4K7BA

Crystal structure of extrinsic protein in photosystem ii
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
111
structure length
111
Chain Sequence
AVSSATINRARGLYGDRIAALKDAVAAGDFKAIAEEKNAFILFNSGAYPTNKAKKNAAIAQTNEIFKAIRSGDKAAVKSAYDAYMAANEIRPLPEINSNVGQGYSSEFDFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extrinsic protein in photosystem II
publication title Crystal Structure of Psb31, a Novel Extrinsic Protein of Photosystem II from a Marine Centric Diatom and Implications for Its Binding and Function
pubmed doi rcsb
source organism Chaetoceros gracilis
molecule tags Photosynthesis
total genus 41
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18240 PSII_Pbs31 Photosystem II Psb31 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1740 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4k7bA00
4K7BA
chains in the Genus database with same CATH superfamily
1BR4A 2CGEA 2XLWA 1SYQA 4CIHA 1QQ3A 5A69A 2KNHA 1A7DA 4HEAJ 3V5XA 1Z23A 2EPNA 2WZLA 4N4WA 2H7VC 5AGFA 3ZQVA 4DBQA 3ASOC 3T6GB 2XLDA 2TMVP 2J46A 2JX0A 1GQAA 2UUHA 3LAYA 4IAQA 3GWLA 4XEKA 2W45A 1N1CA 3U2LA 2VH3A 4PJLA 4EIYA 1NBBA 1QLEC 5FCLA 1V55C 2XL4A 3KYJA 3GM3A 2YRFA 2ZXOA 2OEVA 4MVQA 2R7XA 2DYSC 3VF0A 2IOQA 2BC5A 1VTMP 5T1DB 3U9JA 2I15A 4KC9A 1XWJA 2WZGA 2VASA 3I5QA 4BJ1A 5KYWA 1DOWA 4JRZA 1YYJA 3E9VA 3AG2C 4JC7A 3AQBA 4AE4B 2AU5A 2LD6A 1AEPA 1PV3A 2EIJC 2QY9A 3B29A 4O6MA 4PJJA 1EA8A 4DRJB 4MW3A 2Y39A 2YLGA 3GEIA 1Q0MA 4E17A 1FFTC 1O5HA 4CX9A 5L0JA 1UG7A 5KYNA 3ECSA 3DE9A 2IYLD 3JT1A 3ITFA 3U8PA 3X2QC 2CNWD 3DD7A 3SXYA 1TWGA 2NUPA 3GEEA 3H2UA 3M4BA 2NSGA 4XEFA 5E3AA 3TK0A 3CSKA 3TULA 4JJGA 1H9TA 3OEOA 1HE1A 4CS9A 2QNLA 1OKKD 5CIVA 1PCXA 1Z63A 4PR9A 4XPXA 3AGUA 3GM1A 3R2PA 5T3TA 3S90A 1U89A 2VCCA 4W8KA 1SMYF 3AQCA 1RKCA 3EFOA 3FHDA 4XPWA 5COMA 1NU9C 5DS6A 3LS0A 4R32A 3T6BA 4ONSA 2KYHA 1LE2A 1YVIA 2OJED 5CI9A 3AG4C 2HJMA 2Y3HA 3EQLF 4IB4A 1YJGA 3LLIA 3C62A 4MVZA 3QVYA 1OR3A 3E70C 4XEVA 1E86A 1GS9A 1U0BB 2JPUA 2EIMC 3EH2A 4BJ5A 5E2QA 3KKBA 2YL1A 4EBBA 4DRHB 1MQVA 2ZXRA 3U2MA 3LESA 3NMJA 4JCZA 3NG1A 1S05A 3LNRA 2R9RB 4K7BA 2PX3A 4EKWA 1M2VB 1OW6A 2ZXWC 3I4UA 3MX3A 2OU6A 1A41A 4G7HF 3QVZA 2HZ8A 2RD9A 4P9TA 2WB7A 3NMKA 5TJ5E 3LLKA 4U5DE 5KYUA 2YLDA 4MVRA 1LI5A 4LLEA 3RFYA 3K7DA 2A6HF 4U9DA 1OW7A 2IXPA 4PFPA 4N6CA 4N06A 4C3EA 1RKEA 3FVYA 1CGOA 2WL8A 2XM4A 1O87A 3AG1C 3ZDLA 1IZMA 1CPQA 3FAJA 4J7TA 4NTBA 2ICWG 2KJGA 2M4EA 1LM3B 1Z6AA 2IM8A 1MNEA 3EHNA 1YA7O 4MVSA 3JSZA 2R7OA 1JOGA 1BZ4A 2EPOA 2QLAA 4I3MA 3B0VC 3JYYA 5B1BC 5A6AA 1C17M 3U3FA 4KI2A 4MVUA 3TD7A 5KYXB 2ZXPA 1KNYA 3G4XA 3F47A 3TJ5A 2Y3BA 4OINF 2R7WA 4Q4ZF 4M63A 4PFOA 1J8MF 1FFHA 3VM6A 3SYNA 2CW0F 4DOZA 3B9QA 4D4XA 2EILC 2R7QA 3SXKA 1SR2A 3FOOA 3GANA 3V5ZA 2H8AA 2WVNA 3K1IC 1BR1A 2YWAA 3C8GB 3MLGA 3V7OA 1R4TA 4P9FA 3C63A 4DXWA 2YZSA 1JMWA 4Z9JA 1LS1A 1JPJA 1I5NA 1G4WR 2GDCA 4MNDA 1K04A 1E84A 2J9UA 3WHNA 3U0CA 1XZPA 4FAPB 1B68A 1Q0FA 3OWTA 5JLIA 4NQFA 1JPNA 1FTSA 3FOPA 3H2VA 2NUTA 2KQ9A 1K05A 3DM9B 3TJ6A 2AP3A 1D0XA 3DKAA 4K1OA 1YA9A 3NYMA 4QDLA 5L3QA 2E87A 1Z7Qc 1U6HA 3BRJA 3ZWIA 2LP4A 4AK9A 3W2WA 4NY3A 4CS8C 1XZQA 3H65A 3UNGC 3DAFA 3AOUA 3DI5A 3NRHA 4GQHA 4XWJA 1TWHA 5BQGA 3RF3A 3ZIBA 3ZTZA 4WJ0A 5AC4A 2L81A 1T5OA 1FR0A 2CCYA 2XL6A 4MW8A 1YARO 2Q4FA 2Y3DA 5T3WA 1T6UA 1FAPB 4OIRF 1H7IA 1OCCC 2ASRA 2DI3A 3U3BA 3RVZA 4OD5A 1ORSC 3L8JA 1BR2A 3TQOA 1A0BA 2R7SA 2J7PD 1RXQA 3BEHA 1T01A 1Z3IX 2W4BA 3JYHA 2A0UA 2D4UA 3K1IA 3VAYA 3DJUB 2LFDA 3LNMB 4ZLDA 1V4AA 2H7OA 1A7EA 3I5PA 4YL3A 3VYWA 3PMRA 3ZC4A 1DOVA 1C03A 1QPUA 3AG3C 3K1HA 5COGA 3DZAA 3IQ5A 4JJFA 4WGZA 2R25A 4YN0B 3ZVRA 3DMDA 5A6BA 2KC3A 1RJ9B 1ZYRF 2WVOA 3V5YA 2P1AA 5DS5A 4U5GA 3O10A 4A2NB 4C3DA 5A6KA 1HW2A 2XXAB 3NMIA 4G7OF 2DB4A 1TWCA 3HKKA 1YZCA 5DVWA 1TR2A 4DVYP 3HNIA 3JCUQ 5JRAA 2OG2A 2JD3A 1LS4A 1S7ZA 2R05A 3EGXA 4JVSA 3UGPA 1FNTc 3J06A 1Q0DA 1WTYA 5AC5A 1Q0GA 2A68F 3RVYA 2YHSA 2J9VA 3O6XA 1CPRA 4G78A 5KYYA 1CGNA 4WGYA 1WATA 5EHHA 4YT2A 5L0FA 4C7OB 3LJBA 3S9OA 5F28E 3W8HA 3EG9A 1AUEA 2J0WA 3KYIA 3C7JA 4KBLA 3LUTB 3ABLC 3HLZA 5JSLA 2HJ3A 1NFOA 3WG7C 3ZG1A 2KGOA 3U8VA 4MTGA 1ST6A 2P7VA 4JTDB 2ETSA 1YZAA 1BDJB 2XLOA 2XRHA 4XLPF 2F22A 4DJ9A 4CDVA 4XLNF 2EPKX 3L0IA 3TOMA 2L6HA 5EGYA 1LKXA 1MMGA 1Y6DA 2W9YA 5D92A 3R7CA 2ZD9A 3DAGA 2R7RA 1MMAA 1HW1A 5BQIA 1OCOC 1ZW2A 4Z9HA 3RKOF 2NPUA 2BL2A 2Q00A 2J8WA 1M2OA 3JTLO 3NYLA 2IXOA 2VC9A 3IHUA 3PCVA 1LE4A 2R02A 2XS8A 3NYJA 2MHRA 4LDRA 3HNKA 4E7SA 5IY5C 3GM2A 2XSEA 4Q7CA 1C02A 2HV7A 3SP1A 2L9JA 3W8IA 2Z15A 2LK4A 1YDIA 1WWPA 1L7CA 2Q9AA 3L34A 4XTKA 4OIOF 3C8ZA 5F5HA 2XL8A 3RYLA 2QE9A 4NTFA 3ZQYA 4BEMJ 3QW0A 2XS1A 4FX5A 4KNWA 2HSQA 1YAUO 4LLCA 5JP7A 2UUIA 1CGME 2XLHA 4EWCA 3F46A 4MTOA 1HMDA 1L3PA 4H54A 1F1MA 1QSPA 2HUJA 3ABKC 4YWQA 1OCRC 2PNOA 2XM0A 1M6TA 3CQZA 3QZCA 4GYTA 5FZTA 3RIPA 4BG0A 2OOCA 3S84A 2O9XA 3B0UX 2PBEA 1TFKB 5KYWB 2WZFA 1LPEA 4AL0A 1QZXA 4CSAA 1Q0KA 4U9EA 1M57C 2WVQA 4JTAB 5JUAA 1EI7A 1T6QA 3S27A 1JRAA 1ZU4A 2MYSA 3AGTA 2A6EF 4EHPA 4DBRA 2OCCC 3WAQA 3FMSA 3L1MA 3IQCA 4HE8D 1OCZC 4EUKB 4MTFA 2YL3A 4X0RA 3LEOA 4AE4A 2RSEB 4YT8A 4UDVA 2L6GA 1MMDA 2NUPB 4I44A 2YVKA 1Y4CA 2C03A 3UMHA 3HTKC 2C04A 1LVKA 3AJMA 2R7TA 4P6IC 2MWQA 5JT4A 4BPMA 3IEEA 4CDYA 2PFDA 2VCAA 4A4AA 4E0IA 3UGOA 1W2WA 3EGDA 1NZEA 1BBHA 3EFOB 2L6FA 4WABA 3GORA 3CZ6A 3N0TA 3SZRA 3N24A 1JAFA 1ZVZA 2XLMA 2HMQA 2J9BA 3M1CB 1QKRA 2EPMX 3JRTA 3ASNC 3EPVA 3FAPB 4BJ6C 4EBJA 2LQGA 2PP4A 1ZW3A 2NSFA 2VB6A 3L8IA 4K0DA 5L0DA 3PHF2 1TQGA 4U5HA 2HV6A 4KNVA 1FMVA 1WASA 2PX0A 4MS2A 4YL1A 1GM5A 2J9WA 2Y3GA 4U5CE 2XLVA 2EIKC 4QI0A 2AWCA 2CDQA 2W4MA 3DWWA 4JW1A 4ZLCA 5JVEA 4I1MA 5DQTA 3US6A 2B0HA 4O6NA 4J32B 1H6GA 4FESA 5KYUB 3JRMO 1T6IA 1SF8A 4C3BA 3JZ0A 4JTCB 4U5BE 256BA 1M2VA 4G0HA 1RKEB 3LS1A 4I1OB 2BE5F 1NLXA 4IJJA 4JZAA 2G62A 4LACB 4IWBA 3SXMA 3N2ZB 4IRUA 2FAPB 3QTHA 4CS9C 2EINC 2XLEA 4O7GA 3KPHA 2HSBA 5L0CA 3HNJA 5F5FA 4CS7A 4H4KC 1TKNA 1A7VA 3W2VA 4RD9A 3FXHA 4O79A 2P6VA 5DS4A 1OKKA 3B0PA 2HKVA 3SXZA 4Q5SF 2YLIA 1D0ZA 2G3VA 4EBKA 1OXKA 4J7YA 2DYRC 1M56C 1RMVA 1MNDA 4BJ6A 4BEJA 3GWNA 1G5ZA 2P0NA 4PJMA 1I4YA 1NFNA 3RQGA 3S29A 3VRCA 1D0YA 3EZIA 4CS8A 4YJWA 2LCHA 3T4RA 3IQ6A 5KYXA 2R03A 4BJ5C 4ULWA 4YL0A 3POVA 3K6BA 3C18A 3DE8A 2J0XA 3GEHA 5L0HA 4F4BA 4YK5A 2FFHA 4JIOA 4NC3A 3U5SA 3ATPA 1NU7D 3KH2A 2QTVA 2NG1A 1V54C 1VLSA 1WOLA 4RBNA 5DQZA 4JEBA 1AVOB 3S0XA 2KK1A 3NKEA 4E18A 2VCBA 3KL4A 2EPLX 2DGJA 4IGGA 2IXMA 3C8GA 3Q7LA 3EGDB 3PDMP 5A6BD 4U5EE 3DXJF 4GEHA 3RQEA 1VMAA 2NUTB 4ANJA 2Q9BA 1D1CA 1NG1A 4AX2A 5A6JA 1LI7A 5E33A 1NSGB 4IAOA 1WGWA 5JS5A 3HJCA 1KTMA 2GFHA 4MVMA 2OKUA 2YEVA 4RDAA 2OJQA 4L6RA 3TOLA 1OR2A 2AVKA 3HNLA 1APCA 2V26A 3IPMO 4MVOA 4ER9A 1OQCA 1HY5A 2IXNA 5CI8A 3RQFA 2V3CC 1HMOA 2A0BA 3SNHA 2R7UA 1TWAA 1ZHYA 1VYKA 3OA1A 2A69F 2YKZA 4OD4A 4W8PA 1ZZPA 1K40A 1YLMA 3Q7GA 4J30B 3Q6MA 1HE9A 3QW1A 3EHMA 1Z5ZA 3W4YA 4PJNA 3X1OA 4DVZA 5GPGB 4YT4A 2FGYA 4U5FE 2HFIA 2YL0A 1SZIA 3JSEO 4CBEA 1LIHA 4G7ZF 2Y69C 1OW8A 5HSWA 2G3KA 2M64A 1D1BA 3C8GD 4JKVA 1WN0A 1E85A 3WODF 2Q9CA 2AWYA 5EK0A 2YL7A 4E7ZA 2A1DD 3KMIA 2IBFA 5L0IA 2R7VA 4NTAA 1O3UA 3ABMC 3G50A 1G8XA 5E3CA 4JCHA 1PD1A 3EJNA 2GA0A 4OIQF 1VB5A 4QI2A 5L3VA 3G4ZA 1RJ9A 1ORYA 2P61A 3EGXB 3MBGA 4PK4A 1EQ1A 3NKDA 4LERA 4N6HA 5B1AC 3A9CA 1E83A 2OEXA 1VLTA 1JR8A 2HS5A 2Q7RA 3RH3A 5B3SC 3UMIA 2XXAA 1J8YF 4HFKB 1FMWA 4PACA 2Q3TA 1TFOB 5KYYB 4E0HA 1QVXA 3U9MA 3IQTA 4NCQA 3RW0A 1UFBA 2LSEA 3EZHA 2QUPA 3DJNB 1ZHWA 4XPYA 5K0IA 1I4ZA 4LDKA 3EG9B 1ZHZA 1OXBA 2KW3C 5BUOA 4HFFB 4FWVA 5B3IA 2ZPAA 1EKYA 1ZHTA 3Q6NA 4CDAA 3T9OA 4MQ9F 3ZTMA 4C7OA 4B6IA 1KU2A 2I8BA 1GGQA 1H9GA 4XQ1A 5HV9A 2OQMA 5L0GA 1G4US 2D5RB 3CAXA 1E2XA 3LEVA 2J7PA 3M15A 1MMNA 3MYFA 2H7BA 3O55A 5D91A 3K33A 3EH1A 2KSFA 4ULVA 4JEAA 3UMKA 3MYIA 5DLJA 4CIPA 3S28A 3DM5A 2J45A 1PD0A 3UR3C 4BJTA 3T6JA 3K66A 3M79A 3MFNA 2X0CA 1VYIA 4OIPF 1D1AA 2X51A 2YQYA 3QMKA 2B0JA 1ZU5A 2PF4E 1R5ID 1RCPA 2L7AA 2LIGA 1VOMA 1T9KA 4D4NA 1ORJA 4CJOA 4JE9A 1ZHXA 4LDQA 2HMZA 3FDQA 3O39A 5BQHA 2GWWA 3GODA 4Z9IA 3NDBB 1IW7F 3A11A 1V74B 1YYXA 1VK5A 2LFFA 3B71A 3CEXA 3M4CA 4O6YA 2CNWA 4YT5A 4AL1A 2GAQA 4CSAC 4CJGA 2CYDA 4IARA 3SEOA 4DRIB 5COFA 3ZSUA 4JURI
chains in the Genus database with same CATH topology
1BR4A 2CGEA 4CIHA 2KNHA 4HEAJ 1Z23A 2WZLA 2H7VC 4DBQA 3ASOC 2J46A 3LAYA 2W45A 1N1CA 2VH3A 4PJLA 1QLEC 5FCLA 1V55C 2XL4A 2ZXOA 2R7XA 2DYSC 2IOQA 5T1DB 4KC9A 4BJ1A 5KYWA 2WZGA 2VASA 3I5QA 3E9VA 3AG2C 4AE4B 3AQBA 2EIJC 2QY9A 4O6MA 4PJJA 2Y39A 1FFTC 1O5HA 5KYNA 3ECSA 2IYLD 3JT1A 3ITFA 3X2QC 2CNWD 3DD7A 1TWGA 2NUPA 5E3AA 3CSKA 4JJGA 3OEOA 4CS9A 1OKKD 1PCXA 1Z63A 5T3TA 4W8KA 1SMYF 3AQCA 5DS6A 3EFOA 3FHDA 1NU9C 3LS0A 3T6BA 5CI9A 3AG4C 2Y3HA 3EQLF 3LLIA 3E70C 2EIMC 3EH2A 4BJ5A 5E2QA 3KKBA 4EBBA 2ZXRA 3LESA 4K7BA 3NG1A 3LNRA 2PX3A 1M2VB 2ZXWC 3I4UA 3MX3A 4G7HF 2WB7A 3LLKA 4U5DE 5KYUA 4LLEA 3RFYA 3K7DA 2A6HF 2IXPA 4PFPA 4C3EA 4N06A 3FVYA 2WL8A 1O87A 3AG1C 3POVA 1IZMA 3FAJA 2M4EA 2KJGA 3EHNA 1Z6AA 4YN0B 1MNEA 3JSZA 2R7OA 4I3MA 3B0VC 5B1BC 4KI2A 3TD7A 5KYXB 2ZXPA 3F47A 2Y3BA 4OINF 2R7WA 4Q4ZF 4M63A 4PFOA 1J8MF 1FFHA 3SYNA 2CW0F 4DOZA 3B9QA 2EILC 2R7QA 3GANA 2WVNA 3K1IC 1BR1A 3MLGA 3V7OA 2YZSA 1LS1A 1JPJA 4MNDA 2J9UA 3OWTA 1JPNA 1FTSA 2NUTA 2KQ9A 3DM9B 1D0XA 4QDLA 3NYMA 5L3QA 2E87A 4AK9A 3W2WA 4NY3A 4CS8C 3H65A 3UNGC 3DAFA 3NRHA 4XWJA 1TWHA 3ZIBA 2L81A 5T3WA 2Y3DA 4OIRF 1OCCC 4OD5A 1BR2A 2R7SA 2J7PD 1Z3IX 2W4BA 3JYHA 3VAYA 3DJUB 4ZLDA 2H7OA 3I5PA 3VYWA 3PMRA 3ZC4A 4YT4A 3AG3C 3K1HA 3ZVRA 3DZAA 4JJFA 3DMDA 1RJ9B 1ZYRF 2WVOA 5DS5A 4U5GA 4A2NB 4C3DA 2XXAB 4G7OF 1TWCA 5DVWA 1TR2A 4DVYP 3JCUQ 2OG2A 2JD3A 1S7ZA 3EGXA 4JVSA 3UGPA 2A68F 2YHSA 2J9VA 3O6XA 5KYYA 5EHHA 4YT2A 4C7OB 3LJBA 3W8HA 3EG9A 2J0WA 4KBLA 3ABLC 3HLZA 3WG7C 3ZG1A 2KGOA 4CSAC 1ST6A 2P7VA 4XLPF 2XRHA 4XLNF 3L0IA 5EGYA 1LKXA 1MMGA 2W9YA 5D92A 3DAGA 2R7RA 1MMAA 1OCOC 3RKOF 4WJ0A 3NYLA 1M2OA 4YJWA 2IXOA 3NYJA 5IY5C 2XSEA 4Q7CA 3SP1A 2HV7A 2L9JA 3W8IA 2Z15A 3L34A 2Q9AA 4XTKA 4OIOF 5F5HA 3RYLA 4FX5A 4KNWA 4LLCA 4EWCA 3F46A 4YWQA 3ABKC 1OCRC 4BG0A 3CQZA 3QZCA 4GYTA 3RIPA 3B0UX 2O9XA 5KYWB 2WZFA 1QZXA 4CSAA 1M57C 2WVQA 3S27A 2MYSA 1ZU4A 4DBRA 2A6EF 2OCCC 4HE8D 1OCZC 4X0RA 4AE4A 4YT8A 2NUPB 1MMDA 4I44A 2C03A 3UMHA 3HTKC 2C04A 1LVKA 2R7TA 4P6IC 2MWQA 3IEEA 2PFDA 3UGOA 1W2WA 3EGDA 1NZEA 3EFOB 3N0TA 3CZ6A 3SZRA 3N24A 3M1CB 4BJ6C 3JRTA 3ASNC 3EPVA 2PP4A 2VB6A 3PHF2 4K0DA 4U5HA 2HV6A 4KNVA 1FMVA 2PX0A 2J9WA 2Y3GA 4U5CE 4QI0A 2EIKC 2CDQA 2W4MA 4JW1A 4ZLCA 4I1MA 5DQTA 4O6NA 4J32B 4FESA 5KYUB 4C3BA 1SF8A 4U5BE 1M2VA 4G0HA 4IJJA 3LS1A 4I1OB 2BE5F 4JZAA 2G62A 4LACB 4IWBA 3N2ZB 4IRUA 4CS9C 2EINC 4O7GA 5F5FA 4CS7A 4H4KC 1TKNA 3W2VA 4RD9A 4O79A 2P6VA 5DS4A 1OKKA 3B0PA 4Q5SF 1D0ZA 2G3VA 2DYRC 1M56C 1MNDA 4BJ6A 4BEJA 4PJMA 3S29A 1D0YA 3EZIA 4CS8A 3T4RA 5KYXA 4BJ5C 4ULWA 3K6BA 2J0XA 4F4BA 2FFHA 1NU7D 3KH2A 2QTVA 2NG1A 1V54C 4RBNA 5DQZA 3S0XA 3NKEA 3KL4A 2DGJA 2IXMA 3Q7LA 3EGDB 4U5EE 3DXJF 4GEHA 1VMAA 2NUTB 4ANJA 2Q9BA 1D1CA 1NG1A 4AX2A 5E33A 4IAOA 1WGWA 3HJCA 2GFHA 2YEVA 4RDAA 2V26A 2IXNA 5CI8A 2V3CC 3SNHA 2R7UA 1TWAA 1ZHYA 1VYKA 3OA1A 2A69F 4OD4A 4J30B 3Q7GA 4DVZA 3Q6MA 3EHMA 1Z5ZA 4PJNA 3X1OA 2FGYA 4U5FE 1SZIA 4CBEA 4G7ZF 2Y69C 5HSWA 2G3KA 1D1BA 3WODF 2Q9CA 4E7ZA 2A1DD 3KMIA 2R7VA 3ABMC 1G8XA 5E3CA 4JCHA 1PD1A 3EJNA 4OIQF 4QI2A 5L3VA 1RJ9A 3EGXB 4PK4A 3NKDA 4LERA 5B1AC 5B3SC 3RH3A 3UMIA 2XXAA 1J8YF 4HFKB 1FMWA 2Q3TA 5KYYB 2LSEA 3EZHA 3DJNB 1ZHWA 3EG9B 1ZHZA 2KW3C 5BUOA 4HFFB 4FWVA 2ZPAA 1ZHTA 3Q6NA 4MQ9F 4C7OA 4B6IA 1KU2A 2I8BA 2D5RB 3LEVA 4E7SA 2J7PA 1MMNA 5D91A 2H7BA 3K33A 3EH1A 3UMKA 5DLJA 3S28A 3DM5A 2J45A 1PD0A 3UR3C 4BJTA 3T6JA 3K66A 1VYIA 4OIPF 1D1AA 2X51A 3QMKA 2B0JA 1ZU5A 2PF4E 1VOMA 1ZHXA 3FDQA 3O39A 3GODA 3NDBB 1IW7F 1VK5A 4O6YA 2CNWA 4YT5A 3SEOA 3ZSUA 4JURI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7B A; 
#chains in the Genus database with same CATH topology
 1BR4 A;  2CGE A;  2XLW A;  1SYQ A;  4CIH A;  1QQ3 A;  5A69 A;  2KNH A;  1A7D A;  4HEA J;  3V5X A;  1Z23 A;  2EPN A;  2WZL A;  4N4W A;  2H7V C;  5AGF A;  3ZQV A;  4DBQ A;  3ASO C;  3T6G B;  2XLD A;  2TMV P;  2J46 A;  2JX0 A;  1GQA A;  2UUH A;  3LAY A;  4IAQ A;  3GWL A;  4XEK A;  2W45 A;  1N1C A;  3U2L A;  2VH3 A;  4PJL A;  4EIY A;  1NBB A;  1QLE C;  5FCL A;  1V55 C;  2XL4 A;  3KYJ A;  3GM3 A;  2YRF A;  2ZXO A;  2OEV A;  4MVQ A;  2R7X A;  2DYS C;  3VF0 A;  2IOQ A;  2BC5 A;  1VTM P;  5T1D B;  3U9J A;  2I15 A;  4KC9 A;  1XWJ A;  2WZG A;  2VAS A;  3I5Q A;  4BJ1 A;  5KYW A;  1DOW A;  4JRZ A;  1YYJ A;  3E9V A;  3AG2 C;  4JC7 A;  3AQB A;  4AE4 B;  2AU5 A;  2LD6 A;  1AEP A;  1PV3 A;  2EIJ C;  2QY9 A;  3B29 A;  4O6M A;  4PJJ A;  1EA8 A;  4DRJ B;  4MW3 A;  2Y39 A;  2YLG A;  3GEI A;  1Q0M A;  4E17 A;  1FFT C;  1O5H A;  4CX9 A;  5L0J A;  1UG7 A;  5KYN A;  3ECS A;  3DE9 A;  2IYL D;  3JT1 A;  3ITF A;  3U8P A;  3X2Q C;  2CNW D;  3DD7 A;  3SXY A;  1TWG A;  2NUP A;  3GEE A;  3H2U A;  3M4B A;  2NSG A;  4XEF A;  5E3A A;  3TK0 A;  3CSK A;  3TUL A;  4JJG A;  1H9T A;  3OEO A;  1HE1 A;  4CS9 A;  2QNL A;  1OKK D;  5CIV A;  1PCX A;  1Z63 A;  4PR9 A;  4XPX A;  3AGU A;  3GM1 A;  3R2P A;  5T3T A;  3S90 A;  1U89 A;  2VCC A;  4W8K A;  1SMY F;  3AQC A;  1RKC A;  3EFO A;  3FHD A;  4XPW A;  5COM A;  1NU9 C;  5DS6 A;  3LS0 A;  4R32 A;  3T6B A;  4ONS A;  2KYH A;  1LE2 A;  1YVI A;  2OJE D;  5CI9 A;  3AG4 C;  2HJM A;  2Y3H A;  3EQL F;  4IB4 A;  1YJG A;  3LLI A;  3C62 A;  4MVZ A;  3QVY A;  1OR3 A;  3E70 C;  4XEV A;  1E86 A;  1GS9 A;  1U0B B;  2JPU A;  2EIM C;  3EH2 A;  4BJ5 A;  5E2Q A;  3KKB A;  2YL1 A;  4EBB A;  4DRH B;  1MQV A;  2ZXR A;  3U2M A;  3LES A;  3NMJ A;  4JCZ A;  3NG1 A;  1S05 A;  3LNR A;  2R9R B;  4K7B A;  2PX3 A;  4EKW A;  1M2V B;  1OW6 A;  2ZXW C;  3I4U A;  3MX3 A;  2OU6 A;  1A41 A;  4G7H F;  3QVZ A;  2HZ8 A;  2RD9 A;  4P9T A;  2WB7 A;  3NMK A;  5TJ5 E;  3LLK A;  4U5D E;  5KYU A;  2YLD A;  4MVR A;  1LI5 A;  4LLE A;  3RFY A;  3K7D A;  2A6H F;  4U9D A;  1OW7 A;  2IXP A;  4PFP A;  4N6C A;  4N06 A;  4C3E A;  1RKE A;  3FVY A;  1CGO A;  2WL8 A;  2XM4 A;  1O87 A;  3AG1 C;  3ZDL A;  1IZM A;  1CPQ A;  3FAJ A;  4J7T A;  4NTB A;  2ICW G;  2KJG A;  2M4E A;  1LM3 B;  1Z6A A;  2IM8 A;  1MNE A;  3EHN A;  1YA7 O;  4MVS A;  3JSZ A;  2R7O A;  1JOG A;  1BZ4 A;  2EPO A;  2QLA A;  4I3M A;  3B0V C;  3JYY A;  5B1B C;  5A6A A;  1C17 M;  3U3F A;  4KI2 A;  4MVU A;  3TD7 A;  5KYX B;  2ZXP A;  1KNY A;  3G4X A;  3F47 A;  3TJ5 A;  2Y3B A;  4OIN F;  2R7W A;  4Q4Z F;  4M63 A;  4PFO A;  1J8M F;  1FFH A;  3VM6 A;  3SYN A;  2CW0 F;  4DOZ A;  3B9Q A;  4D4X A;  2EIL C;  2R7Q A;  3SXK A;  1SR2 A;  3FOO A;  3GAN A;  3V5Z A;  2H8A A;  2WVN A;  3K1I C;  1BR1 A;  2YWA A;  3C8G B;  3MLG A;  3V7O A;  1R4T A;  4P9F A;  3C63 A;  4DXW A;  2YZS A;  1JMW A;  4Z9J A;  1LS1 A;  1JPJ A;  1I5N A;  1G4W R;  2GDC A;  4MND A;  1K04 A;  1E84 A;  2J9U A;  3WHN A;  3U0C A;  1XZP A;  4FAP B;  1B68 A;  1Q0F A;  3OWT A;  5JLI A;  4NQF A;  1JPN A;  1FTS A;  3FOP A;  3H2V A;  2NUT A;  2KQ9 A;  1K05 A;  3DM9 B;  3TJ6 A;  2AP3 A;  1D0X A;  3DKA A;  4K1O A;  1YA9 A;  3NYM A;  4QDL A;  5L3Q A;  2E87 A;  1Z7Q c;  1U6H A;  3BRJ A;  3ZWI A;  2LP4 A;  4AK9 A;  3W2W A;  4NY3 A;  4CS8 C;  1XZQ A;  3H65 A;  3UNG C;  3DAF A;  3AOU A;  3DI5 A;  3NRH A;  4GQH A;  4XWJ A;  1TWH A;  5BQG A;  3RF3 A;  3ZIB A;  3ZTZ A;  4WJ0 A;  5AC4 A;  2L81 A;  1T5O A;  1FR0 A;  2CCY A;  2XL6 A;  4MW8 A;  1YAR O;  2Q4F A;  2Y3D A;  5T3W A;  1T6U A;  1FAP B;  4OIR F;  1H7I A;  1OCC C;  2ASR A;  2DI3 A;  3U3B A;  3RVZ A;  4OD5 A;  1ORS C;  3L8J A;  1BR2 A;  3TQO A;  1A0B A;  2R7S A;  2J7P D;  1RXQ A;  3BEH A;  1T01 A;  1Z3I X;  2W4B A;  3JYH A;  2A0U A;  2D4U A;  3K1I A;  3VAY A;  3DJU B;  2LFD A;  3LNM B;  4ZLD A;  1V4A A;  2H7O A;  1A7E A;  3I5P A;  4YL3 A;  3VYW A;  3PMR A;  3ZC4 A;  1DOV A;  1C03 A;  1QPU A;  3AG3 C;  3K1H A;  5COG A;  3DZA A;  3IQ5 A;  4JJF A;  4WGZ A;  2R25 A;  4YN0 B;  3ZVR A;  3DMD A;  5A6B A;  2KC3 A;  1RJ9 B;  1ZYR F;  2WVO A;  3V5Y A;  2P1A A;  5DS5 A;  4U5G A;  3O10 A;  4A2N B;  4C3D A;  5A6K A;  1HW2 A;  2XXA B;  3NMI A;  4G7O F;  2DB4 A;  1TWC A;  3HKK A;  1YZC A;  5DVW A;  1TR2 A;  4DVY P;  3HNI A;  3JCU Q;  5JRA A;  2OG2 A;  2JD3 A;  1LS4 A;  1S7Z A;  2R05 A;  3EGX A;  4JVS A;  3UGP A;  1FNT c;  3J06 A;  1Q0D A;  1WTY A;  5AC5 A;  1Q0G A;  2A68 F;  3RVY A;  2YHS A;  2J9V A;  3O6X A;  1CPR A;  4G78 A;  5KYY A;  1CGN A;  4WGY A;  1WAT A;  5EHH A;  4YT2 A;  5L0F A;  4C7O B;  3LJB A;  3S9O A;  5F28 E;  3W8H A;  3EG9 A;  1AUE A;  2J0W A;  3KYI A;  3C7J A;  4KBL A;  3LUT B;  3ABL C;  3HLZ A;  5JSL A;  2HJ3 A;  1NFO A;  3WG7 C;  3ZG1 A;  2KGO A;  3U8V A;  4MTG A;  1ST6 A;  2P7V A;  4JTD B;  2ETS A;  1YZA A;  1BDJ B;  2XLO A;  2XRH A;  4XLP F;  2F22 A;  4DJ9 A;  4CDV A;  4XLN F;  2EPK X;  3L0I A;  3TOM A;  2L6H A;  5EGY A;  1LKX A;  1MMG A;  1Y6D A;  2W9Y A;  5D92 A;  3R7C A;  2ZD9 A;  3DAG A;  2R7R A;  1MMA A;  1HW1 A;  5BQI A;  1OCO C;  1ZW2 A;  4Z9H A;  3RKO F;  2NPU A;  2BL2 A;  2Q00 A;  2J8W A;  1M2O A;  3JTL O;  3NYL A;  2IXO A;  2VC9 A;  3IHU A;  3PCV A;  1LE4 A;  2R02 A;  2XS8 A;  3NYJ A;  2MHR A;  4LDR A;  3HNK A;  4E7S A;  5IY5 C;  3GM2 A;  2XSE A;  4Q7C A;  1C02 A;  2HV7 A;  3SP1 A;  2L9J A;  3W8I A;  2Z15 A;  2LK4 A;  1YDI A;  1WWP A;  1L7C A;  2Q9A A;  3L34 A;  4XTK A;  4OIO F;  3C8Z A;  5F5H A;  2XL8 A;  3RYL A;  2QE9 A;  4NTF A;  3ZQY A;  4BEM J;  3QW0 A;  2XS1 A;  4FX5 A;  4KNW A;  2HSQ A;  1YAU O;  4LLC A;  5JP7 A;  2UUI A;  1CGM E;  2XLH A;  4EWC A;  3F46 A;  4MTO A;  1HMD A;  1L3P A;  4H54 A;  1F1M A;  1QSP A;  2HUJ A;  3ABK C;  4YWQ A;  1OCR C;  2PNO A;  2XM0 A;  1M6T A;  3CQZ A;  3QZC A;  4GYT A;  5FZT A;  3RIP A;  4BG0 A;  2OOC A;  3S84 A;  2O9X A;  3B0U X;  2PBE A;  1TFK B;  5KYW B;  2WZF A;  1LPE A;  4AL0 A;  1QZX A;  4CSA A;  1Q0K A;  4U9E A;  1M57 C;  2WVQ A;  4JTA B;  5JUA A;  1EI7 A;  1T6Q A;  3S27 A;  1JRA A;  1ZU4 A;  2MYS A;  3AGT A;  2A6E F;  4EHP A;  4DBR A;  2OCC C;  3WAQ A;  3FMS A;  3L1M A;  3IQC A;  4HE8 D;  1OCZ C;  4EUK B;  4MTF A;  2YL3 A;  4X0R A;  3LEO A;  4AE4 A;  2RSE B;  4YT8 A;  4UDV A;  2L6G A;  1MMD A;  2NUP B;  4I44 A;  2YVK A;  1Y4C A;  2C03 A;  3UMH A;  3HTK C;  2C04 A;  1LVK A;  3AJM A;  2R7T A;  4P6I C;  2MWQ A;  5JT4 A;  4BPM A;  3IEE A;  4CDY A;  2PFD A;  2VCA A;  4A4A A;  4E0I A;  3UGO A;  1W2W A;  3EGD A;  1NZE A;  1BBH A;  3EFO B;  2L6F A;  4WAB A;  3GOR A;  3CZ6 A;  3N0T A;  3SZR A;  3N24 A;  1JAF A;  1ZVZ A;  2XLM A;  2HMQ A;  2J9B A;  3M1C B;  1QKR A;  2EPM X;  3JRT A;  3ASN C;  3EPV A;  3FAP B;  4BJ6 C;  4EBJ A;  2LQG A;  2PP4 A;  1ZW3 A;  2NSF A;  2VB6 A;  3L8I A;  4K0D A;  5L0D A;  3PHF 2;  1TQG A;  4U5H A;  2HV6 A;  4KNV A;  1FMV A;  1WAS A;  2PX0 A;  4MS2 A;  4YL1 A;  1GM5 A;  2J9W A;  2Y3G A;  4U5C E;  2XLV A;  2EIK C;  4QI0 A;  2AWC A;  2CDQ A;  2W4M A;  3DWW A;  4JW1 A;  4ZLC A;  5JVE A;  4I1M A;  5DQT A;  3US6 A;  2B0H A;  4O6N A;  4J32 B;  1H6G A;  4FES A;  5KYU B;  3JRM O;  1T6I A;  1SF8 A;  4C3B A;  3JZ0 A;  4JTC B;  4U5B E;  256B A;  1M2V A;  4G0H A;  1RKE B;  3LS1 A;  4I1O B;  2BE5 F;  1NLX A;  4IJJ A;  4JZA A;  2G62 A;  4LAC B;  4IWB A;  3SXM A;  3N2Z B;  4IRU A;  2FAP B;  3QTH A;  4CS9 C;  2EIN C;  2XLE A;  4O7G A;  3KPH A;  2HSB A;  5L0C A;  3HNJ A;  5F5F A;  4CS7 A;  4H4K C;  1TKN A;  1A7V A;  3W2V A;  4RD9 A;  3FXH A;  4O79 A;  2P6V A;  5DS4 A;  1OKK A;  3B0P A;  2HKV A;  3SXZ A;  4Q5S F;  2YLI A;  1D0Z A;  2G3V A;  4EBK A;  1OXK A;  4J7Y A;  2DYR C;  1M56 C;  1RMV A;  1MND A;  4BJ6 A;  4BEJ A;  3GWN A;  1G5Z A;  2P0N A;  4PJM A;  1I4Y A;  1NFN A;  3RQG A;  3S29 A;  3VRC A;  1D0Y A;  3EZI A;  4CS8 A;  4YJW A;  2LCH A;  3T4R A;  3IQ6 A;  5KYX A;  2R03 A;  4BJ5 C;  4ULW A;  4YL0 A;  3POV A;  3K6B A;  3C18 A;  3DE8 A;  2J0X A;  3GEH A;  5L0H A;  4F4B A;  4YK5 A;  2FFH A;  4JIO A;  4NC3 A;  3U5S A;  3ATP A;  1NU7 D;  3KH2 A;  2QTV A;  2NG1 A;  1V54 C;  1VLS A;  1WOL A;  4RBN A;  5DQZ A;  4JEB A;  1AVO B;  3S0X A;  2KK1 A;  3NKE A;  4E18 A;  2VCB A;  3KL4 A;  2EPL X;  2DGJ A;  4IGG A;  2IXM A;  3C8G A;  3Q7L A;  3EGD B;  3PDM P;  5A6B D;  4U5E E;  3DXJ F;  4GEH A;  3RQE A;  1VMA A;  2NUT B;  4ANJ A;  2Q9B A;  1D1C A;  1NG1 A;  4AX2 A;  5A6J A;  1LI7 A;  5E33 A;  1NSG B;  4IAO A;  1WGW A;  5JS5 A;  3HJC A;  1KTM A;  2GFH A;  4MVM A;  2OKU A;  2YEV A;  4RDA A;  2OJQ A;  4L6R A;  3TOL A;  1OR2 A;  2AVK A;  3HNL A;  1APC A;  2V26 A;  3IPM O;  4MVO A;  4ER9 A;  1OQC A;  1HY5 A;  2IXN A;  5CI8 A;  3RQF A;  2V3C C;  1HMO A;  2A0B A;  3SNH A;  2R7U A;  1TWA A;  1ZHY A;  1VYK A;  3OA1 A;  2A69 F;  2YKZ A;  4OD4 A;  4W8P A;  1ZZP A;  1K40 A;  1YLM A;  3Q7G A;  4J30 B;  3Q6M A;  1HE9 A;  3QW1 A;  3EHM A;  1Z5Z A;  3W4Y A;  4PJN A;  3X1O A;  4DVZ A;  5GPG B;  4YT4 A;  2FGY A;  4U5F E;  2HFI A;  2YL0 A;  1SZI A;  3JSE O;  4CBE A;  1LIH A;  4G7Z F;  2Y69 C;  1OW8 A;  5HSW A;  2G3K A;  2M64 A;  1D1B A;  3C8G D;  4JKV A;  1WN0 A;  1E85 A;  3WOD F;  2Q9C A;  2AWY A;  5EK0 A;  2YL7 A;  4E7Z A;  2A1D D;  3KMI A;  2IBF A;  5L0I A;  2R7V A;  4NTA A;  1O3U A;  3ABM C;  3G50 A;  1G8X A;  5E3C A;  4JCH A;  1PD1 A;  3EJN A;  2GA0 A;  4OIQ F;  1VB5 A;  4QI2 A;  5L3V A;  3G4Z A;  1RJ9 A;  1ORY A;  2P61 A;  3EGX B;  3MBG A;  4PK4 A;  1EQ1 A;  3NKD A;  4LER A;  4N6H A;  5B1A C;  3A9C A;  1E83 A;  2OEX A;  1VLT A;  1JR8 A;  2HS5 A;  2Q7R A;  3RH3 A;  5B3S C;  3UMI A;  2XXA A;  1J8Y F;  4HFK B;  1FMW A;  4PAC A;  2Q3T A;  1TFO B;  5KYY B;  4E0H A;  1QVX A;  3U9M A;  3IQT A;  4NCQ A;  3RW0 A;  1UFB A;  2LSE A;  3EZH A;  2QUP A;  3DJN B;  1ZHW A;  4XPY A;  5K0I A;  1I4Z A;  4LDK A;  3EG9 B;  1ZHZ A;  1OXB A;  2KW3 C;  5BUO A;  4HFF B;  4FWV A;  5B3I A;  2ZPA A;  1EKY A;  1ZHT A;  3Q6N A;  4CDA A;  3T9O A;  4MQ9 F;  3ZTM A;  4C7O A;  4B6I A;  1KU2 A;  2I8B A;  1GGQ A;  1H9G A;  4XQ1 A;  5HV9 A;  2OQM A;  5L0G A;  1G4U S;  2D5R B;  3CAX A;  1E2X A;  3LEV A;  2J7P A;  3M15 A;  1MMN A;  3MYF A;  2H7B A;  3O55 A;  5D91 A;  3K33 A;  3EH1 A;  2KSF A;  4ULV A;  4JEA A;  3UMK A;  3MYI A;  5DLJ A;  4CIP A;  3S28 A;  3DM5 A;  2J45 A;  1PD0 A;  3UR3 C;  4BJT A;  3T6J A;  3K66 A;  3M79 A;  3MFN A;  2X0C A;  1VYI A;  4OIP F;  1D1A A;  2X51 A;  2YQY A;  3QMK A;  2B0J A;  1ZU5 A;  2PF4 E;  1R5I D;  1RCP A;  2L7A A;  2LIG A;  1VOM A;  1T9K A;  4D4N A;  1ORJ A;  4CJO A;  4JE9 A;  1ZHX A;  4LDQ A;  2HMZ A;  3FDQ A;  3O39 A;  5BQH A;  2GWW A;  3GOD A;  4Z9I A;  3NDB B;  1IW7 F;  3A11 A;  1V74 B;  1YYX A;  1VK5 A;  2LFF A;  3B71 A;  3CEX A;  3M4C A;  4O6Y A;  2CNW A;  4YT5 A;  4AL1 A;  2GAQ A;  4CSA C;  4CJG A;  2CYD A;  4IAR A;  3SEO A;  4DRI B;  5COF A;  3ZSU A;  4JUR I; 
#chains in the Genus database with same CATH homology
 1BR4 A;  2CGE A;  4CIH A;  2KNH A;  4HEA J;  1Z23 A;  2WZL A;  2H7V C;  4DBQ A;  3ASO C;  2J46 A;  3LAY A;  2W45 A;  1N1C A;  2VH3 A;  4PJL A;  1QLE C;  5FCL A;  1V55 C;  2XL4 A;  2ZXO A;  2R7X A;  2DYS C;  2IOQ A;  5T1D B;  4KC9 A;  4BJ1 A;  5KYW A;  2WZG A;  2VAS A;  3I5Q A;  3E9V A;  3AG2 C;  4AE4 B;  3AQB A;  2EIJ C;  2QY9 A;  4O6M A;  4PJJ A;  2Y39 A;  1FFT C;  1O5H A;  5KYN A;  3ECS A;  2IYL D;  3JT1 A;  3ITF A;  3X2Q C;  2CNW D;  3DD7 A;  1TWG A;  2NUP A;  5E3A A;  3CSK A;  4JJG A;  3OEO A;  4CS9 A;  1OKK D;  1PCX A;  1Z63 A;  5T3T A;  4W8K A;  1SMY F;  3AQC A;  5DS6 A;  3EFO A;  3FHD A;  1NU9 C;  3LS0 A;  3T6B A;  5CI9 A;  3AG4 C;  2Y3H A;  3EQL F;  3LLI A;  3E70 C;  2EIM C;  3EH2 A;  4BJ5 A;  5E2Q A;  3KKB A;  4EBB A;  2ZXR A;  3LES A;  4K7B A;  3NG1 A;  3LNR A;  2PX3 A;  1M2V B;  2ZXW C;  3I4U A;  3MX3 A;  4G7H F;  2WB7 A;  3LLK A;  4U5D E;  5KYU A;  4LLE A;  3RFY A;  3K7D A;  2A6H F;  2IXP A;  4PFP A;  4C3E A;  4N06 A;  3FVY A;  2WL8 A;  1O87 A;  3AG1 C;  3POV A;  1IZM A;  3FAJ A;  2M4E A;  2KJG A;  3EHN A;  1Z6A A;  4YN0 B;  1MNE A;  3JSZ A;  2R7O A;  4I3M A;  3B0V C;  5B1B C;  4KI2 A;  3TD7 A;  5KYX B;  2ZXP A;  3F47 A;  2Y3B A;  4OIN F;  2R7W A;  4Q4Z F;  4M63 A;  4PFO A;  1J8M F;  1FFH A;  3SYN A;  2CW0 F;  4DOZ A;  3B9Q A;  2EIL C;  2R7Q A;  3GAN A;  2WVN A;  3K1I C;  1BR1 A;  3MLG A;  3V7O A;  2YZS A;  1LS1 A;  1JPJ A;  4MND A;  2J9U A;  3OWT A;  1JPN A;  1FTS A;  2NUT A;  2KQ9 A;  3DM9 B;  1D0X A;  4QDL A;  3NYM A;  5L3Q A;  2E87 A;  4AK9 A;  3W2W A;  4NY3 A;  4CS8 C;  3H65 A;  3UNG C;  3DAF A;  3NRH A;  4XWJ A;  1TWH A;  3ZIB A;  2L81 A;  5T3W A;  2Y3D A;  4OIR F;  1OCC C;  4OD5 A;  1BR2 A;  2R7S A;  2J7P D;  1Z3I X;  2W4B A;  3JYH A;  3VAY A;  3DJU B;  4ZLD A;  2H7O A;  3I5P A;  3VYW A;  3PMR A;  3ZC4 A;  4YT4 A;  3AG3 C;  3K1H A;  3ZVR A;  3DZA A;  4JJF A;  3DMD A;  1RJ9 B;  1ZYR F;  2WVO A;  5DS5 A;  4U5G A;  4A2N B;  4C3D A;  2XXA B;  4G7O F;  1TWC A;  5DVW A;  1TR2 A;  4DVY P;  3JCU Q;  2OG2 A;  2JD3 A;  1S7Z A;  3EGX A;  4JVS A;  3UGP A;  2A68 F;  2YHS A;  2J9V A;  3O6X A;  5KYY A;  5EHH A;  4YT2 A;  4C7O B;  3LJB A;  3W8H A;  3EG9 A;  2J0W A;  4KBL A;  3ABL C;  3HLZ A;  3WG7 C;  3ZG1 A;  2KGO A;  4CSA C;  1ST6 A;  2P7V A;  4XLP F;  2XRH A;  4XLN F;  3L0I A;  5EGY A;  1LKX A;  1MMG A;  2W9Y A;  5D92 A;  3DAG A;  2R7R A;  1MMA A;  1OCO C;  3RKO F;  4WJ0 A;  3NYL A;  1M2O A;  4YJW A;  2IXO A;  3NYJ A;  5IY5 C;  2XSE A;  4Q7C A;  3SP1 A;  2HV7 A;  2L9J A;  3W8I A;  2Z15 A;  3L34 A;  2Q9A A;  4XTK A;  4OIO F;  5F5H A;  3RYL A;  4FX5 A;  4KNW A;  4LLC A;  4EWC A;  3F46 A;  4YWQ A;  3ABK C;  1OCR C;  4BG0 A;  3CQZ A;  3QZC A;  4GYT A;  3RIP A;  3B0U X;  2O9X A;  5KYW B;  2WZF A;  1QZX A;  4CSA A;  1M57 C;  2WVQ A;  3S27 A;  2MYS A;  1ZU4 A;  4DBR A;  2A6E F;  2OCC C;  4HE8 D;  1OCZ C;  4X0R A;  4AE4 A;  4YT8 A;  2NUP B;  1MMD A;  4I44 A;  2C03 A;  3UMH A;  3HTK C;  2C04 A;  1LVK A;  2R7T A;  4P6I C;  2MWQ A;  3IEE A;  2PFD A;  3UGO A;  1W2W A;  3EGD A;  1NZE A;  3EFO B;  3N0T A;  3CZ6 A;  3SZR A;  3N24 A;  3M1C B;  4BJ6 C;  3JRT A;  3ASN C;  3EPV A;  2PP4 A;  2VB6 A;  3PHF 2;  4K0D A;  4U5H A;  2HV6 A;  4KNV A;  1FMV A;  2PX0 A;  2J9W A;  2Y3G A;  4U5C E;  4QI0 A;  2EIK C;  2CDQ A;  2W4M A;  4JW1 A;  4ZLC A;  4I1M A;  5DQT A;  4O6N A;  4J32 B;  4FES A;  5KYU B;  4C3B A;  1SF8 A;  4U5B E;  1M2V A;  4G0H A;  4IJJ A;  3LS1 A;  4I1O B;  2BE5 F;  4JZA A;  2G62 A;  4LAC B;  4IWB A;  3N2Z B;  4IRU A;  4CS9 C;  2EIN C;  4O7G A;  5F5F A;  4CS7 A;  4H4K C;  1TKN A;  3W2V A;  4RD9 A;  4O79 A;  2P6V A;  5DS4 A;  1OKK A;  3B0P A;  4Q5S F;  1D0Z A;  2G3V A;  2DYR C;  1M56 C;  1MND A;  4BJ6 A;  4BEJ A;  4PJM A;  3S29 A;  1D0Y A;  3EZI A;  4CS8 A;  3T4R A;  5KYX A;  4BJ5 C;  4ULW A;  3K6B A;  2J0X A;  4F4B A;  2FFH A;  1NU7 D;  3KH2 A;  2QTV A;  2NG1 A;  1V54 C;  4RBN A;  5DQZ A;  3S0X A;  3NKE A;  3KL4 A;  2DGJ A;  2IXM A;  3Q7L A;  3EGD B;  4U5E E;  3DXJ F;  4GEH A;  1VMA A;  2NUT B;  4ANJ A;  2Q9B A;  1D1C A;  1NG1 A;  4AX2 A;  5E33 A;  4IAO A;  1WGW A;  3HJC A;  2GFH A;  2YEV A;  4RDA A;  2V26 A;  2IXN A;  5CI8 A;  2V3C C;  3SNH A;  2R7U A;  1TWA A;  1ZHY A;  1VYK A;  3OA1 A;  2A69 F;  4OD4 A;  4J30 B;  3Q7G A;  4DVZ A;  3Q6M A;  3EHM A;  1Z5Z A;  4PJN A;  3X1O A;  2FGY A;  4U5F E;  1SZI A;  4CBE A;  4G7Z F;  2Y69 C;  5HSW A;  2G3K A;  1D1B A;  3WOD F;  2Q9C A;  4E7Z A;  2A1D D;  3KMI A;  2R7V A;  3ABM C;  1G8X A;  5E3C A;  4JCH A;  1PD1 A;  3EJN A;  4OIQ F;  4QI2 A;  5L3V A;  1RJ9 A;  3EGX B;  4PK4 A;  3NKD A;  4LER A;  5B1A C;  5B3S C;  3RH3 A;  3UMI A;  2XXA A;  1J8Y F;  4HFK B;  1FMW A;  2Q3T A;  5KYY B;  2LSE A;  3EZH A;  3DJN B;  1ZHW A;  3EG9 B;  1ZHZ A;  2KW3 C;  5BUO A;  4HFF B;  4FWV A;  2ZPA A;  1ZHT A;  3Q6N A;  4MQ9 F;  4C7O A;  4B6I A;  1KU2 A;  2I8B A;  2D5R B;  3LEV A;  4E7S A;  2J7P A;  1MMN A;  5D91 A;  2H7B A;  3K33 A;  3EH1 A;  3UMK A;  5DLJ A;  3S28 A;  3DM5 A;  2J45 A;  1PD0 A;  3UR3 C;  4BJT A;  3T6J A;  3K66 A;  1VYI A;  4OIP F;  1D1A A;  2X51 A;  3QMK A;  2B0J A;  1ZU5 A;  2PF4 E;  1VOM A;  1ZHX A;  3FDQ A;  3O39 A;  3GOD A;  3NDB B;  1IW7 F;  1VK5 A;  4O6Y A;  2CNW A;  4YT5 A;  3SEO A;  3ZSU A;  4JUR I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...