3DZAA

Crystal structure of a putative membrane protein of unknown function (yfdx) from klebsiella pneumoniae subsp. at 1.65 a resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
180
structure length
180
Chain Sequence
APAAAATTQVQKEAADVLQVAVQGANAMRDIQFARLALFHGQPDSAKKLTDDAAALLAADDASWAKFVKTDAKAKMIADRYVIINASIALSEDYVATPEKESAIQSANEKLAKGDQKGAIDTLRLAGIGVIENQYLMPLNQTRKAVAQSQELLKAGKYYEANLVLKGAEEGIVVDSEMLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized putative membrane protein
publication title Crystal structure of putative membrane protein of unknown function (YP_001337144.1) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 1.65 A resolution
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
molecule tags Unknown function
total genus 66
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10938 YfdX YfdX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1940 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dzaA01
3DZAA
chains in the Genus database with same CATH superfamily
3G50A 1QKRA 4PJNA 4Z9IA 4OIQF 5B3SC 2IXNA 2KYHA 4WJ0A 2DYSC 4DOZA 4E18A 4NQFA 1BZ4A 2HSQA 2VCAA 2VASA 4HE8D 4PJJA 1HMOA 3L8JA 1FR0A 1I5NA 1CPRA 1MMAA 4CX9A 5FZTA 1A7EA 2LK4A 3N0TA 3ASNC 5B1BC 4YN0B 3AG4C 4QI0A 4FESA 4H54A 5JSLA 1ZHXA 2C03A 4GYTA 4N06A 4W8PA 1FTSA 3US6A 5B1AC 3ZQYA 2PP4A 3S0XA 2VCBA 4MVUA 4JIOA 2ZPAA 2H8AA 2R03A 1H6GA 1T01A 2OJED 2ZXOA 4P9TA 4U5CE 1MMDA 2OEXA 3JZ0A 4J30B 3S29A 4GQHA 4WABA 3K1HA 4NC3A 1XZPA 1G4US 2XM0A 3VRCA 3UGPA 1M57C 5L3VA 1OQCA 1ZVZA 4RDAA 2NUTB 3O10A 1V74B 4BJ5A 3CEXA 3LAYA 2MYSA 4BJ6A 2QTVA 3V5ZA 3C63A 5A6BA 3C8GB 3H65A 4M63A 1YAUO 3ZQVA 1N1CA 3V5YA 1EA8A 2R7XA 3MLGA 4CS9A 2NUPA 4IJJA 1SYQA 4XWJA 3ABMC 3FDQA 2Q3TA 2A6EF 4U5HA 4JEAA 2DYRC 3S84A 2ZXRA 4C3BA 1Z23A 4JCZA 4K1OA 1VB5A 2GFHA 3AQCA 1TFKB 3EG9A 2DB4A 2ICWG 1SR2A 3GEHA 5T3TA 4DVZA 4Q4ZF 1AEPA 1OKKD 1RXQA 3BRJA 3O55A 3IQ6A 1VOMA 3AGTA 3FAJA 3LEVA 3KMIA 3M15A 2J7PA 4J7YA 4EUKB 1FNTc 2IOQA 3PDMP 5D91A 4IAOA 3RW0A 1NFNA 1DOWA 3K7DA 2M64A 1J8YF 4LDKA 3RVYA 3T4RA 3EH1A 2AVKA 3VAYA 1E86A 1K05A 2Y3GA 4MTGA 2C04A 3PCVA 4XEVA 4LLCA 1LVKA 3X1OA 2XSEA 3NKEA 1ST6A 4XPWA 2P7VA 1NZEA 4JZAA 5L0CA 3EQLF 3N24A 1SZIA 1DOVA 1NLXA 2YLIA 5D92A 2YHSA 1PV3A 4A2NB 4DBRA 2L7AA 2VH3A 4U5DE 2QLAA 4YT4A 2BE5F 2XLOA 4FX5A 4MVOA 2E87A 1CPQA 2VCCA 4C7OA 5COFA 2GA0A 3RQEA 1D1BA 3K66A 4N4WA 2LCHA 4AE4B 3TOMA 1Q0FA 2L6FA 4NTFA 4JTDB 3EZHA 5DS4A 1OR2A 3K33A 2R7WA 2MWQA 5EGYA 2IXPA 2J8WA 2KK1A 4XEFA 1TR2A 3FOPA 1CGME 3M4BA 5JLIA 2WVNA 3C62A 3HLZA 2VC9A 4U5BE 1M6TA 2IBFA 3F46A 1QSPA 5E3AA 2CCYA 3DMDA 3JSZA 3JRMO 1ZW3A 2YZSA 3IHUA 3M1CB 4U5FE 3ZWIA 1RJ9A 2GWWA 3PMRA 3UMIA 2A68F 3L0IA 3H2UA 3KPHA 3GM2A 3C8GA 1D0YA 1A41A 1VLTA 4IB4A 4MW3A 3U2MA 3EPVA 2WVOA 4JRZA 4AL0A 2J9UA 4A4AA 4KI2A 1V55C 3IQCA 4YT2A 1A7DA 1U89A 3B29A 5COMA 4ZLCA 1V4AA 1JPNA 3AGUA 2XXAB 3GWNA 3HJCA 4LACB 5KYWA 3B0UX 3B0PA 4MTOA 3TD7A 2EINC 2XL6A 1Z5ZA 4KNWA 2Y3DA 5EK0A 2H7BA 2XL4A 1RMVA 2R7UA 2YRFA 3Q7LA 1OCZC 4R32A 3W2WA 2NSGA 2CNWD 2DI3A 1A0BA 4BEJA 1ORJA 4PACA 3KKBA 4YL1A 4JJGA 5EHHA 2KSFA 5JT4A 3UGOA 4O7GA 4BPMA 4G0HA 1WASA 2CYDA 1SF8A 2CGEA 2KW3C 3FXHA 3Q6MA 3DAFA 2RSEB 3QW1A 1FMWA 1I4ZA 5COGA 3ZTMA 4F4BA 3C18A 4AX2A 2QE9A 3JYHA 2H7OA 5F5HA 1U0BB 2WZLA 1AUEA 2OKUA 3B0VC 4BG0A 2R7VA 2R7TA 3GANA 4IGGA 3EZIA 4OIRF 1EQ1A 4K0DA 2J0WA 4H4KC 2XLVA 3AJMA 3OEOA 1A7VA 3NYJA 1T6UA 1RKEB 4CSAA 3C8ZA 3JSEO 1O87A 4B6IA 3JYYA 4D4NA 1Z63A 1E84A 1YARO 2IM8A 4IWBA 3JTLO 1NU7D 4AE4A 2D5RB 2PF4E 2AWYA 1BDJB 5E33A 3A9CA 3SYNA 2YL7A 1K40A 3H2VA 4YT5A 4BJTA 1YZCA 4CS8C 2Q9BA 1D0XA 2R7OA 4CJGA 2KC3A 3GM1A 4MS2A 1J8MF 1MNDA 2F22A 4I1OB 4QDLA 5DLJA 4EIYA 2W4BA 3U5SA 1AVOB 2EPMX 2M4EA 5TJ5E 3F47A 2X0CA 3RQGA 3RH3A 5HSWA 1YYJA 3IPMO 3FOOA 3O6XA 2LFDA 2L81A 4LDQA 3SXYA 3WG7C 1MMGA 3E9VA 4CDVA 4J32B 5BUOA 1OR3A 1APCA 4MVMA 1Z3IX 1UFBA 4PFPA 1YVIA 1HY5A 2A1DD 4HEAJ 4FWVA 3WAQA 4YWQA 3UNGC 2J0XA 1YZAA 5L0GA 1LKXA 1YLMA 1T9KA 1E83A 1KTMA 1WATA 4PK4A 4DVYP 5CI9A 4NY3A 4JC7A 4ANJA 3GEEA 3DZAA 2Q9CA 2XXAA 1OW8A 1G8XA 3ZSUA 3ABKC 4CIHA 3HNIA 1LS4A 2LIGA 2ZD9A 3OA1A 4MVRA 5L0HA 2R7SA 2AWCA 3C7JA 3U3BA 4Q7CA 2W9YA 5A69A 4JKVA 5T1DB 5DQTA 1ORSC 2GAQA 4CDAA 3VYWA 2VB6A 2DGJA 4CIPA 256BA 3MFNA 2HJMA 2V26A 1T6QA 3ASOC 4NTBA 3GORA 4JTAB 3SNHA 4E7ZA 5DS6A 2HKVA 3JCUQ 5KYXB 2R7RA 4JTCB 3UMKA 5AC5A 3S28A 3LNRA 2CW0F 3M79A 1YA7O 3LNMB 3I5QA 1F1MA 4YK5A 4EBKA 4IRUA 2YLDA 1D1CA 4U5GA 1QVXA 4O6MA 3DJUB 4P9FA 3LEOA 2G3VA 2WZGA 2YL0A 3ATPA 4I1MA 4XQ1A 4G7OF 3B9QA 1OW6A 1OW7A 3ECSA 4BJ5C 1OCCC 5JRAA 5DQZA 1I4YA 2B0JA 4BJ6C 3IQTA 3AG2C 4OIOF 2AP3A 1HMDA 3EGDB 2KGOA 5F5FA 4XTKA 2XRHA 3I5PA 3EHMA 4MVZA 2EIKC 3OWTA 3AG3C 4CS9C 2R9RB 4Z9HA 5E2QA 4DRJB 2KQ9A 3NMJA 1YYXA 2J9VA 1TQGA 5FCLA 2WL8A 1Q0GA 3O39A 3G4ZA 5JUAA 2V3CC 4L6RA 2IYLD 3MYFA 3SEOA 3KYJA 3J06A 1RCPA 2TMVP 3NDBB 1B68A 1FAPB 1M56C 1OKKA 3TJ5A 4DJ9A 2QY9A 4PFOA 5AC4A 3FHDA 2XLEA 3DKAA 3DWWA 4GEHA 1WOLA 4XPXA 2BL2A 2Y3BA 3SXKA 3JRTA 3TK0A 5JVEA 1HW2A 1VK5A 2OQMA 4YL0A 1ZW2A 2NUTA 2LFFA 3RKOF 1H7IA 3JT1A 3E70C 1MQVA 1FMVA 3K1IA 3WODF 2PX3A 1E2XA 3TJ6A 1NU9C 1R5ID 2HV6A 1GGQA 2JD3A 1H9GA 1TWHA 4QI2A 5IY5C 2HS5A 4MQ9F 2Q9AA 3LJBA 3QZCA 4U5EE 4JW1A 4MW8A 1VMAA 1R4TA 2I15A 2L6GA 2QUPA 3POVA 5A6JA 5CIVA 3U9JA 4PJLA 2H7VC 3RF3A 1CGNA 1W2WA 2HFIA 1MMNA 3EFOB 3S9OA 1G4WR 1O3UA 1Q0DA 3TULA 4RBNA 1JRAA 3B71A 3CZ6A 1T6IA 3DI5A 3U9MA 5KYYB 4OIPF 1M2OA 4CBEA 4YL3A 3DE8A 2WVQA 1YJGA 2OOCA 2EPKX 3QTHA 4IARA 2NPUA 4XPYA 1Z7Qc 3ZC4A 2R02A 3DD7A 4G7ZF 1QLEC 1FFTC 1LM3B 3FVYA 4MNDA 4N6CA 2OJQA 1HE9A 3RIPA 5A6KA 3S90A 3L8IA 1HW1A 2HSBA 1Z6AA 1C02A 3V5XA 2OCCC 2JPUA 3EGXB 4HFFB 3T6BA 4DRIB 1WGWA 2J45A 1ZYRF 2XLMA 3W8HA 4LDRA 4O6YA 2OEVA 3GM3A 1YDIA 3L34A 3EGDA 3Q7GA 3SXZA 5JS5A 2Q00A 3L1MA 3ZVRA 2NUPB 3UMHA 2XS8A 2A6HF 4XLPF 2Q4FA 1BR4A 1GQAA 3N2ZB 4DXWA 4J7TA 3ABLC 3CSKA 2HMZA 1OXKA 2P61A 3RFYA 3W8IA 3EG9B 1OXBA 2XLWA 5T3WA 2J46A 2W4MA 3AOUA 3EH2A 3ZTZA 1Q0KA 3TOLA 1Y6DA 2KJGA 1JAFA 2BC5A 2CNWA 1BR1A 1O5HA 3HNLA 2KNHA 2PX0A 1ORYA 1LI7A 5L0DA 2CDQA 4D4XA 5L3QA 2EIMC 1QQ3A 4DBQA 1WWPA 2ZXWC 2ZXPA 1QPUA 2PNOA 3NYLA 1L7CA 2MHRA 4KNVA 3HNJA 2PBEA 1VYKA 1JPJA 2YL1A 5E3CA 1C17M 4LERA 1M2VB 2XM4A 4PJMA 3RYLA 3LS1A 2HUJA 5A6BD 2YWAA 2ASRA 3NMKA 1NBBA 1S7ZA 1LE2A 5BQHA 3GEIA 4CS7A 1ZU5A 3FAPB 4E0HA 4ULWA 1EI7A 2I8BA 1WN0A 1KU2A 3HKKA 4C7OB 1OCOC 1LPEA 2GDCA 2X51A 3EFOA 4CSAC 1Y4CA 1PD0A 2LD6A 3ZG1A 1L3PA 5KYYA 1VYIA 2O9XA 4EBJA 2J7PD 3U8PA 1RKCA 2L9JA 3W4YA 4FAPB 1ZHYA 2EPNA 1G5ZA 3IQ5A 4JCHA 1JMWA 1TFOB 2Y39A 3UR3C 4E17A 2IXMA 3AQBA 3EJNA 3MX3A 1S05A 3W2VA 1RJ9B 3NYMA 5CI8A 3U3FA 1YA9A 1XZQA 2WB7A 3EGXA 1D0ZA 2HV7A 2XLHA 5L0FA 3LLKA 2NSFA 3A11A 3SP1A 5F28E 1H9TA 3ZIBA 4C3EA 1TWCA 2P1AA 2UUIA 3SZRA 3KYIA 2Y3HA 2P6VA 4KBLA 4ULVA 1ZHTA 4BEMJ 3CQZA 1LS1A 1TWGA 2A0UA 3DJNB 4MVSA 3PHF2 4O6NA 3T9OA 2EPOA 4BJ1A 5KYWB 3G4XA 3NKDA 1V54C 2G3KA 5JP7A 4ER9A 4PR9A 4Z9JA 1RKEA 5L0IA 3KH2A 3CAXA 3GODA 1E85A 2LSEA 4I44A 4YJWA 4DRHB 3LLIA 2Q7RA 2EILC 1T5OA 2YL3A 3Q6NA 3KL4A 3BEHA 1LE4A 5BQGA 4OINF 5KYNA 3FMSA 4ONSA 5DS5A 2XS1A 5L0JA 3M4CA 1VLSA 4EWCA 3U0CA 2Z15A 1ZHWA 3ZDLA 4WGZA 1MNEA 3U8VA 1PCXA 1JR8A 1U6HA 1IW7F 3V7OA 5KYUB 2Y69C 3DM5A 1M2VA 3NRHA 3U2LA 1HE1A 3DM9B 2J9BA 2R7QA 3C8GD 3AG1C 5DVWA 2FGYA 1BR2A 4UDVA 3RVZA 4OD5A 4IAQA 2YVKA 2D4UA 2EPLX 5K0IA 3T6GB 1KNYA 2ETSA 2AU5A 4NTAA 4JEBA 3LUTB 3I4UA 3MBGA 2LP4A 2HMQA 3DE9A 2OG2A 3TQOA 4ZLDA 5HV9A 2OU6A 4E0IA 4CDYA 4EKWA 3MYIA 1PD1A 1EKYA 1LI5A 1XWJA 2JX0A 2PFDA 4HFKB 4CJOA 4WGYA 1NFOA 1SMYF 1WTYA 3VM6A 3HTKC 3DXJF 1C03A 3LS0A 2HZ8A 1LIHA 2XL8A 1ZU4A 1Q0MA 2IXOA 3HNKA 4JJFA 3SXMA 4U9EA 5KYXA 1VTMP 4XLNF 2FAPB 2B0HA 2EIJC 4I3MA 4JE9A 4E7SA 1NG1A 2A69F 3RQFA 3K6BA 2P0NA 4MVQA 4XEKA 2R25A 2NG1A 4OD4A 3WHNA 1NSGB 4RD9A 2RD9A 1IZMA 2FFHA 4KC9A 4X0RA 4LLEA 2W45A 1UG7A 1OCRC 1ZHZA 2YEVA 3R7CA 2YKZA 1GM5A 2LQGA 3LESA 3QVZA 4P6IC 4C3DA 2WZFA 3DAGA 3X2QC 3QVYA 4YT8A 3ITFA 3K1IC 5AGFA 2J9WA 4EHPA 1D1AA 2QNLA 4Q5SF 5BQIA 4K7BA 4U9DA 2G62A 1K04A 2YLGA 4G78A 3VF0A 1ZZPA 4G7HF 1TKNA 4CS8A 1TWAA 5B3IA 4EBBA 3QMKA 4AK9A 3NG1A 3R2PA 2XLDA 2YQYA 4NCQA 4AL1A 3GWLA 4JVSA 4MTFA 3IEEA 5GPGB 1JOGA 1BBHA 1CGOA 4N6HA 2A0BA 3T6JA 3S27A 4O79A 1FFHA 1QZXA 2L6HA 2R05A 2UUHA 3EHNA 4W8KA 1GS9A 3NMIA 3QW0A 5KYUA 2HJ3A 5A6AA 4JURI
chains in the Genus database with same CATH topology
4PJNA 4OIQF 5B3SC 2IXNA 4WJ0A 2DYSC 4DOZA 2VASA 4HE8D 4PJJA 1MMAA 3N0TA 3ASNC 5B1BC 4YN0B 3AG4C 4QI0A 4FESA 1ZHXA 2C03A 4GYTA 4N06A 1FTSA 5B1AC 2PP4A 3S0XA 2ZPAA 2ZXOA 4U5CE 1MMDA 4J30B 3S29A 3K1HA 3UGPA 1M57C 5L3VA 4RDAA 2NUTB 4BJ5A 3LAYA 2MYSA 4BJ6A 2QTVA 3H65A 4M63A 1N1CA 2R7XA 3MLGA 4CS9A 2NUPA 4IJJA 4XWJA 3ABMC 3FDQA 2Q3TA 2A6EF 4U5HA 2DYRC 2ZXRA 4C3BA 1Z23A 2GFHA 3AQCA 3EG9A 5T3TA 4DVZA 4Q4ZF 1OKKD 1VOMA 3FAJA 3LEVA 3KMIA 2J7PA 2IOQA 5D91A 4IAOA 3K7DA 1J8YF 3T4RA 3EH1A 3VAYA 2Y3GA 2C04A 4LLCA 1LVKA 3X1OA 2XSEA 3NKEA 1ST6A 2P7VA 1NZEA 4JZAA 3EQLF 3N24A 1SZIA 5D92A 2YHSA 4A2NB 4DBRA 2VH3A 4U5DE 4YT4A 2BE5F 4FX5A 2E87A 4C7OA 4AE4B 1D1BA 3K66A 3EZHA 5DS4A 3K33A 2R7WA 2MWQA 5EGYA 2IXPA 1TR2A 2WVNA 3HLZA 4U5BE 3F46A 5E3AA 3JSZA 3DMDA 2YZSA 3M1CB 4U5FE 1RJ9A 3PMRA 3UMIA 2A68F 3L0IA 1D0YA 3EPVA 2WVOA 2J9UA 4KI2A 1V55C 4YT2A 4ZLCA 1JPNA 2XXAB 3HJCA 4LACB 5KYWA 3B0UX 3B0PA 3TD7A 2EINC 1Z5ZA 4KNWA 2Y3DA 2H7BA 2XL4A 2R7UA 3Q7LA 1OCZC 3W2WA 2CNWD 4BEJA 3KKBA 4JJGA 5EHHA 3UGOA 4O7GA 4G0HA 1SF8A 2CGEA 2KW3C 3Q6MA 3DAFA 1FMWA 4F4BA 4AX2A 3JYHA 5F5HA 2H7OA 2WZLA 3B0VC 4BG0A 2R7VA 2R7TA 3GANA 3EZIA 4OIRF 4K0DA 2J0WA 4H4KC 3OEOA 3NYJA 4CSAA 4B6IA 1O87A 1Z63A 4IWBA 4AE4A 1NU7D 4C3EA 2D5RB 2PF4E 5E33A 3SYNA 4YT5A 4BJTA 4CS8C 2Q9BA 1D0XA 2R7OA 1J8MF 1MNDA 4QDLA 4I1OB 5DLJA 2W4BA 2M4EA 3F47A 3RH3A 5HSWA 3O6XA 3WG7C 2L81A 1MMGA 3E9VA 5BUOA 4J32B 1Z3IX 4PFPA 4YWQA 2A1DD 4HEAJ 4FWVA 3UNGC 2J0XA 1LKXA 4PK4A 4DVYP 5CI9A 4NY3A 4ANJA 3DZAA 2Q9CA 2XXAA 3ZSUA 1G8XA 3ABKC 4CIHA 2R7SA 3OA1A 4Q7CA 2W9YA 5T1DB 5DQTA 3VYWA 2VB6A 2DGJA 2V26A 3ASOC 5DS6A 5KYXB 3SNHA 2R7RA 4E7ZA 3JCUQ 3UMKA 3S28A 3LNRA 2CW0F 3I5QA 4IRUA 1D1CA 4U5GA 4O6MA 3DJUB 2G3VA 2WZGA 4I1MA 4G7OF 3B9QA 3ECSA 4BJ5C 1OCCC 5DQZA 2B0JA 4BJ6C 3AG2C 4OIOF 3EGDB 2KGOA 5F5FA 4XTKA 2XRHA 3I5PA 3EHMA 2EIKC 3OWTA 3AG3C 4CS9C 5E2QA 2KQ9A 2J9VA 5FCLA 2WL8A 3O39A 2V3CC 2IYLD 3SEOA 3NDBB 1M56C 1OKKA 2QY9A 4PFOA 3FHDA 4GEHA 2Y3BA 3JRTA 1VK5A 2NUTA 3RKOF 3JT1A 3E70C 1FMVA 3WODF 2PX3A 1NU9C 2HV6A 2JD3A 1TWHA 4QI2A 5IY5C 4MQ9F 2Q9AA 3LJBA 3QZCA 4U5EE 4JW1A 1VMAA 3POVA 4PJLA 2H7VC 1W2WA 1MMNA 3EFOB 4RBNA 5KYYB 3CZ6A 4OIPF 1M2OA 4CBEA 2WVQA 3ZC4A 4G7ZF 3DD7A 1QLEC 1FFTC 4MNDA 3FVYA 3RIPA 1Z6AA 2OCCC 3EGXB 4HFFB 3T6BA 1WGWA 2J45A 1ZYRF 3W8HA 4O6YA 3L34A 3EGDA 3Q7GA 3ZVRA 2NUPB 3UMHA 2A6HF 4XLPF 1BR4A 3N2ZB 3ABLC 3CSKA 3W8IA 3RFYA 3EG9B 5T3WA 2J46A 2W4MA 3EH2A 2KJGA 2CNWA 1BR1A 1O5HA 2KNHA 2PX0A 2CDQA 5L3QA 2EIMC 4DBQA 2ZXWC 2ZXPA 3NYLA 4KNVA 1VYKA 1JPJA 5E3CA 4PJMA 4LERA 1M2VB 3RYLA 3LS1A 1S7ZA 4CS7A 1ZU5A 4ULWA 4C7OB 2I8BA 1KU2A 1OCOC 2X51A 3EFOA 4CSAC 1PD0A 3ZG1A 5KYYA 1VYIA 2O9XA 2J7PD 2L9JA 1ZHYA 4JCHA 2Y39A 3UR3C 2IXMA 3AQBA 3EJNA 3MX3A 3W2VA 1RJ9B 3NYMA 5CI8A 2WB7A 3EGXA 1D0ZA 2HV7A 3LLKA 3SP1A 3ZIBA 1TWCA 3SZRA 2Y3HA 2P6VA 4KBLA 1ZHTA 3PHF2 3CQZA 1LS1A 1TWGA 3DJNB 4O6NA 4BJ1A 5KYWB 3NKDA 1V54C 2G3KA 3KH2A 3GODA 2LSEA 4I44A 4YJWA 3LLIA 2EILC 3Q6NA 3KL4A 4OINF 5KYNA 5DS5A 4EWCA 2Z15A 1ZHWA 1MNEA 1PCXA 1IW7F 3V7OA 5KYUB 2Y69C 3DM5A 1M2VA 3NRHA 3DM9B 2R7QA 3AG1C 5DVWA 2FGYA 1BR2A 4OD5A 3I4UA 2OG2A 4ZLDA 1PD1A 2PFDA 4HFKB 1SMYF 3HTKC 3DXJF 3LS0A 5KYXA 1ZU4A 4JJFA 2IXOA 4XLNF 2EIJC 4I3MA 4E7SA 1NG1A 2A69F 3K6BA 2NG1A 4OD4A 4RD9A 1IZMA 2FFHA 4KC9A 4X0RA 4LLEA 2W45A 1ZHZA 1OCRC 2YEVA 3LESA 4P6IC 4C3DA 2WZFA 3DAGA 3X2QC 4YT8A 3ITFA 3K1IC 4Q5SF 2J9WA 1D1AA 4K7BA 2G62A 4G7HF 1TKNA 4CS8A 1TWAA 4EBBA 3QMKA 4AK9A 3NG1A 4JVSA 3IEEA 3T6JA 3S27A 4O79A 1FFHA 1QZXA 3EHNA 4W8KA 5KYUA 4JURI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DZA A; 
#chains in the Genus database with same CATH topology
 3G50 A;  1QKR A;  4PJN A;  4Z9I A;  4OIQ F;  5B3S C;  2IXN A;  2KYH A;  4WJ0 A;  2DYS C;  4DOZ A;  4E18 A;  4NQF A;  1BZ4 A;  2HSQ A;  2VCA A;  2VAS A;  4HE8 D;  4PJJ A;  1HMO A;  3L8J A;  1FR0 A;  1I5N A;  1CPR A;  1MMA A;  4CX9 A;  5FZT A;  1A7E A;  2LK4 A;  3N0T A;  3ASN C;  5B1B C;  4YN0 B;  3AG4 C;  4QI0 A;  4FES A;  4H54 A;  5JSL A;  1ZHX A;  2C03 A;  4GYT A;  4N06 A;  4W8P A;  1FTS A;  3US6 A;  5B1A C;  3ZQY A;  2PP4 A;  3S0X A;  2VCB A;  4MVU A;  4JIO A;  2ZPA A;  2H8A A;  2R03 A;  1H6G A;  1T01 A;  2OJE D;  2ZXO A;  4P9T A;  4U5C E;  1MMD A;  2OEX A;  3JZ0 A;  4J30 B;  3S29 A;  4GQH A;  4WAB A;  3K1H A;  4NC3 A;  1XZP A;  1G4U S;  2XM0 A;  3VRC A;  3UGP A;  1M57 C;  5L3V A;  1OQC A;  1ZVZ A;  4RDA A;  2NUT B;  3O10 A;  1V74 B;  4BJ5 A;  3CEX A;  3LAY A;  2MYS A;  4BJ6 A;  2QTV A;  3V5Z A;  3C63 A;  5A6B A;  3C8G B;  3H65 A;  4M63 A;  1YAU O;  3ZQV A;  1N1C A;  3V5Y A;  1EA8 A;  2R7X A;  3MLG A;  4CS9 A;  2NUP A;  4IJJ A;  1SYQ A;  4XWJ A;  3ABM C;  3FDQ A;  2Q3T A;  2A6E F;  4U5H A;  4JEA A;  2DYR C;  3S84 A;  2ZXR A;  4C3B A;  1Z23 A;  4JCZ A;  4K1O A;  1VB5 A;  2GFH A;  3AQC A;  1TFK B;  3EG9 A;  2DB4 A;  2ICW G;  1SR2 A;  3GEH A;  5T3T A;  4DVZ A;  4Q4Z F;  1AEP A;  1OKK D;  1RXQ A;  3BRJ A;  3O55 A;  3IQ6 A;  1VOM A;  3AGT A;  3FAJ A;  3LEV A;  3KMI A;  3M15 A;  2J7P A;  4J7Y A;  4EUK B;  1FNT c;  2IOQ A;  3PDM P;  5D91 A;  4IAO A;  3RW0 A;  1NFN A;  1DOW A;  3K7D A;  2M64 A;  1J8Y F;  4LDK A;  3RVY A;  3T4R A;  3EH1 A;  2AVK A;  3VAY A;  1E86 A;  1K05 A;  2Y3G A;  4MTG A;  2C04 A;  3PCV A;  4XEV A;  4LLC A;  1LVK A;  3X1O A;  2XSE A;  3NKE A;  1ST6 A;  4XPW A;  2P7V A;  1NZE A;  4JZA A;  5L0C A;  3EQL F;  3N24 A;  1SZI A;  1DOV A;  1NLX A;  2YLI A;  5D92 A;  2YHS A;  1PV3 A;  4A2N B;  4DBR A;  2L7A A;  2VH3 A;  4U5D E;  2QLA A;  4YT4 A;  2BE5 F;  2XLO A;  4FX5 A;  4MVO A;  2E87 A;  1CPQ A;  2VCC A;  4C7O A;  5COF A;  2GA0 A;  3RQE A;  1D1B A;  3K66 A;  4N4W A;  2LCH A;  4AE4 B;  3TOM A;  1Q0F A;  2L6F A;  4NTF A;  4JTD B;  3EZH A;  5DS4 A;  1OR2 A;  3K33 A;  2R7W A;  2MWQ A;  5EGY A;  2IXP A;  2J8W A;  2KK1 A;  4XEF A;  1TR2 A;  3FOP A;  1CGM E;  3M4B A;  5JLI A;  2WVN A;  3C62 A;  3HLZ A;  2VC9 A;  4U5B E;  1M6T A;  2IBF A;  3F46 A;  1QSP A;  5E3A A;  2CCY A;  3DMD A;  3JSZ A;  3JRM O;  1ZW3 A;  2YZS A;  3IHU A;  3M1C B;  4U5F E;  3ZWI A;  1RJ9 A;  2GWW A;  3PMR A;  3UMI A;  2A68 F;  3L0I A;  3H2U A;  3KPH A;  3GM2 A;  3C8G A;  1D0Y A;  1A41 A;  1VLT A;  4IB4 A;  4MW3 A;  3U2M A;  3EPV A;  2WVO A;  4JRZ A;  4AL0 A;  2J9U A;  4A4A A;  4KI2 A;  1V55 C;  3IQC A;  4YT2 A;  1A7D A;  1U89 A;  3B29 A;  5COM A;  4ZLC A;  1V4A A;  1JPN A;  3AGU A;  2XXA B;  3GWN A;  3HJC A;  4LAC B;  5KYW A;  3B0U X;  3B0P A;  4MTO A;  3TD7 A;  2EIN C;  2XL6 A;  1Z5Z A;  4KNW A;  2Y3D A;  5EK0 A;  2H7B A;  2XL4 A;  1RMV A;  2R7U A;  2YRF A;  3Q7L A;  1OCZ C;  4R32 A;  3W2W A;  2NSG A;  2CNW D;  2DI3 A;  1A0B A;  4BEJ A;  1ORJ A;  4PAC A;  3KKB A;  4YL1 A;  4JJG A;  5EHH A;  2KSF A;  5JT4 A;  3UGO A;  4O7G A;  4BPM A;  4G0H A;  1WAS A;  2CYD A;  1SF8 A;  2CGE A;  2KW3 C;  3FXH A;  3Q6M A;  3DAF A;  2RSE B;  3QW1 A;  1FMW A;  1I4Z A;  5COG A;  3ZTM A;  4F4B A;  3C18 A;  4AX2 A;  2QE9 A;  3JYH A;  2H7O A;  5F5H A;  1U0B B;  2WZL A;  1AUE A;  2OKU A;  3B0V C;  4BG0 A;  2R7V A;  2R7T A;  3GAN A;  4IGG A;  3EZI A;  4OIR F;  1EQ1 A;  4K0D A;  2J0W A;  4H4K C;  2XLV A;  3AJM A;  3OEO A;  1A7V A;  3NYJ A;  1T6U A;  1RKE B;  4CSA A;  3C8Z A;  3JSE O;  1O87 A;  4B6I A;  3JYY A;  4D4N A;  1Z63 A;  1E84 A;  1YAR O;  2IM8 A;  4IWB A;  3JTL O;  1NU7 D;  4AE4 A;  2D5R B;  2PF4 E;  2AWY A;  1BDJ B;  5E33 A;  3A9C A;  3SYN A;  2YL7 A;  1K40 A;  3H2V A;  4YT5 A;  4BJT A;  1YZC A;  4CS8 C;  2Q9B A;  1D0X A;  2R7O A;  4CJG A;  2KC3 A;  3GM1 A;  4MS2 A;  1J8M F;  1MND A;  2F22 A;  4I1O B;  4QDL A;  5DLJ A;  4EIY A;  2W4B A;  3U5S A;  1AVO B;  2EPM X;  2M4E A;  5TJ5 E;  3F47 A;  2X0C A;  3RQG A;  3RH3 A;  5HSW A;  1YYJ A;  3IPM O;  3FOO A;  3O6X A;  2LFD A;  2L81 A;  4LDQ A;  3SXY A;  3WG7 C;  1MMG A;  3E9V A;  4CDV A;  4J32 B;  5BUO A;  1OR3 A;  1APC A;  4MVM A;  1Z3I X;  1UFB A;  4PFP A;  1YVI A;  1HY5 A;  2A1D D;  4HEA J;  4FWV A;  3WAQ A;  4YWQ A;  3UNG C;  2J0X A;  1YZA A;  5L0G A;  1LKX A;  1YLM A;  1T9K A;  1E83 A;  1KTM A;  1WAT A;  4PK4 A;  4DVY P;  5CI9 A;  4NY3 A;  4JC7 A;  4ANJ A;  3GEE A;  3DZA A;  2Q9C A;  2XXA A;  1OW8 A;  1G8X A;  3ZSU A;  3ABK C;  4CIH A;  3HNI A;  1LS4 A;  2LIG A;  2ZD9 A;  3OA1 A;  4MVR A;  5L0H A;  2R7S A;  2AWC A;  3C7J A;  3U3B A;  4Q7C A;  2W9Y A;  5A69 A;  4JKV A;  5T1D B;  5DQT A;  1ORS C;  2GAQ A;  4CDA A;  3VYW A;  2VB6 A;  2DGJ A;  4CIP A;  256B A;  3MFN A;  2HJM A;  2V26 A;  1T6Q A;  3ASO C;  4NTB A;  3GOR A;  4JTA B;  3SNH A;  4E7Z A;  5DS6 A;  2HKV A;  3JCU Q;  5KYX B;  2R7R A;  4JTC B;  3UMK A;  5AC5 A;  3S28 A;  3LNR A;  2CW0 F;  3M79 A;  1YA7 O;  3LNM B;  3I5Q A;  1F1M A;  4YK5 A;  4EBK A;  4IRU A;  2YLD A;  1D1C A;  4U5G A;  1QVX A;  4O6M A;  3DJU B;  4P9F A;  3LEO A;  2G3V A;  2WZG A;  2YL0 A;  3ATP A;  4I1M A;  4XQ1 A;  4G7O F;  3B9Q A;  1OW6 A;  1OW7 A;  3ECS A;  4BJ5 C;  1OCC C;  5JRA A;  5DQZ A;  1I4Y A;  2B0J A;  4BJ6 C;  3IQT A;  3AG2 C;  4OIO F;  2AP3 A;  1HMD A;  3EGD B;  2KGO A;  5F5F A;  4XTK A;  2XRH A;  3I5P A;  3EHM A;  4MVZ A;  2EIK C;  3OWT A;  3AG3 C;  4CS9 C;  2R9R B;  4Z9H A;  5E2Q A;  4DRJ B;  2KQ9 A;  3NMJ A;  1YYX A;  2J9V A;  1TQG A;  5FCL A;  2WL8 A;  1Q0G A;  3O39 A;  3G4Z A;  5JUA A;  2V3C C;  4L6R A;  2IYL D;  3MYF A;  3SEO A;  3KYJ A;  3J06 A;  1RCP A;  2TMV P;  3NDB B;  1B68 A;  1FAP B;  1M56 C;  1OKK A;  3TJ5 A;  4DJ9 A;  2QY9 A;  4PFO A;  5AC4 A;  3FHD A;  2XLE A;  3DKA A;  3DWW A;  4GEH A;  1WOL A;  4XPX A;  2BL2 A;  2Y3B A;  3SXK A;  3JRT A;  3TK0 A;  5JVE A;  1HW2 A;  1VK5 A;  2OQM A;  4YL0 A;  1ZW2 A;  2NUT A;  2LFF A;  3RKO F;  1H7I A;  3JT1 A;  3E70 C;  1MQV A;  1FMV A;  3K1I A;  3WOD F;  2PX3 A;  1E2X A;  3TJ6 A;  1NU9 C;  1R5I D;  2HV6 A;  1GGQ A;  2JD3 A;  1H9G A;  1TWH A;  4QI2 A;  5IY5 C;  2HS5 A;  4MQ9 F;  2Q9A A;  3LJB A;  3QZC A;  4U5E E;  4JW1 A;  4MW8 A;  1VMA A;  1R4T A;  2I15 A;  2L6G A;  2QUP A;  3POV A;  5A6J A;  5CIV A;  3U9J A;  4PJL A;  2H7V C;  3RF3 A;  1CGN A;  1W2W A;  2HFI A;  1MMN A;  3EFO B;  3S9O A;  1G4W R;  1O3U A;  1Q0D A;  3TUL A;  4RBN A;  1JRA A;  3B71 A;  3CZ6 A;  1T6I A;  3DI5 A;  3U9M A;  5KYY B;  4OIP F;  1M2O A;  4CBE A;  4YL3 A;  3DE8 A;  2WVQ A;  1YJG A;  2OOC A;  2EPK X;  3QTH A;  4IAR A;  2NPU A;  4XPY A;  1Z7Q c;  3ZC4 A;  2R02 A;  3DD7 A;  4G7Z F;  1QLE C;  1FFT C;  1LM3 B;  3FVY A;  4MND A;  4N6C A;  2OJQ A;  1HE9 A;  3RIP A;  5A6K A;  3S90 A;  3L8I A;  1HW1 A;  2HSB A;  1Z6A A;  1C02 A;  3V5X A;  2OCC C;  2JPU A;  3EGX B;  4HFF B;  3T6B A;  4DRI B;  1WGW A;  2J45 A;  1ZYR F;  2XLM A;  3W8H A;  4LDR A;  4O6Y A;  2OEV A;  3GM3 A;  1YDI A;  3L34 A;  3EGD A;  3Q7G A;  3SXZ A;  5JS5 A;  2Q00 A;  3L1M A;  3ZVR A;  2NUP B;  3UMH A;  2XS8 A;  2A6H F;  4XLP F;  2Q4F A;  1BR4 A;  1GQA A;  3N2Z B;  4DXW A;  4J7T A;  3ABL C;  3CSK A;  2HMZ A;  1OXK A;  2P61 A;  3RFY A;  3W8I A;  3EG9 B;  1OXB A;  2XLW A;  5T3W A;  2J46 A;  2W4M A;  3AOU A;  3EH2 A;  3ZTZ A;  1Q0K A;  3TOL A;  1Y6D A;  2KJG A;  1JAF A;  2BC5 A;  2CNW A;  1BR1 A;  1O5H A;  3HNL A;  2KNH A;  2PX0 A;  1ORY A;  1LI7 A;  5L0D A;  2CDQ A;  4D4X A;  5L3Q A;  2EIM C;  1QQ3 A;  4DBQ A;  1WWP A;  2ZXW C;  2ZXP A;  1QPU A;  2PNO A;  3NYL A;  1L7C A;  2MHR A;  4KNV A;  3HNJ A;  2PBE A;  1VYK A;  1JPJ A;  2YL1 A;  5E3C A;  1C17 M;  4LER A;  1M2V B;  2XM4 A;  4PJM A;  3RYL A;  3LS1 A;  2HUJ A;  5A6B D;  2YWA A;  2ASR A;  3NMK A;  1NBB A;  1S7Z A;  1LE2 A;  5BQH A;  3GEI A;  4CS7 A;  1ZU5 A;  3FAP B;  4E0H A;  4ULW A;  1EI7 A;  2I8B A;  1WN0 A;  1KU2 A;  3HKK A;  4C7O B;  1OCO C;  1LPE A;  2GDC A;  2X51 A;  3EFO A;  4CSA C;  1Y4C A;  1PD0 A;  2LD6 A;  3ZG1 A;  1L3P A;  5KYY A;  1VYI A;  2O9X A;  4EBJ A;  2J7P D;  3U8P A;  1RKC A;  2L9J A;  3W4Y A;  4FAP B;  1ZHY A;  2EPN A;  1G5Z A;  3IQ5 A;  4JCH A;  1JMW A;  1TFO B;  2Y39 A;  3UR3 C;  4E17 A;  2IXM A;  3AQB A;  3EJN A;  3MX3 A;  1S05 A;  3W2V A;  1RJ9 B;  3NYM A;  5CI8 A;  3U3F A;  1YA9 A;  1XZQ A;  2WB7 A;  3EGX A;  1D0Z A;  2HV7 A;  2XLH A;  5L0F A;  3LLK A;  2NSF A;  3A11 A;  3SP1 A;  5F28 E;  1H9T A;  3ZIB A;  4C3E A;  1TWC A;  2P1A A;  2UUI A;  3SZR A;  3KYI A;  2Y3H A;  2P6V A;  4KBL A;  4ULV A;  1ZHT A;  4BEM J;  3CQZ A;  1LS1 A;  1TWG A;  2A0U A;  3DJN B;  4MVS A;  3PHF 2;  4O6N A;  3T9O A;  2EPO A;  4BJ1 A;  5KYW B;  3G4X A;  3NKD A;  1V54 C;  2G3K A;  5JP7 A;  4ER9 A;  4PR9 A;  4Z9J A;  1RKE A;  5L0I A;  3KH2 A;  3CAX A;  3GOD A;  1E85 A;  2LSE A;  4I44 A;  4YJW A;  4DRH B;  3LLI A;  2Q7R A;  2EIL C;  1T5O A;  2YL3 A;  3Q6N A;  3KL4 A;  3BEH A;  1LE4 A;  5BQG A;  4OIN F;  5KYN A;  3FMS A;  4ONS A;  5DS5 A;  2XS1 A;  5L0J A;  3M4C A;  1VLS A;  4EWC A;  3U0C A;  2Z15 A;  1ZHW A;  3ZDL A;  4WGZ A;  1MNE A;  3U8V A;  1PCX A;  1JR8 A;  1U6H A;  1IW7 F;  3V7O A;  5KYU B;  2Y69 C;  3DM5 A;  1M2V A;  3NRH A;  3U2L A;  1HE1 A;  3DM9 B;  2J9B A;  2R7Q A;  3C8G D;  3AG1 C;  5DVW A;  2FGY A;  1BR2 A;  4UDV A;  3RVZ A;  4OD5 A;  4IAQ A;  2YVK A;  2D4U A;  2EPL X;  5K0I A;  3T6G B;  1KNY A;  2ETS A;  2AU5 A;  4NTA A;  4JEB A;  3LUT B;  3I4U A;  3MBG A;  2LP4 A;  2HMQ A;  3DE9 A;  2OG2 A;  3TQO A;  4ZLD A;  5HV9 A;  2OU6 A;  4E0I A;  4CDY A;  4EKW A;  3MYI A;  1PD1 A;  1EKY A;  1LI5 A;  1XWJ A;  2JX0 A;  2PFD A;  4HFK B;  4CJO A;  4WGY A;  1NFO A;  1SMY F;  1WTY A;  3VM6 A;  3HTK C;  3DXJ F;  1C03 A;  3LS0 A;  2HZ8 A;  1LIH A;  2XL8 A;  1ZU4 A;  1Q0M A;  2IXO A;  3HNK A;  4JJF A;  3SXM A;  4U9E A;  5KYX A;  1VTM P;  4XLN F;  2FAP B;  2B0H A;  2EIJ C;  4I3M A;  4JE9 A;  4E7S A;  1NG1 A;  2A69 F;  3RQF A;  3K6B A;  2P0N A;  4MVQ A;  4XEK A;  2R25 A;  2NG1 A;  4OD4 A;  3WHN A;  1NSG B;  4RD9 A;  2RD9 A;  1IZM A;  2FFH A;  4KC9 A;  4X0R A;  4LLE A;  2W45 A;  1UG7 A;  1OCR C;  1ZHZ A;  2YEV A;  3R7C A;  2YKZ A;  1GM5 A;  2LQG A;  3LES A;  3QVZ A;  4P6I C;  4C3D A;  2WZF A;  3DAG A;  3X2Q C;  3QVY A;  4YT8 A;  3ITF A;  3K1I C;  5AGF A;  2J9W A;  4EHP A;  1D1A A;  2QNL A;  4Q5S F;  5BQI A;  4K7B A;  4U9D A;  2G62 A;  1K04 A;  2YLG A;  4G78 A;  3VF0 A;  1ZZP A;  4G7H F;  1TKN A;  4CS8 A;  1TWA A;  5B3I A;  4EBB A;  3QMK A;  4AK9 A;  3NG1 A;  3R2P A;  2XLD A;  2YQY A;  4NCQ A;  4AL1 A;  3GWL A;  4JVS A;  4MTF A;  3IEE A;  5GPG B;  1JOG A;  1BBH A;  1CGO A;  4N6H A;  2A0B A;  3T6J A;  3S27 A;  4O79 A;  1FFH A;  1QZX A;  2L6H A;  2R05 A;  2UUH A;  3EHN A;  4W8K A;  1GS9 A;  3NMI A;  3QW0 A;  5KYU A;  2HJ3 A;  5A6A A;  4JUR I; 
#chains in the Genus database with same CATH homology
 4PJN A;  4OIQ F;  5B3S C;  2IXN A;  4WJ0 A;  2DYS C;  4DOZ A;  2VAS A;  4HE8 D;  4PJJ A;  1MMA A;  3N0T A;  3ASN C;  5B1B C;  4YN0 B;  3AG4 C;  4QI0 A;  4FES A;  1ZHX A;  2C03 A;  4GYT A;  4N06 A;  1FTS A;  5B1A C;  2PP4 A;  3S0X A;  2ZPA A;  2ZXO A;  4U5C E;  1MMD A;  4J30 B;  3S29 A;  3K1H A;  3UGP A;  1M57 C;  5L3V A;  4RDA A;  2NUT B;  4BJ5 A;  3LAY A;  2MYS A;  4BJ6 A;  2QTV A;  3H65 A;  4M63 A;  1N1C A;  2R7X A;  3MLG A;  4CS9 A;  2NUP A;  4IJJ A;  4XWJ A;  3ABM C;  3FDQ A;  2Q3T A;  2A6E F;  4U5H A;  2DYR C;  2ZXR A;  4C3B A;  1Z23 A;  2GFH A;  3AQC A;  3EG9 A;  5T3T A;  4DVZ A;  4Q4Z F;  1OKK D;  1VOM A;  3FAJ A;  3LEV A;  3KMI A;  2J7P A;  2IOQ A;  5D91 A;  4IAO A;  3K7D A;  1J8Y F;  3T4R A;  3EH1 A;  3VAY A;  2Y3G A;  2C04 A;  4LLC A;  1LVK A;  3X1O A;  2XSE A;  3NKE A;  1ST6 A;  2P7V A;  1NZE A;  4JZA A;  3EQL F;  3N24 A;  1SZI A;  5D92 A;  2YHS A;  4A2N B;  4DBR A;  2VH3 A;  4U5D E;  4YT4 A;  2BE5 F;  4FX5 A;  2E87 A;  4C7O A;  4AE4 B;  1D1B A;  3K66 A;  3EZH A;  5DS4 A;  3K33 A;  2R7W A;  2MWQ A;  5EGY A;  2IXP A;  1TR2 A;  2WVN A;  3HLZ A;  4U5B E;  3F46 A;  5E3A A;  3JSZ A;  3DMD A;  2YZS A;  3M1C B;  4U5F E;  1RJ9 A;  3PMR A;  3UMI A;  2A68 F;  3L0I A;  1D0Y A;  3EPV A;  2WVO A;  2J9U A;  4KI2 A;  1V55 C;  4YT2 A;  4ZLC A;  1JPN A;  2XXA B;  3HJC A;  4LAC B;  5KYW A;  3B0U X;  3B0P A;  3TD7 A;  2EIN C;  1Z5Z A;  4KNW A;  2Y3D A;  2H7B A;  2XL4 A;  2R7U A;  3Q7L A;  1OCZ C;  3W2W A;  2CNW D;  4BEJ A;  3KKB A;  4JJG A;  5EHH A;  3UGO A;  4O7G A;  4G0H A;  1SF8 A;  2CGE A;  2KW3 C;  3Q6M A;  3DAF A;  1FMW A;  4F4B A;  4AX2 A;  3JYH A;  5F5H A;  2H7O A;  2WZL A;  3B0V C;  4BG0 A;  2R7V A;  2R7T A;  3GAN A;  3EZI A;  4OIR F;  4K0D A;  2J0W A;  4H4K C;  3OEO A;  3NYJ A;  4CSA A;  4B6I A;  1O87 A;  1Z63 A;  4IWB A;  4AE4 A;  1NU7 D;  4C3E A;  2D5R B;  2PF4 E;  5E33 A;  3SYN A;  4YT5 A;  4BJT A;  4CS8 C;  2Q9B A;  1D0X A;  2R7O A;  1J8M F;  1MND A;  4QDL A;  4I1O B;  5DLJ A;  2W4B A;  2M4E A;  3F47 A;  3RH3 A;  5HSW A;  3O6X A;  3WG7 C;  2L81 A;  1MMG A;  3E9V A;  5BUO A;  4J32 B;  1Z3I X;  4PFP A;  4YWQ A;  2A1D D;  4HEA J;  4FWV A;  3UNG C;  2J0X A;  1LKX A;  4PK4 A;  4DVY P;  5CI9 A;  4NY3 A;  4ANJ A;  3DZA A;  2Q9C A;  2XXA A;  3ZSU A;  1G8X A;  3ABK C;  4CIH A;  2R7S A;  3OA1 A;  4Q7C A;  2W9Y A;  5T1D B;  5DQT A;  3VYW A;  2VB6 A;  2DGJ A;  2V26 A;  3ASO C;  5DS6 A;  5KYX B;  3SNH A;  2R7R A;  4E7Z A;  3JCU Q;  3UMK A;  3S28 A;  3LNR A;  2CW0 F;  3I5Q A;  4IRU A;  1D1C A;  4U5G A;  4O6M A;  3DJU B;  2G3V A;  2WZG A;  4I1M A;  4G7O F;  3B9Q A;  3ECS A;  4BJ5 C;  1OCC C;  5DQZ A;  2B0J A;  4BJ6 C;  3AG2 C;  4OIO F;  3EGD B;  2KGO A;  5F5F A;  4XTK A;  2XRH A;  3I5P A;  3EHM A;  2EIK C;  3OWT A;  3AG3 C;  4CS9 C;  5E2Q A;  2KQ9 A;  2J9V A;  5FCL A;  2WL8 A;  3O39 A;  2V3C C;  2IYL D;  3SEO A;  3NDB B;  1M56 C;  1OKK A;  2QY9 A;  4PFO A;  3FHD A;  4GEH A;  2Y3B A;  3JRT A;  1VK5 A;  2NUT A;  3RKO F;  3JT1 A;  3E70 C;  1FMV A;  3WOD F;  2PX3 A;  1NU9 C;  2HV6 A;  2JD3 A;  1TWH A;  4QI2 A;  5IY5 C;  4MQ9 F;  2Q9A A;  3LJB A;  3QZC A;  4U5E E;  4JW1 A;  1VMA A;  3POV A;  4PJL A;  2H7V C;  1W2W A;  1MMN A;  3EFO B;  4RBN A;  5KYY B;  3CZ6 A;  4OIP F;  1M2O A;  4CBE A;  2WVQ A;  3ZC4 A;  4G7Z F;  3DD7 A;  1QLE C;  1FFT C;  4MND A;  3FVY A;  3RIP A;  1Z6A A;  2OCC C;  3EGX B;  4HFF B;  3T6B A;  1WGW A;  2J45 A;  1ZYR F;  3W8H A;  4O6Y A;  3L34 A;  3EGD A;  3Q7G A;  3ZVR A;  2NUP B;  3UMH A;  2A6H F;  4XLP F;  1BR4 A;  3N2Z B;  3ABL C;  3CSK A;  3W8I A;  3RFY A;  3EG9 B;  5T3W A;  2J46 A;  2W4M A;  3EH2 A;  2KJG A;  2CNW A;  1BR1 A;  1O5H A;  2KNH A;  2PX0 A;  2CDQ A;  5L3Q A;  2EIM C;  4DBQ A;  2ZXW C;  2ZXP A;  3NYL A;  4KNV A;  1VYK A;  1JPJ A;  5E3C A;  4PJM A;  4LER A;  1M2V B;  3RYL A;  3LS1 A;  1S7Z A;  4CS7 A;  1ZU5 A;  4ULW A;  4C7O B;  2I8B A;  1KU2 A;  1OCO C;  2X51 A;  3EFO A;  4CSA C;  1PD0 A;  3ZG1 A;  5KYY A;  1VYI A;  2O9X A;  2J7P D;  2L9J A;  1ZHY A;  4JCH A;  2Y39 A;  3UR3 C;  2IXM A;  3AQB A;  3EJN A;  3MX3 A;  3W2V A;  1RJ9 B;  3NYM A;  5CI8 A;  2WB7 A;  3EGX A;  1D0Z A;  2HV7 A;  3LLK A;  3SP1 A;  3ZIB A;  1TWC A;  3SZR A;  2Y3H A;  2P6V A;  4KBL A;  1ZHT A;  3PHF 2;  3CQZ A;  1LS1 A;  1TWG A;  3DJN B;  4O6N A;  4BJ1 A;  5KYW B;  3NKD A;  1V54 C;  2G3K A;  3KH2 A;  3GOD A;  2LSE A;  4I44 A;  4YJW A;  3LLI A;  2EIL C;  3Q6N A;  3KL4 A;  4OIN F;  5KYN A;  5DS5 A;  4EWC A;  2Z15 A;  1ZHW A;  1MNE A;  1PCX A;  1IW7 F;  3V7O A;  5KYU B;  2Y69 C;  3DM5 A;  1M2V A;  3NRH A;  3DM9 B;  2R7Q A;  3AG1 C;  5DVW A;  2FGY A;  1BR2 A;  4OD5 A;  3I4U A;  2OG2 A;  4ZLD A;  1PD1 A;  2PFD A;  4HFK B;  1SMY F;  3HTK C;  3DXJ F;  3LS0 A;  5KYX A;  1ZU4 A;  4JJF A;  2IXO A;  4XLN F;  2EIJ C;  4I3M A;  4E7S A;  1NG1 A;  2A69 F;  3K6B A;  2NG1 A;  4OD4 A;  4RD9 A;  1IZM A;  2FFH A;  4KC9 A;  4X0R A;  4LLE A;  2W45 A;  1ZHZ A;  1OCR C;  2YEV A;  3LES A;  4P6I C;  4C3D A;  2WZF A;  3DAG A;  3X2Q C;  4YT8 A;  3ITF A;  3K1I C;  4Q5S F;  2J9W A;  1D1A A;  4K7B A;  2G62 A;  4G7H F;  1TKN A;  4CS8 A;  1TWA A;  4EBB A;  3QMK A;  4AK9 A;  3NG1 A;  4JVS A;  3IEE A;  3T6J A;  3S27 A;  4O79 A;  1FFH A;  1QZX A;  3EHN A;  4W8K A;  5KYU A;  4JUR I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...