4C3DA

Hrsv m2-1, p422 crystal form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
165
Chain Sequence
LGSMSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDKSLDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords MATRIX M2-1
publication title Crystal Structure of the Essential Transcription Antiterminator M2-1 Protein of Human Respiratory Syncytial Virus and Implications of its Phosphorylation.
pubmed doi rcsb
source organism Human respiratory syncytial virus
total genus 59
structure length 165
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06436 Pneumovirus_M2 Pneumovirus matrix protein 2 (M2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4c3dA00
4CS9C 4CS8C 4CSAA 4CS7A 4CS9A 4CS8A 4C3DA 2L9JA 4C3EA 4CSAC 4C3BA
chains in the Genus database with same CATH superfamily
2W9YA 3JRTA 4LLEA 4M63A 4CIPA 2A0UA 3LJBA 2J9UA 3ABLC 2L81A 1VYKA 2CCYA 2VCCA 1H7IA 2I15A 2DYSC 3NMJA 4U5FE 5B1AC 1D0ZA 3C8GA 1TWGA 5AC5A 2TMVP 3H2VA 2KJGA 4EKWA 4EBKA 2R9RB 4KNVA 4P6IC 2EPOA 1MNDA 4RDAA 3U0CA 2L6FA 2VC9A 1GQAA 3UGOA 4U5CE 1MMNA 4G78A 3L8IA 1KNYA 1QPUA 2FAPB 2Y3DA 3EPVA 3F47A 3JYYA 1WN0A 3NYMA 5KYYA 2YWAA 4BJTA 1NLXA 1BR4A 2ICWG 2R03A 3DAFA 3LS0A 3NMKA 4NTBA 4E7SA 1S05A 3VF0A 4ULWA 3S29A 3AG2C 1CGME 4X0RA 5DVWA 3B0PA 2XXAA 3U9JA 3C8GD 2R7VA 3DM5A 2DB4A 4FX5A 2C04A 2AWCA 4HE8D 4H4KC 5TJ5E 5L3QA 5GPGB 1BR2A 2R05A 3ITFA 3US6A 3UMKA 1M57C 3FXHA 1Q0KA 4YK5A 1ZHYA 3O55A 2R7TA 2VH3A 2M4EA 1ZHTA 1VYIA 3TK0A 1QKRA 2CYDA 3ABMC 5COGA 2MHRA 4BJ6A 4H54A 3W2VA 2YHSA 4U5HA 3L1MA 2ZD9A 2H7BA 4NQFA 3SYNA 2H8AA 3LNMB 4NTAA 3W8IA 1Q0MA 5L0JA 1YARO 1GGQA 2WVNA 5F28E 2J45A 3B9QA 4QI0A 4CX9A 4XEKA 3GODA 3MYIA 5D92A 5A69A 1OQCA 1NU9C 1RJ9A 1EQ1A 3IQ5A 5CI9A 3UGPA 5F5FA 1QQ3A 3S90A 4R32A 4KI2A 1SYQA 2LQGA 4PR9A 3E9VA 3GANA 4MVQA 3TQOA 2CW0F 2WZGA 4N4WA 3N0TA 2XLVA 3ZSUA 1D0YA 1A7EA 3LESA 3GM3A 4G7HF 1ZHXA 3EZHA 4DVYP 2XS1A 4LDRA 1OCOC 4HEAJ 4JW1A 4FWVA 1T6UA 2Y3HA 3V5XA 4ZLCA 1BBHA 1PV3A 3L34A 2V26A 4FESA 4XWJA 3DD7A 4CDVA 2YL0A 1S7ZA 4A4AA 3EFOB 2J7PA 3UMHA 1LPEA 2LSEA 2XLHA 4CS9C 4IRUA 4AX2A 2XM4A 4KC9A 1MMAA 2GAQA 4ULVA 1H6GA 4JJGA 4JJFA 4IJJA 1ZW3A 4MVUA 3OEOA 1ZHZA 2J9BA 3F46A 2A69F 2KC3A 1D1BA 1I4YA 2XS8A 1MQVA 5BQGA 1OR3A 3WG7C 3GEHA 1C02A 3JZ0A 3VM6A 4DRHB 1TR2A 4MTFA 1OCZC 4OIQF 2JX0A 4PK4A 4EBJA 4IAQA 4PFPA 1J8YF 1Z7Qc 5L0CA 1DOWA 2O9XA 5JUAA 4C7OA 3IQ6A 4Q5SF 3DE8A 2ZPAA 3GM1A 3L0IA 3QMKA 4YL1A 3PHF2 2J7PD 1CGNA 2NUTB 1GM5A 1TKNA 2GWWA 2X51A 2EPMX 5AC4A 2HV7A 5JS5A 3PMRA 3EH1A 3B0UX 3JCUQ 3C18A 2Y69C 4Z9IA 5L0DA 3EFOA 4DRIB 3M4CA 2KK1A 2C03A 2ZXPA 5CI8A 3TOLA 1H9GA 4XPYA 1Z3IX 3T6JA 1IZMA 3KKBA 5COMA 2R7QA 1YZCA 1O87A 3X2QC 1M2OA 2PF4E 1E2XA 3FMSA 4LERA 4XPXA 2W45A 5E33A 3K1IA 4CS8C 2G62A 4J7TA 3EJNA 1WGWA 4MVOA 1OKKA 2G3KA 1LKXA 3C8GB 1T01A 4XQ1A 2ZXWC 3AGTA 3JSZA 4UDVA 4GEHA 2HS5A 2LFFA 4JURI 1E83A 1ORJA 3MYFA 1OCCC 3EGXB 4Q7CA 4YWQA 2NUTA 3U8VA 2IYLD 5DS6A 4PACA 3SXMA 4MQ9F 3W4YA 1QSPA 2PFDA 1PD1A 4YL3A 2M64A 3CQZA 1BZ4A 2CNWA 2QE9A 4JTDB 5KYYB 1ZZPA 1HW2A 2OCCC 3JT1A 1T6QA 3C8ZA 2GA0A 2FGYA 4XPWA 1LS4A 3UR3C 3A11A 2HZ8A 1TWHA 5BUOA 4WGYA 5JVEA 1YYJA 3NG1A 3VYWA 2LIGA 1J8MF 4BJ5A 1PD0A 4AK9A 4K0DA 3ZQYA 2IXNA 2PX0A 2VCBA 3Q7GA 4GQHA 1K05A 3NDBB 3N24A 3RKOF 3GEEA 1FMWA 4JTCB 2QNLA 2R7OA 5EGYA 3ECSA 5D91A 2WZLA 2LK4A 3LEOA 4U9EA 3DAGA 1Q0GA 2YQYA 3RVYA 1H9TA 3POVA 2KW3C 3H2UA 2CNWD 4JIOA 3HLZA 3EGXA 1Z63A 3FAPB 1RMVA 3DMDA 4N06A 2P1AA 1YYXA 5BQIA 3PDMP 2B0JA 1Q0FA 1LIHA 2Q9BA 3SXKA 3T9OA 2L7AA 2OJED 3DI5A 3GWLA 1FNTc 3ZTMA 5JRAA 2MYSA 4EIYA 4BPMA 2L9JA 1NG1A 3K7DA 2OQMA 1MMDA 1RJ9B 1K40A 1YDIA 3JRMO 1Z23A 2HSBA 2W4BA 3JSEO 3SXYA 2P6VA 3WHNA 3H65A 4MVMA 5A6AA 1VK5A 3RYLA 5BQHA 4L6RA 4W8PA 4BJ1A 1HMDA 1Q0DA 4OIOF 3Q6NA 2Q4FA 3RW0A 2XLDA 4ANJA 5E3CA 3O39A 1WATA 1RKEA 2DYRC 2A1DD 2WZFA 1HW1A 1V54C 2IXPA 2LP4A 2OG2A 3ASOC 4OD4A 5DLJA 1O3UA 2OEVA 4KNWA 3S28A 1TFOB 3AJMA 1AUEA 1C17M 1SMYF 3S84A 3LUTB 5EHHA 1FTSA 4CSAC 2DGJA 4CBEA 1VLSA 2OOCA 2HJMA 1APCA 4OD5A 1BR1A 3BRJA 5FCLA 3EG9A 3EH2A 2R7RA 4MTGA 3KH2A 1GS9A 1TWAA 3T6BA 4AL0A 3SNHA 3HNKA 3G4ZA 2P7VA 4QI2A 2Q7RA 3WODF 1JPNA 3AQBA 3SZRA 4C3DA 1FFTC 3EQLF 3VAYA 4O6YA 4OINF 2AVKA 1KTMA 5DS5A 4CIHA 4D4XA 4MTOA 3ZVRA 1VMAA 4CJOA 3W8HA 2HSQA 2LFDA 4E0IA 4EUKB 2AP3A 3V5ZA 3R7CA 4C7OB 3DE9A 3ZDLA 1LM3B 2ETSA 1Y4CA 4NY3A 2WVQA 4YT8A 3RH3A 5A6KA 5KYNA 1LI5A 4GYTA 3QVYA 1B68A 1U6HA 1WOLA 1YAUO 2YL1A 2XM0A 5T3TA 1OW8A 3EZIA 5JT4A 3M1CB 2R7XA 4IGGA 3Q7LA 4BEMJ 1AVOB 4JRZA 2ZXRA 5DQTA 3FDQA 4HFFB 2EIKC 3IHUA 5EK0A 3TJ5A 1VOMA 2NPUA 1I4ZA 2KQ9A 1Z6AA 3I5QA 4WABA 3CEXA 3U8PA 2B0HA 1FAPB 2JPUA 4O6NA 4E7ZA 1TQGA 4F4BA 256BA 1E84A 4G7OF 2J9VA 4JE9A 4DBRA 3I4UA 1Y6DA 1WASA 3L8JA 3R2PA 4W8KA 1ZW2A 1M2VA 3RQEA 3U2LA 1M6TA 4CDAA 4NC3A 1L3PA 2Q9CA 4G0HA 3AG3C 1A41A 2OKUA 2F22A 2MWQA 2X0CA 1F1MA 4C3BA 3E70C 3K66A 2PP4A 4EBBA 3U2MA 1LS1A 3NRHA 1YA9A 2QY9A 3IPMO 1OCRC 2EILC 5L0HA 1G4WR 3S9OA 2GDCA 2P0NA 1A7VA 2J46A 1CPRA 4O6MA 1T9KA 3X1OA 4BG0A 3KMIA 5CIVA 2XSEA 1LE2A 3EHNA 2YLIA 3TJ6A 2R7WA 3TD7A 5HSWA 1HMOA 3T6GB 1D1CA 4MW3A 1ZU4A 2OJQA 4DOZA 5A6JA 2R7UA 1V55C 2RSEB 4AE4B 2I8BA 2QUPA 1YLMA 3KYJA 1QZXA 2CDQA 3GEIA 3M4BA 4IARA 3SEOA 1RXQA 3M79A 2HMZA 1SZIA 3K6BA 3ZG1A 1HY5A 2IBFA 2Y39A 2V3CC 3N2ZB 3SXZA 2XL6A 4Z9JA 3ZC4A 1JOGA 4CS9A 1NFOA 4E17A 2KYHA 3IEEA 1NZEA 2Y3GA 4WGZA 4C3EA 2NUPA 2AU5A 5KYWA 1MNEA 4U5BE 2VB6A 1LE4A 3K1HA 4JEBA 3U5SA 1ORYA 2L6HA 2NSFA 2LD6A 3GORA 3HNIA 3QW0A 3OA1A 3S27A 2D5RB 3FOPA 2P61A 3GWNA 4AE4A 2HFIA 5B3IA 2AWYA 2E87A 4JCHA 5K0IA 3AG1C 1I5NA 1ZHWA 3SP1A 3ZWIA 3DZAA 3MX3A 2G3VA 2PX3A 2R7SA 1RKEB 3RIPA 1E86A 2ASRA 4NTFA 3LAYA 2Q9AA 4LACB 1IW7F 3QVZA 4YL0A 1UG7A 2IXOA 3C63A 1D1AA 4ER9A 4BJ6C 2YEVA 1CPQA 4PJMA 1PCXA 4D4NA 1NU7D 2YL7A 1ZYRF 2FFHA 2XLMA 3EG9B 4CS8A 4U5EE 1T5OA 2A6EF 5E2QA 4OIRF 3MLGA 2GFHA 3ZIBA 4EHPA 4XTKA 3NYLA 1YZAA 1EA8A 3DJUB 4JCZA 5KYUA 3ABKC 5DQZA 1FFHA 1RKCA 1R4TA 1MMGA 3M15A 5JSLA 1JPJA 3CSKA 4FAPB 2YZSA 3FOOA 2J9WA 4IB4A 1EKYA 1YJGA 5COFA 2L6GA 1HE1A 3RVZA 5L0FA 3V5YA 3LLIA 1R5ID 2XLWA 4QDLA 2BE5F 4P9FA 3HKKA 5FZTA 5L0GA 3JYHA 3K33A 3KYIA 2H7VC 4DVZA 2YVKA 3C62A 1OW7A 1T6IA 3QTHA 2HKVA 2J8WA 2HMQA 4AL1A 1WTYA 4JKVA 3ZQVA 2XL4A 3HNLA 4N6CA 5L0IA 3FAJA 2WVOA 3NMIA 1ST6A 1NFNA 1KU2A 2EPKX 1NSGB 1C03A 3U3FA 1TWCA 4E18A 3B0VC 5B3SC 3CZ6A 5F5HA 2YRFA 5B1BC 3UMIA 3NKDA 3IQTA 3RF3A 3J06A 4XLPF 2HJ3A 4PJLA 4A2NB 3AGUA 2YL3A 4YT5A 4Z9HA 4ZLDA 1M2VB 2XRHA 3HTKC 1NBBA 5DS4A 3S0XA 1G5ZA 2BL2A 2EPNA 3RQFA 2KNHA 2HUJA 4RBNA 4LLCA 4BEJA 2RD9A 5L3VA 3DWWA 3FVYA 4XEVA 1OR2A 3AQCA 3DKAA 3EHMA 2R02A 1N1CA 5JLIA 2HV6A 3U9MA 4U5DE 4DJ9A 2Z15A 4I1MA 1OXKA 1RCPA 1SR2A 3KL4A 4KBLA 5JP7A 3V7OA 3ATPA 3ASNC 3UNGC 4MS2A 4MVRA 2QTVA 2PNOA 1K04A 1VB5A 2UUHA 1OXBA 4JC7A 4O7GA 4O79A 2Q00A 5T1DB 4IWBA 1O5HA 2LCHA 3C7JA 4U9DA 4EWCA 3K1IC 4J32B 2WB7A 4ONSA 4DXWA 3ZTZA 3LLKA 4PJJA 4MNDA 4B6IA 4CS7A 3PCVA 2XL8A 3RFYA 4YT2A 5A6BA 3A9CA 4JZAA 2EIMC 1JMWA 4MW8A 1OW6A 2WL8A 2KGOA 1LI7A 2IM8A 4NCQA 4RD9A 3U3BA 2OEXA 3Q6MA 1YVIA 4CSAA 5KYXB 4PJNA 1L7CA 2A0BA 2EPLX 3DM9B 3T4RA 1A7DA 1QVXA 3O10A 2NUPB 5KYWB 4YN0B 1VLTA 3QW1A 3EGDB 2PBEA 2W4MA 4YT4A 2H7OA 2DI3A 4K1OA 1LVKA 3LS1A 1VTMP 4PFOA 1V74B 4P9TA 3NYJA 4WJ0A 2A6HF 3GM2A 3O6XA 1E85A 1BDJB 1JAFA 2Y3BA 3CAXA 1M56C 2YLGA 5E3AA 5A6BD 1CGOA 4U5GA 4OIPF 4BJ5C 4Q4ZF 3MBGA 1XWJA 3AOUA 3NKEA 3DXJF 2VASA 3BEHA 3LNRA 1QLEC 2BC5A 2XLOA 4J7YA 3VRCA 4JVSA 2UUIA 4CDYA 4I3MA 1D0XA 1G8XA 5KYXA 1FR0A 1ORSC 2D4UA 1YA7O 4K7BA 3RQGA 4LDQA 2NSGA 2QLAA 2CGEA 2EIJC 4I44A 1A0BA 3QZCA 3EGDA 4JTAB 4MVSA 4CJGA 3G50A 3HNJA 4J30B 1W2WA 1EI7A 1AEPA 1Z5ZA 2Q3TA 3B71A 3JTLO 5T3WA 2VCAA 3HJCA 3MFNA 4HFKB 2IXMA 3TOMA 1V4AA 3WAQA 3B29A 4I1OB 5KYUB 1G4US 2IOQA 2JD3A 3I5PA 2ZXOA 1DOVA 1UFBA 2EINC 2J0WA 1JRAA 3TULA 2YKZA 3OWTA 3LEVA 4N6HA 4XLNF 3IQCA 4IAOA 2OU6A 3AG4C 4E0HA 4DRJB 3FHDA 1ZVZA 4JEAA 1U0BB 1TFKB 4DBQA 2J0XA 3DJNB 5AGFA 2YLDA 1FMVA 4XEFA 1JR8A 5HV9A 1XZPA 1U89A 4G7ZF 1SF8A 1XZQA 4MVZA 4YJWA 2A68F 2R25A 3G4XA 4LDKA 1HE9A 2NG1A 2XLEA 3KPHA 3W2WA 1OKKD 5IY5C 2XXAB 1WWPA 1ZU5A 2KSFA
chains in the Genus database with same CATH topology
2W9YA 3JRTA 4LLEA 4M63A 3LJBA 2J9UA 3ABLC 2L81A 1VYKA 4U5FE 2DYSC 5B1AC 1D0ZA 1TWGA 2KJGA 4KNVA 4P6IC 1MNDA 4RDAA 3UGOA 4U5CE 1MMNA 2Y3DA 3F47A 3EPVA 3NYMA 5KYYA 4BJTA 1BR4A 3DAFA 3LS0A 4E7SA 4ULWA 3S29A 3AG2C 4X0RA 5DVWA 3B0PA 2XXAA 2R7VA 3DM5A 4FX5A 2C04A 4HE8D 4H4KC 5L3QA 1BR2A 3ITFA 3UMKA 1M57C 1ZHYA 2R7TA 2VH3A 2M4EA 1ZHTA 1VYIA 3ABMC 4BJ6A 3W2VA 2YHSA 4U5HA 2H7BA 3SYNA 3W8IA 2WVNA 2J45A 3B9QA 4QI0A 3GODA 5D92A 1NU9C 1RJ9A 5CI9A 3UGPA 5F5FA 4KI2A 3E9VA 3GANA 2CW0F 2WZGA 3N0TA 3ZSUA 1D0YA 3LESA 4G7HF 1ZHXA 3EZHA 4DVYP 1OCOC 4HEAJ 4JW1A 4FWVA 2Y3HA 4ZLCA 3L34A 4FESA 2V26A 4XWJA 3DD7A 1S7ZA 3EFOB 2J7PA 3UMHA 2LSEA 4CS9C 4IRUA 4AX2A 4KC9A 1MMAA 4JJGA 4JJFA 4IJJA 3OEOA 1ZHZA 3F46A 2A69F 1D1BA 3WG7C 1TR2A 1OCZC 4OIQF 4PK4A 4PFPA 1J8YF 2O9XA 4C7OA 4Q5SF 3L0IA 2ZPAA 3QMKA 3PHF2 2J7PD 2NUTB 1TKNA 2X51A 2HV7A 3PMRA 3EH1A 3B0UX 3JCUQ 2Y69C 3EFOA 2ZXPA 2C03A 5CI8A 1Z3IX 3T6JA 1IZMA 3KKBA 2R7QA 3X2QC 1O87A 1M2OA 2PF4E 4LERA 5E33A 2W45A 4CS8C 2G62A 3EJNA 1WGWA 1OKKA 2G3KA 1LKXA 2ZXWC 3JSZA 4GEHA 4JURI 1OCCC 3EGXB 4Q7CA 4YWQA 2NUTA 2IYLD 5DS6A 4MQ9F 2PFDA 1PD1A 3CQZA 2CNWA 5KYYB 2OCCC 3JT1A 2FGYA 3UR3C 1TWHA 5BUOA 3NG1A 3VYWA 1J8MF 4BJ5A 1PD0A 4AK9A 4K0DA 3NDBB 2IXNA 2PX0A 3Q7GA 3N24A 3RKOF 1FMWA 2R7OA 5EGYA 3ECSA 5D91A 2WZLA 3DAGA 3POVA 2KW3C 2CNWD 3HLZA 3EGXA 1Z63A 3DMDA 4N06A 2B0JA 2Q9BA 2MYSA 2L9JA 1NG1A 3K7DA 1MMDA 1RJ9B 1Z23A 2W4BA 2P6VA 3H65A 1VK5A 3RYLA 4BJ1A 4OIOF 3Q6NA 4ANJA 5E3CA 3O39A 2DYRC 2A1DD 2WZFA 1V54C 2IXPA 2OG2A 3ASOC 4OD4A 5DLJA 4KNWA 3S28A 1SMYF 5EHHA 1FTSA 4CSAC 2DGJA 4CBEA 4OD5A 1BR1A 5FCLA 3EG9A 3EH2A 2R7RA 3KH2A 1TWAA 3T6BA 3SNHA 2P7VA 4QI2A 3WODF 1JPNA 3AQBA 3SZRA 4C3DA 1FFTC 3EQLF 3VAYA 4O6YA 4OINF 5DS5A 4CIHA 3ZVRA 1VMAA 3W8HA 4C7OB 4NY3A 5KYNA 2WVQA 4YT8A 3RH3A 4GYTA 5T3TA 3EZIA 3M1CB 2R7XA 3Q7LA 2ZXRA 5DQTA 3FDQA 4HFFB 2EIKC 1VOMA 2KQ9A 1Z6AA 3I5QA 4O6NA 4E7ZA 4G7OF 4F4BA 2J9VA 4DBRA 3I4UA 4W8KA 1M2VA 2Q9CA 4G0HA 3AG3C 2MWQA 4C3BA 3E70C 3K66A 2PP4A 4EBBA 1LS1A 3NRHA 2QY9A 1OCRC 2EILC 2J46A 4O6MA 3X1OA 4BG0A 3KMIA 2XSEA 3EHNA 2R7WA 3TD7A 5HSWA 1D1CA 1ZU4A 4DOZA 2R7UA 1V55C 4AE4B 2I8BA 1QZXA 2CDQA 3SEOA 3K6BA 1SZIA 3ZG1A 2Y39A 2V3CC 3N2ZB 3ZC4A 4CS9A 3IEEA 1NZEA 2Y3GA 4C3EA 2NUPA 5KYWA 1MNEA 4U5BE 2VB6A 3K1HA 3OA1A 3S27A 2D5RB 4AE4A 2E87A 4JCHA 3AG1C 1ZHWA 3SP1A 3DZAA 3MX3A 2G3VA 2PX3A 2R7SA 3RIPA 3LAYA 2Q9AA 4LACB 1IW7F 2IXOA 1D1AA 4BJ6C 2YEVA 4PJMA 1PCXA 1NU7D 1ZYRF 2FFHA 4CS8A 3EG9B 4U5EE 2A6EF 5E2QA 4OIRF 3MLGA 2GFHA 3ZIBA 4XTKA 3NYLA 3DJUB 5KYUA 3ABKC 5DQZA 1FFHA 1MMGA 1JPJA 3CSKA 2YZSA 2J9WA 3LLIA 4QDLA 2BE5F 3JYHA 3K33A 2H7VC 4DVZA 2XL4A 3FAJA 2WVOA 1ST6A 1KU2A 1TWCA 3B0VC 5B3SC 3CZ6A 5F5HA 5B1BC 3UMIA 3NKDA 4XLPF 4PJLA 4A2NB 4YT5A 4ZLDA 1M2VB 2XRHA 3HTKC 5DS4A 3S0XA 2KNHA 4RBNA 4LLCA 4BEJA 5L3VA 3FVYA 3AQCA 3EHMA 1N1CA 2HV6A 4U5DE 2Z15A 4I1MA 4KBLA 3KL4A 3V7OA 3ASNC 3UNGC 2QTVA 4O7GA 4O79A 5T1DB 4IWBA 1O5HA 4EWCA 3K1IC 4J32B 2WB7A 3LLKA 4PJJA 4MNDA 4B6IA 4CS7A 4YT2A 3RFYA 4JZAA 2EIMC 2WL8A 2KGOA 4RD9A 3Q6MA 4CSAA 5KYXB 4PJNA 3DM9B 3T4RA 2NUPB 5KYWB 4YN0B 3EGDB 2W4MA 4YT4A 2H7OA 1LVKA 3LS1A 4PFOA 3NYJA 4WJ0A 2A6HF 3O6XA 2Y3BA 1M56C 5E3AA 4U5GA 4OIPF 4BJ5C 4Q4ZF 3NKEA 3DXJF 2VASA 3LNRA 1QLEC 4JVSA 4I3MA 1D0XA 1G8XA 5KYXA 4K7BA 2CGEA 2EIJC 4I44A 3QZCA 3EGDA 4J30B 1W2WA 1Z5ZA 2Q3TA 5T3WA 3HJCA 4HFKB 2IXMA 4I1OB 5KYUB 2IOQA 2JD3A 3I5PA 2ZXOA 2J0WA 2EINC 3OWTA 3LEVA 4XLNF 4IAOA 3AG4C 3FHDA 4DBQA 2J0XA 3DJNB 1FMVA 4G7ZF 1SF8A 4YJWA 2A68F 2NG1A 5IY5C 2XXAB 3W2WA 1OKKD 1ZU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CS9 C;  4CS8 C;  4CSA A;  4CS7 A;  4CS9 A;  4CS8 A;  4C3D A;  2L9J A;  4C3E A;  4CSA C;  4C3B A; 
#chains in the Genus database with same CATH topology
 2W9Y A;  3JRT A;  4LLE A;  4M63 A;  4CIP A;  2A0U A;  3LJB A;  2J9U A;  3ABL C;  2L81 A;  1VYK A;  2CCY A;  2VCC A;  1H7I A;  2I15 A;  2DYS C;  3NMJ A;  4U5F E;  5B1A C;  1D0Z A;  3C8G A;  1TWG A;  5AC5 A;  2TMV P;  3H2V A;  2KJG A;  4EKW A;  4EBK A;  2R9R B;  4KNV A;  4P6I C;  2EPO A;  1MND A;  4RDA A;  3U0C A;  2L6F A;  2VC9 A;  1GQA A;  3UGO A;  4U5C E;  1MMN A;  4G78 A;  3L8I A;  1KNY A;  1QPU A;  2FAP B;  2Y3D A;  3EPV A;  3F47 A;  3JYY A;  1WN0 A;  3NYM A;  5KYY A;  2YWA A;  4BJT A;  1NLX A;  1BR4 A;  2ICW G;  2R03 A;  3DAF A;  3LS0 A;  3NMK A;  4NTB A;  4E7S A;  1S05 A;  3VF0 A;  4ULW A;  3S29 A;  3AG2 C;  1CGM E;  4X0R A;  5DVW A;  3B0P A;  2XXA A;  3U9J A;  3C8G D;  2R7V A;  3DM5 A;  2DB4 A;  4FX5 A;  2C04 A;  2AWC A;  4HE8 D;  4H4K C;  5TJ5 E;  5L3Q A;  5GPG B;  1BR2 A;  2R05 A;  3ITF A;  3US6 A;  3UMK A;  1M57 C;  3FXH A;  1Q0K A;  4YK5 A;  1ZHY A;  3O55 A;  2R7T A;  2VH3 A;  2M4E A;  1ZHT A;  1VYI A;  3TK0 A;  1QKR A;  2CYD A;  3ABM C;  5COG A;  2MHR A;  4BJ6 A;  4H54 A;  3W2V A;  2YHS A;  4U5H A;  3L1M A;  2ZD9 A;  2H7B A;  4NQF A;  3SYN A;  2H8A A;  3LNM B;  4NTA A;  3W8I A;  1Q0M A;  5L0J A;  1YAR O;  1GGQ A;  2WVN A;  5F28 E;  2J45 A;  3B9Q A;  4QI0 A;  4CX9 A;  4XEK A;  3GOD A;  3MYI A;  5D92 A;  5A69 A;  1OQC A;  1NU9 C;  1RJ9 A;  1EQ1 A;  3IQ5 A;  5CI9 A;  3UGP A;  5F5F A;  1QQ3 A;  3S90 A;  4R32 A;  4KI2 A;  1SYQ A;  2LQG A;  4PR9 A;  3E9V A;  3GAN A;  4MVQ A;  3TQO A;  2CW0 F;  2WZG A;  4N4W A;  3N0T A;  2XLV A;  3ZSU A;  1D0Y A;  1A7E A;  3LES A;  3GM3 A;  4G7H F;  1ZHX A;  3EZH A;  4DVY P;  2XS1 A;  4LDR A;  1OCO C;  4HEA J;  4JW1 A;  4FWV A;  1T6U A;  2Y3H A;  3V5X A;  4ZLC A;  1BBH A;  1PV3 A;  3L34 A;  2V26 A;  4FES A;  4XWJ A;  3DD7 A;  4CDV A;  2YL0 A;  1S7Z A;  4A4A A;  3EFO B;  2J7P A;  3UMH A;  1LPE A;  2LSE A;  2XLH A;  4CS9 C;  4IRU A;  4AX2 A;  2XM4 A;  4KC9 A;  1MMA A;  2GAQ A;  4ULV A;  1H6G A;  4JJG A;  4JJF A;  4IJJ A;  1ZW3 A;  4MVU A;  3OEO A;  1ZHZ A;  2J9B A;  3F46 A;  2A69 F;  2KC3 A;  1D1B A;  1I4Y A;  2XS8 A;  1MQV A;  5BQG A;  1OR3 A;  3WG7 C;  3GEH A;  1C02 A;  3JZ0 A;  3VM6 A;  4DRH B;  1TR2 A;  4MTF A;  1OCZ C;  4OIQ F;  2JX0 A;  4PK4 A;  4EBJ A;  4IAQ A;  4PFP A;  1J8Y F;  1Z7Q c;  5L0C A;  1DOW A;  2O9X A;  5JUA A;  4C7O A;  3IQ6 A;  4Q5S F;  3DE8 A;  2ZPA A;  3GM1 A;  3L0I A;  3QMK A;  4YL1 A;  3PHF 2;  2J7P D;  1CGN A;  2NUT B;  1GM5 A;  1TKN A;  2GWW A;  2X51 A;  2EPM X;  5AC4 A;  2HV7 A;  5JS5 A;  3PMR A;  3EH1 A;  3B0U X;  3JCU Q;  3C18 A;  2Y69 C;  4Z9I A;  5L0D A;  3EFO A;  4DRI B;  3M4C A;  2KK1 A;  2C03 A;  2ZXP A;  5CI8 A;  3TOL A;  1H9G A;  4XPY A;  1Z3I X;  3T6J A;  1IZM A;  3KKB A;  5COM A;  2R7Q A;  1YZC A;  1O87 A;  3X2Q C;  1M2O A;  2PF4 E;  1E2X A;  3FMS A;  4LER A;  4XPX A;  2W45 A;  5E33 A;  3K1I A;  4CS8 C;  2G62 A;  4J7T A;  3EJN A;  1WGW A;  4MVO A;  1OKK A;  2G3K A;  1LKX A;  3C8G B;  1T01 A;  4XQ1 A;  2ZXW C;  3AGT A;  3JSZ A;  4UDV A;  4GEH A;  2HS5 A;  2LFF A;  4JUR I;  1E83 A;  1ORJ A;  3MYF A;  1OCC C;  3EGX B;  4Q7C A;  4YWQ A;  2NUT A;  3U8V A;  2IYL D;  5DS6 A;  4PAC A;  3SXM A;  4MQ9 F;  3W4Y A;  1QSP A;  2PFD A;  1PD1 A;  4YL3 A;  2M64 A;  3CQZ A;  1BZ4 A;  2CNW A;  2QE9 A;  4JTD B;  5KYY B;  1ZZP A;  1HW2 A;  2OCC C;  3JT1 A;  1T6Q A;  3C8Z A;  2GA0 A;  2FGY A;  4XPW A;  1LS4 A;  3UR3 C;  3A11 A;  2HZ8 A;  1TWH A;  5BUO A;  4WGY A;  5JVE A;  1YYJ A;  3NG1 A;  3VYW A;  2LIG A;  1J8M F;  4BJ5 A;  1PD0 A;  4AK9 A;  4K0D A;  3ZQY A;  2IXN A;  2PX0 A;  2VCB A;  3Q7G A;  4GQH A;  1K05 A;  3NDB B;  3N24 A;  3RKO F;  3GEE A;  1FMW A;  4JTC B;  2QNL A;  2R7O A;  5EGY A;  3ECS A;  5D91 A;  2WZL A;  2LK4 A;  3LEO A;  4U9E A;  3DAG A;  1Q0G A;  2YQY A;  3RVY A;  1H9T A;  3POV A;  2KW3 C;  3H2U A;  2CNW D;  4JIO A;  3HLZ A;  3EGX A;  1Z63 A;  3FAP B;  1RMV A;  3DMD A;  4N06 A;  2P1A A;  1YYX A;  5BQI A;  3PDM P;  2B0J A;  1Q0F A;  1LIH A;  2Q9B A;  3SXK A;  3T9O A;  2L7A A;  2OJE D;  3DI5 A;  3GWL A;  1FNT c;  3ZTM A;  5JRA A;  2MYS A;  4EIY A;  4BPM A;  2L9J A;  1NG1 A;  3K7D A;  2OQM A;  1MMD A;  1RJ9 B;  1K40 A;  1YDI A;  3JRM O;  1Z23 A;  2HSB A;  2W4B A;  3JSE O;  3SXY A;  2P6V A;  3WHN A;  3H65 A;  4MVM A;  5A6A A;  1VK5 A;  3RYL A;  5BQH A;  4L6R A;  4W8P A;  4BJ1 A;  1HMD A;  1Q0D A;  4OIO F;  3Q6N A;  2Q4F A;  3RW0 A;  2XLD A;  4ANJ A;  5E3C A;  3O39 A;  1WAT A;  1RKE A;  2DYR C;  2A1D D;  2WZF A;  1HW1 A;  1V54 C;  2IXP A;  2LP4 A;  2OG2 A;  3ASO C;  4OD4 A;  5DLJ A;  1O3U A;  2OEV A;  4KNW A;  3S28 A;  1TFO B;  3AJM A;  1AUE A;  1C17 M;  1SMY F;  3S84 A;  3LUT B;  5EHH A;  1FTS A;  4CSA C;  2DGJ A;  4CBE A;  1VLS A;  2OOC A;  2HJM A;  1APC A;  4OD5 A;  1BR1 A;  3BRJ A;  5FCL A;  3EG9 A;  3EH2 A;  2R7R A;  4MTG A;  3KH2 A;  1GS9 A;  1TWA A;  3T6B A;  4AL0 A;  3SNH A;  3HNK A;  3G4Z A;  2P7V A;  4QI2 A;  2Q7R A;  3WOD F;  1JPN A;  3AQB A;  3SZR A;  4C3D A;  1FFT C;  3EQL F;  3VAY A;  4O6Y A;  4OIN F;  2AVK A;  1KTM A;  5DS5 A;  4CIH A;  4D4X A;  4MTO A;  3ZVR A;  1VMA A;  4CJO A;  3W8H A;  2HSQ A;  2LFD A;  4E0I A;  4EUK B;  2AP3 A;  3V5Z A;  3R7C A;  4C7O B;  3DE9 A;  3ZDL A;  1LM3 B;  2ETS A;  1Y4C A;  4NY3 A;  2WVQ A;  4YT8 A;  3RH3 A;  5A6K A;  5KYN A;  1LI5 A;  4GYT A;  3QVY A;  1B68 A;  1U6H A;  1WOL A;  1YAU O;  2YL1 A;  2XM0 A;  5T3T A;  1OW8 A;  3EZI A;  5JT4 A;  3M1C B;  2R7X A;  4IGG A;  3Q7L A;  4BEM J;  1AVO B;  4JRZ A;  2ZXR A;  5DQT A;  3FDQ A;  4HFF B;  2EIK C;  3IHU A;  5EK0 A;  3TJ5 A;  1VOM A;  2NPU A;  1I4Z A;  2KQ9 A;  1Z6A A;  3I5Q A;  4WAB A;  3CEX A;  3U8P A;  2B0H A;  1FAP B;  2JPU A;  4O6N A;  4E7Z A;  1TQG A;  4F4B A;  256B A;  1E84 A;  4G7O F;  2J9V A;  4JE9 A;  4DBR A;  3I4U A;  1Y6D A;  1WAS A;  3L8J A;  3R2P A;  4W8K A;  1ZW2 A;  1M2V A;  3RQE A;  3U2L A;  1M6T A;  4CDA A;  4NC3 A;  1L3P A;  2Q9C A;  4G0H A;  3AG3 C;  1A41 A;  2OKU A;  2F22 A;  2MWQ A;  2X0C A;  1F1M A;  4C3B A;  3E70 C;  3K66 A;  2PP4 A;  4EBB A;  3U2M A;  1LS1 A;  3NRH A;  1YA9 A;  2QY9 A;  3IPM O;  1OCR C;  2EIL C;  5L0H A;  1G4W R;  3S9O A;  2GDC A;  2P0N A;  1A7V A;  2J46 A;  1CPR A;  4O6M A;  1T9K A;  3X1O A;  4BG0 A;  3KMI A;  5CIV A;  2XSE A;  1LE2 A;  3EHN A;  2YLI A;  3TJ6 A;  2R7W A;  3TD7 A;  5HSW A;  1HMO A;  3T6G B;  1D1C A;  4MW3 A;  1ZU4 A;  2OJQ A;  4DOZ A;  5A6J A;  2R7U A;  1V55 C;  2RSE B;  4AE4 B;  2I8B A;  2QUP A;  1YLM A;  3KYJ A;  1QZX A;  2CDQ A;  3GEI A;  3M4B A;  4IAR A;  3SEO A;  1RXQ A;  3M79 A;  2HMZ A;  1SZI A;  3K6B A;  3ZG1 A;  1HY5 A;  2IBF A;  2Y39 A;  2V3C C;  3N2Z B;  3SXZ A;  2XL6 A;  4Z9J A;  3ZC4 A;  1JOG A;  4CS9 A;  1NFO A;  4E17 A;  2KYH A;  3IEE A;  1NZE A;  2Y3G A;  4WGZ A;  4C3E A;  2NUP A;  2AU5 A;  5KYW A;  1MNE A;  4U5B E;  2VB6 A;  1LE4 A;  3K1H A;  4JEB A;  3U5S A;  1ORY A;  2L6H A;  2NSF A;  2LD6 A;  3GOR A;  3HNI A;  3QW0 A;  3OA1 A;  3S27 A;  2D5R B;  3FOP A;  2P61 A;  3GWN A;  4AE4 A;  2HFI A;  5B3I A;  2AWY A;  2E87 A;  4JCH A;  5K0I A;  3AG1 C;  1I5N A;  1ZHW A;  3SP1 A;  3ZWI A;  3DZA A;  3MX3 A;  2G3V A;  2PX3 A;  2R7S A;  1RKE B;  3RIP A;  1E86 A;  2ASR A;  4NTF A;  3LAY A;  2Q9A A;  4LAC B;  1IW7 F;  3QVZ A;  4YL0 A;  1UG7 A;  2IXO A;  3C63 A;  1D1A A;  4ER9 A;  4BJ6 C;  2YEV A;  1CPQ A;  4PJM A;  1PCX A;  4D4N A;  1NU7 D;  2YL7 A;  1ZYR F;  2FFH A;  2XLM A;  3EG9 B;  4CS8 A;  4U5E E;  1T5O A;  2A6E F;  5E2Q A;  4OIR F;  3MLG A;  2GFH A;  3ZIB A;  4EHP A;  4XTK A;  3NYL A;  1YZA A;  1EA8 A;  3DJU B;  4JCZ A;  5KYU A;  3ABK C;  5DQZ A;  1FFH A;  1RKC A;  1R4T A;  1MMG A;  3M15 A;  5JSL A;  1JPJ A;  3CSK A;  4FAP B;  2YZS A;  3FOO A;  2J9W A;  4IB4 A;  1EKY A;  1YJG A;  5COF A;  2L6G A;  1HE1 A;  3RVZ A;  5L0F A;  3V5Y A;  3LLI A;  1R5I D;  2XLW A;  4QDL A;  2BE5 F;  4P9F A;  3HKK A;  5FZT A;  5L0G A;  3JYH A;  3K33 A;  3KYI A;  2H7V C;  4DVZ A;  2YVK A;  3C62 A;  1OW7 A;  1T6I A;  3QTH A;  2HKV A;  2J8W A;  2HMQ A;  4AL1 A;  1WTY A;  4JKV A;  3ZQV A;  2XL4 A;  3HNL A;  4N6C A;  5L0I A;  3FAJ A;  2WVO A;  3NMI A;  1ST6 A;  1NFN A;  1KU2 A;  2EPK X;  1NSG B;  1C03 A;  3U3F A;  1TWC A;  4E18 A;  3B0V C;  5B3S C;  3CZ6 A;  5F5H A;  2YRF A;  5B1B C;  3UMI A;  3NKD A;  3IQT A;  3RF3 A;  3J06 A;  4XLP F;  2HJ3 A;  4PJL A;  4A2N B;  3AGU A;  2YL3 A;  4YT5 A;  4Z9H A;  4ZLD A;  1M2V B;  2XRH A;  3HTK C;  1NBB A;  5DS4 A;  3S0X A;  1G5Z A;  2BL2 A;  2EPN A;  3RQF A;  2KNH A;  2HUJ A;  4RBN A;  4LLC A;  4BEJ A;  2RD9 A;  5L3V A;  3DWW A;  3FVY A;  4XEV A;  1OR2 A;  3AQC A;  3DKA A;  3EHM A;  2R02 A;  1N1C A;  5JLI A;  2HV6 A;  3U9M A;  4U5D E;  4DJ9 A;  2Z15 A;  4I1M A;  1OXK A;  1RCP A;  1SR2 A;  3KL4 A;  4KBL A;  5JP7 A;  3V7O A;  3ATP A;  3ASN C;  3UNG C;  4MS2 A;  4MVR A;  2QTV A;  2PNO A;  1K04 A;  1VB5 A;  2UUH A;  1OXB A;  4JC7 A;  4O7G A;  4O79 A;  2Q00 A;  5T1D B;  4IWB A;  1O5H A;  2LCH A;  3C7J A;  4U9D A;  4EWC A;  3K1I C;  4J32 B;  2WB7 A;  4ONS A;  4DXW A;  3ZTZ A;  3LLK A;  4PJJ A;  4MND A;  4B6I A;  4CS7 A;  3PCV A;  2XL8 A;  3RFY A;  4YT2 A;  5A6B A;  3A9C A;  4JZA A;  2EIM C;  1JMW A;  4MW8 A;  1OW6 A;  2WL8 A;  2KGO A;  1LI7 A;  2IM8 A;  4NCQ A;  4RD9 A;  3U3B A;  2OEX A;  3Q6M A;  1YVI A;  4CSA A;  5KYX B;  4PJN A;  1L7C A;  2A0B A;  2EPL X;  3DM9 B;  3T4R A;  1A7D A;  1QVX A;  3O10 A;  2NUP B;  5KYW B;  4YN0 B;  1VLT A;  3QW1 A;  3EGD B;  2PBE A;  2W4M A;  4YT4 A;  2H7O A;  2DI3 A;  4K1O A;  1LVK A;  3LS1 A;  1VTM P;  4PFO A;  1V74 B;  4P9T A;  3NYJ A;  4WJ0 A;  2A6H F;  3GM2 A;  3O6X A;  1E85 A;  1BDJ B;  1JAF A;  2Y3B A;  3CAX A;  1M56 C;  2YLG A;  5E3A A;  5A6B D;  1CGO A;  4U5G A;  4OIP F;  4BJ5 C;  4Q4Z F;  3MBG A;  1XWJ A;  3AOU A;  3NKE A;  3DXJ F;  2VAS A;  3BEH A;  3LNR A;  1QLE C;  2BC5 A;  2XLO A;  4J7Y A;  3VRC A;  4JVS A;  2UUI A;  4CDY A;  4I3M A;  1D0X A;  1G8X A;  5KYX A;  1FR0 A;  1ORS C;  2D4U A;  1YA7 O;  4K7B A;  3RQG A;  4LDQ A;  2NSG A;  2QLA A;  2CGE A;  2EIJ C;  4I44 A;  1A0B A;  3QZC A;  3EGD A;  4JTA B;  4MVS A;  4CJG A;  3G50 A;  3HNJ A;  4J30 B;  1W2W A;  1EI7 A;  1AEP A;  1Z5Z A;  2Q3T A;  3B71 A;  3JTL O;  5T3W A;  2VCA A;  3HJC A;  3MFN A;  4HFK B;  2IXM A;  3TOM A;  1V4A A;  3WAQ A;  3B29 A;  4I1O B;  5KYU B;  1G4U S;  2IOQ A;  2JD3 A;  3I5P A;  2ZXO A;  1DOV A;  1UFB A;  2EIN C;  2J0W A;  1JRA A;  3TUL A;  2YKZ A;  3OWT A;  3LEV A;  4N6H A;  4XLN F;  3IQC A;  4IAO A;  2OU6 A;  3AG4 C;  4E0H A;  4DRJ B;  3FHD A;  1ZVZ A;  4JEA A;  1U0B B;  1TFK B;  4DBQ A;  2J0X A;  3DJN B;  5AGF A;  2YLD A;  1FMV A;  4XEF A;  1JR8 A;  5HV9 A;  1XZP A;  1U89 A;  4G7Z F;  1SF8 A;  1XZQ A;  4MVZ A;  4YJW A;  2A68 F;  2R25 A;  3G4X A;  4LDK A;  1HE9 A;  2NG1 A;  2XLE A;  3KPH A;  3W2W A;  1OKK D;  5IY5 C;  2XXA B;  1WWP A;  1ZU5 A;  2KSF A; 
#chains in the Genus database with same CATH homology
 2W9Y A;  3JRT A;  4LLE A;  4M63 A;  3LJB A;  2J9U A;  3ABL C;  2L81 A;  1VYK A;  4U5F E;  2DYS C;  5B1A C;  1D0Z A;  1TWG A;  2KJG A;  4KNV A;  4P6I C;  1MND A;  4RDA A;  3UGO A;  4U5C E;  1MMN A;  2Y3D A;  3F47 A;  3EPV A;  3NYM A;  5KYY A;  4BJT A;  1BR4 A;  3DAF A;  3LS0 A;  4E7S A;  4ULW A;  3S29 A;  3AG2 C;  4X0R A;  5DVW A;  3B0P A;  2XXA A;  2R7V A;  3DM5 A;  4FX5 A;  2C04 A;  4HE8 D;  4H4K C;  5L3Q A;  1BR2 A;  3ITF A;  3UMK A;  1M57 C;  1ZHY A;  2R7T A;  2VH3 A;  2M4E A;  1ZHT A;  1VYI A;  3ABM C;  4BJ6 A;  3W2V A;  2YHS A;  4U5H A;  2H7B A;  3SYN A;  3W8I A;  2WVN A;  2J45 A;  3B9Q A;  4QI0 A;  3GOD A;  5D92 A;  1NU9 C;  1RJ9 A;  5CI9 A;  3UGP A;  5F5F A;  4KI2 A;  3E9V A;  3GAN A;  2CW0 F;  2WZG A;  3N0T A;  3ZSU A;  1D0Y A;  3LES A;  4G7H F;  1ZHX A;  3EZH A;  4DVY P;  1OCO C;  4HEA J;  4JW1 A;  4FWV A;  2Y3H A;  4ZLC A;  3L34 A;  4FES A;  2V26 A;  4XWJ A;  3DD7 A;  1S7Z A;  3EFO B;  2J7P A;  3UMH A;  2LSE A;  4CS9 C;  4IRU A;  4AX2 A;  4KC9 A;  1MMA A;  4JJG A;  4JJF A;  4IJJ A;  3OEO A;  1ZHZ A;  3F46 A;  2A69 F;  1D1B A;  3WG7 C;  1TR2 A;  1OCZ C;  4OIQ F;  4PK4 A;  4PFP A;  1J8Y F;  2O9X A;  4C7O A;  4Q5S F;  3L0I A;  2ZPA A;  3QMK A;  3PHF 2;  2J7P D;  2NUT B;  1TKN A;  2X51 A;  2HV7 A;  3PMR A;  3EH1 A;  3B0U X;  3JCU Q;  2Y69 C;  3EFO A;  2ZXP A;  2C03 A;  5CI8 A;  1Z3I X;  3T6J A;  1IZM A;  3KKB A;  2R7Q A;  3X2Q C;  1O87 A;  1M2O A;  2PF4 E;  4LER A;  5E33 A;  2W45 A;  4CS8 C;  2G62 A;  3EJN A;  1WGW A;  1OKK A;  2G3K A;  1LKX A;  2ZXW C;  3JSZ A;  4GEH A;  4JUR I;  1OCC C;  3EGX B;  4Q7C A;  4YWQ A;  2NUT A;  2IYL D;  5DS6 A;  4MQ9 F;  2PFD A;  1PD1 A;  3CQZ A;  2CNW A;  5KYY B;  2OCC C;  3JT1 A;  2FGY A;  3UR3 C;  1TWH A;  5BUO A;  3NG1 A;  3VYW A;  1J8M F;  4BJ5 A;  1PD0 A;  4AK9 A;  4K0D A;  3NDB B;  2IXN A;  2PX0 A;  3Q7G A;  3N24 A;  3RKO F;  1FMW A;  2R7O A;  5EGY A;  3ECS A;  5D91 A;  2WZL A;  3DAG A;  3POV A;  2KW3 C;  2CNW D;  3HLZ A;  3EGX A;  1Z63 A;  3DMD A;  4N06 A;  2B0J A;  2Q9B A;  2MYS A;  2L9J A;  1NG1 A;  3K7D A;  1MMD A;  1RJ9 B;  1Z23 A;  2W4B A;  2P6V A;  3H65 A;  1VK5 A;  3RYL A;  4BJ1 A;  4OIO F;  3Q6N A;  4ANJ A;  5E3C A;  3O39 A;  2DYR C;  2A1D D;  2WZF A;  1V54 C;  2IXP A;  2OG2 A;  3ASO C;  4OD4 A;  5DLJ A;  4KNW A;  3S28 A;  1SMY F;  5EHH A;  1FTS A;  4CSA C;  2DGJ A;  4CBE A;  4OD5 A;  1BR1 A;  5FCL A;  3EG9 A;  3EH2 A;  2R7R A;  3KH2 A;  1TWA A;  3T6B A;  3SNH A;  2P7V A;  4QI2 A;  3WOD F;  1JPN A;  3AQB A;  3SZR A;  4C3D A;  1FFT C;  3EQL F;  3VAY A;  4O6Y A;  4OIN F;  5DS5 A;  4CIH A;  3ZVR A;  1VMA A;  3W8H A;  4C7O B;  4NY3 A;  5KYN A;  2WVQ A;  4YT8 A;  3RH3 A;  4GYT A;  5T3T A;  3EZI A;  3M1C B;  2R7X A;  3Q7L A;  2ZXR A;  5DQT A;  3FDQ A;  4HFF B;  2EIK C;  1VOM A;  2KQ9 A;  1Z6A A;  3I5Q A;  4O6N A;  4E7Z A;  4G7O F;  4F4B A;  2J9V A;  4DBR A;  3I4U A;  4W8K A;  1M2V A;  2Q9C A;  4G0H A;  3AG3 C;  2MWQ A;  4C3B A;  3E70 C;  3K66 A;  2PP4 A;  4EBB A;  1LS1 A;  3NRH A;  2QY9 A;  1OCR C;  2EIL C;  2J46 A;  4O6M A;  3X1O A;  4BG0 A;  3KMI A;  2XSE A;  3EHN A;  2R7W A;  3TD7 A;  5HSW A;  1D1C A;  1ZU4 A;  4DOZ A;  2R7U A;  1V55 C;  4AE4 B;  2I8B A;  1QZX A;  2CDQ A;  3SEO A;  3K6B A;  1SZI A;  3ZG1 A;  2Y39 A;  2V3C C;  3N2Z B;  3ZC4 A;  4CS9 A;  3IEE A;  1NZE A;  2Y3G A;  4C3E A;  2NUP A;  5KYW A;  1MNE A;  4U5B E;  2VB6 A;  3K1H A;  3OA1 A;  3S27 A;  2D5R B;  4AE4 A;  2E87 A;  4JCH A;  3AG1 C;  1ZHW A;  3SP1 A;  3DZA A;  3MX3 A;  2G3V A;  2PX3 A;  2R7S A;  3RIP A;  3LAY A;  2Q9A A;  4LAC B;  1IW7 F;  2IXO A;  1D1A A;  4BJ6 C;  2YEV A;  4PJM A;  1PCX A;  1NU7 D;  1ZYR F;  2FFH A;  4CS8 A;  3EG9 B;  4U5E E;  2A6E F;  5E2Q A;  4OIR F;  3MLG A;  2GFH A;  3ZIB A;  4XTK A;  3NYL A;  3DJU B;  5KYU A;  3ABK C;  5DQZ A;  1FFH A;  1MMG A;  1JPJ A;  3CSK A;  2YZS A;  2J9W A;  3LLI A;  4QDL A;  2BE5 F;  3JYH A;  3K33 A;  2H7V C;  4DVZ A;  2XL4 A;  3FAJ A;  2WVO A;  1ST6 A;  1KU2 A;  1TWC A;  3B0V C;  5B3S C;  3CZ6 A;  5F5H A;  5B1B C;  3UMI A;  3NKD A;  4XLP F;  4PJL A;  4A2N B;  4YT5 A;  4ZLD A;  1M2V B;  2XRH A;  3HTK C;  5DS4 A;  3S0X A;  2KNH A;  4RBN A;  4LLC A;  4BEJ A;  5L3V A;  3FVY A;  3AQC A;  3EHM A;  1N1C A;  2HV6 A;  4U5D E;  2Z15 A;  4I1M A;  4KBL A;  3KL4 A;  3V7O A;  3ASN C;  3UNG C;  2QTV A;  4O7G A;  4O79 A;  5T1D B;  4IWB A;  1O5H A;  4EWC A;  3K1I C;  4J32 B;  2WB7 A;  3LLK A;  4PJJ A;  4MND A;  4B6I A;  4CS7 A;  4YT2 A;  3RFY A;  4JZA A;  2EIM C;  2WL8 A;  2KGO A;  4RD9 A;  3Q6M A;  4CSA A;  5KYX B;  4PJN A;  3DM9 B;  3T4R A;  2NUP B;  5KYW B;  4YN0 B;  3EGD B;  2W4M A;  4YT4 A;  2H7O A;  1LVK A;  3LS1 A;  4PFO A;  3NYJ A;  4WJ0 A;  2A6H F;  3O6X A;  2Y3B A;  1M56 C;  5E3A A;  4U5G A;  4OIP F;  4BJ5 C;  4Q4Z F;  3NKE A;  3DXJ F;  2VAS A;  3LNR A;  1QLE C;  4JVS A;  4I3M A;  1D0X A;  1G8X A;  5KYX A;  4K7B A;  2CGE A;  2EIJ C;  4I44 A;  3QZC A;  3EGD A;  4J30 B;  1W2W A;  1Z5Z A;  2Q3T A;  5T3W A;  3HJC A;  4HFK B;  2IXM A;  4I1O B;  5KYU B;  2IOQ A;  2JD3 A;  3I5P A;  2ZXO A;  2J0W A;  2EIN C;  3OWT A;  3LEV A;  4XLN F;  4IAO A;  3AG4 C;  3FHD A;  4DBQ A;  2J0X A;  3DJN B;  1FMV A;  4G7Z F;  1SF8 A;  4YJW A;  2A68 F;  2NG1 A;  5IY5 C;  2XXA B;  3W2W A;  1OKK D;  1ZU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...