4C3DA

Hrsv m2-1, p422 crystal form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
165
Chain Sequence
LGSMSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDKSLDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX M2-1
publication title Crystal Structure of the Essential Transcription Antiterminator M2-1 Protein of Human Respiratory Syncytial Virus and Implications of its Phosphorylation.
pubmed doi rcsb
source organism Human respiratory syncytial virus
molecule tags Viral protein
total genus 59
structure length 165
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06436 Pneumovirus_M2 Pneumovirus matrix protein 2 (M2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4c3dA00
4CS7A 2L9JA 4CSAA 4CS9A 4C3EA 4CS8A 4C3BA 4CSAC 4C3DA 4CS9C 4CS8C
chains in the Genus database with same CATH superfamily
4J7TA 1NLXA 3LJBA 1I4YA 1Q0MA 2QLAA 1VLSA 3ASOC 3GEEA 3IQ5A 3LAYA 2KW3C 1GM5A 4N6HA 1G5ZA 3HJCA 1OKKA 4FX5A 5A6BA 4JC7A 2XSEA 3ZQYA 1C03A 2R7OA 2EILC 2NPUA 4JEAA 2A0UA 1E2XA 2JX0A 3J06A 4QI2A 5DS4A 4NCQA 4AE4A 4JTDB 2VH3A 3RFYA 3T6JA 2IXNA 2HV6A 2JD3A 3B0PA 2HMQA 3GWNA 3HNKA 3NYJA 4MQ9F 2HSQA 1GS9A 3LS1A 1L3PA 1QZXA 2GFHA 5E2QA 5KYUA 2YVKA 3VYWA 2V3CC 2A6HF 3F46A 3X1OA 1FNTc 1OCRC 5B3SC 1XZPA 3K1HA 1RKEA 2CDQA 5DVWA 1T01A 2EIJC 4EWCA 3MLGA 2IOQA 2G3VA 1UG7A 3S29A 2GDCA 1HY5A 2PNOA 4HFKB 3WAQA 4DBQA 4D4XA 5HV9A 4AL1A 2XRHA 4BG0A 3N2ZB 2G62A 1ZHZA 3JSZA 3TQOA 3ZSUA 2H7VC 1ZU5A 3NYMA 4E0HA 1D0YA 4HFFB 1M2VB 1D1CA 4NC3A 2YLDA 4N4WA 2WVOA 5TJ5E 2MHRA 3JSEO 3LUTB 3AG4C 3B9QA 4J30B 1VTMP 2PFDA 1NZEA 2WZGA 2J9VA 2Y3DA 4U5CE 3T4RA 5B3IA 5K0IA 4K1OA 3FDQA 4NQFA 3LEOA 1LE2A 2A1DD 5KYYB 2ZD9A 1YZCA 3IQTA 3ZTMA 4QDLA 2L6GA 3EHMA 4XPYA 3WODF 3U5SA 3DD7A 2H8AA 1JMWA 3F47A 3K1IA 2A69F 2PX0A 4BJ5A 1FFHA 4EBJA 4YT4A 3BRJA 4OIRF 3K6BA 2Q7RA 4DBRA 2P1AA 1AEPA 5T3WA 3ZG1A 1RXQA 4EHPA 1MNEA 1PCXA 1JRAA 1LS1A 3L1MA 3EPVA 4OINF 2DB4A 4JCZA 4PJJA 1HMOA 4AK9A 1TQGA 2FAPB 4YT5A 1CGME 1O5HA 5EHHA 1CPQA 1LS4A 1ZHYA 1ZW3A 1U89A 1A0BA 1HE1A 4M63A 5A69A 3U0CA 1C02A 2HJ3A 2ZXPA 3EHNA 4ZLDA 1NSGB 2YRFA 2VCBA 3DXJF 3PCVA 4BEMJ 2XL8A 3KYJA 2J7PA 2XLEA 5KYWB 1VLTA 3IEEA 4LDKA 3WHNA 5L0CA 2XXAB 2ICWG 1T5OA 4ANJA 2LD6A 2ZXWC 5JUAA 5BUOA 3G50A 4CSAA 3US6A 3O10A 4CIPA 4EKWA 1I5NA 3C8GD 3OWTA 2YZSA 3R2PA 2EPKX 2JPUA 4YL3A 1Z3IX 4W8PA 1YLMA 3GORA 3EH1A 4NY3A 4CS9A 3N24A 4A4AA 2G3KA 1V4AA 2Y39A 5E3CA 3VAYA 4DVZA 4EIYA 1E86A 3M4CA 1E85A 4CX9A 1KTMA 2W4MA 3CAXA 5L3VA 2HFIA 2ASRA 2IXPA 3NG1A 5B1AC 3SNHA 4Q7CA 4WGYA 3H2UA 2WZFA 3RVYA 5KYXA 2R05A 2Q9CA 1FAPB 3NKDA 1NU7D 2B0HA 5T3TA 1DOVA 2B0JA 1OR2A 3A9CA 3DAFA 4BEJA 3S9OA 4JKVA 2IM8A 4KNWA 4XLNF 1BR2A 2BC5A 2BE5F 4L6RA 5KYNA 3RYLA 2D4UA 3TD7A 1OKKD 3O55A 2J45A 3CEXA 5A6BD 4CJGA 2EINC 4PFPA 3V5ZA 5L0DA 3GWLA 3O39A 2DGJA 1Z63A 1OW7A 1KU2A 2KGOA 2J9WA 1AUEA 3W8IA 3E9VA 1F1MA 4U9EA 4KI2A 5F28E 3RQEA 1OR3A 2XLHA 3TOLA 2M64A 3AG2C 256BA 2KJGA 4LLCA 1LI7A 1RCPA 4P6IC 3U8PA 4YL0A 4DOZA 2VCCA 4YJWA 3MBGA 2GAQA 3MFNA 4CDAA 4DJ9A 3JRMO 3N0TA 3T9OA 4GEHA 3ZTZA 3AOUA 1M2VA 4MTOA 3TJ5A 1C17M 1G4US 2KNHA 3Q7GA 4DXWA 3EZHA 2OKUA 3KYIA 1QPUA 1TFKB 1H6GA 1ZW2A 2Y3HA 4XPXA 4XEKA 1A7VA 2OJQA 5FZTA 1VK5A 4PJNA 1H7IA 2Q9BA 4K0DA 3SXKA 1WTYA 3TOMA 3JZ0A 3H65A 1ZHWA 3SZRA 1UFBA 5FCLA 3RH3A 1M6TA 1MMNA 1RJ9B 4IB4A 2YWAA 1IW7F 1PD1A 1V54C 2XLWA 4WABA 4LDRA 1YA7O 1R4TA 1SF8A 1R5ID 2W9YA 2R7RA 2LFFA 3U2LA 3NDBB 4AL0A 4XQ1A 1YZAA 2VCAA 1MQVA 3PMRA 5AC5A 3RKOF 4G7HF 3LLIA 2X51A 2YL3A 1S7ZA 4R32A 4MVOA 5COFA 3W4YA 3EFOA 4U5FE 2H7OA 3ASNC 4E0IA 2VB6A 2ETSA 3H2VA 2VASA 4ULWA 2OEVA 5COMA 1SYQA 4OIQF 4JZAA 5JLIA 2Q3TA 3AGUA 3LS0A 2NUPB 2O9XA 4Q4ZF 4MNDA 2WVNA 2R7WA 3X2QC 3C63A 5KYWA 4JTCB 1K40A 4G78A 1D0XA 2Y3BA 5CIVA 3OA1A 1WASA 1YYXA 3C8GB 3ZC4A 2XXAA 1LVKA 2RSEB 4AX2A 3C7JA 3S0XA 1ZYRF 2DYSC 3ZWIA 3V7OA 4EBKA 4BJTA 2FGYA 2OCCC 1QVXA 4J32B 2L81A 1CPRA 3GEHA 4KC9A 4MS2A 1MMGA 4O79A 2J7PD 4EBBA 4QI0A 3DE8A 3SP1A 3UGOA 3QVZA 2BL2A 2XS1A 1SZIA 3FAPB 2OJED 3U3BA 2IBFA 3CSKA 4GQHA 3U9MA 4BJ6C 4MW8A 3AG3C 3PHF2 4FESA 2UUIA 1S05A 3T6GB 5DQTA 5L0GA 4RD9A 1NG1A 2KSFA 4IRUA 3SYNA 1WN0A 1OW6A 3GM2A 2H7BA 3DE9A 5L0IA 1PD0A 3FXHA 1TFOB 1CGNA 1OXBA 2LSEA 2CYDA 3EJNA 1D0ZA 4W8KA 1I4ZA 2YL0A 1BDJB 1LM3B 1TR2A 2VC9A 4JVSA 4YN0B 2IXOA 4XTKA 3KPHA 4BPMA 1H9TA 2Z15A 1HMDA 3QW0A 4G0HA 2NSFA 4LLEA 1K04A 2UUHA 4E18A 4GYTA 4XWJA 3UGPA 3B29A 3EGXA 1WGWA 5DS5A 2NUTB 4AE4B 4OIPF 3FVYA 4JURI 2OG2A 2J9BA 3ECSA 3Q7LA 4U5EE 3W2VA 2AP3A 4NTBA 1V74B 1ZHTA 3B71A 4LDQA 3ZDLA 5KYUB 1GGQA 1ZVZA 2OQMA 4MVUA 2EPNA 3Q6MA 4MTFA 2M4EA 4I1MA 1NBBA 1RKEB 1YDIA 2RD9A 3ABMC 3GEIA 4HE8D 1O3UA 4JJFA 5E33A 1JR8A 3TULA 2FFHA 3SEOA 1PV3A 3DMDA 4EUKB 1Q0FA 1M2OA 3T6BA 4PFOA 3SXZA 3TJ6A 1OW8A 1SMYF 4CS7A 4CS8C 3NKEA 3DAGA 3M4BA 5D91A 2KYHA 4C3BA 1LI5A 1M57C 3EH2A 4PACA 2EPOA 4LERA 4ONSA 2OOCA 4MTGA 3E70C 1MNDA 2CCYA 1SR2A 1NFNA 2QUPA 2QY9A 4IWBA 3W2WA 3CZ6A 5CI8A 3HLZA 3K7DA 2EPMX 4JEBA 2KC3A 2L9JA 1VOMA 2C03A 1RJ9A 4JCHA 4O6YA 4PR9A 1HW2A 1QLEC 3OEOA 1T6QA 2XLVA 1A7DA 3ATPA 2J0XA 1Q0KA 1TWHA 4YK5A 3I4UA 1OXKA 1YVIA 4LACB 5D92A 5DLJA 4CBEA 2KK1A 1JAFA 2QTVA 3AGTA 4H4KC 3UMIA 5F5HA 1TKNA 2P7VA 1TWGA 3ZIBA 3O6XA 3I5PA 5EGYA 3HNJA 3EG9B 3AJMA 3G4ZA 4NTFA 3U8VA 3CQZA 1ORSC 4XEVA 1L7CA 1FR0A 1JPNA 2A0BA 2HS5A 4K7BA 4CJOA 1Y4CA 4ER9A 1OCCC 1TWCA 2HV7A 3IQ6A 1B68A 2XLOA 4N6CA 1LKXA 3DJUB 4U5HA 3M79A 2F22A 1LIHA 5A6KA 3HNIA 1BR4A 3C8GA 3K33A 5EK0A 2EIKC 4C3DA 3SXMA 1FFTC 1YAUO 2W4BA 2Y3GA 4MW3A 5L0HA 2I8BA 5JT4A 5KYYA 2CNWA 2PX3A 4N06A 4JW1A 1YA9A 2HJMA 3JYHA 3QTHA 3UMKA 4C7OB 1EKYA 2L7AA 2PBEA 5T1DB 3POVA 5AC4A 2R7QA 1EA8A 1WATA 5A6AA 4Z9HA 1VYIA 3VM6A 1ZZPA 2L6HA 1M56C 4U9DA 2P6VA 1W2WA 4Z9IA 4O6MA 3FAJA 4YWQA 1J8MF 1ZU4A 3NMIA 2AWYA 3RQGA 3FOPA 5BQHA 2J0WA 1XZQA 2AVKA 4PJLA 3L0IA 1MMAA 2ZPAA 1ZHXA 2YLGA 5DS6A 2I15A 4NTAA 3A11A 5KYXB 1BR1A 4PK4A 3K66A 3Q6NA 3GANA 3LLKA 2WB7A 1ORJA 3S84A 4BJ1A 1EQ1A 4E17A 4B6IA 3IPMO 4RDAA 4IAOA 3G4XA 1JPJA 2YLIA 4O7GA 3VRCA 3ZQVA 2J9UA 4U5GA 3NMJA 1V55C 1VB5A 2QE9A 1FMWA 4IARA 2YL7A 2NUTA 2TMVP 2J8WA 4JJGA 2YL1A 4IGGA 4P9TA 2E87A 4A2NB 5HSWA 4D4NA 2C04A 1T6IA 3AQCA 2HKVA 3L8JA 4XPWA 3U3FA 3LESA 5JP7A 4OIOF 3B0VC 1AVOB 2Y69C 2A68F 1DOWA 4OD5A 4RBNA 2EIMC 4KBLA 4CIHA 2PP4A 3ABLC 5L0JA 2OU6A 3JTLO 1BBHA 1N1CA 2NG1A 3M15A 3NYLA 3DZAA 2PF4E 5CI9A 3EGDB 2CW0F 1IZMA 1HW1A 3ITFA 3L8IA 3C8ZA 3SXYA 3GM1A 3K1IC 1FTSA 2HMZA 4BJ5C 4G7ZF 2Q00A 4YL1A 1KNYA 4JTAB 3UNGC 1G8XA 4O6NA 3KH2A 5IY5C 3FMSA 1APCA 4YT2A 3WG7C 1HE9A 4BJ6A 1CGOA 3HKKA 1U6HA 3AG1C 4HEAJ 5COGA 3KKBA 2HSBA 1OQCA 5JS5A 2CGEA 5B1BC 1E84A 4J7YA 1D1AA 3I5QA 4I3MA 3ABKC 3PDMP 1QSPA 1FMVA 2YQYA 4DRHB 1LPEA 5F5FA 4MVZA 3GODA 3HNLA 3EG9A 1EI7A 1A41A 2XLMA 3IQCA 4I1OB 3L34A 3KL4A 4CDVA 4KNVA 1RKCA 2NSGA 4X0RA 1QQ3A 4P9FA 1Z5ZA 1NFOA 4U5BE 1GQAA 2W45A 3EFOB 4CSAC 1Z23A 2DI3A 3MX3A 4JE9A 3UR3C 2D5RB 2P61A 1D1BA 1T9KA 2GWWA 3NMKA 4FWVA 4ULVA 5GPGB 3RQFA 3JRTA 3QZCA 4F4BA 2LQGA 2OEXA 3EQLF 4OD4A 4PJMA 4Z9JA 3TK0A 4CS9C 3QMKA 4MVRA 1NU9C 4MVQA 3S28A 1OCOC 1U0BB 4JRZA 1ORYA 2GA0A 2XS8A 3IHUA 3V5YA 3M1CB 1RMVA 4CDYA 1LE4A 4WGZA 2LK4A 2R25A 4E7SA 4UDVA 5BQIA 2R7VA 1XWJA 1YJGA 4C7OA 2AWCA 2IXMA 3DJNB 3EZIA 4C3EA 5BQGA 4CS8A 3VF0A 1H9GA 3U2MA 1Y6DA 3JT1A 3B0UX 2Q4FA 1Z7Qc 1Q0GA 3NRHA 4IJJA 2R7SA 1Q0DA 1WWPA 2CNWD 2J46A 2V26A 2KQ9A 2IYLD 1A7EA 2YKZA 3ZVRA 5JVEA 1TWAA 2LCHA 1OCZC 1Z6AA 2LP4A 2XL6A 2XLDA 1T6UA 3QW1A 2YEVA 2XL4A 2R9RB 5A6JA 1VYKA 1QKRA 3LNMB 3UMHA 3R7CA 3QVYA 4DRIB 5JSLA 1ST6A 3DWWA 3MYFA 3RVZA 2AU5A 3JYYA 2P0NA 5E3AA 2R03A 4YT8A 2L6FA 4G7OF 3S90A 4FAPB 2NUPA 1JOGA 3DKAA 4Q5SF 3C62A 3MYIA 4DVYP 1G4WR 2XM4A 2DYRC 2WL8A 3AQBA 4JIOA 1J8YF 1MMDA 2Q9AA 2R02A 2R7XA 1WOLA 1O87A 2LFDA 5AGFA 1YYJA 4DRJB 3V5XA 5L0FA 1E83A 3EGXB 4H54A 3U9JA 2R7UA 2ZXOA 4MVSA 4XEFA 2MYSA 1VMAA 2MWQA 2A6EF 3FHDA 2X0CA 1YARO 4IAQA 1K05A 3LNRA 2HUJA 3GM3A 3RIPA 3JCUQ 5JRAA 4WJ0A 4XLPF 2EPLX 2QNLA 3FOOA 4ZLCA 2R7TA 2LIGA 2WVQA 2XM0A 3KMIA 3S27A 2HZ8A 3HTKC 2WZLA 3W8HA 3C18A 3EGDA 4I44A 1BZ4A 3DM5A 3DM9B 5DQZA 4MVMA 3DI5A 5L3QA 3RF3A 4E7ZA 3BEHA 2YHSA 3LEVA 4U5DE 2ZXRA 3RW0A
chains in the Genus database with same CATH topology
3LJBA 3ASOC 3LAYA 2KW3C 3HJCA 1OKKA 4FX5A 2XSEA 2R7OA 2EILC 4QI2A 5DS4A 4AE4A 3T6JA 2VH3A 3RFYA 2IXNA 2HV6A 2JD3A 3B0PA 3NYJA 4Q4ZF 4MQ9F 3LS1A 5KYUA 3VYWA 5EGYA 1QZXA 2GFHA 5E2QA 2V3CC 2A6HF 3F46A 3X1OA 1OCRC 5B3SC 3K1HA 2CDQA 5DVWA 4EWCA 2EIJC 3MLGA 2IOQA 2G3VA 3S29A 4HFKB 2XRHA 4BG0A 3N2ZB 2G62A 1ZHZA 3JSZA 3ZSUA 2H7VC 1ZU5A 3NYMA 1D0YA 4HFFB 1M2VB 1D1CA 2WVOA 3AG4C 3B9QA 4J30B 2PFDA 1NZEA 2WZGA 2J9VA 2Y3DA 4U5CE 3T4RA 3FDQA 5KYYB 2A1DD 4QDLA 3EHMA 3WODF 3DD7A 3F47A 4BJ5A 2A69F 2PX0A 4YT4A 1FFHA 4OIRF 3K6BA 4DBRA 5T3WA 3ZG1A 1MNEA 1PCXA 1LS1A 4OINF 3EPVA 4PJJA 4AK9A 4YT5A 1O5HA 5EHHA 1ZHYA 4M63A 2ZXPA 3EHNA 4ZLDA 3DXJF 2J7PA 5KYWB 3IEEA 2XXAB 4ANJA 2ZXWC 5BUOA 4CSAA 3OWTA 2YZSA 1Z3IX 3EH1A 4NY3A 4CS9A 3N24A 2G3KA 2Y39A 5E3CA 3VAYA 4DVZA 2W4MA 5L3VA 2IXPA 3NG1A 5B1AC 3SNHA 4Q7CA 2WZFA 5KYXA 2Q9CA 3NKDA 1NU7D 5T3TA 2B0JA 3DAFA 4BEJA 4XLNF 4KNWA 1BR2A 2BE5F 5KYNA 3RYLA 3TD7A 1OKKD 2J45A 2EINC 4PFPA 3O39A 2DGJA 1Z63A 1KU2A 2KGOA 2J9WA 3W8IA 3E9VA 4KI2A 3AG2C 2KJGA 4LLCA 4P6IC 4DOZA 4YJWA 3N0TA 4GEHA 1M2VA 3Q7GA 2KNHA 3EZHA 2Y3HA 1VK5A 4PJNA 2Q9BA 4K0DA 3H65A 1ZHWA 3SZRA 5FCLA 3RH3A 1MMNA 1RJ9B 1IW7F 1PD1A 1V54C 1SF8A 2W9YA 2R7RA 3NDBB 3PMRA 3RKOF 4G7HF 3LLIA 2X51A 1S7ZA 3EFOA 4U5FE 2H7OA 3ASNC 2VB6A 2VASA 4ULWA 4OIQF 4JZAA 2Q3TA 3LS0A 2R7WA 2NUPB 2O9XA 4MNDA 2WVNA 3X2QC 5KYWA 1D0XA 2Y3BA 3OA1A 3ZC4A 2XXAA 1LVKA 4AX2A 3S0XA 1ZYRF 2DYSC 3V7OA 4BJTA 2FGYA 2OCCC 4J32B 2L81A 4KC9A 4O79A 1MMGA 4EBBA 2J7PD 4QI0A 3SP1A 3UGOA 1SZIA 3CSKA 4BJ6C 3AG3C 3PHF2 4FESA 5DQTA 4RD9A 1NG1A 4IRUA 3SYNA 2H7BA 1PD0A 2LSEA 3EJNA 1D0ZA 4W8KA 1TR2A 4JVSA 4YN0B 2IXOA 4XTKA 2Z15A 4G0HA 4LLEA 4GYTA 4XWJA 3UGPA 3EGXA 1WGWA 5DS5A 2NUTB 4AE4B 4OIPF 3FVYA 4JURI 2OG2A 3ECSA 3Q7LA 4U5EE 3W2VA 5KYUB 1ZHTA 3Q6MA 2M4EA 4I1MA 4JJFA 4HE8D 3ABMC 5E33A 2FFHA 3SEOA 3DMDA 3T6BA 1M2OA 4CS8C 4PFOA 1SMYF 4CS7A 3NKEA 3DAGA 5D91A 4C3BA 1M57C 3EH2A 4LERA 3E70C 1MNDA 2QY9A 4IWBA 3W2WA 3CZ6A 5CI8A 3HLZA 3K7DA 2L9JA 1VOMA 2C03A 1RJ9A 4JCHA 4O6YA 1QLEC 3OEOA 4DBQA 2J0XA 1TWHA 3I4UA 4LACB 5D92A 5DLJA 4CBEA 2QTVA 4H4KC 3UMIA 5F5HA 1TKNA 2P7VA 1TWGA 3ZIBA 3O6XA 3I5PA 3EG9B 3CQZA 1JPNA 4K7BA 1OCCC 1TWCA 2HV7A 4U5HA 1LKXA 3DJUB 1BR4A 3K33A 2EIKC 4C3DA 1FFTC 2W4BA 2Y3GA 2I8BA 5KYYA 2CNWA 2PX3A 4N06A 4JW1A 4C7OB 3JYHA 3UMKA 5T1DB 3POVA 2R7QA 1VYIA 1M56C 2P6VA 1W2WA 4O6MA 3FAJA 4YWQA 1J8MF 1ZU4A 2J0WA 4PJLA 3L0IA 1MMAA 2ZPAA 1ZHXA 5DS6A 5KYXB 1BR1A 4PK4A 3K66A 3Q6NA 3GANA 3LLKA 2WB7A 4BJ1A 4B6IA 4RDAA 4IAOA 1JPJA 4O7GA 2J9UA 4U5GA 1V55C 2NUTA 1FMWA 4JJGA 4A2NB 2E87A 5HSWA 2C04A 3AQCA 3LESA 4OIOF 3B0VC 4CIHA 2Y69C 2A68F 4OD5A 4RBNA 2EIMC 4KBLA 2PP4A 3ABLC 2NG1A 1N1CA 3NYLA 3DZAA 2PF4E 5CI9A 3EGDB 2CW0F 1IZMA 3ITFA 3K1IC 1FTSA 4BJ5C 4G7ZF 3UNGC 1G8XA 4O6NA 3KH2A 5IY5C 4YT2A 3WG7C 4BJ6A 3AG1C 4HEAJ 3KKBA 2CGEA 5B1BC 1D1AA 3I5QA 4I3MA 3ABKC 1FMVA 5F5FA 3GODA 3EG9A 4I1OB 3L34A 3KL4A 4KNVA 4X0RA 1Z5ZA 4U5BE 2W45A 3EFOB 4CSAC 1Z23A 3MX3A 3UR3C 2D5RB 1D1BA 4FWVA 3JRTA 3QZCA 4F4BA 3EQLF 4OD4A 4PJMA 4CS9C 3QMKA 1NU9C 3S28A 1OCOC 3M1CB 4E7SA 2R7VA 4C7OA 2IXMA 3DJNB 3EZIA 4C3EA 4CS8A 3JT1A 3B0UX 3NRHA 4IJJA 2R7SA 2CNWD 2J46A 2V26A 2KQ9A 2IYLD 3ZVRA 1TWAA 1OCZC 1Z6AA 2YEVA 2XL4A 1VYKA 3UMHA 1ST6A 4YT8A 5E3AA 4G7OF 2NUPA 4Q5SF 4DVYP 2DYRC 2WL8A 3AQBA 1J8YF 1MMDA 2Q9AA 2R7XA 1O87A 3EGXB 2R7UA 2ZXOA 2MYSA 1VMAA 2MWQA 2A6EF 3FHDA 3LNRA 3RIPA 3JCUQ 4XLPF 4WJ0A 4ZLCA 2R7TA 2WVQA 3KMIA 3S27A 3HTKC 2WZLA 3W8HA 3EGDA 4I44A 3DM5A 3DM9B 5DQZA 5L3QA 4E7ZA 2YHSA 3LEVA 4U5DE 2ZXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CS7 A;  2L9J A;  4CSA A;  4CS9 A;  4C3E A;  4CS8 A;  4C3B A;  4CSA C;  4C3D A;  4CS9 C;  4CS8 C; 
#chains in the Genus database with same CATH topology
 4J7T A;  1NLX A;  3LJB A;  1I4Y A;  1Q0M A;  2QLA A;  1VLS A;  3ASO C;  3GEE A;  3IQ5 A;  3LAY A;  2KW3 C;  1GM5 A;  4N6H A;  1G5Z A;  3HJC A;  1OKK A;  4FX5 A;  5A6B A;  4JC7 A;  2XSE A;  3ZQY A;  1C03 A;  2R7O A;  2EIL C;  2NPU A;  4JEA A;  2A0U A;  1E2X A;  2JX0 A;  3J06 A;  4QI2 A;  5DS4 A;  4NCQ A;  4AE4 A;  4JTD B;  2VH3 A;  3RFY A;  3T6J A;  2IXN A;  2HV6 A;  2JD3 A;  3B0P A;  2HMQ A;  3GWN A;  3HNK A;  3NYJ A;  4MQ9 F;  2HSQ A;  1GS9 A;  3LS1 A;  1L3P A;  1QZX A;  2GFH A;  5E2Q A;  5KYU A;  2YVK A;  3VYW A;  2V3C C;  2A6H F;  3F46 A;  3X1O A;  1FNT c;  1OCR C;  5B3S C;  1XZP A;  3K1H A;  1RKE A;  2CDQ A;  5DVW A;  1T01 A;  2EIJ C;  4EWC A;  3MLG A;  2IOQ A;  2G3V A;  1UG7 A;  3S29 A;  2GDC A;  1HY5 A;  2PNO A;  4HFK B;  3WAQ A;  4DBQ A;  4D4X A;  5HV9 A;  4AL1 A;  2XRH A;  4BG0 A;  3N2Z B;  2G62 A;  1ZHZ A;  3JSZ A;  3TQO A;  3ZSU A;  2H7V C;  1ZU5 A;  3NYM A;  4E0H A;  1D0Y A;  4HFF B;  1M2V B;  1D1C A;  4NC3 A;  2YLD A;  4N4W A;  2WVO A;  5TJ5 E;  2MHR A;  3JSE O;  3LUT B;  3AG4 C;  3B9Q A;  4J30 B;  1VTM P;  2PFD A;  1NZE A;  2WZG A;  2J9V A;  2Y3D A;  4U5C E;  3T4R A;  5B3I A;  5K0I A;  4K1O A;  3FDQ A;  4NQF A;  3LEO A;  1LE2 A;  2A1D D;  5KYY B;  2ZD9 A;  1YZC A;  3IQT A;  3ZTM A;  4QDL A;  2L6G A;  3EHM A;  4XPY A;  3WOD F;  3U5S A;  3DD7 A;  2H8A A;  1JMW A;  3F47 A;  3K1I A;  2A69 F;  2PX0 A;  4BJ5 A;  1FFH A;  4EBJ A;  4YT4 A;  3BRJ A;  4OIR F;  3K6B A;  2Q7R A;  4DBR A;  2P1A A;  1AEP A;  5T3W A;  3ZG1 A;  1RXQ A;  4EHP A;  1MNE A;  1PCX A;  1JRA A;  1LS1 A;  3L1M A;  3EPV A;  4OIN F;  2DB4 A;  4JCZ A;  4PJJ A;  1HMO A;  4AK9 A;  1TQG A;  2FAP B;  4YT5 A;  1CGM E;  1O5H A;  5EHH A;  1CPQ A;  1LS4 A;  1ZHY A;  1ZW3 A;  1U89 A;  1A0B A;  1HE1 A;  4M63 A;  5A69 A;  3U0C A;  1C02 A;  2HJ3 A;  2ZXP A;  3EHN A;  4ZLD A;  1NSG B;  2YRF A;  2VCB A;  3DXJ F;  3PCV A;  4BEM J;  2XL8 A;  3KYJ A;  2J7P A;  2XLE A;  5KYW B;  1VLT A;  3IEE A;  4LDK A;  3WHN A;  5L0C A;  2XXA B;  2ICW G;  1T5O A;  4ANJ A;  2LD6 A;  2ZXW C;  5JUA A;  5BUO A;  3G50 A;  4CSA A;  3US6 A;  3O10 A;  4CIP A;  4EKW A;  1I5N A;  3C8G D;  3OWT A;  2YZS A;  3R2P A;  2EPK X;  2JPU A;  4YL3 A;  1Z3I X;  4W8P A;  1YLM A;  3GOR A;  3EH1 A;  4NY3 A;  4CS9 A;  3N24 A;  4A4A A;  2G3K A;  1V4A A;  2Y39 A;  5E3C A;  3VAY A;  4DVZ A;  4EIY A;  1E86 A;  3M4C A;  1E85 A;  4CX9 A;  1KTM A;  2W4M A;  3CAX A;  5L3V A;  2HFI A;  2ASR A;  2IXP A;  3NG1 A;  5B1A C;  3SNH A;  4Q7C A;  4WGY A;  3H2U A;  2WZF A;  3RVY A;  5KYX A;  2R05 A;  2Q9C A;  1FAP B;  3NKD A;  1NU7 D;  2B0H A;  5T3T A;  1DOV A;  2B0J A;  1OR2 A;  3A9C A;  3DAF A;  4BEJ A;  3S9O A;  4JKV A;  2IM8 A;  4KNW A;  4XLN F;  1BR2 A;  2BC5 A;  2BE5 F;  4L6R A;  5KYN A;  3RYL A;  2D4U A;  3TD7 A;  1OKK D;  3O55 A;  2J45 A;  3CEX A;  5A6B D;  4CJG A;  2EIN C;  4PFP A;  3V5Z A;  5L0D A;  3GWL A;  3O39 A;  2DGJ A;  1Z63 A;  1OW7 A;  1KU2 A;  2KGO A;  2J9W A;  1AUE A;  3W8I A;  3E9V A;  1F1M A;  4U9E A;  4KI2 A;  5F28 E;  3RQE A;  1OR3 A;  2XLH A;  3TOL A;  2M64 A;  3AG2 C;  256B A;  2KJG A;  4LLC A;  1LI7 A;  1RCP A;  4P6I C;  3U8P A;  4YL0 A;  4DOZ A;  2VCC A;  4YJW A;  3MBG A;  2GAQ A;  3MFN A;  4CDA A;  4DJ9 A;  3JRM O;  3N0T A;  3T9O A;  4GEH A;  3ZTZ A;  3AOU A;  1M2V A;  4MTO A;  3TJ5 A;  1C17 M;  1G4U S;  2KNH A;  3Q7G A;  4DXW A;  3EZH A;  2OKU A;  3KYI A;  1QPU A;  1TFK B;  1H6G A;  1ZW2 A;  2Y3H A;  4XPX A;  4XEK A;  1A7V A;  2OJQ A;  5FZT A;  1VK5 A;  4PJN A;  1H7I A;  2Q9B A;  4K0D A;  3SXK A;  1WTY A;  3TOM A;  3JZ0 A;  3H65 A;  1ZHW A;  3SZR A;  1UFB A;  5FCL A;  3RH3 A;  1M6T A;  1MMN A;  1RJ9 B;  4IB4 A;  2YWA A;  1IW7 F;  1PD1 A;  1V54 C;  2XLW A;  4WAB A;  4LDR A;  1YA7 O;  1R4T A;  1SF8 A;  1R5I D;  2W9Y A;  2R7R A;  2LFF A;  3U2L A;  3NDB B;  4AL0 A;  4XQ1 A;  1YZA A;  2VCA A;  1MQV A;  3PMR A;  5AC5 A;  3RKO F;  4G7H F;  3LLI A;  2X51 A;  2YL3 A;  1S7Z A;  4R32 A;  4MVO A;  5COF A;  3W4Y A;  3EFO A;  4U5F E;  2H7O A;  3ASN C;  4E0I A;  2VB6 A;  2ETS A;  3H2V A;  2VAS A;  4ULW A;  2OEV A;  5COM A;  1SYQ A;  4OIQ F;  4JZA A;  5JLI A;  2Q3T A;  3AGU A;  3LS0 A;  2NUP B;  2O9X A;  4Q4Z F;  4MND A;  2WVN A;  2R7W A;  3X2Q C;  3C63 A;  5KYW A;  4JTC B;  1K40 A;  4G78 A;  1D0X A;  2Y3B A;  5CIV A;  3OA1 A;  1WAS A;  1YYX A;  3C8G B;  3ZC4 A;  2XXA A;  1LVK A;  2RSE B;  4AX2 A;  3C7J A;  3S0X A;  1ZYR F;  2DYS C;  3ZWI A;  3V7O A;  4EBK A;  4BJT A;  2FGY A;  2OCC C;  1QVX A;  4J32 B;  2L81 A;  1CPR A;  3GEH A;  4KC9 A;  4MS2 A;  1MMG A;  4O79 A;  2J7P D;  4EBB A;  4QI0 A;  3DE8 A;  3SP1 A;  3UGO A;  3QVZ A;  2BL2 A;  2XS1 A;  1SZI A;  3FAP B;  2OJE D;  3U3B A;  2IBF A;  3CSK A;  4GQH A;  3U9M A;  4BJ6 C;  4MW8 A;  3AG3 C;  3PHF 2;  4FES A;  2UUI A;  1S05 A;  3T6G B;  5DQT A;  5L0G A;  4RD9 A;  1NG1 A;  2KSF A;  4IRU A;  3SYN A;  1WN0 A;  1OW6 A;  3GM2 A;  2H7B A;  3DE9 A;  5L0I A;  1PD0 A;  3FXH A;  1TFO B;  1CGN A;  1OXB A;  2LSE A;  2CYD A;  3EJN A;  1D0Z A;  4W8K A;  1I4Z A;  2YL0 A;  1BDJ B;  1LM3 B;  1TR2 A;  2VC9 A;  4JVS A;  4YN0 B;  2IXO A;  4XTK A;  3KPH A;  4BPM A;  1H9T A;  2Z15 A;  1HMD A;  3QW0 A;  4G0H A;  2NSF A;  4LLE A;  1K04 A;  2UUH A;  4E18 A;  4GYT A;  4XWJ A;  3UGP A;  3B29 A;  3EGX A;  1WGW A;  5DS5 A;  2NUT B;  4AE4 B;  4OIP F;  3FVY A;  4JUR I;  2OG2 A;  2J9B A;  3ECS A;  3Q7L A;  4U5E E;  3W2V A;  2AP3 A;  4NTB A;  1V74 B;  1ZHT A;  3B71 A;  4LDQ A;  3ZDL A;  5KYU B;  1GGQ A;  1ZVZ A;  2OQM A;  4MVU A;  2EPN A;  3Q6M A;  4MTF A;  2M4E A;  4I1M A;  1NBB A;  1RKE B;  1YDI A;  2RD9 A;  3ABM C;  3GEI A;  4HE8 D;  1O3U A;  4JJF A;  5E33 A;  1JR8 A;  3TUL A;  2FFH A;  3SEO A;  1PV3 A;  3DMD A;  4EUK B;  1Q0F A;  1M2O A;  3T6B A;  4PFO A;  3SXZ A;  3TJ6 A;  1OW8 A;  1SMY F;  4CS7 A;  4CS8 C;  3NKE A;  3DAG A;  3M4B A;  5D91 A;  2KYH A;  4C3B A;  1LI5 A;  1M57 C;  3EH2 A;  4PAC A;  2EPO A;  4LER A;  4ONS A;  2OOC A;  4MTG A;  3E70 C;  1MND A;  2CCY A;  1SR2 A;  1NFN A;  2QUP A;  2QY9 A;  4IWB A;  3W2W A;  3CZ6 A;  5CI8 A;  3HLZ A;  3K7D A;  2EPM X;  4JEB A;  2KC3 A;  2L9J A;  1VOM A;  2C03 A;  1RJ9 A;  4JCH A;  4O6Y A;  4PR9 A;  1HW2 A;  1QLE C;  3OEO A;  1T6Q A;  2XLV A;  1A7D A;  3ATP A;  2J0X A;  1Q0K A;  1TWH A;  4YK5 A;  3I4U A;  1OXK A;  1YVI A;  4LAC B;  5D92 A;  5DLJ A;  4CBE A;  2KK1 A;  1JAF A;  2QTV A;  3AGT A;  4H4K C;  3UMI A;  5F5H A;  1TKN A;  2P7V A;  1TWG A;  3ZIB A;  3O6X A;  3I5P A;  5EGY A;  3HNJ A;  3EG9 B;  3AJM A;  3G4Z A;  4NTF A;  3U8V A;  3CQZ A;  1ORS C;  4XEV A;  1L7C A;  1FR0 A;  1JPN A;  2A0B A;  2HS5 A;  4K7B A;  4CJO A;  1Y4C A;  4ER9 A;  1OCC C;  1TWC A;  2HV7 A;  3IQ6 A;  1B68 A;  2XLO A;  4N6C A;  1LKX A;  3DJU B;  4U5H A;  3M79 A;  2F22 A;  1LIH A;  5A6K A;  3HNI A;  1BR4 A;  3C8G A;  3K33 A;  5EK0 A;  2EIK C;  4C3D A;  3SXM A;  1FFT C;  1YAU O;  2W4B A;  2Y3G A;  4MW3 A;  5L0H A;  2I8B A;  5JT4 A;  5KYY A;  2CNW A;  2PX3 A;  4N06 A;  4JW1 A;  1YA9 A;  2HJM A;  3JYH A;  3QTH A;  3UMK A;  4C7O B;  1EKY A;  2L7A A;  2PBE A;  5T1D B;  3POV A;  5AC4 A;  2R7Q A;  1EA8 A;  1WAT A;  5A6A A;  4Z9H A;  1VYI A;  3VM6 A;  1ZZP A;  2L6H A;  1M56 C;  4U9D A;  2P6V A;  1W2W A;  4Z9I A;  4O6M A;  3FAJ A;  4YWQ A;  1J8M F;  1ZU4 A;  3NMI A;  2AWY A;  3RQG A;  3FOP A;  5BQH A;  2J0W A;  1XZQ A;  2AVK A;  4PJL A;  3L0I A;  1MMA A;  2ZPA A;  1ZHX A;  2YLG A;  5DS6 A;  2I15 A;  4NTA A;  3A11 A;  5KYX B;  1BR1 A;  4PK4 A;  3K66 A;  3Q6N A;  3GAN A;  3LLK A;  2WB7 A;  1ORJ A;  3S84 A;  4BJ1 A;  1EQ1 A;  4E17 A;  4B6I A;  3IPM O;  4RDA A;  4IAO A;  3G4X A;  1JPJ A;  2YLI A;  4O7G A;  3VRC A;  3ZQV A;  2J9U A;  4U5G A;  3NMJ A;  1V55 C;  1VB5 A;  2QE9 A;  1FMW A;  4IAR A;  2YL7 A;  2NUT A;  2TMV P;  2J8W A;  4JJG A;  2YL1 A;  4IGG A;  4P9T A;  2E87 A;  4A2N B;  5HSW A;  4D4N A;  2C04 A;  1T6I A;  3AQC A;  2HKV A;  3L8J A;  4XPW A;  3U3F A;  3LES A;  5JP7 A;  4OIO F;  3B0V C;  1AVO B;  2Y69 C;  2A68 F;  1DOW A;  4OD5 A;  4RBN A;  2EIM C;  4KBL A;  4CIH A;  2PP4 A;  3ABL C;  5L0J A;  2OU6 A;  3JTL O;  1BBH A;  1N1C A;  2NG1 A;  3M15 A;  3NYL A;  3DZA A;  2PF4 E;  5CI9 A;  3EGD B;  2CW0 F;  1IZM A;  1HW1 A;  3ITF A;  3L8I A;  3C8Z A;  3SXY A;  3GM1 A;  3K1I C;  1FTS A;  2HMZ A;  4BJ5 C;  4G7Z F;  2Q00 A;  4YL1 A;  1KNY A;  4JTA B;  3UNG C;  1G8X A;  4O6N A;  3KH2 A;  5IY5 C;  3FMS A;  1APC A;  4YT2 A;  3WG7 C;  1HE9 A;  4BJ6 A;  1CGO A;  3HKK A;  1U6H A;  3AG1 C;  4HEA J;  5COG A;  3KKB A;  2HSB A;  1OQC A;  5JS5 A;  2CGE A;  5B1B C;  1E84 A;  4J7Y A;  1D1A A;  3I5Q A;  4I3M A;  3ABK C;  3PDM P;  1QSP A;  1FMV A;  2YQY A;  4DRH B;  1LPE A;  5F5F A;  4MVZ A;  3GOD A;  3HNL A;  3EG9 A;  1EI7 A;  1A41 A;  2XLM A;  3IQC A;  4I1O B;  3L34 A;  3KL4 A;  4CDV A;  4KNV A;  1RKC A;  2NSG A;  4X0R A;  1QQ3 A;  4P9F A;  1Z5Z A;  1NFO A;  4U5B E;  1GQA A;  2W45 A;  3EFO B;  4CSA C;  1Z23 A;  2DI3 A;  3MX3 A;  4JE9 A;  3UR3 C;  2D5R B;  2P61 A;  1D1B A;  1T9K A;  2GWW A;  3NMK A;  4FWV A;  4ULV A;  5GPG B;  3RQF A;  3JRT A;  3QZC A;  4F4B A;  2LQG A;  2OEX A;  3EQL F;  4OD4 A;  4PJM A;  4Z9J A;  3TK0 A;  4CS9 C;  3QMK A;  4MVR A;  1NU9 C;  4MVQ A;  3S28 A;  1OCO C;  1U0B B;  4JRZ A;  1ORY A;  2GA0 A;  2XS8 A;  3IHU A;  3V5Y A;  3M1C B;  1RMV A;  4CDY A;  1LE4 A;  4WGZ A;  2LK4 A;  2R25 A;  4E7S A;  4UDV A;  5BQI A;  2R7V A;  1XWJ A;  1YJG A;  4C7O A;  2AWC A;  2IXM A;  3DJN B;  3EZI A;  4C3E A;  5BQG A;  4CS8 A;  3VF0 A;  1H9G A;  3U2M A;  1Y6D A;  3JT1 A;  3B0U X;  2Q4F A;  1Z7Q c;  1Q0G A;  3NRH A;  4IJJ A;  2R7S A;  1Q0D A;  1WWP A;  2CNW D;  2J46 A;  2V26 A;  2KQ9 A;  2IYL D;  1A7E A;  2YKZ A;  3ZVR A;  5JVE A;  1TWA A;  2LCH A;  1OCZ C;  1Z6A A;  2LP4 A;  2XL6 A;  2XLD A;  1T6U A;  3QW1 A;  2YEV A;  2XL4 A;  2R9R B;  5A6J A;  1VYK A;  1QKR A;  3LNM B;  3UMH A;  3R7C A;  3QVY A;  4DRI B;  5JSL A;  1ST6 A;  3DWW A;  3MYF A;  3RVZ A;  2AU5 A;  3JYY A;  2P0N A;  5E3A A;  2R03 A;  4YT8 A;  2L6F A;  4G7O F;  3S90 A;  4FAP B;  2NUP A;  1JOG A;  3DKA A;  4Q5S F;  3C62 A;  3MYI A;  4DVY P;  1G4W R;  2XM4 A;  2DYR C;  2WL8 A;  3AQB A;  4JIO A;  1J8Y F;  1MMD A;  2Q9A A;  2R02 A;  2R7X A;  1WOL A;  1O87 A;  2LFD A;  5AGF A;  1YYJ A;  4DRJ B;  3V5X A;  5L0F A;  1E83 A;  3EGX B;  4H54 A;  3U9J A;  2R7U A;  2ZXO A;  4MVS A;  4XEF A;  2MYS A;  1VMA A;  2MWQ A;  2A6E F;  3FHD A;  2X0C A;  1YAR O;  4IAQ A;  1K05 A;  3LNR A;  2HUJ A;  3GM3 A;  3RIP A;  3JCU Q;  5JRA A;  4WJ0 A;  4XLP F;  2EPL X;  2QNL A;  3FOO A;  4ZLC A;  2R7T A;  2LIG A;  2WVQ A;  2XM0 A;  3KMI A;  3S27 A;  2HZ8 A;  3HTK C;  2WZL A;  3W8H A;  3C18 A;  3EGD A;  4I44 A;  1BZ4 A;  3DM5 A;  3DM9 B;  5DQZ A;  4MVM A;  3DI5 A;  5L3Q A;  3RF3 A;  4E7Z A;  3BEH A;  2YHS A;  3LEV A;  4U5D E;  2ZXR A;  3RW0 A; 
#chains in the Genus database with same CATH homology
 3LJB A;  3ASO C;  3LAY A;  2KW3 C;  3HJC A;  1OKK A;  4FX5 A;  2XSE A;  2R7O A;  2EIL C;  4QI2 A;  5DS4 A;  4AE4 A;  3T6J A;  2VH3 A;  3RFY A;  2IXN A;  2HV6 A;  2JD3 A;  3B0P A;  3NYJ A;  4Q4Z F;  4MQ9 F;  3LS1 A;  5KYU A;  3VYW A;  5EGY A;  1QZX A;  2GFH A;  5E2Q A;  2V3C C;  2A6H F;  3F46 A;  3X1O A;  1OCR C;  5B3S C;  3K1H A;  2CDQ A;  5DVW A;  4EWC A;  2EIJ C;  3MLG A;  2IOQ A;  2G3V A;  3S29 A;  4HFK B;  2XRH A;  4BG0 A;  3N2Z B;  2G62 A;  1ZHZ A;  3JSZ A;  3ZSU A;  2H7V C;  1ZU5 A;  3NYM A;  1D0Y A;  4HFF B;  1M2V B;  1D1C A;  2WVO A;  3AG4 C;  3B9Q A;  4J30 B;  2PFD A;  1NZE A;  2WZG A;  2J9V A;  2Y3D A;  4U5C E;  3T4R A;  3FDQ A;  5KYY B;  2A1D D;  4QDL A;  3EHM A;  3WOD F;  3DD7 A;  3F47 A;  4BJ5 A;  2A69 F;  2PX0 A;  4YT4 A;  1FFH A;  4OIR F;  3K6B A;  4DBR A;  5T3W A;  3ZG1 A;  1MNE A;  1PCX A;  1LS1 A;  4OIN F;  3EPV A;  4PJJ A;  4AK9 A;  4YT5 A;  1O5H A;  5EHH A;  1ZHY A;  4M63 A;  2ZXP A;  3EHN A;  4ZLD A;  3DXJ F;  2J7P A;  5KYW B;  3IEE A;  2XXA B;  4ANJ A;  2ZXW C;  5BUO A;  4CSA A;  3OWT A;  2YZS A;  1Z3I X;  3EH1 A;  4NY3 A;  4CS9 A;  3N24 A;  2G3K A;  2Y39 A;  5E3C A;  3VAY A;  4DVZ A;  2W4M A;  5L3V A;  2IXP A;  3NG1 A;  5B1A C;  3SNH A;  4Q7C A;  2WZF A;  5KYX A;  2Q9C A;  3NKD A;  1NU7 D;  5T3T A;  2B0J A;  3DAF A;  4BEJ A;  4XLN F;  4KNW A;  1BR2 A;  2BE5 F;  5KYN A;  3RYL A;  3TD7 A;  1OKK D;  2J45 A;  2EIN C;  4PFP A;  3O39 A;  2DGJ A;  1Z63 A;  1KU2 A;  2KGO A;  2J9W A;  3W8I A;  3E9V A;  4KI2 A;  3AG2 C;  2KJG A;  4LLC A;  4P6I C;  4DOZ A;  4YJW A;  3N0T A;  4GEH A;  1M2V A;  3Q7G A;  2KNH A;  3EZH A;  2Y3H A;  1VK5 A;  4PJN A;  2Q9B A;  4K0D A;  3H65 A;  1ZHW A;  3SZR A;  5FCL A;  3RH3 A;  1MMN A;  1RJ9 B;  1IW7 F;  1PD1 A;  1V54 C;  1SF8 A;  2W9Y A;  2R7R A;  3NDB B;  3PMR A;  3RKO F;  4G7H F;  3LLI A;  2X51 A;  1S7Z A;  3EFO A;  4U5F E;  2H7O A;  3ASN C;  2VB6 A;  2VAS A;  4ULW A;  4OIQ F;  4JZA A;  2Q3T A;  3LS0 A;  2R7W A;  2NUP B;  2O9X A;  4MND A;  2WVN A;  3X2Q C;  5KYW A;  1D0X A;  2Y3B A;  3OA1 A;  3ZC4 A;  2XXA A;  1LVK A;  4AX2 A;  3S0X A;  1ZYR F;  2DYS C;  3V7O A;  4BJT A;  2FGY A;  2OCC C;  4J32 B;  2L81 A;  4KC9 A;  4O79 A;  1MMG A;  4EBB A;  2J7P D;  4QI0 A;  3SP1 A;  3UGO A;  1SZI A;  3CSK A;  4BJ6 C;  3AG3 C;  3PHF 2;  4FES A;  5DQT A;  4RD9 A;  1NG1 A;  4IRU A;  3SYN A;  2H7B A;  1PD0 A;  2LSE A;  3EJN A;  1D0Z A;  4W8K A;  1TR2 A;  4JVS A;  4YN0 B;  2IXO A;  4XTK A;  2Z15 A;  4G0H A;  4LLE A;  4GYT A;  4XWJ A;  3UGP A;  3EGX A;  1WGW A;  5DS5 A;  2NUT B;  4AE4 B;  4OIP F;  3FVY A;  4JUR I;  2OG2 A;  3ECS A;  3Q7L A;  4U5E E;  3W2V A;  5KYU B;  1ZHT A;  3Q6M A;  2M4E A;  4I1M A;  4JJF A;  4HE8 D;  3ABM C;  5E33 A;  2FFH A;  3SEO A;  3DMD A;  3T6B A;  1M2O A;  4CS8 C;  4PFO A;  1SMY F;  4CS7 A;  3NKE A;  3DAG A;  5D91 A;  4C3B A;  1M57 C;  3EH2 A;  4LER A;  3E70 C;  1MND A;  2QY9 A;  4IWB A;  3W2W A;  3CZ6 A;  5CI8 A;  3HLZ A;  3K7D A;  2L9J A;  1VOM A;  2C03 A;  1RJ9 A;  4JCH A;  4O6Y A;  1QLE C;  3OEO A;  4DBQ A;  2J0X A;  1TWH A;  3I4U A;  4LAC B;  5D92 A;  5DLJ A;  4CBE A;  2QTV A;  4H4K C;  3UMI A;  5F5H A;  1TKN A;  2P7V A;  1TWG A;  3ZIB A;  3O6X A;  3I5P A;  3EG9 B;  3CQZ A;  1JPN A;  4K7B A;  1OCC C;  1TWC A;  2HV7 A;  4U5H A;  1LKX A;  3DJU B;  1BR4 A;  3K33 A;  2EIK C;  4C3D A;  1FFT C;  2W4B A;  2Y3G A;  2I8B A;  5KYY A;  2CNW A;  2PX3 A;  4N06 A;  4JW1 A;  4C7O B;  3JYH A;  3UMK A;  5T1D B;  3POV A;  2R7Q A;  1VYI A;  1M56 C;  2P6V A;  1W2W A;  4O6M A;  3FAJ A;  4YWQ A;  1J8M F;  1ZU4 A;  2J0W A;  4PJL A;  3L0I A;  1MMA A;  2ZPA A;  1ZHX A;  5DS6 A;  5KYX B;  1BR1 A;  4PK4 A;  3K66 A;  3Q6N A;  3GAN A;  3LLK A;  2WB7 A;  4BJ1 A;  4B6I A;  4RDA A;  4IAO A;  1JPJ A;  4O7G A;  2J9U A;  4U5G A;  1V55 C;  2NUT A;  1FMW A;  4JJG A;  4A2N B;  2E87 A;  5HSW A;  2C04 A;  3AQC A;  3LES A;  4OIO F;  3B0V C;  4CIH A;  2Y69 C;  2A68 F;  4OD5 A;  4RBN A;  2EIM C;  4KBL A;  2PP4 A;  3ABL C;  2NG1 A;  1N1C A;  3NYL A;  3DZA A;  2PF4 E;  5CI9 A;  3EGD B;  2CW0 F;  1IZM A;  3ITF A;  3K1I C;  1FTS A;  4BJ5 C;  4G7Z F;  3UNG C;  1G8X A;  4O6N A;  3KH2 A;  5IY5 C;  4YT2 A;  3WG7 C;  4BJ6 A;  3AG1 C;  4HEA J;  3KKB A;  2CGE A;  5B1B C;  1D1A A;  3I5Q A;  4I3M A;  3ABK C;  1FMV A;  5F5F A;  3GOD A;  3EG9 A;  4I1O B;  3L34 A;  3KL4 A;  4KNV A;  4X0R A;  1Z5Z A;  4U5B E;  2W45 A;  3EFO B;  4CSA C;  1Z23 A;  3MX3 A;  3UR3 C;  2D5R B;  1D1B A;  4FWV A;  3JRT A;  3QZC A;  4F4B A;  3EQL F;  4OD4 A;  4PJM A;  4CS9 C;  3QMK A;  1NU9 C;  3S28 A;  1OCO C;  3M1C B;  4E7S A;  2R7V A;  4C7O A;  2IXM A;  3DJN B;  3EZI A;  4C3E A;  4CS8 A;  3JT1 A;  3B0U X;  3NRH A;  4IJJ A;  2R7S A;  2CNW D;  2J46 A;  2V26 A;  2KQ9 A;  2IYL D;  3ZVR A;  1TWA A;  1OCZ C;  1Z6A A;  2YEV A;  2XL4 A;  1VYK A;  3UMH A;  1ST6 A;  4YT8 A;  5E3A A;  4G7O F;  2NUP A;  4Q5S F;  4DVY P;  2DYR C;  2WL8 A;  3AQB A;  1J8Y F;  1MMD A;  2Q9A A;  2R7X A;  1O87 A;  3EGX B;  2R7U A;  2ZXO A;  2MYS A;  1VMA A;  2MWQ A;  2A6E F;  3FHD A;  3LNR A;  3RIP A;  3JCU Q;  4XLP F;  4WJ0 A;  4ZLC A;  2R7T A;  2WVQ A;  3KMI A;  3S27 A;  3HTK C;  2WZL A;  3W8H A;  3EGD A;  4I44 A;  3DM5 A;  3DM9 B;  5DQZ A;  5L3Q A;  4E7Z A;  2YHS A;  3LEV A;  4U5D E;  2ZXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...