4K7BA

Crystal structure of extrinsic protein in photosystem ii
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
111
structure length
111
Chain Sequence
b'AVSSATINRARGLYGDRIAALKDAVAAGDFKAIAEEKNAFILFNSGAYPTNKAKKNAAIAQTNEIFKAIRSGDKAAVKSAYDAYMAANEIRPLPEINSNVGQGYSSEFDFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extrinsic protein in photosystem II
publication title Crystal Structure of Psb31, a Novel Extrinsic Protein of Photosystem II from a Marine Centric Diatom and Implications for Its Binding and Function
pubmed doi rcsb
source organism Chaetoceros gracilis
molecule tags Photosynthesis
total genus 41
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18240 PSII_Pbs31 Photosystem II Psb31 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1740 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4k7bA00
4K7BA
chains in the Genus database with same CATH superfamily
5E2QA 2NUTB 2R7RA 3JRMO 3N24A 1RMVA 3GORA 4MVQA 3RW0A 3B71A 4XEFA 4MTFA 1D0XA 1ZHYA 3OEOA 1TR2A 2QNLA 3QZCA 4IGGA 1LVKA 4JC7A 5COMA 3PDMP 1E2XA 2KQ9A 2ZD9A 1ST6A 2GFHA 3JT1A 2HSBA 3ZDLA 4LDRA 5BUOA 5CIVA 4KI2A 1W2WA 1M56C 2LK4A 3M79A 3EH1A 2YKZA 1VYIA 5DS4A 2XLDA 1H7IA 2DYRC 4BJ1A 1FFTC 5CI9A 3K66A 4KBLA 2PNOA 3A11A 1TFOB 2WZFA 2EPKX 3FHDA 2R7WA 2G3VA 3H65A 1Y4CA 1G4WR 4I1OB 4K0DA 3MLGA 2FGYA 2QY9A 3K6BA 3M15A 4U9EA 5L0HA 1QVXA 1N1CA 2EPMX 2EPLX 4ZLDA 2BL2A 3QVYA 1MMDA 2J9UA 3R2PA 5COFA 2JD3A 3BRJA 1U6HA 2NUPA 4MVSA 3W4YA 5L0JA 1V74B 2M4EA 2PX3A 1HMDA 3H2UA 1U0BB 3GEHA 3I5QA 4JTDB 4WGYA 2EPOA 1XZQA 3LEOA 3LLKA 2DI3A 4MW8A 4N4WA 4C3EA 2OEVA 3SXZA 1FTSA 2IXMA 4P9FA 1O87A 4MVRA 1YYXA 3RFYA 2YRFA 4MVOA 2F22A 3Q7LA 3FOOA 3OA1A 4KC9A 3SYNA 3K33A 1T6IA 5KYXA 1M57C 1LE4A 1IZMA 1G8XA 2XLVA 1A7DA 3L1MA 3DWWA 1Z3IX 2W45A 3C7JA 4YL3A 2OJQA 4HFKB 2NG1A 4CDAA 2KSFA 2J0WA 5D92A 2PP4A 2P0NA 3BEHA 4WABA 4I44A 4YL0A 3LJBA 1I4YA 4F4BA 1APCA 2R7QA 5T1DB 4QI0A 1WWPA 1HMOA 3DI5A 3G50A 2YL1A 1TKNA 1YJGA 4J30B 1VLSA 1YLMA 4XWJA 5FZTA 1FNTc 4U5GA 1KNYA 3U8PA 1HY5A 2YLDA 4NTFA 3O55A 1WTYA 5T3WA 3FXHA 3HNIA 2WVOA 1A7EA 4IAOA 4CX9A 4J7YA 4DJ9A 2Y3HA 2HJMA 2LSEA 3HNKA 3UMHA 2VCAA 2A0BA 1K05A 2RSEB 2PBEA 3U8VA 4CIPA 3FDQA 3US6A 4XPWA 1Z5ZA 3JYHA 1I4ZA 5JS5A 1MNEA 2H7BA 4U5BE 5L3QA 3ZWIA 3CSKA 3DJNB 1LIHA 4A2NB 3SEOA 5B3IA 3N0TA 5KYUB 1CPRA 4UDVA 1YZAA 3UGOA 4Q7CA 2HZ8A 4BJ6A 1QKRA 4MVMA 3TD7A 1OW6A 4OIRF 3A9CA 2P7VA 3O39A 3QW1A 3RIPA 1S7ZA 3U9MA 3U0CA 1M2VB 1HW2A 2ETSA 1GGQA 3EFOB 3M4BA 2H7OA 3X1OA 3JRTA 4PFPA 1BDJB 1MMNA 1TWAA 3W2WA 1MNDA 1RJ9B 1HE1A 4YN0B 3POVA 1O5HA 2UUHA 3L0IA 5JRAA 4G7OF 1RXQA 1GM5A 4WGZA 1WOLA 2Y39A 2KYHA 4J7TA 1Q0KA 2KNHA 4ZLCA 4J32B 4XTKA 3TJ6A 4E17A 2FFHA 5JT4A 2LIGA 4XPXA 2VC9A 1SR2A 2AU5A 2OCCC 2YLIA 5KYWA 2J9BA 1ZHTA 2PF4E 4G0HA 1TWGA 2DB4A 1TWHA 3AQBA 3L8IA 3WG7C 3S0XA 3S84A 4RBNA 4CJGA 4DXWA 3RQEA 4W8PA 3AJMA 1JPJA 2CYDA 3IHUA 3EG9A 3QMKA 4NCQA 4N6HA 3IQ6A 3K1IA 4H54A 2GAQA 5BQHA 3TJ5A 3W8IA 1ZVZA 5L0FA 3J06A 4U5CE 2AP3A 1TWCA 3G4XA 3HJCA 3TK0A 3LESA 3EH2A 3B0PA 3O6XA 4DBQA 3T4RA 3V5XA 1O3UA 3ECSA 1B68A 2ICWG 3JTLO 4GEHA 4U5DE 3KKBA 2KW3C 5TJ5E 1F1MA 1V55C 1J8YF 3S9OA 1A41A 2QUPA 3FVYA 3C63A 1FFHA 2R7VA 4FWVA 2L81A 3DM9B 3T6BA 4M63A 3GM3A 3QTHA 3TULA 2VCBA 2H7VC 1T6QA 3C8GB 3LS0A 3EGDA 3NG1A 4DRJB 1PCXA 1LI7A 2PFDA 2LD6A 1ZHWA 1C17M 2ZXWC 2R9RB 3ZQYA 1VMAA 5AC4A 3C8ZA 4OINF 4CDYA 3NDBB 3L34A 4PFOA 5KYUA 2YZSA 4D4NA 2ZXOA 3S90A 1YA7O 5K0IA 5JSLA 2XL6A 3EQLF 3PMRA 4E7SA 3JSZA 2X51A 2X0CA 3TQOA 3TOMA 1I5NA 1RKEB 3U3FA 2D4UA 5L0CA 3PHF2 3LNMB 2L6GA 4B6IA 4QDLA 4CBEA 2VASA 2H8AA 1YDIA 3HTKC 2ASRA 2IXOA 4CDVA 4BG0A 3SXMA 2Q9CA 4C7OA 4LLEA 4MVZA 1LM3B 5A6BA 2XSEA 4P9TA 1VK5A 3NYMA 2XS8A 2YLGA 2GDCA 2MYSA 1G4US 2YL0A 4G78A 4JJGA 3B29A 4EBKA 4EUKB 3ZVRA 2O9XA 1OXKA 5EHHA 2CCYA 3LAYA 4NTAA 3JCUQ 3G4ZA 3RVYA 1BZ4A 3IQCA 5DS6A 5A69A 1D1CA 3KYJA 2OQMA 4K7BA 2XRHA 4LERA 2VH3A 2Q7RA 3C62A 4IARA 1K04A 2OU6A 1QQ3A 2P6VA 3EPVA 3WAQA 1TQGA 2R7UA 2J9VA 4YT2A 3EGXA 1NU7D 3MYFA 2XLHA 4CIHA 2A1DD 2Y3DA 3DZAA 2DGJA 2L6FA 4JIOA 4YT8A 2EIJC 5DQTA 3T6JA 1LI5A 4R32A 4YWQA 2HS5A 3T9OA 2Y3BA 4OIQF 1HE9A 5B1BC 2Y3GA 3HNJA 4D4XA 3B9QA 1SMYF 3X2QC 1R4TA 2R05A 4YJWA 4O7GA 3W2VA 4DVYP 1KU2A 1BR2A 1V4AA 1HW1A 1PV3A 2C03A 2R7OA 3ASOC 1YZCA 4H4KC 4YT5A 2NUTA 1IW7F 1NZEA 3UR3C 4DVZA 2VCCA 2LFFA 1NSGB 4PK4A 3F47A 3UGPA 1MMAA 4JEAA 4P6IC 4PJJA 2YQYA 2WZLA 4U5HA 4RDAA 5DVWA 3V5ZA 3ZQVA 3JZ0A 4E0IA 1ZU4A 3ITFA 5E3CA 4O6MA 4K1OA 2A6EF 2MWQA 2R7XA 2QTVA 5DLJA 5JP7A 4FESA 2HSQA 3V7OA 3ZSUA 2R7TA 3KH2A 4YK5A 4BPMA 1SYQA 5KYYB 1NFNA 3IQ5A 4JKVA 3IPMO 3RKOF 1H9GA 1RKCA 3AQCA 2Z15A 4BJTA 1VOMA 4CSAC 2UUIA 4PR9A 1EA8A 1AUEA 3SXYA 5JLIA 2ZPAA 4OD5A 3K1HA 1WN0A 2L7AA 1GS9A 2J45A 3EHMA 5A6AA 2CDQA 1JOGA 4Z9IA 1CPQA 4DRHB 2E87A 2BE5F 2IOQA 2HKVA 1S05A 1Q0MA 2YHSA 1AEPA 4IAQA 3SXKA 3DE9A 1A7VA 2OJED 3KPHA 2XS1A 5FCLA 1JMWA 3GWLA 2IM8A 3FAPB 5A6BD 3C18A 1OW8A 3GEEA 3VF0A 1SZIA 5L0DA 4A4AA 1LE2A 2IBFA 4YL1A 2OKUA 4JTAB 2IYLD 4MTOA 1SF8A 2V3CC 1QSPA 2DYSC 4NY3A 3JYYA 1YA9A 2LCHA 3E9VA 5IY5C 3U5SA 4QI2A 1RCPA 1YVIA 3GM1A 2A68F 4NC3A 3HNLA 1J8MF 2XL4A 4XQ1A 2P1AA 5AGFA 1PD1A 3KMIA 1PD0A 4JCZA 1Y6DA 2YEVA 1OCRC 3HLZA 2WL8A 3CZ6A 3ASNC 1L7CA 1Z63A 3MBGA 3F46A 3AG2C 3V5YA 3GWNA 4PACA 2KC3A 4JVSA 2J7PA 4W8KA 4Z9JA 4GQHA 3T6GB 4DRIB 1A0BA 1QPUA 4XEKA 3VAYA 3DD7A 5HSWA 3NMKA 1D1AA 1CGME 3ZC4A 5JUAA 3WODF 1EQ1A 4ULVA 2J9WA 2L9JA 2HUJA 2NUPB 3S28A 1TFKB 1XWJA 4AE4B 2PX0A 1C02A 4Q4ZF 2A0UA 4JE9A 1Z6AA 3EZIA 1L3PA 1NBBA 1VYKA 2HMQA 4LDKA 2D5RB 3UNGC 3C8GD 4ONSA 1QLEC 2XL8A 1H6GA 1OR2A 3DE8A 2BC5A 2NPUA 4EWCA 3DM5A 1ORSC 1YYJA 1D0ZA 4ULWA 3SNHA 3CAXA 2OEXA 1ZU5A 5F5HA 1ZW3A 3E70C 1DOWA 1M2VA 3H2VA 3ZTZA 1ZW2A 3EFOA 3I4UA 3ABMC 1T9KA 3DMDA 2B0JA 4BEJA 1NU9C 2V26A 2IXNA 4WJ0A 3RQFA 3RVZA 4I1MA 1RJ9A 1WASA 4IRUA 3AG4C 3L8JA 4MVUA 1Q0DA 4PJLA 3B0UX 4OD4A 4U9DA 2TMVP 2YL3A 2HFIA 5EK0A 2QE9A 3W8HA 2I15A 1U89A 2HV7A 2J46A 1FMWA 5CI8A 4ER9A 1LS4A 2CW0F 4JRZA 4IWBA 5COGA 2HMZA 2HJ3A 3NMIA 4E7ZA 3VYWA 4Q5SF 5DS5A 3DKAA 1Z7Qc 1BR4A 4OIOF 4MQ9F 1XZPA 2W9YA 2XLWA 2G62A 1D0YA 2GA0A 2XLMA 4MTGA 1E85A 3VM6A 2W4MA 2G3KA 3MYIA 4AK9A 2Q00A 2EPNA 2Q4FA 3S27A 3U2MA 1E84A 1JPNA 2ZXRA 3AG3C 2OOCA 3O10A 3TOLA 3U2LA 4JW1A 4RD9A 1VLTA 4PJNA 1AVOB 1VTMP 2L6HA 1BR1A 1Q0FA 4MNDA 1OCOC 4JZAA 3RF3A 3UMIA 2JX0A 3NKEA 3GEIA 4CS9C 1H9TA 3JSEO 1ZZPA 4X0RA 4I3MA 5D91A 4CJOA 1CGOA 4O6YA 4LACB 3Q6NA 4Z9HA 3NYJA 3SP1A 3AOUA 5BQIA 3ATPA 4OIPF 4AE4A 5A6KA 2KJGA 4XEVA 1OKKD 1G5ZA 2J7PD 4HFFB 1R5ID 1OXBA 3C8GA 1LPEA 4MW3A 3KYIA 3EZHA 1JR8A 3GODA 4JEBA 4U5FE 2R7SA 2CNWA 5JVEA 1NLXA 4EHPA 3ABKC 3Q6MA 4N6CA 1T5OA 1JRAA 3HKKA 4BEMJ 5B1AC 2YWAA 4NTBA 4BJ6C 1ZHZA 2I8BA 3QW0A 5KYWB 4HEAJ 4IJJA 5EGYA 3IQTA 3Q7GA 3U9JA 1M2OA 1M6TA 1YARO 3ABLC 2RD9A 1CGNA 2NSGA 3EG9B 3N2ZB 2LFDA 3K7DA 1EI7A 1RKEA 3MX3A 2QLAA 4CS8C 5B3SC 4G7HF 1KTMA 4EBBA 3KL4A 3LLIA 1OCCC 1UG7A 2LQGA 2XXAB 1T6UA 3UMKA 5F5FA 3AG1C 2NSFA 3WHNA 4KNVA 1Q0GA 3M1CB 5DQZA 1K40A 1C03A 1GQAA 3LS1A 3ZIBA 3DXJF 3RYLA 4HE8D 4MS2A 3NKDA 3CQZA 2R25A 1ZYRF 2W4BA 4ANJA 3PCVA 4CS9A 4XLPF 2AVKA 3DAGA 1WATA 3ZTMA 4O79A 3GM2A 2WB7A 4C3DA 2EINC 4LLCA 2XM4A 1FR0A 1NFOA 4DBRA 1OQCA 2MHRA 2A69F 3EGDB 2XLEA 2KK1A 2J8WA 2B0HA 3ZG1A 4BJ5C 4CS7A 1OW7A 4E0HA 4EKWA 3K1IC 1E86A 1LS1A 5E33A 2LP4A 5GPGB 2R02A 2XLOA 2FAPB 5F28E 4C3BA 256BA 3RH3A 3U3BA 3FAJA 4NQFA 1Z23A 4FX5A 4IB4A 3EHNA 3MFNA 2JPUA 2Q9AA 3R7CA 1BBHA 2YVKA 4CS8A 3NYLA 3QVZA 4AL0A 2WVQA 5A6JA 4C7OB 4XLNF 2HV6A 2EILC 1QZXA 1OKKA 4CSAA 2KGOA 4JURI 2C04A 5L0GA 3DAFA 2WVNA 3IEEA 1NG1A 4JJFA 2R03A 3FOPA 4XPYA 3AGTA 1LKXA 3RQGA 4JCHA 4G7ZF 1FMVA 3I5PA 2M64A 2Y69C 1MMGA 1V54C 1ZHXA 2AWCA 2WZGA 3NRHA 2ZXPA 4YT4A 1JAFA 3VRCA 3OWTA 1VB5A 2IXPA 3LEVA 2XM0A 1ORJA 2GWWA 3EJNA 5HV9A 2Q3TA 5L3VA 2YL7A 1YAUO 3FMSA 3EGXB 4JTCB 5AC5A 5KYYA 1EKYA 1WGWA 2Q9BA 4BJ5A 4N06A 2J0XA 3GANA 3SZRA 4AL1A 4EBJA 2XXAA 4KNWA 2CNWD 3S29A 1OCZC 1DOVA 3LUTB 1ORYA 4U5EE 4PJMA 4E18A 3CEXA 4O6NA 5BQGA 5T3TA 4AX2A 5KYXB 4L6RA 1T01A 2A6HF 2CGEA 2VB6A 3AGUA 5KYNA 1D1BA 2P61A 1FAPB 4DOZA 3LNRA 1MQVA 3M4CA 3NMJA 5L0IA 2EIKC 3DJUB 2EIMC 2AWYA 4GYTA 5E3AA 2OG2A 4LDQA 4FAPB 1E83A 4EIYA 1OR3A 1UFBA 3B0VC
chains in the Genus database with same CATH topology
5E2QA 2NUTB 2R7RA 3N24A 1D0XA 1ZHYA 3OEOA 1TR2A 3QZCA 1LVKA 2KQ9A 3JT1A 1ST6A 2GFHA 5BUOA 4KI2A 1W2WA 1M56C 3EH1A 1VYIA 5DS4A 2DYRC 4BJ1A 1FFTC 5CI9A 3K66A 4KBLA 3FHDA 2WZFA 2R7WA 2G3VA 3H65A 4I1OB 4K0DA 3MLGA 2FGYA 3K6BA 1N1CA 4ZLDA 1MMDA 2J9UA 2JD3A 2NUPA 2M4EA 2PX3A 3I5QA 3LLKA 4C3EA 1FTSA 2IXMA 1O87A 3RFYA 3Q7LA 4KC9A 3OA1A 3SYNA 3K33A 5KYXA 1M57C 1IZMA 1G8XA 1Z3IX 2W45A 4HFKB 2NG1A 2J0WA 5D92A 2PP4A 4I44A 4F4BA 3LJBA 2R7QA 5T1DB 4QI0A 1TKNA 4J30B 4XWJA 4U5GA 5T3WA 2WVOA 4IAOA 2Y3HA 2LSEA 3UMHA 3FDQA 1Z5ZA 3JYHA 1MNEA 2H7BA 4U5BE 5L3QA 3CSKA 3DJNB 4A2NB 3SEOA 3N0TA 5KYUB 3UGOA 4Q7CA 4BJ6A 3TD7A 3RIPA 4OIRF 2P7VA 3O39A 1S7ZA 1M2VB 3EFOB 2H7OA 3X1OA 3JRTA 4PFPA 1MMNA 1TWAA 3W2WA 1MNDA 1RJ9B 4YN0B 3POVA 1O5HA 3L0IA 2Y39A 2KNHA 4ZLCA 4J32B 4XTKA 2FFHA 2OCCC 5KYWA 1ZHTA 2PF4E 4G0HA 1TWGA 1TWHA 3AQBA 3WG7C 3S0XA 4RBNA 1JPJA 3EG9A 3QMKA 3W8IA 4U5CE 1TWCA 3HJCA 3LESA 3EH2A 3B0PA 3O6XA 4DBQA 3T4RA 3ECSA 4GEHA 4U5DE 3KKBA 2KW3C 1V55C 1J8YF 3FVYA 1FFHA 2R7VA 4FWVA 2L81A 3DM9B 3T6BA 4M63A 2H7VC 3LS0A 3EGDA 3NG1A 1PCXA 2PFDA 1ZHWA 2ZXWC 1VMAA 4OINF 3NDBB 3L34A 4PFOA 5KYUA 2YZSA 2ZXOA 3EQLF 3PMRA 4E7SA 3JSZA 2X51A 3PHF2 4B6IA 4QDLA 4CBEA 2VASA 3HTKC 2IXOA 4BG0A 2Q9CA 4C7OA 4LLEA 2XSEA 1VK5A 3NYMA 2MYSA 4JJGA 3ZVRA 2O9XA 5EHHA 3LAYA 3JCUQ 5DS6A 1D1CA 4K7BA 2XRHA 4LERA 2VH3A 3EPVA 2P6VA 2R7UA 2J9VA 4YT2A 3EGXA 1NU7D 4CIHA 2A1DD 2Y3DA 3DZAA 2DGJA 4YT8A 2EIJC 5DQTA 3T6JA 4YWQA 2Y3BA 4OIQF 5B1BC 2Y3GA 3B9QA 1SMYF 3X2QC 4YJWA 4O7GA 3W2VA 4DVYP 1KU2A 1BR2A 2C03A 2R7OA 4H4KC 3ASOC 4YT5A 3UR3C 2NUTA 4DVZA 1IW7F 1NZEA 4PK4A 3F47A 3UGPA 1MMAA 4P6IC 4PJJA 2WZLA 4U5HA 4RDAA 5DVWA 1ZU4A 3ITFA 5E3CA 4O6MA 2A6EF 2MWQA 2R7XA 2QTVA 5DLJA 4FESA 3V7OA 3ZSUA 2R7TA 3KH2A 5KYYB 3RKOF 3AQCA 2Z15A 4BJTA 1VOMA 4CSAC 2ZPAA 4OD5A 3K1HA 2J45A 3EHMA 2CDQA 2E87A 2BE5F 2IOQA 2YHSA 5FCLA 1SZIA 2IYLD 1SF8A 2V3CC 2DYSC 4NY3A 5IY5C 3E9VA 4QI2A 2A68F 1J8MF 2XL4A 1PD1A 3KMIA 1PD0A 3HLZA 2YEVA 1OCRC 2WL8A 3CZ6A 3ASNC 1Z63A 3F46A 3AG2C 4JVSA 2J7PA 4W8KA 3VAYA 3DD7A 5HSWA 1D1AA 3ZC4A 3WODF 2J9WA 2L9JA 2NUPB 3S28A 4AE4B 2PX0A 4Q4ZF 1Z6AA 3EZIA 1VYKA 3UNGC 2D5RB 1QLEC 4EWCA 3DM5A 1D0ZA 4ULWA 3SNHA 1ZU5A 5F5HA 3E70C 1M2VA 3EFOA 3I4UA 3ABMC 3DMDA 2B0JA 4BEJA 1NU9C 2V26A 2IXNA 4WJ0A 4I1MA 1RJ9A 4IRUA 3AG4C 4PJLA 3B0UX 4OD4A 3W8HA 5CI8A 2HV7A 2J46A 1FMWA 2CW0F 4IWBA 4E7ZA 3VYWA 4Q5SF 5DS5A 1BR4A 4OIOF 4MQ9F 2W9YA 2G62A 1D0YA 2W4MA 2G3KA 4AK9A 3S27A 1JPNA 2ZXRA 3AG3C 4JW1A 4RD9A 4PJNA 1BR1A 4MNDA 3UMIA 1OCOC 4JZAA 3NKEA 4CS9C 4X0RA 5D91A 4I3MA 4O6YA 4LACB 3Q6NA 3NYJA 3SP1A 4OIPF 4AE4A 2KJGA 1OKKD 2J7PD 4HFFB 4U5FE 3EZHA 3GODA 2R7SA 2CNWA 3ABKC 3Q6MA 5KYWB 5B1AC 4BJ6C 1ZHZA 2I8BA 4HEAJ 4IJJA 5EGYA 3Q7GA 1M2OA 3ABLC 3N2ZB 3EG9B 4CS8C 3K7DA 3MX3A 5B3SC 4G7HF 4EBBA 3KL4A 3LLIA 1OCCC 2XXAB 3UMKA 5F5FA 3AG1C 4KNVA 5DQZA 3M1CB 3LS1A 3ZIBA 3DXJF 3RYLA 4HE8D 3NKDA 3CQZA 1ZYRF 2W4BA 4ANJA 4CS9A 4XLPF 3DAGA 4O79A 2WB7A 4C3DA 2EINC 4LLCA 4DBRA 2A69F 3EGDB 3ZG1A 4BJ5C 4CS7A 3K1IC 1LS1A 5E33A 4C3BA 3RH3A 3FAJA 1Z23A 4FX5A 4CS8A 3EHNA 4G7OF 2Q9AA 3NYLA 2WVQA 4C7OB 4XLNF 2HV6A 2EILC 1QZXA 1OKKA 4CSAA 2KGOA 4JURI 2C04A 3DAFA 2WVNA 3IEEA 1NG1A 4JJFA 1LKXA 4JCHA 4G7ZF 1FMVA 3I5PA 2Y69C 1MMGA 1V54C 1ZHXA 3NRHA 2WZGA 4YT4A 2ZXPA 3OWTA 2IXPA 3LEVA 5L3VA 3EJNA 2Q3TA 3EGXB 5KYYA 1WGWA 2Q9BA 4BJ5A 4N06A 2J0XA 3GANA 3SZRA 2XXAA 4KNWA 2CNWD 3S29A 1OCZC 4U5EE 4PJMA 4O6NA 5T3TA 4AX2A 5KYXB 2A6HF 2CGEA 2VB6A 5KYNA 1D1BA 4DOZA 3LNRA 2EIKC 3DJUB 2EIMC 4GYTA 5E3AA 2OG2A 2QY9A 3B0VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7B A; 
#chains in the Genus database with same CATH topology
 5E2Q A;  2NUT B;  2R7R A;  3JRM O;  3N24 A;  1RMV A;  3GOR A;  4MVQ A;  3RW0 A;  3B71 A;  4XEF A;  4MTF A;  1D0X A;  1ZHY A;  3OEO A;  1TR2 A;  2QNL A;  3QZC A;  4IGG A;  1LVK A;  4JC7 A;  5COM A;  3PDM P;  1E2X A;  2KQ9 A;  2ZD9 A;  1ST6 A;  2GFH A;  3JT1 A;  2HSB A;  3ZDL A;  4LDR A;  5BUO A;  5CIV A;  4KI2 A;  1W2W A;  1M56 C;  2LK4 A;  3M79 A;  3EH1 A;  2YKZ A;  1VYI A;  5DS4 A;  2XLD A;  1H7I A;  2DYR C;  4BJ1 A;  1FFT C;  5CI9 A;  3K66 A;  4KBL A;  2PNO A;  3A11 A;  1TFO B;  2WZF A;  2EPK X;  3FHD A;  2R7W A;  2G3V A;  3H65 A;  1Y4C A;  1G4W R;  4I1O B;  4K0D A;  3MLG A;  2FGY A;  2QY9 A;  3K6B A;  3M15 A;  4U9E A;  5L0H A;  1QVX A;  1N1C A;  2EPM X;  2EPL X;  4ZLD A;  2BL2 A;  3QVY A;  1MMD A;  2J9U A;  3R2P A;  5COF A;  2JD3 A;  3BRJ A;  1U6H A;  2NUP A;  4MVS A;  3W4Y A;  5L0J A;  1V74 B;  2M4E A;  2PX3 A;  1HMD A;  3H2U A;  1U0B B;  3GEH A;  3I5Q A;  4JTD B;  4WGY A;  2EPO A;  1XZQ A;  3LEO A;  3LLK A;  2DI3 A;  4MW8 A;  4N4W A;  4C3E A;  2OEV A;  3SXZ A;  1FTS A;  2IXM A;  4P9F A;  1O87 A;  4MVR A;  1YYX A;  3RFY A;  2YRF A;  4MVO A;  2F22 A;  3Q7L A;  3FOO A;  3OA1 A;  4KC9 A;  3SYN A;  3K33 A;  1T6I A;  5KYX A;  1M57 C;  1LE4 A;  1IZM A;  1G8X A;  2XLV A;  1A7D A;  3L1M A;  3DWW A;  1Z3I X;  2W45 A;  3C7J A;  4YL3 A;  2OJQ A;  4HFK B;  2NG1 A;  4CDA A;  2KSF A;  2J0W A;  5D92 A;  2PP4 A;  2P0N A;  3BEH A;  4WAB A;  4I44 A;  4YL0 A;  3LJB A;  1I4Y A;  4F4B A;  1APC A;  2R7Q A;  5T1D B;  4QI0 A;  1WWP A;  1HMO A;  3DI5 A;  3G50 A;  2YL1 A;  1TKN A;  1YJG A;  4J30 B;  1VLS A;  1YLM A;  4XWJ A;  5FZT A;  1FNT c;  4U5G A;  1KNY A;  3U8P A;  1HY5 A;  2YLD A;  4NTF A;  3O55 A;  1WTY A;  5T3W A;  3FXH A;  3HNI A;  2WVO A;  1A7E A;  4IAO A;  4CX9 A;  4J7Y A;  4DJ9 A;  2Y3H A;  2HJM A;  2LSE A;  3HNK A;  3UMH A;  2VCA A;  2A0B A;  1K05 A;  2RSE B;  2PBE A;  3U8V A;  4CIP A;  3FDQ A;  3US6 A;  4XPW A;  1Z5Z A;  3JYH A;  1I4Z A;  5JS5 A;  1MNE A;  2H7B A;  4U5B E;  5L3Q A;  3ZWI A;  3CSK A;  3DJN B;  1LIH A;  4A2N B;  3SEO A;  5B3I A;  3N0T A;  5KYU B;  1CPR A;  4UDV A;  1YZA A;  3UGO A;  4Q7C A;  2HZ8 A;  4BJ6 A;  1QKR A;  4MVM A;  3TD7 A;  1OW6 A;  4OIR F;  3A9C A;  2P7V A;  3O39 A;  3QW1 A;  3RIP A;  1S7Z A;  3U9M A;  3U0C A;  1M2V B;  1HW2 A;  2ETS A;  1GGQ A;  3EFO B;  3M4B A;  2H7O A;  3X1O A;  3JRT A;  4PFP A;  1BDJ B;  1MMN A;  1TWA A;  3W2W A;  1MND A;  1RJ9 B;  1HE1 A;  4YN0 B;  3POV A;  1O5H A;  2UUH A;  3L0I A;  5JRA A;  4G7O F;  1RXQ A;  1GM5 A;  4WGZ A;  1WOL A;  2Y39 A;  2KYH A;  4J7T A;  1Q0K A;  2KNH A;  4ZLC A;  4J32 B;  4XTK A;  3TJ6 A;  4E17 A;  2FFH A;  5JT4 A;  2LIG A;  4XPX A;  2VC9 A;  1SR2 A;  2AU5 A;  2OCC C;  2YLI A;  5KYW A;  2J9B A;  1ZHT A;  2PF4 E;  4G0H A;  1TWG A;  2DB4 A;  1TWH A;  3AQB A;  3L8I A;  3WG7 C;  3S0X A;  3S84 A;  4RBN A;  4CJG A;  4DXW A;  3RQE A;  4W8P A;  3AJM A;  1JPJ A;  2CYD A;  3IHU A;  3EG9 A;  3QMK A;  4NCQ A;  4N6H A;  3IQ6 A;  3K1I A;  4H54 A;  2GAQ A;  5BQH A;  3TJ5 A;  3W8I A;  1ZVZ A;  5L0F A;  3J06 A;  4U5C E;  2AP3 A;  1TWC A;  3G4X A;  3HJC A;  3TK0 A;  3LES A;  3EH2 A;  3B0P A;  3O6X A;  4DBQ A;  3T4R A;  3V5X A;  1O3U A;  3ECS A;  1B68 A;  2ICW G;  3JTL O;  4GEH A;  4U5D E;  3KKB A;  2KW3 C;  5TJ5 E;  1F1M A;  1V55 C;  1J8Y F;  3S9O A;  1A41 A;  2QUP A;  3FVY A;  3C63 A;  1FFH A;  2R7V A;  4FWV A;  2L81 A;  3DM9 B;  3T6B A;  4M63 A;  3GM3 A;  3QTH A;  3TUL A;  2VCB A;  2H7V C;  1T6Q A;  3C8G B;  3LS0 A;  3EGD A;  3NG1 A;  4DRJ B;  1PCX A;  1LI7 A;  2PFD A;  2LD6 A;  1ZHW A;  1C17 M;  2ZXW C;  2R9R B;  3ZQY A;  1VMA A;  5AC4 A;  3C8Z A;  4OIN F;  4CDY A;  3NDB B;  3L34 A;  4PFO A;  5KYU A;  2YZS A;  4D4N A;  2ZXO A;  3S90 A;  1YA7 O;  5K0I A;  5JSL A;  2XL6 A;  3EQL F;  3PMR A;  4E7S A;  3JSZ A;  2X51 A;  2X0C A;  3TQO A;  3TOM A;  1I5N A;  1RKE B;  3U3F A;  2D4U A;  5L0C A;  3PHF 2;  3LNM B;  2L6G A;  4B6I A;  4QDL A;  4CBE A;  2VAS A;  2H8A A;  1YDI A;  3HTK C;  2ASR A;  2IXO A;  4CDV A;  4BG0 A;  3SXM A;  2Q9C A;  4C7O A;  4LLE A;  4MVZ A;  1LM3 B;  5A6B A;  2XSE A;  4P9T A;  1VK5 A;  3NYM A;  2XS8 A;  2YLG A;  2GDC A;  2MYS A;  1G4U S;  2YL0 A;  4G78 A;  4JJG A;  3B29 A;  4EBK A;  4EUK B;  3ZVR A;  2O9X A;  1OXK A;  5EHH A;  2CCY A;  3LAY A;  4NTA A;  3JCU Q;  3G4Z A;  3RVY A;  1BZ4 A;  3IQC A;  5DS6 A;  5A69 A;  1D1C A;  3KYJ A;  2OQM A;  4K7B A;  2XRH A;  4LER A;  2VH3 A;  2Q7R A;  3C62 A;  4IAR A;  1K04 A;  2OU6 A;  1QQ3 A;  2P6V A;  3EPV A;  3WAQ A;  1TQG A;  2R7U A;  2J9V A;  4YT2 A;  3EGX A;  1NU7 D;  3MYF A;  2XLH A;  4CIH A;  2A1D D;  2Y3D A;  3DZA A;  2DGJ A;  2L6F A;  4JIO A;  4YT8 A;  2EIJ C;  5DQT A;  3T6J A;  1LI5 A;  4R32 A;  4YWQ A;  2HS5 A;  3T9O A;  2Y3B A;  4OIQ F;  1HE9 A;  5B1B C;  2Y3G A;  3HNJ A;  4D4X A;  3B9Q A;  1SMY F;  3X2Q C;  1R4T A;  2R05 A;  4YJW A;  4O7G A;  3W2V A;  4DVY P;  1KU2 A;  1BR2 A;  1V4A A;  1HW1 A;  1PV3 A;  2C03 A;  2R7O A;  3ASO C;  1YZC A;  4H4K C;  4YT5 A;  2NUT A;  1IW7 F;  1NZE A;  3UR3 C;  4DVZ A;  2VCC A;  2LFF A;  1NSG B;  4PK4 A;  3F47 A;  3UGP A;  1MMA A;  4JEA A;  4P6I C;  4PJJ A;  2YQY A;  2WZL A;  4U5H A;  4RDA A;  5DVW A;  3V5Z A;  3ZQV A;  3JZ0 A;  4E0I A;  1ZU4 A;  3ITF A;  5E3C A;  4O6M A;  4K1O A;  2A6E F;  2MWQ A;  2R7X A;  2QTV A;  5DLJ A;  5JP7 A;  4FES A;  2HSQ A;  3V7O A;  3ZSU A;  2R7T A;  3KH2 A;  4YK5 A;  4BPM A;  1SYQ A;  5KYY B;  1NFN A;  3IQ5 A;  4JKV A;  3IPM O;  3RKO F;  1H9G A;  1RKC A;  3AQC A;  2Z15 A;  4BJT A;  1VOM A;  4CSA C;  2UUI A;  4PR9 A;  1EA8 A;  1AUE A;  3SXY A;  5JLI A;  2ZPA A;  4OD5 A;  3K1H A;  1WN0 A;  2L7A A;  1GS9 A;  2J45 A;  3EHM A;  5A6A A;  2CDQ A;  1JOG A;  4Z9I A;  1CPQ A;  4DRH B;  2E87 A;  2BE5 F;  2IOQ A;  2HKV A;  1S05 A;  1Q0M A;  2YHS A;  1AEP A;  4IAQ A;  3SXK A;  3DE9 A;  1A7V A;  2OJE D;  3KPH A;  2XS1 A;  5FCL A;  1JMW A;  3GWL A;  2IM8 A;  3FAP B;  5A6B D;  3C18 A;  1OW8 A;  3GEE A;  3VF0 A;  1SZI A;  5L0D A;  4A4A A;  1LE2 A;  2IBF A;  4YL1 A;  2OKU A;  4JTA B;  2IYL D;  4MTO A;  1SF8 A;  2V3C C;  1QSP A;  2DYS C;  4NY3 A;  3JYY A;  1YA9 A;  2LCH A;  3E9V A;  5IY5 C;  3U5S A;  4QI2 A;  1RCP A;  1YVI A;  3GM1 A;  2A68 F;  4NC3 A;  3HNL A;  1J8M F;  2XL4 A;  4XQ1 A;  2P1A A;  5AGF A;  1PD1 A;  3KMI A;  1PD0 A;  4JCZ A;  1Y6D A;  2YEV A;  1OCR C;  3HLZ A;  2WL8 A;  3CZ6 A;  3ASN C;  1L7C A;  1Z63 A;  3MBG A;  3F46 A;  3AG2 C;  3V5Y A;  3GWN A;  4PAC A;  2KC3 A;  4JVS A;  2J7P A;  4W8K A;  4Z9J A;  4GQH A;  3T6G B;  4DRI B;  1A0B A;  1QPU A;  4XEK A;  3VAY A;  3DD7 A;  5HSW A;  3NMK A;  1D1A A;  1CGM E;  3ZC4 A;  5JUA A;  3WOD F;  1EQ1 A;  4ULV A;  2J9W A;  2L9J A;  2HUJ A;  2NUP B;  3S28 A;  1TFK B;  1XWJ A;  4AE4 B;  2PX0 A;  1C02 A;  4Q4Z F;  2A0U A;  4JE9 A;  1Z6A A;  3EZI A;  1L3P A;  1NBB A;  1VYK A;  2HMQ A;  4LDK A;  2D5R B;  3UNG C;  3C8G D;  4ONS A;  1QLE C;  2XL8 A;  1H6G A;  1OR2 A;  3DE8 A;  2BC5 A;  2NPU A;  4EWC A;  3DM5 A;  1ORS C;  1YYJ A;  1D0Z A;  4ULW A;  3SNH A;  3CAX A;  2OEX A;  1ZU5 A;  5F5H A;  1ZW3 A;  3E70 C;  1DOW A;  1M2V A;  3H2V A;  3ZTZ A;  1ZW2 A;  3EFO A;  3I4U A;  3ABM C;  1T9K A;  3DMD A;  2B0J A;  4BEJ A;  1NU9 C;  2V26 A;  2IXN A;  4WJ0 A;  3RQF A;  3RVZ A;  4I1M A;  1RJ9 A;  1WAS A;  4IRU A;  3AG4 C;  3L8J A;  4MVU A;  1Q0D A;  4PJL A;  3B0U X;  4OD4 A;  4U9D A;  2TMV P;  2YL3 A;  2HFI A;  5EK0 A;  2QE9 A;  3W8H A;  2I15 A;  1U89 A;  2HV7 A;  2J46 A;  1FMW A;  5CI8 A;  4ER9 A;  1LS4 A;  2CW0 F;  4JRZ A;  4IWB A;  5COG A;  2HMZ A;  2HJ3 A;  3NMI A;  4E7Z A;  3VYW A;  4Q5S F;  5DS5 A;  3DKA A;  1Z7Q c;  1BR4 A;  4OIO F;  4MQ9 F;  1XZP A;  2W9Y A;  2XLW A;  2G62 A;  1D0Y A;  2GA0 A;  2XLM A;  4MTG A;  1E85 A;  3VM6 A;  2W4M A;  2G3K A;  3MYI A;  4AK9 A;  2Q00 A;  2EPN A;  2Q4F A;  3S27 A;  3U2M A;  1E84 A;  1JPN A;  2ZXR A;  3AG3 C;  2OOC A;  3O10 A;  3TOL A;  3U2L A;  4JW1 A;  4RD9 A;  1VLT A;  4PJN A;  1AVO B;  1VTM P;  2L6H A;  1BR1 A;  1Q0F A;  4MND A;  1OCO C;  4JZA A;  3RF3 A;  3UMI A;  2JX0 A;  3NKE A;  3GEI A;  4CS9 C;  1H9T A;  3JSE O;  1ZZP A;  4X0R A;  4I3M A;  5D91 A;  4CJO A;  1CGO A;  4O6Y A;  4LAC B;  3Q6N A;  4Z9H A;  3NYJ A;  3SP1 A;  3AOU A;  5BQI A;  3ATP A;  4OIP F;  4AE4 A;  5A6K A;  2KJG A;  4XEV A;  1OKK D;  1G5Z A;  2J7P D;  4HFF B;  1R5I D;  1OXB A;  3C8G A;  1LPE A;  4MW3 A;  3KYI A;  3EZH A;  1JR8 A;  3GOD A;  4JEB A;  4U5F E;  2R7S A;  2CNW A;  5JVE A;  1NLX A;  4EHP A;  3ABK C;  3Q6M A;  4N6C A;  1T5O A;  1JRA A;  3HKK A;  4BEM J;  5B1A C;  2YWA A;  4NTB A;  4BJ6 C;  1ZHZ A;  2I8B A;  3QW0 A;  5KYW B;  4HEA J;  4IJJ A;  5EGY A;  3IQT A;  3Q7G A;  3U9J A;  1M2O A;  1M6T A;  1YAR O;  3ABL C;  2RD9 A;  1CGN A;  2NSG A;  3EG9 B;  3N2Z B;  2LFD A;  3K7D A;  1EI7 A;  1RKE A;  3MX3 A;  2QLA A;  4CS8 C;  5B3S C;  4G7H F;  1KTM A;  4EBB A;  3KL4 A;  3LLI A;  1OCC C;  1UG7 A;  2LQG A;  2XXA B;  1T6U A;  3UMK A;  5F5F A;  3AG1 C;  2NSF A;  3WHN A;  4KNV A;  1Q0G A;  3M1C B;  5DQZ A;  1K40 A;  1C03 A;  1GQA A;  3LS1 A;  3ZIB A;  3DXJ F;  3RYL A;  4HE8 D;  4MS2 A;  3NKD A;  3CQZ A;  2R25 A;  1ZYR F;  2W4B A;  4ANJ A;  3PCV A;  4CS9 A;  4XLP F;  2AVK A;  3DAG A;  1WAT A;  3ZTM A;  4O79 A;  3GM2 A;  2WB7 A;  4C3D A;  2EIN C;  4LLC A;  2XM4 A;  1FR0 A;  1NFO A;  4DBR A;  1OQC A;  2MHR A;  2A69 F;  3EGD B;  2XLE A;  2KK1 A;  2J8W A;  2B0H A;  3ZG1 A;  4BJ5 C;  4CS7 A;  1OW7 A;  4E0H A;  4EKW A;  3K1I C;  1E86 A;  1LS1 A;  5E33 A;  2LP4 A;  5GPG B;  2R02 A;  2XLO A;  2FAP B;  5F28 E;  4C3B A;  256B A;  3RH3 A;  3U3B A;  3FAJ A;  4NQF A;  1Z23 A;  4FX5 A;  4IB4 A;  3EHN A;  3MFN A;  2JPU A;  2Q9A A;  3R7C A;  1BBH A;  2YVK A;  4CS8 A;  3NYL A;  3QVZ A;  4AL0 A;  2WVQ A;  5A6J A;  4C7O B;  4XLN F;  2HV6 A;  2EIL C;  1QZX A;  1OKK A;  4CSA A;  2KGO A;  4JUR I;  2C04 A;  5L0G A;  3DAF A;  2WVN A;  3IEE A;  1NG1 A;  4JJF A;  2R03 A;  3FOP A;  4XPY A;  3AGT A;  1LKX A;  3RQG A;  4JCH A;  4G7Z F;  1FMV A;  3I5P A;  2M64 A;  2Y69 C;  1MMG A;  1V54 C;  1ZHX A;  2AWC A;  2WZG A;  3NRH A;  2ZXP A;  4YT4 A;  1JAF A;  3VRC A;  3OWT A;  1VB5 A;  2IXP A;  3LEV A;  2XM0 A;  1ORJ A;  2GWW A;  3EJN A;  5HV9 A;  2Q3T A;  5L3V A;  2YL7 A;  1YAU O;  3FMS A;  3EGX B;  4JTC B;  5AC5 A;  5KYY A;  1EKY A;  1WGW A;  2Q9B A;  4BJ5 A;  4N06 A;  2J0X A;  3GAN A;  3SZR A;  4AL1 A;  4EBJ A;  2XXA A;  4KNW A;  2CNW D;  3S29 A;  1OCZ C;  1DOV A;  3LUT B;  1ORY A;  4U5E E;  4PJM A;  4E18 A;  3CEX A;  4O6N A;  5BQG A;  5T3T A;  4AX2 A;  5KYX B;  4L6R A;  1T01 A;  2A6H F;  2CGE A;  2VB6 A;  3AGU A;  5KYN A;  1D1B A;  2P61 A;  1FAP B;  4DOZ A;  3LNR A;  1MQV A;  3M4C A;  3NMJ A;  5L0I A;  2EIK C;  3DJU B;  2EIM C;  2AWY A;  4GYT A;  5E3A A;  2OG2 A;  4LDQ A;  4FAP B;  1E83 A;  4EIY A;  1OR3 A;  1UFB A;  3B0V C; 
#chains in the Genus database with same CATH homology
 5E2Q A;  2NUT B;  2R7R A;  3N24 A;  1D0X A;  1ZHY A;  3OEO A;  1TR2 A;  3QZC A;  1LVK A;  2KQ9 A;  3JT1 A;  1ST6 A;  2GFH A;  5BUO A;  4KI2 A;  1W2W A;  1M56 C;  3EH1 A;  1VYI A;  5DS4 A;  2DYR C;  4BJ1 A;  1FFT C;  5CI9 A;  3K66 A;  4KBL A;  3FHD A;  2WZF A;  2R7W A;  2G3V A;  3H65 A;  4I1O B;  4K0D A;  3MLG A;  2FGY A;  3K6B A;  1N1C A;  4ZLD A;  1MMD A;  2J9U A;  2JD3 A;  2NUP A;  2M4E A;  2PX3 A;  3I5Q A;  3LLK A;  4C3E A;  1FTS A;  2IXM A;  1O87 A;  3RFY A;  3Q7L A;  4KC9 A;  3OA1 A;  3SYN A;  3K33 A;  5KYX A;  1M57 C;  1IZM A;  1G8X A;  1Z3I X;  2W45 A;  4HFK B;  2NG1 A;  2J0W A;  5D92 A;  2PP4 A;  4I44 A;  4F4B A;  3LJB A;  2R7Q A;  5T1D B;  4QI0 A;  1TKN A;  4J30 B;  4XWJ A;  4U5G A;  5T3W A;  2WVO A;  4IAO A;  2Y3H A;  2LSE A;  3UMH A;  3FDQ A;  1Z5Z A;  3JYH A;  1MNE A;  2H7B A;  4U5B E;  5L3Q A;  3CSK A;  3DJN B;  4A2N B;  3SEO A;  3N0T A;  5KYU B;  3UGO A;  4Q7C A;  4BJ6 A;  3TD7 A;  3RIP A;  4OIR F;  2P7V A;  3O39 A;  1S7Z A;  1M2V B;  3EFO B;  2H7O A;  3X1O A;  3JRT A;  4PFP A;  1MMN A;  1TWA A;  3W2W A;  1MND A;  1RJ9 B;  4YN0 B;  3POV A;  1O5H A;  3L0I A;  2Y39 A;  2KNH A;  4ZLC A;  4J32 B;  4XTK A;  2FFH A;  2OCC C;  5KYW A;  1ZHT A;  2PF4 E;  4G0H A;  1TWG A;  1TWH A;  3AQB A;  3WG7 C;  3S0X A;  4RBN A;  1JPJ A;  3EG9 A;  3QMK A;  3W8I A;  4U5C E;  1TWC A;  3HJC A;  3LES A;  3EH2 A;  3B0P A;  3O6X A;  4DBQ A;  3T4R A;  3ECS A;  4GEH A;  4U5D E;  3KKB A;  2KW3 C;  1V55 C;  1J8Y F;  3FVY A;  1FFH A;  2R7V A;  4FWV A;  2L81 A;  3DM9 B;  3T6B A;  4M63 A;  2H7V C;  3LS0 A;  3EGD A;  3NG1 A;  1PCX A;  2PFD A;  1ZHW A;  2ZXW C;  1VMA A;  4OIN F;  3NDB B;  3L34 A;  4PFO A;  5KYU A;  2YZS A;  2ZXO A;  3EQL F;  3PMR A;  4E7S A;  3JSZ A;  2X51 A;  3PHF 2;  4B6I A;  4QDL A;  4CBE A;  2VAS A;  3HTK C;  2IXO A;  4BG0 A;  2Q9C A;  4C7O A;  4LLE A;  2XSE A;  1VK5 A;  3NYM A;  2MYS A;  4JJG A;  3ZVR A;  2O9X A;  5EHH A;  3LAY A;  3JCU Q;  5DS6 A;  1D1C A;  4K7B A;  2XRH A;  4LER A;  2VH3 A;  3EPV A;  2P6V A;  2R7U A;  2J9V A;  4YT2 A;  3EGX A;  1NU7 D;  4CIH A;  2A1D D;  2Y3D A;  3DZA A;  2DGJ A;  4YT8 A;  2EIJ C;  5DQT A;  3T6J A;  4YWQ A;  2Y3B A;  4OIQ F;  5B1B C;  2Y3G A;  3B9Q A;  1SMY F;  3X2Q C;  4YJW A;  4O7G A;  3W2V A;  4DVY P;  1KU2 A;  1BR2 A;  2C03 A;  2R7O A;  4H4K C;  3ASO C;  4YT5 A;  3UR3 C;  2NUT A;  4DVZ A;  1IW7 F;  1NZE A;  4PK4 A;  3F47 A;  3UGP A;  1MMA A;  4P6I C;  4PJJ A;  2WZL A;  4U5H A;  4RDA A;  5DVW A;  1ZU4 A;  3ITF A;  5E3C A;  4O6M A;  2A6E F;  2MWQ A;  2R7X A;  2QTV A;  5DLJ A;  4FES A;  3V7O A;  3ZSU A;  2R7T A;  3KH2 A;  5KYY B;  3RKO F;  3AQC A;  2Z15 A;  4BJT A;  1VOM A;  4CSA C;  2ZPA A;  4OD5 A;  3K1H A;  2J45 A;  3EHM A;  2CDQ A;  2E87 A;  2BE5 F;  2IOQ A;  2YHS A;  5FCL A;  1SZI A;  2IYL D;  1SF8 A;  2V3C C;  2DYS C;  4NY3 A;  5IY5 C;  3E9V A;  4QI2 A;  2A68 F;  1J8M F;  2XL4 A;  1PD1 A;  3KMI A;  1PD0 A;  3HLZ A;  2YEV A;  1OCR C;  2WL8 A;  3CZ6 A;  3ASN C;  1Z63 A;  3F46 A;  3AG2 C;  4JVS A;  2J7P A;  4W8K A;  3VAY A;  3DD7 A;  5HSW A;  1D1A A;  3ZC4 A;  3WOD F;  2J9W A;  2L9J A;  2NUP B;  3S28 A;  4AE4 B;  2PX0 A;  4Q4Z F;  1Z6A A;  3EZI A;  1VYK A;  3UNG C;  2D5R B;  1QLE C;  4EWC A;  3DM5 A;  1D0Z A;  4ULW A;  3SNH A;  1ZU5 A;  5F5H A;  3E70 C;  1M2V A;  3EFO A;  3I4U A;  3ABM C;  3DMD A;  2B0J A;  4BEJ A;  1NU9 C;  2V26 A;  2IXN A;  4WJ0 A;  4I1M A;  1RJ9 A;  4IRU A;  3AG4 C;  4PJL A;  3B0U X;  4OD4 A;  3W8H A;  5CI8 A;  2HV7 A;  2J46 A;  1FMW A;  2CW0 F;  4IWB A;  4E7Z A;  3VYW A;  4Q5S F;  5DS5 A;  1BR4 A;  4OIO F;  4MQ9 F;  2W9Y A;  2G62 A;  1D0Y A;  2W4M A;  2G3K A;  4AK9 A;  3S27 A;  1JPN A;  2ZXR A;  3AG3 C;  4JW1 A;  4RD9 A;  4PJN A;  1BR1 A;  4MND A;  3UMI A;  1OCO C;  4JZA A;  3NKE A;  4CS9 C;  4X0R A;  5D91 A;  4I3M A;  4O6Y A;  4LAC B;  3Q6N A;  3NYJ A;  3SP1 A;  4OIP F;  4AE4 A;  2KJG A;  1OKK D;  2J7P D;  4HFF B;  4U5F E;  3EZH A;  3GOD A;  2R7S A;  2CNW A;  3ABK C;  3Q6M A;  5KYW B;  5B1A C;  4BJ6 C;  1ZHZ A;  2I8B A;  4HEA J;  4IJJ A;  5EGY A;  3Q7G A;  1M2O A;  3ABL C;  3N2Z B;  3EG9 B;  4CS8 C;  3K7D A;  3MX3 A;  5B3S C;  4G7H F;  4EBB A;  3KL4 A;  3LLI A;  1OCC C;  2XXA B;  3UMK A;  5F5F A;  3AG1 C;  4KNV A;  5DQZ A;  3M1C B;  3LS1 A;  3ZIB A;  3DXJ F;  3RYL A;  4HE8 D;  3NKD A;  3CQZ A;  1ZYR F;  2W4B A;  4ANJ A;  4CS9 A;  4XLP F;  3DAG A;  4O79 A;  2WB7 A;  4C3D A;  2EIN C;  4LLC A;  4DBR A;  2A69 F;  3EGD B;  3ZG1 A;  4BJ5 C;  4CS7 A;  3K1I C;  1LS1 A;  5E33 A;  4C3B A;  3RH3 A;  3FAJ A;  1Z23 A;  4FX5 A;  4CS8 A;  3EHN A;  4G7O F;  2Q9A A;  3NYL A;  2WVQ A;  4C7O B;  4XLN F;  2HV6 A;  2EIL C;  1QZX A;  1OKK A;  4CSA A;  2KGO A;  4JUR I;  2C04 A;  3DAF A;  2WVN A;  3IEE A;  1NG1 A;  4JJF A;  1LKX A;  4JCH A;  4G7Z F;  1FMV A;  3I5P A;  2Y69 C;  1MMG A;  1V54 C;  1ZHX A;  3NRH A;  2WZG A;  4YT4 A;  2ZXP A;  3OWT A;  2IXP A;  3LEV A;  5L3V A;  3EJN A;  2Q3T A;  3EGX B;  5KYY A;  1WGW A;  2Q9B A;  4BJ5 A;  4N06 A;  2J0X A;  3GAN A;  3SZR A;  2XXA A;  4KNW A;  2CNW D;  3S29 A;  1OCZ C;  4U5E E;  4PJM A;  4O6N A;  5T3T A;  4AX2 A;  5KYX B;  2A6H F;  2CGE A;  2VB6 A;  5KYN A;  1D1B A;  4DOZ A;  3LNR A;  2EIK C;  3DJU B;  2EIM C;  4GYT A;  5E3A A;  2OG2 A;  2QY9 A;  3B0V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...