4K7BA

Crystal structure of extrinsic protein in photosystem ii
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
111
structure length
111
Chain Sequence
AVSSATINRARGLYGDRIAALKDAVAAGDFKAIAEEKNAFILFNSGAYPTNKAKKNAAIAQTNEIFKAIRSGDKAAVKSAYDAYMAANEIRPLPEINSNVGQGYSSEFDFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Extrinsic protein in photosystem II
publication title Crystal Structure of Psb31, a Novel Extrinsic Protein of Photosystem II from a Marine Centric Diatom and Implications for Its Binding and Function
pubmed doi rcsb
source organism Chaetoceros gracilis
total genus 41
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18240 PSII_Pbs31 Photosystem II Psb31 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1740 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4k7bA00
4K7BA
chains in the Genus database with same CATH superfamily
4CSAC 3UNGC 4KC9A 1J8YF 3ITFA 2LFFA 2IXOA 2YLGA 4I44A 2VH3A 3M1CB 4JZAA 2OJED 1M57C 1TFOB 1VB5A 4XPWA 1VTMP 1OCRC 2Q9AA 2CNWD 3K1IC 4YL1A 1E86A 1KTMA 1WATA 4ANJA 3EGDA 4WABA 2B0JA 3I5QA 3ZDLA 3NMIA 4CS7A 2KQ9A 1E83A 1BR1A 4PJMA 2R7UA 2L6HA 4I1OB 1HW2A 3UMHA 3LLIA 1LS4A 2FGYA 3H65A 2VCCA 5COFA 5T3WA 4BJ5C 4MVUA 4HEAJ 2R25A 1I5NA 2XS1A 2ICWG 4MTFA 2WZFA 1RCPA 2OU6A 4QDLA 2F22A 5T3TA 3DZAA 1PCXA 5BQIA 5DS4A 1TKNA 1IW7F 4JJFA 3DI5A 3G50A 3S27A 3RFYA 1OR3A 4K1OA 2WZGA 3B71A 1A7DA 3L1MA 3HNKA 4IAQA 4C3DA 3EZHA 1OR2A 4XEVA 4EBKA 1LI7A 1GS9A 1K04A 1XWJA 4EKWA 5COMA 3FXHA 4H4KC 1H7IA 3LUTB 4EBJA 2I8BA 1A41A 1CPQA 3K1HA 5FZTA 4LACB 3AG4C 4AX2A 4DRHB 3FAPB 3L8JA 1T9KA 3C62A 3GWNA 2HZ8A 4Q7CA 2W4MA 3UGPA 3MBGA 2KW3C 2LSEA 1OXKA 3IQ5A 4JRZA 3X1OA 3ASNC 4U5GA 1AEPA 1ZZPA 1A7VA 4RBNA 2A68F 3HKKA 3TJ5A 2A0UA 1Z63A 3CQZA 3DAFA 2WVQA 3LEOA 4XQ1A 1JMWA 3Q6MA 3NKDA 5KYYB 2EPKX 4IGGA 3EH1A 3HLZA 3S28A 1T6QA 1YA7O 2IXPA 3U3FA 1VYIA 4CDAA 2RSEB 4U5BE 5L0FA 4O6NA 3VM6A 5JLIA 1QVXA 3F47A 5A6KA 1U89A 3B29A 3C8GB 3GM2A 1LI5A 3LNMB 4PACA 4E17A 5L0DA 1O5HA 3IQCA 4BJ6A 1Q0DA 4EWCA 1Q0KA 2CCYA 2PFDA 1WN0A 3S9OA 4E0HA 5A6BA 4EUKB 1E84A 1VLSA 3O10A 4BJTA 1ST6A 2IOQA 1K40A 4JEAA 3JZ0A 1E2XA 1YARO 3LS0A 3B0UX 2ZXWC 5AC4A 4OD5A 4JURI 5E33A 4BJ1A 5DS6A 3IPMO 4U9EA 1V55C 1L7CA 2A0BA 3WODF 5KYUA 4XEKA 4E7SA 2Y3GA 1V4AA 3LLKA 1FR0A 1TWCA 3MX3A 1HW1A 3UR3C 4D4NA 4CX9A 1VK5A 4W8KA 2DYSC 5A6JA 3FVYA 1GGQA 4CIPA 1N1CA 2W4BA 2VASA 3O55A 5KYXA 1R5ID 1WASA 3B0PA 2VC9A 4N4WA 4P9TA 2P7VA 1I4ZA 2YL3A 3AQCA 4PFOA 3RF3A 2CW0F 3QMKA 5F5HA 2XLOA 5HV9A 1OW8A 2EPMX 3JCUQ 3HNJA 1SR2A 3AOUA 3TJ6A 5BUOA 2JX0A 1GM5A 3RYLA 2AVKA 2XLEA 1W2WA 1OKKA 2H7OA 5DQTA 3TK0A 4JCZA 2HUJA 3NG1A 5L0JA 4GQHA 4YL0A 1YLMA 2A6HF 1DOWA 5E2QA 1ZVZA 1BR2A 2EILC 3MFNA 2TMVP 4WGYA 4OINF 4ZLDA 1Z3IX 4JKVA 2GWWA 3CAXA 3W4YA 1T6IA 3EH2A 3K7DA 4MVQA 3E9VA 1UG7A 2EINC 3EFOA 2KJGA 3NRHA 1G4US 2OKUA 5L0GA 5L3QA 2XXAA 3EGDB 2LCHA 4C7OA 3Q7LA 4CDYA 2WZLA 4UDVA 2J9VA 2Q00A 3PCVA 4IJJA 2CNWA 2VB6A 2XLVA 3I5PA 4N6CA 3Q6NA 4K0DA 5IY5C 5JS5A 2V3CC 4DBQA 1Z7Qc 1BZ4A 3ABKC 3Q7GA 1JRAA 1NFNA 1TFKB 1U0BB 4O6YA 3JTLO 3RH3A 4J7TA 2LP4A 3LJBA 4JEBA 2PX3A 3ZQYA 4E7ZA 4BEMJ 3SNHA 1ORYA 2BE5F 1ZW2A 2C04A 3NYLA 4HE8D 4XLNF 5FCLA 3DD7A 4OIOF 4BJ6C 2J45A 4NTBA 2J8WA 2YKZA 3QVZA 3KMIA 2KK1A 3G4ZA 3HNIA 3OEOA 1TWAA 2YZSA 2YHSA 1YJGA 4EIYA 1YYJA 3S29A 5CI8A 2YVKA 1EQ1A 3MLGA 2EIMC 3CEXA 1T6UA 3SYNA 4XLPF 4FAPB 2P1AA 3KYJA 2LQGA 4JJGA 1H6GA 3S90A 3HTKC 4IAOA 2VCAA 5DQZA 2PBEA 2R02A 2YL0A 2EPNA 4OD4A 2HMZA 2XM0A 4ULVA 4Z9IA 4FWVA 2XLWA 2G3KA 2Z15A 5BQHA 3RKOF 3UMIA 3JRMO 4QI0A 2C03A 3AGTA 1QSPA 2J46A 2VCBA 3IEEA 2XLMA 3AG2C 4BG0A 4U5DE 4AL1A 2MYSA 2M64A 4KBLA 5JRAA 5T1DB 4E18A 5TJ5E 3M4BA 5JVEA 3DE8A 2HJ3A 2ZD9A 1JAFA 3LNRA 3S0XA 1M2VA 2DB4A 1D0YA 1FMWA 2OCCC 3FMSA 3QZCA 4XPXA 1NZEA 2XLDA 1CGME 1WTYA 1ZHYA 2W9YA 5JSLA 4G0HA 3W2WA 2NSGA 4CDVA 4XWJA 2PNOA 4C3BA 2A69F 3POVA 1TQGA 1ZHWA 4Z9JA 3FDQA 2OEVA 3EPVA 1NBBA 3TOMA 2IM8A 2YL1A 3FOOA 3W8HA 5A69A 4CIHA 1WOLA 3T9OA 1EI7A 3RVZA 2GDCA 5B3IA 1Z5ZA 2I15A 3FHDA 1NU7D 2YWAA 4PK4A 1F1MA 3UGOA 5F5FA 1MMDA 3TD7A 4MW3A 3UMKA 1WWPA 2J0WA 1D1CA 3HNLA 1FFHA 1MMNA 4RDAA 1YZCA 4U5HA 4FESA 3AGUA 2EIKC 4K7BA 5KYUB 3OWTA 3V5XA 2ZXRA 2L81A 4DRJB 4JVSA 1SF8A 3KPHA 1IZMA 4JTAB 3QTHA 4N06A 3IQ6A 3L34A 3TOLA 1TWHA 2R7RA 1BBHA 2R7OA 3CZ6A 2IXMA 4NY3A 4PJLA 5KYXB 2YLDA 5DS5A 4ZLCA 4DXWA 3MYIA 4OIRF 4B6IA 4AE4A 4EBBA 2AWYA 2HFIA 4JTDB 1NG1A 3M4CA 3U2LA 2HS5A 4JE9A 3GM1A 1ZW3A 3ASOC 3B9QA 2WB7A 3T6GB 3GORA 2OG2A 2Q9BA 3JRTA 4J7YA 4DVYP 2Y3HA 4CS9C 2AU5A 3O6XA 1VLTA 2Y3BA 2Y69C 4PJNA 2P6VA 3PMRA 4XPYA 2YQYA 2W45A 4GYTA 5GPGB 3EG9B 1OW6A 1G5ZA 5HSWA 4M63A 1H9GA 1LKXA 1D1BA 1NFOA 2H7VC 4JC7A 2QNLA 4YT5A 2D5RB 3GANA 4P9FA 3U2MA 3AQBA 3VYWA 4EHPA 1O87A 5B3SC 1YYXA 4QI2A 4CS8A 2XSEA 1VMAA 3EFOB 2JPUA 2FAPB 2XM4A 2DI3A 4GEHA 1GQAA 3U5SA 1WGWA 1H9TA 4JIOA 1L3PA 1LE2A 3TQOA 3KH2A 4OIPF 3C8ZA 3MYFA 4O7GA 4LDRA 3GEHA 5CI9A 2XXAB 4C7OB 4Q5SF 2R7XA 5K0IA 1RJ9A 2NUPA 4C3EA 4NTFA 1D0XA 4A4AA 1K05A 1V54C 2KGOA 1T01A 5KYWB 4MS2A 1NU9C 3SZRA 4J30B 1JPNA 3H2UA 3US6A 4IARA 1XZQA 3M15A 2A6EF 4G78A 2HKVA 3C18A 1LE4A 3EG9A 3RQEA 5D92A 2XLHA 1U6HA 2KYHA 2NG1A 3LS1A 4A2NB 2KNHA 2HV6A 5DVWA 2GAQA 3EJNA 1VOMA 3C8GD 3GWLA 2OOCA 5KYNA 2NUTA 2PP4A 3AG3C 1YA9A 4L6RA 4YT4A 2QUPA 1OCOC 4U5FE 4G7OF 3EQLF 1QLEC 3SXKA 5KYWA 1DOVA 2YL7A 1CGOA 4U5EE 2CDQA 1R4TA 1PD0A 3DM5A 1Q0FA 3I4UA 5L0HA 1ZU4A 3EHMA 3GODA 3ZSUA 1PD1A 5EK0A 1OW7A 1SMYF 1NLXA 4FX5A 1OXBA 5JT4A 1AUEA 3W8IA 2R7VA 1SYQA 4MVSA 1RXQA 2EPOA 2Q3TA 1RKEA 3A11A 4IRUA 3LAYA 2L7AA 5E3CA 4R32A 3BEHA 3VRCA 4CS9A 4AL0A 5B1BC 2ASRA 1LVKA 3GM3A 4H54A 2NSFA 3RIPA 1I4YA 2LD6A 4PJJA 3C7JA 2CYDA 1S7ZA 3W2VA 3R2PA 3SP1A 4DBRA 1C03A 3EZIA 2R7WA 4D4XA 4IWBA 3U0CA 4JTCB 4YN0B 3FOPA 256BA 1M2VB 2QLAA 2MHRA 2HJMA 4O79A 3QW1A 4J32B 4Z9HA 1RKCA 1EKYA 3ECSA 3RW0A 3L8IA 3VF0A 2R7SA 2L6FA 4XEFA 3ATPA 4P6IC 2AWCA 4ULWA 2HSQA 2R03A 4MVRA 4U9DA 2BL2A 3IQTA 3PDMP 3JYYA 3NMKA 2XL8A 5D91A 3NYMA 3C63A 1OQCA 4LLCA 1BR4A 3NMJA 4MW8A 1QKRA 2UUIA 3K66A 3DKAA 3EHNA 3NYJA 4LDQA 5E3AA 1MMGA 3ZIBA 4BPMA 2R7TA 4WGZA 1JR8A 4NTAA 4X0RA 2Q9CA 4CS8C 1APCA 2EPLX 4KI2A 2IYLD 3N2ZB 2KC3A 1AVOB 2HSBA 2FFHA 1HE9A 3QW0A 5DLJA 3ABLC 3VAYA 2J0XA 2XL6A 4Q4ZF 2NPUA 4JW1A 3ZG1A 1EA8A 1ZHXA 3ZVRA 3WHNA 2BC5A 2IXNA 1E85A 4XTKA 3GEEA 2DYRC 1C02A 1YZAA 1FFTC 4U5CE 2IBFA 2R9RB 4PR9A 2ETSA 5L0CA 3F46A 3V7OA 3HJCA 3O39A 1ORSC 3WG7C 2PX0A 1YVIA 4IB4A 4AE4B 3KKBA 1B68A 3CSKA 2L6GA 3DMDA 3EGXB 4HFFB 1TWGA 4CJGA 3FAJA 3IHUA 3QVYA 1QZXA 2ZXOA 1ZYRF 4MVOA 1T5OA 2QY9A 3NKEA 5COGA 3T6JA 1HE1A 4LERA 3U3BA 1HMDA 4NQFA 1G8XA 4N6HA 5CIVA 3JYHA 2PF4E 2YEVA 1A7EA 3R7CA 4F4BA 1HY5A 4LDKA 3L0IA 3OA1A 4KNWA 2X0CA 2J9BA 1C17M 1ZHZA 4MVZA 3U8PA 1M56C 2Y39A 3K6BA 1V74B 3SXYA 3J06A 5F28E 4I3MA 1RMVA 3T4RA 1Y4CA 3N24A 3DJUB 3SXZA 3EGXA 1TR2A 1YDIA 2AP3A 2E87A 2Q4FA 4CSAA 2ZPAA 3RQGA 4NC3A 5A6AA 2YLIA 5JUAA 1MQVA 2M4EA 2JD3A 3BRJA 3DAGA 4W8PA 3ZWIA 2DGJA 1RJ9B 2NUPB 2X51A 4WJ0A 1S05A 3DXJF 4KNVA 3AG1C 5AC5A 3S84A 1JPJA 1ORJA 4YWQA 1NSGB 3K1IA 3ZQVA 4YK5A 3ZTZA 1QPUA 4JCHA 5JP7A 1OCCC 2J9UA 2XS8A 3ABMC 1FNTc 2J7PA 2WVOA 1Y6DA 4RD9A 1LPEA 2WL8A 3RVYA 3X2QC 4MVMA 4MTOA 1LS1A 5KYYA 1Z23A 2CGEA 2RD9A 1FTSA 4BJ5A 3JT1A 3E70C 1O3UA 3GEIA 2NUTB 4MNDA 3ZTMA 3PHF2 1Q0MA 2KSFA 2OQMA 1YAUO 3C8GA 3JSEO 5A6BD 1D1AA 2OEXA 3U9MA 1JOGA 2J7PD 2R05A 3NDBB 1FMVA 2H8AA 3H2VA 5AGFA 4G7ZF 2LFDA 3B0VC 3ZC4A 1M6TA 2UUHA 3KL4A 4YJWA 2G62A 2QE9A 3V5YA 4I1MA 3SEOA 2V26A 1G4WR 1KNYA 2L9JA 2O9XA 1BDJB 1LM3B 1QQ3A 1SZIA 4AK9A 1LIHA 2GA0A 4E0IA 2LK4A 1HMOA 3N0TA 4HFKB 1FAPB 1KU2A 1RKEB 2P61A 3M79A 3WAQA 3LEVA 2MWQA 4G7HF 4O6MA 3DE9A 3DJNB 4PFPA 1Q0GA 2HMQA 3DWWA 1Z6AA 4DOZA 1PV3A 1MMAA 1OCZC 3K33A 3AJMA 4MTGA 2OJQA 2H7BA 3G4XA 3DM9B 2XRHA 2LIGA 2A1DD 4LLEA 1J8MF 5L0IA 5L3VA 1D0ZA 1XZPA 2P0NA 5BQGA 4CJOA 4OIQF 2G3VA 4YT2A 4DVZA 2HV7A 2B0HA 5EGYA 3V5ZA 3T6BA 1MNDA 3JSZA 1MNEA 3KYIA 4CBEA 2J9WA 4DJ9A 1CGNA 2Y3DA 4YL3A 5EHHA 2YRFA 1ZU5A 2D4UA 4NCQA 3U8VA 2ZXPA 3LESA 2QTVA 2XL4A 2Q7RA 4BEJA 2WVNA 4ER9A 3TULA 2EIJC 3A9CA 1OKKD 1M2OA 4MQ9F 1A0BA 1CPRA 2GFHA 2R7QA 1ZHTA 3SXMA 3U9JA 1VYKA 4DRIB 4YT8A 4ONSA 5B1AC 1UFBA 3RQFA
chains in the Genus database with same CATH topology
4CSAC 3UNGC 4KC9A 1J8YF 3ITFA 2IXOA 4I44A 2VH3A 3M1CB 4JZAA 1M57C 1OCRC 2Q9AA 2CNWD 3K1IC 4ANJA 3EGDA 2B0JA 3I5QA 4CS7A 2KQ9A 1BR1A 4PJMA 2R7UA 4I1OB 3UMHA 3LLIA 2FGYA 3H65A 4BJ5C 5T3WA 4HEAJ 2WZFA 4QDLA 5T3TA 3DZAA 1PCXA 5DS4A 1TKNA 1IW7F 4JJFA 3S27A 3RFYA 2WZGA 4C3DA 3EZHA 4H4KC 2I8BA 3K1HA 4LACB 3AG4C 4AX2A 4Q7CA 2W4MA 3UGPA 2KW3C 2LSEA 3X1OA 3ASNC 4U5GA 4RBNA 2A68F 1Z63A 3CQZA 3DAFA 2WVQA 3Q6MA 3NKDA 5KYYB 3EH1A 3HLZA 3S28A 2IXPA 1VYIA 4U5BE 4O6NA 3F47A 1O5HA 4BJ6A 4EWCA 2PFDA 4BJTA 1ST6A 2IOQA 3LS0A 3B0UX 2ZXWC 4OD5A 4JURI 5E33A 4BJ1A 5DS6A 1V55C 3WODF 5KYUA 4E7SA 2Y3GA 3LLKA 1TWCA 3MX3A 3UR3C 1VK5A 4W8KA 2DYSC 3FVYA 1N1CA 2W4BA 2VASA 5KYXA 3B0PA 2P7VA 3AQCA 4PFOA 5F5HA 2CW0F 3QMKA 3JCUQ 5BUOA 3RYLA 1W2WA 1OKKA 2H7OA 5DQTA 3NG1A 2A6HF 5E2QA 1BR2A 2EILC 4OINF 4ZLDA 1Z3IX 3EH2A 3K7DA 3E9VA 2EINC 3EFOA 2KJGA 3NRHA 5L3QA 2XXAA 3EGDB 4C7OA 3Q7LA 2WZLA 2J9VA 4IJJA 5IY5C 2CNWA 2VB6A 3I5PA 4G7OF 3Q6NA 4K0DA 2V3CC 4DBQA 3ABKC 3Q7GA 4O6YA 3RH3A 3LJBA 2PX3A 4E7ZA 3SNHA 2BE5F 2C04A 3NYLA 4HE8D 4XLNF 5FCLA 3DD7A 4OIOF 4BJ6C 2J45A 3KMIA 3OEOA 1TWAA 2YZSA 2YHSA 3S29A 5CI8A 3MLGA 2EIMC 3SYNA 4XLPF 4JJGA 3HTKC 4IAOA 5DQZA 4OD4A 4FWVA 2G3KA 2Z15A 3RKOF 3UMIA 4QI0A 2C03A 2J46A 3IEEA 3AG2C 4BG0A 4U5DE 2MYSA 4KBLA 5T1DB 3S0XA 3LNRA 1M2VA 1D0YA 1FMWA 2OCCC 3QZCA 1NZEA 1ZHYA 2W9YA 4G0HA 3W2WA 4XWJA 4C3BA 2A69F 3POVA 1ZHWA 3EPVA 3W8HA 4CIHA 1Z5ZA 3FHDA 1NU7D 4PK4A 5F5FA 1MMDA 3TD7A 3UMKA 2J0WA 1D1CA 1FFHA 1MMNA 4RDAA 4U5HA 4FESA 2EIKC 4K7BA 5KYUB 3OWTA 2ZXRA 2L81A 4JVSA 1SF8A 1IZMA 4N06A 3L34A 1TWHA 2R7RA 2R7OA 3CZ6A 4PJLA 2IXMA 4NY3A 5KYXB 5DS5A 4ZLCA 4B6IA 4OIRF 4EBBA 4AE4A 1NG1A 3ASOC 3B9QA 2WB7A 2OG2A 2Q9BA 3JRTA 4DVYP 2Y3HA 4CS9C 3O6XA 2Y3BA 2Y69C 4PJNA 2P6VA 3PMRA 4GYTA 2W45A 3EG9B 5HSWA 4M63A 1LKXA 1D1BA 2H7VC 4YT5A 2D5RB 3GANA 3AQBA 3VYWA 1O87A 5B3SC 4CS8A 2XSEA 1VMAA 3EFOB 4GEHA 1WGWA 4OIPF 3KH2A 2XXAB 4O7GA 5CI9A 4Q5SF 2R7XA 4C7OB 1RJ9A 2NUPA 4C3EA 1D0XA 1V54C 2KGOA 5KYWB 1NU9C 3SZRA 4J30B 1JPNA 2A6EF 3EG9A 5D92A 2NG1A 3LS1A 4A2NB 2KNHA 2HV6A 5DVWA 3EJNA 1VOMA 5KYNA 2NUTA 2PP4A 3AG3C 4YT4A 1OCOC 4U5FE 3EQLF 1QLEC 5KYWA 4U5EE 2CDQA 1PD0A 3DM5A 3I4UA 1ZU4A 3EHMA 3GODA 3ZSUA 1PD1A 1SMYF 4FX5A 3W8IA 2R7VA 2Q3TA 4IRUA 3LAYA 5E3CA 4CS9A 5B1BC 1LVKA 3RIPA 4PJJA 1S7ZA 3W2VA 3SP1A 4DBRA 3EZIA 2R7WA 4IWBA 4YN0B 1M2VB 4O79A 4J32B 3ECSA 2R7SA 4P6IC 4ULWA 5D91A 3NYMA 4LLCA 1BR4A 3K66A 3NYJA 3EHNA 3ZIBA 5E3AA 1MMGA 2R7TA 4X0RA 2Q9CA 4CS8C 4KI2A 2IYLD 3N2ZB 2FFHA 5DLJA 3ABLC 3VAYA 2J0XA 4Q4ZF 4JW1A 3ZG1A 1ZHXA 3ZVRA 2IXNA 4XTKA 2DYRC 1FFTC 4U5CE 3F46A 3V7OA 3HJCA 3O39A 3WG7C 2PX0A 4AE4B 3KKBA 3CSKA 3DMDA 3EGXB 4HFFB 1TWGA 3FAJA 1QZXA 2ZXOA 1ZYRF 2QY9A 3NKEA 3T6JA 4LERA 1G8XA 3JYHA 2PF4E 2YEVA 4F4BA 3L0IA 3OA1A 4KNWA 1ZHZA 1M56C 2Y39A 3K6BA 4I3MA 3T4RA 3N24A 3DJUB 3EGXA 1TR2A 2E87A 4CSAA 2ZPAA 2M4EA 2JD3A 3DAGA 2DGJA 1RJ9B 2NUPB 2X51A 4WJ0A 3DXJF 4KNVA 3AG1C 4QI2A 1JPJA 4YWQA 4JCHA 1OCCC 2J9UA 3ABMC 2J7PA 2WVOA 4RD9A 2WL8A 3X2QC 1LS1A 5KYYA 1Z23A 2CGEA 4BJ5A 1FTSA 3JT1A 3E70C 2NUTB 4MNDA 3PHF2 1D1AA 2J7PD 3NDBB 1FMVA 4G7ZF 3B0VC 3ZC4A 4YJWA 3KL4A 2G62A 4I1MA 3SEOA 2V26A 2L9JA 2O9XA 4AK9A 1SZIA 3N0TA 4HFKB 1KU2A 3LEVA 2MWQA 4G7HF 4O6MA 3DJNB 4PFPA 1Z6AA 4DOZA 1OCZC 1MMAA 3K33A 4LLEA 2H7BA 3FDQA 3DM9B 2XRHA 3UGOA 2A1DD 5L3VA 1J8MF 1D0ZA 4OIQF 2G3VA 4YT2A 4DVZA 2HV7A 5EGYA 3T6BA 1MNDA 3JSZA 1MNEA 4CBEA 2J9WA 2Y3DA 5EHHA 1ZU5A 2ZXPA 3LESA 2QTVA 2XL4A 4BEJA 2WVNA 2EIJC 1OKKD 1M2OA 4MQ9F 2GFHA 2R7QA 1ZHTA 1VYKA 4YT8A 5B1AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7B A; 
#chains in the Genus database with same CATH topology
 4CSA C;  3UNG C;  4KC9 A;  1J8Y F;  3ITF A;  2LFF A;  2IXO A;  2YLG A;  4I44 A;  2VH3 A;  3M1C B;  4JZA A;  2OJE D;  1M57 C;  1TFO B;  1VB5 A;  4XPW A;  1VTM P;  1OCR C;  2Q9A A;  2CNW D;  3K1I C;  4YL1 A;  1E86 A;  1KTM A;  1WAT A;  4ANJ A;  3EGD A;  4WAB A;  2B0J A;  3I5Q A;  3ZDL A;  3NMI A;  4CS7 A;  2KQ9 A;  1E83 A;  1BR1 A;  4PJM A;  2R7U A;  2L6H A;  4I1O B;  1HW2 A;  3UMH A;  3LLI A;  1LS4 A;  2FGY A;  3H65 A;  2VCC A;  5COF A;  5T3W A;  4BJ5 C;  4MVU A;  4HEA J;  2R25 A;  1I5N A;  2XS1 A;  2ICW G;  4MTF A;  2WZF A;  1RCP A;  2OU6 A;  4QDL A;  2F22 A;  5T3T A;  3DZA A;  1PCX A;  5BQI A;  5DS4 A;  1TKN A;  1IW7 F;  4JJF A;  3DI5 A;  3G50 A;  3S27 A;  3RFY A;  1OR3 A;  4K1O A;  2WZG A;  3B71 A;  1A7D A;  3L1M A;  3HNK A;  4IAQ A;  4C3D A;  3EZH A;  1OR2 A;  4XEV A;  4EBK A;  1LI7 A;  1GS9 A;  1K04 A;  1XWJ A;  4EKW A;  5COM A;  3FXH A;  4H4K C;  1H7I A;  3LUT B;  4EBJ A;  2I8B A;  1A41 A;  1CPQ A;  3K1H A;  5FZT A;  4LAC B;  3AG4 C;  4AX2 A;  4DRH B;  3FAP B;  3L8J A;  1T9K A;  3C62 A;  3GWN A;  2HZ8 A;  4Q7C A;  2W4M A;  3UGP A;  3MBG A;  2KW3 C;  2LSE A;  1OXK A;  3IQ5 A;  4JRZ A;  3X1O A;  3ASN C;  4U5G A;  1AEP A;  1ZZP A;  1A7V A;  4RBN A;  2A68 F;  3HKK A;  3TJ5 A;  2A0U A;  1Z63 A;  3CQZ A;  3DAF A;  2WVQ A;  3LEO A;  4XQ1 A;  1JMW A;  3Q6M A;  3NKD A;  5KYY B;  2EPK X;  4IGG A;  3EH1 A;  3HLZ A;  3S28 A;  1T6Q A;  1YA7 O;  2IXP A;  3U3F A;  1VYI A;  4CDA A;  2RSE B;  4U5B E;  5L0F A;  4O6N A;  3VM6 A;  5JLI A;  1QVX A;  3F47 A;  5A6K A;  1U89 A;  3B29 A;  3C8G B;  3GM2 A;  1LI5 A;  3LNM B;  4PAC A;  4E17 A;  5L0D A;  1O5H A;  3IQC A;  4BJ6 A;  1Q0D A;  4EWC A;  1Q0K A;  2CCY A;  2PFD A;  1WN0 A;  3S9O A;  4E0H A;  5A6B A;  4EUK B;  1E84 A;  1VLS A;  3O10 A;  4BJT A;  1ST6 A;  2IOQ A;  1K40 A;  4JEA A;  3JZ0 A;  1E2X A;  1YAR O;  3LS0 A;  3B0U X;  2ZXW C;  5AC4 A;  4OD5 A;  4JUR I;  5E33 A;  4BJ1 A;  5DS6 A;  3IPM O;  4U9E A;  1V55 C;  1L7C A;  2A0B A;  3WOD F;  5KYU A;  4XEK A;  4E7S A;  2Y3G A;  1V4A A;  3LLK A;  1FR0 A;  1TWC A;  3MX3 A;  1HW1 A;  3UR3 C;  4D4N A;  4CX9 A;  1VK5 A;  4W8K A;  2DYS C;  5A6J A;  3FVY A;  1GGQ A;  4CIP A;  1N1C A;  2W4B A;  2VAS A;  3O55 A;  5KYX A;  1R5I D;  1WAS A;  3B0P A;  2VC9 A;  4N4W A;  4P9T A;  2P7V A;  1I4Z A;  2YL3 A;  3AQC A;  4PFO A;  3RF3 A;  2CW0 F;  3QMK A;  5F5H A;  2XLO A;  5HV9 A;  1OW8 A;  2EPM X;  3JCU Q;  3HNJ A;  1SR2 A;  3AOU A;  3TJ6 A;  5BUO A;  2JX0 A;  1GM5 A;  3RYL A;  2AVK A;  2XLE A;  1W2W A;  1OKK A;  2H7O A;  5DQT A;  3TK0 A;  4JCZ A;  2HUJ A;  3NG1 A;  5L0J A;  4GQH A;  4YL0 A;  1YLM A;  2A6H F;  1DOW A;  5E2Q A;  1ZVZ A;  1BR2 A;  2EIL C;  3MFN A;  2TMV P;  4WGY A;  4OIN F;  4ZLD A;  1Z3I X;  4JKV A;  2GWW A;  3CAX A;  3W4Y A;  1T6I A;  3EH2 A;  3K7D A;  4MVQ A;  3E9V A;  1UG7 A;  2EIN C;  3EFO A;  2KJG A;  3NRH A;  1G4U S;  2OKU A;  5L0G A;  5L3Q A;  2XXA A;  3EGD B;  2LCH A;  4C7O A;  3Q7L A;  4CDY A;  2WZL A;  4UDV A;  2J9V A;  2Q00 A;  3PCV A;  4IJJ A;  2CNW A;  2VB6 A;  2XLV A;  3I5P A;  4N6C A;  3Q6N A;  4K0D A;  5IY5 C;  5JS5 A;  2V3C C;  4DBQ A;  1Z7Q c;  1BZ4 A;  3ABK C;  3Q7G A;  1JRA A;  1NFN A;  1TFK B;  1U0B B;  4O6Y A;  3JTL O;  3RH3 A;  4J7T A;  2LP4 A;  3LJB A;  4JEB A;  2PX3 A;  3ZQY A;  4E7Z A;  4BEM J;  3SNH A;  1ORY A;  2BE5 F;  1ZW2 A;  2C04 A;  3NYL A;  4HE8 D;  4XLN F;  5FCL A;  3DD7 A;  4OIO F;  4BJ6 C;  2J45 A;  4NTB A;  2J8W A;  2YKZ A;  3QVZ A;  3KMI A;  2KK1 A;  3G4Z A;  3HNI A;  3OEO A;  1TWA A;  2YZS A;  2YHS A;  1YJG A;  4EIY A;  1YYJ A;  3S29 A;  5CI8 A;  2YVK A;  1EQ1 A;  3MLG A;  2EIM C;  3CEX A;  1T6U A;  3SYN A;  4XLP F;  4FAP B;  2P1A A;  3KYJ A;  2LQG A;  4JJG A;  1H6G A;  3S90 A;  3HTK C;  4IAO A;  2VCA A;  5DQZ A;  2PBE A;  2R02 A;  2YL0 A;  2EPN A;  4OD4 A;  2HMZ A;  2XM0 A;  4ULV A;  4Z9I A;  4FWV A;  2XLW A;  2G3K A;  2Z15 A;  5BQH A;  3RKO F;  3UMI A;  3JRM O;  4QI0 A;  2C03 A;  3AGT A;  1QSP A;  2J46 A;  2VCB A;  3IEE A;  2XLM A;  3AG2 C;  4BG0 A;  4U5D E;  4AL1 A;  2MYS A;  2M64 A;  4KBL A;  5JRA A;  5T1D B;  4E18 A;  5TJ5 E;  3M4B A;  5JVE A;  3DE8 A;  2HJ3 A;  2ZD9 A;  1JAF A;  3LNR A;  3S0X A;  1M2V A;  2DB4 A;  1D0Y A;  1FMW A;  2OCC C;  3FMS A;  3QZC A;  4XPX A;  1NZE A;  2XLD A;  1CGM E;  1WTY A;  1ZHY A;  2W9Y A;  5JSL A;  4G0H A;  3W2W A;  2NSG A;  4CDV A;  4XWJ A;  2PNO A;  4C3B A;  2A69 F;  3POV A;  1TQG A;  1ZHW A;  4Z9J A;  3FDQ A;  2OEV A;  3EPV A;  1NBB A;  3TOM A;  2IM8 A;  2YL1 A;  3FOO A;  3W8H A;  5A69 A;  4CIH A;  1WOL A;  3T9O A;  1EI7 A;  3RVZ A;  2GDC A;  5B3I A;  1Z5Z A;  2I15 A;  3FHD A;  1NU7 D;  2YWA A;  4PK4 A;  1F1M A;  3UGO A;  5F5F A;  1MMD A;  3TD7 A;  4MW3 A;  3UMK A;  1WWP A;  2J0W A;  1D1C A;  3HNL A;  1FFH A;  1MMN A;  4RDA A;  1YZC A;  4U5H A;  4FES A;  3AGU A;  2EIK C;  4K7B A;  5KYU B;  3OWT A;  3V5X A;  2ZXR A;  2L81 A;  4DRJ B;  4JVS A;  1SF8 A;  3KPH A;  1IZM A;  4JTA B;  3QTH A;  4N06 A;  3IQ6 A;  3L34 A;  3TOL A;  1TWH A;  2R7R A;  1BBH A;  2R7O A;  3CZ6 A;  2IXM A;  4NY3 A;  4PJL A;  5KYX B;  2YLD A;  5DS5 A;  4ZLC A;  4DXW A;  3MYI A;  4OIR F;  4B6I A;  4AE4 A;  4EBB A;  2AWY A;  2HFI A;  4JTD B;  1NG1 A;  3M4C A;  3U2L A;  2HS5 A;  4JE9 A;  3GM1 A;  1ZW3 A;  3ASO C;  3B9Q A;  2WB7 A;  3T6G B;  3GOR A;  2OG2 A;  2Q9B A;  3JRT A;  4J7Y A;  4DVY P;  2Y3H A;  4CS9 C;  2AU5 A;  3O6X A;  1VLT A;  2Y3B A;  2Y69 C;  4PJN A;  2P6V A;  3PMR A;  4XPY A;  2YQY A;  2W45 A;  4GYT A;  5GPG B;  3EG9 B;  1OW6 A;  1G5Z A;  5HSW A;  4M63 A;  1H9G A;  1LKX A;  1D1B A;  1NFO A;  2H7V C;  4JC7 A;  2QNL A;  4YT5 A;  2D5R B;  3GAN A;  4P9F A;  3U2M A;  3AQB A;  3VYW A;  4EHP A;  1O87 A;  5B3S C;  1YYX A;  4QI2 A;  4CS8 A;  2XSE A;  1VMA A;  3EFO B;  2JPU A;  2FAP B;  2XM4 A;  2DI3 A;  4GEH A;  1GQA A;  3U5S A;  1WGW A;  1H9T A;  4JIO A;  1L3P A;  1LE2 A;  3TQO A;  3KH2 A;  4OIP F;  3C8Z A;  3MYF A;  4O7G A;  4LDR A;  3GEH A;  5CI9 A;  2XXA B;  4C7O B;  4Q5S F;  2R7X A;  5K0I A;  1RJ9 A;  2NUP A;  4C3E A;  4NTF A;  1D0X A;  4A4A A;  1K05 A;  1V54 C;  2KGO A;  1T01 A;  5KYW B;  4MS2 A;  1NU9 C;  3SZR A;  4J30 B;  1JPN A;  3H2U A;  3US6 A;  4IAR A;  1XZQ A;  3M15 A;  2A6E F;  4G78 A;  2HKV A;  3C18 A;  1LE4 A;  3EG9 A;  3RQE A;  5D92 A;  2XLH A;  1U6H A;  2KYH A;  2NG1 A;  3LS1 A;  4A2N B;  2KNH A;  2HV6 A;  5DVW A;  2GAQ A;  3EJN A;  1VOM A;  3C8G D;  3GWL A;  2OOC A;  5KYN A;  2NUT A;  2PP4 A;  3AG3 C;  1YA9 A;  4L6R A;  4YT4 A;  2QUP A;  1OCO C;  4U5F E;  4G7O F;  3EQL F;  1QLE C;  3SXK A;  5KYW A;  1DOV A;  2YL7 A;  1CGO A;  4U5E E;  2CDQ A;  1R4T A;  1PD0 A;  3DM5 A;  1Q0F A;  3I4U A;  5L0H A;  1ZU4 A;  3EHM A;  3GOD A;  3ZSU A;  1PD1 A;  5EK0 A;  1OW7 A;  1SMY F;  1NLX A;  4FX5 A;  1OXB A;  5JT4 A;  1AUE A;  3W8I A;  2R7V A;  1SYQ A;  4MVS A;  1RXQ A;  2EPO A;  2Q3T A;  1RKE A;  3A11 A;  4IRU A;  3LAY A;  2L7A A;  5E3C A;  4R32 A;  3BEH A;  3VRC A;  4CS9 A;  4AL0 A;  5B1B C;  2ASR A;  1LVK A;  3GM3 A;  4H54 A;  2NSF A;  3RIP A;  1I4Y A;  2LD6 A;  4PJJ A;  3C7J A;  2CYD A;  1S7Z A;  3W2V A;  3R2P A;  3SP1 A;  4DBR A;  1C03 A;  3EZI A;  2R7W A;  4D4X A;  4IWB A;  3U0C A;  4JTC B;  4YN0 B;  3FOP A;  256B A;  1M2V B;  2QLA A;  2MHR A;  2HJM A;  4O79 A;  3QW1 A;  4J32 B;  4Z9H A;  1RKC A;  1EKY A;  3ECS A;  3RW0 A;  3L8I A;  3VF0 A;  2R7S A;  2L6F A;  4XEF A;  3ATP A;  4P6I C;  2AWC A;  4ULW A;  2HSQ A;  2R03 A;  4MVR A;  4U9D A;  2BL2 A;  3IQT A;  3PDM P;  3JYY A;  3NMK A;  2XL8 A;  5D91 A;  3NYM A;  3C63 A;  1OQC A;  4LLC A;  1BR4 A;  3NMJ A;  4MW8 A;  1QKR A;  2UUI A;  3K66 A;  3DKA A;  3EHN A;  3NYJ A;  4LDQ A;  5E3A A;  1MMG A;  3ZIB A;  4BPM A;  2R7T A;  4WGZ A;  1JR8 A;  4NTA A;  4X0R A;  2Q9C A;  4CS8 C;  1APC A;  2EPL X;  4KI2 A;  2IYL D;  3N2Z B;  2KC3 A;  1AVO B;  2HSB A;  2FFH A;  1HE9 A;  3QW0 A;  5DLJ A;  3ABL C;  3VAY A;  2J0X A;  2XL6 A;  4Q4Z F;  2NPU A;  4JW1 A;  3ZG1 A;  1EA8 A;  1ZHX A;  3ZVR A;  3WHN A;  2BC5 A;  2IXN A;  1E85 A;  4XTK A;  3GEE A;  2DYR C;  1C02 A;  1YZA A;  1FFT C;  4U5C E;  2IBF A;  2R9R B;  4PR9 A;  2ETS A;  5L0C A;  3F46 A;  3V7O A;  3HJC A;  3O39 A;  1ORS C;  3WG7 C;  2PX0 A;  1YVI A;  4IB4 A;  4AE4 B;  3KKB A;  1B68 A;  3CSK A;  2L6G A;  3DMD A;  3EGX B;  4HFF B;  1TWG A;  4CJG A;  3FAJ A;  3IHU A;  3QVY A;  1QZX A;  2ZXO A;  1ZYR F;  4MVO A;  1T5O A;  2QY9 A;  3NKE A;  5COG A;  3T6J A;  1HE1 A;  4LER A;  3U3B A;  1HMD A;  4NQF A;  1G8X A;  4N6H A;  5CIV A;  3JYH A;  2PF4 E;  2YEV A;  1A7E A;  3R7C A;  4F4B A;  1HY5 A;  4LDK A;  3L0I A;  3OA1 A;  4KNW A;  2X0C A;  2J9B A;  1C17 M;  1ZHZ A;  4MVZ A;  3U8P A;  1M56 C;  2Y39 A;  3K6B A;  1V74 B;  3SXY A;  3J06 A;  5F28 E;  4I3M A;  1RMV A;  3T4R A;  1Y4C A;  3N24 A;  3DJU B;  3SXZ A;  3EGX A;  1TR2 A;  1YDI A;  2AP3 A;  2E87 A;  2Q4F A;  4CSA A;  2ZPA A;  3RQG A;  4NC3 A;  5A6A A;  2YLI A;  5JUA A;  1MQV A;  2M4E A;  2JD3 A;  3BRJ A;  3DAG A;  4W8P A;  3ZWI A;  2DGJ A;  1RJ9 B;  2NUP B;  2X51 A;  4WJ0 A;  1S05 A;  3DXJ F;  4KNV A;  3AG1 C;  5AC5 A;  3S84 A;  1JPJ A;  1ORJ A;  4YWQ A;  1NSG B;  3K1I A;  3ZQV A;  4YK5 A;  3ZTZ A;  1QPU A;  4JCH A;  5JP7 A;  1OCC C;  2J9U A;  2XS8 A;  3ABM C;  1FNT c;  2J7P A;  2WVO A;  1Y6D A;  4RD9 A;  1LPE A;  2WL8 A;  3RVY A;  3X2Q C;  4MVM A;  4MTO A;  1LS1 A;  5KYY A;  1Z23 A;  2CGE A;  2RD9 A;  1FTS A;  4BJ5 A;  3JT1 A;  3E70 C;  1O3U A;  3GEI A;  2NUT B;  4MND A;  3ZTM A;  3PHF 2;  1Q0M A;  2KSF A;  2OQM A;  1YAU O;  3C8G A;  3JSE O;  5A6B D;  1D1A A;  2OEX A;  3U9M A;  1JOG A;  2J7P D;  2R05 A;  3NDB B;  1FMV A;  2H8A A;  3H2V A;  5AGF A;  4G7Z F;  2LFD A;  3B0V C;  3ZC4 A;  1M6T A;  2UUH A;  3KL4 A;  4YJW A;  2G62 A;  2QE9 A;  3V5Y A;  4I1M A;  3SEO A;  2V26 A;  1G4W R;  1KNY A;  2L9J A;  2O9X A;  1BDJ B;  1LM3 B;  1QQ3 A;  1SZI A;  4AK9 A;  1LIH A;  2GA0 A;  4E0I A;  2LK4 A;  1HMO A;  3N0T A;  4HFK B;  1FAP B;  1KU2 A;  1RKE B;  2P61 A;  3M79 A;  3WAQ A;  3LEV A;  2MWQ A;  4G7H F;  4O6M A;  3DE9 A;  3DJN B;  4PFP A;  1Q0G A;  2HMQ A;  3DWW A;  1Z6A A;  4DOZ A;  1PV3 A;  1MMA A;  1OCZ C;  3K33 A;  3AJM A;  4MTG A;  2OJQ A;  2H7B A;  3G4X A;  3DM9 B;  2XRH A;  2LIG A;  2A1D D;  4LLE A;  1J8M F;  5L0I A;  5L3V A;  1D0Z A;  1XZP A;  2P0N A;  5BQG A;  4CJO A;  4OIQ F;  2G3V A;  4YT2 A;  4DVZ A;  2HV7 A;  2B0H A;  5EGY A;  3V5Z A;  3T6B A;  1MND A;  3JSZ A;  1MNE A;  3KYI A;  4CBE A;  2J9W A;  4DJ9 A;  1CGN A;  2Y3D A;  4YL3 A;  5EHH A;  2YRF A;  1ZU5 A;  2D4U A;  4NCQ A;  3U8V A;  2ZXP A;  3LES A;  2QTV A;  2XL4 A;  2Q7R A;  4BEJ A;  2WVN A;  4ER9 A;  3TUL A;  2EIJ C;  3A9C A;  1OKK D;  1M2O A;  4MQ9 F;  1A0B A;  1CPR A;  2GFH A;  2R7Q A;  1ZHT A;  3SXM A;  3U9J A;  1VYK A;  4DRI B;  4YT8 A;  4ONS A;  5B1A C;  1UFB A;  3RQF A; 
#chains in the Genus database with same CATH homology
 4CSA C;  3UNG C;  4KC9 A;  1J8Y F;  3ITF A;  2IXO A;  4I44 A;  2VH3 A;  3M1C B;  4JZA A;  1M57 C;  1OCR C;  2Q9A A;  2CNW D;  3K1I C;  4ANJ A;  3EGD A;  2B0J A;  3I5Q A;  4CS7 A;  2KQ9 A;  1BR1 A;  4PJM A;  2R7U A;  4I1O B;  3UMH A;  3LLI A;  2FGY A;  3H65 A;  4BJ5 C;  5T3W A;  4HEA J;  2WZF A;  4QDL A;  5T3T A;  3DZA A;  1PCX A;  5DS4 A;  1TKN A;  1IW7 F;  4JJF A;  3S27 A;  3RFY A;  2WZG A;  4C3D A;  3EZH A;  4H4K C;  2I8B A;  3K1H A;  4LAC B;  3AG4 C;  4AX2 A;  4Q7C A;  2W4M A;  3UGP A;  2KW3 C;  2LSE A;  3X1O A;  3ASN C;  4U5G A;  4RBN A;  2A68 F;  1Z63 A;  3CQZ A;  3DAF A;  2WVQ A;  3Q6M A;  3NKD A;  5KYY B;  3EH1 A;  3HLZ A;  3S28 A;  2IXP A;  1VYI A;  4U5B E;  4O6N A;  3F47 A;  1O5H A;  4BJ6 A;  4EWC A;  2PFD A;  4BJT A;  1ST6 A;  2IOQ A;  3LS0 A;  3B0U X;  2ZXW C;  4OD5 A;  4JUR I;  5E33 A;  4BJ1 A;  5DS6 A;  1V55 C;  3WOD F;  5KYU A;  4E7S A;  2Y3G A;  3LLK A;  1TWC A;  3MX3 A;  3UR3 C;  1VK5 A;  4W8K A;  2DYS C;  3FVY A;  1N1C A;  2W4B A;  2VAS A;  5KYX A;  3B0P A;  2P7V A;  3AQC A;  4PFO A;  5F5H A;  2CW0 F;  3QMK A;  3JCU Q;  5BUO A;  3RYL A;  1W2W A;  1OKK A;  2H7O A;  5DQT A;  3NG1 A;  2A6H F;  5E2Q A;  1BR2 A;  2EIL C;  4OIN F;  4ZLD A;  1Z3I X;  3EH2 A;  3K7D A;  3E9V A;  2EIN C;  3EFO A;  2KJG A;  3NRH A;  5L3Q A;  2XXA A;  3EGD B;  4C7O A;  3Q7L A;  2WZL A;  2J9V A;  4IJJ A;  5IY5 C;  2CNW A;  2VB6 A;  3I5P A;  4G7O F;  3Q6N A;  4K0D A;  2V3C C;  4DBQ A;  3ABK C;  3Q7G A;  4O6Y A;  3RH3 A;  3LJB A;  2PX3 A;  4E7Z A;  3SNH A;  2BE5 F;  2C04 A;  3NYL A;  4HE8 D;  4XLN F;  5FCL A;  3DD7 A;  4OIO F;  4BJ6 C;  2J45 A;  3KMI A;  3OEO A;  1TWA A;  2YZS A;  2YHS A;  3S29 A;  5CI8 A;  3MLG A;  2EIM C;  3SYN A;  4XLP F;  4JJG A;  3HTK C;  4IAO A;  5DQZ A;  4OD4 A;  4FWV A;  2G3K A;  2Z15 A;  3RKO F;  3UMI A;  4QI0 A;  2C03 A;  2J46 A;  3IEE A;  3AG2 C;  4BG0 A;  4U5D E;  2MYS A;  4KBL A;  5T1D B;  3S0X A;  3LNR A;  1M2V A;  1D0Y A;  1FMW A;  2OCC C;  3QZC A;  1NZE A;  1ZHY A;  2W9Y A;  4G0H A;  3W2W A;  4XWJ A;  4C3B A;  2A69 F;  3POV A;  1ZHW A;  3EPV A;  3W8H A;  4CIH A;  1Z5Z A;  3FHD A;  1NU7 D;  4PK4 A;  5F5F A;  1MMD A;  3TD7 A;  3UMK A;  2J0W A;  1D1C A;  1FFH A;  1MMN A;  4RDA A;  4U5H A;  4FES A;  2EIK C;  4K7B A;  5KYU B;  3OWT A;  2ZXR A;  2L81 A;  4JVS A;  1SF8 A;  1IZM A;  4N06 A;  3L34 A;  1TWH A;  2R7R A;  2R7O A;  3CZ6 A;  4PJL A;  2IXM A;  4NY3 A;  5KYX B;  5DS5 A;  4ZLC A;  4B6I A;  4OIR F;  4EBB A;  4AE4 A;  1NG1 A;  3ASO C;  3B9Q A;  2WB7 A;  2OG2 A;  2Q9B A;  3JRT A;  4DVY P;  2Y3H A;  4CS9 C;  3O6X A;  2Y3B A;  2Y69 C;  4PJN A;  2P6V A;  3PMR A;  4GYT A;  2W45 A;  3EG9 B;  5HSW A;  4M63 A;  1LKX A;  1D1B A;  2H7V C;  4YT5 A;  2D5R B;  3GAN A;  3AQB A;  3VYW A;  1O87 A;  5B3S C;  4CS8 A;  2XSE A;  1VMA A;  3EFO B;  4GEH A;  1WGW A;  4OIP F;  3KH2 A;  2XXA B;  4O7G A;  5CI9 A;  4Q5S F;  2R7X A;  4C7O B;  1RJ9 A;  2NUP A;  4C3E A;  1D0X A;  1V54 C;  2KGO A;  5KYW B;  1NU9 C;  3SZR A;  4J30 B;  1JPN A;  2A6E F;  3EG9 A;  5D92 A;  2NG1 A;  3LS1 A;  4A2N B;  2KNH A;  2HV6 A;  5DVW A;  3EJN A;  1VOM A;  5KYN A;  2NUT A;  2PP4 A;  3AG3 C;  4YT4 A;  1OCO C;  4U5F E;  3EQL F;  1QLE C;  5KYW A;  4U5E E;  2CDQ A;  1PD0 A;  3DM5 A;  3I4U A;  1ZU4 A;  3EHM A;  3GOD A;  3ZSU A;  1PD1 A;  1SMY F;  4FX5 A;  3W8I A;  2R7V A;  2Q3T A;  4IRU A;  3LAY A;  5E3C A;  4CS9 A;  5B1B C;  1LVK A;  3RIP A;  4PJJ A;  1S7Z A;  3W2V A;  3SP1 A;  4DBR A;  3EZI A;  2R7W A;  4IWB A;  4YN0 B;  1M2V B;  4O79 A;  4J32 B;  3ECS A;  2R7S A;  4P6I C;  4ULW A;  5D91 A;  3NYM A;  4LLC A;  1BR4 A;  3K66 A;  3NYJ A;  3EHN A;  3ZIB A;  5E3A A;  1MMG A;  2R7T A;  4X0R A;  2Q9C A;  4CS8 C;  4KI2 A;  2IYL D;  3N2Z B;  2FFH A;  5DLJ A;  3ABL C;  3VAY A;  2J0X A;  4Q4Z F;  4JW1 A;  3ZG1 A;  1ZHX A;  3ZVR A;  2IXN A;  4XTK A;  2DYR C;  1FFT C;  4U5C E;  3F46 A;  3V7O A;  3HJC A;  3O39 A;  3WG7 C;  2PX0 A;  4AE4 B;  3KKB A;  3CSK A;  3DMD A;  3EGX B;  4HFF B;  1TWG A;  3FAJ A;  1QZX A;  2ZXO A;  1ZYR F;  2QY9 A;  3NKE A;  3T6J A;  4LER A;  1G8X A;  3JYH A;  2PF4 E;  2YEV A;  4F4B A;  3L0I A;  3OA1 A;  4KNW A;  1ZHZ A;  1M56 C;  2Y39 A;  3K6B A;  4I3M A;  3T4R A;  3N24 A;  3DJU B;  3EGX A;  1TR2 A;  2E87 A;  4CSA A;  2ZPA A;  2M4E A;  2JD3 A;  3DAG A;  2DGJ A;  1RJ9 B;  2NUP B;  2X51 A;  4WJ0 A;  3DXJ F;  4KNV A;  3AG1 C;  4QI2 A;  1JPJ A;  4YWQ A;  4JCH A;  1OCC C;  2J9U A;  3ABM C;  2J7P A;  2WVO A;  4RD9 A;  2WL8 A;  3X2Q C;  1LS1 A;  5KYY A;  1Z23 A;  2CGE A;  4BJ5 A;  1FTS A;  3JT1 A;  3E70 C;  2NUT B;  4MND A;  3PHF 2;  1D1A A;  2J7P D;  3NDB B;  1FMV A;  4G7Z F;  3B0V C;  3ZC4 A;  4YJW A;  3KL4 A;  2G62 A;  4I1M A;  3SEO A;  2V26 A;  2L9J A;  2O9X A;  4AK9 A;  1SZI A;  3N0T A;  4HFK B;  1KU2 A;  3LEV A;  2MWQ A;  4G7H F;  4O6M A;  3DJN B;  4PFP A;  1Z6A A;  4DOZ A;  1OCZ C;  1MMA A;  3K33 A;  4LLE A;  2H7B A;  3FDQ A;  3DM9 B;  2XRH A;  3UGO A;  2A1D D;  5L3V A;  1J8M F;  1D0Z A;  4OIQ F;  2G3V A;  4YT2 A;  4DVZ A;  2HV7 A;  5EGY A;  3T6B A;  1MND A;  3JSZ A;  1MNE A;  4CBE A;  2J9W A;  2Y3D A;  5EHH A;  1ZU5 A;  2ZXP A;  3LES A;  2QTV A;  2XL4 A;  4BEJ A;  2WVN A;  2EIJ C;  1OKK D;  1M2O A;  4MQ9 F;  2GFH A;  2R7Q A;  1ZHT A;  1VYK A;  4YT8 A;  5B1A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...