4K7BA

Crystal structure of extrinsic protein in photosystem ii
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
111
structure length
111
Chain Sequence
AVSSATINRARGLYGDRIAALKDAVAAGDFKAIAEEKNAFILFNSGAYPTNKAKKNAAIAQTNEIFKAIRSGDKAAVKSAYDAYMAANEIRPLPEINSNVGQGYSSEFDFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Psb31, a Novel Extrinsic Protein of Photosystem II from a Marine Centric Diatom and Implications for Its Binding and Function
pubmed doi rcsb
source organism Chaetoceros gracilis
molecule tags Photosynthesis
molecule keywords Extrinsic protein in photosystem II
total genus 41
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18240 PSII_Pbs31 Photosystem II Psb31 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1740 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4k7bA00
4K7BA
chains in the Genus database with same CATH superfamily
1K40A 4NTFA 5CIVA 1ST6A 3M15A 4D4XA 4LDKA 4XLPF 3LAYA 1J8YF 1CGOA 5CI9A 2YL0A 3AJMA 1OCZC 3K6BA 2VASA 1LIHA 2CNWD 4Q7CA 3JRMO 2QUPA 1FFTC 4LERA 5EHHA 2KNHA 3SNHA 3S27A 1YLMA 4XPWA 1NZEA 3S84A 2PP4A 5A6KA 2LK4A 3AG3C 5L0HA 3C18A 5B1BC 1M56C 5L0CA 1SMYF 2YKZA 3FXHA 4OIQF 3SXZA 2XLDA 3DAFA 1R5ID 3L8JA 4JTDB 4JTAB 5BUOA 4CS8A 2PNOA 1G4US 1V74B 3DE9A 2HSBA 4E18A 1NLXA 1YARO 3B71A 2L6FA 3OA1A 4AL1A 4MVSA 1VYKA 1VOMA 1E2XA 2QY9A 5KYNA 3EG9B 5DS5A 2UUIA 2LQGA 3K1IC 3UGOA 2EILC 2R9RB 1QKRA 1QLEC 5KYWB 5EGYA 4HEAJ 1N1CA 2Q4FA 1E83A 2XS1A 2P1AA 5L0DA 1HW1A 1OW6A 3CQZA 3TULA 1ORJA 1S05A 1YA7O 2J9WA 3EGDB 3ECSA 1A41A 2DI3A 4C7OB 3NDBB 1H7IA 2YQYA 5E3AA 1ZHTA 2FFHA 3M4CA 2KJGA 4MNDA 4PACA 1H9GA 3ZVRA 1UFBA 1EQ1A 1T01A 4PFOA 4JE9A 4FWVA 1VLTA 3POVA 2HJMA 4NTBA 5D92A 5FZTA 5JLIA 1E86A 3B29A 4BJ6C 3S90A 3M4BA 3C8ZA 3AGUA 3OWTA 3W8HA 2IBFA 5JT4A 1F1MA 1ZVZA 2EPLX 4I1OB 3UMIA 3UR3C 2R7UA 3V5YA 3LESA 1MMDA 3RH3A 1Q0FA 1YYJA 4DXWA 4K1OA 3SZRA 3R7CA 3RQFA 3U5SA 4JW1A 4B6IA 5DLJA 1BR1A 3NYJA 4BJ5C 2W9YA 2Q9AA 4QI2A 3NMJA 1MMAA 3BRJA 2HV6A 3R2PA 1LVKA 1FMWA 3FHDA 4PJNA 2NUTA 4YL3A 2ZD9A 2DYRC 3UGPA 2WB7A 1Z23A 3HJCA 2R7OA 4KC9A 5KYYA 4QI0A 1LM3B 2WVOA 3K66A 1VB5A 3ZTZA 3U0CA 4KBLA 1V55C 2LFDA 4U5DE 2JX0A 5COMA 1Z63A 3L34A 3CZ6A 3DMDA 2AP3A 4JIOA 4RD9A 1T5OA 3PCVA 3SYNA 3NRHA 1OQCA 1ORSC 2CCYA 2VH3A 2ICWG 1NSGB 2EPOA 2XM4A 3AG2C 4HFKB 2UUHA 4MTGA 2QTVA 3LUTB 1E84A 2WZFA 3N2ZB 2YLGA 2IXOA 2IOQA 1VLSA 1BR4A 1YA9A 2L9JA 2X0CA 5B3IA 4BJ5A 3EPVA 4U5EE 5A69A 4G78A 2RD9A 2FAPB 2OG2A 3KPHA 4LDRA 3S29A 3T9OA 1TFKB 2YZSA 4E0HA 1NFNA 5T3WA 3EZHA 3ABLC 5GPGB 2XXAB 1HMOA 3EZIA 5JUAA 3HTKC 1XWJA 1S7ZA 3NMKA 3SXKA 5A6BA 1DOWA 3MYIA 3E9VA 4FAPB 3WHNA 2XL4A 2I8BA 4E0IA 4DBQA 4EBJA 3PMRA 4MVOA 5JVEA 2GFHA 4WABA 1RJ9B 1YDIA 1MMNA 2WVQA 4O79A 2J9UA 1OR3A 2AVKA 1SYQA 3K1HA 1D0YA 1RKEB 1OKKA 3EJNA 4AK9A 4IARA 5L0IA 3GANA 4U5CE 1IW7F 2Q9CA 3L8IA 4GQHA 4LDQA 2CDQA 1G5ZA 2R02A 4M63A 2J0XA 3V7OA 3QVYA 4Z9IA 3ZIBA 4J32B 3EQLF 5BQHA 3LNMB 2R7WA 1ZHZA 5A6BD 2YL7A 1VTMP 3C8GB 1E85A 1U89A 2FGYA 4G0HA 2WL8A 3K1IA 3LLIA 3NKEA 1NG1A 1KNYA 3KMIA 4D4NA 3EH2A 4DBRA 2OU6A 5JRAA 2F22A 3GEIA 1MQVA 2VCCA 3Q7GA 4N6HA 2XLHA 3IQ5A 2ZXOA 1JPJA 4PFPA 3GM3A 4CS8C 1XZQA 3JYHA 4O6YA 1H6GA 2P61A 2VC9A 4OIPF 4DVYP 2XXAA 3EGXA 2J9BA 1MMGA 4FX5A 3TQOA 2PX0A 4NQFA 5F5FA 1O5HA 3JRTA 1O87A 2H7OA 3GODA 3N24A 2L81A 1JPNA 3HNKA 2XLVA 2R25A 3JT1A 3Q7LA 4MS2A 3O6XA 3O39A 5AC5A 2Y3BA 5HV9A 3KYJA 3LLKA 4PK4A 1D1AA 3VRCA 2OQMA 2XL6A 2XSEA 4YJWA 3TK0A 3X1OA 1KTMA 1RKEA 3DI5A 3IEEA 1OW7A 3ZDLA 2P6VA 4HE8D 4Z9HA 1Q0DA 2LP4A 2YLDA 3T6BA 1ZHWA 1XZPA 5BQIA 3L0IA 4KNWA 4NY3A 1AVOB 2J7PD 3SXYA 1D0ZA 1M2OA 4ZLDA 2GDCA 3W2WA 1OR2A 3WODF 3IQTA 2D4UA 3LS0A 4BJ6A 1SF8A 2Q9BA 3VF0A 4X0RA 1A7VA 1GM5A 1QPUA 1C03A 3T6GB 4MW8A 4IWBA 5KYXB 4OINF 2OCCC 2YRFA 3EGDA 4K0DA 4CS9C 4W8KA 2KC3A 2O9XA 2HS5A 4CDAA 4ANJA 2R7VA 3RVYA 2HFIA 2L7AA 4IAOA 2IYLD 1OW8A 4JKVA 1YVIA 1YZAA 2OEVA 2OEXA 3GORA 3HKKA 2TMVP 4CSAC 3RQEA 3LEVA 1LS4A 4IAQA 3FDQA 2CYDA 3L1MA 1A7EA 2G62A 5B3SC 3CAXA 1V54C 1EI7A 1WOLA 2XLWA 2YL1A 5L3QA 3U3FA 2H7BA 3MBGA 2Q7RA 3TJ5A 3DZAA 1TWAA 2PX3A 3DM5A 2Z15A 3U8PA 1TWGA 2HUJA 3OEOA 1ZHYA 4JRZA 2YLIA 1M2VB 4JTCB 2LSEA 3JSEO 3VM6A 2EPNA 1LI5A 1AUEA 2R05A 2GA0A 5HSWA 4BPMA 3US6A 2VCBA 4Z9JA 4XEVA 2NUTB 2LD6A 2A1DD 2Y69C 3B9QA 4MVRA 4CDVA 4EIYA 1LE2A 5COGA 2LCHA 3ZSUA 4EWCA 5L0FA 4YL0A 4KNVA 3M1CB 4AE4A 1FFHA 4U9DA 3S28A 3BEHA 1M57C 1U0BB 3WG7C 4NTAA 1J8MF 4BEMJ 5F5HA 3J06A 2KSFA 1A0BA 3AG4C 2HV7A 1MNDA 2OJQA 3RW0A 3EG9A 2CGEA 5K0IA 1T6UA 3DJUB 2P0NA 1WGWA 4MVMA 2HZ8A 4IRUA 2KYHA 3UMKA 2W4BA 3FAJA 4DOZA 4G7OF 2R7TA 4U9EA 4XPYA 3UMHA 2V26A 3QW1A 2J46A 2NPUA 2R7QA 4DRIB 2BL2A 3LS1A 4JURI 4CIPA 3RFYA 4A2NB 1OXBA 3IHUA 2EINC 3Q6NA 3TOLA 1YJGA 3O10A 4HFFB 4IGGA 3ZWIA 3U3BA 5FCLA 4WGZA 3KYIA 1Z6AA 3GWNA 4YL1A 5DS6A 1Z3IX 3DD7A 2ZXPA 3EHMA 4P9FA 3T4RA 4R32A 1TWHA 4E7ZA 4JVSA 3SXMA 1ZZPA 4UDVA 2A6EF 3FVYA 4DRJB 2XM0A 1RMVA 3EFOB 3ATPA 3HNIA 3X2QC 3FOOA 2EPKX 5TJ5E 1B68A 1JAFA 2XS8A 1QVXA 2J8WA 4C3EA 5T3TA 5DQTA 1MNEA 1BDJB 2MYSA 1K04A 4U5BE 4F4BA 3MLGA 2M4EA 2KK1A 4YN0B 5EK0A 3RIPA 1ZU5A 4ER9A 1ZHXA 3LNRA 3ZQYA 3RKOF 4BJTA 3CEXA 3ZQVA 4XPXA 4CIHA 5L0JA 4OIOF 1ZU4A 1QZXA 2DGJA 5KYYB 4JEBA 4MW3A 2IXNA 2KQ9A 2OJED 2MHRA 1APCA 2A6HF 2B0HA 1ZW2A 2A0BA 1TQGA 2YVKA 2Y3DA 3FAPB 3NYLA 4I3MA 1R4TA 5DS4A 3FMSA 1ZW3A 2LIGA 3G4XA 4XEFA 1WN0A 2YWAA 3A11A 2C04A 1A7DA 1OXKA 3QZCA 2HMZA 2JD3A 4MTFA 5B1AC 4CS9A 3TJ6A 3QMKA 3RVZA 1G4WR 1DOVA 1VYIA 4XTKA 5JP7A 4EBKA 1EKYA 3GM2A 1BZ4A 3I5PA 4CS7A 4IJJA 4IB4A 1YZCA 4O6NA 1KU2A 4U5HA 4YK5A 3W8IA 4CJGA 1WASA 3IQCA 3W2VA 1LS1A 2HKVA 5E2QA 3F47A 2R7XA 3K33A 1CGNA 1JOGA 2MWQA 5AC4A 3NYMA 5JSLA 3F46A 4O7GA 3MYFA 2P7VA 3ITFA 1T6QA 3HLZA 1RJ9A 3I5QA 1O3UA 3ZTMA 2W45A 4DVZA 2R7RA 4PJLA 5COFA 4OD4A 4P6IC 4EBBA 1PV3A 2J45A 3B0UX 1OKKD 5KYXA 2R7SA 4JCZA 4C3BA 2EIJC 1HW2A 5KYUB 2EIMC 5KYWA 1GGQA 3H2VA 4U5FE 3T6JA 3QVZA 1C02A 3GWLA 1UG7A 1VK5A 4JJGA 3VYWA 2J9VA 2WZGA 1NBBA 2QNLA 3EHNA 2KGOA 2VCAA 3IQ6A 2Y3GA 2L6GA 5E3CA 3DJNB 4Q4ZF 3DAGA 4WJ0A 1D1CA 1LPEA 2ETSA 2ZXRA 4P9TA 1JR8A 2C03A 2YHSA 2AWYA 4W8PA 4XEKA 3RYLA 4DJ9A 2NSFA 2R03A 2H7VC 1BBHA 1OCCC 1JMWA 2NG1A 3NKDA 4L6RA 1LE4A 4GEHA 3RF3A 3RQGA 2X51A 1WWPA 4C3DA 4BG0A 2BC5A 2GWWA 1LI7A 1LKXA 2I15A 4GYTA 5D91A 3K7DA 4CX9A 4I1MA 1CPRA 2QE9A 4ONSA 4YT8A 3AQBA 3W4YA 1FMVA 1SR2A 5AGFA 5CI8A 3PDMP 3LEOA 4YWQA 2OOCA 4XWJA 1GQAA 3IPMO 4PJJA 3B0VC 2XLEA 5A6AA 1VMAA 3S9OA 3NMIA 4ULWA 4ULVA 4RBNA 3HNJA 2WZLA 2XLOA 4ZLCA 4N06A 1HY5A 3EFOA 1TR2A 4N4WA 2KW3C 2D5RB 1NU9C 1I4ZA 3A9CA 2XRHA 3GM1A 3DWWA 1FTSA 4OD5A 2DB4A 2PFDA 4LLEA 4DRHB 3DM9B 4EUKB 3G50A 3WAQA 1T6IA 2G3KA 3CSKA 3KKBA 4JCHA 4EKWA 2XLMA 3HNLA 4LACB 1L7CA 3AOUA 2Y3HA 2ASRA 1EA8A 2J7PA 2RSEB 4J30B 2J0WA 2A68F 3FOPA 4PJMA 256BA 3ASNC 3GEHA 3SEOA 3U9MA 4G7HF 2YEVA 4I44A 1Q0MA 2NUPB 4NCQA 4K7BA 4MVQA 1I4YA 3MX3A 4JJFA 4C7OA 4AX2A 1HE9A 4MTOA 3QW0A 4MVUA 1FR0A 2IM8A 4G7ZF 2M64A 4E7SA 1V4AA 4O6MA 4WGYA 5BQGA 1OCRC 1SZIA 2LFFA 4OIRF 3U9JA 2YL3A 4CSAA 1D0XA 2IXPA 3B0PA 3C62A 2WVNA 1M2VA 1NU7D 3H65A 4RDAA 3N0TA 5E33A 2BE5F 5T1DB 4YT2A 2V3CC 1YYXA 2A0UA 1CPQA 1OCOC 2A69F 3AGTA 4KI2A 1ZYRF 1H9TA 1Z7Qc 2IXMA 4CJOA 1AEPA 5DQZA 3JTLO 3C7JA 4J7YA 3TOMA 1ORYA 2H8AA 3UNGC 3C8GA 1HMDA 3VAYA 4AE4B 4U5GA 1M6TA 3JZ0A 3MFNA 3LJBA 5L3VA 1L3PA 2PF4E 1CGME 4BJ1A 3ZG1A 1K05A 2VB6A 4E17A 2NSGA 1D1BA 4CBEA 1I5NA 2JPUA 2Y39A 3DXJF 4Q5SF 2L6HA 3M79A 5A6JA 3AG1C 3EH1A 2PBEA 3EGXB 4H4KC 4YT4A 2NUPA 3JSZA 2CW0F 2HJ3A 2ZXWC 1YAUO 1Q0KA 2EPMX 2AU5A 4JEAA 4PR9A 4XLNF 3H2UA 4BEJA 2CNWA 1QSPA 3U2MA 1WATA 2B0JA 4H54A 4J7TA 1U6HA 4JZAA 3TD7A 2Q00A 4JC7A 1TKNA 4MQ9F 4CDYA 4MVZA 1BR2A 4A4AA 4XQ1A 1HE1A 3U2LA 3AQCA 5IY5C 2GAQA 3ABKC 3C63A 3KL4A 5DVWA 3G4ZA 1T9KA 2AWCA 4YT5A 3JCUQ 3S0XA 2XL8A 3QTHA 1PCXA 1RKCA 1Y6DA 3O55A 2QLAA 2E87A 1JRAA 1C17M 1FAPB 4QDLA 3V5ZA 1QQ3A 1W2WA 2HSQA 2DYSC 2G3VA 4LLCA 5KYUA 2ZPAA 3DE8A 1Y4CA 1WTYA 1RXQA 2Q3TA 3ASOC 1GS9A 2OKUA 3KH2A 3NG1A 2W4MA 1PD0A 1NFOA 2HMQA 3U8VA 4NC3A 5JS5A 1TFOB 3V5XA 4FESA 3PHF2 3Q6MA 1RCPA 1FNTc 3C8GD 3I4UA 3E70C 3DKAA 3JYYA 1IZMA 1Q0GA 5L0GA 5F28E 3SP1A 3ZC4A 1Z5ZA 2EIKC 1TWCA 4AL0A 1G8XA 4EHPA 4N6CA 3GEEA 3ABMC 1PD1A
chains in the Genus database with same CATH topology
1ST6A 4XLPF 3LAYA 1J8YF 5CI9A 1OCZC 3K6BA 2VASA 2CNWD 4Q7CA 1FFTC 4LERA 5EHHA 2KNHA 3SNHA 3S27A 1NZEA 2PP4A 3AG3C 5B1BC 1M56C 1SMYF 4OIQF 3DAFA 5BUOA 4CS8A 3OA1A 5KYNA 1VYKA 1VOMA 2QY9A 5DS5A 3EG9B 3K1IC 3UGOA 2EILC 5KYWB 1QLEC 5EGYA 4HEAJ 1N1CA 3CQZA 2J9WA 3EGDB 3ECSA 4C7OB 3NDBB 5E3AA 1ZHTA 2FFHA 4MNDA 2KJGA 3ZVRA 4PFOA 4FWVA 3POVA 5D92A 4BJ6C 3OWTA 3W8HA 4I1OB 3UMIA 3UR3C 2R7UA 3LESA 1MMDA 3RH3A 3SZRA 4JW1A 4B6IA 5DLJA 1BR1A 3NYJA 4BJ5C 2W9YA 2Q9AA 4QI2A 1MMAA 2HV6A 1LVKA 1FMWA 3FHDA 4PJNA 2NUTA 2DYRC 3UGPA 2WB7A 1Z23A 3HJCA 2R7OA 4KC9A 5KYYA 4QI0A 2WVOA 3K66A 4KBLA 1V55C 4U5DE 1Z63A 3L34A 3CZ6A 3DMDA 3SYNA 4RD9A 3NRHA 2VH3A 3AG2C 4HFKB 2QTVA 2WZFA 3N2ZB 2IXOA 2IOQA 2L9JA 1BR4A 4BJ5A 3EPVA 4U5EE 2OG2A 3S29A 2YZSA 5T3WA 3EZHA 3ABLC 2XXAB 3EZIA 3HTKC 1S7ZA 3E9VA 2XL4A 2I8BA 4DBQA 3PMRA 2GFHA 1RJ9B 1MMNA 2WVQA 4O79A 2J9UA 3K1HA 1D0YA 1OKKA 3EJNA 4AK9A 3GANA 4U5CE 1IW7F 2Q9CA 2CDQA 4M63A 3V7OA 2J0XA 3ZIBA 4J32B 3EQLF 2R7WA 1ZHZA 2FGYA 4G0HA 2WL8A 3LLIA 3NKEA 1NG1A 3KMIA 3EH2A 4DBRA 3Q7GA 2ZXOA 1JPJA 4PFPA 4CS8C 3JYHA 4O6YA 4OIPF 4DVYP 2XXAA 3EGXA 1MMGA 4FX5A 2PX0A 5F5FA 1O5HA 3JRTA 1O87A 2H7OA 3GODA 3N24A 2L81A 1JPNA 3JT1A 3Q7LA 3O6XA 3O39A 2Y3BA 3LLKA 4PK4A 1D1AA 2XSEA 4YJWA 3X1OA 3IEEA 2P6VA 4HE8D 3T6BA 1ZHWA 3L0IA 4KNWA 4NY3A 2J7PD 1D0ZA 1M2OA 4ZLDA 3W2WA 3WODF 3LS0A 4BJ6A 1SF8A 2Q9BA 4X0RA 4IWBA 5KYXB 4OINF 2OCCC 3EGDA 4K0DA 4CS9C 4W8KA 2O9XA 4ANJA 2R7VA 4IAOA 2IYLD 4CSAC 3LEVA 3FDQA 2G62A 1V54C 5L3QA 2H7BA 3DZAA 1TWAA 2PX3A 3DM5A 2Z15A 1TWGA 3OEOA 1ZHYA 1M2VB 2LSEA 5HSWA 2NUTB 3B9QA 2A1DD 2Y69C 3ZSUA 4EWCA 4KNVA 3M1CB 4AE4A 1FFHA 3S28A 1M57C 3WG7C 1J8MF 5F5HA 3AG4C 2HV7A 1MNDA 3EG9A 2CGEA 3DJUB 1WGWA 4IRUA 3UMKA 2W4BA 3FAJA 4DOZA 4G7OF 2R7TA 3UMHA 2V26A 2R7QA 2J46A 4JURI 3LS1A 3RFYA 4A2NB 2EINC 3Q6NA 4HFFB 5FCLA 1Z6AA 5DS6A 1Z3IX 3DD7A 2ZXPA 3EHMA 3T4RA 1TWHA 4E7ZA 4JVSA 2A6EF 3FVYA 3EFOB 3X2QC 4C3EA 4F4BA 5T3TA 5DQTA 1MNEA 2MYSA 4U5BE 3MLGA 2M4EA 3RIPA 4YN0B 1ZU5A 1ZHXA 3LNRA 4BJTA 3RKOF 4CIHA 4OIOF 1ZU4A 1QZXA 2DGJA 5KYYB 2IXNA 2KQ9A 4O6NA 5B3SC 2A6HF 4I3MA 3NYLA 2Y3DA 5DS4A 2C04A 3QZCA 2JD3A 5B1AC 4CS9A 3QMKA 1VYIA 4XTKA 3I5PA 4CS7A 4IJJA 4U5HA 1KU2A 3W8IA 3W2VA 1LS1A 5E2QA 3F47A 2R7XA 3K33A 2MWQA 3NYMA 3F46A 4O7GA 2P7VA 3ITFA 3HLZA 1RJ9A 3I5QA 2W45A 4DVZA 2R7RA 4PJLA 4OD4A 4P6IC 4EBBA 2J45A 3B0UX 1OKKD 5KYXA 2R7SA 4C3BA 2EIJC 5KYUB 2EIMC 5KYWA 4U5FE 3T6JA 1VK5A 4JJGA 3VYWA 2J9VA 2WZGA 3EHNA 2KGOA 2Y3GA 5E3CA 3DJNB 4Q4ZF 3DAGA 4WJ0A 1D1CA 2ZXRA 3B0VC 2C03A 2YHSA 3RYLA 2H7VC 1OCCC 2NG1A 3NKDA 4GEHA 2X51A 4C3DA 4BG0A 4GYTA 1LKXA 5D91A 3K7DA 4I1MA 4YT8A 3AQBA 1FMVA 5CI8A 4YWQA 4XWJA 4PJJA 1VMAA 4ULWA 4RBNA 2WZLA 4ZLCA 4N06A 3EFOA 1TR2A 2KW3C 2D5RB 1NU9C 2XRHA 1FTSA 4OD5A 4LLEA 2PFDA 3DM9B 2G3KA 3KKBA 3CSKA 4JCHA 4LACB 2Y3HA 2J7PA 4J30B 2J0WA 2A68F 4PJMA 3ASNC 3SEOA 4G7HF 2YEVA 4I44A 2NUPB 4K7BA 3MX3A 4JJFA 4C7OA 4AX2A 4G7ZF 4E7SA 4O6MA 1OCRC 1SZIA 4OIRF 4CSAA 1D0XA 2IXPA 3B0PA 2WVNA 1M2VA 1NU7D 3H65A 4RDAA 3N0TA 5E33A 2BE5F 5T1DB 4YT2A 2V3CC 1OCOC 2A69F 4KI2A 1ZYRF 2IXMA 5DQZA 3UNGC 3VAYA 4AE4B 4U5GA 3LJBA 5L3VA 2PF4E 4BJ1A 3ZG1A 2VB6A 1D1BA 4CBEA 3DXJF 2Y39A 4Q5SF 3AG1C 3EH1A 3EGXB 4H4KC 4YT4A 2NUPA 3JSZA 2CW0F 2ZXWC 4XLNF 4BEJA 2CNWA 2B0JA 4JZAA 3TD7A 1TKNA 4MQ9F 1BR2A 3AQCA 5IY5C 3ABKC 5DVWA 3KL4A 4YT5A 3JCUQ 3S0XA 1PCXA 4QDLA 2E87A 1W2WA 2DYSC 2G3VA 4LLCA 5KYUA 2ZPAA 3ASOC 2Q3TA 3KH2A 3NG1A 2W4MA 1PD0A 4FESA 3PHF2 3Q6MA 3I4UA 3E70C 1IZMA 3SP1A 3ZC4A 1Z5ZA 2EIKC 1TWCA 1G8XA 3ABMC 1PD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7B A; 
#chains in the Genus database with same CATH topology
 1K40 A;  4NTF A;  5CIV A;  1ST6 A;  3M15 A;  4D4X A;  4LDK A;  4XLP F;  3LAY A;  1J8Y F;  1CGO A;  5CI9 A;  2YL0 A;  3AJM A;  1OCZ C;  3K6B A;  2VAS A;  1LIH A;  2CNW D;  4Q7C A;  3JRM O;  2QUP A;  1FFT C;  4LER A;  5EHH A;  2KNH A;  3SNH A;  3S27 A;  1YLM A;  4XPW A;  1NZE A;  3S84 A;  2PP4 A;  5A6K A;  2LK4 A;  3AG3 C;  5L0H A;  3C18 A;  5B1B C;  1M56 C;  5L0C A;  1SMY F;  2YKZ A;  3FXH A;  4OIQ F;  3SXZ A;  2XLD A;  3DAF A;  1R5I D;  3L8J A;  4JTD B;  4JTA B;  5BUO A;  4CS8 A;  2PNO A;  1G4U S;  1V74 B;  3DE9 A;  2HSB A;  4E18 A;  1NLX A;  1YAR O;  3B71 A;  2L6F A;  3OA1 A;  4AL1 A;  4MVS A;  1VYK A;  1VOM A;  1E2X A;  2QY9 A;  5KYN A;  3EG9 B;  5DS5 A;  2UUI A;  2LQG A;  3K1I C;  3UGO A;  2EIL C;  2R9R B;  1QKR A;  1QLE C;  5KYW B;  5EGY A;  4HEA J;  1N1C A;  2Q4F A;  1E83 A;  2XS1 A;  2P1A A;  5L0D A;  1HW1 A;  1OW6 A;  3CQZ A;  3TUL A;  1ORJ A;  1S05 A;  1YA7 O;  2J9W A;  3EGD B;  3ECS A;  1A41 A;  2DI3 A;  4C7O B;  3NDB B;  1H7I A;  2YQY A;  5E3A A;  1ZHT A;  2FFH A;  3M4C A;  2KJG A;  4MND A;  4PAC A;  1H9G A;  3ZVR A;  1UFB A;  1EQ1 A;  1T01 A;  4PFO A;  4JE9 A;  4FWV A;  1VLT A;  3POV A;  2HJM A;  4NTB A;  5D92 A;  5FZT A;  5JLI A;  1E86 A;  3B29 A;  4BJ6 C;  3S90 A;  3M4B A;  3C8Z A;  3AGU A;  3OWT A;  3W8H A;  2IBF A;  5JT4 A;  1F1M A;  1ZVZ A;  2EPL X;  4I1O B;  3UMI A;  3UR3 C;  2R7U A;  3V5Y A;  3LES A;  1MMD A;  3RH3 A;  1Q0F A;  1YYJ A;  4DXW A;  4K1O A;  3SZR A;  3R7C A;  3RQF A;  3U5S A;  4JW1 A;  4B6I A;  5DLJ A;  1BR1 A;  3NYJ A;  4BJ5 C;  2W9Y A;  2Q9A A;  4QI2 A;  3NMJ A;  1MMA A;  3BRJ A;  2HV6 A;  3R2P A;  1LVK A;  1FMW A;  3FHD A;  4PJN A;  2NUT A;  4YL3 A;  2ZD9 A;  2DYR C;  3UGP A;  2WB7 A;  1Z23 A;  3HJC A;  2R7O A;  4KC9 A;  5KYY A;  4QI0 A;  1LM3 B;  2WVO A;  3K66 A;  1VB5 A;  3ZTZ A;  3U0C A;  4KBL A;  1V55 C;  2LFD A;  4U5D E;  2JX0 A;  5COM A;  1Z63 A;  3L34 A;  3CZ6 A;  3DMD A;  2AP3 A;  4JIO A;  4RD9 A;  1T5O A;  3PCV A;  3SYN A;  3NRH A;  1OQC A;  1ORS C;  2CCY A;  2VH3 A;  2ICW G;  1NSG B;  2EPO A;  2XM4 A;  3AG2 C;  4HFK B;  2UUH A;  4MTG A;  2QTV A;  3LUT B;  1E84 A;  2WZF A;  3N2Z B;  2YLG A;  2IXO A;  2IOQ A;  1VLS A;  1BR4 A;  1YA9 A;  2L9J A;  2X0C A;  5B3I A;  4BJ5 A;  3EPV A;  4U5E E;  5A69 A;  4G78 A;  2RD9 A;  2FAP B;  2OG2 A;  3KPH A;  4LDR A;  3S29 A;  3T9O A;  1TFK B;  2YZS A;  4E0H A;  1NFN A;  5T3W A;  3EZH A;  3ABL C;  5GPG B;  2XXA B;  1HMO A;  3EZI A;  5JUA A;  3HTK C;  1XWJ A;  1S7Z A;  3NMK A;  3SXK A;  5A6B A;  1DOW A;  3MYI A;  3E9V A;  4FAP B;  3WHN A;  2XL4 A;  2I8B A;  4E0I A;  4DBQ A;  4EBJ A;  3PMR A;  4MVO A;  5JVE A;  2GFH A;  4WAB A;  1RJ9 B;  1YDI A;  1MMN A;  2WVQ A;  4O79 A;  2J9U A;  1OR3 A;  2AVK A;  1SYQ A;  3K1H A;  1D0Y A;  1RKE B;  1OKK A;  3EJN A;  4AK9 A;  4IAR A;  5L0I A;  3GAN A;  4U5C E;  1IW7 F;  2Q9C A;  3L8I A;  4GQH A;  4LDQ A;  2CDQ A;  1G5Z A;  2R02 A;  4M63 A;  2J0X A;  3V7O A;  3QVY A;  4Z9I A;  3ZIB A;  4J32 B;  3EQL F;  5BQH A;  3LNM B;  2R7W A;  1ZHZ A;  5A6B D;  2YL7 A;  1VTM P;  3C8G B;  1E85 A;  1U89 A;  2FGY A;  4G0H A;  2WL8 A;  3K1I A;  3LLI A;  3NKE A;  1NG1 A;  1KNY A;  3KMI A;  4D4N A;  3EH2 A;  4DBR A;  2OU6 A;  5JRA A;  2F22 A;  3GEI A;  1MQV A;  2VCC A;  3Q7G A;  4N6H A;  2XLH A;  3IQ5 A;  2ZXO A;  1JPJ A;  4PFP A;  3GM3 A;  4CS8 C;  1XZQ A;  3JYH A;  4O6Y A;  1H6G A;  2P61 A;  2VC9 A;  4OIP F;  4DVY P;  2XXA A;  3EGX A;  2J9B A;  1MMG A;  4FX5 A;  3TQO A;  2PX0 A;  4NQF A;  5F5F A;  1O5H A;  3JRT A;  1O87 A;  2H7O A;  3GOD A;  3N24 A;  2L81 A;  1JPN A;  3HNK A;  2XLV A;  2R25 A;  3JT1 A;  3Q7L A;  4MS2 A;  3O6X A;  3O39 A;  5AC5 A;  2Y3B A;  5HV9 A;  3KYJ A;  3LLK A;  4PK4 A;  1D1A A;  3VRC A;  2OQM A;  2XL6 A;  2XSE A;  4YJW A;  3TK0 A;  3X1O A;  1KTM A;  1RKE A;  3DI5 A;  3IEE A;  1OW7 A;  3ZDL A;  2P6V A;  4HE8 D;  4Z9H A;  1Q0D A;  2LP4 A;  2YLD A;  3T6B A;  1ZHW A;  1XZP A;  5BQI A;  3L0I A;  4KNW A;  4NY3 A;  1AVO B;  2J7P D;  3SXY A;  1D0Z A;  1M2O A;  4ZLD A;  2GDC A;  3W2W A;  1OR2 A;  3WOD F;  3IQT A;  2D4U A;  3LS0 A;  4BJ6 A;  1SF8 A;  2Q9B A;  3VF0 A;  4X0R A;  1A7V A;  1GM5 A;  1QPU A;  1C03 A;  3T6G B;  4MW8 A;  4IWB A;  5KYX B;  4OIN F;  2OCC C;  2YRF A;  3EGD A;  4K0D A;  4CS9 C;  4W8K A;  2KC3 A;  2O9X A;  2HS5 A;  4CDA A;  4ANJ A;  2R7V A;  3RVY A;  2HFI A;  2L7A A;  4IAO A;  2IYL D;  1OW8 A;  4JKV A;  1YVI A;  1YZA A;  2OEV A;  2OEX A;  3GOR A;  3HKK A;  2TMV P;  4CSA C;  3RQE A;  3LEV A;  1LS4 A;  4IAQ A;  3FDQ A;  2CYD A;  3L1M A;  1A7E A;  2G62 A;  5B3S C;  3CAX A;  1V54 C;  1EI7 A;  1WOL A;  2XLW A;  2YL1 A;  5L3Q A;  3U3F A;  2H7B A;  3MBG A;  2Q7R A;  3TJ5 A;  3DZA A;  1TWA A;  2PX3 A;  3DM5 A;  2Z15 A;  3U8P A;  1TWG A;  2HUJ A;  3OEO A;  1ZHY A;  4JRZ A;  2YLI A;  1M2V B;  4JTC B;  2LSE A;  3JSE O;  3VM6 A;  2EPN A;  1LI5 A;  1AUE A;  2R05 A;  2GA0 A;  5HSW A;  4BPM A;  3US6 A;  2VCB A;  4Z9J A;  4XEV A;  2NUT B;  2LD6 A;  2A1D D;  2Y69 C;  3B9Q A;  4MVR A;  4CDV A;  4EIY A;  1LE2 A;  5COG A;  2LCH A;  3ZSU A;  4EWC A;  5L0F A;  4YL0 A;  4KNV A;  3M1C B;  4AE4 A;  1FFH A;  4U9D A;  3S28 A;  3BEH A;  1M57 C;  1U0B B;  3WG7 C;  4NTA A;  1J8M F;  4BEM J;  5F5H A;  3J06 A;  2KSF A;  1A0B A;  3AG4 C;  2HV7 A;  1MND A;  2OJQ A;  3RW0 A;  3EG9 A;  2CGE A;  5K0I A;  1T6U A;  3DJU B;  2P0N A;  1WGW A;  4MVM A;  2HZ8 A;  4IRU A;  2KYH A;  3UMK A;  2W4B A;  3FAJ A;  4DOZ A;  4G7O F;  2R7T A;  4U9E A;  4XPY A;  3UMH A;  2V26 A;  3QW1 A;  2J46 A;  2NPU A;  2R7Q A;  4DRI B;  2BL2 A;  3LS1 A;  4JUR I;  4CIP A;  3RFY A;  4A2N B;  1OXB A;  3IHU A;  2EIN C;  3Q6N A;  3TOL A;  1YJG A;  3O10 A;  4HFF B;  4IGG A;  3ZWI A;  3U3B A;  5FCL A;  4WGZ A;  3KYI A;  1Z6A A;  3GWN A;  4YL1 A;  5DS6 A;  1Z3I X;  3DD7 A;  2ZXP A;  3EHM A;  4P9F A;  3T4R A;  4R32 A;  1TWH A;  4E7Z A;  4JVS A;  3SXM A;  1ZZP A;  4UDV A;  2A6E F;  3FVY A;  4DRJ B;  2XM0 A;  1RMV A;  3EFO B;  3ATP A;  3HNI A;  3X2Q C;  3FOO A;  2EPK X;  5TJ5 E;  1B68 A;  1JAF A;  2XS8 A;  1QVX A;  2J8W A;  4C3E A;  5T3T A;  5DQT A;  1MNE A;  1BDJ B;  2MYS A;  1K04 A;  4U5B E;  4F4B A;  3MLG A;  2M4E A;  2KK1 A;  4YN0 B;  5EK0 A;  3RIP A;  1ZU5 A;  4ER9 A;  1ZHX A;  3LNR A;  3ZQY A;  3RKO F;  4BJT A;  3CEX A;  3ZQV A;  4XPX A;  4CIH A;  5L0J A;  4OIO F;  1ZU4 A;  1QZX A;  2DGJ A;  5KYY B;  4JEB A;  4MW3 A;  2IXN A;  2KQ9 A;  2OJE D;  2MHR A;  1APC A;  2A6H F;  2B0H A;  1ZW2 A;  2A0B A;  1TQG A;  2YVK A;  2Y3D A;  3FAP B;  3NYL A;  4I3M A;  1R4T A;  5DS4 A;  3FMS A;  1ZW3 A;  2LIG A;  3G4X A;  4XEF A;  1WN0 A;  2YWA A;  3A11 A;  2C04 A;  1A7D A;  1OXK A;  3QZC A;  2HMZ A;  2JD3 A;  4MTF A;  5B1A C;  4CS9 A;  3TJ6 A;  3QMK A;  3RVZ A;  1G4W R;  1DOV A;  1VYI A;  4XTK A;  5JP7 A;  4EBK A;  1EKY A;  3GM2 A;  1BZ4 A;  3I5P A;  4CS7 A;  4IJJ A;  4IB4 A;  1YZC A;  4O6N A;  1KU2 A;  4U5H A;  4YK5 A;  3W8I A;  4CJG A;  1WAS A;  3IQC A;  3W2V A;  1LS1 A;  2HKV A;  5E2Q A;  3F47 A;  2R7X A;  3K33 A;  1CGN A;  1JOG A;  2MWQ A;  5AC4 A;  3NYM A;  5JSL A;  3F46 A;  4O7G A;  3MYF A;  2P7V A;  3ITF A;  1T6Q A;  3HLZ A;  1RJ9 A;  3I5Q A;  1O3U A;  3ZTM A;  2W45 A;  4DVZ A;  2R7R A;  4PJL A;  5COF A;  4OD4 A;  4P6I C;  4EBB A;  1PV3 A;  2J45 A;  3B0U X;  1OKK D;  5KYX A;  2R7S A;  4JCZ A;  4C3B A;  2EIJ C;  1HW2 A;  5KYU B;  2EIM C;  5KYW A;  1GGQ A;  3H2V A;  4U5F E;  3T6J A;  3QVZ A;  1C02 A;  3GWL A;  1UG7 A;  1VK5 A;  4JJG A;  3VYW A;  2J9V A;  2WZG A;  1NBB A;  2QNL A;  3EHN A;  2KGO A;  2VCA A;  3IQ6 A;  2Y3G A;  2L6G A;  5E3C A;  3DJN B;  4Q4Z F;  3DAG A;  4WJ0 A;  1D1C A;  1LPE A;  2ETS A;  2ZXR A;  4P9T A;  1JR8 A;  2C03 A;  2YHS A;  2AWY A;  4W8P A;  4XEK A;  3RYL A;  4DJ9 A;  2NSF A;  2R03 A;  2H7V C;  1BBH A;  1OCC C;  1JMW A;  2NG1 A;  3NKD A;  4L6R A;  1LE4 A;  4GEH A;  3RF3 A;  3RQG A;  2X51 A;  1WWP A;  4C3D A;  4BG0 A;  2BC5 A;  2GWW A;  1LI7 A;  1LKX A;  2I15 A;  4GYT A;  5D91 A;  3K7D A;  4CX9 A;  4I1M A;  1CPR A;  2QE9 A;  4ONS A;  4YT8 A;  3AQB A;  3W4Y A;  1FMV A;  1SR2 A;  5AGF A;  5CI8 A;  3PDM P;  3LEO A;  4YWQ A;  2OOC A;  4XWJ A;  1GQA A;  3IPM O;  4PJJ A;  3B0V C;  2XLE A;  5A6A A;  1VMA A;  3S9O A;  3NMI A;  4ULW A;  4ULV A;  4RBN A;  3HNJ A;  2WZL A;  2XLO A;  4ZLC A;  4N06 A;  1HY5 A;  3EFO A;  1TR2 A;  4N4W A;  2KW3 C;  2D5R B;  1NU9 C;  1I4Z A;  3A9C A;  2XRH A;  3GM1 A;  3DWW A;  1FTS A;  4OD5 A;  2DB4 A;  2PFD A;  4LLE A;  4DRH B;  3DM9 B;  4EUK B;  3G50 A;  3WAQ A;  1T6I A;  2G3K A;  3CSK A;  3KKB A;  4JCH A;  4EKW A;  2XLM A;  3HNL A;  4LAC B;  1L7C A;  3AOU A;  2Y3H A;  2ASR A;  1EA8 A;  2J7P A;  2RSE B;  4J30 B;  2J0W A;  2A68 F;  3FOP A;  4PJM A;  256B A;  3ASN C;  3GEH A;  3SEO A;  3U9M A;  4G7H F;  2YEV A;  4I44 A;  1Q0M A;  2NUP B;  4NCQ A;  4K7B A;  4MVQ A;  1I4Y A;  3MX3 A;  4JJF A;  4C7O A;  4AX2 A;  1HE9 A;  4MTO A;  3QW0 A;  4MVU A;  1FR0 A;  2IM8 A;  4G7Z F;  2M64 A;  4E7S A;  1V4A A;  4O6M A;  4WGY A;  5BQG A;  1OCR C;  1SZI A;  2LFF A;  4OIR F;  3U9J A;  2YL3 A;  4CSA A;  1D0X A;  2IXP A;  3B0P A;  3C62 A;  2WVN A;  1M2V A;  1NU7 D;  3H65 A;  4RDA A;  3N0T A;  5E33 A;  2BE5 F;  5T1D B;  4YT2 A;  2V3C C;  1YYX A;  2A0U A;  1CPQ A;  1OCO C;  2A69 F;  3AGT A;  4KI2 A;  1ZYR F;  1H9T A;  1Z7Q c;  2IXM A;  4CJO A;  1AEP A;  5DQZ A;  3JTL O;  3C7J A;  4J7Y A;  3TOM A;  1ORY A;  2H8A A;  3UNG C;  3C8G A;  1HMD A;  3VAY A;  4AE4 B;  4U5G A;  1M6T A;  3JZ0 A;  3MFN A;  3LJB A;  5L3V A;  1L3P A;  2PF4 E;  1CGM E;  4BJ1 A;  3ZG1 A;  1K05 A;  2VB6 A;  4E17 A;  2NSG A;  1D1B A;  4CBE A;  1I5N A;  2JPU A;  2Y39 A;  3DXJ F;  4Q5S F;  2L6H A;  3M79 A;  5A6J A;  3AG1 C;  3EH1 A;  2PBE A;  3EGX B;  4H4K C;  4YT4 A;  2NUP A;  3JSZ A;  2CW0 F;  2HJ3 A;  2ZXW C;  1YAU O;  1Q0K A;  2EPM X;  2AU5 A;  4JEA A;  4PR9 A;  4XLN F;  3H2U A;  4BEJ A;  2CNW A;  1QSP A;  3U2M A;  1WAT A;  2B0J A;  4H54 A;  4J7T A;  1U6H A;  4JZA A;  3TD7 A;  2Q00 A;  4JC7 A;  1TKN A;  4MQ9 F;  4CDY A;  4MVZ A;  1BR2 A;  4A4A A;  4XQ1 A;  1HE1 A;  3U2L A;  3AQC A;  5IY5 C;  2GAQ A;  3ABK C;  3C63 A;  3KL4 A;  5DVW A;  3G4Z A;  1T9K A;  2AWC A;  4YT5 A;  3JCU Q;  3S0X A;  2XL8 A;  3QTH A;  1PCX A;  1RKC A;  1Y6D A;  3O55 A;  2QLA A;  2E87 A;  1JRA A;  1C17 M;  1FAP B;  4QDL A;  3V5Z A;  1QQ3 A;  1W2W A;  2HSQ A;  2DYS C;  2G3V A;  4LLC A;  5KYU A;  2ZPA A;  3DE8 A;  1Y4C A;  1WTY A;  1RXQ A;  2Q3T A;  3ASO C;  1GS9 A;  2OKU A;  3KH2 A;  3NG1 A;  2W4M A;  1PD0 A;  1NFO A;  2HMQ A;  3U8V A;  4NC3 A;  5JS5 A;  1TFO B;  3V5X A;  4FES A;  3PHF 2;  3Q6M A;  1RCP A;  1FNT c;  3C8G D;  3I4U A;  3E70 C;  3DKA A;  3JYY A;  1IZM A;  1Q0G A;  5L0G A;  5F28 E;  3SP1 A;  3ZC4 A;  1Z5Z A;  2EIK C;  1TWC A;  4AL0 A;  1G8X A;  4EHP A;  4N6C A;  3GEE A;  3ABM C;  1PD1 A; 
#chains in the Genus database with same CATH homology
 1ST6 A;  4XLP F;  3LAY A;  1J8Y F;  5CI9 A;  1OCZ C;  3K6B A;  2VAS A;  2CNW D;  4Q7C A;  1FFT C;  4LER A;  5EHH A;  2KNH A;  3SNH A;  3S27 A;  1NZE A;  2PP4 A;  3AG3 C;  5B1B C;  1M56 C;  1SMY F;  4OIQ F;  3DAF A;  5BUO A;  4CS8 A;  3OA1 A;  5KYN A;  1VYK A;  1VOM A;  2QY9 A;  5DS5 A;  3EG9 B;  3K1I C;  3UGO A;  2EIL C;  5KYW B;  1QLE C;  5EGY A;  4HEA J;  1N1C A;  3CQZ A;  2J9W A;  3EGD B;  3ECS A;  4C7O B;  3NDB B;  5E3A A;  1ZHT A;  2FFH A;  4MND A;  2KJG A;  3ZVR A;  4PFO A;  4FWV A;  3POV A;  5D92 A;  4BJ6 C;  3OWT A;  3W8H A;  4I1O B;  3UMI A;  3UR3 C;  2R7U A;  3LES A;  1MMD A;  3RH3 A;  3SZR A;  4JW1 A;  4B6I A;  5DLJ A;  1BR1 A;  3NYJ A;  4BJ5 C;  2W9Y A;  2Q9A A;  4QI2 A;  1MMA A;  2HV6 A;  1LVK A;  1FMW A;  3FHD A;  4PJN A;  2NUT A;  2DYR C;  3UGP A;  2WB7 A;  1Z23 A;  3HJC A;  2R7O A;  4KC9 A;  5KYY A;  4QI0 A;  2WVO A;  3K66 A;  4KBL A;  1V55 C;  4U5D E;  1Z63 A;  3L34 A;  3CZ6 A;  3DMD A;  3SYN A;  4RD9 A;  3NRH A;  2VH3 A;  3AG2 C;  4HFK B;  2QTV A;  2WZF A;  3N2Z B;  2IXO A;  2IOQ A;  2L9J A;  1BR4 A;  4BJ5 A;  3EPV A;  4U5E E;  2OG2 A;  3S29 A;  2YZS A;  5T3W A;  3EZH A;  3ABL C;  2XXA B;  3EZI A;  3HTK C;  1S7Z A;  3E9V A;  2XL4 A;  2I8B A;  4DBQ A;  3PMR A;  2GFH A;  1RJ9 B;  1MMN A;  2WVQ A;  4O79 A;  2J9U A;  3K1H A;  1D0Y A;  1OKK A;  3EJN A;  4AK9 A;  3GAN A;  4U5C E;  1IW7 F;  2Q9C A;  2CDQ A;  4M63 A;  3V7O A;  2J0X A;  3ZIB A;  4J32 B;  3EQL F;  2R7W A;  1ZHZ A;  2FGY A;  4G0H A;  2WL8 A;  3LLI A;  3NKE A;  1NG1 A;  3KMI A;  3EH2 A;  4DBR A;  3Q7G A;  2ZXO A;  1JPJ A;  4PFP A;  4CS8 C;  3JYH A;  4O6Y A;  4OIP F;  4DVY P;  2XXA A;  3EGX A;  1MMG A;  4FX5 A;  2PX0 A;  5F5F A;  1O5H A;  3JRT A;  1O87 A;  2H7O A;  3GOD A;  3N24 A;  2L81 A;  1JPN A;  3JT1 A;  3Q7L A;  3O6X A;  3O39 A;  2Y3B A;  3LLK A;  4PK4 A;  1D1A A;  2XSE A;  4YJW A;  3X1O A;  3IEE A;  2P6V A;  4HE8 D;  3T6B A;  1ZHW A;  3L0I A;  4KNW A;  4NY3 A;  2J7P D;  1D0Z A;  1M2O A;  4ZLD A;  3W2W A;  3WOD F;  3LS0 A;  4BJ6 A;  1SF8 A;  2Q9B A;  4X0R A;  4IWB A;  5KYX B;  4OIN F;  2OCC C;  3EGD A;  4K0D A;  4CS9 C;  4W8K A;  2O9X A;  4ANJ A;  2R7V A;  4IAO A;  2IYL D;  4CSA C;  3LEV A;  3FDQ A;  2G62 A;  1V54 C;  5L3Q A;  2H7B A;  3DZA A;  1TWA A;  2PX3 A;  3DM5 A;  2Z15 A;  1TWG A;  3OEO A;  1ZHY A;  1M2V B;  2LSE A;  5HSW A;  2NUT B;  3B9Q A;  2A1D D;  2Y69 C;  3ZSU A;  4EWC A;  4KNV A;  3M1C B;  4AE4 A;  1FFH A;  3S28 A;  1M57 C;  3WG7 C;  1J8M F;  5F5H A;  3AG4 C;  2HV7 A;  1MND A;  3EG9 A;  2CGE A;  3DJU B;  1WGW A;  4IRU A;  3UMK A;  2W4B A;  3FAJ A;  4DOZ A;  4G7O F;  2R7T A;  3UMH A;  2V26 A;  2R7Q A;  2J46 A;  4JUR I;  3LS1 A;  3RFY A;  4A2N B;  2EIN C;  3Q6N A;  4HFF B;  5FCL A;  1Z6A A;  5DS6 A;  1Z3I X;  3DD7 A;  2ZXP A;  3EHM A;  3T4R A;  1TWH A;  4E7Z A;  4JVS A;  2A6E F;  3FVY A;  3EFO B;  3X2Q C;  4C3E A;  4F4B A;  5T3T A;  5DQT A;  1MNE A;  2MYS A;  4U5B E;  3MLG A;  2M4E A;  3RIP A;  4YN0 B;  1ZU5 A;  1ZHX A;  3LNR A;  4BJT A;  3RKO F;  4CIH A;  4OIO F;  1ZU4 A;  1QZX A;  2DGJ A;  5KYY B;  2IXN A;  2KQ9 A;  4O6N A;  5B3S C;  2A6H F;  4I3M A;  3NYL A;  2Y3D A;  5DS4 A;  2C04 A;  3QZC A;  2JD3 A;  5B1A C;  4CS9 A;  3QMK A;  1VYI A;  4XTK A;  3I5P A;  4CS7 A;  4IJJ A;  4U5H A;  1KU2 A;  3W8I A;  3W2V A;  1LS1 A;  5E2Q A;  3F47 A;  2R7X A;  3K33 A;  2MWQ A;  3NYM A;  3F46 A;  4O7G A;  2P7V A;  3ITF A;  3HLZ A;  1RJ9 A;  3I5Q A;  2W45 A;  4DVZ A;  2R7R A;  4PJL A;  4OD4 A;  4P6I C;  4EBB A;  2J45 A;  3B0U X;  1OKK D;  5KYX A;  2R7S A;  4C3B A;  2EIJ C;  5KYU B;  2EIM C;  5KYW A;  4U5F E;  3T6J A;  1VK5 A;  4JJG A;  3VYW A;  2J9V A;  2WZG A;  3EHN A;  2KGO A;  2Y3G A;  5E3C A;  3DJN B;  4Q4Z F;  3DAG A;  4WJ0 A;  1D1C A;  2ZXR A;  3B0V C;  2C03 A;  2YHS A;  3RYL A;  2H7V C;  1OCC C;  2NG1 A;  3NKD A;  4GEH A;  2X51 A;  4C3D A;  4BG0 A;  4GYT A;  1LKX A;  5D91 A;  3K7D A;  4I1M A;  4YT8 A;  3AQB A;  1FMV A;  5CI8 A;  4YWQ A;  4XWJ A;  4PJJ A;  1VMA A;  4ULW A;  4RBN A;  2WZL A;  4ZLC A;  4N06 A;  3EFO A;  1TR2 A;  2KW3 C;  2D5R B;  1NU9 C;  2XRH A;  1FTS A;  4OD5 A;  4LLE A;  2PFD A;  3DM9 B;  2G3K A;  3KKB A;  3CSK A;  4JCH A;  4LAC B;  2Y3H A;  2J7P A;  4J30 B;  2J0W A;  2A68 F;  4PJM A;  3ASN C;  3SEO A;  4G7H F;  2YEV A;  4I44 A;  2NUP B;  4K7B A;  3MX3 A;  4JJF A;  4C7O A;  4AX2 A;  4G7Z F;  4E7S A;  4O6M A;  1OCR C;  1SZI A;  4OIR F;  4CSA A;  1D0X A;  2IXP A;  3B0P A;  2WVN A;  1M2V A;  1NU7 D;  3H65 A;  4RDA A;  3N0T A;  5E33 A;  2BE5 F;  5T1D B;  4YT2 A;  2V3C C;  1OCO C;  2A69 F;  4KI2 A;  1ZYR F;  2IXM A;  5DQZ A;  3UNG C;  3VAY A;  4AE4 B;  4U5G A;  3LJB A;  5L3V A;  2PF4 E;  4BJ1 A;  3ZG1 A;  2VB6 A;  1D1B A;  4CBE A;  3DXJ F;  2Y39 A;  4Q5S F;  3AG1 C;  3EH1 A;  3EGX B;  4H4K C;  4YT4 A;  2NUP A;  3JSZ A;  2CW0 F;  2ZXW C;  4XLN F;  4BEJ A;  2CNW A;  2B0J A;  4JZA A;  3TD7 A;  1TKN A;  4MQ9 F;  1BR2 A;  3AQC A;  5IY5 C;  3ABK C;  5DVW A;  3KL4 A;  4YT5 A;  3JCU Q;  3S0X A;  1PCX A;  4QDL A;  2E87 A;  1W2W A;  2DYS C;  2G3V A;  4LLC A;  5KYU A;  2ZPA A;  3ASO C;  2Q3T A;  3KH2 A;  3NG1 A;  2W4M A;  1PD0 A;  4FES A;  3PHF 2;  3Q6M A;  3I4U A;  3E70 C;  1IZM A;  3SP1 A;  3ZC4 A;  1Z5Z A;  2EIK C;  1TWC A;  1G8X A;  3ABM C;  1PD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...