3DZAA

Crystal structure of a putative membrane protein of unknown function (yfdx) from klebsiella pneumoniae subsp. at 1.65 a resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
180
structure length
180
Chain Sequence
b'APAAAATTQVQKEAADVLQVAVQGANAMRDIQFARLALFHGQPDSAKKLTDDAAALLAADDASWAKFVKTDAKAKMIADRYVIINASIALSEDYVATPEKESAIQSANEKLAKGDQKGAIDTLRLAGIGVIENQYLMPLNQTRKAVAQSQELLKAGKYYEANLVLKGAEEGIVVDSEMLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized putative membrane protein
molecule tags Unknown function
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
publication title Crystal structure of putative membrane protein of unknown function (YP_001337144.1) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 1.65 A resolution
rcsb
total genus 66
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10938 YfdX YfdX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1940 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dzaA01
3DZAA
chains in the Genus database with same CATH superfamily
3M15A 2EIKC 3AJMA 1E83A 2XM4A 3JZ0A 3MYIA 4MVMA 2VH3A 4K0DA 3HNLA 3DKAA 1OXKA 1TFOB 4ZLCA 3RVYA 1TWAA 1HW2A 4N6CA 4XEFA 5JLIA 3DAGA 3FOPA 4E0IA 1U6HA 2H7BA 3A9CA 1K04A 1FFHA 1L7CA 1ZU4A 2YZSA 1W2WA 2CCYA 2GDCA 5JSLA 4CSAA 2P61A 3C63A 5T1DB 2NUPA 1FMVA 2W4MA 2PNOA 4A2NB 2GWWA 3CSKA 3LUTB 1C02A 3LNRA 1AUEA 3U5SA 3W2VA 1MMNA 4AL1A 3GEHA 1Q0MA 4I1MA 1YZCA 2UUIA 3W2WA 3JTLO 1WATA 2ETSA 2XLEA 3ZVRA 1OR3A 4J30B 3EGDB 1VLSA 3HNIA 4O6YA 1QZXA 3QTHA 3KH2A 3ZWIA 2LD6A 3ECSA 5L3VA 3B0VC 1R5ID 1H9TA 3LLKA 3DAFA 2XSEA 4XQ1A 4AK9A 5TJ5E 3NYLA 1V74B 1AVOB 1U89A 3TQOA 3U3BA 1RXQA 4GQHA 3FAJA 2C03A 4BPMA 4U5DE 2O9XA 5A6BD 4YT4A 2IXNA 1FMWA 2OKUA 5DLJA 2VCAA 5A69A 3M4BA 3NYMA 1T6IA 2QY9A 3S28A 3N24A 2G3KA 1RJ9B 1PD0A 4MVZA 4ONSA 4YT2A 1FR0A 4E7ZA 3MBGA 5T3TA 3U8VA 1HY5A 2KYHA 4JVSA 3H2UA 4MS2A 3L1MA 4NTFA 1D0YA 1FAPB 3RH3A 2R7WA 1EQ1A 4MVSA 3NDBB 4PJMA 2PX3A 3B0PA 3S84A 2YWAA 1YARO 2XL6A 3DE8A 2OEVA 2B0HA 3EGDA 4CDYA 1SZIA 1ORJA 2HKVA 4XEVA 3U2MA 4DVYP 3ASOC 3K33A 5FZTA 3ABMC 4CSAC 3HJCA 4LERA 1WASA 4NTBA 3E9VA 3HLZA 2CDQA 2LK4A 1IW7F 2PX0A 5B3IA 1JR8A 3C62A 3POVA 5AC5A 1M56C 1OKKA 1M2VB 3BRJA 4XLNF 2A1DD 2J7PD 3U9MA 5KYYB 2KJGA 1NZEA 2KC3A 3U0CA 2XL4A 4FESA 2LCHA 4EUKB 1E84A 3LNMB 3O39A 4DOZA 1Z7Qc 2FAPB 2HSBA 2QTVA 1BZ4A 2QE9A 2EPOA 5JUAA 4OIQF 1NFNA 2H8AA 3T6GB 3DWWA 1JPJA 4A4AA 2VC9A 2YVKA 1MMDA 2HFIA 3RQFA 4YJWA 2G62A 4CBEA 5E2QA 4OINF 4XEKA 2YRFA 3O55A 2PFDA 1UFBA 2HMZA 1T6QA 3M4CA 3EG9B 3RKOF 1M2VA 1TWCA 3B71A 4U9EA 4G7ZF 1QQ3A 3DI5A 3EGXB 3I4UA 3S29A 4DRHB 1T5OA 4U5FE 1CGOA 1RMVA 1Q0DA 2DI3A 4O6NA 5COMA 4N06A 2CNWA 1ZW3A 2J0WA 3LJBA 3NKEA 5BUOA 4G7OF 2Q9CA 1SYQA 5E3AA 3EZIA 3U9JA 2Q9BA 3VYWA 1EA8A 2FFHA 2KNHA 1JRAA 1MMAA 2DYSC 2PF4E 3U2LA 2OCCC 3Q6NA 1QSPA 4DJ9A 2A0BA 2XLOA 5BQGA 2EPMX 4IGGA 1SF8A 2WVNA 2EINC 3AG4C 3NG1A 2X0CA 4BJ5A 1J8MF 1QKRA 3C18A 4I44A 1OW7A 5L3QA 3PMRA 2KQ9A 5IY5C 3GM3A 4K1OA 2P0NA 2IOQA 1DOWA 2F22A 2W9YA 4MTGA 2J7PA 4RD9A 4Z9JA 2MHRA 2HMQA 3EGXA 2ZXOA 4DRIB 2IXMA 3VRCA 1QLEC 2Q9AA 3UR3C 4BJ6A 5KYWA 4DVZA 4O79A 2Q3TA 2R7OA 2NSGA 4FX5A 1CPRA 3ZIBA 2MWQA 4BJ5C 1YJGA 1NU9C 4NCQA 4U5HA 4AL0A 1Q0FA 3GEIA 3LAYA 4I1OB 4JKVA 1D0XA 2YLDA 2BC5A 3KYJA 2XM0A 5BQIA 2GAQA 4EBBA 3E70C 1FNTc 3I5PA 4MW3A 4XLPF 3FDQA 3V7OA 3LEVA 1ZW2A 2D4UA 2M64A 4QDLA 5JRAA 3ASNC 3C8GD 2NUTA 1E2XA 4GYTA 3EHNA 1R4TA 2RD9A 3RIPA 5JP7A 1KTMA 4G0HA 1EI7A 3KL4A 3KMIA 2CYDA 4LDRA 3SXZA 2VASA 5A6KA 3W8HA 5F5FA 3EFOB 3UMHA 4I3MA 1T9KA 2L6FA 2R7UA 3K6BA 4OD5A 4ULWA 1YLMA 5A6AA 1Q0GA 4LACB 5EHHA 3K1IC 3VF0A 3RF3A 4KBLA 3EH1A 4CIPA 2V3CC 4Q5SF 3EHMA 3SXKA 4LDQA 4JEAA 4CIHA 2OOCA 3ZQYA 2OJED 4PJNA 3UGOA 4HFFB 4M63A 3G50A 2IXOA 2P7VA 4W8KA 1C17M 3JRMO 4KNVA 3AQCA 3V5YA 2AWYA 1OR2A 2X51A 4J7TA 2NUTB 4AX2A 3N0TA 1F1MA 1NBBA 3US6A 1A0BA 4U5GA 3AG3C 1CGNA 1GGQA 2OG2A 3B29A 1LM3B 2DGJA 4OIRF 1BDJB 1V54C 3GODA 2NPUA 5KYXA 1CGME 1RCPA 5L0JA 1D1CA 1D1AA 1WTYA 4JEBA 3SP1A 4OIPF 3B0UX 2WB7A 4JE9A 3ZTZA 1OQCA 4E7SA 1M6TA 3GWNA 2KSFA 1FFTC 4XPWA 1YYJA 1OCRC 4JCHA 1GQAA 1LI5A 4J7YA 2Y3BA 2R02A 3RVZA 3UNGC 1A7VA 3EPVA 3QW1A 3MYFA 2P1AA 3WHNA 3IQTA 2ZPAA 2A0UA 4XPYA 2OQMA 2LP4A 4PR9A 2XLVA 1CPQA 1O5HA 2AU5A 3T9OA 2Z15A 4C3BA 3DMDA 5B1AC 3QVYA 1KNYA 1G5ZA 5BQHA 1T6UA 1A41A 3TK0A 2IBFA 4PFOA 4BJ1A 5KYXB 4PJLA 1KU2A 2QLAA 2L81A 2HV7A 1ZVZA 3FHDA 2CGEA 1VYIA 3QW0A 4EBKA 4PJJA 4CS8C 4Q4ZF 4XTKA 2BL2A 2HJ3A 3DJNB 3NYJA 3Q7LA 1RKCA 2XLDA 2Q00A 5A6JA 5E3CA 3ZC4A 4UDVA 3GM2A 1O3UA 1VLTA 4KNWA 3RQGA 4G7HF 1OXBA 1K05A 1H9GA 1YA9A 2JPUA 1C03A 2LFDA 256BA 4YN0B 5E33A 5KYUB 5CIVA 5DS5A 1YVIA 5FCLA 1V55C 2IM8A 2RSEB 3IQ5A 2EIJC 3C8GB 3MFNA 1MMGA 2M4EA 3QVZA 4CS9C 3ATPA 3NMJA 1N1CA 3RW0A 3EH2A 3L34A 3SXMA 4F4BA 1ZHTA 2W4BA 4YWQA 4N6HA 1E86A 4DXWA 3PCVA 2ASRA 4RBNA 5F5HA 2Y3GA 1HW1A 1XZPA 4XWJA 4PFPA 1MQVA 5EGYA 3AQBA 3R2PA 1NFOA 1LPEA 4HE8D 3ZDLA 2XS8A 4MVQA 3HNJA 4C3DA 3W8IA 1GM5A 1JMWA 4H4KC 1BR4A 4BG0A 4Z9HA 3TOLA 3ZG1A 4PACA 1G4WR 1MNEA 1Z3IX 2EILC 2JD3A 3MLGA 5AC4A 1RJ9A 1YYXA 2H7VC 3H65A 4NC3A 5KYUA 1NSGB 1T01A 3IQ6A 2A68F 3QMKA 3DM5A 2HV6A 4P9TA 2ZXWC 4JURI 3R7CA 2UUHA 3RYLA 3FMSA 2J9BA 3SYNA 1WOLA 2Y3HA 3C8GA 4B6IA 4YT8A 1ORYA 5L0GA 2AWCA 1Z63A 2KW3C 1U0BB 2OU6A 3K7DA 1H7IA 1SMYF 1D0ZA 4BEJA 1BBHA 5L0IA 1B68A 4E18A 2E87A 3AG1C 1TFKB 2JX0A 3K1IA 2R7TA 4FAPB 2A69F 3ZSUA 1VOMA 1S7ZA 1BR1A 3N2ZB 2R25A 2BE5F 3A11A 3UMKA 2NUPB 1VYKA 2J9WA 2YEVA 3EJNA 3IQCA 4RDAA 5JVEA 1YA7O 2B0JA 4D4NA 2HJMA 3AGTA 1LE4A 1E85A 1BR2A 2MYSA 3KPHA 3LEOA 3NMIA 2YL7A 2R05A 3LLIA 2LFFA 5DS4A 4MTFA 2J45A 1YZAA 2VB6A 3ITFA 4X0RA 3GANA 4MW8A 2HUJA 3EZHA 5COFA 1PCXA 4JTDB 1XZQA 4IAQA 5B1BC 5DS6A 5T3WA 1Q0KA 3JCUQ 4QI0A 2XLWA 2GFHA 4IJJA 1VMAA 3CEXA 2YL3A 4L6RA 3JYYA 1OW6A 3TJ6A 5JT4A 4WABA 4MTOA 2HSQA 4NY3A 4BJTA 4IAOA 3IPMO 4C3EA 2FGYA 1LI7A 2ICWG 1MNDA 3EG9A 4W8PA 5COGA 2R9RB 3O6XA 1Z6AA 5DQTA 4ZLDA 3DD7A 3OA1A 4JZAA 4ULVA 1HMDA 2L7AA 2YHSA 2HS5A 1OCCC 2YLIA 3NKDA 2W45A 2Y3DA 4WGYA 3JSEO 4BJ6C 3B9QA 3AG2C 4JC7A 3U8PA 1L3PA 2ZXPA 1WWPA 4FWVA 2I8BA 5CI9A 1ZHXA 4AE4A 1O87A 1VTMP 2HZ8A 3S0XA 3L8JA 1M2OA 1QPUA 3DZAA 3K1HA 3CQZA 2AP3A 4MVOA 1NLXA 2R7RA 2WZFA 2A6HF 4WJ0A 4Q7CA 4E0HA 1PV3A 1JOGA 3S90A 3IHUA 2DB4A 1G4US 1Y6DA 4XPXA 3G4XA 1VB5A 5F28E 4N4WA 2KGOA 1Z5ZA 2EPNA 1M57C 2WVQA 3H2VA 3V5XA 3JYHA 1Z23A 2IYLD 5KYYA 4ANJA 2ZXRA 3CZ6A 1HE1A 2PP4A 3MX3A 2L6GA 1I5NA 2NSFA 4MVUA 1JPNA 1ZHYA 1ST6A 2J46A 2J9UA 4MNDA 4O6MA 3V5ZA 5HV9A 4YL3A 3JSZA 3OWTA 3M79A 2ZD9A 4NTAA 1HE9A 4CX9A 1ORSC 1WN0A 3JT1A 3W4YA 2LIGA 4AE4B 4JRZA 2EIMC 3TJ5A 3J06A 1LS4A 1S05A 2J8WA 2OEXA 2Q4FA 1NU7D 2Y39A 1LE2A 1FTSA 3JRTA 3ZTMA 4CDAA 4J32B 3SEOA 2P6VA 3X2QC 1Y4CA 5KYNA 1D1BA 5EK0A 3FOOA 1A7DA 4U5EE 1DOVA 2WZGA 5A6BA 4O7GA 2XXAA 1EKYA 3F47A 4KI2A 4CS8A 1LKXA 2XS1A 1UG7A 3DJUB 2D5RB 4IWBA 1APCA 3FVYA 4KC9A 4HFKB 5L0FA 2CNWD 5L0CA 3S27A 4CDVA 1GS9A 4QI2A 1TKNA 2R7QA 3TD7A 3DM9B 4E17A 1SR2A 1OW8A 1WGWA 3FAPB 3T4RA 1YDIA 2EPKX 2KK1A 3QZCA 4CJOA 2L6HA 3TOMA 4WGZA 3KYIA 5B3SC 2YQYA 3C7JA 2DYRC 5DQZA 2YL0A 4JW1A 3AGUA 3VM6A 3GWLA 2QUPA 1IZMA 1LIHA 1OCOC 3KKBA 4U5CE 4LLCA 2R7XA 3GM1A 3S9OA 3Q6MA 2PBEA 3HKKA 4IB4A 5AGFA 3GEEA 4YL1A 3TULA 2XXAB 3WODF 4LLEA 3ZQVA 2EPLX 3DXJF 3VAYA 3L0IA 4D4XA 5KYWB 4JTAB 3IEEA 4C7OA 2VCCA 3WG7C 4DRJB 5JS5A 1QVXA 3NMKA 4U9DA 5D92A 3OEOA 2R7SA 3UMIA 3ABKC 4CS7A 4U5BE 2R03A 2J0XA 1OCZC 1LVKA 3EQLF 4H54A 3RQEA 2TMVP 2A6EF 1TR2A 1YAUO 3Q7GA 1A7EA 4OD4A 2Q7RA 2V26A 1RKEB 4Z9IA 4ER9A 1J8YF 3C8ZA 2GA0A 3T6BA 2H7OA 1ZU5A 3G4ZA 3UGPA 3F46A 3LESA 5GPGB 1XWJA 2WZLA 2YKZA 4YT5A 3LS1A 4P9FA 2Y69C 4P6IC 2XLHA 3SNHA 3CAXA 3X1OA 3EFOA 4JIOA 2LSEA 4BEMJ 4EIYA 4C7OB 3BEHA 4EKWA 1I4ZA 3GORA 4HEAJ 4EWCA 2XRHA 3DE9A 1PD1A 1HMOA 1TWHA 4JTCB 5K0IA 1ZHZA 4GEHA 5L0HA 4JJFA 3LS0A 4MQ9F 4CS9A 2G3VA 4MVRA 4OIOF 1RKEA 2I15A 1I4YA 3AOUA 3T6JA 4G78A 1V4AA 1TWGA 1ZHWA 2NG1A 3K66A 2R7VA 5D91A 2LQGA 3ABLC 4LDKA 2C04A 4DBRA 3L8IA 2WVOA 3HTKC 4DBQA 2XL8A 3O10A 3PHF2 4YK5A 4EHPA 5L0DA 2VCBA 4EBJA 1ZZPA 3I5QA 3NRHA 1VK5A 5HSWA 2YLGA 4IARA 1NG1A 5CI8A 3SZRA 3WAQA 3PDMP 2XLMA 3FXHA 1AEPA 1K40A 2YL1A 2J9VA 1JAFA 3U3FA 1LS1A 4K7BA 4JJGA 2CW0F 4NQFA 4JCZA 2WL8A 3SXYA 2QNLA 1OKKD 3RFYA 3M1CB 2AVKA 2IXPA 1ZYRF 3HNKA 1TQGA 4IRUA 4R32A 1H6GA 2OJQA 4CJGA 2L9JA 4PK4A 5DVWA 1G8XA 4YL0A
chains in the Genus database with same CATH topology
2EIKC 2VH3A 4K0DA 4ZLCA 1TWAA 3DAGA 2H7BA 1FFHA 1ZU4A 2YZSA 1W2WA 4CSAA 5T1DB 2NUPA 1FMVA 2W4MA 4A2NB 3CSKA 3LNRA 3W2VA 1MMNA 4I1MA 3W2WA 3ZVRA 4J30B 3EGDB 4O6YA 1QZXA 3KH2A 3B0VC 3ECSA 5L3VA 3LLKA 3DAFA 2XSEA 4AK9A 3NYLA 3FAJA 2C03A 4U5DE 2O9XA 4YT4A 2IXNA 1FMWA 5DLJA 3NYMA 2QY9A 3S28A 3N24A 2G3KA 1RJ9B 1PD0A 4YT2A 4E7ZA 5T3TA 4JVSA 3RH3A 1D0YA 2R7WA 3NDBB 4PJMA 2PX3A 3B0PA 3EGDA 1SZIA 4DVYP 3ASOC 3K33A 3ABMC 4CSAC 3HJCA 4LERA 3E9VA 3HLZA 2CDQA 1IW7F 2PX0A 3POVA 5KYYB 1M56C 1OKKA 1M2VB 4XLNF 2A1DD 2J7PD 2KJGA 1NZEA 2XL4A 4FESA 3O39A 4DOZA 2QTVA 4OIQF 1JPJA 1MMDA 4YJWA 2G62A 4CBEA 5E2QA 4OINF 2PFDA 3RKOF 3EG9B 1M2VA 1TWCA 4G7ZF 3EGXB 3I4UA 3S29A 4U5FE 4O6NA 4N06A 2CNWA 2J0WA 3NKEA 3LJBA 5BUOA 4G7OF 2Q9CA 5E3AA 3EZIA 3VYWA 2Q9BA 2FFHA 2KNHA 2PF4E 1MMAA 2DYSC 2OCCC 3Q6NA 1SF8A 2WVNA 2EINC 3AG4C 3NG1A 4BJ5A 1J8MF 5L3QA 4I44A 3PMRA 2KQ9A 5IY5C 4RD9A 2IOQA 2W9YA 2J7PA 3EGXA 2ZXOA 2IXMA 1QLEC 2Q9AA 3UR3C 4BJ6A 5KYWA 4DVZA 4O79A 2Q3TA 2R7OA 4FX5A 3ZIBA 2MWQA 4BJ5C 1NU9C 4U5HA 3LAYA 4I1OB 1D0XA 4EBBA 3E70C 3I5PA 4XLPF 3FDQA 3V7OA 3LEVA 4QDLA 3ASNC 2NUTA 4GYTA 3EHNA 3RIPA 4G0HA 3KL4A 3KMIA 2VASA 3W8HA 5F5FA 3EFOB 3UMHA 4I3MA 2R7UA 3K6BA 4OD5A 4ULWA 5EHHA 4LACB 3K1IC 4KBLA 3EH1A 2V3CC 3EHMA 4CIHA 4PJNA 3UGOA 4HFFB 4M63A 2IXOA 2P7VA 4W8KA 4KNVA 3AQCA 2X51A 2NUTB 4AX2A 3N0TA 4U5GA 3AG3C 2OG2A 4OIRF 2DGJA 1V54C 3GODA 5KYXA 2R7XA 1D1CA 1D1AA 3SP1A 4OIPF 3B0UX 2WB7A 1FFTC 1OCRC 4JCHA 2Y3BA 3UNGC 3EPVA 2ZPAA 1O5HA 2Z15A 4C3BA 3DMDA 5B1AC 4PFOA 4BJ1A 5KYXB 4PJLA 1KU2A 2L81A 2HV7A 3FHDA 2CGEA 1VYIA 4PJJA 4Q4ZF 4XTKA 3DJNB 3NYJA 3Q7LA 5E3CA 3ZC4A 4KNWA 4G7HF 4YN0B 5E33A 5KYUB 5DS5A 5FCLA 1V55C 2EIJC 4CS9C 1MMGA 2M4EA 1N1CA 3EH2A 3L34A 4F4BA 1ZHTA 2W4BA 4YWQA 4RBNA 5F5HA 2Y3GA 4XWJA 4PFPA 5EGYA 3AQBA 4HE8D 4C3DA 3W8IA 4H4KC 1BR4A 4BG0A 3ZG1A 1MNEA 1Z3IX 2EILC 2JD3A 3MLGA 1RJ9A 2H7VC 3H65A 5KYUA 3QMKA 2A68F 3DM5A 2HV6A 2ZXWC 4JURI 3SYNA 3RYLA 4B6IA 2Y3HA 1Z63A 4YT8A 2KW3C 3K7DA 1SMYF 1D0ZA 4BEJA 2E87A 3AG1C 2R7TA 2A69F 3ZSUA 1VOMA 1S7ZA 1BR1A 3N2ZB 2BE5F 3UMKA 2NUPB 1VYKA 2J9WA 2YEVA 3EJNA 4RDAA 2B0JA 1BR2A 2MYSA 3LLIA 5DS4A 2J45A 2VB6A 3ITFA 4X0RA 3GANA 3EZHA 1PCXA 5B1BC 5DS6A 5T3WA 3JCUQ 4QI0A 2GFHA 4IJJA 1VMAA 4NY3A 4BJTA 4IAOA 4C3EA 3EG9A 2FGYA 1MNDA 3O6XA 4ZLDA 1Z6AA 5DQTA 3DD7A 3OA1A 4JZAA 4DBQA 2YHSA 3NKDA 4E7SA 1OCCC 2W45A 2Y3DA 4BJ6C 3B9QA 3AG2C 2ZXPA 4FWVA 2I8BA 5CI9A 1ZHXA 4AE4A 1O87A 4Q5SF 3S0XA 1M2OA 3DZAA 3K1HA 3CQZA 2R7RA 2WZFA 2A6HF 4WJ0A 4Q7CA 2KGOA 1Z5ZA 1M57C 2WVQA 3JYHA 1Z23A 2IYLD 5KYYA 4ANJA 2ZXRA 3CZ6A 2PP4A 3MX3A 1JPNA 1ZHYA 1ST6A 2J46A 2J9UA 4MNDA 4O6MA 3JSZA 3OWTA 3JT1A 4AE4B 2EIMC 2Y39A 1NU7D 3JRTA 1FTSA 4J32B 3SEOA 2P6VA 3X2QC 5KYNA 1D1BA 4U5EE 2WZGA 2XXAA 4O7GA 3F47A 4KI2A 4CS8A 1LKXA 3DJUB 2D5RB 4IWBA 3FVYA 4KC9A 4HFKB 2CNWD 3S27A 4QI2A 1TKNA 2R7QA 3TD7A 3DM9B 1WGWA 3T4RA 3QZCA 5B3SC 2DYRC 5DQZA 4JW1A 1IZMA 3KKBA 1OCOC 4U5CE 4LLCA 3Q6MA 2XXAB 3WODF 4LLEA 3DXJF 3VAYA 3L0IA 5KYWB 3IEEA 4C7OA 3WG7C 5D92A 3OEOA 2R7SA 3UMIA 3ABKC 4CS7A 4U5BE 2J0XA 1OCZC 1LVKA 3EQLF 2A6EF 1TR2A 3Q7GA 4OD4A 2V26A 1J8YF 3T6BA 2H7OA 1ZU5A 3UGPA 3F46A 3LESA 2WZLA 4YT5A 3LS1A 2Y69C 4P6IC 3SNHA 3X1OA 3EFOA 2LSEA 4C7OB 4HEAJ 4EWCA 2XRHA 1PD1A 1TWHA 1ZHZA 4GEHA 4JJFA 3LS0A 4MQ9F 4CS9A 2G3VA 4OIOF 3T6JA 1TWGA 1ZHWA 2NG1A 3K66A 2R7VA 5D91A 4DBRA 3ABLC 2C04A 2WVOA 3HTKC 3PHF2 3I5QA 3NRHA 1VK5A 5HSWA 5CI8A 1NG1A 3SZRA 2J9VA 1LS1A 4K7BA 4JJGA 2CW0F 2WL8A 1OKKD 3RFYA 3M1CB 2IXPA 1ZYRF 4IRUA 2L9JA 4PK4A 5DVWA 1G8XA 4CS8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DZA A; 
#chains in the Genus database with same CATH topology
 3M15 A;  2EIK C;  3AJM A;  1E83 A;  2XM4 A;  3JZ0 A;  3MYI A;  4MVM A;  2VH3 A;  4K0D A;  3HNL A;  3DKA A;  1OXK A;  1TFO B;  4ZLC A;  3RVY A;  1TWA A;  1HW2 A;  4N6C A;  4XEF A;  5JLI A;  3DAG A;  3FOP A;  4E0I A;  1U6H A;  2H7B A;  3A9C A;  1K04 A;  1FFH A;  1L7C A;  1ZU4 A;  2YZS A;  1W2W A;  2CCY A;  2GDC A;  5JSL A;  4CSA A;  2P61 A;  3C63 A;  5T1D B;  2NUP A;  1FMV A;  2W4M A;  2PNO A;  4A2N B;  2GWW A;  3CSK A;  3LUT B;  1C02 A;  3LNR A;  1AUE A;  3U5S A;  3W2V A;  1MMN A;  4AL1 A;  3GEH A;  1Q0M A;  4I1M A;  1YZC A;  2UUI A;  3W2W A;  3JTL O;  1WAT A;  2ETS A;  2XLE A;  3ZVR A;  1OR3 A;  4J30 B;  3EGD B;  1VLS A;  3HNI A;  4O6Y A;  1QZX A;  3QTH A;  3KH2 A;  3ZWI A;  2LD6 A;  3ECS A;  5L3V A;  3B0V C;  1R5I D;  1H9T A;  3LLK A;  3DAF A;  2XSE A;  4XQ1 A;  4AK9 A;  5TJ5 E;  3NYL A;  1V74 B;  1AVO B;  1U89 A;  3TQO A;  3U3B A;  1RXQ A;  4GQH A;  3FAJ A;  2C03 A;  4BPM A;  4U5D E;  2O9X A;  5A6B D;  4YT4 A;  2IXN A;  1FMW A;  2OKU A;  5DLJ A;  2VCA A;  5A69 A;  3M4B A;  3NYM A;  1T6I A;  2QY9 A;  3S28 A;  3N24 A;  2G3K A;  1RJ9 B;  1PD0 A;  4MVZ A;  4ONS A;  4YT2 A;  1FR0 A;  4E7Z A;  3MBG A;  5T3T A;  3U8V A;  1HY5 A;  2KYH A;  4JVS A;  3H2U A;  4MS2 A;  3L1M A;  4NTF A;  1D0Y A;  1FAP B;  3RH3 A;  2R7W A;  1EQ1 A;  4MVS A;  3NDB B;  4PJM A;  2PX3 A;  3B0P A;  3S84 A;  2YWA A;  1YAR O;  2XL6 A;  3DE8 A;  2OEV A;  2B0H A;  3EGD A;  4CDY A;  1SZI A;  1ORJ A;  2HKV A;  4XEV A;  3U2M A;  4DVY P;  3ASO C;  3K33 A;  5FZT A;  3ABM C;  4CSA C;  3HJC A;  4LER A;  1WAS A;  4NTB A;  3E9V A;  3HLZ A;  2CDQ A;  2LK4 A;  1IW7 F;  2PX0 A;  5B3I A;  1JR8 A;  3C62 A;  3POV A;  5AC5 A;  1M56 C;  1OKK A;  1M2V B;  3BRJ A;  4XLN F;  2A1D D;  2J7P D;  3U9M A;  5KYY B;  2KJG A;  1NZE A;  2KC3 A;  3U0C A;  2XL4 A;  4FES A;  2LCH A;  4EUK B;  1E84 A;  3LNM B;  3O39 A;  4DOZ A;  1Z7Q c;  2FAP B;  2HSB A;  2QTV A;  1BZ4 A;  2QE9 A;  2EPO A;  5JUA A;  4OIQ F;  1NFN A;  2H8A A;  3T6G B;  3DWW A;  1JPJ A;  4A4A A;  2VC9 A;  2YVK A;  1MMD A;  2HFI A;  3RQF A;  4YJW A;  2G62 A;  4CBE A;  5E2Q A;  4OIN F;  4XEK A;  2YRF A;  3O55 A;  2PFD A;  1UFB A;  2HMZ A;  1T6Q A;  3M4C A;  3EG9 B;  3RKO F;  1M2V A;  1TWC A;  3B71 A;  4U9E A;  4G7Z F;  1QQ3 A;  3DI5 A;  3EGX B;  3I4U A;  3S29 A;  4DRH B;  1T5O A;  4U5F E;  1CGO A;  1RMV A;  1Q0D A;  2DI3 A;  4O6N A;  5COM A;  4N06 A;  2CNW A;  1ZW3 A;  2J0W A;  3LJB A;  3NKE A;  5BUO A;  4G7O F;  2Q9C A;  1SYQ A;  5E3A A;  3EZI A;  3U9J A;  2Q9B A;  3VYW A;  1EA8 A;  2FFH A;  2KNH A;  1JRA A;  1MMA A;  2DYS C;  2PF4 E;  3U2L A;  2OCC C;  3Q6N A;  1QSP A;  4DJ9 A;  2A0B A;  2XLO A;  5BQG A;  2EPM X;  4IGG A;  1SF8 A;  2WVN A;  2EIN C;  3AG4 C;  3NG1 A;  2X0C A;  4BJ5 A;  1J8M F;  1QKR A;  3C18 A;  4I44 A;  1OW7 A;  5L3Q A;  3PMR A;  2KQ9 A;  5IY5 C;  3GM3 A;  4K1O A;  2P0N A;  2IOQ A;  1DOW A;  2F22 A;  2W9Y A;  4MTG A;  2J7P A;  4RD9 A;  4Z9J A;  2MHR A;  2HMQ A;  3EGX A;  2ZXO A;  4DRI B;  2IXM A;  3VRC A;  1QLE C;  2Q9A A;  3UR3 C;  4BJ6 A;  5KYW A;  4DVZ A;  4O79 A;  2Q3T A;  2R7O A;  2NSG A;  4FX5 A;  1CPR A;  3ZIB A;  2MWQ A;  4BJ5 C;  1YJG A;  1NU9 C;  4NCQ A;  4U5H A;  4AL0 A;  1Q0F A;  3GEI A;  3LAY A;  4I1O B;  4JKV A;  1D0X A;  2YLD A;  2BC5 A;  3KYJ A;  2XM0 A;  5BQI A;  2GAQ A;  4EBB A;  3E70 C;  1FNT c;  3I5P A;  4MW3 A;  4XLP F;  3FDQ A;  3V7O A;  3LEV A;  1ZW2 A;  2D4U A;  2M64 A;  4QDL A;  5JRA A;  3ASN C;  3C8G D;  2NUT A;  1E2X A;  4GYT A;  3EHN A;  1R4T A;  2RD9 A;  3RIP A;  5JP7 A;  1KTM A;  4G0H A;  1EI7 A;  3KL4 A;  3KMI A;  2CYD A;  4LDR A;  3SXZ A;  2VAS A;  5A6K A;  3W8H A;  5F5F A;  3EFO B;  3UMH A;  4I3M A;  1T9K A;  2L6F A;  2R7U A;  3K6B A;  4OD5 A;  4ULW A;  1YLM A;  5A6A A;  1Q0G A;  4LAC B;  5EHH A;  3K1I C;  3VF0 A;  3RF3 A;  4KBL A;  3EH1 A;  4CIP A;  2V3C C;  4Q5S F;  3EHM A;  3SXK A;  4LDQ A;  4JEA A;  4CIH A;  2OOC A;  3ZQY A;  2OJE D;  4PJN A;  3UGO A;  4HFF B;  4M63 A;  3G50 A;  2IXO A;  2P7V A;  4W8K A;  1C17 M;  3JRM O;  4KNV A;  3AQC A;  3V5Y A;  2AWY A;  1OR2 A;  2X51 A;  4J7T A;  2NUT B;  4AX2 A;  3N0T A;  1F1M A;  1NBB A;  3US6 A;  1A0B A;  4U5G A;  3AG3 C;  1CGN A;  1GGQ A;  2OG2 A;  3B29 A;  1LM3 B;  2DGJ A;  4OIR F;  1BDJ B;  1V54 C;  3GOD A;  2NPU A;  5KYX A;  1CGM E;  1RCP A;  5L0J A;  1D1C A;  1D1A A;  1WTY A;  4JEB A;  3SP1 A;  4OIP F;  3B0U X;  2WB7 A;  4JE9 A;  3ZTZ A;  1OQC A;  4E7S A;  1M6T A;  3GWN A;  2KSF A;  1FFT C;  4XPW A;  1YYJ A;  1OCR C;  4JCH A;  1GQA A;  1LI5 A;  4J7Y A;  2Y3B A;  2R02 A;  3RVZ A;  3UNG C;  1A7V A;  3EPV A;  3QW1 A;  3MYF A;  2P1A A;  3WHN A;  3IQT A;  2ZPA A;  2A0U A;  4XPY A;  2OQM A;  2LP4 A;  4PR9 A;  2XLV A;  1CPQ A;  1O5H A;  2AU5 A;  3T9O A;  2Z15 A;  4C3B A;  3DMD A;  5B1A C;  3QVY A;  1KNY A;  1G5Z A;  5BQH A;  1T6U A;  1A41 A;  3TK0 A;  2IBF A;  4PFO A;  4BJ1 A;  5KYX B;  4PJL A;  1KU2 A;  2QLA A;  2L81 A;  2HV7 A;  1ZVZ A;  3FHD A;  2CGE A;  1VYI A;  3QW0 A;  4EBK A;  4PJJ A;  4CS8 C;  4Q4Z F;  4XTK A;  2BL2 A;  2HJ3 A;  3DJN B;  3NYJ A;  3Q7L A;  1RKC A;  2XLD A;  2Q00 A;  5A6J A;  5E3C A;  3ZC4 A;  4UDV A;  3GM2 A;  1O3U A;  1VLT A;  4KNW A;  3RQG A;  4G7H F;  1OXB A;  1K05 A;  1H9G A;  1YA9 A;  2JPU A;  1C03 A;  2LFD A;  256B A;  4YN0 B;  5E33 A;  5KYU B;  5CIV A;  5DS5 A;  1YVI A;  5FCL A;  1V55 C;  2IM8 A;  2RSE B;  3IQ5 A;  2EIJ C;  3C8G B;  3MFN A;  1MMG A;  2M4E A;  3QVZ A;  4CS9 C;  3ATP A;  3NMJ A;  1N1C A;  3RW0 A;  3EH2 A;  3L34 A;  3SXM A;  4F4B A;  1ZHT A;  2W4B A;  4YWQ A;  4N6H A;  1E86 A;  4DXW A;  3PCV A;  2ASR A;  4RBN A;  5F5H A;  2Y3G A;  1HW1 A;  1XZP A;  4XWJ A;  4PFP A;  1MQV A;  5EGY A;  3AQB A;  3R2P A;  1NFO A;  1LPE A;  4HE8 D;  3ZDL A;  2XS8 A;  4MVQ A;  3HNJ A;  4C3D A;  3W8I A;  1GM5 A;  1JMW A;  4H4K C;  1BR4 A;  4BG0 A;  4Z9H A;  3TOL A;  3ZG1 A;  4PAC A;  1G4W R;  1MNE A;  1Z3I X;  2EIL C;  2JD3 A;  3MLG A;  5AC4 A;  1RJ9 A;  1YYX A;  2H7V C;  3H65 A;  4NC3 A;  5KYU A;  1NSG B;  1T01 A;  3IQ6 A;  2A68 F;  3QMK A;  3DM5 A;  2HV6 A;  4P9T A;  2ZXW C;  4JUR I;  3R7C A;  2UUH A;  3RYL A;  3FMS A;  2J9B A;  3SYN A;  1WOL A;  2Y3H A;  3C8G A;  4B6I A;  4YT8 A;  1ORY A;  5L0G A;  2AWC A;  1Z63 A;  2KW3 C;  1U0B B;  2OU6 A;  3K7D A;  1H7I A;  1SMY F;  1D0Z A;  4BEJ A;  1BBH A;  5L0I A;  1B68 A;  4E18 A;  2E87 A;  3AG1 C;  1TFK B;  2JX0 A;  3K1I A;  2R7T A;  4FAP B;  2A69 F;  3ZSU A;  1VOM A;  1S7Z A;  1BR1 A;  3N2Z B;  2R25 A;  2BE5 F;  3A11 A;  3UMK A;  2NUP B;  1VYK A;  2J9W A;  2YEV A;  3EJN A;  3IQC A;  4RDA A;  5JVE A;  1YA7 O;  2B0J A;  4D4N A;  2HJM A;  3AGT A;  1LE4 A;  1E85 A;  1BR2 A;  2MYS A;  3KPH A;  3LEO A;  3NMI A;  2YL7 A;  2R05 A;  3LLI A;  2LFF A;  5DS4 A;  4MTF A;  2J45 A;  1YZA A;  2VB6 A;  3ITF A;  4X0R A;  3GAN A;  4MW8 A;  2HUJ A;  3EZH A;  5COF A;  1PCX A;  4JTD B;  1XZQ A;  4IAQ A;  5B1B C;  5DS6 A;  5T3W A;  1Q0K A;  3JCU Q;  4QI0 A;  2XLW A;  2GFH A;  4IJJ A;  1VMA A;  3CEX A;  2YL3 A;  4L6R A;  3JYY A;  1OW6 A;  3TJ6 A;  5JT4 A;  4WAB A;  4MTO A;  2HSQ A;  4NY3 A;  4BJT A;  4IAO A;  3IPM O;  4C3E A;  2FGY A;  1LI7 A;  2ICW G;  1MND A;  3EG9 A;  4W8P A;  5COG A;  2R9R B;  3O6X A;  1Z6A A;  5DQT A;  4ZLD A;  3DD7 A;  3OA1 A;  4JZA A;  4ULV A;  1HMD A;  2L7A A;  2YHS A;  2HS5 A;  1OCC C;  2YLI A;  3NKD A;  2W45 A;  2Y3D A;  4WGY A;  3JSE O;  4BJ6 C;  3B9Q A;  3AG2 C;  4JC7 A;  3U8P A;  1L3P A;  2ZXP A;  1WWP A;  4FWV A;  2I8B A;  5CI9 A;  1ZHX A;  4AE4 A;  1O87 A;  1VTM P;  2HZ8 A;  3S0X A;  3L8J A;  1M2O A;  1QPU A;  3DZA A;  3K1H A;  3CQZ A;  2AP3 A;  4MVO A;  1NLX A;  2R7R A;  2WZF A;  2A6H F;  4WJ0 A;  4Q7C A;  4E0H A;  1PV3 A;  1JOG A;  3S90 A;  3IHU A;  2DB4 A;  1G4U S;  1Y6D A;  4XPX A;  3G4X A;  1VB5 A;  5F28 E;  4N4W A;  2KGO A;  1Z5Z A;  2EPN A;  1M57 C;  2WVQ A;  3H2V A;  3V5X A;  3JYH A;  1Z23 A;  2IYL D;  5KYY A;  4ANJ A;  2ZXR A;  3CZ6 A;  1HE1 A;  2PP4 A;  3MX3 A;  2L6G A;  1I5N A;  2NSF A;  4MVU A;  1JPN A;  1ZHY A;  1ST6 A;  2J46 A;  2J9U A;  4MND A;  4O6M A;  3V5Z A;  5HV9 A;  4YL3 A;  3JSZ A;  3OWT A;  3M79 A;  2ZD9 A;  4NTA A;  1HE9 A;  4CX9 A;  1ORS C;  1WN0 A;  3JT1 A;  3W4Y A;  2LIG A;  4AE4 B;  4JRZ A;  2EIM C;  3TJ5 A;  3J06 A;  1LS4 A;  1S05 A;  2J8W A;  2OEX A;  2Q4F A;  1NU7 D;  2Y39 A;  1LE2 A;  1FTS A;  3JRT A;  3ZTM A;  4CDA A;  4J32 B;  3SEO A;  2P6V A;  3X2Q C;  1Y4C A;  5KYN A;  1D1B A;  5EK0 A;  3FOO A;  1A7D A;  4U5E E;  1DOV A;  2WZG A;  5A6B A;  4O7G A;  2XXA A;  1EKY A;  3F47 A;  4KI2 A;  4CS8 A;  1LKX A;  2XS1 A;  1UG7 A;  3DJU B;  2D5R B;  4IWB A;  1APC A;  3FVY A;  4KC9 A;  4HFK B;  5L0F A;  2CNW D;  5L0C A;  3S27 A;  4CDV A;  1GS9 A;  4QI2 A;  1TKN A;  2R7Q A;  3TD7 A;  3DM9 B;  4E17 A;  1SR2 A;  1OW8 A;  1WGW A;  3FAP B;  3T4R A;  1YDI A;  2EPK X;  2KK1 A;  3QZC A;  4CJO A;  2L6H A;  3TOM A;  4WGZ A;  3KYI A;  5B3S C;  2YQY A;  3C7J A;  2DYR C;  5DQZ A;  2YL0 A;  4JW1 A;  3AGU A;  3VM6 A;  3GWL A;  2QUP A;  1IZM A;  1LIH A;  1OCO C;  3KKB A;  4U5C E;  4LLC A;  2R7X A;  3GM1 A;  3S9O A;  3Q6M A;  2PBE A;  3HKK A;  4IB4 A;  5AGF A;  3GEE A;  4YL1 A;  3TUL A;  2XXA B;  3WOD F;  4LLE A;  3ZQV A;  2EPL X;  3DXJ F;  3VAY A;  3L0I A;  4D4X A;  5KYW B;  4JTA B;  3IEE A;  4C7O A;  2VCC A;  3WG7 C;  4DRJ B;  5JS5 A;  1QVX A;  3NMK A;  4U9D A;  5D92 A;  3OEO A;  2R7S A;  3UMI A;  3ABK C;  4CS7 A;  4U5B E;  2R03 A;  2J0X A;  1OCZ C;  1LVK A;  3EQL F;  4H54 A;  3RQE A;  2TMV P;  2A6E F;  1TR2 A;  1YAU O;  3Q7G A;  1A7E A;  4OD4 A;  2Q7R A;  2V26 A;  1RKE B;  4Z9I A;  4ER9 A;  1J8Y F;  3C8Z A;  2GA0 A;  3T6B A;  2H7O A;  1ZU5 A;  3G4Z A;  3UGP A;  3F46 A;  3LES A;  5GPG B;  1XWJ A;  2WZL A;  2YKZ A;  4YT5 A;  3LS1 A;  4P9F A;  2Y69 C;  4P6I C;  2XLH A;  3SNH A;  3CAX A;  3X1O A;  3EFO A;  4JIO A;  2LSE A;  4BEM J;  4EIY A;  4C7O B;  3BEH A;  4EKW A;  1I4Z A;  3GOR A;  4HEA J;  4EWC A;  2XRH A;  3DE9 A;  1PD1 A;  1HMO A;  1TWH A;  4JTC B;  5K0I A;  1ZHZ A;  4GEH A;  5L0H A;  4JJF A;  3LS0 A;  4MQ9 F;  4CS9 A;  2G3V A;  4MVR A;  4OIO F;  1RKE A;  2I15 A;  1I4Y A;  3AOU A;  3T6J A;  4G78 A;  1V4A A;  1TWG A;  1ZHW A;  2NG1 A;  3K66 A;  2R7V A;  5D91 A;  2LQG A;  3ABL C;  4LDK A;  2C04 A;  4DBR A;  3L8I A;  2WVO A;  3HTK C;  4DBQ A;  2XL8 A;  3O10 A;  3PHF 2;  4YK5 A;  4EHP A;  5L0D A;  2VCB A;  4EBJ A;  1ZZP A;  3I5Q A;  3NRH A;  1VK5 A;  5HSW A;  2YLG A;  4IAR A;  1NG1 A;  5CI8 A;  3SZR A;  3WAQ A;  3PDM P;  2XLM A;  3FXH A;  1AEP A;  1K40 A;  2YL1 A;  2J9V A;  1JAF A;  3U3F A;  1LS1 A;  4K7B A;  4JJG A;  2CW0 F;  4NQF A;  4JCZ A;  2WL8 A;  3SXY A;  2QNL A;  1OKK D;  3RFY A;  3M1C B;  2AVK A;  2IXP A;  1ZYR F;  3HNK A;  1TQG A;  4IRU A;  4R32 A;  1H6G A;  2OJQ A;  4CJG A;  2L9J A;  4PK4 A;  5DVW A;  1G8X A;  4YL0 A; 
#chains in the Genus database with same CATH homology
 2EIK C;  2VH3 A;  4K0D A;  4ZLC A;  1TWA A;  3DAG A;  2H7B A;  1FFH A;  1ZU4 A;  2YZS A;  1W2W A;  4CSA A;  5T1D B;  2NUP A;  1FMV A;  2W4M A;  4A2N B;  3CSK A;  3LNR A;  3W2V A;  1MMN A;  4I1M A;  3W2W A;  3ZVR A;  4J30 B;  3EGD B;  4O6Y A;  1QZX A;  3KH2 A;  3B0V C;  3ECS A;  5L3V A;  3LLK A;  3DAF A;  2XSE A;  4AK9 A;  3NYL A;  3FAJ A;  2C03 A;  4U5D E;  2O9X A;  4YT4 A;  2IXN A;  1FMW A;  5DLJ A;  3NYM A;  2QY9 A;  3S28 A;  3N24 A;  2G3K A;  1RJ9 B;  1PD0 A;  4YT2 A;  4E7Z A;  5T3T A;  4JVS A;  3RH3 A;  1D0Y A;  2R7W A;  3NDB B;  4PJM A;  2PX3 A;  3B0P A;  3EGD A;  1SZI A;  4DVY P;  3ASO C;  3K33 A;  3ABM C;  4CSA C;  3HJC A;  4LER A;  3E9V A;  3HLZ A;  2CDQ A;  1IW7 F;  2PX0 A;  3POV A;  5KYY B;  1M56 C;  1OKK A;  1M2V B;  4XLN F;  2A1D D;  2J7P D;  2KJG A;  1NZE A;  2XL4 A;  4FES A;  3O39 A;  4DOZ A;  2QTV A;  4OIQ F;  1JPJ A;  1MMD A;  4YJW A;  2G62 A;  4CBE A;  5E2Q A;  4OIN F;  2PFD A;  3RKO F;  3EG9 B;  1M2V A;  1TWC A;  4G7Z F;  3EGX B;  3I4U A;  3S29 A;  4U5F E;  4O6N A;  4N06 A;  2CNW A;  2J0W A;  3NKE A;  3LJB A;  5BUO A;  4G7O F;  2Q9C A;  5E3A A;  3EZI A;  3VYW A;  2Q9B A;  2FFH A;  2KNH A;  2PF4 E;  1MMA A;  2DYS C;  2OCC C;  3Q6N A;  1SF8 A;  2WVN A;  2EIN C;  3AG4 C;  3NG1 A;  4BJ5 A;  1J8M F;  5L3Q A;  4I44 A;  3PMR A;  2KQ9 A;  5IY5 C;  4RD9 A;  2IOQ A;  2W9Y A;  2J7P A;  3EGX A;  2ZXO A;  2IXM A;  1QLE C;  2Q9A A;  3UR3 C;  4BJ6 A;  5KYW A;  4DVZ A;  4O79 A;  2Q3T A;  2R7O A;  4FX5 A;  3ZIB A;  2MWQ A;  4BJ5 C;  1NU9 C;  4U5H A;  3LAY A;  4I1O B;  1D0X A;  4EBB A;  3E70 C;  3I5P A;  4XLP F;  3FDQ A;  3V7O A;  3LEV A;  4QDL A;  3ASN C;  2NUT A;  4GYT A;  3EHN A;  3RIP A;  4G0H A;  3KL4 A;  3KMI A;  2VAS A;  3W8H A;  5F5F A;  3EFO B;  3UMH A;  4I3M A;  2R7U A;  3K6B A;  4OD5 A;  4ULW A;  5EHH A;  4LAC B;  3K1I C;  4KBL A;  3EH1 A;  2V3C C;  3EHM A;  4CIH A;  4PJN A;  3UGO A;  4HFF B;  4M63 A;  2IXO A;  2P7V A;  4W8K A;  4KNV A;  3AQC A;  2X51 A;  2NUT B;  4AX2 A;  3N0T A;  4U5G A;  3AG3 C;  2OG2 A;  4OIR F;  2DGJ A;  1V54 C;  3GOD A;  5KYX A;  2R7X A;  1D1C A;  1D1A A;  3SP1 A;  4OIP F;  3B0U X;  2WB7 A;  1FFT C;  1OCR C;  4JCH A;  2Y3B A;  3UNG C;  3EPV A;  2ZPA A;  1O5H A;  2Z15 A;  4C3B A;  3DMD A;  5B1A C;  4PFO A;  4BJ1 A;  5KYX B;  4PJL A;  1KU2 A;  2L81 A;  2HV7 A;  3FHD A;  2CGE A;  1VYI A;  4PJJ A;  4Q4Z F;  4XTK A;  3DJN B;  3NYJ A;  3Q7L A;  5E3C A;  3ZC4 A;  4KNW A;  4G7H F;  4YN0 B;  5E33 A;  5KYU B;  5DS5 A;  5FCL A;  1V55 C;  2EIJ C;  4CS9 C;  1MMG A;  2M4E A;  1N1C A;  3EH2 A;  3L34 A;  4F4B A;  1ZHT A;  2W4B A;  4YWQ A;  4RBN A;  5F5H A;  2Y3G A;  4XWJ A;  4PFP A;  5EGY A;  3AQB A;  4HE8 D;  4C3D A;  3W8I A;  4H4K C;  1BR4 A;  4BG0 A;  3ZG1 A;  1MNE A;  1Z3I X;  2EIL C;  2JD3 A;  3MLG A;  1RJ9 A;  2H7V C;  3H65 A;  5KYU A;  3QMK A;  2A68 F;  3DM5 A;  2HV6 A;  2ZXW C;  4JUR I;  3SYN A;  3RYL A;  4B6I A;  2Y3H A;  1Z63 A;  4YT8 A;  2KW3 C;  3K7D A;  1SMY F;  1D0Z A;  4BEJ A;  2E87 A;  3AG1 C;  2R7T A;  2A69 F;  3ZSU A;  1VOM A;  1S7Z A;  1BR1 A;  3N2Z B;  2BE5 F;  3UMK A;  2NUP B;  1VYK A;  2J9W A;  2YEV A;  3EJN A;  4RDA A;  2B0J A;  1BR2 A;  2MYS A;  3LLI A;  5DS4 A;  2J45 A;  2VB6 A;  3ITF A;  4X0R A;  3GAN A;  3EZH A;  1PCX A;  5B1B C;  5DS6 A;  5T3W A;  3JCU Q;  4QI0 A;  2GFH A;  4IJJ A;  1VMA A;  4NY3 A;  4BJT A;  4IAO A;  4C3E A;  3EG9 A;  2FGY A;  1MND A;  3O6X A;  4ZLD A;  1Z6A A;  5DQT A;  3DD7 A;  3OA1 A;  4JZA A;  4DBQ A;  2YHS A;  3NKD A;  4E7S A;  1OCC C;  2W45 A;  2Y3D A;  4BJ6 C;  3B9Q A;  3AG2 C;  2ZXP A;  4FWV A;  2I8B A;  5CI9 A;  1ZHX A;  4AE4 A;  1O87 A;  4Q5S F;  3S0X A;  1M2O A;  3DZA A;  3K1H A;  3CQZ A;  2R7R A;  2WZF A;  2A6H F;  4WJ0 A;  4Q7C A;  2KGO A;  1Z5Z A;  1M57 C;  2WVQ A;  3JYH A;  1Z23 A;  2IYL D;  5KYY A;  4ANJ A;  2ZXR A;  3CZ6 A;  2PP4 A;  3MX3 A;  1JPN A;  1ZHY A;  1ST6 A;  2J46 A;  2J9U A;  4MND A;  4O6M A;  3JSZ A;  3OWT A;  3JT1 A;  4AE4 B;  2EIM C;  2Y39 A;  1NU7 D;  3JRT A;  1FTS A;  4J32 B;  3SEO A;  2P6V A;  3X2Q C;  5KYN A;  1D1B A;  4U5E E;  2WZG A;  2XXA A;  4O7G A;  3F47 A;  4KI2 A;  4CS8 A;  1LKX A;  3DJU B;  2D5R B;  4IWB A;  3FVY A;  4KC9 A;  4HFK B;  2CNW D;  3S27 A;  4QI2 A;  1TKN A;  2R7Q A;  3TD7 A;  3DM9 B;  1WGW A;  3T4R A;  3QZC A;  5B3S C;  2DYR C;  5DQZ A;  4JW1 A;  1IZM A;  3KKB A;  1OCO C;  4U5C E;  4LLC A;  3Q6M A;  2XXA B;  3WOD F;  4LLE A;  3DXJ F;  3VAY A;  3L0I A;  5KYW B;  3IEE A;  4C7O A;  3WG7 C;  5D92 A;  3OEO A;  2R7S A;  3UMI A;  3ABK C;  4CS7 A;  4U5B E;  2J0X A;  1OCZ C;  1LVK A;  3EQL F;  2A6E F;  1TR2 A;  3Q7G A;  4OD4 A;  2V26 A;  1J8Y F;  3T6B A;  2H7O A;  1ZU5 A;  3UGP A;  3F46 A;  3LES A;  2WZL A;  4YT5 A;  3LS1 A;  2Y69 C;  4P6I C;  3SNH A;  3X1O A;  3EFO A;  2LSE A;  4C7O B;  4HEA J;  4EWC A;  2XRH A;  1PD1 A;  1TWH A;  1ZHZ A;  4GEH A;  4JJF A;  3LS0 A;  4MQ9 F;  4CS9 A;  2G3V A;  4OIO F;  3T6J A;  1TWG A;  1ZHW A;  2NG1 A;  3K66 A;  2R7V A;  5D91 A;  4DBR A;  3ABL C;  2C04 A;  2WVO A;  3HTK C;  3PHF 2;  3I5Q A;  3NRH A;  1VK5 A;  5HSW A;  5CI8 A;  1NG1 A;  3SZR A;  2J9V A;  1LS1 A;  4K7B A;  4JJG A;  2CW0 F;  2WL8 A;  1OKK D;  3RFY A;  3M1C B;  2IXP A;  1ZYR F;  4IRU A;  2L9J A;  4PK4 A;  5DVW A;  1G8X A;  4CS8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...