4K7BA

Crystal structure of extrinsic protein in photosystem ii
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
111
structure length
111
Chain Sequence
AVSSATINRARGLYGDRIAALKDAVAAGDFKAIAEEKNAFILFNSGAYPTNKAKKNAAIAQTNEIFKAIRSGDKAAVKSAYDAYMAANEIRPLPEINSNVGQGYSSEFDFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Psb31, a Novel Extrinsic Protein of Photosystem II from a Marine Centric Diatom and Implications for Its Binding and Function
pubmed doi rcsb
source organism Chaetoceros gracilis
molecule tags Photosynthesis
molecule keywords Extrinsic protein in photosystem II
total genus 41
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18240 PSII_Pbs31 Photosystem II Psb31 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1740 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4k7bA00
4K7BA
chains in the Genus database with same CATH superfamily
1GQAA 3HNKA 3I5PA 4JC7A 4G78A 3LJBA 2ZD9A 4LERA 4JZAA 3C63A 4BJ1A 4EBKA 4Z9IA 2R7OA 2WVOA 3K1IC 3NMKA 2C04A 2HMQA 2Q9AA 2R7QA 4E7ZA 3L1MA 2KK1A 1AEPA 2XLEA 3T6GB 3W4YA 1YVIA 4I44A 1O5HA 5K0IA 1OQCA 4GYTA 1HMOA 1NFNA 2PFDA 3AG3C 4BJ5C 2P6VA 3EGDB 3JSZA 4O6MA 1YLMA 2CNWA 4BEJA 5TJ5E 1NG1A 4HE8D 3C62A 3EFOA 4NY3A 1RKEA 4OINF 4MVUA 1KTMA 2HS5A 1D0XA 1ZHTA 3KH2A 1OXBA 2HUJA 3E70C 3FOPA 3FOOA 4NTBA 2VC9A 5AGFA 3RF3A 1KNYA 3JT1A 1ORJA 1S7ZA 2IXMA 2XLOA 2OOCA 3M79A 5A69A 3ZC4A 4AL0A 1JPNA 3OEOA 4CSAC 2O9XA 1YYJA 2NUTA 1VLTA 2A68F 4K0DA 2OCCC 2HSQA 2Y3DA 4OIOF 3N2ZB 1C03A 3DJNB 3O55A 3Q6MA 3RKOF 2JPUA 2QUPA 3ATPA 4ER9A 5DVWA 4U9DA 3AOUA 1PD1A 3G4ZA 5E2QA 2D5RB 3EH2A 3I4UA 4G7OF 3GODA 1JPJA 4QDLA 4OIRF 2NSFA 1OCOC 2P0NA 2J9VA 4P9FA 4PK4A 5DQTA 2GWWA 1VYKA 4GQHA 1YYXA 3U2LA 2B0JA 2W9YA 3G50A 1SMYF 3QW1A 1ZHZA 5D91A 2PP4A 2Z15A 2EPNA 1QQ3A 1WTYA 2L6HA 3OA1A 3U9MA 2WZLA 4CBEA 5L0CA 5KYYA 2GA0A 1OR2A 3RVYA 1LVKA 5KYWA 1FMWA 1OKKD 5KYXA 4JURI 2IBFA 2ZXOA 2KNHA 2YVKA 5E3CA 4P6IC 1XWJA 3T6JA 1EI7A 2Q00A 3MX3A 3L8IA 4MVOA 3X1OA 3US6A 4RD9A 4MW8A 1O87A 4AK9A 2XM4A 1D1CA 3A9CA 5F28E 4D4NA 4LLEA 3B0UX 4ZLCA 1MMAA 1PD0A 3TOLA 5FCLA 3QMKA 3Q6NA 3ZSUA 4EBBA 4OIQF 1YZAA 1Q0MA 2B0HA 2JD3A 4C3EA 3DE9A 4BJTA 1V4AA 2AU5A 2KGOA 2H7BA 3LS0A 4XPYA 3BRJA 4KI2A 4PR9A 3ZQVA 4DRIB 4G7HF 1QZXA 3NMIA 3JTLO 1MMNA 1OXKA 3C7JA 2R7VA 4U5EE 3H2VA 3JYHA 2AVKA 4CDVA 2H7OA 1QKRA 5L0FA 3FDQA 4G0HA 2ICWG 5D92A 1M2VA 1QVXA 2VCBA 2CYDA 2QNLA 1LS1A 2YL3A 4I1OB 4I1MA 1LPEA 1QLEC 3NYLA 2Q9CA 2KC3A 3C8ZA 3B29A 2F22A 1I4YA 1VYIA 3AJMA 3NYJA 2MHRA 5BQIA 2J7PA 4CDYA 1YAUO 3NKEA 1R5ID 4Q4ZF 1LIHA 2YHSA 2OJQA 4LDKA 2MYSA 4Z9JA 3NMJA 4FWVA 4BJ6A 3ABMC 2A1DD 4HFFB 4YT4A 4JEAA 3GANA 3X2QC 2FGYA 2EPMX 3A11A 2R02A 2YLGA 1EA8A 5KYUB 5B3SC 2L7AA 2QTVA 4H4KC 2H7VC 1A7VA 2OU6A 4M63A 4YWQA 3LNMB 2J45A 2OJED 4QI0A 1DOWA 2W45A 2X51A 3FAPB 2BL2A 2XLDA 3LAYA 3PCVA 4MNDA 4NCQA 4DXWA 2TMVP 2GAQA 2VASA 3UMHA 2IM8A 4ONSA 3IQCA 1WGWA 3HNLA 4XQ1A 4XLNF 4CDAA 1C17M 3R2PA 5KYXB 1NBBA 1FAPB 3EZHA 1Z5ZA 2CNWD 1MQVA 3F46A 4JCZA 2XXAA 1VMAA 2XLMA 2A69F 5HV9A 1V54C 5BUOA 4C7OB 2NSGA 2KQ9A 4PJMA 3RFYA 3U3BA 3U8PA 1LKXA 4YT8A 2IYLD 2KSFA 1OKKA 4GEHA 3K1IA 4CSAA 4JRZA 3TD7A 3WODF 1JAFA 4CS9A 3SEOA 2VCAA 3RH3A 5KYUA 1E85A 2I8BA 1HY5A 3VYWA 3LLIA 3RW0A 4CS7A 5COMA 3FMSA 3L34A 4EUKB 2CGEA 4W8KA 3N24A 4BJ6C 4XWJA 3B0PA 1J8YF 1JMWA 2YL7A 3NRHA 3U5SA 4IB4A 1U89A 1TQGA 3EGDA 4AX2A 4H54A 2GFHA 2YRFA 1NU7D 3UMKA 2KJGA 2OG2A 1F1MA 3H2UA 5JT4A 1IZMA 2ZXPA 5AC5A 3QZCA 2H8AA 1HE1A 1Q0FA 2V3CC 1EKYA 5DS5A 3VRCA 4P9TA 1MMGA 4Q5SF 2DYSC 2XM0A 5CIVA 1J8MF 2FFHA 1N1CA 4J32B 5IY5C 1T5OA 2ZXWC 3EG9B 2LP4A 3GM3A 3NYMA 4YN0B 2G3KA 5E3AA 4MTOA 3UMIA 1D1AA 3S29A 3UR3C 4CS9C 3O10A 3IHUA 4DJ9A 3ABLC 3M4CA 4DBQA 3SZRA 3EJNA 3HTKC 3DXJF 3GM1A 4DVYP 3EPVA 3MFNA 1WOLA 3CSKA 5E33A 1VTMP 4WABA 2YL1A 1TWGA 4EBJA 2FAPB 2RSEB 3SYNA 3FAJA 4U5FE 1WN0A 3S0XA 1B68A 4PJJA 3NKDA 4WGYA 3ZWIA 1NSGB 1PCXA 5BQHA 5FZTA 4EHPA 2E87A 2EIJC 1E83A 1BR4A 4MVSA 4XEVA 3H65A 1C02A 1YJGA 4KNWA 2R25A 3O6XA 4XPXA 2Q7RA 3DJUB 4KC9A 3WG7C 3MLGA 4C3BA 3IQTA 4KNVA 3WAQA 4IJJA 1FR0A 1Z3IX 2YKZA 3HNJA 4NTAA 1RJ9A 1Y6DA 2LIGA 4JW1A 3SXYA 3ASNC 3DAGA 3F47A 2YQYA 2L6FA 4U5DE 2XL6A 4HFKB 5GPGB 3SNHA 3VF0A 2CCYA 1YARO 1FFHA 1EQ1A 3T6BA 3EQLF 1NLXA 3S9OA 4B6IA 5A6AA 3S28A 1GM5A 3KYIA 1E86A 1Q0GA 1M2VB 1Z6AA 4XPWA 4U5GA 4LDQA 2WL8A 1G4US 3N0TA 1T9KA 4PFPA 1FTSA 1LE4A 2XLHA 1OW6A 3JRMO 3VM6A 4W8PA 2L81A 4DOZA 4NTFA 3MBGA 3RYLA 5DS4A 4XEKA 5L0JA 1HMDA 4FAPB 1D0YA 1T01A 1QSPA 3RIPA 2R03A 4ULVA 2HJMA 1LE2A 4PJLA 4D4XA 1UG7A 2DB4A 2GDCA 2P7VA 3E9VA 4L6RA 4E18A 2XXAB 2J9WA 2A0BA 3KKBA 3RQFA 1CGOA 2PX3A 1ZW2A 4C3DA 2AP3A 3C8GB 4EKWA 2A6HF 5A6KA 2NUPA 2W4BA 1MMDA 4JTAB 2QE9A 5L0GA 1D1BA 2EPLX 2R9RB 4KBLA 1GS9A 1ZVZA 2HKVA 3SP1A 4BG0A 4G7ZF 1K04A 4MVRA 4LLCA 2ZXRA 4OD5A 4N6HA 1VOMA 3NG1A 3TK0A 2M64A 5B3IA 5A6BD 1OR3A 3ITFA 2R05A 3LNRA 2CDQA 1Z23A 2HMZA 4LACB 3Q7GA 3GEHA 1ZU5A 3K66A 1IW7F 3DE8A 4A4AA 4E17A 1TWCA 2Y3GA 4Z9HA 1A7EA 5EHHA 4MVMA 4MQ9F 2EIMC 3LLKA 4YK5A 3JYYA 3V5ZA 2HV6A 1G8XA 1SYQA 2PX0A 2WVNA 2XL8A 4E0IA 2NUTB 2Y39A 3J06A 1RKCA 2WZFA 1FMVA 1Q0DA 1ZHXA 4MTFA 3W2WA 4JJFA 3ZIBA 4CJOA 1CGNA 2NPUA 2M4EA 3DAFA 5L3VA 4Q7CA 1M6TA 3SXMA 5EGYA 3L8JA 3M15A 2WB7A 3MYIA 4O7GA 4IRUA 1SR2A 5B1AC 1OCZC 4A2NB 2IXPA 1RXQA 3Q7LA 1MNDA 4ULWA 1TWHA 2MWQA 2AWCA 3B71A 4EWCA 1E84A 2R7TA 1A0BA 2D4UA 2J9BA 4FESA 3IEEA 4MS2A 1H9TA 3S27A 4YL3A 1WWPA 3BEHA 1T6IA 3S84A 1RJ9B 1UFBA 2YLDA 3K7DA 4J7YA 4MVZA 5BQGA 2WVQA 3GORA 1W2WA 4PACA 3NDBB 1LM3B 2XS1A 3EFOB 4UDVA 4JCHA 4JE9A 4O6YA 5JS5A 1APCA 3HNIA 4X0RA 4N06A 3JZ0A 5A6BA 2XRHA 3AGUA 2DI3A 3GWNA 3LUTB 4E7SA 4XLPF 4AE4B 5HSWA 3U9JA 3ASOC 3V5XA 1OW8A 2LFFA 4RDAA 1LI7A 1G5ZA 2DYRC 4YL0A 3B9QA 3R7CA 5CI8A 2CW0F 3U8VA 4DVZA 1ORSC 2J8WA 3LEVA 1WASA 1I4ZA 1RKEB 3DKAA 5JSLA 1LS4A 5T3TA 2G3VA 1LI5A 4YT5A 1YA9A 1YZCA 4NQFA 4U9EA 2KW3C 1E2XA 5L0IA 4YT2A 2HZ8A 5COFA 4OIPF 3V7OA 1T6UA 2UUIA 2IOQA 2YL0A 1U6HA 2LSEA 4JJGA 1K05A 1JOGA 1O3UA 3AQBA 1S05A 2HSBA 3TJ5A 3PDMP 3PMRA 1Z7Qc 3C18A 4CX9A 1SF8A 2QLAA 4IGGA 2L9JA 2EINC 1Q0KA 3CQZA 3U3FA 5L0DA 3EHMA 3MYFA 4XEFA 4O6NA 1NZEA 3ZTMA 1JR8A 1BR2A 1TFOB 2HFIA 2ZPAA 3C8GA 4LDRA 4WJ0A 1ZYRF 2LCHA 3KPHA 3WHNA 1Z63A 3GEIA 3GM2A 3HJCA 3W2VA 1H9GA 2Y3BA 3EHNA 3LEOA 3M4BA 4J30B 5KYYB 2WZGA 1JRAA 5DQZA 3JSEO 2PNOA 4U5CE 3AGTA 2QY9A 3B0VC 2I15A 2XS8A 1BZ4A 3UNGC 5JUAA 3FHDA 1CPQA 2ETSA 1VLSA 4U5HA 4C7OA 2Q3TA 3TULA 1V55C 3JCUQ 4HEAJ 3W8IA 1ZZPA 1QPUA 3CEXA 3IPMO 4FX5A 2LD6A 3W8HA 4IWBA 3ZG1A 1D0ZA 2IXNA 2XLVA 4CIPA 2EILC 2P1AA 4ZLDA 4JTDB 1HW1A 2BC5A 3U2MA 5EK0A 2UUHA 4BEMJ 4BJ5A 3UGOA 4J7TA 2OEVA 3I5QA 4YJWA 3TJ6A 1BBHA 3ABKC 2W4MA 5DS6A 3RVZA 2R7WA 4N6CA 1FNTc 3VAYA 4IARA 1R4TA 2BE5F 4XTKA 2L6GA 2V26A 5JP7A 3ECSA 2IXOA 3RQEA 2R7XA 4I3MA 4K7BA 3T4RA 1ZU4A 1VB5A 3QVYA 1ZHYA 1SZIA 2A0UA 3EGXA 5L3QA 1HE9A 3O39A 3ZTZA 1PV3A 1AUEA 3AG2C 4R32A 3JRTA 3AG1C 1H7IA 1DOVA 3CAXA 2EPOA 1NFOA 4IAQA 3QVZA 1CGME 1YDIA 1M57C 4JKVA 2HV7A 1L3PA 1WATA 4U5BE 3RQGA 4DRHB 3IQ5A 3LS1A 2AWYA 3C8GD 2J46A 1BDJB 1ZHWA 3EG9A 3QTHA 4F4BA 3L0IA 5B1BC 2X0CA 2LK4A 1G4WR 1M56C 2EIKC 3LESA 3DI5A 2OQMA 2Y3HA 3DM9B 1A7DA 3ZQYA 3QW0A 4O79A 3EZIA 4JIOA 2EPKX 4JTCB 4QI2A 5KYNA 4E0HA 2YWAA 5L0HA 1OCRC 4NC3A 4AE4A 1V74B 2KYHA 4JEBA 1ST6A 3EH1A 3GEEA 4RBNA 3V5YA 4DRJB 1TKNA 2VCCA 3K33A 4WGZA 2YLIA 1H6GA 1NU9C 3DWWA 3CZ6A 3M1CB 5T3WA 1MNEA 1K40A 2HJ3A 5JVEA 4JVSA 3TQOA 2LQGA 3KMIA 2XL4A 3K6BA 1ZW3A 1ORYA 3IQ6A 3K1HA 3OWTA 3PHF2 2NUPB 3AQCA 2VH3A 2R7SA 4BPMA 2J0WA 1OCCC 3TOMA 1L7CA 2J0XA 4CS8C 1HW2A 2A6EF 1VK5A 3ZVRA 5A6JA 1RMVA 5JRAA 3AG4C 3HKKA 3FXHA 4K1OA 5COGA 2YEVA 5F5HA 3ZDLA 1XZPA 2RD9A 4MVQA 3T9OA 2Q4FA 2XSEA 2R7UA 2P61A 4EIYA 4MTGA 5DLJA 5JLIA 1T6QA 3FVYA 1XZQA 2C03A 1I5NA 2PBEA 4MW3A 2VB6A 4YL1A 2YZSA 1Y4CA 3EGXB 3KL4A 3KYJA 5CI9A 3SXZA 1BR1A 5AC4A 1TWAA 1A41A 2OEXA 2OKUA 3DD7A 5KYWB 4AL1A 1FFTC 1GGQA 1CPRA 2XLWA 3GWLA 5T1DB 1TR2A 1YA7O 256BA 3UGPA 3HLZA 1M2OA 3DMDA 3DM5A 1U0BB 3SXKA 2LFDA 1KU2A 2PF4E 3U0CA 2J7PD 1TFKB 2NG1A 3G4XA 5F5FA 4CJGA 4N4WA 2Y69C 2R7RA 4DBRA 3POVA 2DGJA 4CS8A 4PFOA 2J9UA 3DZAA 1RCPA 4IAOA 4CIHA 3S90A 2ASRA 4OD4A 4ANJA 1OW7A 2JX0A 1AVOB 2G62A 2Q9BA 4PJNA
chains in the Genus database with same CATH topology
3I5PA 3LJBA 4LERA 4JZAA 4BJ1A 2R7OA 2WVOA 3K1IC 2C04A 2Q9AA 2R7QA 4E7ZA 4I44A 1O5HA 4GYTA 4BJ5C 3AG3C 2PFDA 2P6VA 3EGDB 3JSZA 4O6MA 2CNWA 4BEJA 1NG1A 4HE8D 3EFOA 4NY3A 4OINF 1D0XA 1ZHTA 3KH2A 3E70C 3JT1A 1S7ZA 2IXMA 3ZC4A 1JPNA 3OEOA 4CSAC 2O9XA 2NUTA 2A68F 4K0DA 2OCCC 4OIOF 2Y3DA 3N2ZB 3DJNB 3Q6MA 3RKOF 5DVWA 1PD1A 5E2QA 2D5RB 3EH2A 3I4UA 4G7OF 3GODA 1JPJA 4QDLA 4OIRF 1OCOC 4PK4A 2J9VA 5DQTA 1VYKA 2B0JA 2W9YA 1SMYF 1ZHZA 5D91A 2PP4A 2Z15A 5KYYA 3OA1A 4CBEA 2WZLA 1LVKA 5KYWA 1FMWA 1OKKD 5KYXA 4JURI 2ZXOA 2KNHA 5E3CA 4P6IC 3T6JA 3MX3A 3X1OA 4RD9A 1O87A 4AK9A 1D1CA 3B0UX 4LLEA 4ZLCA 1MMAA 1PD0A 5FCLA 3QMKA 3Q6NA 3ZSUA 4EBBA 4OIQF 2JD3A 4C3EA 4BJTA 2KGOA 2H7BA 3LS0A 4KI2A 4G7HF 1QZXA 1MMNA 2R7VA 4U5EE 3JYHA 2H7OA 3FDQA 4G0HA 5D92A 1M2VA 1LS1A 4I1OB 4I1MA 1QLEC 3NYLA 2Q9CA 1VYIA 3NYJA 2J7PA 3NKEA 4Q4ZF 2YHSA 2MYSA 4FWVA 4BJ6A 3ABMC 2A1DD 4HFFB 4YT4A 3GANA 3X2QC 2FGYA 5KYUB 5B3SC 2QTVA 4H4KC 2H7VC 4M63A 4YWQA 2J45A 4QI0A 2W45A 2X51A 3LAYA 4MNDA 2VASA 3UMHA 1WGWA 4XLNF 5KYXB 3EZHA 1Z5ZA 2CNWD 3F46A 2XXAA 1VMAA 2A69F 1V54C 5BUOA 4C7OB 4PJMA 2KQ9A 3RFYA 1LKXA 4YT8A 2IYLD 4GEHA 1OKKA 4CSAA 3TD7A 3WODF 4CS9A 3SEOA 3RH3A 5KYUA 2I8BA 3VYWA 4CS7A 3LLIA 3L34A 2CGEA 4W8KA 3N24A 4BJ6C 4XWJA 3B0PA 1J8YF 3NRHA 3EGDA 4AX2A 2GFHA 1NU7D 3UMKA 2KJGA 2OG2A 1IZMA 2ZXPA 3QZCA 2V3CC 5DS5A 1MMGA 4Q5SF 2DYSC 1J8MF 2FFHA 1N1CA 4J32B 5IY5C 2ZXWC 3EG9B 3NYMA 4YN0B 4CS9C 2G3KA 5E3AA 3UMIA 1D1AA 3S29A 3UR3C 3ABLC 4DBQA 3SZRA 3EJNA 3HTKC 3DXJF 4DVYP 3EPVA 3CSKA 5E33A 1TWGA 3SYNA 3FAJA 4U5FE 3S0XA 4PJJA 3NKDA 1PCXA 2E87A 2EIJC 1BR4A 3H65A 4KNWA 3O6XA 3DJUB 4KC9A 3WG7C 3MLGA 4C3BA 4KNVA 4IJJA 1Z3IX 1RJ9A 4JW1A 3ASNC 3DAGA 3F47A 4U5DE 4HFKB 3SNHA 1FFHA 3T6BA 3EQLF 4B6IA 3S28A 1M2VB 1Z6AA 4U5GA 2WL8A 3N0TA 4PFPA 1FTSA 4DOZA 2L81A 3RYLA 5DS4A 1D0YA 3RIPA 4PJLA 3E9VA 2P7VA 2XXAB 2J9WA 3KKBA 4C3DA 2PX3A 2A6HF 2NUPA 2W4BA 1MMDA 1D1BA 4KBLA 4BG0A 4G7ZF 3SP1A 4LLCA 2ZXRA 4OD5A 1VOMA 3NG1A 3ITFA 3LNRA 2CDQA 1Z23A 4LACB 3Q7GA 1ZU5A 3K66A 1IW7F 1TWCA 2Y3GA 5EHHA 4MQ9F 2EIMC 3LLKA 2HV6A 1G8XA 2PX0A 2WVNA 2NUTB 2Y39A 2WZFA 1FMVA 1ZHXA 3W2WA 4JJFA 3ZIBA 2M4EA 3DAFA 5L3VA 4Q7CA 5EGYA 2WB7A 4O7GA 4IRUA 5B1AC 1OCZC 4A2NB 2IXPA 3Q7LA 4ULWA 1MNDA 1TWHA 2MWQA 4EWCA 2R7TA 4FESA 3IEEA 3S27A 1RJ9B 3K7DA 2WVQA 1W2WA 3NDBB 3EFOB 4JCHA 4O6YA 4X0RA 4N06A 2XRHA 4E7SA 4XLPF 4AE4B 5HSWA 3ASOC 4RDAA 2DYRC 3B9QA 5CI8A 2CW0F 4DVZA 3LEVA 5T3TA 2G3VA 4YT5A 2KW3C 4YT2A 3V7OA 4JJGA 2IOQA 2LSEA 3AQBA 3PMRA 1SF8A 2L9JA 2EINC 3CQZA 3EHMA 4O6NA 1NZEA 1BR2A 2ZPAA 4WJ0A 1ZYRF 1Z63A 3HJCA 3W2VA 2Y3BA 3EHNA 4J30B 5KYYB 2WZGA 5DQZA 4U5CE 2QY9A 3B0VC 3UNGC 3FHDA 4U5HA 4C7OA 2Q3TA 1V55C 3JCUQ 4HEAJ 3W8IA 4FX5A 3W8HA 4IWBA 3ZG1A 1D0ZA 2IXNA 2EILC 4ZLDA 4BJ5A 3UGOA 3I5QA 4YJWA 3ABKC 2W4MA 5DS6A 2R7WA 3VAYA 4OIPF 2BE5F 4XTKA 2V26A 3ECSA 2IXOA 2R7XA 4I3MA 4K7BA 3T4RA 1ZU4A 5L3QA 1ZHYA 1SZIA 3EGXA 3O39A 3AG2C 3JRTA 3AG1C 1M57C 2HV7A 4U5BE 3LS1A 4F4BA 2J46A 3EG9A 1ZHWA 3L0IA 5B1BC 1M56C 2EIKC 3LESA 2Y3HA 3DM9B 4O79A 3EZIA 4QI2A 5KYNA 1OCRC 4AE4A 4RBNA 1ST6A 3EH1A 1TKNA 3K33A 1NU9C 3CZ6A 3M1CB 5T3WA 1MNEA 4JVSA 3KMIA 2XL4A 3K6BA 3K1HA 3OWTA 3PHF2 2NUPB 3AQCA 2VH3A 2R7SA 2J0WA 1OCCC 2J0XA 4CS8C 2A6EF 1VK5A 3ZVRA 3AG4C 2YEVA 5F5HA 2XSEA 2R7UA 5DLJA 3FVYA 2C03A 2VB6A 2YZSA 3EGXB 3KL4A 5CI9A 1BR1A 5KYWB 1TWAA 3DD7A 1FFTC 5T1DB 1TR2A 3UGPA 3HLZA 1M2OA 3DMDA 3DM5A 1KU2A 2PF4E 2J7PD 2NG1A 5F5FA 2Y69C 2R7RA 4DBRA 3POVA 2DGJA 4CS8A 4PFOA 2J9UA 3DZAA 4IAOA 4CIHA 4OD4A 4ANJA 2G62A 2Q9BA 4PJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7B A; 
#chains in the Genus database with same CATH topology
 1GQA A;  3HNK A;  3I5P A;  4JC7 A;  4G78 A;  3LJB A;  2ZD9 A;  4LER A;  4JZA A;  3C63 A;  4BJ1 A;  4EBK A;  4Z9I A;  2R7O A;  2WVO A;  3K1I C;  3NMK A;  2C04 A;  2HMQ A;  2Q9A A;  2R7Q A;  4E7Z A;  3L1M A;  2KK1 A;  1AEP A;  2XLE A;  3T6G B;  3W4Y A;  1YVI A;  4I44 A;  1O5H A;  5K0I A;  1OQC A;  4GYT A;  1HMO A;  1NFN A;  2PFD A;  3AG3 C;  4BJ5 C;  2P6V A;  3EGD B;  3JSZ A;  4O6M A;  1YLM A;  2CNW A;  4BEJ A;  5TJ5 E;  1NG1 A;  4HE8 D;  3C62 A;  3EFO A;  4NY3 A;  1RKE A;  4OIN F;  4MVU A;  1KTM A;  2HS5 A;  1D0X A;  1ZHT A;  3KH2 A;  1OXB A;  2HUJ A;  3E70 C;  3FOP A;  3FOO A;  4NTB A;  2VC9 A;  5AGF A;  3RF3 A;  1KNY A;  3JT1 A;  1ORJ A;  1S7Z A;  2IXM A;  2XLO A;  2OOC A;  3M79 A;  5A69 A;  3ZC4 A;  4AL0 A;  1JPN A;  3OEO A;  4CSA C;  2O9X A;  1YYJ A;  2NUT A;  1VLT A;  2A68 F;  4K0D A;  2OCC C;  2HSQ A;  2Y3D A;  4OIO F;  3N2Z B;  1C03 A;  3DJN B;  3O55 A;  3Q6M A;  3RKO F;  2JPU A;  2QUP A;  3ATP A;  4ER9 A;  5DVW A;  4U9D A;  3AOU A;  1PD1 A;  3G4Z A;  5E2Q A;  2D5R B;  3EH2 A;  3I4U A;  4G7O F;  3GOD A;  1JPJ A;  4QDL A;  4OIR F;  2NSF A;  1OCO C;  2P0N A;  2J9V A;  4P9F A;  4PK4 A;  5DQT A;  2GWW A;  1VYK A;  4GQH A;  1YYX A;  3U2L A;  2B0J A;  2W9Y A;  3G50 A;  1SMY F;  3QW1 A;  1ZHZ A;  5D91 A;  2PP4 A;  2Z15 A;  2EPN A;  1QQ3 A;  1WTY A;  2L6H A;  3OA1 A;  3U9M A;  2WZL A;  4CBE A;  5L0C A;  5KYY A;  2GA0 A;  1OR2 A;  3RVY A;  1LVK A;  5KYW A;  1FMW A;  1OKK D;  5KYX A;  4JUR I;  2IBF A;  2ZXO A;  2KNH A;  2YVK A;  5E3C A;  4P6I C;  1XWJ A;  3T6J A;  1EI7 A;  2Q00 A;  3MX3 A;  3L8I A;  4MVO A;  3X1O A;  3US6 A;  4RD9 A;  4MW8 A;  1O87 A;  4AK9 A;  2XM4 A;  1D1C A;  3A9C A;  5F28 E;  4D4N A;  4LLE A;  3B0U X;  4ZLC A;  1MMA A;  1PD0 A;  3TOL A;  5FCL A;  3QMK A;  3Q6N A;  3ZSU A;  4EBB A;  4OIQ F;  1YZA A;  1Q0M A;  2B0H A;  2JD3 A;  4C3E A;  3DE9 A;  4BJT A;  1V4A A;  2AU5 A;  2KGO A;  2H7B A;  3LS0 A;  4XPY A;  3BRJ A;  4KI2 A;  4PR9 A;  3ZQV A;  4DRI B;  4G7H F;  1QZX A;  3NMI A;  3JTL O;  1MMN A;  1OXK A;  3C7J A;  2R7V A;  4U5E E;  3H2V A;  3JYH A;  2AVK A;  4CDV A;  2H7O A;  1QKR A;  5L0F A;  3FDQ A;  4G0H A;  2ICW G;  5D92 A;  1M2V A;  1QVX A;  2VCB A;  2CYD A;  2QNL A;  1LS1 A;  2YL3 A;  4I1O B;  4I1M A;  1LPE A;  1QLE C;  3NYL A;  2Q9C A;  2KC3 A;  3C8Z A;  3B29 A;  2F22 A;  1I4Y A;  1VYI A;  3AJM A;  3NYJ A;  2MHR A;  5BQI A;  2J7P A;  4CDY A;  1YAU O;  3NKE A;  1R5I D;  4Q4Z F;  1LIH A;  2YHS A;  2OJQ A;  4LDK A;  2MYS A;  4Z9J A;  3NMJ A;  4FWV A;  4BJ6 A;  3ABM C;  2A1D D;  4HFF B;  4YT4 A;  4JEA A;  3GAN A;  3X2Q C;  2FGY A;  2EPM X;  3A11 A;  2R02 A;  2YLG A;  1EA8 A;  5KYU B;  5B3S C;  2L7A A;  2QTV A;  4H4K C;  2H7V C;  1A7V A;  2OU6 A;  4M63 A;  4YWQ A;  3LNM B;  2J45 A;  2OJE D;  4QI0 A;  1DOW A;  2W45 A;  2X51 A;  3FAP B;  2BL2 A;  2XLD A;  3LAY A;  3PCV A;  4MND A;  4NCQ A;  4DXW A;  2TMV P;  2GAQ A;  2VAS A;  3UMH A;  2IM8 A;  4ONS A;  3IQC A;  1WGW A;  3HNL A;  4XQ1 A;  4XLN F;  4CDA A;  1C17 M;  3R2P A;  5KYX B;  1NBB A;  1FAP B;  3EZH A;  1Z5Z A;  2CNW D;  1MQV A;  3F46 A;  4JCZ A;  2XXA A;  1VMA A;  2XLM A;  2A69 F;  5HV9 A;  1V54 C;  5BUO A;  4C7O B;  2NSG A;  2KQ9 A;  4PJM A;  3RFY A;  3U3B A;  3U8P A;  1LKX A;  4YT8 A;  2IYL D;  2KSF A;  1OKK A;  4GEH A;  3K1I A;  4CSA A;  4JRZ A;  3TD7 A;  3WOD F;  1JAF A;  4CS9 A;  3SEO A;  2VCA A;  3RH3 A;  5KYU A;  1E85 A;  2I8B A;  1HY5 A;  3VYW A;  3LLI A;  3RW0 A;  4CS7 A;  5COM A;  3FMS A;  3L34 A;  4EUK B;  2CGE A;  4W8K A;  3N24 A;  4BJ6 C;  4XWJ A;  3B0P A;  1J8Y F;  1JMW A;  2YL7 A;  3NRH A;  3U5S A;  4IB4 A;  1U89 A;  1TQG A;  3EGD A;  4AX2 A;  4H54 A;  2GFH A;  2YRF A;  1NU7 D;  3UMK A;  2KJG A;  2OG2 A;  1F1M A;  3H2U A;  5JT4 A;  1IZM A;  2ZXP A;  5AC5 A;  3QZC A;  2H8A A;  1HE1 A;  1Q0F A;  2V3C C;  1EKY A;  5DS5 A;  3VRC A;  4P9T A;  1MMG A;  4Q5S F;  2DYS C;  2XM0 A;  5CIV A;  1J8M F;  2FFH A;  1N1C A;  4J32 B;  5IY5 C;  1T5O A;  2ZXW C;  3EG9 B;  2LP4 A;  3GM3 A;  3NYM A;  4YN0 B;  2G3K A;  5E3A A;  4MTO A;  3UMI A;  1D1A A;  3S29 A;  3UR3 C;  4CS9 C;  3O10 A;  3IHU A;  4DJ9 A;  3ABL C;  3M4C A;  4DBQ A;  3SZR A;  3EJN A;  3HTK C;  3DXJ F;  3GM1 A;  4DVY P;  3EPV A;  3MFN A;  1WOL A;  3CSK A;  5E33 A;  1VTM P;  4WAB A;  2YL1 A;  1TWG A;  4EBJ A;  2FAP B;  2RSE B;  3SYN A;  3FAJ A;  4U5F E;  1WN0 A;  3S0X A;  1B68 A;  4PJJ A;  3NKD A;  4WGY A;  3ZWI A;  1NSG B;  1PCX A;  5BQH A;  5FZT A;  4EHP A;  2E87 A;  2EIJ C;  1E83 A;  1BR4 A;  4MVS A;  4XEV A;  3H65 A;  1C02 A;  1YJG A;  4KNW A;  2R25 A;  3O6X A;  4XPX A;  2Q7R A;  3DJU B;  4KC9 A;  3WG7 C;  3MLG A;  4C3B A;  3IQT A;  4KNV A;  3WAQ A;  4IJJ A;  1FR0 A;  1Z3I X;  2YKZ A;  3HNJ A;  4NTA A;  1RJ9 A;  1Y6D A;  2LIG A;  4JW1 A;  3SXY A;  3ASN C;  3DAG A;  3F47 A;  2YQY A;  2L6F A;  4U5D E;  2XL6 A;  4HFK B;  5GPG B;  3SNH A;  3VF0 A;  2CCY A;  1YAR O;  1FFH A;  1EQ1 A;  3T6B A;  3EQL F;  1NLX A;  3S9O A;  4B6I A;  5A6A A;  3S28 A;  1GM5 A;  3KYI A;  1E86 A;  1Q0G A;  1M2V B;  1Z6A A;  4XPW A;  4U5G A;  4LDQ A;  2WL8 A;  1G4U S;  3N0T A;  1T9K A;  4PFP A;  1FTS A;  1LE4 A;  2XLH A;  1OW6 A;  3JRM O;  3VM6 A;  4W8P A;  2L81 A;  4DOZ A;  4NTF A;  3MBG A;  3RYL A;  5DS4 A;  4XEK A;  5L0J A;  1HMD A;  4FAP B;  1D0Y A;  1T01 A;  1QSP A;  3RIP A;  2R03 A;  4ULV A;  2HJM A;  1LE2 A;  4PJL A;  4D4X A;  1UG7 A;  2DB4 A;  2GDC A;  2P7V A;  3E9V A;  4L6R A;  4E18 A;  2XXA B;  2J9W A;  2A0B A;  3KKB A;  3RQF A;  1CGO A;  2PX3 A;  1ZW2 A;  4C3D A;  2AP3 A;  3C8G B;  4EKW A;  2A6H F;  5A6K A;  2NUP A;  2W4B A;  1MMD A;  4JTA B;  2QE9 A;  5L0G A;  1D1B A;  2EPL X;  2R9R B;  4KBL A;  1GS9 A;  1ZVZ A;  2HKV A;  3SP1 A;  4BG0 A;  4G7Z F;  1K04 A;  4MVR A;  4LLC A;  2ZXR A;  4OD5 A;  4N6H A;  1VOM A;  3NG1 A;  3TK0 A;  2M64 A;  5B3I A;  5A6B D;  1OR3 A;  3ITF A;  2R05 A;  3LNR A;  2CDQ A;  1Z23 A;  2HMZ A;  4LAC B;  3Q7G A;  3GEH A;  1ZU5 A;  3K66 A;  1IW7 F;  3DE8 A;  4A4A A;  4E17 A;  1TWC A;  2Y3G A;  4Z9H A;  1A7E A;  5EHH A;  4MVM A;  4MQ9 F;  2EIM C;  3LLK A;  4YK5 A;  3JYY A;  3V5Z A;  2HV6 A;  1G8X A;  1SYQ A;  2PX0 A;  2WVN A;  2XL8 A;  4E0I A;  2NUT B;  2Y39 A;  3J06 A;  1RKC A;  2WZF A;  1FMV A;  1Q0D A;  1ZHX A;  4MTF A;  3W2W A;  4JJF A;  3ZIB A;  4CJO A;  1CGN A;  2NPU A;  2M4E A;  3DAF A;  5L3V A;  4Q7C A;  1M6T A;  3SXM A;  5EGY A;  3L8J A;  3M15 A;  2WB7 A;  3MYI A;  4O7G A;  4IRU A;  1SR2 A;  5B1A C;  1OCZ C;  4A2N B;  2IXP A;  1RXQ A;  3Q7L A;  1MND A;  4ULW A;  1TWH A;  2MWQ A;  2AWC A;  3B71 A;  4EWC A;  1E84 A;  2R7T A;  1A0B A;  2D4U A;  2J9B A;  4FES A;  3IEE A;  4MS2 A;  1H9T A;  3S27 A;  4YL3 A;  1WWP A;  3BEH A;  1T6I A;  3S84 A;  1RJ9 B;  1UFB A;  2YLD A;  3K7D A;  4J7Y A;  4MVZ A;  5BQG A;  2WVQ A;  3GOR A;  1W2W A;  4PAC A;  3NDB B;  1LM3 B;  2XS1 A;  3EFO B;  4UDV A;  4JCH A;  4JE9 A;  4O6Y A;  5JS5 A;  1APC A;  3HNI A;  4X0R A;  4N06 A;  3JZ0 A;  5A6B A;  2XRH A;  3AGU A;  2DI3 A;  3GWN A;  3LUT B;  4E7S A;  4XLP F;  4AE4 B;  5HSW A;  3U9J A;  3ASO C;  3V5X A;  1OW8 A;  2LFF A;  4RDA A;  1LI7 A;  1G5Z A;  2DYR C;  4YL0 A;  3B9Q A;  3R7C A;  5CI8 A;  2CW0 F;  3U8V A;  4DVZ A;  1ORS C;  2J8W A;  3LEV A;  1WAS A;  1I4Z A;  1RKE B;  3DKA A;  5JSL A;  1LS4 A;  5T3T A;  2G3V A;  1LI5 A;  4YT5 A;  1YA9 A;  1YZC A;  4NQF A;  4U9E A;  2KW3 C;  1E2X A;  5L0I A;  4YT2 A;  2HZ8 A;  5COF A;  4OIP F;  3V7O A;  1T6U A;  2UUI A;  2IOQ A;  2YL0 A;  1U6H A;  2LSE A;  4JJG A;  1K05 A;  1JOG A;  1O3U A;  3AQB A;  1S05 A;  2HSB A;  3TJ5 A;  3PDM P;  3PMR A;  1Z7Q c;  3C18 A;  4CX9 A;  1SF8 A;  2QLA A;  4IGG A;  2L9J A;  2EIN C;  1Q0K A;  3CQZ A;  3U3F A;  5L0D A;  3EHM A;  3MYF A;  4XEF A;  4O6N A;  1NZE A;  3ZTM A;  1JR8 A;  1BR2 A;  1TFO B;  2HFI A;  2ZPA A;  3C8G A;  4LDR A;  4WJ0 A;  1ZYR F;  2LCH A;  3KPH A;  3WHN A;  1Z63 A;  3GEI A;  3GM2 A;  3HJC A;  3W2V A;  1H9G A;  2Y3B A;  3EHN A;  3LEO A;  3M4B A;  4J30 B;  5KYY B;  2WZG A;  1JRA A;  5DQZ A;  3JSE O;  2PNO A;  4U5C E;  3AGT A;  2QY9 A;  3B0V C;  2I15 A;  2XS8 A;  1BZ4 A;  3UNG C;  5JUA A;  3FHD A;  1CPQ A;  2ETS A;  1VLS A;  4U5H A;  4C7O A;  2Q3T A;  3TUL A;  1V55 C;  3JCU Q;  4HEA J;  3W8I A;  1ZZP A;  1QPU A;  3CEX A;  3IPM O;  4FX5 A;  2LD6 A;  3W8H A;  4IWB A;  3ZG1 A;  1D0Z A;  2IXN A;  2XLV A;  4CIP A;  2EIL C;  2P1A A;  4ZLD A;  4JTD B;  1HW1 A;  2BC5 A;  3U2M A;  5EK0 A;  2UUH A;  4BEM J;  4BJ5 A;  3UGO A;  4J7T A;  2OEV A;  3I5Q A;  4YJW A;  3TJ6 A;  1BBH A;  3ABK C;  2W4M A;  5DS6 A;  3RVZ A;  2R7W A;  4N6C A;  1FNT c;  3VAY A;  4IAR A;  1R4T A;  2BE5 F;  4XTK A;  2L6G A;  2V26 A;  5JP7 A;  3ECS A;  2IXO A;  3RQE A;  2R7X A;  4I3M A;  4K7B A;  3T4R A;  1ZU4 A;  1VB5 A;  3QVY A;  1ZHY A;  1SZI A;  2A0U A;  3EGX A;  5L3Q A;  1HE9 A;  3O39 A;  3ZTZ A;  1PV3 A;  1AUE A;  3AG2 C;  4R32 A;  3JRT A;  3AG1 C;  1H7I A;  1DOV A;  3CAX A;  2EPO A;  1NFO A;  4IAQ A;  3QVZ A;  1CGM E;  1YDI A;  1M57 C;  4JKV A;  2HV7 A;  1L3P A;  1WAT A;  4U5B E;  3RQG A;  4DRH B;  3IQ5 A;  3LS1 A;  2AWY A;  3C8G D;  2J46 A;  1BDJ B;  1ZHW A;  3EG9 A;  3QTH A;  4F4B A;  3L0I A;  5B1B C;  2X0C A;  2LK4 A;  1G4W R;  1M56 C;  2EIK C;  3LES A;  3DI5 A;  2OQM A;  2Y3H A;  3DM9 B;  1A7D A;  3ZQY A;  3QW0 A;  4O79 A;  3EZI A;  4JIO A;  2EPK X;  4JTC B;  4QI2 A;  5KYN A;  4E0H A;  2YWA A;  5L0H A;  1OCR C;  4NC3 A;  4AE4 A;  1V74 B;  2KYH A;  4JEB A;  1ST6 A;  3EH1 A;  3GEE A;  4RBN A;  3V5Y A;  4DRJ B;  1TKN A;  2VCC A;  3K33 A;  4WGZ A;  2YLI A;  1H6G A;  1NU9 C;  3DWW A;  3CZ6 A;  3M1C B;  5T3W A;  1MNE A;  1K40 A;  2HJ3 A;  5JVE A;  4JVS A;  3TQO A;  2LQG A;  3KMI A;  2XL4 A;  3K6B A;  1ZW3 A;  1ORY A;  3IQ6 A;  3K1H A;  3OWT A;  3PHF 2;  2NUP B;  3AQC A;  2VH3 A;  2R7S A;  4BPM A;  2J0W A;  1OCC C;  3TOM A;  1L7C A;  2J0X A;  4CS8 C;  1HW2 A;  2A6E F;  1VK5 A;  3ZVR A;  5A6J A;  1RMV A;  5JRA A;  3AG4 C;  3HKK A;  3FXH A;  4K1O A;  5COG A;  2YEV A;  5F5H A;  3ZDL A;  1XZP A;  2RD9 A;  4MVQ A;  3T9O A;  2Q4F A;  2XSE A;  2R7U A;  2P61 A;  4EIY A;  4MTG A;  5DLJ A;  5JLI A;  1T6Q A;  3FVY A;  1XZQ A;  2C03 A;  1I5N A;  2PBE A;  4MW3 A;  2VB6 A;  4YL1 A;  2YZS A;  1Y4C A;  3EGX B;  3KL4 A;  3KYJ A;  5CI9 A;  3SXZ A;  1BR1 A;  5AC4 A;  1TWA A;  1A41 A;  2OEX A;  2OKU A;  3DD7 A;  5KYW B;  4AL1 A;  1FFT C;  1GGQ A;  1CPR A;  2XLW A;  3GWL A;  5T1D B;  1TR2 A;  1YA7 O;  256B A;  3UGP A;  3HLZ A;  1M2O A;  3DMD A;  3DM5 A;  1U0B B;  3SXK A;  2LFD A;  1KU2 A;  2PF4 E;  3U0C A;  2J7P D;  1TFK B;  2NG1 A;  3G4X A;  5F5F A;  4CJG A;  4N4W A;  2Y69 C;  2R7R A;  4DBR A;  3POV A;  2DGJ A;  4CS8 A;  4PFO A;  2J9U A;  3DZA A;  1RCP A;  4IAO A;  4CIH A;  3S90 A;  2ASR A;  4OD4 A;  4ANJ A;  1OW7 A;  2JX0 A;  1AVO B;  2G62 A;  2Q9B A;  4PJN A; 
#chains in the Genus database with same CATH homology
 3I5P A;  3LJB A;  4LER A;  4JZA A;  4BJ1 A;  2R7O A;  2WVO A;  3K1I C;  2C04 A;  2Q9A A;  2R7Q A;  4E7Z A;  4I44 A;  1O5H A;  4GYT A;  4BJ5 C;  3AG3 C;  2PFD A;  2P6V A;  3EGD B;  3JSZ A;  4O6M A;  2CNW A;  4BEJ A;  1NG1 A;  4HE8 D;  3EFO A;  4NY3 A;  4OIN F;  1D0X A;  1ZHT A;  3KH2 A;  3E70 C;  3JT1 A;  1S7Z A;  2IXM A;  3ZC4 A;  1JPN A;  3OEO A;  4CSA C;  2O9X A;  2NUT A;  2A68 F;  4K0D A;  2OCC C;  4OIO F;  2Y3D A;  3N2Z B;  3DJN B;  3Q6M A;  3RKO F;  5DVW A;  1PD1 A;  5E2Q A;  2D5R B;  3EH2 A;  3I4U A;  4G7O F;  3GOD A;  1JPJ A;  4QDL A;  4OIR F;  1OCO C;  4PK4 A;  2J9V A;  5DQT A;  1VYK A;  2B0J A;  2W9Y A;  1SMY F;  1ZHZ A;  5D91 A;  2PP4 A;  2Z15 A;  5KYY A;  3OA1 A;  4CBE A;  2WZL A;  1LVK A;  5KYW A;  1FMW A;  1OKK D;  5KYX A;  4JUR I;  2ZXO A;  2KNH A;  5E3C A;  4P6I C;  3T6J A;  3MX3 A;  3X1O A;  4RD9 A;  1O87 A;  4AK9 A;  1D1C A;  3B0U X;  4LLE A;  4ZLC A;  1MMA A;  1PD0 A;  5FCL A;  3QMK A;  3Q6N A;  3ZSU A;  4EBB A;  4OIQ F;  2JD3 A;  4C3E A;  4BJT A;  2KGO A;  2H7B A;  3LS0 A;  4KI2 A;  4G7H F;  1QZX A;  1MMN A;  2R7V A;  4U5E E;  3JYH A;  2H7O A;  3FDQ A;  4G0H A;  5D92 A;  1M2V A;  1LS1 A;  4I1O B;  4I1M A;  1QLE C;  3NYL A;  2Q9C A;  1VYI A;  3NYJ A;  2J7P A;  3NKE A;  4Q4Z F;  2YHS A;  2MYS A;  4FWV A;  4BJ6 A;  3ABM C;  2A1D D;  4HFF B;  4YT4 A;  3GAN A;  3X2Q C;  2FGY A;  5KYU B;  5B3S C;  2QTV A;  4H4K C;  2H7V C;  4M63 A;  4YWQ A;  2J45 A;  4QI0 A;  2W45 A;  2X51 A;  3LAY A;  4MND A;  2VAS A;  3UMH A;  1WGW A;  4XLN F;  5KYX B;  3EZH A;  1Z5Z A;  2CNW D;  3F46 A;  2XXA A;  1VMA A;  2A69 F;  1V54 C;  5BUO A;  4C7O B;  4PJM A;  2KQ9 A;  3RFY A;  1LKX A;  4YT8 A;  2IYL D;  4GEH A;  1OKK A;  4CSA A;  3TD7 A;  3WOD F;  4CS9 A;  3SEO A;  3RH3 A;  5KYU A;  2I8B A;  3VYW A;  4CS7 A;  3LLI A;  3L34 A;  2CGE A;  4W8K A;  3N24 A;  4BJ6 C;  4XWJ A;  3B0P A;  1J8Y F;  3NRH A;  3EGD A;  4AX2 A;  2GFH A;  1NU7 D;  3UMK A;  2KJG A;  2OG2 A;  1IZM A;  2ZXP A;  3QZC A;  2V3C C;  5DS5 A;  1MMG A;  4Q5S F;  2DYS C;  1J8M F;  2FFH A;  1N1C A;  4J32 B;  5IY5 C;  2ZXW C;  3EG9 B;  3NYM A;  4YN0 B;  4CS9 C;  2G3K A;  5E3A A;  3UMI A;  1D1A A;  3S29 A;  3UR3 C;  3ABL C;  4DBQ A;  3SZR A;  3EJN A;  3HTK C;  3DXJ F;  4DVY P;  3EPV A;  3CSK A;  5E33 A;  1TWG A;  3SYN A;  3FAJ A;  4U5F E;  3S0X A;  4PJJ A;  3NKD A;  1PCX A;  2E87 A;  2EIJ C;  1BR4 A;  3H65 A;  4KNW A;  3O6X A;  3DJU B;  4KC9 A;  3WG7 C;  3MLG A;  4C3B A;  4KNV A;  4IJJ A;  1Z3I X;  1RJ9 A;  4JW1 A;  3ASN C;  3DAG A;  3F47 A;  4U5D E;  4HFK B;  3SNH A;  1FFH A;  3T6B A;  3EQL F;  4B6I A;  3S28 A;  1M2V B;  1Z6A A;  4U5G A;  2WL8 A;  3N0T A;  4PFP A;  1FTS A;  4DOZ A;  2L81 A;  3RYL A;  5DS4 A;  1D0Y A;  3RIP A;  4PJL A;  3E9V A;  2P7V A;  2XXA B;  2J9W A;  3KKB A;  4C3D A;  2PX3 A;  2A6H F;  2NUP A;  2W4B A;  1MMD A;  1D1B A;  4KBL A;  4BG0 A;  4G7Z F;  3SP1 A;  4LLC A;  2ZXR A;  4OD5 A;  1VOM A;  3NG1 A;  3ITF A;  3LNR A;  2CDQ A;  1Z23 A;  4LAC B;  3Q7G A;  1ZU5 A;  3K66 A;  1IW7 F;  1TWC A;  2Y3G A;  5EHH A;  4MQ9 F;  2EIM C;  3LLK A;  2HV6 A;  1G8X A;  2PX0 A;  2WVN A;  2NUT B;  2Y39 A;  2WZF A;  1FMV A;  1ZHX A;  3W2W A;  4JJF A;  3ZIB A;  2M4E A;  3DAF A;  5L3V A;  4Q7C A;  5EGY A;  2WB7 A;  4O7G A;  4IRU A;  5B1A C;  1OCZ C;  4A2N B;  2IXP A;  3Q7L A;  4ULW A;  1MND A;  1TWH A;  2MWQ A;  4EWC A;  2R7T A;  4FES A;  3IEE A;  3S27 A;  1RJ9 B;  3K7D A;  2WVQ A;  1W2W A;  3NDB B;  3EFO B;  4JCH A;  4O6Y A;  4X0R A;  4N06 A;  2XRH A;  4E7S A;  4XLP F;  4AE4 B;  5HSW A;  3ASO C;  4RDA A;  2DYR C;  3B9Q A;  5CI8 A;  2CW0 F;  4DVZ A;  3LEV A;  5T3T A;  2G3V A;  4YT5 A;  2KW3 C;  4YT2 A;  3V7O A;  4JJG A;  2IOQ A;  2LSE A;  3AQB A;  3PMR A;  1SF8 A;  2L9J A;  2EIN C;  3CQZ A;  3EHM A;  4O6N A;  1NZE A;  1BR2 A;  2ZPA A;  4WJ0 A;  1ZYR F;  1Z63 A;  3HJC A;  3W2V A;  2Y3B A;  3EHN A;  4J30 B;  5KYY B;  2WZG A;  5DQZ A;  4U5C E;  2QY9 A;  3B0V C;  3UNG C;  3FHD A;  4U5H A;  4C7O A;  2Q3T A;  1V55 C;  3JCU Q;  4HEA J;  3W8I A;  4FX5 A;  3W8H A;  4IWB A;  3ZG1 A;  1D0Z A;  2IXN A;  2EIL C;  4ZLD A;  4BJ5 A;  3UGO A;  3I5Q A;  4YJW A;  3ABK C;  2W4M A;  5DS6 A;  2R7W A;  3VAY A;  4OIP F;  2BE5 F;  4XTK A;  2V26 A;  3ECS A;  2IXO A;  2R7X A;  4I3M A;  4K7B A;  3T4R A;  1ZU4 A;  5L3Q A;  1ZHY A;  1SZI A;  3EGX A;  3O39 A;  3AG2 C;  3JRT A;  3AG1 C;  1M57 C;  2HV7 A;  4U5B E;  3LS1 A;  4F4B A;  2J46 A;  3EG9 A;  1ZHW A;  3L0I A;  5B1B C;  1M56 C;  2EIK C;  3LES A;  2Y3H A;  3DM9 B;  4O79 A;  3EZI A;  4QI2 A;  5KYN A;  1OCR C;  4AE4 A;  4RBN A;  1ST6 A;  3EH1 A;  1TKN A;  3K33 A;  1NU9 C;  3CZ6 A;  3M1C B;  5T3W A;  1MNE A;  4JVS A;  3KMI A;  2XL4 A;  3K6B A;  3K1H A;  3OWT A;  3PHF 2;  2NUP B;  3AQC A;  2VH3 A;  2R7S A;  2J0W A;  1OCC C;  2J0X A;  4CS8 C;  2A6E F;  1VK5 A;  3ZVR A;  3AG4 C;  2YEV A;  5F5H A;  2XSE A;  2R7U A;  5DLJ A;  3FVY A;  2C03 A;  2VB6 A;  2YZS A;  3EGX B;  3KL4 A;  5CI9 A;  1BR1 A;  5KYW B;  1TWA A;  3DD7 A;  1FFT C;  5T1D B;  1TR2 A;  3UGP A;  3HLZ A;  1M2O A;  3DMD A;  3DM5 A;  1KU2 A;  2PF4 E;  2J7P D;  2NG1 A;  5F5F A;  2Y69 C;  2R7R A;  4DBR A;  3POV A;  2DGJ A;  4CS8 A;  4PFO A;  2J9U A;  3DZA A;  4IAO A;  4CIH A;  4OD4 A;  4ANJ A;  2G62 A;  2Q9B A;  4PJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...