3DZAA

Crystal structure of a putative membrane protein of unknown function (yfdx) from klebsiella pneumoniae subsp. at 1.65 a resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
180
structure length
180
Chain Sequence
APAAAATTQVQKEAADVLQVAVQGANAMRDIQFARLALFHGQPDSAKKLTDDAAALLAADDASWAKFVKTDAKAKMIADRYVIINASIALSEDYVATPEKESAIQSANEKLAKGDQKGAIDTLRLAGIGVIENQYLMPLNQTRKAVAQSQELLKAGKYYEANLVLKGAEEGIVVDSEMLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords uncharacterized putative membrane protein
publication title Crystal structure of putative membrane protein of unknown function (YP_001337144.1) from Klebsiella pneumoniae subsp. pneumoniae MGH 78578 at 1.65 A resolution
rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
total genus 66
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10938 YfdX YfdX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1940 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3dzaA01
3DZAA
chains in the Genus database with same CATH superfamily
3GM1A 4O6NA 5DQTA 5A6KA 2DB4A 3GANA 5T3WA 5A6BA 1APCA 3ZQVA 2HMZA 1MMAA 4NTAA 2CNWA 4BG0A 3T9OA 2A1DD 3ZVRA 4IAOA 3U0CA 1Z3IX 2OQMA 2P0NA 2R03A 4YT5A 5AC5A 4MTOA 2G3KA 5JSLA 5DQZA 4LACB 1RKCA 2EIMC 1VTMP 4QDLA 4JKVA 3AQCA 3PDMP 4ZLDA 3QZCA 1M6TA 3AGUA 1KU2A 2Y3GA 1WWPA 1KTMA 1XZPA 2YQYA 1NFOA 2R9RB 3JRTA 4PFPA 3EZHA 1NG1A 3UMIA 4L6RA 3WHNA 3LEOA 3B9QA 4AK9A 4J7YA 4ER9A 3K1HA 2LIGA 4J30B 1D1BA 1U0BB 2HMQA 2R05A 2ZXWC 3R2PA 1FFTC 4MS2A 2KK1A 2I15A 3G4ZA 3NKEA 2HKVA 4CS9A 4K1OA 2ZXOA 2IXNA 4FAPB 5TJ5E 4E17A 2WB7A 3F46A 3ZDLA 1T6IA 2EPLX 1NU9C 3EQLF 3ITFA 2PX3A 1VLTA 3OWTA 4U5BE 3V5ZA 5B3IA 2TMVP 3RQFA 4U5FE 4QI0A 1HMDA 5DS6A 3U2LA 1RJ9B 1YAUO 5CI9A 1MMGA 3X1OA 1ORYA 2IXMA 4U5HA 4DBQA 4Q7CA 3IEEA 1IZMA 2C03A 1CGNA 3TJ6A 5KYXB 1FNTc 1T01A 4I1MA 1LS4A 2J9WA 2KC3A 3A9CA 1Y4CA 1LVKA 2Q7RA 2Y3HA 2YWAA 1GQAA 2X51A 3U3FA 3C18A 4ULWA 3ZG1A 3GEHA 4QI2A 4GEHA 2KW3C 4NC3A 3C63A 1LS1A 3IPMO 2HV6A 3DE9A 3EHNA 2B0HA 3LLKA 5JLIA 3HTKC 4NQFA 1VYIA 2WL8A 4E7SA 1E84A 4W8KA 3MYFA 5E2QA 2XM4A 4CDAA 1LI7A 2C04A 1SYQA 5BQIA 2A68F 3W2VA 4MVSA 4NY3A 3KL4A 1ORSC 2VCCA 3TJ5A 1HW2A 4BEMJ 3T6BA 4IB4A 1A7EA 3IQCA 1U89A 3ZWIA 5JUAA 2XLDA 1MMNA 3TQOA 3W8IA 3B0VC 2PF4E 1LIHA 3DKAA 4YL1A 1D0YA 2MYSA 3LNRA 4CX9A 1M56C 4WJ0A 1R5ID 2Q3TA 5BQGA 1O87A 3T4RA 1C03A 1ZHXA 4H54A 2DYRC 2QNLA 3U2MA 4P9TA 3CQZA 3G4XA 4GQHA 5JVEA 1BR1A 1TR2A 1ZYRF 3B71A 2OCCC 3HKKA 4U5CE 3SNHA 3V5YA 2OJQA 4U5GA 3QTHA 3ZIBA 4A2NB 2R7TA 2R7VA 4XTKA 3KMIA 5D91A 1WOLA 5T3TA 5KYWA 4N06A 2I8BA 2IXPA 2J9BA 3I5QA 3DAGA 2R7WA 2LCHA 3ZTMA 4G7HF 3UNGC 5CIVA 3HLZA 4BJ5A 2EPOA 1FMWA 3GORA 5E3AA 4CDYA 5AC4A 2WZGA 3HNLA 2PBEA 4A4AA 4DJ9A 2YHSA 1TWGA 2Z15A 4DVYP 4XPYA 4Q4ZF 2G3VA 4CDVA 2NPUA 2CDQA 2XLVA 4FX5A 4JTDB 3CSKA 1M2VA 4MVOA 3RVYA 1GM5A 4ULVA 4G78A 3BEHA 1V55C 2ETSA 2CW0F 2ICWG 3UGPA 5L0JA 3ZQYA 1A41A 3SYNA 3UR3C 1I4ZA 2YKZA 3DJNB 1PD0A 1EA8A 2HJ3A 2WZFA 4DXWA 1MQVA 5A6JA 4EHPA 3C8GB 3UGOA 3HJCA 3KYJA 3K1IC 3VF0A 4F4BA 4MNDA 1KNYA 1H9TA 2EIKC 2KJGA 3DI5A 3EPVA 2XRHA 3JYHA 3KPHA 5KYNA 4BJTA 4CJGA 1E85A 1RMVA 2IBFA 3EHMA 3JT1A 2R25A 3AG2C 1FAPB 1TQGA 5HSWA 3AG3C 2J8WA 1BR2A 1K05A 1Q0DA 2YL7A 1GGQA 2JX0A 3DM5A 3NMIA 3IQ6A 3K7DA 3NYMA 1C02A 1J8MF 4MVZA 4HE8D 3AOUA 1EQ1A 3SP1A 3EGXB 2D5RB 3DAFA 1FFHA 3JTLO 4R32A 2J0XA 4BJ6A 1NFNA 5L3QA 4JZAA 4EBBA 3ABKC 3NMJA 4C7OB 2D4UA 4BJ1A 3HNJA 3W4YA 4Z9JA 4P6IC 3NDBB 3JSEO 1D1AA 1RJ9A 3TOMA 3A11A 4RBNA 2J9VA 3TK0A 2R7SA 1YLMA 2XXAB 2AWYA 3OEOA 1OCCC 3QVZA 4G0HA 4IARA 4MQ9F 1Q0GA 4XEKA 2P7VA 4YL0A 3WAQA 4C3BA 1D1CA 1FR0A 2Q00A 1H6GA 1F1MA 2YLDA 2YRFA 3US6A 3U9MA 1SMYF 1SR2A 1SF8A 4PFOA 4YT2A 5BQHA 1CPRA 3EGDB 1LE4A 1ZW3A 2W4MA 3NYJA 2GAQA 3V5XA 1I4YA 3C8ZA 4WABA 3NYLA 3B0UX 3ASNC 1EKYA 1D0XA 4CS9C 1TFKB 3DWWA 1OCOC 3Q6NA 3UMKA 5KYYB 1NZEA 2MHRA 4I44A 2XL6A 2NG1A 3U5SA 1BZ4A 2ZXPA 4JCZA 4AE4B 1NLXA 3QMKA 4D4XA 4JURI 2L6FA 3ZSUA 3MBGA 2EPMX 1MNDA 1N1CA 2HSBA 4Z9IA 1CGOA 3DJUB 4YK5A 5JRAA 1CPQA 2FGYA 1Z63A 1GS9A 2A6HF 3CZ6A 4OIOF 4MW3A 3E70C 2P61A 2XL8A 4OIQF 3O10A 3LJBA 5KYUB 2NUPB 2VASA 2KSFA 3M4BA 3VAYA 1MNEA 4YWQA 2ZXRA 2HV7A 3R7CA 4CIPA 4W8PA 4OINF 4XLNF 1Q0KA 3M4CA 1WTYA 2Q9BA 3TD7A 2YL1A 1A0BA 1WASA 1E83A 2XLHA 1PD1A 2LK4A 2YL3A 2A0UA 4DRHB 1FMVA 4LDQA 4LERA 3T6JA 4BPMA 1Z6AA 4H4KC 3UMHA 4KNWA 5A6BD 3ASOC 4HEAJ 5DS4A 2Q4FA 4D4NA 2CNWD 1OCZC 1J8YF 3K6BA 1JR8A 4EUKB 2HFIA 2J45A 1OKKA 3FHDA 4IWBA 4U9DA 4DOZA 1JPNA 1V4AA 1LKXA 2Y3BA 2F22A 2PX0A 3H2VA 4KC9A 5DS5A 2W9YA 3GM3A 1Y6DA 3U8PA 3FAJA 2L9JA 2CGEA 2FFHA 3QVYA 4P9FA 1Q0MA 2LD6A 4M63A 4XQ1A 3FAPB 2XSEA 2M64A 4LLCA 3MLGA 2LP4A 256BA 4NTFA 3CEXA 5E33A 2KYHA 1ZVZA 5DVWA 2M4EA 2PP4A 2Y69C 3EG9A 5AGFA 3T6GB 1DOWA 3RW0A 4G7OF 3FOPA 5JS5A 2J0WA 3B0PA 4O6MA 3C8GA 4O7GA 2DGJA 2G62A 3JSZA 4C3EA 3AQBA 4IGGA 3NMKA 2HS5A 2E87A 1OR2A 3G50A 4E0IA 2J7PA 5KYYA 2LFDA 3LLIA 3PMRA 4YT8A 1M2OA 4BJ5C 5HV9A 2JD3A 3MFNA 3ABMC 1YDIA 4CSAA 1JOGA 1DOVA 1YARO 2HZ8A 2ZPAA 3EH1A 3L1MA 4LDRA 3EGXA 2CYDA 4O6YA 3VYWA 1HY5A 2V3CC 3RFYA 3W8HA 1R4TA 4X0RA 4C7OA 3AGTA 1T6QA 3WG7C 4MW8A 4PJLA 2EINC 1QZXA 1BBHA 2IM8A 2XLEA 2BL2A 1RXQA 3B29A 3EFOB 4WGZA 4FWVA 2XXAA 3S28A 1RKEB 3JZ0A 1LE2A 4BJ6C 3DZAA 1A7VA 2R7OA 3N24A 1OXBA 1VOMA 2B0JA 3E9VA 5JT4A 3SEOA 2J9UA 4LDKA 3U9JA 2HUJA 4EIYA 4PR9A 1OW8A 3K66A 1YYJA 4U5DE 3Q7GA 3U3BA 4E18A 2WZLA 4YT4A 3EZIA 1LPEA 3EGDA 1L7CA 4DRJB 3PCVA 3RQGA 2W4BA 1O3UA 1XWJA 3AG1C 1WN0A 3IHUA 3SXMA 4E0HA 1V74B 4NCQA 2R7QA 3L8JA 2PNOA 3H2UA 4XEVA 2OU6A 1K40A 2MWQA 3AG4C 5EGYA 1NBBA 3EH2A 2L81A 4CS8A 1QKRA 3O55A 2Q9CA 4AE4A 4XEFA 1S7ZA 1JRAA 2BE5F 2PFDA 1NU7D 1YJGA 1YVIA 2OOCA 3I4UA 3S27A 3M15A 1T6UA 1XZQA 4EBJA 4EBKA 2QTVA 3HNIA 2QLAA 4XPXA 5DLJA 2GA0A 2OEVA 2Q9AA 2Y39A 3L8IA 1T5OA 4YL3A 5B1AC 3RYLA 2NSGA 4CIHA 2GDCA 1TKNA 1ZW2A 1QQ3A 1VLSA 5D92A 1FTSA 2OKUA 2EPKX 4JC7A 3RKOF 3S29A 1L3PA 1UFBA 4ONSA 5KYUA 1H7IA 2AWCA 2NUPA 4JTCB 4HFKB 3FOOA 3OA1A 1ZHZA 3JYYA 4N6HA 5KYXA 3S90A 2J7PD 5A69A 1YA7O 5FZTA 3SXZA 1SZIA 3V7OA 2XL4A 1JMWA 1OR3A 3DXJF 2L7AA 4IRUA 2A69F 2VCBA 3S9OA 1VYKA 1Z5ZA 3SZRA 1S05A 1E2XA 3IQTA 2OEXA 3DE8A 4Q5SF 2KQ9A 1EI7A 1OCRC 3RVZA 1JPJA 4OIRF 5F28E 2H7VC 1G8XA 1HE9A 3FXHA 3GODA 3N0TA 1M2VB 1TFOB 2YL0A 2A0BA 2H7BA 4RD9A 3LUTB 4RDAA 2GWWA 4DVZA 4E7ZA 2KGOA 1O5HA 4JE9A 2BC5A 5B3SC 1YZAA 3K33A 3ZC4A 4OD4A 4MTGA 4JW1A 1QPUA 1ORJA 4J7TA 1E86A 2XM0A 3S84A 1ZHYA 2IXOA 2YEVA 3FVYA 3FDQA 1YYXA 2XLOA 1TWCA 2XLWA 5L3VA 4UDVA 1OW7A 1OXKA 4PJJA 2WVNA 2YLGA 1ZU4A 2CCYA 3TOLA 1WGWA 1Z23A 3BRJA 3KH2A 3LS0A 2VC9A 4JIOA 4K0DA 4JEAA 2EIJC 4DBRA 3X2QC 1QVXA 2NUTB 3GEIA 2YLIA 5COMA 2RD9A 5BUOA 2H7OA 2QUPA 1C17M 2QY9A 3LNMB 3TULA 3DMDA 1AUEA 2ZD9A 1I5NA 4I1OB 4FESA 3M79A 3GWLA 2RSEB 1RCPA 3JRMO 2R02A 4U9EA 4PK4A 1HW1A 2OG2A 3GM2A 4I3MA 2VCAA 2R7XA 3VRCA 4J32B 1AVOB 4G7ZF 5EK0A 2EPNA 1G5ZA 1H9GA 4JEBA 1ZU5A 3NG1A 1TWAA 1UG7A 4CJOA 4C3DA 4AL0A 4AX2A 1V54C 4PJMA 5GPGB 4MVRA 5L0HA 4O79A 2A6EF 3EFOA 3L34A 1YZCA 1BDJB 1HE1A 3LEVA 4AL1A 4WGYA 1RKEA 4B6IA 3ATPA 4JJGA 2IYLD 3RH3A 4KBLA 1PCXA 3KYIA 5L0GA 1MMDA 3J06A 2VB6A 3AJMA 3SXYA 5FCLA 3FMSA 4YJWA 1ZZPA 4XLPF 1AEPA 4LLEA 1K04A 3QW1A 5L0DA 4IAQA 4XPWA 2NSFA 2V26A 3LS1A 4MVUA 1G4US 4OIPF 3M1CB 3DM9B 2UUIA 4JTAB 2LQGA 2WVQA 5JP7A 1PV3A 3POVA 3GWNA 5T1DB 5K0IA 1NSGB 5L0FA 2W45A 3O39A 2H8AA 4HFFB 2AP3A 5E3CA 3Q6MA 5B1BC 1Z7Qc 3U8VA 4KI2A 2AVKA 1IW7F 3Q7LA 3SXKA 2P6VA 3DD7A 2VH3A 1VB5A 5CI8A 4EWCA 4YN0B 3PHF2 1VMAA 4GYTA 2LSEA 3EJNA 1Q0FA 1ST6A 2LFFA 4MVMA 4ZLCA 3S0XA 2UUHA 2YZSA 1WATA 4CSAC 2JPUA 1QSPA 5EHHA 2FAPB 3JCUQ 3QW0A 1BR4A 3ABLC 3KKBA 4U5EE 4ANJA 4N6CA 3RQEA 5F5HA 2QE9A 1B68A 3O6XA 3N2ZB 3RIPA 4EKWA 3GEEA 3H65A 1ZHTA 3ECSA 1HMOA 3C7JA 1A7DA 1TWHA 1LM3B 1YA9A 2R7UA 4MTFA 4OD5A 3WODF 2AU5A 1LI5A 4JJFA 4N4WA 1OKKD 4KNVA 4BEJA 5A6AA 2XS8A 4CS8C 2J46A 4PJNA 1D0ZA 2R7RA 1ZHWA 2YVKA 2HSQA 3LESA 2WVOA 2DYSC 2ASRA 5COGA 2P1AA 3CAXA 4DRIB 2HJMA 5IY5C 2DI3A 5L0CA 3HNKA 3RF3A 5L0IA 1G4WR 3LAYA 3EG9B 1T9KA 3IQ5A 1U6HA 4JCHA 4IJJA 1JAFA 4JVSA 2X0CA 1M57C 3NKDA 4K7BA 4MVQA 5COFA 3MYIA 3NRHA 1CGME 3C8GD 1OQCA 3F47A 3L0IA 3C62A 2Y3DA 3MX3A 4JRZA 1VK5A 2KNHA 2XLMA 1OW6A 1QLEC 4XWJA 4CS7A 2EILC 4PACA 3ZTZA 3K1IA 3VM6A 2O9XA 2XS1A 3I5PA 3W2WA 2NUTA 2GFHA 2L6GA 2OJED 4CBEA 5F5FA 5KYWB 2IOQA 1W2WA 4NTBA 2L6HA 4Z9HA
chains in the Genus database with same CATH topology
4O6NA 5DQTA 3GANA 5T3WA 1MMAA 2CNWA 4BG0A 2A1DD 3ZVRA 4IAOA 1Z3IX 4YT5A 2G3KA 5DQZA 4LACB 2EIMC 4QDLA 4ZLDA 3AQCA 3QZCA 1KU2A 2Y3GA 3JRTA 4PFPA 3EZHA 1NG1A 3UMIA 3B9QA 4AK9A 3K1HA 4J30B 1D1BA 2ZXWC 1FFTC 3NKEA 4CS9A 2ZXOA 2IXNA 2WB7A 3F46A 1NU9C 3EQLF 3ITFA 2PX3A 3OWTA 4U5BE 4U5FE 4QI0A 5DS6A 1RJ9B 5CI9A 1MMGA 3X1OA 2IXMA 4DBQA 4U5HA 4Q7CA 3IEEA 1IZMA 2C03A 5KYXB 4I1MA 2J9WA 1LVKA 2Y3HA 2X51A 4ULWA 3ZG1A 4QI2A 4GEHA 2KW3C 1LS1A 2HV6A 3EHNA 3LLKA 3HTKC 1VYIA 2WL8A 4E7SA 4W8KA 5E2QA 2C04A 2A68F 3W2VA 4NY3A 3KL4A 3T6BA 1MMNA 3W8IA 3B0VC 2PF4E 3LNRA 1D0YA 2MYSA 1M56C 4WJ0A 2Q3TA 1O87A 3T4RA 1ZHXA 2DYRC 3CQZA 1BR1A 1TR2A 1ZYRF 4U5CE 2OCCC 3SNHA 4A2NB 4U5GA 2R7TA 3ZIBA 2R7VA 4XTKA 3KMIA 5D91A 5T3TA 5KYWA 4N06A 2I8BA 2IXPA 2R7WA 3I5QA 3DAGA 4G7HF 3UNGC 3HLZA 4BJ5A 1FMWA 5E3AA 2WZGA 2YHSA 1TWGA 2Z15A 4DVYP 4Q4ZF 2G3VA 2CDQA 4FX5A 3CSKA 1M2VA 1V55C 2CW0F 3UGPA 3SYNA 3UR3C 3DJNB 1PD0A 2WZFA 3UGOA 3HJCA 3K1IC 4F4BA 4MNDA 2EIKC 2KJGA 3EPVA 2XRHA 3JYHA 5KYNA 4BJTA 3JT1A 3EHMA 3AG2C 5HSWA 3AG3C 1BR2A 3DM5A 3K7DA 3NYMA 1J8MF 4HE8D 3SP1A 3EGXB 2D5RB 3DAFA 1FFHA 2J0XA 4BJ6A 5L3QA 4JZAA 4EBBA 3ABKC 4C7OB 4BJ1A 3NDBB 4P6IC 1D1AA 1RJ9A 4RBNA 2J9VA 2R7SA 2XXAB 3OEOA 1OCCC 4G0HA 4MQ9F 2P7VA 4C3BA 1D1CA 1SMYF 4PFOA 1SF8A 4YT2A 3EGDB 3NYJA 2W4MA 3NYLA 3ASNC 1D0XA 4CS9C 1OCOC 3Q6NA 3UMKA 5KYYB 1NZEA 4I44A 2NG1A 2ZXPA 4AE4B 3QMKA 4JURI 3ZSUA 1MNDA 1N1CA 3DJUB 2FGYA 1Z63A 2A6HF 3CZ6A 4OIOF 3E70C 4OIQF 3LJBA 5KYUB 2NUPB 2VASA 4YWQA 3VAYA 1MNEA 2ZXRA 2HV7A 4OINF 4XLNF 3TD7A 2Q9BA 1PD1A 1FMVA 4LERA 3T6JA 1Z6AA 4H4KC 3UMHA 4KNWA 3ASOC 4HEAJ 5DS4A 2CNWD 1OCZC 1J8YF 3K6BA 2J45A 1OKKA 3FHDA 4IWBA 4DOZA 1JPNA 2Y3BA 1LKXA 5DS5A 2PX0A 4KC9A 2W9YA 3FAJA 2L9JA 2CGEA 2FFHA 4M63A 2XSEA 4LLCA 3MLGA 5E33A 5DVWA 4G7OF 2M4EA 2PP4A 2Y69C 3EG9A 2J0WA 3B0PA 4O6MA 4O7GA 2DGJA 2G62A 3JSZA 4C3EA 3AQBA 2E87A 2J7PA 3LLIA 3PMRA 4YT8A 1M2OA 4BJ5C 2JD3A 3ABMC 4CSAA 2ZPAA 3EH1A 4O6YA 3EGXA 3VYWA 2V3CC 3RFYA 3W8HA 4X0RA 4C7OA 3WG7C 4PJLA 2EINC 1QZXA 3EFOB 4FWVA 2XXAA 3S28A 3DZAA 2R7OA 3N24A 1VOMA 2B0JA 3E9VA 3SEOA 2J9UA 3K66A 4YT4A 4U5DE 3Q7GA 2WZLA 3EZIA 3EGDA 2W4BA 3AG1C 2R7QA 5KYYA 3B0UX 2MWQA 3AG4C 5EGYA 3EH2A 2L81A 4CS8A 2Q9CA 4AE4A 1S7ZA 4BJ6C 2BE5F 2PFDA 1NU7D 3I4UA 3S27A 2QTVA 5DLJA 3RYLA 2Q9AA 2Y39A 5B1AC 4CIHA 1TKNA 5D92A 3RKOF 1FTSA 3S29A 5KYUA 2NUPA 5KYXA 4HFKB 3OA1A 1ZHZA 2J7PD 1SZIA 3V7OA 2XL4A 3DXJF 4IRUA 2A69F 3SZRA 1VYKA 1Z5ZA 4Q5SF 2KQ9A 1OCRC 1JPJA 4OIRF 2H7VC 1G8XA 3GODA 3N0TA 1M2VB 4RD9A 2H7BA 4E7ZA 4RDAA 4DVZA 2KGOA 1O5HA 5B3SC 3K33A 3ZC4A 4OD4A 4JW1A 1ZHYA 2IXOA 2YEVA 3FVYA 3FDQA 1TWCA 5L3VA 4PJJA 2WVNA 1ZU4A 5F5HA 1WGWA 1Z23A 3KH2A 4K0DA 3LS0A 4DBRA 2EIJC 3X2QC 2NUTB 5BUOA 2H7OA 2QY9A 3DMDA 4I1OB 4FESA 2R7XA 4PK4A 2OG2A 4I3MA 4J32B 4G7ZF 1ZU5A 3NG1A 1TWAA 4C3DA 4AX2A 1V54C 4PJMA 4O79A 2A6EF 3EFOA 3L34A 4B6IA 3LEVA 4JJGA 3RH3A 2IYLD 4KBLA 1PCXA 1MMDA 2VB6A 5FCLA 4YJWA 4XLPF 4LLEA 2V26A 3LS1A 4OIPF 3M1CB 3DM9B 4CSAC 2WVQA 3POVA 5T1DB 2W45A 3O39A 4HFFB 5E3CA 5B1BC 4KI2A 3Q6MA 1IW7F 3Q7LA 4EWCA 2P6VA 3DD7A 2VH3A 5CI8A 4YN0B 3PHF2 1VMAA 4GYTA 2LSEA 3EJNA 1ST6A 4ZLCA 3S0XA 2YZSA 5EHHA 3JCUQ 1BR4A 3ABLC 3KKBA 4U5EE 4ANJA 3O6XA 3N2ZB 3RIPA 3H65A 1ZHTA 3ECSA 1TWHA 2R7UA 4OD5A 3WODF 4JJFA 4BEJA 1OKKD 4KNVA 4CS8C 2J46A 4PJNA 1D0ZA 2R7RA 1ZHWA 3LESA 2WVOA 2DYSC 5IY5C 3LAYA 3EG9B 4JCHA 4IJJA 4JVSA 1M57C 3NKDA 4K7BA 3NRHA 3F47A 3L0IA 2Y3DA 3MX3A 1VK5A 2KNHA 4CS7A 1QLEC 4XWJA 2EILC 2O9XA 3I5PA 3W2WA 2NUTA 2GFHA 5F5FA 4CBEA 5KYWB 2IOQA 1W2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DZA A; 
#chains in the Genus database with same CATH topology
 3GM1 A;  4O6N A;  5DQT A;  5A6K A;  2DB4 A;  3GAN A;  5T3W A;  5A6B A;  1APC A;  3ZQV A;  2HMZ A;  1MMA A;  4NTA A;  2CNW A;  4BG0 A;  3T9O A;  2A1D D;  3ZVR A;  4IAO A;  3U0C A;  1Z3I X;  2OQM A;  2P0N A;  2R03 A;  4YT5 A;  5AC5 A;  4MTO A;  2G3K A;  5JSL A;  5DQZ A;  4LAC B;  1RKC A;  2EIM C;  1VTM P;  4QDL A;  4JKV A;  3AQC A;  3PDM P;  4ZLD A;  3QZC A;  1M6T A;  3AGU A;  1KU2 A;  2Y3G A;  1WWP A;  1KTM A;  1XZP A;  2YQY A;  1NFO A;  2R9R B;  3JRT A;  4PFP A;  3EZH A;  1NG1 A;  3UMI A;  4L6R A;  3WHN A;  3LEO A;  3B9Q A;  4AK9 A;  4J7Y A;  4ER9 A;  3K1H A;  2LIG A;  4J30 B;  1D1B A;  1U0B B;  2HMQ A;  2R05 A;  2ZXW C;  3R2P A;  1FFT C;  4MS2 A;  2KK1 A;  2I15 A;  3G4Z A;  3NKE A;  2HKV A;  4CS9 A;  4K1O A;  2ZXO A;  2IXN A;  4FAP B;  5TJ5 E;  4E17 A;  2WB7 A;  3F46 A;  3ZDL A;  1T6I A;  2EPL X;  1NU9 C;  3EQL F;  3ITF A;  2PX3 A;  1VLT A;  3OWT A;  4U5B E;  3V5Z A;  5B3I A;  2TMV P;  3RQF A;  4U5F E;  4QI0 A;  1HMD A;  5DS6 A;  3U2L A;  1RJ9 B;  1YAU O;  5CI9 A;  1MMG A;  3X1O A;  1ORY A;  2IXM A;  4U5H A;  4DBQ A;  4Q7C A;  3IEE A;  1IZM A;  2C03 A;  1CGN A;  3TJ6 A;  5KYX B;  1FNT c;  1T01 A;  4I1M A;  1LS4 A;  2J9W A;  2KC3 A;  3A9C A;  1Y4C A;  1LVK A;  2Q7R A;  2Y3H A;  2YWA A;  1GQA A;  2X51 A;  3U3F A;  3C18 A;  4ULW A;  3ZG1 A;  3GEH A;  4QI2 A;  4GEH A;  2KW3 C;  4NC3 A;  3C63 A;  1LS1 A;  3IPM O;  2HV6 A;  3DE9 A;  3EHN A;  2B0H A;  3LLK A;  5JLI A;  3HTK C;  4NQF A;  1VYI A;  2WL8 A;  4E7S A;  1E84 A;  4W8K A;  3MYF A;  5E2Q A;  2XM4 A;  4CDA A;  1LI7 A;  2C04 A;  1SYQ A;  5BQI A;  2A68 F;  3W2V A;  4MVS A;  4NY3 A;  3KL4 A;  1ORS C;  2VCC A;  3TJ5 A;  1HW2 A;  4BEM J;  3T6B A;  4IB4 A;  1A7E A;  3IQC A;  1U89 A;  3ZWI A;  5JUA A;  2XLD A;  1MMN A;  3TQO A;  3W8I A;  3B0V C;  2PF4 E;  1LIH A;  3DKA A;  4YL1 A;  1D0Y A;  2MYS A;  3LNR A;  4CX9 A;  1M56 C;  4WJ0 A;  1R5I D;  2Q3T A;  5BQG A;  1O87 A;  3T4R A;  1C03 A;  1ZHX A;  4H54 A;  2DYR C;  2QNL A;  3U2M A;  4P9T A;  3CQZ A;  3G4X A;  4GQH A;  5JVE A;  1BR1 A;  1TR2 A;  1ZYR F;  3B71 A;  2OCC C;  3HKK A;  4U5C E;  3SNH A;  3V5Y A;  2OJQ A;  4U5G A;  3QTH A;  3ZIB A;  4A2N B;  2R7T A;  2R7V A;  4XTK A;  3KMI A;  5D91 A;  1WOL A;  5T3T A;  5KYW A;  4N06 A;  2I8B A;  2IXP A;  2J9B A;  3I5Q A;  3DAG A;  2R7W A;  2LCH A;  3ZTM A;  4G7H F;  3UNG C;  5CIV A;  3HLZ A;  4BJ5 A;  2EPO A;  1FMW A;  3GOR A;  5E3A A;  4CDY A;  5AC4 A;  2WZG A;  3HNL A;  2PBE A;  4A4A A;  4DJ9 A;  2YHS A;  1TWG A;  2Z15 A;  4DVY P;  4XPY A;  4Q4Z F;  2G3V A;  4CDV A;  2NPU A;  2CDQ A;  2XLV A;  4FX5 A;  4JTD B;  3CSK A;  1M2V A;  4MVO A;  3RVY A;  1GM5 A;  4ULV A;  4G78 A;  3BEH A;  1V55 C;  2ETS A;  2CW0 F;  2ICW G;  3UGP A;  5L0J A;  3ZQY A;  1A41 A;  3SYN A;  3UR3 C;  1I4Z A;  2YKZ A;  3DJN B;  1PD0 A;  1EA8 A;  2HJ3 A;  2WZF A;  4DXW A;  1MQV A;  5A6J A;  4EHP A;  3C8G B;  3UGO A;  3HJC A;  3KYJ A;  3K1I C;  3VF0 A;  4F4B A;  4MND A;  1KNY A;  1H9T A;  2EIK C;  2KJG A;  3DI5 A;  3EPV A;  2XRH A;  3JYH A;  3KPH A;  5KYN A;  4BJT A;  4CJG A;  1E85 A;  1RMV A;  2IBF A;  3EHM A;  3JT1 A;  2R25 A;  3AG2 C;  1FAP B;  1TQG A;  5HSW A;  3AG3 C;  2J8W A;  1BR2 A;  1K05 A;  1Q0D A;  2YL7 A;  1GGQ A;  2JX0 A;  3DM5 A;  3NMI A;  3IQ6 A;  3K7D A;  3NYM A;  1C02 A;  1J8M F;  4MVZ A;  4HE8 D;  3AOU A;  1EQ1 A;  3SP1 A;  3EGX B;  2D5R B;  3DAF A;  1FFH A;  3JTL O;  4R32 A;  2J0X A;  4BJ6 A;  1NFN A;  5L3Q A;  4JZA A;  4EBB A;  3ABK C;  3NMJ A;  4C7O B;  2D4U A;  4BJ1 A;  3HNJ A;  3W4Y A;  4Z9J A;  4P6I C;  3NDB B;  3JSE O;  1D1A A;  1RJ9 A;  3TOM A;  3A11 A;  4RBN A;  2J9V A;  3TK0 A;  2R7S A;  1YLM A;  2XXA B;  2AWY A;  3OEO A;  1OCC C;  3QVZ A;  4G0H A;  4IAR A;  4MQ9 F;  1Q0G A;  4XEK A;  2P7V A;  4YL0 A;  3WAQ A;  4C3B A;  1D1C A;  1FR0 A;  2Q00 A;  1H6G A;  1F1M A;  2YLD A;  2YRF A;  3US6 A;  3U9M A;  1SMY F;  1SR2 A;  1SF8 A;  4PFO A;  4YT2 A;  5BQH A;  1CPR A;  3EGD B;  1LE4 A;  1ZW3 A;  2W4M A;  3NYJ A;  2GAQ A;  3V5X A;  1I4Y A;  3C8Z A;  4WAB A;  3NYL A;  3B0U X;  3ASN C;  1EKY A;  1D0X A;  4CS9 C;  1TFK B;  3DWW A;  1OCO C;  3Q6N A;  3UMK A;  5KYY B;  1NZE A;  2MHR A;  4I44 A;  2XL6 A;  2NG1 A;  3U5S A;  1BZ4 A;  2ZXP A;  4JCZ A;  4AE4 B;  1NLX A;  3QMK A;  4D4X A;  4JUR I;  2L6F A;  3ZSU A;  3MBG A;  2EPM X;  1MND A;  1N1C A;  2HSB A;  4Z9I A;  1CGO A;  3DJU B;  4YK5 A;  5JRA A;  1CPQ A;  2FGY A;  1Z63 A;  1GS9 A;  2A6H F;  3CZ6 A;  4OIO F;  4MW3 A;  3E70 C;  2P61 A;  2XL8 A;  4OIQ F;  3O10 A;  3LJB A;  5KYU B;  2NUP B;  2VAS A;  2KSF A;  3M4B A;  3VAY A;  1MNE A;  4YWQ A;  2ZXR A;  2HV7 A;  3R7C A;  4CIP A;  4W8P A;  4OIN F;  4XLN F;  1Q0K A;  3M4C A;  1WTY A;  2Q9B A;  3TD7 A;  2YL1 A;  1A0B A;  1WAS A;  1E83 A;  2XLH A;  1PD1 A;  2LK4 A;  2YL3 A;  2A0U A;  4DRH B;  1FMV A;  4LDQ A;  4LER A;  3T6J A;  4BPM A;  1Z6A A;  4H4K C;  3UMH A;  4KNW A;  5A6B D;  3ASO C;  4HEA J;  5DS4 A;  2Q4F A;  4D4N A;  2CNW D;  1OCZ C;  1J8Y F;  3K6B A;  1JR8 A;  4EUK B;  2HFI A;  2J45 A;  1OKK A;  3FHD A;  4IWB A;  4U9D A;  4DOZ A;  1JPN A;  1V4A A;  1LKX A;  2Y3B A;  2F22 A;  2PX0 A;  3H2V A;  4KC9 A;  5DS5 A;  2W9Y A;  3GM3 A;  1Y6D A;  3U8P A;  3FAJ A;  2L9J A;  2CGE A;  2FFH A;  3QVY A;  4P9F A;  1Q0M A;  2LD6 A;  4M63 A;  4XQ1 A;  3FAP B;  2XSE A;  2M64 A;  4LLC A;  3MLG A;  2LP4 A;  256B A;  4NTF A;  3CEX A;  5E33 A;  2KYH A;  1ZVZ A;  5DVW A;  2M4E A;  2PP4 A;  2Y69 C;  3EG9 A;  5AGF A;  3T6G B;  1DOW A;  3RW0 A;  4G7O F;  3FOP A;  5JS5 A;  2J0W A;  3B0P A;  4O6M A;  3C8G A;  4O7G A;  2DGJ A;  2G62 A;  3JSZ A;  4C3E A;  3AQB A;  4IGG A;  3NMK A;  2HS5 A;  2E87 A;  1OR2 A;  3G50 A;  4E0I A;  2J7P A;  5KYY A;  2LFD A;  3LLI A;  3PMR A;  4YT8 A;  1M2O A;  4BJ5 C;  5HV9 A;  2JD3 A;  3MFN A;  3ABM C;  1YDI A;  4CSA A;  1JOG A;  1DOV A;  1YAR O;  2HZ8 A;  2ZPA A;  3EH1 A;  3L1M A;  4LDR A;  3EGX A;  2CYD A;  4O6Y A;  3VYW A;  1HY5 A;  2V3C C;  3RFY A;  3W8H A;  1R4T A;  4X0R A;  4C7O A;  3AGT A;  1T6Q A;  3WG7 C;  4MW8 A;  4PJL A;  2EIN C;  1QZX A;  1BBH A;  2IM8 A;  2XLE A;  2BL2 A;  1RXQ A;  3B29 A;  3EFO B;  4WGZ A;  4FWV A;  2XXA A;  3S28 A;  1RKE B;  3JZ0 A;  1LE2 A;  4BJ6 C;  3DZA A;  1A7V A;  2R7O A;  3N24 A;  1OXB A;  1VOM A;  2B0J A;  3E9V A;  5JT4 A;  3SEO A;  2J9U A;  4LDK A;  3U9J A;  2HUJ A;  4EIY A;  4PR9 A;  1OW8 A;  3K66 A;  1YYJ A;  4U5D E;  3Q7G A;  3U3B A;  4E18 A;  2WZL A;  4YT4 A;  3EZI A;  1LPE A;  3EGD A;  1L7C A;  4DRJ B;  3PCV A;  3RQG A;  2W4B A;  1O3U A;  1XWJ A;  3AG1 C;  1WN0 A;  3IHU A;  3SXM A;  4E0H A;  1V74 B;  4NCQ A;  2R7Q A;  3L8J A;  2PNO A;  3H2U A;  4XEV A;  2OU6 A;  1K40 A;  2MWQ A;  3AG4 C;  5EGY A;  1NBB A;  3EH2 A;  2L81 A;  4CS8 A;  1QKR A;  3O55 A;  2Q9C A;  4AE4 A;  4XEF A;  1S7Z A;  1JRA A;  2BE5 F;  2PFD A;  1NU7 D;  1YJG A;  1YVI A;  2OOC A;  3I4U A;  3S27 A;  3M15 A;  1T6U A;  1XZQ A;  4EBJ A;  4EBK A;  2QTV A;  3HNI A;  2QLA A;  4XPX A;  5DLJ A;  2GA0 A;  2OEV A;  2Q9A A;  2Y39 A;  3L8I A;  1T5O A;  4YL3 A;  5B1A C;  3RYL A;  2NSG A;  4CIH A;  2GDC A;  1TKN A;  1ZW2 A;  1QQ3 A;  1VLS A;  5D92 A;  1FTS A;  2OKU A;  2EPK X;  4JC7 A;  3RKO F;  3S29 A;  1L3P A;  1UFB A;  4ONS A;  5KYU A;  1H7I A;  2AWC A;  2NUP A;  4JTC B;  4HFK B;  3FOO A;  3OA1 A;  1ZHZ A;  3JYY A;  4N6H A;  5KYX A;  3S90 A;  2J7P D;  5A69 A;  1YA7 O;  5FZT A;  3SXZ A;  1SZI A;  3V7O A;  2XL4 A;  1JMW A;  1OR3 A;  3DXJ F;  2L7A A;  4IRU A;  2A69 F;  2VCB A;  3S9O A;  1VYK A;  1Z5Z A;  3SZR A;  1S05 A;  1E2X A;  3IQT A;  2OEX A;  3DE8 A;  4Q5S F;  2KQ9 A;  1EI7 A;  1OCR C;  3RVZ A;  1JPJ A;  4OIR F;  5F28 E;  2H7V C;  1G8X A;  1HE9 A;  3FXH A;  3GOD A;  3N0T A;  1M2V B;  1TFO B;  2YL0 A;  2A0B A;  2H7B A;  4RD9 A;  3LUT B;  4RDA A;  2GWW A;  4DVZ A;  4E7Z A;  2KGO A;  1O5H A;  4JE9 A;  2BC5 A;  5B3S C;  1YZA A;  3K33 A;  3ZC4 A;  4OD4 A;  4MTG A;  4JW1 A;  1QPU A;  1ORJ A;  4J7T A;  1E86 A;  2XM0 A;  3S84 A;  1ZHY A;  2IXO A;  2YEV A;  3FVY A;  3FDQ A;  1YYX A;  2XLO A;  1TWC A;  2XLW A;  5L3V A;  4UDV A;  1OW7 A;  1OXK A;  4PJJ A;  2WVN A;  2YLG A;  1ZU4 A;  2CCY A;  3TOL A;  1WGW A;  1Z23 A;  3BRJ A;  3KH2 A;  3LS0 A;  2VC9 A;  4JIO A;  4K0D A;  4JEA A;  2EIJ C;  4DBR A;  3X2Q C;  1QVX A;  2NUT B;  3GEI A;  2YLI A;  5COM A;  2RD9 A;  5BUO A;  2H7O A;  2QUP A;  1C17 M;  2QY9 A;  3LNM B;  3TUL A;  3DMD A;  1AUE A;  2ZD9 A;  1I5N A;  4I1O B;  4FES A;  3M79 A;  3GWL A;  2RSE B;  1RCP A;  3JRM O;  2R02 A;  4U9E A;  4PK4 A;  1HW1 A;  2OG2 A;  3GM2 A;  4I3M A;  2VCA A;  2R7X A;  3VRC A;  4J32 B;  1AVO B;  4G7Z F;  5EK0 A;  2EPN A;  1G5Z A;  1H9G A;  4JEB A;  1ZU5 A;  3NG1 A;  1TWA A;  1UG7 A;  4CJO A;  4C3D A;  4AL0 A;  4AX2 A;  1V54 C;  4PJM A;  5GPG B;  4MVR A;  5L0H A;  4O79 A;  2A6E F;  3EFO A;  3L34 A;  1YZC A;  1BDJ B;  1HE1 A;  3LEV A;  4AL1 A;  4WGY A;  1RKE A;  4B6I A;  3ATP A;  4JJG A;  2IYL D;  3RH3 A;  4KBL A;  1PCX A;  3KYI A;  5L0G A;  1MMD A;  3J06 A;  2VB6 A;  3AJM A;  3SXY A;  5FCL A;  3FMS A;  4YJW A;  1ZZP A;  4XLP F;  1AEP A;  4LLE A;  1K04 A;  3QW1 A;  5L0D A;  4IAQ A;  4XPW A;  2NSF A;  2V26 A;  3LS1 A;  4MVU A;  1G4U S;  4OIP F;  3M1C B;  3DM9 B;  2UUI A;  4JTA B;  2LQG A;  2WVQ A;  5JP7 A;  1PV3 A;  3POV A;  3GWN A;  5T1D B;  5K0I A;  1NSG B;  5L0F A;  2W45 A;  3O39 A;  2H8A A;  4HFF B;  2AP3 A;  5E3C A;  3Q6M A;  5B1B C;  1Z7Q c;  3U8V A;  4KI2 A;  2AVK A;  1IW7 F;  3Q7L A;  3SXK A;  2P6V A;  3DD7 A;  2VH3 A;  1VB5 A;  5CI8 A;  4EWC A;  4YN0 B;  3PHF 2;  1VMA A;  4GYT A;  2LSE A;  3EJN A;  1Q0F A;  1ST6 A;  2LFF A;  4MVM A;  4ZLC A;  3S0X A;  2UUH A;  2YZS A;  1WAT A;  4CSA C;  2JPU A;  1QSP A;  5EHH A;  2FAP B;  3JCU Q;  3QW0 A;  1BR4 A;  3ABL C;  3KKB A;  4U5E E;  4ANJ A;  4N6C A;  3RQE A;  5F5H A;  2QE9 A;  1B68 A;  3O6X A;  3N2Z B;  3RIP A;  4EKW A;  3GEE A;  3H65 A;  1ZHT A;  3ECS A;  1HMO A;  3C7J A;  1A7D A;  1TWH A;  1LM3 B;  1YA9 A;  2R7U A;  4MTF A;  4OD5 A;  3WOD F;  2AU5 A;  1LI5 A;  4JJF A;  4N4W A;  1OKK D;  4KNV A;  4BEJ A;  5A6A A;  2XS8 A;  4CS8 C;  2J46 A;  4PJN A;  1D0Z A;  2R7R A;  1ZHW A;  2YVK A;  2HSQ A;  3LES A;  2WVO A;  2DYS C;  2ASR A;  5COG A;  2P1A A;  3CAX A;  4DRI B;  2HJM A;  5IY5 C;  2DI3 A;  5L0C A;  3HNK A;  3RF3 A;  5L0I A;  1G4W R;  3LAY A;  3EG9 B;  1T9K A;  3IQ5 A;  1U6H A;  4JCH A;  4IJJ A;  1JAF A;  4JVS A;  2X0C A;  1M57 C;  3NKD A;  4K7B A;  4MVQ A;  5COF A;  3MYI A;  3NRH A;  1CGM E;  3C8G D;  1OQC A;  3F47 A;  3L0I A;  3C62 A;  2Y3D A;  3MX3 A;  4JRZ A;  1VK5 A;  2KNH A;  2XLM A;  1OW6 A;  1QLE C;  4XWJ A;  4CS7 A;  2EIL C;  4PAC A;  3ZTZ A;  3K1I A;  3VM6 A;  2O9X A;  2XS1 A;  3I5P A;  3W2W A;  2NUT A;  2GFH A;  2L6G A;  2OJE D;  4CBE A;  5F5F A;  5KYW B;  2IOQ A;  1W2W A;  4NTB A;  2L6H A;  4Z9H A; 
#chains in the Genus database with same CATH homology
 4O6N A;  5DQT A;  3GAN A;  5T3W A;  1MMA A;  2CNW A;  4BG0 A;  2A1D D;  3ZVR A;  4IAO A;  1Z3I X;  4YT5 A;  2G3K A;  5DQZ A;  4LAC B;  2EIM C;  4QDL A;  4ZLD A;  3AQC A;  3QZC A;  1KU2 A;  2Y3G A;  3JRT A;  4PFP A;  3EZH A;  1NG1 A;  3UMI A;  3B9Q A;  4AK9 A;  3K1H A;  4J30 B;  1D1B A;  2ZXW C;  1FFT C;  3NKE A;  4CS9 A;  2ZXO A;  2IXN A;  2WB7 A;  3F46 A;  1NU9 C;  3EQL F;  3ITF A;  2PX3 A;  3OWT A;  4U5B E;  4U5F E;  4QI0 A;  5DS6 A;  1RJ9 B;  5CI9 A;  1MMG A;  3X1O A;  2IXM A;  4DBQ A;  4U5H A;  4Q7C A;  3IEE A;  1IZM A;  2C03 A;  5KYX B;  4I1M A;  2J9W A;  1LVK A;  2Y3H A;  2X51 A;  4ULW A;  3ZG1 A;  4QI2 A;  4GEH A;  2KW3 C;  1LS1 A;  2HV6 A;  3EHN A;  3LLK A;  3HTK C;  1VYI A;  2WL8 A;  4E7S A;  4W8K A;  5E2Q A;  2C04 A;  2A68 F;  3W2V A;  4NY3 A;  3KL4 A;  3T6B A;  1MMN A;  3W8I A;  3B0V C;  2PF4 E;  3LNR A;  1D0Y A;  2MYS A;  1M56 C;  4WJ0 A;  2Q3T A;  1O87 A;  3T4R A;  1ZHX A;  2DYR C;  3CQZ A;  1BR1 A;  1TR2 A;  1ZYR F;  4U5C E;  2OCC C;  3SNH A;  4A2N B;  4U5G A;  2R7T A;  3ZIB A;  2R7V A;  4XTK A;  3KMI A;  5D91 A;  5T3T A;  5KYW A;  4N06 A;  2I8B A;  2IXP A;  2R7W A;  3I5Q A;  3DAG A;  4G7H F;  3UNG C;  3HLZ A;  4BJ5 A;  1FMW A;  5E3A A;  2WZG A;  2YHS A;  1TWG A;  2Z15 A;  4DVY P;  4Q4Z F;  2G3V A;  2CDQ A;  4FX5 A;  3CSK A;  1M2V A;  1V55 C;  2CW0 F;  3UGP A;  3SYN A;  3UR3 C;  3DJN B;  1PD0 A;  2WZF A;  3UGO A;  3HJC A;  3K1I C;  4F4B A;  4MND A;  2EIK C;  2KJG A;  3EPV A;  2XRH A;  3JYH A;  5KYN A;  4BJT A;  3JT1 A;  3EHM A;  3AG2 C;  5HSW A;  3AG3 C;  1BR2 A;  3DM5 A;  3K7D A;  3NYM A;  1J8M F;  4HE8 D;  3SP1 A;  3EGX B;  2D5R B;  3DAF A;  1FFH A;  2J0X A;  4BJ6 A;  5L3Q A;  4JZA A;  4EBB A;  3ABK C;  4C7O B;  4BJ1 A;  3NDB B;  4P6I C;  1D1A A;  1RJ9 A;  4RBN A;  2J9V A;  2R7S A;  2XXA B;  3OEO A;  1OCC C;  4G0H A;  4MQ9 F;  2P7V A;  4C3B A;  1D1C A;  1SMY F;  4PFO A;  1SF8 A;  4YT2 A;  3EGD B;  3NYJ A;  2W4M A;  3NYL A;  3ASN C;  1D0X A;  4CS9 C;  1OCO C;  3Q6N A;  3UMK A;  5KYY B;  1NZE A;  4I44 A;  2NG1 A;  2ZXP A;  4AE4 B;  3QMK A;  4JUR I;  3ZSU A;  1MND A;  1N1C A;  3DJU B;  2FGY A;  1Z63 A;  2A6H F;  3CZ6 A;  4OIO F;  3E70 C;  4OIQ F;  3LJB A;  5KYU B;  2NUP B;  2VAS A;  4YWQ A;  3VAY A;  1MNE A;  2ZXR A;  2HV7 A;  4OIN F;  4XLN F;  3TD7 A;  2Q9B A;  1PD1 A;  1FMV A;  4LER A;  3T6J A;  1Z6A A;  4H4K C;  3UMH A;  4KNW A;  3ASO C;  4HEA J;  5DS4 A;  2CNW D;  1OCZ C;  1J8Y F;  3K6B A;  2J45 A;  1OKK A;  3FHD A;  4IWB A;  4DOZ A;  1JPN A;  2Y3B A;  1LKX A;  5DS5 A;  2PX0 A;  4KC9 A;  2W9Y A;  3FAJ A;  2L9J A;  2CGE A;  2FFH A;  4M63 A;  2XSE A;  4LLC A;  3MLG A;  5E33 A;  5DVW A;  4G7O F;  2M4E A;  2PP4 A;  2Y69 C;  3EG9 A;  2J0W A;  3B0P A;  4O6M A;  4O7G A;  2DGJ A;  2G62 A;  3JSZ A;  4C3E A;  3AQB A;  2E87 A;  2J7P A;  3LLI A;  3PMR A;  4YT8 A;  1M2O A;  4BJ5 C;  2JD3 A;  3ABM C;  4CSA A;  2ZPA A;  3EH1 A;  4O6Y A;  3EGX A;  3VYW A;  2V3C C;  3RFY A;  3W8H A;  4X0R A;  4C7O A;  3WG7 C;  4PJL A;  2EIN C;  1QZX A;  3EFO B;  4FWV A;  2XXA A;  3S28 A;  3DZA A;  2R7O A;  3N24 A;  1VOM A;  2B0J A;  3E9V A;  3SEO A;  2J9U A;  3K66 A;  4YT4 A;  4U5D E;  3Q7G A;  2WZL A;  3EZI A;  3EGD A;  2W4B A;  3AG1 C;  2R7Q A;  5KYY A;  3B0U X;  2MWQ A;  3AG4 C;  5EGY A;  3EH2 A;  2L81 A;  4CS8 A;  2Q9C A;  4AE4 A;  1S7Z A;  4BJ6 C;  2BE5 F;  2PFD A;  1NU7 D;  3I4U A;  3S27 A;  2QTV A;  5DLJ A;  3RYL A;  2Q9A A;  2Y39 A;  5B1A C;  4CIH A;  1TKN A;  5D92 A;  3RKO F;  1FTS A;  3S29 A;  5KYU A;  2NUP A;  5KYX A;  4HFK B;  3OA1 A;  1ZHZ A;  2J7P D;  1SZI A;  3V7O A;  2XL4 A;  3DXJ F;  4IRU A;  2A69 F;  3SZR A;  1VYK A;  1Z5Z A;  4Q5S F;  2KQ9 A;  1OCR C;  1JPJ A;  4OIR F;  2H7V C;  1G8X A;  3GOD A;  3N0T A;  1M2V B;  4RD9 A;  2H7B A;  4E7Z A;  4RDA A;  4DVZ A;  2KGO A;  1O5H A;  5B3S C;  3K33 A;  3ZC4 A;  4OD4 A;  4JW1 A;  1ZHY A;  2IXO A;  2YEV A;  3FVY A;  3FDQ A;  1TWC A;  5L3V A;  4PJJ A;  2WVN A;  1ZU4 A;  5F5H A;  1WGW A;  1Z23 A;  3KH2 A;  4K0D A;  3LS0 A;  4DBR A;  2EIJ C;  3X2Q C;  2NUT B;  5BUO A;  2H7O A;  2QY9 A;  3DMD A;  4I1O B;  4FES A;  2R7X A;  4PK4 A;  2OG2 A;  4I3M A;  4J32 B;  4G7Z F;  1ZU5 A;  3NG1 A;  1TWA A;  4C3D A;  4AX2 A;  1V54 C;  4PJM A;  4O79 A;  2A6E F;  3EFO A;  3L34 A;  4B6I A;  3LEV A;  4JJG A;  3RH3 A;  2IYL D;  4KBL A;  1PCX A;  1MMD A;  2VB6 A;  5FCL A;  4YJW A;  4XLP F;  4LLE A;  2V26 A;  3LS1 A;  4OIP F;  3M1C B;  3DM9 B;  4CSA C;  2WVQ A;  3POV A;  5T1D B;  2W45 A;  3O39 A;  4HFF B;  5E3C A;  5B1B C;  4KI2 A;  3Q6M A;  1IW7 F;  3Q7L A;  4EWC A;  2P6V A;  3DD7 A;  2VH3 A;  5CI8 A;  4YN0 B;  3PHF 2;  1VMA A;  4GYT A;  2LSE A;  3EJN A;  1ST6 A;  4ZLC A;  3S0X A;  2YZS A;  5EHH A;  3JCU Q;  1BR4 A;  3ABL C;  3KKB A;  4U5E E;  4ANJ A;  3O6X A;  3N2Z B;  3RIP A;  3H65 A;  1ZHT A;  3ECS A;  1TWH A;  2R7U A;  4OD5 A;  3WOD F;  4JJF A;  4BEJ A;  1OKK D;  4KNV A;  4CS8 C;  2J46 A;  4PJN A;  1D0Z A;  2R7R A;  1ZHW A;  3LES A;  2WVO A;  2DYS C;  5IY5 C;  3LAY A;  3EG9 B;  4JCH A;  4IJJ A;  4JVS A;  1M57 C;  3NKD A;  4K7B A;  3NRH A;  3F47 A;  3L0I A;  2Y3D A;  3MX3 A;  1VK5 A;  2KNH A;  4CS7 A;  1QLE C;  4XWJ A;  2EIL C;  2O9X A;  3I5P A;  3W2W A;  2NUT A;  2GFH A;  5F5F A;  4CBE A;  5KYW B;  2IOQ A;  1W2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...