Y A;  2D5R B;  4N06 A;  2OQM A;  4EBK A;  1OW7 A;  3A11 A;  3ABK C;  3KYI A;  5HSW A;  5CI9 A;  2EIJ C;  3IEE A;  4BJ6 A;  4U5G A;  4C3E A;  2Y3G A;  3M4B A;  1H6G A;  1Q0M A;  2XM4 A;  1TWG A;  2D4U A;  2VCA A;  2PNO A;  3LEO A;  4OD5 A;  2OG2 A;  3WHN A;  1JR8 A;  3U8P A;  4D4X A;  5D91 A;  3OWT A;  2OU6 A;  2ICW G;  2ZXW C;  1ZHZ A;  2IBF A;  4AL1 A;  5A6K A;  1FMW A;  1ZU4 A;  2KQ9 A;  2KSF A;  2QE9 A;  1EQ1 A;  1OCR C;  2GAQ A;  4XLP F;  2J9V A;  3ZQV A;  1ZYR F;  2NUT B;  3EHM A;  2BE5 F;  2LK4 A;  3K33 A;  2IXN A;  2Q00 A;  2LD6 A;  2Z15 A;  3SP1 A;  2HV6 A;  1HE9 A;  3NDB B;  2ZD9 A;  2NSF A;  2CDQ A;  2G3K A;  3H65 A;  1YVI A;  4J7T A;  3HLZ A;  4MTO A;  4YL3 A;  4CS8 C;  2GWW A;  1DOV A;  3LJB A;  1V4A A;  3VYW A;  4KI2 A;  2YWA A;  4Q7C A;  4DRH B;  1V74 B;  3JRT A;  2XXA A;  3RFY A;  3T4R A;  3KL4 A;  4U9D A;  1H7I A;  2A68 F;  2UUI A;  3HNK A;  3B0V C;  4U5C E;  3W8I A;  2CCY A;  4HFF B;  3M4C A;  3IQ5 A;  3I4U A;  4JTD B;  3RVZ A;  5DLJ A;  5L3Q A;  1C03 A;  4I1O B;  2X0C A;  1MMG A;  3AG4 C;  3EH1 A;  2PX3 A;  1QZX A;  3LEV A;  1YLM A;  4JKV A;  1D0Y A;  4DXW A;  4C7O A;  2R7T A;  1RXQ A;  1WGW A;  3C8Z A;  4J32 B;  4OD4 A;  3HNL A;  2W45 A;  1CPR A;  2YLI A;  4YL1 A;  3CZ6 A;  3GOD A;  2J9B A;  2PP4 A;  1YZA A;  3QVY A;  4N6C A;  4XWJ A;  4HFK B;  4BPM A;  4YT2 A;  3O39 A;  4IWB A;  1D1B A;  2X51 A;  4U5B E;  4XPW A;  5KYN A;  3EGD B;  4P9T A;  3DMD A;  3FXH A;  1YA7 O;  3AG1 C;  3Q6N A;  4PJM A;  5KYX A;  1IW7 F;  3HNJ A;  3LAY A;  4LLE A;  4NTA A;  3TOL A;  2OJE D;  4G0H A;  4I44 A;  4XEV A;  3W4Y A;  3TJ5 A;  1CGN A;  3KYJ A;  1OCC C;  2WZG A;  1RKE B;  3N0T A;  1YA9 A;  2VCC A;  1FFT C;  2J7P A;  4J30 B;  2J8W A;  4IAQ A;  3W2V A;  5A6B A;  1ZHW A;  3B0P A;  4CJG A;  5BQH A;  3JT1 A;  4BJT A;  3JSE O;  3DJU B;  2W4B A;  2QLA A;  3A9C A;  3ZVR A;  5EGY A;  5HV9 A;  1Q0D A;  4PJN A;  1Y6D A;  5L0F A;  4P9F A;  2YKZ A;  1MND A;  1OR3 A;  2XSE A;  4MVU A;  4XEF A;  2XLH A;  3RVY A;  3ZIB A;  2R7W A;  2Q4F A;  4KC9 A;  2J0X A;  2HUJ A;  4JC7 A;  4YN0 B;  1G5Z A;  1WAT A;  3L8J A;  2V3C C;  1VYK A;  2YLG A;  5E3A A;  2CNW A;  3SXK A;  3UNG C;  3LES A;  4DVZ A;  4EBJ A;  1ZHX A;  1R4T A;  3EHN A;  1NU9 C;  1S7Z A;  1VLT A;  4XQ1 A;  3SZR A;  3IQT A;  3TOM A;  4ULW A;  1R5I D;  3JZ0 A;  4K1O A;  4LDK A;  3C62 A;  1Q0G A;  4Z9H A;  2I15 A;  4JJG A;  4PFP A;  3FVY A;  3LLK A;  3NMI A;  1FAP B;  5KYU A;  4DRJ B;  1FNT c;  1EA8 A;  3MFN A;  2XLM A;  2PX0 A;  3ZTZ A;  2NUP A;  3R7C A;  3C8G A;  4Z9J A;  1OR2 A;  3GEH A;  4QI2 A;  1JPJ A;  1HE1 A;  3M1C B;  4X0R A;  4WGY A;  2EPM X;  2RSE B;  2R7S A;  1Z5Z A;  3BRJ A;  1G8X A;  1KTM A;  4GQH A;  1NLX A;  1Z23 A;  1T01 A;  2XRH A;  3G4Z A;  2CNW D;  4JEA A;  3RW0 A;  4RDA A;  2HFI A;  1CPQ A;  2EIL C;  2HKV A;  1GQA A;  4YWQ A;  4BJ6 C;  3B71 A;  1YYX A;  3NKE A;  5JS5 A;  2NSG A;  1TFK B;  1J8Y F;  2KYH A;  2QNL A;  2F22 A;  3CQZ A;  3OA1 A;  4IGG A;  4LDR A;  2YRF A;  3S9O A;  2GFH A;  4IJJ A;  4ZLC A;  2DI3 A;  3EG9 A;  4D4N A;  3M15 A;  4N6H A;  1Z6A A;  4QI0 A;  3U3B A;  1S05 A;  1EI7 A;  2R25 A;  2W9Y A;  2A0U A;  2XM0 A;  1O87 A;  3C8G D;  4DOZ A;  3QMK A;  3W8H A;  1I4Z A;  2Y69 C;  2DB4 A;  3DM5 A;  3EGX B;  2P0N A;  3FMS A;  3L1M A;  3NYJ A;  4RD9 A;  2HSB A;  2HMQ A;  2OJQ A;  3UMI A;  3V5Y A;  1NBB A;  1DOW A;  3FHD A;  3AGT A;  1V54 C;  3JYY A;  1BR4 A;  2H7V C;  4G7O F;  1D1C A;  4LLC A;  4XLN F;  1JMW A;  2AP3 A;  4AL0 A;  3Q7G A;  3C63 A;  1M56 C;  3NRH A;  3RH3 A;  1VMA A;  1RMV A;  3EFO B;  1OW8 A;  3CEX A;  4EKW A;  2XL6 A;  1ZU5 A;  3DXJ F;  4ULV A;  3T6B A;  5KYW A;  2R7X A;  1T9K A;  1JOG A;  1ZHY A;  2LQG A;  2WVN A;  2P6V A;  4IAR A;  5B1B C;  3ZTM A;  1E84 A;  1E86 A;  2HV7 A;  2XL8 A;  5JT4 A;  2IM8 A;  3T6J A;  2L6H A;  1K04 A;  1CGM E;  2H8A A;  1HMO A;  3QW1 A;  1HMD A;  1LE4 A;  2A0B A;  2CW0 F;  1I4Y A;  3F47 A;  1SYQ A;  2LIG A;  4P6I C;  2NUT A;  3K1H A;  4CS9 A;  4EBB A;  2TMV P;  2WZL A;  4OIN F; 
#chains in the Genus database with same CATH homology
 5JRA A;  4CX9 A;  4L6R A;  1M6T A;  3NMJ A;  3HNJ A;  1QQ3 A;  3TOL A;  5JUA A;  1CGN A;  4JEB A;  4EIY A;  3FOO A;  4CDV A;  1QPU A;  5B3I A;  2J8W A;  4IAQ A;  4CJG A;  2QLA A;  5AGF A;  5JLI A;  2YL0 A;  1MQV A;  2YKZ A;  2XLH A;  4WGZ A;  5JP7 A;  1BBH A;  256B A;  2YLG A;  3FOP A;  2YLD A;  5JVE A;  2XLO A;  1YYJ A;  3TOM A;  3VRC A;  4CDA A;  3C62 A;  1LM3 B;  1APC A;  2XLE A;  3NMI A;  3HNI A;  4IB4 A;  3NMK A;  2XLM A;  2YL3 A;  3ZTZ A;  1YZC A;  3DE9 A;  3QVZ A;  1CGO A;  4U9E A;  3ZWI A;  4WGY A;  3M4B A;  2XM4 A;  2YL1 A;  4JEA A;  2YL7 A;  4NC3 A;  1CPQ A;  1A7V A;  3U8P A;  3ZQY A;  4D4X A;  1JAF A;  1GQA A;  4CDY A;  1E85 A;  1YYX A;  5JS5 A;  3IQ6 A;  2XLW A;  3ZQV A;  4CIP A;  1RCP A;  4D4N A;  3M15 A;  3M79 A;  4N6H A;  3DE8 A;  1S05 A;  4JE9 A;  2XM0 A;  3L1M A;  4ER9 A;  4CJO A;  1NBB A;  1EKY A;  2BC5 A;  4U9D A;  3HNK A;  3C63 A;  2CCY A;  2XLV A;  3M4C A;  3IQ5 A;  2XL6 A;  4ULV A;  4N4W A;  5JSL A;  4IAR A;  3ZTM A;  4JKV A;  1E84 A;  3QW0 A;  1E86 A;  2XL8 A;  5JT4 A;  2XLD A;  3HNL A;  1CPR A;  2YLI A;  2J9B A;  3QW1 A;  1YZA A;  3QVY A;  1E83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...