4K7BA

Crystal structure of extrinsic protein in photosystem ii
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
111
structure length
111
Chain Sequence
b'AVSSATINRARGLYGDRIAALKDAVAAGDFKAIAEEKNAFILFNSGAYPTNKAKKNAAIAQTNEIFKAIRSGDKAAVKSAYDAYMAANEIRPLPEINSNVGQGYSSEFDFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extrinsic protein in photosystem II
molecule tags Photosynthesis
source organism Chaetoceros gracilis
publication title Crystal Structure of Psb31, a Novel Extrinsic Protein of Photosystem II from a Marine Centric Diatom and Implications for Its Binding and Function
pubmed doi rcsb
total genus 41
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18240 PSII_Pbs31 Photosystem II Psb31 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1740 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4k7bA00
4K7BA
chains in the Genus database with same CATH superfamily
2EIMC 1T6QA 4JKVA 1KNYA 2J8WA 3G4XA 1FNTc 3UGPA 1NU9C 5FZTA 2A0UA 2XLWA 1A7DA 4HFKB 4JRZA 4NC3A 4EBKA 4EIYA 3DD7A 1Q0FA 4K7BA 2R7WA 3EHNA 4WGZA 1Z7Qc 3L34A 4EBJA 3L8IA 3MYIA 5A6KA 1YJGA 1H7IA 4ER9A 2LK4A 3VAYA 3RIPA 1YLMA 2V26A 3K1IA 4KNWA 2ZD9A 2W4MA 4RBNA 4DBRA 2PNOA 4A2NB 4OIRF 5DLJA 4K0DA 4MW8A 5JSLA 4Q7CA 3SYNA 2W45A 4HE8D 2ZXWC 5L0JA 4G7OF 4EUKB 3ITFA 2YWAA 4IB4A 4LDKA 5E3CA 3U9JA 5KYWB 2AP3A 2DB4A 2ZPAA 1YVIA 3PCVA 4CS9A 1E2XA 1ORSC 3IPMO 3T6JA 1K40A 4WGYA 1HE1A 2YL3A 1C03A 2V3CC 1S7ZA 2HMQA 1H6GA 3JCUQ 4U9DA 1VB5A 1D1AA 2YQYA 2XS1A 1E86A 5KYNA 1OQCA 1Z6AA 1K04A 2EIJC 4G0HA 3GM3A 2EPKX 3OWTA 3AGUA 3R2PA 2A68F 4GYTA 3T6BA 2PF4E 3CEXA 3QZCA 2LIGA 3LJBA 2OOCA 3FMSA 3PDMP 3IQTA 3EGXB 1SYQA 5CIVA 5L0DA 1TKNA 1ZHXA 3N0TA 1ORYA 2MHRA 1HY5A 1GQAA 1MNDA 1Y6DA 4O6YA 2YZSA 3SNHA 3FOOA 4N4WA 2R02A 4E18A 3I5QA 2NSGA 5COMA 3UNGC 3I4UA 3TOLA 1RKCA 2KQ9A 2KNHA 2HV7A 4I44A 3JT1A 3FHDA 1G5ZA 3DJUB 3ECSA 3B0PA 1NG1A 4P9FA 3U2LA 3HNIA 1YARO 2UUIA 4JJFA 4NTBA 3KL4A 2Q9AA 4H54A 1AUEA 2H7VC 3FAJA 1YZAA 3AG4C 2P61A 4MVSA 4AL0A 2R7SA 2G62A 3AGTA 1SR2A 1YAUO 2HSQA 2IXMA 2NUTA 3S0XA 4JC7A 1JOGA 4ANJA 4C7OB 1QSPA 3L1MA 4BJ5C 1NBBA 3LAYA 2AWCA 1LI7A 3DM5A 2YLGA 4XPYA 1TFOB 3MYFA 2XLEA 3GEHA 4JURI 4PK4A 4AE4A 3AQBA 4CDYA 3NDBB 1Z5ZA 2L81A 4R32A 1VYIA 5BQHA 2Y3GA 3U8VA 4EBBA 4KC9A 5A6BA 1OXBA 2HV6A 2TMVP 2HKVA 4HEAJ 1T6IA 1XWJA 1YYXA 1VLTA 2IXNA 3DI5A 4QDLA 2YRFA 4YWQA 4BEJA 4JTDB 2CDQA 2CW0F 3ZWIA 2I8BA 2YLDA 4J7YA 3PMRA 5JS5A 4E7SA 1BBHA 3N24A 1UG7A 5DVWA 5KYUA 3T6GB 3ZTMA 1QZXA 4CS7A 1M57C 4MVQA 2Y69C 4G7ZF 2R7QA 2IYLD 3C8GB 3FDQA 2PP4A 3OEOA 4I1MA 4CDVA 4W8KA 1NLXA 2XSEA 4MVRA 4WJ0A 3GEIA 1D0YA 3B0UX 3LNRA 2KSFA 4C7OA 2YKZA 1RJ9B 1TQGA 3KYJA 1QKRA 2XLMA 5JVEA 2Q4FA 1C02A 4XWJA 3SZRA 3ZG1A 5JP7A 5KYYA 2QTVA 4EHPA 3V5ZA 5L0GA 1YZCA 1PCXA 4MTFA 2L6FA 4NCQA 1O3UA 3SXMA 3RQFA 3FVYA 1WTYA 2CNWD 2XM0A 3UMKA 2OJQA 4IARA 2B0JA 2I15A 5B1AC 3RVZA 5F5HA 2J9VA 2L7AA 2M64A 3G4ZA 5L3VA 5GPGB 2VCBA 3LEOA 1OCZC 1CPRA 4IRUA 4J7TA 3U9MA 3F47A 3KMIA 1TR2A 4DRIB 2LD6A 2WVOA 3K1HA 1FFTC 2XL6A 2ASRA 2A0BA 2HJ3A 4HFFB 5B3SC 3W2WA 2OG2A 1RXQA 1ZZPA 2YEVA 5EHHA 2PBEA 4O6MA 5DQZA 1V74B 3H2UA 4D4XA 3GORA 4MVMA 4CJOA 4FWVA 1LPEA 2J0XA 3DAGA 5B3IA 1GM5A 2XLOA 3DAFA 1OR3A 1LS1A 3IHUA 1WATA 3AG3C 3BEHA 3O6XA 4WABA 2KYHA 1KU2A 4KNVA 3ZC4A 2XXAA 4CS9C 1FFHA 1T01A 2BE5F 4LLCA 2XS8A 4U5EE 2ETSA 4U9EA 4M63A 3IQ5A 1V55C 4OD5A 1G4US 1KTMA 1D1BA 3DXJF 1ZU4A 2PX3A 3JRMO 1ORJA 5A69A 3M4BA 1PD0A 2J9UA 4OD4A 4A4AA 3ABLC 5E2QA 5BUOA 3QVZA 1TWHA 2JX0A 2XRHA 3EFOA 1BDJB 4U5GA 1YDIA 2VASA 3HNLA 5T3TA 2OCCC 1I4ZA 2EPOA 4JCHA 3V7OA 2R03A 3RQEA 3ABMC 1QVXA 2Q7RA 3SP1A 3HTKC 3RW0A 3C8GD 1U6HA 3QW1A 2C03A 1NZEA 5E33A 3B0VC 3CSKA 3W8IA 1A7VA 3IEEA 5E3AA 3TOMA 3EH1A 3QTHA 3U5SA 4E0IA 4Z9IA 2QE9A 3AG2C 5T3WA 3M4CA 4BJ1A 3C7JA 2NSFA 1H9GA 2D5RB 1OCCC 3UMHA 2EPMX 3VYWA 2O9XA 3I5PA 3US6A 2P6VA 3JSZA 3NMKA 2L6GA 2VH3A 3DE9A 3EJNA 4O7GA 3U3BA 2EPNA 1G4WR 1LIHA 1V54C 2IOQA 4CS8C 3TULA 1NSGB 4IGGA 1Q0DA 3KPHA 1VTMP 3JZ0A 4P9TA 3W2VA 4BPMA 4CS8A 4DBQA 1ZW3A 5JT4A 3AJMA 3RVYA 3ZVRA 3GWLA 5A6BD 1T9KA 2PX0A 4W8PA 4FAPB 1TWGA 4JEAA 4DVYP 1MMDA 2P1AA 3TJ5A 1LE4A 3K66A 1LI5A 4ULWA 5BQGA 4LDQA 2LFDA 3C18A 3FAPB 4F4BA 1V4AA 4U5FE 3NG1A 4AL1A 1VK5A 4L6RA 4N6HA 3J06A 3KYIA 2R7XA 4JTAB 3JYYA 4J32B 3MFNA 2X51A 5JRAA 1D0XA 3U2MA 2CCYA 1M6TA 3C62A 1VLSA 3GM2A 2J46A 1OKKA 2YLIA 3GWNA 1SZIA 3SXKA 5DQTA 1NU7D 1QLEC 1PV3A 3VRCA 5L0FA 4JE9A 1AVOB 1ZHTA 4J30B 2WZGA 1I5NA 3QMKA 2XM4A 4GQHA 4IJJA 4YN0B 5DS4A 2HJMA 2HMZA 3G50A 2DGJA 4U5CE 1ZYRF 4DRJB 4JCZA 3VM6A 1M2VB 1OW8A 3A9CA 3GM1A 1M56C 2GFHA 3M1CB 5DS5A 1PD1A 1S05A 3B29A 1J8YF 2BL2A 3NRHA 2L9JA 2AU5A 1I4YA 1ZVZA 3WG7C 1VYKA 2JPUA 4CX9A 2D4UA 4C3DA 1LS4A 4BG0A 2XXAB 3LS1A 4O6NA 1W2WA 2R7RA 2HUJA 5BQIA 2AWYA 1CGOA 1MNEA 3L0IA 4P6IC 4YT8A 3HJCA 4YT2A 4JIOA 4ZLCA 2VCAA 3ZQVA 3H65A 1CGNA 1DOWA 1ZW2A 2A6HF 2B0HA 2QLAA 1OW7A 1LM3B 2QNLA 4GEHA 4MNDA 4DOZA 5L3QA 1HW2A 3S27A 4YL3A 3RF3A 3DWWA 3X2QC 2Q9BA 2WL8A 4PFPA 2G3VA 5KYXB 2Y3HA 5AGFA 3EG9B 2VC9A 2YL1A 4DJ9A 1VMAA 3HNKA 4MVZA 4JEBA 3C63A 1TWAA 4MQ9F 2J9WA 5COFA 3S9OA 4MVOA 3CQZA 4MS2A 2OQMA 4DRHB 5L0IA 2R7UA 3SEOA 3EFOB 3O55A 4YJWA 1DOVA 1APCA 3EPVA 4KI2A 1J8MF 2KK1A 1WN0A 2LSEA 2Q9CA 3EGDB 4ZLDA 2H8AA 2EILC 2R7VA 4CIHA 1AEPA 1T5OA 3U0CA 1QQ3A 2R05A 3ATPA 4DXWA 4OIPF 1B68A 3AQCA 2CNWA 4NQFA 3KKBA 4MW3A 1JMWA 4RD9A 1HMDA 4OINF 4CJGA 5JLIA 1MMGA 2KJGA 1MMAA 4YL0A 3Q7LA 3ZDLA 1JPJA 2M4EA 1EA8A 2WVQA 4U5DE 3ASNC 5KYUB 2NG1A 3LUTB 3RQGA 5L0HA 2J7PD 2OU6A 3DKAA 1JR8A 4Q5SF 1BR4A 3H2VA 1CPQA 1OXKA 1XZQA 2DI3A 2QY9A 3T9OA 2LQGA 4XEVA 1HW1A 5KYXA 3NKEA 3NYLA 4IWBA 1ZU5A 2CGEA 2EIKC 2FGYA 3DE8A 3HNJA 4MTGA 2HFIA 4CSAA 3MLGA 5CI8A 2X0CA 4LERA 3E9VA 2XLHA 4G78A 3KH2A 4NY3A 1K05A 2XLVA 3CZ6A 2LFFA 1CGME 3LS0A 3WAQA 2RD9A 4CBEA 4N6CA 3NMJA 1FR0A 1EKYA 2FAPB 3LESA 1IW7F 5T1DB 2NUPA 2ZXRA 3WHNA 1MQVA 2KW3C 1E83A 3ASOC 5TJ5E 2A1DD 2XL4A 3EH2A 4XEKA 2DYSC 3ZIBA 2A69F 3QVYA 4I3MA 1R5ID 3BRJA 4DVZA 4QI2A 4XPXA 2QUPA 1R4TA 1WWPA 5D92A 3RFYA 4QI0A 1U89A 5DS6A 5B1BC 3RH3A 1BR1A 1ZHZA 3C8GA 1LVKA 2P7VA 3X1OA 4XLNF 3WODF 1E85A 3EQLF 2MWQA 2Y39A 1JAFA 1MMNA 3F46A 4YK5A 3MBGA 4U5HA 1H9TA 1EQ1A 4LLEA 3TK0A 4MVUA 4U5BE 3M79A 4FESA 1FMWA 4PJJA 1GGQA 3W8HA 1Z63A 2H7BA 2IXPA 1WOLA 2GDCA 1L7CA 1EI7A 1L3PA 2W9YA 2YHSA 4LDRA 2WVNA 3B9QA 5HV9A 3S90A 3RYLA 3W4YA 4OIOF 4CDAA 2OEXA 3UGOA 3EGXA 3QW0A 3HLZA 3NYMA 3TQOA 3GEEA 3ZTZA 4D4NA 2F22A 4NTAA 1RJ9A 4MTOA 5COGA 3S84A 3JTLO 3LLIA 5EGYA 1U0BB 1Y4CA 3EZHA 3ZQYA 3FOPA 1NFNA 2OJED 3FXHA 4AK9A 2NUPB 3DM9B 4Z9HA 5KYWA 2YVKA 2LP4A 5K0IA 3POVA 2LCHA 1Z3IX 1JRAA 3O39A 3SXYA 1Z23A 4XLPF 2J0WA 2WZLA 4YT5A 1HMOA 1RCPA 1IZMA 1HE9A 2H7OA 4IAQA 2NUTB 3TD7A 2YL0A 4JTCB 3EG9A 3GODA 3ABKC 3R7CA 4BJ6A 1JPNA 3JYHA 3E70C 4E17A 5AC5A 2IM8A 3T4RA 3IQCA 5A6JA 4JVSA 1WASA 1F1MA 4BJ6C 1SF8A 2Y3DA 1M2VA 1SMYF 256BA 3HKKA 2MYSA 3VF0A 1BZ4A 1OKKD 2UUHA 1O5HA 5IY5C 2HS5A 1G8XA 2W4BA 2RSEB 3DMDA 3M15A 4PJMA 1D0ZA 1WGWA 3AG1C 3PHF2 2P0NA 2J9BA 2EINC 2GAQA 2R7TA 3EHMA 3L8JA 1YA9A 3LEVA 2VB6A 1XZPA 2G3KA 2R9RB 3U3FA 4C3BA 5FCLA 4AE4B 3SXZA 1QPUA 1Q0GA 2ZXOA 4XQ1A 5CI9A 1OR2A 3V5XA 2IBFA 4CIPA 1A7EA 3GANA 3NKDA 3N2ZB 2IXOA 4O79A 3EZIA 3V5YA 5F28E 2R25A 1TWCA 4IAOA 1M2OA 4I1OB 1A0BA 1TFKB 1ST6A 3IQ6A 4Q4ZF 3JSEO 4PACA 1RMVA 1E84A 3EGDA 5D91A 3K33A 2KC3A 2FFHA 3K1IC 5JUAA 4LACB 4BEMJ 5L0CA 1NFOA 2CYDA 4ONSA 4PJLA 1LKXA 1RKEA 1VOMA 3U8PA 1BR2A 2A6EF 4H4KC 2XLDA 4EWCA 1UFBA 3UR3C 1GS9A 2J45A 2HZ8A 2R7OA 3C8ZA 4G7HF 4FX5A 5AC4A 2Z15A 5EK0A 2YL7A 1Q0MA 1LE2A 2KGOA 2NPUA 2OKUA 2OEVA 2PFDA 2C04A 4YL1A 1FAPB 1FTSA 3O10A 4E7ZA 4OIQF 2Q3TA 4PJNA 3K6BA 4RDAA 3NYJA 4YT4A 3Q7GA 3TJ6A 4N06A 1ZHYA 2GA0A 2WZFA 3B71A 1FMVA 4KBLA 1D1CA 3AOUA 4AX2A 3UMIA 3JRTA 4C3EA 4EKWA 3Q6NA 4JJGA 4K1OA 1C17M 3RKOF 1ZHWA 3LNMB 5HSWA 2Y3BA 2GWWA 4NTFA 4PR9A 5A6AA 4XEFA 4JW1A 1OCRC 4JZAA 4BJTA 3NMIA 4PFOA 2WB7A 3DZAA 4X0RA 4BJ5A 1OW6A 1Q0KA 3K7DA 4CSAC 1YA7O 2Q00A 3DJNB 3MX3A 3Q6MA 1T6UA 3LLKA 2ZXPA 3S29A 3ZSUA 1RKEB 4B6IA 4UDVA 3CAXA 2BC5A 1OCOC 1A41A 1N1CA 5F5FA 1O87A 2DYRC 4ULVA 2EPLX 2AVKA 2E87A 4XTKA 3S28A 3A11A 2VCCA 4Z9JA 2HSBA 4XPWA 5KYYB 3OA1A 2L6HA 1YYJA 2XL8A 4E0HA 2JD3A 2ICWG 2J7PA
chains in the Genus database with same CATH topology
2EIMC 3UGPA 1NU9C 4HFKB 3DD7A 4K7BA 2R7WA 3EHNA 3L34A 3VAYA 3RIPA 2V26A 4KNWA 2W4MA 4RBNA 4DBRA 4A2NB 4OIRF 5DLJA 4K0DA 4Q7CA 3SYNA 2W45A 4HE8D 2ZXWC 4G7OF 3ITFA 5E3CA 5KYWB 2ZPAA 4CS9A 3T6JA 2V3CC 1S7ZA 3JCUQ 1D1AA 5KYNA 1Z6AA 4G0HA 2EIJC 3OWTA 4GYTA 2A68F 3T6BA 2PF4E 3QZCA 3LJBA 3EGXB 1TKNA 1ZHXA 3N0TA 3SNHA 1MNDA 4O6YA 2YZSA 3I5QA 3UNGC 3I4UA 2KQ9A 2KNHA 2HV7A 4I44A 3JT1A 3FHDA 3DJUB 3ECSA 3B0PA 1NG1A 4JJFA 3KL4A 2Q9AA 2H7VC 3FAJA 3AG4C 2R7SA 2G62A 3S0XA 2IXMA 2NUTA 4ANJA 4C7OB 4BJ5C 3LAYA 3DM5A 4PK4A 4JURI 4AE4A 3AQBA 3NDBB 1Z5ZA 2L81A 1VYIA 2Y3GA 4EBBA 4KC9A 2HV6A 4HEAJ 2IXNA 4QDLA 4YWQA 4BEJA 2CDQA 2CW0F 2I8BA 3PMRA 4E7SA 3N24A 5DVWA 5KYUA 4CS7A 1QZXA 1M57C 2Y69C 4G7ZF 2R7QA 2IYLD 3FDQA 2PP4A 3OEOA 4I1MA 4W8KA 2XSEA 4WJ0A 1D0YA 3B0UX 3LNRA 4C7OA 1RJ9B 5KYYA 4XWJA 3SZRA 3ZG1A 2QTVA 1PCXA 3FVYA 2CNWD 3UMKA 2B0JA 5B1AC 5F5HA 2J9VA 5L3VA 1OCZC 4IRUA 3F47A 3KMIA 1TR2A 2WVOA 3K1HA 1FFTC 4HFFB 5B3SC 3W2WA 2OG2A 2YEVA 5EHHA 4O6MA 5DQZA 4FWVA 3DAGA 2J0XA 3DAFA 1LS1A 3AG3C 3O6XA 3ZC4A 1KU2A 4KNVA 2XXAA 4CS9C 1FFHA 2BE5F 4LLCA 4U5EE 4M63A 1V55C 4OD5A 1D1BA 3DXJF 1ZU4A 2PX3A 1PD0A 2J9UA 4OD4A 3ABLC 5BUOA 1TWHA 2XRHA 4U5GA 3EFOA 2VASA 5T3TA 2OCCC 4JCHA 3V7OA 3ABMC 3SP1A 3HTKC 2C03A 1NZEA 5E33A 3B0VC 3CSKA 3W8IA 3IEEA 5E3AA 3EH1A 3AG2C 5T3WA 4BJ1A 2D5RB 1OCCC 3UMHA 3VYWA 2O9XA 3I5PA 2P6VA 3JSZA 2VH3A 3EJNA 4O7GA 1V54C 2IOQA 4CS8C 3W2VA 4CS8A 4DBQA 3ZVRA 2PX0A 1TWGA 4DVYP 1MMDA 3K66A 4ULWA 4F4BA 4U5FE 3NG1A 1VK5A 2R7XA 4J32B 2X51A 1D0XA 5DQTA 1OKKA 2J46A 1SZIA 1NU7D 1QLEC 1ZHTA 4J30B 2WZGA 3QMKA 4IJJA 4YN0B 5DS4A 4U5CE 2DGJA 1ZYRF 1M2VB 5DS5A 1M56C 2GFHA 3M1CB 1PD1A 1J8YF 3NRHA 2L9JA 3WG7C 1VYKA 2J7PA 4C3DA 4BG0A 2XXAB 3LS1A 4O6NA 1W2WA 2R7RA 4YT8A 1MNEA 3L0IA 4P6IC 3HJCA 4YT2A 4ZLCA 3H65A 2A6HF 4GEHA 4MNDA 4DOZA 5L3QA 3S27A 3X2QC 2Q9BA 2WL8A 4PFPA 2G3VA 5KYXB 2Y3HA 3EG9B 1VMAA 1TWAA 4MQ9F 2J9WA 3CQZA 2R7UA 3SEOA 3EFOB 4YJWA 3EPVA 4KI2A 1J8MF 2LSEA 2Q9CA 3EGDB 4ZLDA 2EILC 2R7VA 4CIHA 4OIPF 3AQCA 2CNWA 3KKBA 4RD9A 4OINF 1MMGA 2KJGA 1MMAA 3Q7LA 1JPJA 2M4EA 4U5DE 2WVQA 3ASNC 5KYUB 2NG1A 2J7PD 4Q5SF 1BR4A 2QY9A 5KYXA 3NKEA 3NYLA 4IWBA 1ZU5A 2CGEA 2EIKC 2FGYA 4CSAA 3MLGA 5CI8A 4LERA 3E9VA 3KH2A 4NY3A 3CZ6A 3LS0A 4CBEA 3LESA 1IW7F 5T1DB 2NUPA 2ZXRA 2KW3C 3ASOC 2A1DD 2XL4A 3EH2A 2DYSC 3ZIBA 2A69F 4I3MA 4DVZA 4QI2A 3RFYA 5D92A 4QI0A 5DS6A 5B1BC 3RH3A 1BR1A 1ZHZA 1LVKA 2P7VA 3X1OA 4XLNF 3WODF 3EQLF 2MWQA 2Y39A 1MMNA 3F46A 4U5HA 4LLEA 4U5BE 4PJJA 4FESA 1FMWA 3W8HA 1Z63A 2H7BA 2W9YA 2IXPA 4CSAC 2YHSA 2WVNA 3B9QA 3RYLA 4OIOF 3UGOA 3EGXA 3HLZA 3NYMA 1RJ9A 3LLIA 5EGYA 3EZHA 4AK9A 2NUPB 3DM9B 3POVA 1Z3IX 3O39A 1Z23A 4XLPF 2J0WA 2WZLA 4YT5A 1IZMA 2H7OA 2NUTB 3TD7A 3EG9A 3GODA 3ABKC 4BJ6A 1JPNA 3JYHA 3E70C 3T4RA 4JVSA 4BJ6C 1SF8A 2Y3DA 1M2VA 1SMYF 2MYSA 1OKKD 1O5HA 5IY5C 1G8XA 2W4BA 3DMDA 4PJMA 1D0ZA 1WGWA 3AG1C 3PHF2 2R7TA 2EINC 3LEVA 2VB6A 2G3KA 4C3BA 5FCLA 4AE4B 2ZXOA 5CI9A 3GANA 3NKDA 3N2ZB 2IXOA 4O79A 3EZIA 1TWCA 4IAOA 1M2OA 4I1OB 1ST6A 4Q4ZF 3EGDA 5D91A 3K33A 2FFHA 3K1IC 4LACB 4PJLA 1LKXA 1VOMA 1BR2A 2A6EF 4H4KC 4EWCA 5KYWA 3UR3C 4OIQF 2J45A 2R7OA 4G7HF 4FX5A 2Z15A 2KGOA 5E2QA 2PFDA 2C04A 1FTSA 4E7ZA 2Q3TA 4PJNA 3K6BA 4RDAA 3NYJA 4YT4A 3Q7GA 4N06A 1ZHYA 2WZFA 4KBLA 1FMVA 1D1CA 4AX2A 3UMIA 3JRTA 4C3EA 3Q6NA 4JJGA 3RKOF 1ZHWA 5HSWA 2Y3BA 4JW1A 1OCRC 4JZAA 4BJTA 4PFOA 2WB7A 3DZAA 4X0RA 4BJ5A 3K7DA 3DJNB 3MX3A 3Q6MA 3LLKA 3S29A 2ZXPA 4B6IA 3ZSUA 1OCOC 1N1CA 5F5FA 1O87A 2DYRC 4XTKA 2E87A 3S28A 5KYYB 3OA1A 2JD3A 3EHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7B A; 
#chains in the Genus database with same CATH topology
 2EIM C;  1T6Q A;  4JKV A;  1KNY A;  2J8W A;  3G4X A;  1FNT c;  3UGP A;  1NU9 C;  5FZT A;  2A0U A;  2XLW A;  1A7D A;  4HFK B;  4JRZ A;  4NC3 A;  4EBK A;  4EIY A;  3DD7 A;  1Q0F A;  4K7B A;  2R7W A;  3EHN A;  4WGZ A;  1Z7Q c;  3L34 A;  4EBJ A;  3L8I A;  3MYI A;  5A6K A;  1YJG A;  1H7I A;  4ER9 A;  2LK4 A;  3VAY A;  3RIP A;  1YLM A;  2V26 A;  3K1I A;  4KNW A;  2ZD9 A;  2W4M A;  4RBN A;  4DBR A;  2PNO A;  4A2N B;  4OIR F;  5DLJ A;  4K0D A;  4MW8 A;  5JSL A;  4Q7C A;  3SYN A;  2W45 A;  4HE8 D;  2ZXW C;  5L0J A;  4G7O F;  4EUK B;  3ITF A;  2YWA A;  4IB4 A;  4LDK A;  5E3C A;  3U9J A;  5KYW B;  2AP3 A;  2DB4 A;  2ZPA A;  1YVI A;  3PCV A;  4CS9 A;  1E2X A;  1ORS C;  3IPM O;  3T6J A;  1K40 A;  4WGY A;  1HE1 A;  2YL3 A;  1C03 A;  2V3C C;  1S7Z A;  2HMQ A;  1H6G A;  3JCU Q;  4U9D A;  1VB5 A;  1D1A A;  2YQY A;  2XS1 A;  1E86 A;  5KYN A;  1OQC A;  1Z6A A;  1K04 A;  2EIJ C;  4G0H A;  3GM3 A;  2EPK X;  3OWT A;  3AGU A;  3R2P A;  2A68 F;  4GYT A;  3T6B A;  2PF4 E;  3CEX A;  3QZC A;  2LIG A;  3LJB A;  2OOC A;  3FMS A;  3PDM P;  3IQT A;  3EGX B;  1SYQ A;  5CIV A;  5L0D A;  1TKN A;  1ZHX A;  3N0T A;  1ORY A;  2MHR A;  1HY5 A;  1GQA A;  1MND A;  1Y6D A;  4O6Y A;  2YZS A;  3SNH A;  3FOO A;  4N4W A;  2R02 A;  4E18 A;  3I5Q A;  2NSG A;  5COM A;  3UNG C;  3I4U A;  3TOL A;  1RKC A;  2KQ9 A;  2KNH A;  2HV7 A;  4I44 A;  3JT1 A;  3FHD A;  1G5Z A;  3DJU B;  3ECS A;  3B0P A;  1NG1 A;  4P9F A;  3U2L A;  3HNI A;  1YAR O;  2UUI A;  4JJF A;  4NTB A;  3KL4 A;  2Q9A A;  4H54 A;  1AUE A;  2H7V C;  3FAJ A;  1YZA A;  3AG4 C;  2P61 A;  4MVS A;  4AL0 A;  2R7S A;  2G62 A;  3AGT A;  1SR2 A;  1YAU O;  2HSQ A;  2IXM A;  2NUT A;  3S0X A;  4JC7 A;  1JOG A;  4ANJ A;  4C7O B;  1QSP A;  3L1M A;  4BJ5 C;  1NBB A;  3LAY A;  2AWC A;  1LI7 A;  3DM5 A;  2YLG A;  4XPY A;  1TFO B;  3MYF A;  2XLE A;  3GEH A;  4JUR I;  4PK4 A;  4AE4 A;  3AQB A;  4CDY A;  3NDB B;  1Z5Z A;  2L81 A;  4R32 A;  1VYI A;  5BQH A;  2Y3G A;  3U8V A;  4EBB A;  4KC9 A;  5A6B A;  1OXB A;  2HV6 A;  2TMV P;  2HKV A;  4HEA J;  1T6I A;  1XWJ A;  1YYX A;  1VLT A;  2IXN A;  3DI5 A;  4QDL A;  2YRF A;  4YWQ A;  4BEJ A;  4JTD B;  2CDQ A;  2CW0 F;  3ZWI A;  2I8B A;  2YLD A;  4J7Y A;  3PMR A;  5JS5 A;  4E7S A;  1BBH A;  3N24 A;  1UG7 A;  5DVW A;  5KYU A;  3T6G B;  3ZTM A;  1QZX A;  4CS7 A;  1M57 C;  4MVQ A;  2Y69 C;  4G7Z F;  2R7Q A;  2IYL D;  3C8G B;  3FDQ A;  2PP4 A;  3OEO A;  4I1M A;  4CDV A;  4W8K A;  1NLX A;  2XSE A;  4MVR A;  4WJ0 A;  3GEI A;  1D0Y A;  3B0U X;  3LNR A;  2KSF A;  4C7O A;  2YKZ A;  1RJ9 B;  1TQG A;  3KYJ A;  1QKR A;  2XLM A;  5JVE A;  2Q4F A;  1C02 A;  4XWJ A;  3SZR A;  3ZG1 A;  5JP7 A;  5KYY A;  2QTV A;  4EHP A;  3V5Z A;  5L0G A;  1YZC A;  1PCX A;  4MTF A;  2L6F A;  4NCQ A;  1O3U A;  3SXM A;  3RQF A;  3FVY A;  1WTY A;  2CNW D;  2XM0 A;  3UMK A;  2OJQ A;  4IAR A;  2B0J A;  2I15 A;  5B1A C;  3RVZ A;  5F5H A;  2J9V A;  2L7A A;  2M64 A;  3G4Z A;  5L3V A;  5GPG B;  2VCB A;  3LEO A;  1OCZ C;  1CPR A;  4IRU A;  4J7T A;  3U9M A;  3F47 A;  3KMI A;  1TR2 A;  4DRI B;  2LD6 A;  2WVO A;  3K1H A;  1FFT C;  2XL6 A;  2ASR A;  2A0B A;  2HJ3 A;  4HFF B;  5B3S C;  3W2W A;  2OG2 A;  1RXQ A;  1ZZP A;  2YEV A;  5EHH A;  2PBE A;  4O6M A;  5DQZ A;  1V74 B;  3H2U A;  4D4X A;  3GOR A;  4MVM A;  4CJO A;  4FWV A;  1LPE A;  2J0X A;  3DAG A;  5B3I A;  1GM5 A;  2XLO A;  3DAF A;  1OR3 A;  1LS1 A;  3IHU A;  1WAT A;  3AG3 C;  3BEH A;  3O6X A;  4WAB A;  2KYH A;  1KU2 A;  4KNV A;  3ZC4 A;  2XXA A;  4CS9 C;  1FFH A;  1T01 A;  2BE5 F;  4LLC A;  2XS8 A;  4U5E E;  2ETS A;  4U9E A;  4M63 A;  3IQ5 A;  1V55 C;  4OD5 A;  1G4U S;  1KTM A;  1D1B A;  3DXJ F;  1ZU4 A;  2PX3 A;  3JRM O;  1ORJ A;  5A69 A;  3M4B A;  1PD0 A;  2J9U A;  4OD4 A;  4A4A A;  3ABL C;  5E2Q A;  5BUO A;  3QVZ A;  1TWH A;  2JX0 A;  2XRH A;  3EFO A;  1BDJ B;  4U5G A;  1YDI A;  2VAS A;  3HNL A;  5T3T A;  2OCC C;  1I4Z A;  2EPO A;  4JCH A;  3V7O A;  2R03 A;  3RQE A;  3ABM C;  1QVX A;  2Q7R A;  3SP1 A;  3HTK C;  3RW0 A;  3C8G D;  1U6H A;  3QW1 A;  2C03 A;  1NZE A;  5E33 A;  3B0V C;  3CSK A;  3W8I A;  1A7V A;  3IEE A;  5E3A A;  3TOM A;  3EH1 A;  3QTH A;  3U5S A;  4E0I A;  4Z9I A;  2QE9 A;  3AG2 C;  5T3W A;  3M4C A;  4BJ1 A;  3C7J A;  2NSF A;  1H9G A;  2D5R B;  1OCC C;  3UMH A;  2EPM X;  3VYW A;  2O9X A;  3I5P A;  3US6 A;  2P6V A;  3JSZ A;  3NMK A;  2L6G A;  2VH3 A;  3DE9 A;  3EJN A;  4O7G A;  3U3B A;  2EPN A;  1G4W R;  1LIH A;  1V54 C;  2IOQ A;  4CS8 C;  3TUL A;  1NSG B;  4IGG A;  1Q0D A;  3KPH A;  1VTM P;  3JZ0 A;  4P9T A;  3W2V A;  4BPM A;  4CS8 A;  4DBQ A;  1ZW3 A;  5JT4 A;  3AJM A;  3RVY A;  3ZVR A;  3GWL A;  5A6B D;  1T9K A;  2PX0 A;  4W8P A;  4FAP B;  1TWG A;  4JEA A;  4DVY P;  1MMD A;  2P1A A;  3TJ5 A;  1LE4 A;  3K66 A;  1LI5 A;  4ULW A;  5BQG A;  4LDQ A;  2LFD A;  3C18 A;  3FAP B;  4F4B A;  1V4A A;  4U5F E;  3NG1 A;  4AL1 A;  1VK5 A;  4L6R A;  4N6H A;  3J06 A;  3KYI A;  2R7X A;  4JTA B;  3JYY A;  4J32 B;  3MFN A;  2X51 A;  5JRA A;  1D0X A;  3U2M A;  2CCY A;  1M6T A;  3C62 A;  1VLS A;  3GM2 A;  2J46 A;  1OKK A;  2YLI A;  3GWN A;  1SZI A;  3SXK A;  5DQT A;  1NU7 D;  1QLE C;  1PV3 A;  3VRC A;  5L0F A;  4JE9 A;  1AVO B;  1ZHT A;  4J30 B;  2WZG A;  1I5N A;  3QMK A;  2XM4 A;  4GQH A;  4IJJ A;  4YN0 B;  5DS4 A;  2HJM A;  2HMZ A;  3G50 A;  2DGJ A;  4U5C E;  1ZYR F;  4DRJ B;  4JCZ A;  3VM6 A;  1M2V B;  1OW8 A;  3A9C A;  3GM1 A;  1M56 C;  2GFH A;  3M1C B;  5DS5 A;  1PD1 A;  1S05 A;  3B29 A;  1J8Y F;  2BL2 A;  3NRH A;  2L9J A;  2AU5 A;  1I4Y A;  1ZVZ A;  3WG7 C;  1VYK A;  2JPU A;  4CX9 A;  2D4U A;  4C3D A;  1LS4 A;  4BG0 A;  2XXA B;  3LS1 A;  4O6N A;  1W2W A;  2R7R A;  2HUJ A;  5BQI A;  2AWY A;  1CGO A;  1MNE A;  3L0I A;  4P6I C;  4YT8 A;  3HJC A;  4YT2 A;  4JIO A;  4ZLC A;  2VCA A;  3ZQV A;  3H65 A;  1CGN A;  1DOW A;  1ZW2 A;  2A6H F;  2B0H A;  2QLA A;  1OW7 A;  1LM3 B;  2QNL A;  4GEH A;  4MND A;  4DOZ A;  5L3Q A;  1HW2 A;  3S27 A;  4YL3 A;  3RF3 A;  3DWW A;  3X2Q C;  2Q9B A;  2WL8 A;  4PFP A;  2G3V A;  5KYX B;  2Y3H A;  5AGF A;  3EG9 B;  2VC9 A;  2YL1 A;  4DJ9 A;  1VMA A;  3HNK A;  4MVZ A;  4JEB A;  3C63 A;  1TWA A;  4MQ9 F;  2J9W A;  5COF A;  3S9O A;  4MVO A;  3CQZ A;  4MS2 A;  2OQM A;  4DRH B;  5L0I A;  2R7U A;  3SEO A;  3EFO B;  3O55 A;  4YJW A;  1DOV A;  1APC A;  3EPV A;  4KI2 A;  1J8M F;  2KK1 A;  1WN0 A;  2LSE A;  2Q9C A;  3EGD B;  4ZLD A;  2H8A A;  2EIL C;  2R7V A;  4CIH A;  1AEP A;  1T5O A;  3U0C A;  1QQ3 A;  2R05 A;  3ATP A;  4DXW A;  4OIP F;  1B68 A;  3AQC A;  2CNW A;  4NQF A;  3KKB A;  4MW3 A;  1JMW A;  4RD9 A;  1HMD A;  4OIN F;  4CJG A;  5JLI A;  1MMG A;  2KJG A;  1MMA A;  4YL0 A;  3Q7L A;  3ZDL A;  1JPJ A;  2M4E A;  1EA8 A;  2WVQ A;  4U5D E;  3ASN C;  5KYU B;  2NG1 A;  3LUT B;  3RQG A;  5L0H A;  2J7P D;  2OU6 A;  3DKA A;  1JR8 A;  4Q5S F;  1BR4 A;  3H2V A;  1CPQ A;  1OXK A;  1XZQ A;  2DI3 A;  2QY9 A;  3T9O A;  2LQG A;  4XEV A;  1HW1 A;  5KYX A;  3NKE A;  3NYL A;  4IWB A;  1ZU5 A;  2CGE A;  2EIK C;  2FGY A;  3DE8 A;  3HNJ A;  4MTG A;  2HFI A;  4CSA A;  3MLG A;  5CI8 A;  2X0C A;  4LER A;  3E9V A;  2XLH A;  4G78 A;  3KH2 A;  4NY3 A;  1K05 A;  2XLV A;  3CZ6 A;  2LFF A;  1CGM E;  3LS0 A;  3WAQ A;  2RD9 A;  4CBE A;  4N6C A;  3NMJ A;  1FR0 A;  1EKY A;  2FAP B;  3LES A;  1IW7 F;  5T1D B;  2NUP A;  2ZXR A;  3WHN A;  1MQV A;  2KW3 C;  1E83 A;  3ASO C;  5TJ5 E;  2A1D D;  2XL4 A;  3EH2 A;  4XEK A;  2DYS C;  3ZIB A;  2A69 F;  3QVY A;  4I3M A;  1R5I D;  3BRJ A;  4DVZ A;  4QI2 A;  4XPX A;  2QUP A;  1R4T A;  1WWP A;  5D92 A;  3RFY A;  4QI0 A;  1U89 A;  5DS6 A;  5B1B C;  3RH3 A;  1BR1 A;  1ZHZ A;  3C8G A;  1LVK A;  2P7V A;  3X1O A;  4XLN F;  3WOD F;  1E85 A;  3EQL F;  2MWQ A;  2Y39 A;  1JAF A;  1MMN A;  3F46 A;  4YK5 A;  3MBG A;  4U5H A;  1H9T A;  1EQ1 A;  4LLE A;  3TK0 A;  4MVU A;  4U5B E;  3M79 A;  4FES A;  1FMW A;  4PJJ A;  1GGQ A;  3W8H A;  1Z63 A;  2H7B A;  2IXP A;  1WOL A;  2GDC A;  1L7C A;  1EI7 A;  1L3P A;  2W9Y A;  2YHS A;  4LDR A;  2WVN A;  3B9Q A;  5HV9 A;  3S90 A;  3RYL A;  3W4Y A;  4OIO F;  4CDA A;  2OEX A;  3UGO A;  3EGX A;  3QW0 A;  3HLZ A;  3NYM A;  3TQO A;  3GEE A;  3ZTZ A;  4D4N A;  2F22 A;  4NTA A;  1RJ9 A;  4MTO A;  5COG A;  3S84 A;  3JTL O;  3LLI A;  5EGY A;  1U0B B;  1Y4C A;  3EZH A;  3ZQY A;  3FOP A;  1NFN A;  2OJE D;  3FXH A;  4AK9 A;  2NUP B;  3DM9 B;  4Z9H A;  5KYW A;  2YVK A;  2LP4 A;  5K0I A;  3POV A;  2LCH A;  1Z3I X;  1JRA A;  3O39 A;  3SXY A;  1Z23 A;  4XLP F;  2J0W A;  2WZL A;  4YT5 A;  1HMO A;  1RCP A;  1IZM A;  1HE9 A;  2H7O A;  4IAQ A;  2NUT B;  3TD7 A;  2YL0 A;  4JTC B;  3EG9 A;  3GOD A;  3ABK C;  3R7C A;  4BJ6 A;  1JPN A;  3JYH A;  3E70 C;  4E17 A;  5AC5 A;  2IM8 A;  3T4R A;  3IQC A;  5A6J A;  4JVS A;  1WAS A;  1F1M A;  4BJ6 C;  1SF8 A;  2Y3D A;  1M2V A;  1SMY F;  256B A;  3HKK A;  2MYS A;  3VF0 A;  1BZ4 A;  1OKK D;  2UUH A;  1O5H A;  5IY5 C;  2HS5 A;  1G8X A;  2W4B A;  2RSE B;  3DMD A;  3M15 A;  4PJM A;  1D0Z A;  1WGW A;  3AG1 C;  3PHF 2;  2P0N A;  2J9B A;  2EIN C;  2GAQ A;  2R7T A;  3EHM A;  3L8J A;  1YA9 A;  3LEV A;  2VB6 A;  1XZP A;  2G3K A;  2R9R B;  3U3F A;  4C3B A;  5FCL A;  4AE4 B;  3SXZ A;  1QPU A;  1Q0G A;  2ZXO A;  4XQ1 A;  5CI9 A;  1OR2 A;  3V5X A;  2IBF A;  4CIP A;  1A7E A;  3GAN A;  3NKD A;  3N2Z B;  2IXO A;  4O79 A;  3EZI A;  3V5Y A;  5F28 E;  2R25 A;  1TWC A;  4IAO A;  1M2O A;  4I1O B;  1A0B A;  1TFK B;  1ST6 A;  3IQ6 A;  4Q4Z F;  3JSE O;  4PAC A;  1RMV A;  1E84 A;  3EGD A;  5D91 A;  3K33 A;  2KC3 A;  2FFH A;  3K1I C;  5JUA A;  4LAC B;  4BEM J;  5L0C A;  1NFO A;  2CYD A;  4ONS A;  4PJL A;  1LKX A;  1RKE A;  1VOM A;  3U8P A;  1BR2 A;  2A6E F;  4H4K C;  2XLD A;  4EWC A;  1UFB A;  3UR3 C;  1GS9 A;  2J45 A;  2HZ8 A;  2R7O A;  3C8Z A;  4G7H F;  4FX5 A;  5AC4 A;  2Z15 A;  5EK0 A;  2YL7 A;  1Q0M A;  1LE2 A;  2KGO A;  2NPU A;  2OKU A;  2OEV A;  2PFD A;  2C04 A;  4YL1 A;  1FAP B;  1FTS A;  3O10 A;  4E7Z A;  4OIQ F;  2Q3T A;  4PJN A;  3K6B A;  4RDA A;  3NYJ A;  4YT4 A;  3Q7G A;  3TJ6 A;  4N06 A;  1ZHY A;  2GA0 A;  2WZF A;  3B71 A;  1FMV A;  4KBL A;  1D1C A;  3AOU A;  4AX2 A;  3UMI A;  3JRT A;  4C3E A;  4EKW A;  3Q6N A;  4JJG A;  4K1O A;  1C17 M;  3RKO F;  1ZHW A;  3LNM B;  5HSW A;  2Y3B A;  2GWW A;  4NTF A;  4PR9 A;  5A6A A;  4XEF A;  4JW1 A;  1OCR C;  4JZA A;  4BJT A;  3NMI A;  4PFO A;  2WB7 A;  3DZA A;  4X0R A;  4BJ5 A;  1OW6 A;  1Q0K A;  3K7D A;  4CSA C;  1YA7 O;  2Q00 A;  3DJN B;  3MX3 A;  3Q6M A;  1T6U A;  3LLK A;  2ZXP A;  3S29 A;  3ZSU A;  1RKE B;  4B6I A;  4UDV A;  3CAX A;  2BC5 A;  1OCO C;  1A41 A;  1N1C A;  5F5F A;  1O87 A;  2DYR C;  4ULV A;  2EPL X;  2AVK A;  2E87 A;  4XTK A;  3S28 A;  3A11 A;  2VCC A;  4Z9J A;  2HSB A;  4XPW A;  5KYY B;  3OA1 A;  2L6H A;  1YYJ A;  2XL8 A;  4E0H A;  2JD3 A;  2ICW G;  2J7P A; 
#chains in the Genus database with same CATH homology
 2EIM C;  3UGP A;  1NU9 C;  4HFK B;  3DD7 A;  4K7B A;  2R7W A;  3EHN A;  3L34 A;  3VAY A;  3RIP A;  2V26 A;  4KNW A;  2W4M A;  4RBN A;  4DBR A;  4A2N B;  4OIR F;  5DLJ A;  4K0D A;  4Q7C A;  3SYN A;  2W45 A;  4HE8 D;  2ZXW C;  4G7O F;  3ITF A;  5E3C A;  5KYW B;  2ZPA A;  4CS9 A;  3T6J A;  2V3C C;  1S7Z A;  3JCU Q;  1D1A A;  5KYN A;  1Z6A A;  4G0H A;  2EIJ C;  3OWT A;  4GYT A;  2A68 F;  3T6B A;  2PF4 E;  3QZC A;  3LJB A;  3EGX B;  1TKN A;  1ZHX A;  3N0T A;  3SNH A;  1MND A;  4O6Y A;  2YZS A;  3I5Q A;  3UNG C;  3I4U A;  2KQ9 A;  2KNH A;  2HV7 A;  4I44 A;  3JT1 A;  3FHD A;  3DJU B;  3ECS A;  3B0P A;  1NG1 A;  4JJF A;  3KL4 A;  2Q9A A;  2H7V C;  3FAJ A;  3AG4 C;  2R7S A;  2G62 A;  3S0X A;  2IXM A;  2NUT A;  4ANJ A;  4C7O B;  4BJ5 C;  3LAY A;  3DM5 A;  4PK4 A;  4JUR I;  4AE4 A;  3AQB A;  3NDB B;  1Z5Z A;  2L81 A;  1VYI A;  2Y3G A;  4EBB A;  4KC9 A;  2HV6 A;  4HEA J;  2IXN A;  4QDL A;  4YWQ A;  4BEJ A;  2CDQ A;  2CW0 F;  2I8B A;  3PMR A;  4E7S A;  3N24 A;  5DVW A;  5KYU A;  4CS7 A;  1QZX A;  1M57 C;  2Y69 C;  4G7Z F;  2R7Q A;  2IYL D;  3FDQ A;  2PP4 A;  3OEO A;  4I1M A;  4W8K A;  2XSE A;  4WJ0 A;  1D0Y A;  3B0U X;  3LNR A;  4C7O A;  1RJ9 B;  5KYY A;  4XWJ A;  3SZR A;  3ZG1 A;  2QTV A;  1PCX A;  3FVY A;  2CNW D;  3UMK A;  2B0J A;  5B1A C;  5F5H A;  2J9V A;  5L3V A;  1OCZ C;  4IRU A;  3F47 A;  3KMI A;  1TR2 A;  2WVO A;  3K1H A;  1FFT C;  4HFF B;  5B3S C;  3W2W A;  2OG2 A;  2YEV A;  5EHH A;  4O6M A;  5DQZ A;  4FWV A;  3DAG A;  2J0X A;  3DAF A;  1LS1 A;  3AG3 C;  3O6X A;  3ZC4 A;  1KU2 A;  4KNV A;  2XXA A;  4CS9 C;  1FFH A;  2BE5 F;  4LLC A;  4U5E E;  4M63 A;  1V55 C;  4OD5 A;  1D1B A;  3DXJ F;  1ZU4 A;  2PX3 A;  1PD0 A;  2J9U A;  4OD4 A;  3ABL C;  5BUO A;  1TWH A;  2XRH A;  4U5G A;  3EFO A;  2VAS A;  5T3T A;  2OCC C;  4JCH A;  3V7O A;  3ABM C;  3SP1 A;  3HTK C;  2C03 A;  1NZE A;  5E33 A;  3B0V C;  3CSK A;  3W8I A;  3IEE A;  5E3A A;  3EH1 A;  3AG2 C;  5T3W A;  4BJ1 A;  2D5R B;  1OCC C;  3UMH A;  3VYW A;  2O9X A;  3I5P A;  2P6V A;  3JSZ A;  2VH3 A;  3EJN A;  4O7G A;  1V54 C;  2IOQ A;  4CS8 C;  3W2V A;  4CS8 A;  4DBQ A;  3ZVR A;  2PX0 A;  1TWG A;  4DVY P;  1MMD A;  3K66 A;  4ULW A;  4F4B A;  4U5F E;  3NG1 A;  1VK5 A;  2R7X A;  4J32 B;  2X51 A;  1D0X A;  5DQT A;  1OKK A;  2J46 A;  1SZI A;  1NU7 D;  1QLE C;  1ZHT A;  4J30 B;  2WZG A;  3QMK A;  4IJJ A;  4YN0 B;  5DS4 A;  4U5C E;  2DGJ A;  1ZYR F;  1M2V B;  5DS5 A;  1M56 C;  2GFH A;  3M1C B;  1PD1 A;  1J8Y F;  3NRH A;  2L9J A;  3WG7 C;  1VYK A;  2J7P A;  4C3D A;  4BG0 A;  2XXA B;  3LS1 A;  4O6N A;  1W2W A;  2R7R A;  4YT8 A;  1MNE A;  3L0I A;  4P6I C;  3HJC A;  4YT2 A;  4ZLC A;  3H65 A;  2A6H F;  4GEH A;  4MND A;  4DOZ A;  5L3Q A;  3S27 A;  3X2Q C;  2Q9B A;  2WL8 A;  4PFP A;  2G3V A;  5KYX B;  2Y3H A;  3EG9 B;  1VMA A;  1TWA A;  4MQ9 F;  2J9W A;  3CQZ A;  2R7U A;  3SEO A;  3EFO B;  4YJW A;  3EPV A;  4KI2 A;  1J8M F;  2LSE A;  2Q9C A;  3EGD B;  4ZLD A;  2EIL C;  2R7V A;  4CIH A;  4OIP F;  3AQC A;  2CNW A;  3KKB A;  4RD9 A;  4OIN F;  1MMG A;  2KJG A;  1MMA A;  3Q7L A;  1JPJ A;  2M4E A;  4U5D E;  2WVQ A;  3ASN C;  5KYU B;  2NG1 A;  2J7P D;  4Q5S F;  1BR4 A;  2QY9 A;  5KYX A;  3NKE A;  3NYL A;  4IWB A;  1ZU5 A;  2CGE A;  2EIK C;  2FGY A;  4CSA A;  3MLG A;  5CI8 A;  4LER A;  3E9V A;  3KH2 A;  4NY3 A;  3CZ6 A;  3LS0 A;  4CBE A;  3LES A;  1IW7 F;  5T1D B;  2NUP A;  2ZXR A;  2KW3 C;  3ASO C;  2A1D D;  2XL4 A;  3EH2 A;  2DYS C;  3ZIB A;  2A69 F;  4I3M A;  4DVZ A;  4QI2 A;  3RFY A;  5D92 A;  4QI0 A;  5DS6 A;  5B1B C;  3RH3 A;  1BR1 A;  1ZHZ A;  1LVK A;  2P7V A;  3X1O A;  4XLN F;  3WOD F;  3EQL F;  2MWQ A;  2Y39 A;  1MMN A;  3F46 A;  4U5H A;  4LLE A;  4U5B E;  4PJJ A;  4FES A;  1FMW A;  3W8H A;  1Z63 A;  2H7B A;  2W9Y A;  2IXP A;  4CSA C;  2YHS A;  2WVN A;  3B9Q A;  3RYL A;  4OIO F;  3UGO A;  3EGX A;  3HLZ A;  3NYM A;  1RJ9 A;  3LLI A;  5EGY A;  3EZH A;  4AK9 A;  2NUP B;  3DM9 B;  3POV A;  1Z3I X;  3O39 A;  1Z23 A;  4XLP F;  2J0W A;  2WZL A;  4YT5 A;  1IZM A;  2H7O A;  2NUT B;  3TD7 A;  3EG9 A;  3GOD A;  3ABK C;  4BJ6 A;  1JPN A;  3JYH A;  3E70 C;  3T4R A;  4JVS A;  4BJ6 C;  1SF8 A;  2Y3D A;  1M2V A;  1SMY F;  2MYS A;  1OKK D;  1O5H A;  5IY5 C;  1G8X A;  2W4B A;  3DMD A;  4PJM A;  1D0Z A;  1WGW A;  3AG1 C;  3PHF 2;  2R7T A;  2EIN C;  3LEV A;  2VB6 A;  2G3K A;  4C3B A;  5FCL A;  4AE4 B;  2ZXO A;  5CI9 A;  3GAN A;  3NKD A;  3N2Z B;  2IXO A;  4O79 A;  3EZI A;  1TWC A;  4IAO A;  1M2O A;  4I1O B;  1ST6 A;  4Q4Z F;  3EGD A;  5D91 A;  3K33 A;  2FFH A;  3K1I C;  4LAC B;  4PJL A;  1LKX A;  1VOM A;  1BR2 A;  2A6E F;  4H4K C;  4EWC A;  5KYW A;  3UR3 C;  4OIQ F;  2J45 A;  2R7O A;  4G7H F;  4FX5 A;  2Z15 A;  2KGO A;  5E2Q A;  2PFD A;  2C04 A;  1FTS A;  4E7Z A;  2Q3T A;  4PJN A;  3K6B A;  4RDA A;  3NYJ A;  4YT4 A;  3Q7G A;  4N06 A;  1ZHY A;  2WZF A;  4KBL A;  1FMV A;  1D1C A;  4AX2 A;  3UMI A;  3JRT A;  4C3E A;  3Q6N A;  4JJG A;  3RKO F;  1ZHW A;  5HSW A;  2Y3B A;  4JW1 A;  1OCR C;  4JZA A;  4BJT A;  4PFO A;  2WB7 A;  3DZA A;  4X0R A;  4BJ5 A;  3K7D A;  3DJN B;  3MX3 A;  3Q6M A;  3LLK A;  3S29 A;  2ZXP A;  4B6I A;  3ZSU A;  1OCO C;  1N1C A;  5F5F A;  1O87 A;  2DYR C;  4XTK A;  2E87 A;  3S28 A;  5KYY B;  3OA1 A;  2JD3 A;  3EHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...