3DZAA

Crystal structure of a putative membrane protein of unknown function (yfdx) from klebsiella pneumoniae subsp. at 1.65 a resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
180
structure length
180
Chain Sequence
APAAAATTQVQKEAADVLQVAVQGANAMRDIQFARLALFHGQPDSAKKLTDDAAALLAADDASWAKFVKTDAKAKMIADRYVIINASIALSEDYVATPEKESAIQSANEKLAKGDQKGAIDTLRLAGIGVIENQYLMPLNQTRKAVAQSQELLKAGKYYEANLVLKGAEEGIVVDSEMLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative membrane protein of unknown function (YP_001337144.1) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 1.65 A resolution
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
molecule tags Unknown function
molecule keywords uncharacterized putative membrane protein
total genus 66
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10938 YfdX YfdX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1940 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dzaA01
3DZAA
chains in the Genus database with same CATH superfamily
1G8XA 2Q00A 1ZVZA 2NSGA 1ZHWA 1OKKA 1C02A 1I4YA 4MW3A 4IWBA 1MMGA 2OG2A 2Q7RA 4CDYA 1CGNA 1LVKA 5FZTA 2P0NA 3IHUA 1WOLA 3QW0A 2CW0F 4FWVA 1QQ3A 2XS1A 2Y3BA 2KQ9A 2NUPB 3JTLO 2PNOA 3K1IC 5EK0A 3SP1A 4MNDA 3C62A 4YT4A 4DJ9A 2J0XA 1BBHA 2Q9CA 4BJ6C 3M4BA 3SZRA 2HMZA 3LS0A 1C03A 1J8YF 2YHSA 4JTCB 3V5XA 5EGYA 2WVQA 1OR2A 4YWQA 1D0ZA 2H7VC 4JZAA 4NC3A 2MYSA 3NRHA 3KMIA 4NTBA 4PFOA 5EHHA 5KYWB 1ZYRF 2EINC 2KW3C 2XSEA 1CGOA 5FCLA 1MNDA 2W45A 3BRJA 3W2VA 1E84A 1H9GA 2NUTA 3KKBA 3TJ6A 5K0IA 1S7ZA 2I15A 2YQYA 5COFA 3U8PA 4FAPB 1BR1A 1OCRC 1G4US 1OW6A 2A69F 3MLGA 4KNVA 4N6CA 4W8PA 2Y69C 3H2VA 2DYSC 3AGTA 3WODF 1NFNA 3Q6MA 3R7CA 1OCOC 1MMAA 1Y6DA 1QZXA 4IB4A 3S84A 2R7RA 1EKYA 3MX3A 3B0PA 1T6QA 3Q7GA 4JIOA 4Q7CA 1Z63A 2AWYA 4CDVA 3S9OA 1A41A 3AG3C 3LJBA 3VM6A 5L0JA 4O7GA 3EFOA 2YLGA 3RVYA 3C8GD 2RD9A 2JD3A 3DE8A 2P61A 3MYFA 4P9FA 4AL0A 5KYYB 2IXPA 3M4CA 3OEOA 4YJWA 4U5GA 1O5HA 5F5HA 5JUAA 4CSAA 2KGOA 3UMHA 2QLAA 2R7XA 2M64A 3AJMA 4J7TA 1VTMP 4CX9A 2OEVA 2AP3A 2HV6A 2Y3GA 4XWJA 3X2QC 3RH3A 3ZSUA 3IQTA 4H54A 1KU2A 4PJJA 2L6GA 1ZU5A 2X51A 4DVZA 4EBJA 4JE9A 3KYJA 3L1MA 1B68A 3M79A 2GFHA 4K7BA 3PHF2 1OXKA 3U0CA 2BL2A 1TWHA 4K1OA 4LERA 4OD5A 4WABA 3F46A 4MTFA 3JSEO 4C3DA 3DMDA 2A6EF 5JP7A 1XZQA 5DS5A 4P9TA 2PX0A 4NY3A 1TWCA 5AC4A 3QW1A 2Q9BA 4I44A 3SXMA 1ZZPA 2L7AA 4BEJA 3FAPB 1YZAA 2YL3A 4YL1A 2BC5A 3U3BA 1QLEC 2R7OA 3IPMO 1K40A 3IQ5A 3N2ZB 1G4WR 3EZIA 5KYXA 2XM4A 2VB6A 5L3QA 1MNEA 2J7PA 2R05A 1F1MA 3N0TA 2W4BA 3GM1A 4HE8D 4AX2A 4OD4A 5IY5C 2R9RB 5COGA 4IARA 3RYLA 1M2VA 3ZTZA 1M6TA 1FFTC 3UMKA 2A0BA 4YL0A 3A11A 3CAXA 3ZQVA 1GM5A 4G78A 1W2WA 1T6IA 1K04A 4BJ1A 1T9KA 1RJ9B 1Y4CA 2XLVA 4JTAB 4NTAA 4WJ0A 2DI3A 3ATPA 3Q7LA 4XPXA 3S27A 2DB4A 3GEHA 3VF0A 3EQLF 2UUHA 3W2WA 4LLCA 4BPMA 4XLPF 2EIMC 2R7UA 3DI5A 1HW1A 4RD9A 1SMYF 1SYQA 3OWTA 3SYNA 1PCXA 2IXOA 2XS8A 3LAYA 3NYLA 4EWCA 2LP4A 1TR2A 3B29A 3JRMO 3SXZA 5JS5A 2DGJA 5KYUA 3NDBB 3O39A 4JW1A 2XRHA 2XLMA 2WB7A 3RF3A 1BR4A 3EGXB 3GANA 3TQOA 1D1AA 1ST6A 3EJNA 3C8GB 3EGDA 4MTGA 3V7OA 2HKVA 4AE4B 5BUOA 2F22A 2VASA 2HZ8A 1T6UA 3LNMB 2CYDA 1WN0A 4U5FE 1AVOB 2OQMA 4KNWA 4XLNF 2X0CA 4O6YA 2HMQA 2KC3A 4OIRF 2FFHA 2R7WA 5L0CA 1YVIA 3VYWA 2XLWA 4MVUA 2C04A 4YL3A 4OIOF 5JRAA 2ZXRA 1JMWA 3NMJA 1WATA 2KK1A 4E7ZA 2ZXOA 5A69A 1YYXA 4BEMJ 4CS8A 2G3VA 2WVNA 4MW8A 2JPUA 3GM3A 3POVA 1YLMA 1V55C 2IYLD 4U5DE 2VCAA 3SEOA 1SR2A 3AQBA 2L6FA 4C7OB 4YK5A 3ZTMA 3T6JA 3GWNA 4U5HA 2H8AA 3RFYA 2J9BA 4DBQA 1APCA 3TD7A 1H9TA 1TKNA 5A6KA 4JJFA 2KJGA 4ANJA 4XPYA 4E18A 2G62A 3V5ZA 3I5QA 2LFDA 4Z9JA 1ORYA 4KI2A 3IQCA 1AUEA 3FVYA 3U2MA 3S0XA 1JPNA 2V26A 5A6AA 1IZMA 1V4AA 2VH3A 4C3EA 1ZHTA 2D4UA 4C7OA 1LE2A 1I5NA 2HJMA 2QUPA 5COMA 4O79A 4K0DA 5L0FA 2D5RB 4CJGA 2G3KA 1ZW3A 2P6VA 4I1OB 1Q0DA 4M63A 2AWCA 3UGPA 1LPEA 1VB5A 2NG1A 4PFPA 1VK5A 1SF8A 1YA7O 4MVRA 1YARO 2AU5A 2WL8A 2RSEB 2V3CC 2J8WA 1HMDA 2HUJA 2A0UA 4AL1A 3C18A 3FOPA 1E2XA 1ORSC 4EBBA 4BG0A 3LEOA 1BDJB 1OCCC 1M2OA 3LUTB 4AE4A 4IAOA 3C8GA 1VYKA 3EGDB 1JPJA 5TJ5E 3U9MA 3EGXA 1D1BA 4C3BA 2XL4A 4MTOA 3RW0A 3ASNC 3HLZA 3K7DA 2YL7A 3NKDA 3S28A 4BJ5A 5KYUB 1A7DA 1Q0KA 3G4XA 3G50A 1WWPA 2YZSA 3RVZA 5DQTA 2J9WA 4DXWA 1L3PA 2ASRA 2E87A 3BEHA 3AGUA 2B0HA 4HEAJ 3DJNB 1M57C 2J9VA 2HSBA 2J45A 2LD6A 2ZD9A 3ITFA 3K1IA 4GQHA 2GWWA 3EH2A 4FESA 5DS6A 4OIPF 1RJ9A 1D1CA 1V54C 3CQZA 3O10A 4BJTA 3QVZA 4U9DA 3MFNA 3B0VC 3K1HA 5DVWA 1TFOB 1M2VB 2QE9A 3G4ZA 1YZCA 5B1BC 3W8HA 2PP4A 3SNHA 2GA0A 3ZDLA 4O6NA 2UUIA 4G7HF 1EQ1A 1SZIA 2EPMX 4I3MA 3ZWIA 1Z6AA 2IBFA 4ULWA 4ER9A 4MVQA 2DYRC 2J9UA 3NKEA 3Q6NA 3W4YA 5KYXB 4MQ9F 3ZG1A 1T01A 2FGYA 3RKOF 1NU9C 2ZXPA 1HE1A 3K6BA 1A7VA 2FAPB 2Z15A 3HKKA 4LDRA 5CI9A 3VRCA 4D4XA 4PJNA 4MS2A 3U3FA 3ASOC 2TMVP 4CIPA 3E9VA 4JEAA 3DM5A 2WZLA 1FTSA 2YLIA 4MVOA 3DKAA 4X0RA 3L34A 3JRTA 4XPWA 3VAYA 4Q4ZF 3FXHA 4G0HA 1KTMA 1K05A 1ZHZA 2OEXA 3FHDA 4QI2A 1L7CA 3HNLA 2VCCA 1DOWA 1N1CA 256BA 4JRZA 1M56C 2ZPAA 4HFFB 4LDQA 2HS5A 5JLIA 3NMKA 1G5ZA 1T5OA 4O6MA 3GODA 1MMNA 3U9JA 2OCCC 2YWAA 2YEVA 4JC7A 1HY5A 1YA9A 1GS9A 1HE9A 1V74B 2EPNA 2NPUA 3I4UA 1NBBA 3WG7C 4N6HA 2LFFA 1TQGA 4KBLA 2HFIA 4XEKA 2PX3A 4CBEA 2IXNA 3U8VA 4PJMA 3GM2A 5A6BD 5KYYA 3NMIA 1I4ZA 3C7JA 4Z9IA 1NZEA 1OQCA 3S90A 1JAFA 5E3AA 4NCQA 4NTFA 3C8ZA 2JX0A 3AG4C 3H65A 1UG7A 3JYHA 3TULA 3EFOB 2VC9A 3LESA 2LCHA 4KC9A 5B3SC 3JZ0A 1TWGA 2EIKC 1CGME 4J32B 1Q0GA 1PD1A 1NSGB 2LQGA 5DQZA 3PDMP 3T9OA 1HW2A 3HNJA 5BQGA 2YKZA 2CNWD 3B9QA 2W4MA 3DE9A 1U0BB 2Q4FA 2XLHA 4JTDB 1NG1A 4R32A 4XEFA 1U6HA 1QKRA 3FOOA 2NUTB 1IW7F 1VLSA 1OR3A 3QVYA 4JEBA 3U2LA 2NSFA 5BQHA 4QDLA 3EZHA 2KYHA 2R02A 3LS1A 1Q0FA 1QPUA 5KYWA 4BJ6A 2R7VA 3GORA 4MVSA 1BZ4A 3ABMC 4PK4A 2CCYA 2EPOA 2MWQA 2WZFA 2OU6A 4A4AA 3NYMA 4P6IC 4LDKA 4CJOA 1YAUO 2IOQA 2XL6A 1QVXA 5B3IA 1CPQA 3TK0A 4ZLCA 2R7QA 2VCBA 4W8KA 4LLEA 3B0UX 3CSKA 4XEVA 2XM0A 2GDCA 1LKXA 2PBEA 4QI0A 2XLDA 2MHRA 1ORJA 2NUPA 4XTKA 3TOMA 3HNIA 5HSWA 3J06A 4DRHB 4JCZA 3UNGC 2J7PD 4U5CE 2R7SA 4J7YA 3DAFA 1H7IA 3ZC4A 1YYJA 3ABLC 3GEEA 2L9JA 2LK4A 3NYJA 4LACB 4N06A 4F4BA 4ZLDA 2CNWA 4J30B 2Q3TA 3RQEA 4NQFA 1WASA 3ABKC 3JCUQ 3TOLA 1EI7A 2A68F 2OOCA 1DOVA 3X1OA 4A2NB 4E0HA 3GEIA 3K33A 3RIPA 4EKWA 1Z3IX 3M15A 3L8JA 2EPLX 3A9CA 5AC5A 1OKKD 1UFBA 3T6BA 3FAJA 2YVKA 1LS4A 3LLKA 3DJUB 1TWAA 4U5BE 5A6JA 3H2UA 4IGGA 2GAQA 4CSAC 2R7TA 2WVOA 3ECSA 5DS4A 4WGYA 2IM8A 1U89A 3CEXA 4CS8C 5L0HA 1D0YA 4N4WA 2YRFA 4EHPA 1RKCA 1RXQA 5T1DB 3EG9B 3MBGA 2H7BA 1RKEB 1QSPA 2LIGA 4CS9C 4DRIB 5L0IA 1Q0MA 1S05A 1E83A 2A1DD 3B71A 5E33A 2YLDA 2XLOA 3ZVRA 5JT4A 2J46A 2BE5F 4RBNA 4DBRA 4PR9A 3DWWA 4YT8A 3SXYA 3KH2A 4D4NA 1A7EA 4JVSA 3V5YA 5D92A 3T4RA 1OW7A 1HMOA 1VYIA 4G7ZF 1JRAA 1O3UA 2PF4E 4U9EA 1VMAA 4ULVA 4WGZA 4IJJA 3IEEA 2EPKX 5E2QA 1WGWA 5F28E 3K66A 1FMWA 1D0XA 3QTHA 4H4KC 2P1AA 3UMIA 1NU7D 3L8IA 3FMSA 3C63A 3JT1A 3KYIA 3ZQYA 4AK9A 4EIYA 2XXAA 4FX5A 4YT2A 5B1AC 4PJLA 3O55A 4MVMA 3TJ5A 4BJ5C 3FDQA 1RMVA 2YL0A 3O6XA 1XZPA 1C17M 3UGOA 2CDQA 5L0DA 2AVKA 1XWJA 3AG1C 2ICWG 3LEVA 2C03A 3NG1A 3QMKA 3L0IA 4YN0B 1YJGA 5JVEA 1LS1A 2IXMA 4OIQF 3M1CB 1JR8A 3QZCA 4E17A 5L0GA 2R25A 2QTVA 3DAGA 5F5FA 5BQIA 4DRJB 1ZHXA 2QY9A 2HSQA 3I5PA 2OKUA 3IQ6A 5E3CA 1TFKB 4CIHA 5HV9A 4Q5SF 4B6IA 3EHNA 3EPVA 1PD0A 3F47A 1VLTA 1J8MF 1GGQA 1OW8A 2OJED 4RDAA 4IRUA 1OXBA 3SXKA 3PMRA 4U5EE 3CZ6A 4IAQA 2J0WA 3N24A 4Z9HA 1LIHA 4GEHA 2O9XA 2H7OA 5AGFA 1EA8A 1FFHA 1LI5A 3AQCA 2W9YA 4I1MA 1OCZC 3LNRA 3EHMA 3RQFA 1A0BA 4E7SA 1KNYA 3AOUA 2KSFA 5A6BA 3PCVA 4MVZA 4JJGA 1YDIA 3EH1A 4JKVA 2R03A 1H6GA 2Y3HA 3AG2C 5CI8A 3W8IA 5CIVA 3E70C 2XLEA 5KYNA 1AEPA 3HTKC 4EUKB 2YL1A 2CGEA 3HNKA 1ZU4A 3RQGA 5T3WA 3WHNA 1NLXA 2Q9AA 4HFKB 3DXJF 2QNLA 4JURI 2L6HA 2P7VA 1R5ID 3DZAA 3HJCA 2XXAB 3OA1A 3T6GB 4DOZA 2I8BA 1O87A 2EILC 3MYIA 1ZHYA 1RCPA 1FAPB 1LM3B 4G7OF 4YT5A 5JSLA 5D91A 4E0IA 2L81A 3JSZA 1PV3A 3DD7A 3UR3C 1E86A 2KNHA 3ZIBA 1LE4A 2XL8A 5GPGB 1Z23A 4UDVA 4EBKA 2ETSA 3DM9B 2WZGA 2B0JA 2EIJC 2PFDA 1Z7Qc 3KPHA 3GWLA 4CDAA 5DLJA 4CS7A 1NFOA 2ZXWC 1ZW2A 4DVYP 5L3VA 1GQAA 2OJQA 1CPRA 1RKEA 3EG9A 1MMDA 3JYYA 1Z5ZA 2HJ3A 4PACA 2Y39A 4OINF 1E85A 1FNTc 1BR2A 4L6RA 4ONSA 5T3TA 4GYTA 3S29A 1MQVA 1LI7A 1WTYA 3R2PA 3KL4A 3WAQA 3U5SA 1FMVA 1JOGA 4JCHA 4CS9A 1R4TA 1VOMA 2HV7A 1FR0A 4XQ1A 2M4EA 3US6A 2Y3DA 2A6HF 3LLIA 2LSEA
chains in the Genus database with same CATH topology
1G8XA 1ZHWA 1OKKA 4IWBA 1MMGA 2OG2A 1LVKA 4FWVA 2CW0F 2Y3BA 2KQ9A 2NUPB 3SP1A 3K1IC 4MNDA 4YT4A 2J0XA 2Q9CA 4BJ6C 3SZRA 3LS0A 2YHSA 1J8YF 5EGYA 2WVQA 4YWQA 1D0ZA 2H7VC 4JZAA 2MYSA 3NRHA 3KMIA 4PFOA 5KYWB 1ZYRF 2EINC 2KW3C 2XSEA 5FCLA 1MNDA 2W45A 3W2VA 2NUTA 3KKBA 1S7ZA 1BR1A 1OCRC 2A69F 3MLGA 4KNVA 2Y69C 2DYSC 3WODF 3Q6MA 1OCOC 1MMAA 1QZXA 2R7RA 3MX3A 3B0PA 3Q7GA 4Q7CA 1Z63A 3AG3C 3LJBA 4O7GA 3EFOA 2JD3A 5KYYB 2IXPA 3OEOA 5F5HA 4YJWA 4U5GA 1O5HA 4CSAA 2KGOA 3UMHA 2R7XA 2HV6A 2Y3GA 4XWJA 3X2QC 3ZSUA 3RH3A 4PJJA 1KU2A 1ZU5A 2X51A 4DVZA 2GFHA 4K7BA 3PHF2 1TWHA 4LERA 4OD5A 3F46A 4C3DA 3DMDA 2A6EF 5DS5A 2PX0A 4NY3A 1TWCA 2Q9BA 4I44A 4BEJA 1QLEC 2R7OA 5KYXA 3N2ZB 3EZIA 2VB6A 5L3QA 1MNEA 2J7PA 3N0TA 2W4BA 4HE8D 4AX2A 4OD4A 5IY5C 3RYLA 1M2VA 1FFTC 3UMKA 1W2WA 4BJ1A 1RJ9B 4WJ0A 3Q7LA 3S27A 3W2WA 3EQLF 2R7UA 4LLCA 4XLPF 2EIMC 4RD9A 1SMYF 3OWTA 3SYNA 1PCXA 2IXOA 3NYLA 3LAYA 4EWCA 1TR2A 2DGJA 5KYUA 3NDBB 3O39A 4JW1A 2XRHA 2WB7A 1BR4A 3EGXB 3GANA 1D1AA 1ST6A 3EJNA 3EGDA 5BUOA 3V7OA 4AE4B 2VASA 4U5FE 4XLNF 4KNWA 4O6YA 4OIRF 2FFHA 2R7WA 3VYWA 4OIOF 2C04A 2ZXRA 4E7ZA 2ZXOA 4CS8A 2G3VA 2WVNA 3POVA 1V55C 2IYLD 4U5DE 3SEOA 3AQBA 4C7OB 3T6JA 4U5HA 3RFYA 4DBQA 3TD7A 1TKNA 4JJFA 2KJGA 4ANJA 2G62A 3I5QA 4KI2A 3FVYA 3S0XA 1JPNA 2V26A 1IZMA 2VH3A 4C3EA 1ZHTA 4C7OA 4O79A 4K0DA 2D5RB 2G3KA 4I1OB 2P6VA 4M63A 3UGPA 2NG1A 4PFPA 1VK5A 1SF8A 2WL8A 2V3CC 4EBBA 4BG0A 1OCCC 1M2OA 4AE4A 4IAOA 3EGDB 1VYKA 1JPJA 3EGXA 1D1BA 4C3BA 2XL4A 3ASNC 3HLZA 3K7DA 3NKDA 3S28A 4BJ5A 5KYUB 2YZSA 5DQTA 2J9WA 2E87A 4HEAJ 3DJNB 1M57C 2J45A 2J9VA 3ITFA 5DS6A 4OIPF 3EH2A 4FESA 1RJ9A 1D1CA 1V54C 3CQZA 4BJTA 3K1HA 5DVWA 1M2VB 5B1BC 3W8HA 2PP4A 3SNHA 4G7HF 4O6NA 1SZIA 4I3MA 1Z6AA 4ULWA 2DYRC 2J9UA 3NKEA 3Q6NA 5KYXB 4MQ9F 3ZG1A 2FGYA 3RKOF 1NU9C 2ZXPA 3K6BA 5CI9A 2Z15A 4PJNA 3ASOC 3E9VA 3DM5A 2WZLA 1FTSA 4X0RA 3L34A 3JRTA 3VAYA 4Q4ZF 4G0HA 1ZHZA 3FHDA 4QI2A 1N1CA 1M56C 2ZPAA 4HFFB 4O6MA 3GODA 1MMNA 2OCCC 2YEVA 3I4UA 3WG7C 4KBLA 2PX3A 4CBEA 2IXNA 4PJMA 5KYYA 1NZEA 5E3AA 3H65A 3AG4C 3JYHA 3EFOB 3LESA 5B3SC 4KC9A 1TWGA 2EIKC 4J32B 1PD1A 5DQZA 2CNWD 3B9QA 2W4MA 1NG1A 2NUTB 1IW7F 4QDLA 3EZHA 3LS1A 5KYWA 4BJ6A 2R7VA 3ABMC 4PK4A 2WZFA 2MWQA 3NYMA 4P6IC 2IOQA 4ZLCA 2R7QA 4W8KA 4LLEA 3B0UX 3CSKA 4QI0A 1LKXA 2NUPA 4XTKA 5HSWA 3UNGC 2J7PD 4U5CE 2R7SA 3DAFA 3ZC4A 3ABLC 3NYJA 2L9JA 4N06A 4F4BA 4LACB 4ZLDA 2CNWA 4J30B 2Q3TA 3JCUQ 3ABKC 3X1OA 5EHHA 2A68F 4A2NB 3K33A 3RIPA 1Z3IX 1OKKD 3T6BA 3FAJA 3LLKA 3DJUB 1TWAA 4U5BE 2R7TA 4CSAC 2WVOA 3ECSA 5DS4A 4CS8C 1D0YA 5T1DB 3EG9B 2H7BA 4CS9C 2A1DD 5E33A 3ZVRA 2J46A 2BE5F 4RBNA 4DBRA 4YT8A 3KH2A 4JVSA 5D92A 3T4RA 1VYIA 4G7ZF 2PF4E 1VMAA 4IJJA 3IEEA 5E2QA 1WGWA 3K66A 1FMWA 1D0XA 4H4KC 3UMIA 1NU7D 4AK9A 3JT1A 2XXAA 4FX5A 4YT2A 5B1AC 4PJLA 4BJ5C 3FDQA 3O6XA 3UGOA 2CDQA 3AG1C 3LEVA 2C03A 3NG1A 3QMKA 3L0IA 4YN0B 1LS1A 2IXMA 4OIQF 3M1CB 3QZCA 5F5FA 2QTVA 3DAGA 1ZHXA 2QY9A 3I5PA 4CIHA 5E3CA 4Q5SF 4B6IA 3EHNA 3EPVA 1PD0A 3F47A 1J8MF 4RDAA 4IRUA 3PMRA 4U5EE 3CZ6A 2J0WA 3N24A 4GEHA 2O9XA 2H7OA 1FFHA 3AQCA 2W9YA 4I1MA 1OCZC 3LNRA 3EHMA 4E7SA 4JJGA 3EH1A 2Y3HA 3AG2C 5CI8A 3W8IA 3E70C 5KYNA 3HTKC 2CGEA 1ZU4A 5T3WA 2Q9AA 4HFKB 3DXJF 4JURI 2P7VA 3DZAA 3HJCA 2XXAB 3OA1A 4DOZA 2I8BA 1O87A 2EILC 1ZHYA 4G7OF 4YT5A 5D91A 2L81A 3JSZA 3DD7A 3UR3C 2KNHA 3ZIBA 1Z23A 3DM9B 2WZGA 2B0JA 2EIJC 2PFDA 3B0VC 4CS7A 5L3VA 5DLJA 2ZXWC 4DVYP 3EG9A 1MMDA 1Z5ZA 2Y39A 4OINF 1BR2A 5T3TA 4GYTA 3S29A 3KL4A 1FMVA 4JCHA 4CS9A 1VOMA 2HV7A 2M4EA 2Y3DA 2A6HF 3LLIA 2LSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DZA A; 
#chains in the Genus database with same CATH topology
 1G8X A;  2Q00 A;  1ZVZ A;  2NSG A;  1ZHW A;  1OKK A;  1C02 A;  1I4Y A;  4MW3 A;  4IWB A;  1MMG A;  2OG2 A;  2Q7R A;  4CDY A;  1CGN A;  1LVK A;  5FZT A;  2P0N A;  3IHU A;  1WOL A;  3QW0 A;  2CW0 F;  4FWV A;  1QQ3 A;  2XS1 A;  2Y3B A;  2KQ9 A;  2NUP B;  3JTL O;  2PNO A;  3K1I C;  5EK0 A;  3SP1 A;  4MND A;  3C62 A;  4YT4 A;  4DJ9 A;  2J0X A;  1BBH A;  2Q9C A;  4BJ6 C;  3M4B A;  3SZR A;  2HMZ A;  3LS0 A;  1C03 A;  1J8Y F;  2YHS A;  4JTC B;  3V5X A;  5EGY A;  2WVQ A;  1OR2 A;  4YWQ A;  1D0Z A;  2H7V C;  4JZA A;  4NC3 A;  2MYS A;  3NRH A;  3KMI A;  4NTB A;  4PFO A;  5EHH A;  5KYW B;  1ZYR F;  2EIN C;  2KW3 C;  2XSE A;  1CGO A;  5FCL A;  1MND A;  2W45 A;  3BRJ A;  3W2V A;  1E84 A;  1H9G A;  2NUT A;  3KKB A;  3TJ6 A;  5K0I A;  1S7Z A;  2I15 A;  2YQY A;  5COF A;  3U8P A;  4FAP B;  1BR1 A;  1OCR C;  1G4U S;  1OW6 A;  2A69 F;  3MLG A;  4KNV A;  4N6C A;  4W8P A;  2Y69 C;  3H2V A;  2DYS C;  3AGT A;  3WOD F;  1NFN A;  3Q6M A;  3R7C A;  1OCO C;  1MMA A;  1Y6D A;  1QZX A;  4IB4 A;  3S84 A;  2R7R A;  1EKY A;  3MX3 A;  3B0P A;  1T6Q A;  3Q7G A;  4JIO A;  4Q7C A;  1Z63 A;  2AWY A;  4CDV A;  3S9O A;  1A41 A;  3AG3 C;  3LJB A;  3VM6 A;  5L0J A;  4O7G A;  3EFO A;  2YLG A;  3RVY A;  3C8G D;  2RD9 A;  2JD3 A;  3DE8 A;  2P61 A;  3MYF A;  4P9F A;  4AL0 A;  5KYY B;  2IXP A;  3M4C A;  3OEO A;  4YJW A;  4U5G A;  1O5H A;  5F5H A;  5JUA A;  4CSA A;  2KGO A;  3UMH A;  2QLA A;  2R7X A;  2M64 A;  3AJM A;  4J7T A;  1VTM P;  4CX9 A;  2OEV A;  2AP3 A;  2HV6 A;  2Y3G A;  4XWJ A;  3X2Q C;  3RH3 A;  3ZSU A;  3IQT A;  4H54 A;  1KU2 A;  4PJJ A;  2L6G A;  1ZU5 A;  2X51 A;  4DVZ A;  4EBJ A;  4JE9 A;  3KYJ A;  3L1M A;  1B68 A;  3M79 A;  2GFH A;  4K7B A;  3PHF 2;  1OXK A;  3U0C A;  2BL2 A;  1TWH A;  4K1O A;  4LER A;  4OD5 A;  4WAB A;  3F46 A;  4MTF A;  3JSE O;  4C3D A;  3DMD A;  2A6E F;  5JP7 A;  1XZQ A;  5DS5 A;  4P9T A;  2PX0 A;  4NY3 A;  1TWC A;  5AC4 A;  3QW1 A;  2Q9B A;  4I44 A;  3SXM A;  1ZZP A;  2L7A A;  4BEJ A;  3FAP B;  1YZA A;  2YL3 A;  4YL1 A;  2BC5 A;  3U3B A;  1QLE C;  2R7O A;  3IPM O;  1K40 A;  3IQ5 A;  3N2Z B;  1G4W R;  3EZI A;  5KYX A;  2XM4 A;  2VB6 A;  5L3Q A;  1MNE A;  2J7P A;  2R05 A;  1F1M A;  3N0T A;  2W4B A;  3GM1 A;  4HE8 D;  4AX2 A;  4OD4 A;  5IY5 C;  2R9R B;  5COG A;  4IAR A;  3RYL A;  1M2V A;  3ZTZ A;  1M6T A;  1FFT C;  3UMK A;  2A0B A;  4YL0 A;  3A11 A;  3CAX A;  3ZQV A;  1GM5 A;  4G78 A;  1W2W A;  1T6I A;  1K04 A;  4BJ1 A;  1T9K A;  1RJ9 B;  1Y4C A;  2XLV A;  4JTA B;  4NTA A;  4WJ0 A;  2DI3 A;  3ATP A;  3Q7L A;  4XPX A;  3S27 A;  2DB4 A;  3GEH A;  3VF0 A;  3EQL F;  2UUH A;  3W2W A;  4LLC A;  4BPM A;  4XLP F;  2EIM C;  2R7U A;  3DI5 A;  1HW1 A;  4RD9 A;  1SMY F;  1SYQ A;  3OWT A;  3SYN A;  1PCX A;  2IXO A;  2XS8 A;  3LAY A;  3NYL A;  4EWC A;  2LP4 A;  1TR2 A;  3B29 A;  3JRM O;  3SXZ A;  5JS5 A;  2DGJ A;  5KYU A;  3NDB B;  3O39 A;  4JW1 A;  2XRH A;  2XLM A;  2WB7 A;  3RF3 A;  1BR4 A;  3EGX B;  3GAN A;  3TQO A;  1D1A A;  1ST6 A;  3EJN A;  3C8G B;  3EGD A;  4MTG A;  3V7O A;  2HKV A;  4AE4 B;  5BUO A;  2F22 A;  2VAS A;  2HZ8 A;  1T6U A;  3LNM B;  2CYD A;  1WN0 A;  4U5F E;  1AVO B;  2OQM A;  4KNW A;  4XLN F;  2X0C A;  4O6Y A;  2HMQ A;  2KC3 A;  4OIR F;  2FFH A;  2R7W A;  5L0C A;  1YVI A;  3VYW A;  2XLW A;  4MVU A;  2C04 A;  4YL3 A;  4OIO F;  5JRA A;  2ZXR A;  1JMW A;  3NMJ A;  1WAT A;  2KK1 A;  4E7Z A;  2ZXO A;  5A69 A;  1YYX A;  4BEM J;  4CS8 A;  2G3V A;  2WVN A;  4MW8 A;  2JPU A;  3GM3 A;  3POV A;  1YLM A;  1V55 C;  2IYL D;  4U5D E;  2VCA A;  3SEO A;  1SR2 A;  3AQB A;  2L6F A;  4C7O B;  4YK5 A;  3ZTM A;  3T6J A;  3GWN A;  4U5H A;  2H8A A;  3RFY A;  2J9B A;  4DBQ A;  1APC A;  3TD7 A;  1H9T A;  1TKN A;  5A6K A;  4JJF A;  2KJG A;  4ANJ A;  4XPY A;  4E18 A;  2G62 A;  3V5Z A;  3I5Q A;  2LFD A;  4Z9J A;  1ORY A;  4KI2 A;  3IQC A;  1AUE A;  3FVY A;  3U2M A;  3S0X A;  1JPN A;  2V26 A;  5A6A A;  1IZM A;  1V4A A;  2VH3 A;  4C3E A;  1ZHT A;  2D4U A;  4C7O A;  1LE2 A;  1I5N A;  2HJM A;  2QUP A;  5COM A;  4O79 A;  4K0D A;  5L0F A;  2D5R B;  4CJG A;  2G3K A;  1ZW3 A;  2P6V A;  4I1O B;  1Q0D A;  4M63 A;  2AWC A;  3UGP A;  1LPE A;  1VB5 A;  2NG1 A;  4PFP A;  1VK5 A;  1SF8 A;  1YA7 O;  4MVR A;  1YAR O;  2AU5 A;  2WL8 A;  2RSE B;  2V3C C;  2J8W A;  1HMD A;  2HUJ A;  2A0U A;  4AL1 A;  3C18 A;  3FOP A;  1E2X A;  1ORS C;  4EBB A;  4BG0 A;  3LEO A;  1BDJ B;  1OCC C;  1M2O A;  3LUT B;  4AE4 A;  4IAO A;  3C8G A;  1VYK A;  3EGD B;  1JPJ A;  5TJ5 E;  3U9M A;  3EGX A;  1D1B A;  4C3B A;  2XL4 A;  4MTO A;  3RW0 A;  3ASN C;  3HLZ A;  3K7D A;  2YL7 A;  3NKD A;  3S28 A;  4BJ5 A;  5KYU B;  1A7D A;  1Q0K A;  3G4X A;  3G50 A;  1WWP A;  2YZS A;  3RVZ A;  5DQT A;  2J9W A;  4DXW A;  1L3P A;  2ASR A;  2E87 A;  3BEH A;  3AGU A;  2B0H A;  4HEA J;  3DJN B;  1M57 C;  2J9V A;  2HSB A;  2J45 A;  2LD6 A;  2ZD9 A;  3ITF A;  3K1I A;  4GQH A;  2GWW A;  3EH2 A;  4FES A;  5DS6 A;  4OIP F;  1RJ9 A;  1D1C A;  1V54 C;  3CQZ A;  3O10 A;  4BJT A;  3QVZ A;  4U9D A;  3MFN A;  3B0V C;  3K1H A;  5DVW A;  1TFO B;  1M2V B;  2QE9 A;  3G4Z A;  1YZC A;  5B1B C;  3W8H A;  2PP4 A;  3SNH A;  2GA0 A;  3ZDL A;  4O6N A;  2UUI A;  4G7H F;  1EQ1 A;  1SZI A;  2EPM X;  4I3M A;  3ZWI A;  1Z6A A;  2IBF A;  4ULW A;  4ER9 A;  4MVQ A;  2DYR C;  2J9U A;  3NKE A;  3Q6N A;  3W4Y A;  5KYX B;  4MQ9 F;  3ZG1 A;  1T01 A;  2FGY A;  3RKO F;  1NU9 C;  2ZXP A;  1HE1 A;  3K6B A;  1A7V A;  2FAP B;  2Z15 A;  3HKK A;  4LDR A;  5CI9 A;  3VRC A;  4D4X A;  4PJN A;  4MS2 A;  3U3F A;  3ASO C;  2TMV P;  4CIP A;  3E9V A;  4JEA A;  3DM5 A;  2WZL A;  1FTS A;  2YLI A;  4MVO A;  3DKA A;  4X0R A;  3L34 A;  3JRT A;  4XPW A;  3VAY A;  4Q4Z F;  3FXH A;  4G0H A;  1KTM A;  1K05 A;  1ZHZ A;  2OEX A;  3FHD A;  4QI2 A;  1L7C A;  3HNL A;  2VCC A;  1DOW A;  1N1C A;  256B A;  4JRZ A;  1M56 C;  2ZPA A;  4HFF B;  4LDQ A;  2HS5 A;  5JLI A;  3NMK A;  1G5Z A;  1T5O A;  4O6M A;  3GOD A;  1MMN A;  3U9J A;  2OCC C;  2YWA A;  2YEV A;  4JC7 A;  1HY5 A;  1YA9 A;  1GS9 A;  1HE9 A;  1V74 B;  2EPN A;  2NPU A;  3I4U A;  1NBB A;  3WG7 C;  4N6H A;  2LFF A;  1TQG A;  4KBL A;  2HFI A;  4XEK A;  2PX3 A;  4CBE A;  2IXN A;  3U8V A;  4PJM A;  3GM2 A;  5A6B D;  5KYY A;  3NMI A;  1I4Z A;  3C7J A;  4Z9I A;  1NZE A;  1OQC A;  3S90 A;  1JAF A;  5E3A A;  4NCQ A;  4NTF A;  3C8Z A;  2JX0 A;  3AG4 C;  3H65 A;  1UG7 A;  3JYH A;  3TUL A;  3EFO B;  2VC9 A;  3LES A;  2LCH A;  4KC9 A;  5B3S C;  3JZ0 A;  1TWG A;  2EIK C;  1CGM E;  4J32 B;  1Q0G A;  1PD1 A;  1NSG B;  2LQG A;  5DQZ A;  3PDM P;  3T9O A;  1HW2 A;  3HNJ A;  5BQG A;  2YKZ A;  2CNW D;  3B9Q A;  2W4M A;  3DE9 A;  1U0B B;  2Q4F A;  2XLH A;  4JTD B;  1NG1 A;  4R32 A;  4XEF A;  1U6H A;  1QKR A;  3FOO A;  2NUT B;  1IW7 F;  1VLS A;  1OR3 A;  3QVY A;  4JEB A;  3U2L A;  2NSF A;  5BQH A;  4QDL A;  3EZH A;  2KYH A;  2R02 A;  3LS1 A;  1Q0F A;  1QPU A;  5KYW A;  4BJ6 A;  2R7V A;  3GOR A;  4MVS A;  1BZ4 A;  3ABM C;  4PK4 A;  2CCY A;  2EPO A;  2MWQ A;  2WZF A;  2OU6 A;  4A4A A;  3NYM A;  4P6I C;  4LDK A;  4CJO A;  1YAU O;  2IOQ A;  2XL6 A;  1QVX A;  5B3I A;  1CPQ A;  3TK0 A;  4ZLC A;  2R7Q A;  2VCB A;  4W8K A;  4LLE A;  3B0U X;  3CSK A;  4XEV A;  2XM0 A;  2GDC A;  1LKX A;  2PBE A;  4QI0 A;  2XLD A;  2MHR A;  1ORJ A;  2NUP A;  4XTK A;  3TOM A;  3HNI A;  5HSW A;  3J06 A;  4DRH B;  4JCZ A;  3UNG C;  2J7P D;  4U5C E;  2R7S A;  4J7Y A;  3DAF A;  1H7I A;  3ZC4 A;  1YYJ A;  3ABL C;  3GEE A;  2L9J A;  2LK4 A;  3NYJ A;  4LAC B;  4N06 A;  4F4B A;  4ZLD A;  2CNW A;  4J30 B;  2Q3T A;  3RQE A;  4NQF A;  1WAS A;  3ABK C;  3JCU Q;  3TOL A;  1EI7 A;  2A68 F;  2OOC A;  1DOV A;  3X1O A;  4A2N B;  4E0H A;  3GEI A;  3K33 A;  3RIP A;  4EKW A;  1Z3I X;  3M15 A;  3L8J A;  2EPL X;  3A9C A;  5AC5 A;  1OKK D;  1UFB A;  3T6B A;  3FAJ A;  2YVK A;  1LS4 A;  3LLK A;  3DJU B;  1TWA A;  4U5B E;  5A6J A;  3H2U A;  4IGG A;  2GAQ A;  4CSA C;  2R7T A;  2WVO A;  3ECS A;  5DS4 A;  4WGY A;  2IM8 A;  1U89 A;  3CEX A;  4CS8 C;  5L0H A;  1D0Y A;  4N4W A;  2YRF A;  4EHP A;  1RKC A;  1RXQ A;  5T1D B;  3EG9 B;  3MBG A;  2H7B A;  1RKE B;  1QSP A;  2LIG A;  4CS9 C;  4DRI B;  5L0I A;  1Q0M A;  1S05 A;  1E83 A;  2A1D D;  3B71 A;  5E33 A;  2YLD A;  2XLO A;  3ZVR A;  5JT4 A;  2J46 A;  2BE5 F;  4RBN A;  4DBR A;  4PR9 A;  3DWW A;  4YT8 A;  3SXY A;  3KH2 A;  4D4N A;  1A7E A;  4JVS A;  3V5Y A;  5D92 A;  3T4R A;  1OW7 A;  1HMO A;  1VYI A;  4G7Z F;  1JRA A;  1O3U A;  2PF4 E;  4U9E A;  1VMA A;  4ULV A;  4WGZ A;  4IJJ A;  3IEE A;  2EPK X;  5E2Q A;  1WGW A;  5F28 E;  3K66 A;  1FMW A;  1D0X A;  3QTH A;  4H4K C;  2P1A A;  3UMI A;  1NU7 D;  3L8I A;  3FMS A;  3C63 A;  3JT1 A;  3KYI A;  3ZQY A;  4AK9 A;  4EIY A;  2XXA A;  4FX5 A;  4YT2 A;  5B1A C;  4PJL A;  3O55 A;  4MVM A;  3TJ5 A;  4BJ5 C;  3FDQ A;  1RMV A;  2YL0 A;  3O6X A;  1XZP A;  1C17 M;  3UGO A;  2CDQ A;  5L0D A;  2AVK A;  1XWJ A;  3AG1 C;  2ICW G;  3LEV A;  2C03 A;  3NG1 A;  3QMK A;  3L0I A;  4YN0 B;  1YJG A;  5JVE A;  1LS1 A;  2IXM A;  4OIQ F;  3M1C B;  1JR8 A;  3QZC A;  4E17 A;  5L0G A;  2R25 A;  2QTV A;  3DAG A;  5F5F A;  5BQI A;  4DRJ B;  1ZHX A;  2QY9 A;  2HSQ A;  3I5P A;  2OKU A;  3IQ6 A;  5E3C A;  1TFK B;  4CIH A;  5HV9 A;  4Q5S F;  4B6I A;  3EHN A;  3EPV A;  1PD0 A;  3F47 A;  1VLT A;  1J8M F;  1GGQ A;  1OW8 A;  2OJE D;  4RDA A;  4IRU A;  1OXB A;  3SXK A;  3PMR A;  4U5E E;  3CZ6 A;  4IAQ A;  2J0W A;  3N24 A;  4Z9H A;  1LIH A;  4GEH A;  2O9X A;  2H7O A;  5AGF A;  1EA8 A;  1FFH A;  1LI5 A;  3AQC A;  2W9Y A;  4I1M A;  1OCZ C;  3LNR A;  3EHM A;  3RQF A;  1A0B A;  4E7S A;  1KNY A;  3AOU A;  2KSF A;  5A6B A;  3PCV A;  4MVZ A;  4JJG A;  1YDI A;  3EH1 A;  4JKV A;  2R03 A;  1H6G A;  2Y3H A;  3AG2 C;  5CI8 A;  3W8I A;  5CIV A;  3E70 C;  2XLE A;  5KYN A;  1AEP A;  3HTK C;  4EUK B;  2YL1 A;  2CGE A;  3HNK A;  1ZU4 A;  3RQG A;  5T3W A;  3WHN A;  1NLX A;  2Q9A A;  4HFK B;  3DXJ F;  2QNL A;  4JUR I;  2L6H A;  2P7V A;  1R5I D;  3DZA A;  3HJC A;  2XXA B;  3OA1 A;  3T6G B;  4DOZ A;  2I8B A;  1O87 A;  2EIL C;  3MYI A;  1ZHY A;  1RCP A;  1FAP B;  1LM3 B;  4G7O F;  4YT5 A;  5JSL A;  5D91 A;  4E0I A;  2L81 A;  3JSZ A;  1PV3 A;  3DD7 A;  3UR3 C;  1E86 A;  2KNH A;  3ZIB A;  1LE4 A;  2XL8 A;  5GPG B;  1Z23 A;  4UDV A;  4EBK A;  2ETS A;  3DM9 B;  2WZG A;  2B0J A;  2EIJ C;  2PFD A;  1Z7Q c;  3KPH A;  3GWL A;  4CDA A;  5DLJ A;  4CS7 A;  1NFO A;  2ZXW C;  1ZW2 A;  4DVY P;  5L3V A;  1GQA A;  2OJQ A;  1CPR A;  1RKE A;  3EG9 A;  1MMD A;  3JYY A;  1Z5Z A;  2HJ3 A;  4PAC A;  2Y39 A;  4OIN F;  1E85 A;  1FNT c;  1BR2 A;  4L6R A;  4ONS A;  5T3T A;  4GYT A;  3S29 A;  1MQV A;  1LI7 A;  1WTY A;  3R2P A;  3KL4 A;  3WAQ A;  3U5S A;  1FMV A;  1JOG A;  4JCH A;  4CS9 A;  1R4T A;  1VOM A;  2HV7 A;  1FR0 A;  4XQ1 A;  2M4E A;  3US6 A;  2Y3D A;  2A6H F;  3LLI A;  2LSE A; 
#chains in the Genus database with same CATH homology
 1G8X A;  1ZHW A;  1OKK A;  4IWB A;  1MMG A;  2OG2 A;  1LVK A;  4FWV A;  2CW0 F;  2Y3B A;  2KQ9 A;  2NUP B;  3SP1 A;  3K1I C;  4MND A;  4YT4 A;  2J0X A;  2Q9C A;  4BJ6 C;  3SZR A;  3LS0 A;  2YHS A;  1J8Y F;  5EGY A;  2WVQ A;  4YWQ A;  1D0Z A;  2H7V C;  4JZA A;  2MYS A;  3NRH A;  3KMI A;  4PFO A;  5KYW B;  1ZYR F;  2EIN C;  2KW3 C;  2XSE A;  5FCL A;  1MND A;  2W45 A;  3W2V A;  2NUT A;  3KKB A;  1S7Z A;  1BR1 A;  1OCR C;  2A69 F;  3MLG A;  4KNV A;  2Y69 C;  2DYS C;  3WOD F;  3Q6M A;  1OCO C;  1MMA A;  1QZX A;  2R7R A;  3MX3 A;  3B0P A;  3Q7G A;  4Q7C A;  1Z63 A;  3AG3 C;  3LJB A;  4O7G A;  3EFO A;  2JD3 A;  5KYY B;  2IXP A;  3OEO A;  5F5H A;  4YJW A;  4U5G A;  1O5H A;  4CSA A;  2KGO A;  3UMH A;  2R7X A;  2HV6 A;  2Y3G A;  4XWJ A;  3X2Q C;  3ZSU A;  3RH3 A;  4PJJ A;  1KU2 A;  1ZU5 A;  2X51 A;  4DVZ A;  2GFH A;  4K7B A;  3PHF 2;  1TWH A;  4LER A;  4OD5 A;  3F46 A;  4C3D A;  3DMD A;  2A6E F;  5DS5 A;  2PX0 A;  4NY3 A;  1TWC A;  2Q9B A;  4I44 A;  4BEJ A;  1QLE C;  2R7O A;  5KYX A;  3N2Z B;  3EZI A;  2VB6 A;  5L3Q A;  1MNE A;  2J7P A;  3N0T A;  2W4B A;  4HE8 D;  4AX2 A;  4OD4 A;  5IY5 C;  3RYL A;  1M2V A;  1FFT C;  3UMK A;  1W2W A;  4BJ1 A;  1RJ9 B;  4WJ0 A;  3Q7L A;  3S27 A;  3W2W A;  3EQL F;  2R7U A;  4LLC A;  4XLP F;  2EIM C;  4RD9 A;  1SMY F;  3OWT A;  3SYN A;  1PCX A;  2IXO A;  3NYL A;  3LAY A;  4EWC A;  1TR2 A;  2DGJ A;  5KYU A;  3NDB B;  3O39 A;  4JW1 A;  2XRH A;  2WB7 A;  1BR4 A;  3EGX B;  3GAN A;  1D1A A;  1ST6 A;  3EJN A;  3EGD A;  5BUO A;  3V7O A;  4AE4 B;  2VAS A;  4U5F E;  4XLN F;  4KNW A;  4O6Y A;  4OIR F;  2FFH A;  2R7W A;  3VYW A;  4OIO F;  2C04 A;  2ZXR A;  4E7Z A;  2ZXO A;  4CS8 A;  2G3V A;  2WVN A;  3POV A;  1V55 C;  2IYL D;  4U5D E;  3SEO A;  3AQB A;  4C7O B;  3T6J A;  4U5H A;  3RFY A;  4DBQ A;  3TD7 A;  1TKN A;  4JJF A;  2KJG A;  4ANJ A;  2G62 A;  3I5Q A;  4KI2 A;  3FVY A;  3S0X A;  1JPN A;  2V26 A;  1IZM A;  2VH3 A;  4C3E A;  1ZHT A;  4C7O A;  4O79 A;  4K0D A;  2D5R B;  2G3K A;  4I1O B;  2P6V A;  4M63 A;  3UGP A;  2NG1 A;  4PFP A;  1VK5 A;  1SF8 A;  2WL8 A;  2V3C C;  4EBB A;  4BG0 A;  1OCC C;  1M2O A;  4AE4 A;  4IAO A;  3EGD B;  1VYK A;  1JPJ A;  3EGX A;  1D1B A;  4C3B A;  2XL4 A;  3ASN C;  3HLZ A;  3K7D A;  3NKD A;  3S28 A;  4BJ5 A;  5KYU B;  2YZS A;  5DQT A;  2J9W A;  2E87 A;  4HEA J;  3DJN B;  1M57 C;  2J45 A;  2J9V A;  3ITF A;  5DS6 A;  4OIP F;  3EH2 A;  4FES A;  1RJ9 A;  1D1C A;  1V54 C;  3CQZ A;  4BJT A;  3K1H A;  5DVW A;  1M2V B;  5B1B C;  3W8H A;  2PP4 A;  3SNH A;  4G7H F;  4O6N A;  1SZI A;  4I3M A;  1Z6A A;  4ULW A;  2DYR C;  2J9U A;  3NKE A;  3Q6N A;  5KYX B;  4MQ9 F;  3ZG1 A;  2FGY A;  3RKO F;  1NU9 C;  2ZXP A;  3K6B A;  5CI9 A;  2Z15 A;  4PJN A;  3ASO C;  3E9V A;  3DM5 A;  2WZL A;  1FTS A;  4X0R A;  3L34 A;  3JRT A;  3VAY A;  4Q4Z F;  4G0H A;  1ZHZ A;  3FHD A;  4QI2 A;  1N1C A;  1M56 C;  2ZPA A;  4HFF B;  4O6M A;  3GOD A;  1MMN A;  2OCC C;  2YEV A;  3I4U A;  3WG7 C;  4KBL A;  2PX3 A;  4CBE A;  2IXN A;  4PJM A;  5KYY A;  1NZE A;  5E3A A;  3H65 A;  3AG4 C;  3JYH A;  3EFO B;  3LES A;  5B3S C;  4KC9 A;  1TWG A;  2EIK C;  4J32 B;  1PD1 A;  5DQZ A;  2CNW D;  3B9Q A;  2W4M A;  1NG1 A;  2NUT B;  1IW7 F;  4QDL A;  3EZH A;  3LS1 A;  5KYW A;  4BJ6 A;  2R7V A;  3ABM C;  4PK4 A;  2WZF A;  2MWQ A;  3NYM A;  4P6I C;  2IOQ A;  4ZLC A;  2R7Q A;  4W8K A;  4LLE A;  3B0U X;  3CSK A;  4QI0 A;  1LKX A;  2NUP A;  4XTK A;  5HSW A;  3UNG C;  2J7P D;  4U5C E;  2R7S A;  3DAF A;  3ZC4 A;  3ABL C;  3NYJ A;  2L9J A;  4N06 A;  4F4B A;  4LAC B;  4ZLD A;  2CNW A;  4J30 B;  2Q3T A;  3JCU Q;  3ABK C;  3X1O A;  5EHH A;  2A68 F;  4A2N B;  3K33 A;  3RIP A;  1Z3I X;  1OKK D;  3T6B A;  3FAJ A;  3LLK A;  3DJU B;  1TWA A;  4U5B E;  2R7T A;  4CSA C;  2WVO A;  3ECS A;  5DS4 A;  4CS8 C;  1D0Y A;  5T1D B;  3EG9 B;  2H7B A;  4CS9 C;  2A1D D;  5E33 A;  3ZVR A;  2J46 A;  2BE5 F;  4RBN A;  4DBR A;  4YT8 A;  3KH2 A;  4JVS A;  5D92 A;  3T4R A;  1VYI A;  4G7Z F;  2PF4 E;  1VMA A;  4IJJ A;  3IEE A;  5E2Q A;  1WGW A;  3K66 A;  1FMW A;  1D0X A;  4H4K C;  3UMI A;  1NU7 D;  4AK9 A;  3JT1 A;  2XXA A;  4FX5 A;  4YT2 A;  5B1A C;  4PJL A;  4BJ5 C;  3FDQ A;  3O6X A;  3UGO A;  2CDQ A;  3AG1 C;  3LEV A;  2C03 A;  3NG1 A;  3QMK A;  3L0I A;  4YN0 B;  1LS1 A;  2IXM A;  4OIQ F;  3M1C B;  3QZC A;  5F5F A;  2QTV A;  3DAG A;  1ZHX A;  2QY9 A;  3I5P A;  4CIH A;  5E3C A;  4Q5S F;  4B6I A;  3EHN A;  3EPV A;  1PD0 A;  3F47 A;  1J8M F;  4RDA A;  4IRU A;  3PMR A;  4U5E E;  3CZ6 A;  2J0W A;  3N24 A;  4GEH A;  2O9X A;  2H7O A;  1FFH A;  3AQC A;  2W9Y A;  4I1M A;  1OCZ C;  3LNR A;  3EHM A;  4E7S A;  4JJG A;  3EH1 A;  2Y3H A;  3AG2 C;  5CI8 A;  3W8I A;  3E70 C;  5KYN A;  3HTK C;  2CGE A;  1ZU4 A;  5T3W A;  2Q9A A;  4HFK B;  3DXJ F;  4JUR I;  2P7V A;  3DZA A;  3HJC A;  2XXA B;  3OA1 A;  4DOZ A;  2I8B A;  1O87 A;  2EIL C;  1ZHY A;  4G7O F;  4YT5 A;  5D91 A;  2L81 A;  3JSZ A;  3DD7 A;  3UR3 C;  2KNH A;  3ZIB A;  1Z23 A;  3DM9 B;  2WZG A;  2B0J A;  2EIJ C;  2PFD A;  3B0V C;  4CS7 A;  5L3V A;  5DLJ A;  2ZXW C;  4DVY P;  3EG9 A;  1MMD A;  1Z5Z A;  2Y39 A;  4OIN F;  1BR2 A;  5T3T A;  4GYT A;  3S29 A;  3KL4 A;  1FMV A;  4JCH A;  4CS9 A;  1VOM A;  2HV7 A;  2M4E A;  2Y3D A;  2A6H F;  3LLI A;  2LSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...