3DZAA

Crystal structure of a putative membrane protein of unknown function (yfdx) from klebsiella pneumoniae subsp. at 1.65 a resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
180
structure length
180
Chain Sequence
APAAAATTQVQKEAADVLQVAVQGANAMRDIQFARLALFHGQPDSAKKLTDDAAALLAADDASWAKFVKTDAKAKMIADRYVIINASIALSEDYVATPEKESAIQSANEKLAKGDQKGAIDTLRLAGIGVIENQYLMPLNQTRKAVAQSQELLKAGKYYEANLVLKGAEEGIVVDSEMLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized putative membrane protein
publication title Crystal structure of putative membrane protein of unknown function (YP_001337144.1) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 1.65 A resolution
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
molecule tags Unknown function
total genus 66
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10938 YfdX YfdX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1940 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dzaA01
3DZAA
chains in the Genus database with same CATH superfamily
2NPUA 1CPQA 3FOPA 2W4MA 1R5ID 2QNLA 3EZHA 3FOOA 4CIPA 3JCUQ 2I15A 3O39A 3K6BA 5DS4A 1M2VB 4JVSA 4U9DA 1WATA 5A69A 1G4WR 2P0NA 1O5HA 3AOUA 3C8GA 3DI5A 2D5RB 2H7VC 1M56C 4KBLA 3RQGA 3KMIA 3LNMB 1WWPA 3ZC4A 2XS8A 4FWVA 4MTGA 2NSGA 1F1MA 3ZQYA 4UDVA 1T6UA 3V5XA 1T5OA 2Q9BA 1HY5A 3C7JA 2QLAA 4X0RA 3SZRA 2XLEA 2E87A 2KC3A 3HLZA 2YHSA 4CSAA 2YKZA 4OIOF 3UR3C 4MW8A 1TWCA 2XL4A 2EIMC 4C7OB 3H2VA 2YL7A 1GGQA 4CS8C 5E3CA 4EKWA 1WGWA 2XRHA 4XEKA 1M6TA 1MQVA 3T6BA 4J32B 4WABA 3AG3C 4JE9A 5T3TA 3J06A 4XPWA 1ZHYA 4E18A 2I8BA 3HTKC 3JYHA 2XS1A 4CDYA 2J8WA 1QVXA 3DM9B 4YL0A 2Q9AA 2NUPB 1LS1A 1NFNA 2Y3HA 3GWNA 4I1OB 1DOVA 1WN0A 1TWHA 4JRZA 3U3BA 2L81A 3VYWA 4MW3A 1J8YF 1FMVA 2JPUA 3TOMA 4NTAA 2R7OA 1OXBA 4CBEA 2R7SA 2YLDA 4JKVA 1OKKD 1YA9A 2PBEA 4PJMA 2GFHA 2MWQA 1QSPA 4W8KA 2CNWD 5FZTA 4CX9A 1A7EA 2PX3A 4C7OA 5DLJA 4HFKB 2LK4A 3A11A 3GEEA 3BEHA 1YAUO 4FESA 2EIJC 4MVOA 5B1AC 3S29A 3PDMP 4U5CE 4BJ1A 1Y6DA 2NSFA 3RVZA 4DVZA 1EKYA 1TWGA 4G78A 5A6KA 2Y3BA 1E2XA 2X51A 1LI7A 3LLKA 1SR2A 4O6NA 2HV7A 3WHNA 4ZLDA 4EWCA 2NUPA 2EPKX 2Q00A 1ZW2A 1O3UA 2L6HA 3LEVA 3LUTB 2NG1A 3I5PA 4JTAB 4WJ0A 5TJ5E 4PFOA 2OEXA 5F28E 3RQFA 4XLNF 1VMAA 4I3MA 4IAOA 2KNHA 2OJED 3U8PA 1A41A 2Y39A 2PX0A 3KKBA 2Y69C 3CAXA 1ZHTA 4WGYA 3ZWIA 4A2NB 4CS9C 2KGOA 4KNWA 1YZAA 3E70C 1KU2A 2J9BA 2LP4A 2YVKA 3NKDA 1Z3IX 4XPYA 3B29A 2R7XA 2HJMA 4OINF 1TFKB 4N6CA 4XTKA 4ZLCA 1Z63A 1V55C 4P9FA 4C3DA 3L34A 4RD9A 4OIRF 3S28A 4LACB 1MNEA 3SXZA 5JVEA 2J7PD 2PNOA 3US6A 2FGYA 1ZHZA 4U9EA 3DE8A 2P1AA 4R32A 4MQ9F 3S84A 3PHF2 2X0CA 4H4KC 2IXMA 1K05A 3DAFA 4FX5A 4JEAA 3WODF 1EQ1A 1SYQA 1H9GA 1OQCA 2AVKA 2Q4FA 3ZVRA 4M63A 3QZCA 4CS9A 5JT4A 4GYTA 4IRUA 5KYWB 4J7YA 3SP1A 3KYJA 2ZXOA 1A7DA 2OG2A 1RCPA 5CI9A 3TQOA 1C03A 4HFFB 3L8JA 3S27A 2R7TA 1I5NA 2LQGA 4YT8A 2ICWG 1JR8A 3C18A 2Q3TA 1LIHA 1SMYF 1JOGA 2KQ9A 5L0CA 3FDQA 3OA1A 3C62A 1APCA 3VM6A 5L3QA 1D0ZA 1Z23A 3L0IA 3WG7C 4JC7A 1MMAA 3JT1A 1EA8A 3QVYA 2LFFA 3QW1A 4Q5SF 2HMZA 5L0IA 3ABKC 2GA0A 1D1CA 1IZMA 2DI3A 4DRJB 4DXWA 4P9TA 2LSEA 1JRAA 1CGME 3ITFA 1AUEA 3LEOA 1OW8A 2QE9A 2R02A 1ZU4A 2OU6A 4YT5A 1LVKA 3CEXA 2A0UA 3UNGC 4J30B 5E3AA 4NTFA 3NMIA 2GWWA 5A6JA 3GEIA 1PV3A 4Q7CA 5L0HA 1HE9A 1Q0KA 2AU5A 2CW0F 3IQTA 4JIOA 2W45A 4MVQA 4NY3A 4U5EE 5COFA 4J7TA 2L6FA 3SYNA 3EHNA 4E7ZA 3V7OA 3L8IA 3LAYA 4MTOA 3MBGA 4BJ6A 1NSGB 2XLWA 2V3CC 1JMWA 2R7RA 4CSAC 2B0HA 2EIKC 4EBJA 4ANJA 4K1OA 3DWWA 2J0XA 5EHHA 1L7CA 4K0DA 3T6GB 3IEEA 1ZHXA 2NUTB 3C8GD 1C17M 4DRHB 5D91A 4ER9A 2VCAA 3CZ6A 3ZSUA 2P6VA 4PJLA 3T9OA 2L7AA 3Q7GA 1FFTC 3CQZA 3DJUB 2VCCA 2HSBA 5B3IA 4E17A 3VF0A 1BR2A 1CPRA 4EIYA 1NG1A 3IPMO 1HMDA 2OJQA 4A4AA 3U9JA 1FFHA 3MX3A 3NKEA 3LLIA 3QTHA 4PJJA 3N24A 5COGA 2Z15A 3GORA 1YLMA 2KJGA 4OD5A 1JAFA 4DBRA 3JRMO 3PCVA 3W2WA 3CSKA 2KK1A 2Q9CA 2Y3DA 3I5QA 1V74B 3G50A 4AL1A 4G7ZF 1FAPB 2DB4A 2WVNA 3ECSA 1GM5A 1NU7D 3DMDA 1BZ4A 1H6GA 4ULWA 1A0BA 1XZPA 2M64A 2NUTA 3U3FA 5EGYA 2DYSC 3JTLO 2Q7RA 2MHRA 2YZSA 4DBQA 5BQHA 4N6HA 1MMDA 2C03A 4FAPB 5HV9A 2XM4A 4QDLA 3ABMC 3DD7A 1U0BB 1YYJA 4Z9JA 1RKEB 2W9YA 2YL3A 4YN0B 1ZU5A 3IHUA 2C04A 4MTFA 1Q0FA 5E2QA 5JP7A 2ZPAA 3ZTMA 4YJWA 4Z9HA 4O6MA 2TMVP 1TQGA 1C02A 4NQFA 2F22A 2WVOA 2FAPB 3O10A 2R25A 2J9WA 2L6GA 3AG4C 1T9KA 1WOLA 2EPNA 2H7BA 2GAQA 2IXNA 2R9RB 2ASRA 3FAJA 5BUOA 1OCZC 3RW0A 2H7OA 5DQZA 3TOLA 1LM3B 4U5HA 3EH1A 3EPVA 4ONSA 2WVQA 1Q0GA 3LS1A 5F5HA 3I4UA 1OXKA 4IARA 3OEOA 2J45A 4AE4A 2L9JA 2Y3GA 1RKEA 3LESA 4G7HF 2XSEA 2WZFA 1VYKA 3W2VA 3DKAA 2XLMA 3GWLA 3IQ6A 2HS5A 4U5BE 3VAYA 5BQGA 2HJ3A 1OKKA 3VRCA 5L0JA 1N1CA 3TD7A 1T6IA 2CNWA 4U5FE 4JTDB 256BA 3TK0A 2A0BA 4YT2A 3EHMA 1OW6A 3JSZA 4JCHA 4O7GA 3B0UX 1ORJA 2PFDA 3MYFA 4E0IA 4PR9A 5CIVA 3TJ5A 1AVOB 1NFOA 4U5GA 5L0DA 2AP3A 2YL0A 1ORSC 4I1MA 3MYIA 4MVSA 3EJNA 3RH3A 3K1HA 3M4CA 2ZXPA 1J8MF 3DAGA 3JRTA 1PD1A 3T6JA 1ZYRF 4XEVA 4C3EA 1FNTc 3S0XA 3EFOB 4JURI 2GDCA 2CDQA 2LD6A 1Z5ZA 4NCQA 1R4TA 2YQYA 4AX2A 1E86A 1HMOA 2B0JA 1MNDA 3V5YA 3GM2A 5L0GA 3M4BA 4DRIB 1TWAA 1ZVZA 1XZQA 4EBKA 1TR2A 3B71A 4PFPA 4ULVA 3SNHA 3WAQA 2A6HF 4RDAA 5JRAA 2JX0A 4Z9IA 3AG1C 3POVA 3G4XA 2VB6A 5L0FA 3NYMA 2J7PA 5DS5A 1GS9A 1LE4A 1T6QA 2MYSA 1HW2A 1T01A 3MFNA 1VOMA 1OW7A 2AWCA 3JSEO 2J0WA 4WGZA 1V54C 5BQIA 4E0HA 3EFOA 3FMSA 4BJ6C 3F46A 4AK9A 5A6BA 3IQCA 3AGTA 3E9VA 4CJOA 2R03A 4D4NA 3RFYA 2A69F 1ZW3A 3DE9A 4QI0A 2IBFA 4L6RA 1LKXA 2UUHA 3W8HA 4MVRA 2JD3A 1TFOB 4BJ5A 2OKUA 1FMWA 3DXJF 1E85A 2WL8A 2R7UA 4O6YA 1I4YA 5AGFA 2YWAA 2WB7A 1HW1A 3SXKA 3GODA 3RVYA 2J9VA 2R7WA 2EPLX 3Q7LA 1CGNA 3UGPA 3U2MA 1WTYA 2BE5F 2KYHA 1TKNA 1UG7A 2P61A 2BL2A 3DJNB 2XM0A 1OR2A 1M57C 4F4BA 2QUPA 1G8XA 2J9UA 3SXYA 3UGOA 3GEHA 2ZD9A 4B6IA 4G0HA 3FVYA 5T3WA 1YJGA 5KYNA 1OR3A 3LNRA 3HNJA 3R2PA 4YWQA 5DVWA 4LLCA 4U5DE 3AGUA 3B0PA 3KL4A 3QMKA 4BEMJ 2KW3C 3EG9B 2HFIA 3HNKA 4RBNA 4W8PA 1Z7Qc 1B68A 4OIPF 3W4YA 2OQMA 3QW0A 4PK4A 1QQ3A 4BJTA 3MLGA 2A1DD 2QY9A 3TULA 1LE2A 4MNDA 2OEVA 5AC4A 4YL3A 2D4UA 2AWYA 4NTBA 2WZLA 2ETSA 3TJ6A 1QPUA 4DOZA 4IWBA 2P7VA 1RMVA 2IXOA 3NG1A 3UMIA 3JZ0A 1Y4CA 1D0XA 1NZEA 1U89A 4IGGA 4LDQA 1YVIA 4CS7A 3EH2A 2ZXWC 1GQAA 4JJFA 2IOQA 3KYIA 4NC3A 1S7ZA 5KYXB 1FR0A 4MVZA 3EG9A 2XL8A 4AE4B 2RSEB 1K04A 4EUKB 2YLIA 3H2UA 5A6AA 4CDVA 1DOWA 2FFHA 1NBBA 2CYDA 1CGOA 2LIGA 3EGXB 1RXQA 3W8IA 5KYUB 1RJ9A 3RQEA 1D1BA 3M15A 1KNYA 2HV6A 2IYLD 4DJ9A 1UFBA 3BRJA 3KH2A 4LDRA 1G4US 3N2ZB 4MVUA 3L1MA 3SXMA 2XXAB 4KI2A 1M2VA 5F5FA 5L3VA 3V5ZA 3M1CB 1G5ZA 4PJNA 3NRHA 1JPJA 3B0VC 1QZXA 3ABLC 3AQBA 1YYXA 3AG2C 3K33A 5K0IA 4P6IC 5FCLA 1D0YA 1VK5A 1BR1A 1PCXA 1V4AA 1M2OA 5EK0A 5KYXA 1E84A 4KC9A 3K1IC 1IW7F 1Q0DA 2LCHA 3DZAA 2A6EF 3N0TA 2ZXRA 4N06A 4YT4A 4Q4ZF 2W4BA 1NLXA 1O87A 2PP4A 2QTVA 4C3BA 1SF8A 4IJJA 3GM1A 2G3KA 2G3VA 5KYUA 3EGXA 3Q6NA 1LS4A 3EGDB 3ASOC 4CS8A 4JCZA 2YEVA 4CIHA 2RD9A 2R7QA 4D4XA 3U8VA 5JS5A 5GPGB 3FHDA 2XXAA 3GM3A 3RF3A 5KYYB 4IAQA 3U0CA 1BBHA 1MMNA 1I4ZA 3ZTZA 3ZIBA 3LS0A 5COMA 4LERA 3U9MA 3X2QC 4EBBA 4LLEA 3U5SA 3S90A 3NMKA 3RYLA 3K1IA 1Z6AA 4CDAA 4YL1A 3LJBA 3NDBB 1L3PA 4JW1A 4LDKA 4JJGA 1ORYA 5T1DB 1K40A 1KTMA 2PF4E 4OD4A 3QVZA 4XWJA 4DVYP 1ZZPA 2DYRC 3DM5A 4HEAJ 5IY5C 3RKOF 3T4RA 3EGDA 3ZDLA 2HUJA 2WZGA 1PD0A 2HKVA 1VYIA 3GANA 3K66A 3M79A 1Q0MA 4YK5A 3R7CA 3FXHA 2CCYA 2XLOA 1YARO 2R7VA 4BPMA 3SEOA 1D1AA 1QLEC 5KYYA 1U6HA 5DQTA 2DGJA 4BJ5C 4XPXA 3ZQVA 3F47A 4K7BA 1RKCA 3HNIA 3O55A 1XWJA 1YA7O 1LPEA 2V26A 2HSQA 2G62A 3NMJA 4JZAA 2YRFA 1FTSA 3H65A 1LI5A 1ZHWA 3NYJA 4I44A 4OIQF 2XLDA 5A6BD 1OCCC 1VLTA 3FAPB 4E7SA 4MVMA 3IQ5A 1E83A 1QKRA 3RIPA 2EINC 3C63A 3OWTA 4PACA 4XLPF 2EILC 3AJMA 1WASA 3G4ZA 5JUAA 3HJCA 4G7OF 5JSLA 3X1OA 1VTMP 1EI7A 2BC5A 4JEBA 1YDIA 1VLSA 4N4WA 3UMHA 2O9XA 2A68F 2HZ8A 1BR4A 1SZIA 3NYLA 4GQHA 2EPMX 4GEHA 4CJGA 3ASNC 2LFDA 1BDJB 3K7DA 2R05A 1H9TA 2CGEA 1OCRC 3C8ZA 1ST6A 1W2WA 3U2LA 5B3SC 4QI2A 2IXPA 1YZCA 3ZG1A 1NU9C 1VB5A 2KSFA 2J46A 5D92A 4XQ1A 4BG0A 4BEJA 1JPNA 3Q6MA 4O79A 4KNVA 3ATPA 1H7IA 5HSWA 1HE1A 2YLGA 3EQLF 5KYWA 2XL6A 1MMGA 5E33A 4XEFA 5JLIA 2VH3A 3C8GB 3PMRA 4IB4A 4H54A 2M4EA 2IM8A 3HNLA 3UMKA 3KPHA 1A7VA 1S05A 3B9QA 3S9OA 1OCOC 2H8AA 2OOCA 3AQCA 5CI8A 5DS6A 5AC5A 3JYYA 2VC9A 2HMQA 5B1BC 4AL0A 2OCCC 2VASA 3O6XA 4MS2A 2XLHA 4EHPA 2YL1A 3A9CA 3HKKA 1AEPA 2XLVA 4JTCB 4HE8D 2UUIA 3EZIA 1RJ9B 2VCBA 2EPOA
chains in the Genus database with same CATH topology
2W4MA 3EZHA 3JCUQ 3O39A 3K6BA 5DS4A 1M2VB 4JVSA 1O5HA 4KBLA 2D5RB 2H7VC 1M56C 3KMIA 3ZC4A 4FWVA 2Q9BA 4X0RA 3SZRA 4OIOF 2E87A 3HLZA 2YHSA 4CSAA 3UR3C 1TWCA 2XL4A 2EIMC 4C7OB 4CS8C 5E3CA 1WGWA 2XRHA 3T6BA 4J32B 3AG3C 5T3TA 1ZHYA 2I8BA 3HTKC 3JYHA 3DM9B 2Q9AA 2NUPB 1LS1A 2Y3HA 4I1OB 3VYWA 1TWHA 2L81A 1J8YF 1FMVA 2R7OA 4CBEA 2R7SA 4PJMA 1OKKD 2GFHA 2MWQA 4W8KA 2CNWD 2PX3A 4C7OA 5DLJA 4HFKB 5B1AC 4FESA 2EIJC 3S29A 4U5CE 4BJ1A 4DVZA 1TWGA 2R7VA 2Y3BA 2X51A 3LLKA 4O6NA 2HV7A 4ZLDA 4EWCA 2NUPA 3LEVA 2NG1A 3I5PA 4WJ0A 4PFOA 4XLNF 1VMAA 4I3MA 4IAOA 2KNHA 2Y39A 2PX0A 3KKBA 2Y69C 4A2NB 1ZHTA 4CS9C 2KGOA 4KNWA 3E70C 1KU2A 3NKDA 1Z3IX 2R7XA 4OINF 4XTKA 4ZLCA 1Z63A 1V55C 4C3DA 3L34A 4RD9A 4OIRF 3S28A 4LACB 1MNEA 2J7PD 2FGYA 1ZHZA 4MQ9F 3PHF2 4H4KC 2IXMA 3DAFA 4FX5A 3WODF 3ZVRA 4M63A 3QZCA 4CS9A 4GYTA 4IRUA 5KYWB 3SP1A 2ZXOA 5CI9A 2OG2A 4HFFB 3S27A 2R7TA 4YT8A 3FDQA 2Q3TA 1SMYF 2KQ9A 3OA1A 5L3QA 1D0ZA 1Z23A 3L0IA 3WG7C 1MMAA 3JT1A 4Q5SF 3ABKC 1D1CA 1IZMA 2LSEA 3ITFA 1ZU4A 4YT5A 1LVKA 3UNGC 4J30B 5E3AA 4Q7CA 2CW0F 4NY3A 2W45A 4U5EE 3SYNA 3EHNA 4E7ZA 3V7OA 3LAYA 4BJ6A 2V3CC 2R7RA 4CSAC 2EIKC 4ANJA 2J0XA 5EHHA 4K0DA 3IEEA 1ZHXA 2NUTB 5D91A 3CZ6A 3ZSUA 2P6VA 4PJLA 3Q7GA 1FFTC 3CQZA 3DJUB 1BR2A 1NG1A 1FFHA 3MX3A 3NKEA 3LLIA 4PJJA 3N24A 2Z15A 2KJGA 4OD5A 4DBRA 3W2WA 3CSKA 2Q9CA 2Y3DA 3I5QA 4G7ZF 2WVNA 3ECSA 1NU7D 3DMDA 4ULWA 2NUTA 5EGYA 2DYSC 2YZSA 4DBQA 1MMDA 2C03A 4QDLA 3ABMC 3DD7A 2W9YA 4YN0B 1ZU5A 2C04A 5E2QA 2ZPAA 4YJWA 4O6MA 2WVOA 2J9WA 3AG4C 2H7BA 2IXNA 3FAJA 5BUOA 1OCZC 2H7OA 5DQZA 4U5HA 3EH1A 3EPVA 5F5HA 2WVQA 3LS1A 3I4UA 3OEOA 2J45A 4AE4A 2L9JA 2Y3GA 3LESA 4G7HF 2XSEA 2WZFA 1VYKA 3W2VA 4U5BE 3VAYA 1OKKA 1N1CA 3TD7A 2CNWA 4U5FE 4YT2A 3EHMA 3JSZA 4JCHA 4O7GA 2PFDA 4U5GA 4I1MA 3EJNA 3RH3A 3K1HA 2ZXPA 1J8MF 3DAGA 3JRTA 1PD1A 3T6JA 1ZYRF 4C3EA 3S0XA 3EFOB 4JURI 2CDQA 1Z5ZA 4AX2A 2B0JA 1MNDA 1TWAA 1TR2A 4PFPA 3SNHA 2A6HF 4RDAA 3AG1C 3POVA 2VB6A 3NYMA 2J7PA 5DS5A 2MYSA 1VOMA 2J0WA 1V54C 3EFOA 4BJ6C 3F46A 4AK9A 3E9VA 3RFYA 2A69F 4QI0A 1LKXA 3W8HA 2JD3A 4BJ5A 1FMWA 3DXJF 2WL8A 2R7UA 4O6YA 2WB7A 3GODA 2J9VA 2R7WA 3Q7LA 3UGPA 2BE5F 1TKNA 3DJNB 1M57C 4F4BA 1G8XA 2J9UA 3UGOA 4B6IA 4G0HA 3FVYA 5T3WA 5KYNA 3LNRA 4YWQA 5DVWA 4LLCA 4U5DE 3KL4A 3B0PA 3QMKA 2KW3C 3EG9B 4RBNA 4OIPF 4PK4A 4BJTA 3MLGA 2A1DD 2QY9A 4MNDA 2WZLA 4DOZA 4IWBA 2P7VA 2IXOA 3NG1A 3UMIA 1D0XA 1NZEA 4CS7A 3EH2A 2ZXWC 4JJFA 2IOQA 5KYXB 1S7ZA 3EG9A 4AE4B 2FFHA 3W8IA 5KYUB 3EGXB 1RJ9A 1D1BA 2HV6A 2IYLD 3KH2A 3N2ZB 2XXAB 4KI2A 1M2VA 5F5FA 5L3VA 3M1CB 4PJNA 3NRHA 1JPJA 3B0VC 1QZXA 3ABLC 3AQBA 3K33A 3AG2C 4P6IC 5FCLA 1D0YA 1VK5A 1BR1A 1PCXA 5KYXA 1M2OA 4KC9A 3K1IC 1IW7F 4N06A 3B0UX 3DZAA 2A6EF 3N0TA 2ZXRA 4YT4A 4Q4ZF 2W4BA 1O87A 2PP4A 2QTVA 4C3BA 1SF8A 4IJJA 2G3KA 2G3VA 5KYUA 3EGXA 3Q6NA 3EGDB 3ASOC 4CS8A 4CIHA 2YEVA 2R7QA 3FHDA 2XXAA 5KYYB 1MMNA 3ZIBA 3LS0A 4LERA 3X2QC 4EBBA 4LLEA 3RYLA 1Z6AA 3LJBA 3NDBB 4JW1A 4JJGA 5T1DB 2PF4E 4OD4A 4XWJA 4DVYP 2DYRC 5IY5C 3DM5A 4HEAJ 3RKOF 3T4RA 3EGDA 2WZGA 1PD0A 3GANA 1VYIA 3K66A 3SEOA 1D1AA 1QLEC 5KYYA 5DQTA 2DGJA 4BJ5C 3F47A 4K7BA 2V26A 4JZAA 2G62A 1FTSA 3H65A 1ZHWA 3NYJA 4I44A 4OIQF 1OCCC 4E7SA 3RIPA 2EINC 3OWTA 4XLPF 2EILC 4G7OF 3HJCA 3X1OA 3UMHA 2O9XA 2A68F 1BR4A 1SZIA 3NYLA 4GEHA 3ASNC 3K7DA 2CGEA 1OCRC 1ST6A 1W2WA 5B3SC 4QI2A 2IXPA 3ZG1A 1NU9C 2J46A 5D92A 4BEJA 4BG0A 1JPNA 3Q6MA 4O79A 4KNVA 5HSWA 3EQLF 5KYWA 1MMGA 5E33A 2VH3A 3PMRA 2M4EA 3UMKA 3B9QA 1OCOC 3AQCA 5CI8A 5DS6A 5B1BC 2OCCC 2VASA 3O6XA 4HE8D 3EZIA 1RJ9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DZA A; 
#chains in the Genus database with same CATH topology
 2NPU A;  1CPQ A;  3FOP A;  2W4M A;  1R5I D;  2QNL A;  3EZH A;  3FOO A;  4CIP A;  3JCU Q;  2I15 A;  3O39 A;  3K6B A;  5DS4 A;  1M2V B;  4JVS A;  4U9D A;  1WAT A;  5A69 A;  1G4W R;  2P0N A;  1O5H A;  3AOU A;  3C8G A;  3DI5 A;  2D5R B;  2H7V C;  1M56 C;  4KBL A;  3RQG A;  3KMI A;  3LNM B;  1WWP A;  3ZC4 A;  2XS8 A;  4FWV A;  4MTG A;  2NSG A;  1F1M A;  3ZQY A;  4UDV A;  1T6U A;  3V5X A;  1T5O A;  2Q9B A;  1HY5 A;  3C7J A;  2QLA A;  4X0R A;  3SZR A;  2XLE A;  2E87 A;  2KC3 A;  3HLZ A;  2YHS A;  4CSA A;  2YKZ A;  4OIO F;  3UR3 C;  4MW8 A;  1TWC A;  2XL4 A;  2EIM C;  4C7O B;  3H2V A;  2YL7 A;  1GGQ A;  4CS8 C;  5E3C A;  4EKW A;  1WGW A;  2XRH A;  4XEK A;  1M6T A;  1MQV A;  3T6B A;  4J32 B;  4WAB A;  3AG3 C;  4JE9 A;  5T3T A;  3J06 A;  4XPW A;  1ZHY A;  4E18 A;  2I8B A;  3HTK C;  3JYH A;  2XS1 A;  4CDY A;  2J8W A;  1QVX A;  3DM9 B;  4YL0 A;  2Q9A A;  2NUP B;  1LS1 A;  1NFN A;  2Y3H A;  3GWN A;  4I1O B;  1DOV A;  1WN0 A;  1TWH A;  4JRZ A;  3U3B A;  2L81 A;  3VYW A;  4MW3 A;  1J8Y F;  1FMV A;  2JPU A;  3TOM A;  4NTA A;  2R7O A;  1OXB A;  4CBE A;  2R7S A;  2YLD A;  4JKV A;  1OKK D;  1YA9 A;  2PBE A;  4PJM A;  2GFH A;  2MWQ A;  1QSP A;  4W8K A;  2CNW D;  5FZT A;  4CX9 A;  1A7E A;  2PX3 A;  4C7O A;  5DLJ A;  4HFK B;  2LK4 A;  3A11 A;  3GEE A;  3BEH A;  1YAU O;  4FES A;  2EIJ C;  4MVO A;  5B1A C;  3S29 A;  3PDM P;  4U5C E;  4BJ1 A;  1Y6D A;  2NSF A;  3RVZ A;  4DVZ A;  1EKY A;  1TWG A;  4G78 A;  5A6K A;  2Y3B A;  1E2X A;  2X51 A;  1LI7 A;  3LLK A;  1SR2 A;  4O6N A;  2HV7 A;  3WHN A;  4ZLD A;  4EWC A;  2NUP A;  2EPK X;  2Q00 A;  1ZW2 A;  1O3U A;  2L6H A;  3LEV A;  3LUT B;  2NG1 A;  3I5P A;  4JTA B;  4WJ0 A;  5TJ5 E;  4PFO A;  2OEX A;  5F28 E;  3RQF A;  4XLN F;  1VMA A;  4I3M A;  4IAO A;  2KNH A;  2OJE D;  3U8P A;  1A41 A;  2Y39 A;  2PX0 A;  3KKB A;  2Y69 C;  3CAX A;  1ZHT A;  4WGY A;  3ZWI A;  4A2N B;  4CS9 C;  2KGO A;  4KNW A;  1YZA A;  3E70 C;  1KU2 A;  2J9B A;  2LP4 A;  2YVK A;  3NKD A;  1Z3I X;  4XPY A;  3B29 A;  2R7X A;  2HJM A;  4OIN F;  1TFK B;  4N6C A;  4XTK A;  4ZLC A;  1Z63 A;  1V55 C;  4P9F A;  4C3D A;  3L34 A;  4RD9 A;  4OIR F;  3S28 A;  4LAC B;  1MNE A;  3SXZ A;  5JVE A;  2J7P D;  2PNO A;  3US6 A;  2FGY A;  1ZHZ A;  4U9E A;  3DE8 A;  2P1A A;  4R32 A;  4MQ9 F;  3S84 A;  3PHF 2;  2X0C A;  4H4K C;  2IXM A;  1K05 A;  3DAF A;  4FX5 A;  4JEA A;  3WOD F;  1EQ1 A;  1SYQ A;  1H9G A;  1OQC A;  2AVK A;  2Q4F A;  3ZVR A;  4M63 A;  3QZC A;  4CS9 A;  5JT4 A;  4GYT A;  4IRU A;  5KYW B;  4J7Y A;  3SP1 A;  3KYJ A;  2ZXO A;  1A7D A;  2OG2 A;  1RCP A;  5CI9 A;  3TQO A;  1C03 A;  4HFF B;  3L8J A;  3S27 A;  2R7T A;  1I5N A;  2LQG A;  4YT8 A;  2ICW G;  1JR8 A;  3C18 A;  2Q3T A;  1LIH A;  1SMY F;  1JOG A;  2KQ9 A;  5L0C A;  3FDQ A;  3OA1 A;  3C62 A;  1APC A;  3VM6 A;  5L3Q A;  1D0Z A;  1Z23 A;  3L0I A;  3WG7 C;  4JC7 A;  1MMA A;  3JT1 A;  1EA8 A;  3QVY A;  2LFF A;  3QW1 A;  4Q5S F;  2HMZ A;  5L0I A;  3ABK C;  2GA0 A;  1D1C A;  1IZM A;  2DI3 A;  4DRJ B;  4DXW A;  4P9T A;  2LSE A;  1JRA A;  1CGM E;  3ITF A;  1AUE A;  3LEO A;  1OW8 A;  2QE9 A;  2R02 A;  1ZU4 A;  2OU6 A;  4YT5 A;  1LVK A;  3CEX A;  2A0U A;  3UNG C;  4J30 B;  5E3A A;  4NTF A;  3NMI A;  2GWW A;  5A6J A;  3GEI A;  1PV3 A;  4Q7C A;  5L0H A;  1HE9 A;  1Q0K A;  2AU5 A;  2CW0 F;  3IQT A;  4JIO A;  2W45 A;  4MVQ A;  4NY3 A;  4U5E E;  5COF A;  4J7T A;  2L6F A;  3SYN A;  3EHN A;  4E7Z A;  3V7O A;  3L8I A;  3LAY A;  4MTO A;  3MBG A;  4BJ6 A;  1NSG B;  2XLW A;  2V3C C;  1JMW A;  2R7R A;  4CSA C;  2B0H A;  2EIK C;  4EBJ A;  4ANJ A;  4K1O A;  3DWW A;  2J0X A;  5EHH A;  1L7C A;  4K0D A;  3T6G B;  3IEE A;  1ZHX A;  2NUT B;  3C8G D;  1C17 M;  4DRH B;  5D91 A;  4ER9 A;  2VCA A;  3CZ6 A;  3ZSU A;  2P6V A;  4PJL A;  3T9O A;  2L7A A;  3Q7G A;  1FFT C;  3CQZ A;  3DJU B;  2VCC A;  2HSB A;  5B3I A;  4E17 A;  3VF0 A;  1BR2 A;  1CPR A;  4EIY A;  1NG1 A;  3IPM O;  1HMD A;  2OJQ A;  4A4A A;  3U9J A;  1FFH A;  3MX3 A;  3NKE A;  3LLI A;  3QTH A;  4PJJ A;  3N24 A;  5COG A;  2Z15 A;  3GOR A;  1YLM A;  2KJG A;  4OD5 A;  1JAF A;  4DBR A;  3JRM O;  3PCV A;  3W2W A;  3CSK A;  2KK1 A;  2Q9C A;  2Y3D A;  3I5Q A;  1V74 B;  3G50 A;  4AL1 A;  4G7Z F;  1FAP B;  2DB4 A;  2WVN A;  3ECS A;  1GM5 A;  1NU7 D;  3DMD A;  1BZ4 A;  1H6G A;  4ULW A;  1A0B A;  1XZP A;  2M64 A;  2NUT A;  3U3F A;  5EGY A;  2DYS C;  3JTL O;  2Q7R A;  2MHR A;  2YZS A;  4DBQ A;  5BQH A;  4N6H A;  1MMD A;  2C03 A;  4FAP B;  5HV9 A;  2XM4 A;  4QDL A;  3ABM C;  3DD7 A;  1U0B B;  1YYJ A;  4Z9J A;  1RKE B;  2W9Y A;  2YL3 A;  4YN0 B;  1ZU5 A;  3IHU A;  2C04 A;  4MTF A;  1Q0F A;  5E2Q A;  5JP7 A;  2ZPA A;  3ZTM A;  4YJW A;  4Z9H A;  4O6M A;  2TMV P;  1TQG A;  1C02 A;  4NQF A;  2F22 A;  2WVO A;  2FAP B;  3O10 A;  2R25 A;  2J9W A;  2L6G A;  3AG4 C;  1T9K A;  1WOL A;  2EPN A;  2H7B A;  2GAQ A;  2IXN A;  2R9R B;  2ASR A;  3FAJ A;  5BUO A;  1OCZ C;  3RW0 A;  2H7O A;  5DQZ A;  3TOL A;  1LM3 B;  4U5H A;  3EH1 A;  3EPV A;  4ONS A;  2WVQ A;  1Q0G A;  3LS1 A;  5F5H A;  3I4U A;  1OXK A;  4IAR A;  3OEO A;  2J45 A;  4AE4 A;  2L9J A;  2Y3G A;  1RKE A;  3LES A;  4G7H F;  2XSE A;  2WZF A;  1VYK A;  3W2V A;  3DKA A;  2XLM A;  3GWL A;  3IQ6 A;  2HS5 A;  4U5B E;  3VAY A;  5BQG A;  2HJ3 A;  1OKK A;  3VRC A;  5L0J A;  1N1C A;  3TD7 A;  1T6I A;  2CNW A;  4U5F E;  4JTD B;  256B A;  3TK0 A;  2A0B A;  4YT2 A;  3EHM A;  1OW6 A;  3JSZ A;  4JCH A;  4O7G A;  3B0U X;  1ORJ A;  2PFD A;  3MYF A;  4E0I A;  4PR9 A;  5CIV A;  3TJ5 A;  1AVO B;  1NFO A;  4U5G A;  5L0D A;  2AP3 A;  2YL0 A;  1ORS C;  4I1M A;  3MYI A;  4MVS A;  3EJN A;  3RH3 A;  3K1H A;  3M4C A;  2ZXP A;  1J8M F;  3DAG A;  3JRT A;  1PD1 A;  3T6J A;  1ZYR F;  4XEV A;  4C3E A;  1FNT c;  3S0X A;  3EFO B;  4JUR I;  2GDC A;  2CDQ A;  2LD6 A;  1Z5Z A;  4NCQ A;  1R4T A;  2YQY A;  4AX2 A;  1E86 A;  1HMO A;  2B0J A;  1MND A;  3V5Y A;  3GM2 A;  5L0G A;  3M4B A;  4DRI B;  1TWA A;  1ZVZ A;  1XZQ A;  4EBK A;  1TR2 A;  3B71 A;  4PFP A;  4ULV A;  3SNH A;  3WAQ A;  2A6H F;  4RDA A;  5JRA A;  2JX0 A;  4Z9I A;  3AG1 C;  3POV A;  3G4X A;  2VB6 A;  5L0F A;  3NYM A;  2J7P A;  5DS5 A;  1GS9 A;  1LE4 A;  1T6Q A;  2MYS A;  1HW2 A;  1T01 A;  3MFN A;  1VOM A;  1OW7 A;  2AWC A;  3JSE O;  2J0W A;  4WGZ A;  1V54 C;  5BQI A;  4E0H A;  3EFO A;  3FMS A;  4BJ6 C;  3F46 A;  4AK9 A;  5A6B A;  3IQC A;  3AGT A;  3E9V A;  4CJO A;  2R03 A;  4D4N A;  3RFY A;  2A69 F;  1ZW3 A;  3DE9 A;  4QI0 A;  2IBF A;  4L6R A;  1LKX A;  2UUH A;  3W8H A;  4MVR A;  2JD3 A;  1TFO B;  4BJ5 A;  2OKU A;  1FMW A;  3DXJ F;  1E85 A;  2WL8 A;  2R7U A;  4O6Y A;  1I4Y A;  5AGF A;  2YWA A;  2WB7 A;  1HW1 A;  3SXK A;  3GOD A;  3RVY A;  2J9V A;  2R7W A;  2EPL X;  3Q7L A;  1CGN A;  3UGP A;  3U2M A;  1WTY A;  2BE5 F;  2KYH A;  1TKN A;  1UG7 A;  2P61 A;  2BL2 A;  3DJN B;  2XM0 A;  1OR2 A;  1M57 C;  4F4B A;  2QUP A;  1G8X A;  2J9U A;  3SXY A;  3UGO A;  3GEH A;  2ZD9 A;  4B6I A;  4G0H A;  3FVY A;  5T3W A;  1YJG A;  5KYN A;  1OR3 A;  3LNR A;  3HNJ A;  3R2P A;  4YWQ A;  5DVW A;  4LLC A;  4U5D E;  3AGU A;  3B0P A;  3KL4 A;  3QMK A;  4BEM J;  2KW3 C;  3EG9 B;  2HFI A;  3HNK A;  4RBN A;  4W8P A;  1Z7Q c;  1B68 A;  4OIP F;  3W4Y A;  2OQM A;  3QW0 A;  4PK4 A;  1QQ3 A;  4BJT A;  3MLG A;  2A1D D;  2QY9 A;  3TUL A;  1LE2 A;  4MND A;  2OEV A;  5AC4 A;  4YL3 A;  2D4U A;  2AWY A;  4NTB A;  2WZL A;  2ETS A;  3TJ6 A;  1QPU A;  4DOZ A;  4IWB A;  2P7V A;  1RMV A;  2IXO A;  3NG1 A;  3UMI A;  3JZ0 A;  1Y4C A;  1D0X A;  1NZE A;  1U89 A;  4IGG A;  4LDQ A;  1YVI A;  4CS7 A;  3EH2 A;  2ZXW C;  1GQA A;  4JJF A;  2IOQ A;  3KYI A;  4NC3 A;  1S7Z A;  5KYX B;  1FR0 A;  4MVZ A;  3EG9 A;  2XL8 A;  4AE4 B;  2RSE B;  1K04 A;  4EUK B;  2YLI A;  3H2U A;  5A6A A;  4CDV A;  1DOW A;  2FFH A;  1NBB A;  2CYD A;  1CGO A;  2LIG A;  3EGX B;  1RXQ A;  3W8I A;  5KYU B;  1RJ9 A;  3RQE A;  1D1B A;  3M15 A;  1KNY A;  2HV6 A;  2IYL D;  4DJ9 A;  1UFB A;  3BRJ A;  3KH2 A;  4LDR A;  1G4U S;  3N2Z B;  4MVU A;  3L1M A;  3SXM A;  2XXA B;  4KI2 A;  1M2V A;  5F5F A;  5L3V A;  3V5Z A;  3M1C B;  1G5Z A;  4PJN A;  3NRH A;  1JPJ A;  3B0V C;  1QZX A;  3ABL C;  3AQB A;  1YYX A;  3AG2 C;  3K33 A;  5K0I A;  4P6I C;  5FCL A;  1D0Y A;  1VK5 A;  1BR1 A;  1PCX A;  1V4A A;  1M2O A;  5EK0 A;  5KYX A;  1E84 A;  4KC9 A;  3K1I C;  1IW7 F;  1Q0D A;  2LCH A;  3DZA A;  2A6E F;  3N0T A;  2ZXR A;  4N06 A;  4YT4 A;  4Q4Z F;  2W4B A;  1NLX A;  1O87 A;  2PP4 A;  2QTV A;  4C3B A;  1SF8 A;  4IJJ A;  3GM1 A;  2G3K A;  2G3V A;  5KYU A;  3EGX A;  3Q6N A;  1LS4 A;  3EGD B;  3ASO C;  4CS8 A;  4JCZ A;  2YEV A;  4CIH A;  2RD9 A;  2R7Q A;  4D4X A;  3U8V A;  5JS5 A;  5GPG B;  3FHD A;  2XXA A;  3GM3 A;  3RF3 A;  5KYY B;  4IAQ A;  3U0C A;  1BBH A;  1MMN A;  1I4Z A;  3ZTZ A;  3ZIB A;  3LS0 A;  5COM A;  4LER A;  3U9M A;  3X2Q C;  4EBB A;  4LLE A;  3U5S A;  3S90 A;  3NMK A;  3RYL A;  3K1I A;  1Z6A A;  4CDA A;  4YL1 A;  3LJB A;  3NDB B;  1L3P A;  4JW1 A;  4LDK A;  4JJG A;  1ORY A;  5T1D B;  1K40 A;  1KTM A;  2PF4 E;  4OD4 A;  3QVZ A;  4XWJ A;  4DVY P;  1ZZP A;  2DYR C;  3DM5 A;  4HEA J;  5IY5 C;  3RKO F;  3T4R A;  3EGD A;  3ZDL A;  2HUJ A;  2WZG A;  1PD0 A;  2HKV A;  1VYI A;  3GAN A;  3K66 A;  3M79 A;  1Q0M A;  4YK5 A;  3R7C A;  3FXH A;  2CCY A;  2XLO A;  1YAR O;  2R7V A;  4BPM A;  3SEO A;  1D1A A;  1QLE C;  5KYY A;  1U6H A;  5DQT A;  2DGJ A;  4BJ5 C;  4XPX A;  3ZQV A;  3F47 A;  4K7B A;  1RKC A;  3HNI A;  3O55 A;  1XWJ A;  1YA7 O;  1LPE A;  2V26 A;  2HSQ A;  2G62 A;  3NMJ A;  4JZA A;  2YRF A;  1FTS A;  3H65 A;  1LI5 A;  1ZHW A;  3NYJ A;  4I44 A;  4OIQ F;  2XLD A;  5A6B D;  1OCC C;  1VLT A;  3FAP B;  4E7S A;  4MVM A;  3IQ5 A;  1E83 A;  1QKR A;  3RIP A;  2EIN C;  3C63 A;  3OWT A;  4PAC A;  4XLP F;  2EIL C;  3AJM A;  1WAS A;  3G4Z A;  5JUA A;  3HJC A;  4G7O F;  5JSL A;  3X1O A;  1VTM P;  1EI7 A;  2BC5 A;  4JEB A;  1YDI A;  1VLS A;  4N4W A;  3UMH A;  2O9X A;  2A68 F;  2HZ8 A;  1BR4 A;  1SZI A;  3NYL A;  4GQH A;  2EPM X;  4GEH A;  4CJG A;  3ASN C;  2LFD A;  1BDJ B;  3K7D A;  2R05 A;  1H9T A;  2CGE A;  1OCR C;  3C8Z A;  1ST6 A;  1W2W A;  3U2L A;  5B3S C;  4QI2 A;  2IXP A;  1YZC A;  3ZG1 A;  1NU9 C;  1VB5 A;  2KSF A;  2J46 A;  5D92 A;  4XQ1 A;  4BG0 A;  4BEJ A;  1JPN A;  3Q6M A;  4O79 A;  4KNV A;  3ATP A;  1H7I A;  5HSW A;  1HE1 A;  2YLG A;  3EQL F;  5KYW A;  2XL6 A;  1MMG A;  5E33 A;  4XEF A;  5JLI A;  2VH3 A;  3C8G B;  3PMR A;  4IB4 A;  4H54 A;  2M4E A;  2IM8 A;  3HNL A;  3UMK A;  3KPH A;  1A7V A;  1S05 A;  3B9Q A;  3S9O A;  1OCO C;  2H8A A;  2OOC A;  3AQC A;  5CI8 A;  5DS6 A;  5AC5 A;  3JYY A;  2VC9 A;  2HMQ A;  5B1B C;  4AL0 A;  2OCC C;  2VAS A;  3O6X A;  4MS2 A;  2XLH A;  4EHP A;  2YL1 A;  3A9C A;  3HKK A;  1AEP A;  2XLV A;  4JTC B;  4HE8 D;  2UUI A;  3EZI A;  1RJ9 B;  2VCB A;  2EPO A; 
#chains in the Genus database with same CATH homology
 2W4M A;  3EZH A;  3JCU Q;  3O39 A;  3K6B A;  5DS4 A;  1M2V B;  4JVS A;  1O5H A;  4KBL A;  2D5R B;  2H7V C;  1M56 C;  3KMI A;  3ZC4 A;  4FWV A;  2Q9B A;  4X0R A;  3SZR A;  4OIO F;  2E87 A;  3HLZ A;  2YHS A;  4CSA A;  3UR3 C;  1TWC A;  2XL4 A;  2EIM C;  4C7O B;  4CS8 C;  5E3C A;  1WGW A;  2XRH A;  3T6B A;  4J32 B;  3AG3 C;  5T3T A;  1ZHY A;  2I8B A;  3HTK C;  3JYH A;  3DM9 B;  2Q9A A;  2NUP B;  1LS1 A;  2Y3H A;  4I1O B;  3VYW A;  1TWH A;  2L81 A;  1J8Y F;  1FMV A;  2R7O A;  4CBE A;  2R7S A;  4PJM A;  1OKK D;  2GFH A;  2MWQ A;  4W8K A;  2CNW D;  2PX3 A;  4C7O A;  5DLJ A;  4HFK B;  5B1A C;  4FES A;  2EIJ C;  3S29 A;  4U5C E;  4BJ1 A;  4DVZ A;  1TWG A;  2R7V A;  2Y3B A;  2X51 A;  3LLK A;  4O6N A;  2HV7 A;  4ZLD A;  4EWC A;  2NUP A;  3LEV A;  2NG1 A;  3I5P A;  4WJ0 A;  4PFO A;  4XLN F;  1VMA A;  4I3M A;  4IAO A;  2KNH A;  2Y39 A;  2PX0 A;  3KKB A;  2Y69 C;  4A2N B;  1ZHT A;  4CS9 C;  2KGO A;  4KNW A;  3E70 C;  1KU2 A;  3NKD A;  1Z3I X;  2R7X A;  4OIN F;  4XTK A;  4ZLC A;  1Z63 A;  1V55 C;  4C3D A;  3L34 A;  4RD9 A;  4OIR F;  3S28 A;  4LAC B;  1MNE A;  2J7P D;  2FGY A;  1ZHZ A;  4MQ9 F;  3PHF 2;  4H4K C;  2IXM A;  3DAF A;  4FX5 A;  3WOD F;  3ZVR A;  4M63 A;  3QZC A;  4CS9 A;  4GYT A;  4IRU A;  5KYW B;  3SP1 A;  2ZXO A;  5CI9 A;  2OG2 A;  4HFF B;  3S27 A;  2R7T A;  4YT8 A;  3FDQ A;  2Q3T A;  1SMY F;  2KQ9 A;  3OA1 A;  5L3Q A;  1D0Z A;  1Z23 A;  3L0I A;  3WG7 C;  1MMA A;  3JT1 A;  4Q5S F;  3ABK C;  1D1C A;  1IZM A;  2LSE A;  3ITF A;  1ZU4 A;  4YT5 A;  1LVK A;  3UNG C;  4J30 B;  5E3A A;  4Q7C A;  2CW0 F;  4NY3 A;  2W45 A;  4U5E E;  3SYN A;  3EHN A;  4E7Z A;  3V7O A;  3LAY A;  4BJ6 A;  2V3C C;  2R7R A;  4CSA C;  2EIK C;  4ANJ A;  2J0X A;  5EHH A;  4K0D A;  3IEE A;  1ZHX A;  2NUT B;  5D91 A;  3CZ6 A;  3ZSU A;  2P6V A;  4PJL A;  3Q7G A;  1FFT C;  3CQZ A;  3DJU B;  1BR2 A;  1NG1 A;  1FFH A;  3MX3 A;  3NKE A;  3LLI A;  4PJJ A;  3N24 A;  2Z15 A;  2KJG A;  4OD5 A;  4DBR A;  3W2W A;  3CSK A;  2Q9C A;  2Y3D A;  3I5Q A;  4G7Z F;  2WVN A;  3ECS A;  1NU7 D;  3DMD A;  4ULW A;  2NUT A;  5EGY A;  2DYS C;  2YZS A;  4DBQ A;  1MMD A;  2C03 A;  4QDL A;  3ABM C;  3DD7 A;  2W9Y A;  4YN0 B;  1ZU5 A;  2C04 A;  5E2Q A;  2ZPA A;  4YJW A;  4O6M A;  2WVO A;  2J9W A;  3AG4 C;  2H7B A;  2IXN A;  3FAJ A;  5BUO A;  1OCZ C;  2H7O A;  5DQZ A;  4U5H A;  3EH1 A;  3EPV A;  5F5H A;  2WVQ A;  3LS1 A;  3I4U A;  3OEO A;  2J45 A;  4AE4 A;  2L9J A;  2Y3G A;  3LES A;  4G7H F;  2XSE A;  2WZF A;  1VYK A;  3W2V A;  4U5B E;  3VAY A;  1OKK A;  1N1C A;  3TD7 A;  2CNW A;  4U5F E;  4YT2 A;  3EHM A;  3JSZ A;  4JCH A;  4O7G A;  2PFD A;  4U5G A;  4I1M A;  3EJN A;  3RH3 A;  3K1H A;  2ZXP A;  1J8M F;  3DAG A;  3JRT A;  1PD1 A;  3T6J A;  1ZYR F;  4C3E A;  3S0X A;  3EFO B;  4JUR I;  2CDQ A;  1Z5Z A;  4AX2 A;  2B0J A;  1MND A;  1TWA A;  1TR2 A;  4PFP A;  3SNH A;  2A6H F;  4RDA A;  3AG1 C;  3POV A;  2VB6 A;  3NYM A;  2J7P A;  5DS5 A;  2MYS A;  1VOM A;  2J0W A;  1V54 C;  3EFO A;  4BJ6 C;  3F46 A;  4AK9 A;  3E9V A;  3RFY A;  2A69 F;  4QI0 A;  1LKX A;  3W8H A;  2JD3 A;  4BJ5 A;  1FMW A;  3DXJ F;  2WL8 A;  2R7U A;  4O6Y A;  2WB7 A;  3GOD A;  2J9V A;  2R7W A;  3Q7L A;  3UGP A;  2BE5 F;  1TKN A;  3DJN B;  1M57 C;  4F4B A;  1G8X A;  2J9U A;  3UGO A;  4B6I A;  4G0H A;  3FVY A;  5T3W A;  5KYN A;  3LNR A;  4YWQ A;  5DVW A;  4LLC A;  4U5D E;  3KL4 A;  3B0P A;  3QMK A;  2KW3 C;  3EG9 B;  4RBN A;  4OIP F;  4PK4 A;  4BJT A;  3MLG A;  2A1D D;  2QY9 A;  4MND A;  2WZL A;  4DOZ A;  4IWB A;  2P7V A;  2IXO A;  3NG1 A;  3UMI A;  1D0X A;  1NZE A;  4CS7 A;  3EH2 A;  2ZXW C;  4JJF A;  2IOQ A;  5KYX B;  1S7Z A;  3EG9 A;  4AE4 B;  2FFH A;  3W8I A;  5KYU B;  3EGX B;  1RJ9 A;  1D1B A;  2HV6 A;  2IYL D;  3KH2 A;  3N2Z B;  2XXA B;  4KI2 A;  1M2V A;  5F5F A;  5L3V A;  3M1C B;  4PJN A;  3NRH A;  1JPJ A;  3B0V C;  1QZX A;  3ABL C;  3AQB A;  3K33 A;  3AG2 C;  4P6I C;  5FCL A;  1D0Y A;  1VK5 A;  1BR1 A;  1PCX A;  5KYX A;  1M2O A;  4KC9 A;  3K1I C;  1IW7 F;  4N06 A;  3B0U X;  3DZA A;  2A6E F;  3N0T A;  2ZXR A;  4YT4 A;  4Q4Z F;  2W4B A;  1O87 A;  2PP4 A;  2QTV A;  4C3B A;  1SF8 A;  4IJJ A;  2G3K A;  2G3V A;  5KYU A;  3EGX A;  3Q6N A;  3EGD B;  3ASO C;  4CS8 A;  4CIH A;  2YEV A;  2R7Q A;  3FHD A;  2XXA A;  5KYY B;  1MMN A;  3ZIB A;  3LS0 A;  4LER A;  3X2Q C;  4EBB A;  4LLE A;  3RYL A;  1Z6A A;  3LJB A;  3NDB B;  4JW1 A;  4JJG A;  5T1D B;  2PF4 E;  4OD4 A;  4XWJ A;  4DVY P;  2DYR C;  5IY5 C;  3DM5 A;  4HEA J;  3RKO F;  3T4R A;  3EGD A;  2WZG A;  1PD0 A;  3GAN A;  1VYI A;  3K66 A;  3SEO A;  1D1A A;  1QLE C;  5KYY A;  5DQT A;  2DGJ A;  4BJ5 C;  3F47 A;  4K7B A;  2V26 A;  4JZA A;  2G62 A;  1FTS A;  3H65 A;  1ZHW A;  3NYJ A;  4I44 A;  4OIQ F;  1OCC C;  4E7S A;  3RIP A;  2EIN C;  3OWT A;  4XLP F;  2EIL C;  4G7O F;  3HJC A;  3X1O A;  3UMH A;  2O9X A;  2A68 F;  1BR4 A;  1SZI A;  3NYL A;  4GEH A;  3ASN C;  3K7D A;  2CGE A;  1OCR C;  1ST6 A;  1W2W A;  5B3S C;  4QI2 A;  2IXP A;  3ZG1 A;  1NU9 C;  2J46 A;  5D92 A;  4BEJ A;  4BG0 A;  1JPN A;  3Q6M A;  4O79 A;  4KNV A;  5HSW A;  3EQL F;  5KYW A;  1MMG A;  5E33 A;  2VH3 A;  3PMR A;  2M4E A;  3UMK A;  3B9Q A;  1OCO C;  3AQC A;  5CI8 A;  5DS6 A;  5B1B C;  2OCC C;  2VAS A;  3O6X A;  4HE8 D;  3EZI A;  1RJ9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...