4C3DA

Hrsv m2-1, p422 crystal form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
165
Chain Sequence
LGSMSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDKSLDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Essential Transcription Antiterminator M2-1 Protein of Human Respiratory Syncytial Virus and Implications of its Phosphorylation.
pubmed doi rcsb
source organism Human respiratory syncytial virus
molecule tags Viral protein
molecule keywords MATRIX M2-1
total genus 59
structure length 165
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06436 Pneumovirus_M2 Pneumovirus matrix protein 2 (M2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4c3dA00
2L9JA 4C3BA 4CSAC 4CSAA 4CS8A 4CS8C 4C3DA 4CS7A 4CS9A 4C3EA 4CS9C
chains in the Genus database with same CATH superfamily
4U9DA 4KI2A 4F4BA 1NU9C 1TKNA 4MTFA 3ZTZA 1YAUO 4O7GA 5BQIA 3C8GB 2J9VA 2WVNA 4EIYA 1E86A 3HNLA 4QI0A 1H9TA 1LKXA 1C17M 1YARO 4EBBA 2R02A 2HMZA 4BG0A 1NG1A 3MYIA 2R7VA 3RF3A 4JRZA 3DJNB 3UMKA 5A69A 1BBHA 3EGDB 4IB4A 4MS2A 2AWCA 1G4US 2DGJA 4MNDA 3X1OA 1CGNA 2H7VC 1MMDA 2J45A 2NSGA 1T6IA 2YHSA 2DB4A 2LQGA 2QE9A 1T5OA 3NRHA 4J32B 4YWQA 3EPVA 3Q7GA 3TD7A 1Z5ZA 2A68F 2EPKX 4ONSA 4CS7A 2R05A 3H2UA 3L0IA 5TJ5E 1R5ID 1YZAA 4BJ6A 2EILC 2KSFA 2R7UA 3EZHA 2Y3BA 2ZXPA 3MYFA 2HS5A 3IEEA 3OWTA 4ZLCA 4LERA 2AU5A 1B68A 3C8GA 3FOOA 2XXAA 3WG7C 2YZSA 4C3EA 1M6TA 1KNYA 2NPUA 1OKKD 1YA9A 5L0CA 4OIQF 3U9JA 4RBNA 5CI9A 4K7BA 2Q9AA 2R7RA 5E3CA 4A4AA 2PP4A 4U5FE 4XPYA 5COMA 1PD0A 2G3VA 3K1IA 4K0DA 3E70C 4DOZA 2PX3A 2A69F 3SP1A 3CQZA 4BEMJ 2V26A 2Q9BA 3SXKA 5CIVA 1SMYF 2Q3TA 3LNMB 4BEJA 2OJED 4NQFA 2NG1A 2WVOA 4J30B 1L7CA 2Y3HA 3ZSUA 2R7SA 3JSEO 1XZQA 3EHNA 4H54A 3MBGA 1FFHA 2QLAA 3DD7A 5L0IA 1M56C 4G7OF 3W8IA 2MHRA 2ETSA 5AC5A 5L0DA 4IRUA 2J7PD 4OD5A 3RH3A 2O9XA 5JS5A 4N4WA 2LIGA 2NSFA 2VCBA 2TMVP 2L81A 4LDRA 4BJTA 5JVEA 4U5EE 2PNOA 1NLXA 2CYDA 1APCA 2UUIA 2R7WA 2W45A 2MYSA 2VCCA 4J7TA 1JPNA 1NSGB 1EQ1A 1LS4A 2PF4E 3SEOA 1D1BA 2JX0A 2J9WA 4MTGA 4MVOA 2R7QA 3RVYA 5F5HA 3S29A 2P6VA 1FFTC 5AC4A 3PHF2 1YJGA 1IZMA 1ZW2A 2OU6A 4JTAB 1DOVA 3Q7LA 3HNJA 4YT4A 1EA8A 1MMNA 1OW6A 2CGEA 2IXOA 2PBEA 3EJNA 3FMSA 3QW1A 2E87A 4JCHA 1ORSC 3AQCA 2Z15A 4IWBA 1Z63A 4YK5A 3T4RA 4PK4A 3HJCA 4LLCA 3JRTA 3GWLA 2Q4FA 1GS9A 3I5PA 4G78A 1TWAA 2C03A 2WVQA 4RD9A 3M15A 1Y6DA 2NUPA 3A11A 1FTSA 3L8JA 1QPUA 5KYYB 4EKWA 1EI7A 1TWGA 3AOUA 1TWHA 4U5BE 1CGME 4AE4A 2C04A 2YLIA 3R7CA 3JRMO 2W4BA 3B9QA 4EBJA 3IQ6A 2EPNA 2KQ9A 2VH3A 1PV3A 1YZCA 4OIRF 1T01A 1Q0MA 3V7OA 3VF0A 1NFNA 2EPMX 4Q4ZF 1D0YA 1Q0DA 2F22A 1ZW3A 4CDYA 1T6QA 4FX5A 1I4ZA 1ST6A 1TR2A 4BPMA 2A0BA 2QTVA 4XEFA 1J8YF 4L6RA 4OD4A 1YLMA 3KKBA 3UMHA 1VYKA 3U5SA 1LIHA 2KW3C 4U5GA 2ZXRA 1Z6AA 4PJJA 4KC9A 5BQHA 2CCYA 2QY9A 1G4WR 4AK9A 3A9CA 3SYNA 3WAQA 4FESA 3JT1A 4AE4B 1I4YA 1Y4CA 1ZHTA 2Y69C 1OCOC 4OINF 1A7EA 1ZHWA 1HW2A 4AX2A 1OCRC 2HMQA 1F1MA 5K0IA 1ZVZA 1VK5A 4GQHA 1TFKB 3FXHA 5L0HA 2HJ3A 4JURI 1UFBA 1O87A 3K6BA 4PJMA 5COFA 1OW7A 3GODA 3JZ0A 4YT2A 1QSPA 2EPLX 2Y3GA 3L1MA 2LFDA 3EGXA 4CS8C 3I5QA 3QVYA 2W9YA 5BUOA 4MVMA 3E9VA 3M1CB 1ZZPA 3NYMA 3EHMA 5D91A 3X2QC 2GWWA 1TWCA 2PFDA 1Z23A 4MVQA 1SR2A 1I5NA 5DS6A 2EINC 1C02A 3K1HA 4E0HA 1UG7A 3S0XA 2J46A 4HE8D 4AL0A 4PJNA 1LM3B 1O5HA 2J8WA 3LEVA 4A2NB 2BC5A 1BDJB 1U89A 3NYLA 3RKOF 3RFYA 3AG2C 4EWCA 4CX9A 4OIOF 5HSWA 3HLZA 3T6JA 4ER9A 2YL1A 1ORYA 3S90A 2M4EA 1BR1A 1Q0KA 3GORA 1LE2A 1YYJA 3NMKA 4RDAA 4W8PA 5E2QA 3NDBB 1GGQA 1D1AA 2CNWD 2OG2A 2KJGA 3DAFA 4R32A 1VYIA 4MVRA 3ECSA 4O6YA 3EQLF 4XPWA 2EIJC 2P61A 1XZPA 3EFOA 1RKEA 5DS5A 3B0UX 1LPEA 5HV9A 3GEEA 1V74B 4W8KA 2JPUA 3AG4C 3JSZA 5DLJA 1E85A 4U5HA 4N6CA 2D5RB 2Q9CA 3QMKA 4WGZA 3TJ5A 4DRJB 2XLHA 4E7ZA 2EIMC 3G4XA 4LDKA 2QUPA 4EBKA 3K7DA 3C7JA 3IQTA 3SXYA 3ZC4A 1CPRA 4DVYP 4D4NA 3O6XA 4CDVA 1M2VB 2AVKA 2X51A 2EPOA 5KYUA 4NCQA 4D4XA 1E2XA 5E3AA 3EH2A 3W4YA 2R7TA 1SZIA 3ZTMA 3JYHA 5T3TA 1RJ9A 2YRFA 3DM5A 3JTLO 1E84A 2J7PA 2YQYA 3DJUB 4IARA 1ZU5A 1A7VA 3KPHA 2XL6A 3ABLC 4CS9C 5F5FA 3C18A 4U5CE 2HV7A 5L0JA 4MVUA 2XL4A 3V5XA 1OR3A 1RKCA 5FZTA 4PFOA 5T1DB 5KYWA 3O39A 4DVZA 1U0BB 3DI5A 3Q6MA 2B0HA 1RCPA 3CZ6A 4FWVA 3U2LA 1OQCA 3VYWA 256BA 2BL2A 3NKEA 3QVZA 2GAQA 2JD3A 3GANA 4BJ5C 3ATPA 3Q6NA 4Z9IA 3W8HA 3LJBA 3AGUA 4PACA 1Z7Qc 3DZAA 3S28A 3C8ZA 3KH2A 4XPXA 4JTDB 1YVIA 1JR8A 5JUAA 2LFFA 3ASNC 4YT5A 2R25A 3HTKC 5B3IA 1V54C 3ASOC 3DAGA 2MWQA 3DKAA 4JCZA 1CGOA 4PFPA 1IW7F 1OKKA 2LSEA 3AG1C 4G0HA 3KYIA 3UGPA 1RMVA 5BQGA 1Z3IX 2IXMA 3L34A 3GEHA 2HFIA 3UGOA 3UMIA 2H8AA 2YWAA 1WASA 2P7VA 1KTMA 3U3BA 2ZPAA 1QLEC 3G4ZA 3CAXA 3FHDA 3JYYA 2I8BA 1M2OA 1FNTc 2L6GA 4AL1A 5IY5C 1MQVA 1U6HA 3DWWA 2H7BA 3U2MA 4ANJA 2DYRC 5T3WA 4N6HA 1FAPB 2R9RB 2J0WA 3LESA 1KU2A 1JPJA 2RSEB 1HMOA 3N0TA 5A6KA 3GM1A 3GWNA 1W2WA 2YL3A 4JEAA 3FDQA 1H7IA 5L3QA 1Q0GA 3LEOA 4YJWA 1ZYRF 3PMRA 5EGYA 2W4MA 4JVSA 3ZQVA 4BJ5A 5A6BA 1OXBA 2FGYA 4IJJA 4NC3A 1WN0A 4LDQA 4HFKB 2R03A 1SF8A 4O6MA 4DXWA 1VOMA 2IBFA 2M64A 2B0JA 2HV6A 2XSEA 4C3BA 2YL7A 2LK4A 1H6GA 4NTAA 2P0NA 4WGYA 4EHPA 4CBEA 3FOPA 3LUTB 3DXJF 4E0IA 5GPGB 1C03A 4YN0B 1VMAA 5B1BC 2XS1A 3IHUA 4MTOA 3T6BA 4KBLA 3ABKC 4ULWA 3PDMP 2XM0A 2L7AA 2XLVA 1A7DA 4JIOA 1MNEA 3EFOB 3C63A 1R4TA 1OW8A 3IPMO 1BR2A 2FAPB 2IOQA 3V5ZA 1YYXA 2WL8A 3HKKA 3N2ZB 3O55A 2XLMA 3PCVA 4JKVA 3OA1A 2QNLA 3T6GB 3V5YA 3C62A 3VRCA 2GFHA 3SNHA 4C7OB 3US6A 2NUPB 3RVZA 3KMIA 5CI8A 1FMWA 4I1MA 5DQTA 3FAPB 1ZHZA 4MVZA 4N06A 1M2VA 3EZIA 5L0GA 3NKDA 4I3MA 5D92A 5DVWA 3ZIBA 1GM5A 3K66A 4NTBA 1BZ4A 1VLTA 3J06A 3LLIA 1WGWA 2D4UA 3AGTA 3M4CA 3ABMC 3H2VA 3JCUQ 1HW1A 3EG9B 1OR2A 4HEAJ 2IYLD 5AGFA 4CS9A 3TULA 5JP7A 2VB6A 4M63A 5KYNA 4C7OA 1N1CA 3I4UA 4E7SA 2NUTA 4OIPF 4MW3A 3SXMA 2ICWG 3BRJA 3CSKA 1NU7D 1QKRA 2AWYA 1PCXA 2L9JA 2UUHA 2HJMA 1T9KA 1QZXA 1QVXA 3EGDA 3MX3A 2HKVA 5F28E 4XQ1A 1YDIA 1LI7A 3M79A 4I44A 3UR3C 3TK0A 1HY5A 2LP4A 1G8XA 2R7XA 2A6HF 2BE5F 3AQBA 2RD9A 3H65A 3K33A 4JC7A 3GM3A 3LAYA 2XS8A 3B71A 2FFHA 2KGOA 1AVOB 3WODF 2A1DD 3BEHA 5KYXB 3ZDLA 2Y39A 4QDLA 2L6FA 5JSLA 2HUJA 2YL0A 5JT4A 4DBQA 3RW0A 3VM6A 4CDAA 3K1IC 4P9FA 4XLNF 1YA7O 1JMWA 1MMGA 1ZHXA 2WZLA 1J8MF 2DI3A 2J0XA 3HNKA 3ZVRA 5KYXA 4ZLDA 4JW1A 4QI2A 1S05A 1XWJA 2XLOA 3GEIA 1FMVA 2WB7A 4NY3A 3L8IA 3EGXB 2VASA 2OQMA 2ZD9A 1TFOB 4YT8A 3AJMA 1ORJA 4Q7CA 3KL4A 2DYSC 4IAQA 4K1OA 4O79A 3W2WA 1QQ3A 3ITFA 4BJ6C 2J9UA 2WZFA 3WHNA 4CJOA 1K05A 1VB5A 4E18A 4G7HF 1HE1A 2XXAB 4MVSA 4U9EA 4FAPB 1Q0FA 3OEOA 4C3DA 3U8VA 5EK0A 4LLEA 3CEXA 4XTKA 2NUTB 4KNWA 5KYYA 5E33A 4MQ9F 3IQCA 4JEBA 1D0XA 5KYWB 4CSAA 1AUEA 4J7YA 1V55C 1E83A 4Q5SF 2ASRA 3SXZA 1D0ZA 2XM4A 1LE4A 3EG9A 4DBRA 3B29A 3ZQYA 1HE9A 2KK1A 3TOMA 2LCHA 4P6IC 4CS8A 1O3UA 3QZCA 4IGGA 4DJ9A 2Q7RA 4U5DE 1V4AA 2G3KA 3LS0A 4UDVA 4CIHA 2XLWA 3N24A 2XRHA 3G50A 1K04A 2P1AA 1H9GA 4MW8A 1VTMP 3SZRA 1WOLA 4CIPA 4G7ZF 2GDCA 1GQAA 4E17A 1NFOA 4O6NA 2YEVA 3QTHA 2XLEA 2Q00A 2WZGA 3ZWIA 3KYJA 1JAFA 4WABA 2HZ8A 3S27A 2OOCA 2R7OA 1AEPA 2CW0F 1RXQA 4YL0A 4P9TA 2YLGA 1A0BA 2OKUA 5FCLA 2KC3A 4CSAC 1PD1A 3B0VC 5L3VA 4CJGA 3NYJA 4H4KC 1M57C 4YL1A 5L0FA 3RQFA 4JZAA 3U9MA 2IM8A 2YLDA 4XWJA 3T9OA 3TQOA 2V3CC 2XLDA 3U8PA 3U0CA 4XEKA 1MNDA 1LVKA 1ZU4A 2H7OA 3LLKA 1JOGA 3IQ5A 2ZXOA 4I1OB 1OXKA 3RYLA 5JRAA 3S84A 3RQEA 4GEHA 1LI5A 1JRAA 4PR9A 4DRIB 3GM2A 4LACB 3C8GD 4ULVA 3U3FA 1WWPA 2L6HA 1T6UA 1D1CA 5EHHA 2A6EF 2AP3A 5A6BD 3HNIA 2I15A 1NZEA 2EIKC 4EUKB 1VLSA 2KNHA 1L3PA 4YL3A 3AG3C 2VC9A 1NBBA 4Z9JA 1S7ZA 3NMIA 3TOLA 5COGA 4X0RA 1HMDA 2G62A 3QW0A 4Z9HA 1RJ9B 3R2PA 1ZHYA 4JE9A 3VAYA 3B0PA 2VCAA 1FR0A 3DE8A 5A6JA 5KYUB 4IAOA 4HFFB 1OCZC 2CDQA 2IXNA 1CPQA 1WTYA 2OCCC 3F47A 1SYQA 3NMJA 3O10A 2PX0A 1LS1A 3EH1A 4XEVA 2CNWA 1MMAA 4JJGA 3UNGC 2X0CA 3FAJA 3LS1A 4B6IA 2OJQA 3FVYA 1G5ZA 1EKYA 4XLPF 2HSQA 3DM9B 2LD6A 2YVKA 5A6AA 5JLIA 1K40A 2ZXWC 2OEVA 1TQGA 3DE9A 3F46A 3NG1A 3M4BA 4GYTA 4JJFA 1A41A 2HSBA 3TJ6A 1OCCC 2J9BA 4KNVA 1WATA 3W2VA 1RKEB 3LNRA 4WJ0A 4JTCB 4DRHB 2XL8A 3POVA 4PJLA 3MLGA 2GA0A 3ZG1A 5B3SC 3MFNA 5DQZA 3DMDA 4NTFA 3RQGA 3S9OA 1BR4A 2A0UA 4BJ1A 2KYHA 5DS4A 3RIPA 2OEXA 2YKZA 2IXPA 2Y3DA 1DOWA 5B1AC
chains in the Genus database with same CATH topology
4KI2A 4F4BA 1NU9C 1TKNA 4O7GA 2J9VA 2WVNA 4QI0A 1LKXA 4EBBA 4BG0A 1NG1A 2R7VA 3DJNB 3UMKA 3EGDB 2DGJA 4MNDA 3X1OA 2H7VC 1MMDA 2J45A 4YWQA 2YHSA 3NRHA 4J32B 3EPVA 3Q7GA 3TD7A 1Z5ZA 2A68F 4CS7A 3L0IA 4BJ6A 2EILC 2R7UA 3EZHA 2Y3BA 2ZXPA 3OWTA 3IEEA 4ZLCA 4LERA 2XXAA 3WG7C 2YZSA 4C3EA 1OKKD 4OIQF 4RBNA 5CI9A 4K7BA 2Q9AA 2R7RA 5E3CA 2PP4A 4U5FE 1PD0A 2G3VA 4K0DA 3E70C 4DOZA 2PX3A 2A69F 3SP1A 3CQZA 2V26A 2Q9BA 1SMYF 2Q3TA 4BEJA 2NG1A 2WVOA 4J30B 2Y3HA 3ZSUA 2R7SA 3EHNA 1FFHA 3DD7A 4G7OF 1M56C 3W8IA 4IRUA 2J7PD 4OD5A 3RH3A 2O9XA 2L81A 4BJTA 4U5EE 2R7WA 2W45A 2MYSA 1JPNA 2PF4E 3SEOA 1D1BA 2J9WA 2R7QA 5F5HA 3S29A 2P6VA 1FFTC 3PHF2 1IZMA 3Q7LA 4YT4A 1MMNA 2CGEA 2IXOA 3EJNA 2E87A 4JCHA 3AQCA 2Z15A 4IWBA 1Z63A 3T4RA 4PK4A 3HJCA 4LLCA 3JRTA 3I5PA 1TWAA 2C03A 2WVQA 4RD9A 2NUPA 1FTSA 5KYYB 1TWGA 1TWHA 4U5BE 4AE4A 2C04A 2W4BA 3B9QA 2KQ9A 2VH3A 4OIRF 3V7OA 4Q4ZF 1D0YA 4FX5A 1TR2A 1ST6A 2QTVA 1J8YF 4OD4A 3KKBA 3UMHA 1VYKA 2KW3C 4U5GA 2ZXRA 1Z6AA 4PJJA 4KC9A 2QY9A 4AK9A 3SYNA 4FESA 3JT1A 4AE4B 1ZHTA 2Y69C 1OCOC 4OINF 1ZHWA 4AX2A 1OCRC 1VK5A 4JURI 1O87A 3K6BA 4PJMA 3GODA 4YT2A 2Y3GA 3EGXA 4CS8C 3I5QA 2W9YA 5BUOA 3E9VA 3M1CB 3NYMA 3EHMA 5D91A 3X2QC 1TWCA 2PFDA 1Z23A 5DS6A 2EINC 3K1HA 3S0XA 2J46A 4HE8D 4PJNA 1O5HA 3LEVA 4A2NB 3NYLA 3RKOF 3RFYA 3AG2C 4EWCA 4OIOF 5HSWA 3HLZA 3T6JA 2M4EA 1BR1A 4RDAA 5E2QA 3NDBB 2OG2A 1D1AA 2CNWD 2KJGA 3DAFA 1VYIA 3ECSA 4O6YA 3EQLF 2EIJC 3EFOA 5DS5A 3B0UX 4W8KA 3JSZA 3AG4C 5DLJA 4U5HA 2D5RB 2Q9CA 3QMKA 4E7ZA 2EIMC 3K7DA 3ZC4A 4DVYP 3O6XA 1M2VB 2X51A 5KYUA 5E3AA 3EH2A 2R7TA 1SZIA 3JYHA 5T3TA 1RJ9A 3DM5A 2J7PA 3DJUB 1ZU5A 5F5FA 3ABLC 4CS9C 4U5CE 2HV7A 2XL4A 5KYWA 4PFOA 5T1DB 3O39A 4DVZA 3Q6MA 3CZ6A 4FWVA 3VYWA 3NKEA 2JD3A 3GANA 4BJ5C 3Q6NA 3W8HA 3LJBA 3DZAA 3S28A 3KH2A 3ASNC 4YT5A 3HTKC 1V54C 3ASOC 3DAGA 2MWQA 4PFPA 1IW7F 1OKKA 2LSEA 3AG1C 4G0HA 3UGPA 1Z3IX 2IXMA 3L34A 3UGOA 3UMIA 2P7VA 2ZPAA 1QLEC 3FHDA 2I8BA 1M2OA 5IY5C 2H7BA 4ANJA 2DYRC 5T3WA 2J0WA 3LESA 1KU2A 1JPJA 3N0TA 1W2WA 3FDQA 5L3QA 4YJWA 1ZYRF 3PMRA 5EGYA 2W4MA 4JVSA 4BJ5A 2FGYA 4IJJA 4HFKB 1SF8A 4O6MA 1VOMA 2B0JA 2HV6A 2XSEA 4C3BA 4CBEA 3DXJF 4YN0B 1VMAA 5B1BC 3T6BA 4KBLA 3ABKC 4ULWA 1MNEA 3EFOB 1BR2A 2IOQA 2WL8A 3N2ZB 3OA1A 2GFHA 3SNHA 4C7OB 2NUPB 3KMIA 5CI8A 1FMWA 4I1MA 5DQTA 1ZHZA 4N06A 1M2VA 3EZIA 3NKDA 4I3MA 5D92A 5DVWA 3ZIBA 3K66A 3LLIA 1WGWA 3ABMC 3JCUQ 3EG9B 4HEAJ 2IYLD 4CS9A 2VB6A 4M63A 5KYNA 4C7OA 1N1CA 3I4UA 4E7SA 2NUTA 4OIPF 3CSKA 1NU7D 2L9JA 1PCXA 3EGDA 3MX3A 1QZXA 4I44A 3UR3C 1G8XA 2R7XA 2A6HF 2BE5F 3AQBA 3H65A 3K33A 3LAYA 2FFHA 2KGOA 3WODF 5KYXB 2A1DD 2Y39A 4QDLA 4DBQA 3K1IC 4XLNF 1MMGA 1ZHXA 2WZLA 1J8MF 2J0XA 3ZVRA 5KYXA 4ZLDA 4JW1A 4QI2A 1FMVA 2WB7A 4NY3A 3EGXB 2VASA 4YT8A 4Q7CA 3W2WA 3KL4A 2DYSC 4BJ6C 4O79A 3ITFA 2J9UA 2WZFA 4G7HF 2XXAB 3OEOA 4C3DA 4LLEA 4XTKA 2NUTB 4KNWA 5KYYA 5E33A 4MQ9F 1D0XA 5KYWB 4CSAA 4Q5SF 1V55C 1D0ZA 3EG9A 4DBRA 4P6IC 4CS8A 3QZCA 4U5DE 2G3KA 3LS0A 4CIHA 3N24A 2XRHA 3SZRA 4G7ZF 4O6NA 2YEVA 2WZGA 3S27A 2R7OA 2CW0F 5FCLA 4CSAC 1PD1A 3B0VC 5L3VA 3NYJA 4H4KC 1M57C 4JZAA 4XWJA 2V3CC 4I1OB 1MNDA 1LVKA 1ZU4A 2H7OA 3LLKA 3RYLA 2ZXOA 4GEHA 4LACB 5EHHA 1D1CA 2A6EF 1NZEA 2EIKC 2KNHA 3AG3C 1S7ZA 4X0RA 2G62A 1RJ9B 1ZHYA 3VAYA 3B0PA 5KYUB 4IAOA 4HFFB 1OCZC 2CDQA 2IXNA 2OCCC 3F47A 2PX0A 1LS1A 3EH1A 2CNWA 1MMAA 4JJGA 3UNGC 4B6IA 3FAJA 3LS1A 3FVYA 4XLPF 3DM9B 2ZXWC 4JJFA 3NG1A 4GYTA 3F46A 3W2VA 1OCCC 4KNVA 3LNRA 4WJ0A 3POVA 4PJLA 3MLGA 3ZG1A 5B3SC 5DQZA 3DMDA 1BR4A 4BJ1A 5DS4A 3RIPA 2IXPA 2Y3DA 5B1AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L9J A;  4C3B A;  4CSA C;  4CSA A;  4CS8 A;  4CS8 C;  4C3D A;  4CS7 A;  4CS9 A;  4C3E A;  4CS9 C; 
#chains in the Genus database with same CATH topology
 4U9D A;  4KI2 A;  4F4B A;  1NU9 C;  1TKN A;  4MTF A;  3ZTZ A;  1YAU O;  4O7G A;  5BQI A;  3C8G B;  2J9V A;  2WVN A;  4EIY A;  1E86 A;  3HNL A;  4QI0 A;  1H9T A;  1LKX A;  1C17 M;  1YAR O;  4EBB A;  2R02 A;  2HMZ A;  4BG0 A;  1NG1 A;  3MYI A;  2R7V A;  3RF3 A;  4JRZ A;  3DJN B;  3UMK A;  5A69 A;  1BBH A;  3EGD B;  4IB4 A;  4MS2 A;  2AWC A;  1G4U S;  2DGJ A;  4MND A;  3X1O A;  1CGN A;  2H7V C;  1MMD A;  2J45 A;  2NSG A;  1T6I A;  2YHS A;  2DB4 A;  2LQG A;  2QE9 A;  1T5O A;  3NRH A;  4J32 B;  4YWQ A;  3EPV A;  3Q7G A;  3TD7 A;  1Z5Z A;  2A68 F;  2EPK X;  4ONS A;  4CS7 A;  2R05 A;  3H2U A;  3L0I A;  5TJ5 E;  1R5I D;  1YZA A;  4BJ6 A;  2EIL C;  2KSF A;  2R7U A;  3EZH A;  2Y3B A;  2ZXP A;  3MYF A;  2HS5 A;  3IEE A;  3OWT A;  4ZLC A;  4LER A;  2AU5 A;  1B68 A;  3C8G A;  3FOO A;  2XXA A;  3WG7 C;  2YZS A;  4C3E A;  1M6T A;  1KNY A;  2NPU A;  1OKK D;  1YA9 A;  5L0C A;  4OIQ F;  3U9J A;  4RBN A;  5CI9 A;  4K7B A;  2Q9A A;  2R7R A;  5E3C A;  4A4A A;  2PP4 A;  4U5F E;  4XPY A;  5COM A;  1PD0 A;  2G3V A;  3K1I A;  4K0D A;  3E70 C;  4DOZ A;  2PX3 A;  2A69 F;  3SP1 A;  3CQZ A;  4BEM J;  2V26 A;  2Q9B A;  3SXK A;  5CIV A;  1SMY F;  2Q3T A;  3LNM B;  4BEJ A;  2OJE D;  4NQF A;  2NG1 A;  2WVO A;  4J30 B;  1L7C A;  2Y3H A;  3ZSU A;  2R7S A;  3JSE O;  1XZQ A;  3EHN A;  4H54 A;  3MBG A;  1FFH A;  2QLA A;  3DD7 A;  5L0I A;  1M56 C;  4G7O F;  3W8I A;  2MHR A;  2ETS A;  5AC5 A;  5L0D A;  4IRU A;  2J7P D;  4OD5 A;  3RH3 A;  2O9X A;  5JS5 A;  4N4W A;  2LIG A;  2NSF A;  2VCB A;  2TMV P;  2L81 A;  4LDR A;  4BJT A;  5JVE A;  4U5E E;  2PNO A;  1NLX A;  2CYD A;  1APC A;  2UUI A;  2R7W A;  2W45 A;  2MYS A;  2VCC A;  4J7T A;  1JPN A;  1NSG B;  1EQ1 A;  1LS4 A;  2PF4 E;  3SEO A;  1D1B A;  2JX0 A;  2J9W A;  4MTG A;  4MVO A;  2R7Q A;  3RVY A;  5F5H A;  3S29 A;  2P6V A;  1FFT C;  5AC4 A;  3PHF 2;  1YJG A;  1IZM A;  1ZW2 A;  2OU6 A;  4JTA B;  1DOV A;  3Q7L A;  3HNJ A;  4YT4 A;  1EA8 A;  1MMN A;  1OW6 A;  2CGE A;  2IXO A;  2PBE A;  3EJN A;  3FMS A;  3QW1 A;  2E87 A;  4JCH A;  1ORS C;  3AQC A;  2Z15 A;  4IWB A;  1Z63 A;  4YK5 A;  3T4R A;  4PK4 A;  3HJC A;  4LLC A;  3JRT A;  3GWL A;  2Q4F A;  1GS9 A;  3I5P A;  4G78 A;  1TWA A;  2C03 A;  2WVQ A;  4RD9 A;  3M15 A;  1Y6D A;  2NUP A;  3A11 A;  1FTS A;  3L8J A;  1QPU A;  5KYY B;  4EKW A;  1EI7 A;  1TWG A;  3AOU A;  1TWH A;  4U5B E;  1CGM E;  4AE4 A;  2C04 A;  2YLI A;  3R7C A;  3JRM O;  2W4B A;  3B9Q A;  4EBJ A;  3IQ6 A;  2EPN A;  2KQ9 A;  2VH3 A;  1PV3 A;  1YZC A;  4OIR F;  1T01 A;  1Q0M A;  3V7O A;  3VF0 A;  1NFN A;  2EPM X;  4Q4Z F;  1D0Y A;  1Q0D A;  2F22 A;  1ZW3 A;  4CDY A;  1T6Q A;  4FX5 A;  1I4Z A;  1ST6 A;  1TR2 A;  4BPM A;  2A0B A;  2QTV A;  4XEF A;  1J8Y F;  4L6R A;  4OD4 A;  1YLM A;  3KKB A;  3UMH A;  1VYK A;  3U5S A;  1LIH A;  2KW3 C;  4U5G A;  2ZXR A;  1Z6A A;  4PJJ A;  4KC9 A;  5BQH A;  2CCY A;  2QY9 A;  1G4W R;  4AK9 A;  3A9C A;  3SYN A;  3WAQ A;  4FES A;  3JT1 A;  4AE4 B;  1I4Y A;  1Y4C A;  1ZHT A;  2Y69 C;  1OCO C;  4OIN F;  1A7E A;  1ZHW A;  1HW2 A;  4AX2 A;  1OCR C;  2HMQ A;  1F1M A;  5K0I A;  1ZVZ A;  1VK5 A;  4GQH A;  1TFK B;  3FXH A;  5L0H A;  2HJ3 A;  4JUR I;  1UFB A;  1O87 A;  3K6B A;  4PJM A;  5COF A;  1OW7 A;  3GOD A;  3JZ0 A;  4YT2 A;  1QSP A;  2EPL X;  2Y3G A;  3L1M A;  2LFD A;  3EGX A;  4CS8 C;  3I5Q A;  3QVY A;  2W9Y A;  5BUO A;  4MVM A;  3E9V A;  3M1C B;  1ZZP A;  3NYM A;  3EHM A;  5D91 A;  3X2Q C;  2GWW A;  1TWC A;  2PFD A;  1Z23 A;  4MVQ A;  1SR2 A;  1I5N A;  5DS6 A;  2EIN C;  1C02 A;  3K1H A;  4E0H A;  1UG7 A;  3S0X A;  2J46 A;  4HE8 D;  4AL0 A;  4PJN A;  1LM3 B;  1O5H A;  2J8W A;  3LEV A;  4A2N B;  2BC5 A;  1BDJ B;  1U89 A;  3NYL A;  3RKO F;  3RFY A;  3AG2 C;  4EWC A;  4CX9 A;  4OIO F;  5HSW A;  3HLZ A;  3T6J A;  4ER9 A;  2YL1 A;  1ORY A;  3S90 A;  2M4E A;  1BR1 A;  1Q0K A;  3GOR A;  1LE2 A;  1YYJ A;  3NMK A;  4RDA A;  4W8P A;  5E2Q A;  3NDB B;  1GGQ A;  1D1A A;  2CNW D;  2OG2 A;  2KJG A;  3DAF A;  4R32 A;  1VYI A;  4MVR A;  3ECS A;  4O6Y A;  3EQL F;  4XPW A;  2EIJ C;  2P61 A;  1XZP A;  3EFO A;  1RKE A;  5DS5 A;  3B0U X;  1LPE A;  5HV9 A;  3GEE A;  1V74 B;  4W8K A;  2JPU A;  3AG4 C;  3JSZ A;  5DLJ A;  1E85 A;  4U5H A;  4N6C A;  2D5R B;  2Q9C A;  3QMK A;  4WGZ A;  3TJ5 A;  4DRJ B;  2XLH A;  4E7Z A;  2EIM C;  3G4X A;  4LDK A;  2QUP A;  4EBK A;  3K7D A;  3C7J A;  3IQT A;  3SXY A;  3ZC4 A;  1CPR A;  4DVY P;  4D4N A;  3O6X A;  4CDV A;  1M2V B;  2AVK A;  2X51 A;  2EPO A;  5KYU A;  4NCQ A;  4D4X A;  1E2X A;  5E3A A;  3EH2 A;  3W4Y A;  2R7T A;  1SZI A;  3ZTM A;  3JYH A;  5T3T A;  1RJ9 A;  2YRF A;  3DM5 A;  3JTL O;  1E84 A;  2J7P A;  2YQY A;  3DJU B;  4IAR A;  1ZU5 A;  1A7V A;  3KPH A;  2XL6 A;  3ABL C;  4CS9 C;  5F5F A;  3C18 A;  4U5C E;  2HV7 A;  5L0J A;  4MVU A;  2XL4 A;  3V5X A;  1OR3 A;  1RKC A;  5FZT A;  4PFO A;  5T1D B;  5KYW A;  3O39 A;  4DVZ A;  1U0B B;  3DI5 A;  3Q6M A;  2B0H A;  1RCP A;  3CZ6 A;  4FWV A;  3U2L A;  1OQC A;  3VYW A;  256B A;  2BL2 A;  3NKE A;  3QVZ A;  2GAQ A;  2JD3 A;  3GAN A;  4BJ5 C;  3ATP A;  3Q6N A;  4Z9I A;  3W8H A;  3LJB A;  3AGU A;  4PAC A;  1Z7Q c;  3DZA A;  3S28 A;  3C8Z A;  3KH2 A;  4XPX A;  4JTD B;  1YVI A;  1JR8 A;  5JUA A;  2LFF A;  3ASN C;  4YT5 A;  2R25 A;  3HTK C;  5B3I A;  1V54 C;  3ASO C;  3DAG A;  2MWQ A;  3DKA A;  4JCZ A;  1CGO A;  4PFP A;  1IW7 F;  1OKK A;  2LSE A;  3AG1 C;  4G0H A;  3KYI A;  3UGP A;  1RMV A;  5BQG A;  1Z3I X;  2IXM A;  3L34 A;  3GEH A;  2HFI A;  3UGO A;  3UMI A;  2H8A A;  2YWA A;  1WAS A;  2P7V A;  1KTM A;  3U3B A;  2ZPA A;  1QLE C;  3G4Z A;  3CAX A;  3FHD A;  3JYY A;  2I8B A;  1M2O A;  1FNT c;  2L6G A;  4AL1 A;  5IY5 C;  1MQV A;  1U6H A;  3DWW A;  2H7B A;  3U2M A;  4ANJ A;  2DYR C;  5T3W A;  4N6H A;  1FAP B;  2R9R B;  2J0W A;  3LES A;  1KU2 A;  1JPJ A;  2RSE B;  1HMO A;  3N0T A;  5A6K A;  3GM1 A;  3GWN A;  1W2W A;  2YL3 A;  4JEA A;  3FDQ A;  1H7I A;  5L3Q A;  1Q0G A;  3LEO A;  4YJW A;  1ZYR F;  3PMR A;  5EGY A;  2W4M A;  4JVS A;  3ZQV A;  4BJ5 A;  5A6B A;  1OXB A;  2FGY A;  4IJJ A;  4NC3 A;  1WN0 A;  4LDQ A;  4HFK B;  2R03 A;  1SF8 A;  4O6M A;  4DXW A;  1VOM A;  2IBF A;  2M64 A;  2B0J A;  2HV6 A;  2XSE A;  4C3B A;  2YL7 A;  2LK4 A;  1H6G A;  4NTA A;  2P0N A;  4WGY A;  4EHP A;  4CBE A;  3FOP A;  3LUT B;  3DXJ F;  4E0I A;  5GPG B;  1C03 A;  4YN0 B;  1VMA A;  5B1B C;  2XS1 A;  3IHU A;  4MTO A;  3T6B A;  4KBL A;  3ABK C;  4ULW A;  3PDM P;  2XM0 A;  2L7A A;  2XLV A;  1A7D A;  4JIO A;  1MNE A;  3EFO B;  3C63 A;  1R4T A;  1OW8 A;  3IPM O;  1BR2 A;  2FAP B;  2IOQ A;  3V5Z A;  1YYX A;  2WL8 A;  3HKK A;  3N2Z B;  3O55 A;  2XLM A;  3PCV A;  4JKV A;  3OA1 A;  2QNL A;  3T6G B;  3V5Y A;  3C62 A;  3VRC A;  2GFH A;  3SNH A;  4C7O B;  3US6 A;  2NUP B;  3RVZ A;  3KMI A;  5CI8 A;  1FMW A;  4I1M A;  5DQT A;  3FAP B;  1ZHZ A;  4MVZ A;  4N06 A;  1M2V A;  3EZI A;  5L0G A;  3NKD A;  4I3M A;  5D92 A;  5DVW A;  3ZIB A;  1GM5 A;  3K66 A;  4NTB A;  1BZ4 A;  1VLT A;  3J06 A;  3LLI A;  1WGW A;  2D4U A;  3AGT A;  3M4C A;  3ABM C;  3H2V A;  3JCU Q;  1HW1 A;  3EG9 B;  1OR2 A;  4HEA J;  2IYL D;  5AGF A;  4CS9 A;  3TUL A;  5JP7 A;  2VB6 A;  4M63 A;  5KYN A;  4C7O A;  1N1C A;  3I4U A;  4E7S A;  2NUT A;  4OIP F;  4MW3 A;  3SXM A;  2ICW G;  3BRJ A;  3CSK A;  1NU7 D;  1QKR A;  2AWY A;  1PCX A;  2L9J A;  2UUH A;  2HJM A;  1T9K A;  1QZX A;  1QVX A;  3EGD A;  3MX3 A;  2HKV A;  5F28 E;  4XQ1 A;  1YDI A;  1LI7 A;  3M79 A;  4I44 A;  3UR3 C;  3TK0 A;  1HY5 A;  2LP4 A;  1G8X A;  2R7X A;  2A6H F;  2BE5 F;  3AQB A;  2RD9 A;  3H65 A;  3K33 A;  4JC7 A;  3GM3 A;  3LAY A;  2XS8 A;  3B71 A;  2FFH A;  2KGO A;  1AVO B;  3WOD F;  2A1D D;  3BEH A;  5KYX B;  3ZDL A;  2Y39 A;  4QDL A;  2L6F A;  5JSL A;  2HUJ A;  2YL0 A;  5JT4 A;  4DBQ A;  3RW0 A;  3VM6 A;  4CDA A;  3K1I C;  4P9F A;  4XLN F;  1YA7 O;  1JMW A;  1MMG A;  1ZHX A;  2WZL A;  1J8M F;  2DI3 A;  2J0X A;  3HNK A;  3ZVR A;  5KYX A;  4ZLD A;  4JW1 A;  4QI2 A;  1S05 A;  1XWJ A;  2XLO A;  3GEI A;  1FMV A;  2WB7 A;  4NY3 A;  3L8I A;  3EGX B;  2VAS A;  2OQM A;  2ZD9 A;  1TFO B;  4YT8 A;  3AJM A;  1ORJ A;  4Q7C A;  3KL4 A;  2DYS C;  4IAQ A;  4K1O A;  4O79 A;  3W2W A;  1QQ3 A;  3ITF A;  4BJ6 C;  2J9U A;  2WZF A;  3WHN A;  4CJO A;  1K05 A;  1VB5 A;  4E18 A;  4G7H F;  1HE1 A;  2XXA B;  4MVS A;  4U9E A;  4FAP B;  1Q0F A;  3OEO A;  4C3D A;  3U8V A;  5EK0 A;  4LLE A;  3CEX A;  4XTK A;  2NUT B;  4KNW A;  5KYY A;  5E33 A;  4MQ9 F;  3IQC A;  4JEB A;  1D0X A;  5KYW B;  4CSA A;  1AUE A;  4J7Y A;  1V55 C;  1E83 A;  4Q5S F;  2ASR A;  3SXZ A;  1D0Z A;  2XM4 A;  1LE4 A;  3EG9 A;  4DBR A;  3B29 A;  3ZQY A;  1HE9 A;  2KK1 A;  3TOM A;  2LCH A;  4P6I C;  4CS8 A;  1O3U A;  3QZC A;  4IGG A;  4DJ9 A;  2Q7R A;  4U5D E;  1V4A A;  2G3K A;  3LS0 A;  4UDV A;  4CIH A;  2XLW A;  3N24 A;  2XRH A;  3G50 A;  1K04 A;  2P1A A;  1H9G A;  4MW8 A;  1VTM P;  3SZR A;  1WOL A;  4CIP A;  4G7Z F;  2GDC A;  1GQA A;  4E17 A;  1NFO A;  4O6N A;  2YEV A;  3QTH A;  2XLE A;  2Q00 A;  2WZG A;  3ZWI A;  3KYJ A;  1JAF A;  4WAB A;  2HZ8 A;  3S27 A;  2OOC A;  2R7O A;  1AEP A;  2CW0 F;  1RXQ A;  4YL0 A;  4P9T A;  2YLG A;  1A0B A;  2OKU A;  5FCL A;  2KC3 A;  4CSA C;  1PD1 A;  3B0V C;  5L3V A;  4CJG A;  3NYJ A;  4H4K C;  1M57 C;  4YL1 A;  5L0F A;  3RQF A;  4JZA A;  3U9M A;  2IM8 A;  2YLD A;  4XWJ A;  3T9O A;  3TQO A;  2V3C C;  2XLD A;  3U8P A;  3U0C A;  4XEK A;  1MND A;  1LVK A;  1ZU4 A;  2H7O A;  3LLK A;  1JOG A;  3IQ5 A;  2ZXO A;  4I1O B;  1OXK A;  3RYL A;  5JRA A;  3S84 A;  3RQE A;  4GEH A;  1LI5 A;  1JRA A;  4PR9 A;  4DRI B;  3GM2 A;  4LAC B;  3C8G D;  4ULV A;  3U3F A;  1WWP A;  2L6H A;  1T6U A;  1D1C A;  5EHH A;  2A6E F;  2AP3 A;  5A6B D;  3HNI A;  2I15 A;  1NZE A;  2EIK C;  4EUK B;  1VLS A;  2KNH A;  1L3P A;  4YL3 A;  3AG3 C;  2VC9 A;  1NBB A;  4Z9J A;  1S7Z A;  3NMI A;  3TOL A;  5COG A;  4X0R A;  1HMD A;  2G62 A;  3QW0 A;  4Z9H A;  1RJ9 B;  3R2P A;  1ZHY A;  4JE9 A;  3VAY A;  3B0P A;  2VCA A;  1FR0 A;  3DE8 A;  5A6J A;  5KYU B;  4IAO A;  4HFF B;  1OCZ C;  2CDQ A;  2IXN A;  1CPQ A;  1WTY A;  2OCC C;  3F47 A;  1SYQ A;  3NMJ A;  3O10 A;  2PX0 A;  1LS1 A;  3EH1 A;  4XEV A;  2CNW A;  1MMA A;  4JJG A;  3UNG C;  2X0C A;  3FAJ A;  3LS1 A;  4B6I A;  2OJQ A;  3FVY A;  1G5Z A;  1EKY A;  4XLP F;  2HSQ A;  3DM9 B;  2LD6 A;  2YVK A;  5A6A A;  5JLI A;  1K40 A;  2ZXW C;  2OEV A;  1TQG A;  3DE9 A;  3F46 A;  3NG1 A;  3M4B A;  4GYT A;  4JJF A;  1A41 A;  2HSB A;  3TJ6 A;  1OCC C;  2J9B A;  4KNV A;  1WAT A;  3W2V A;  1RKE B;  3LNR A;  4WJ0 A;  4JTC B;  4DRH B;  2XL8 A;  3POV A;  4PJL A;  3MLG A;  2GA0 A;  3ZG1 A;  5B3S C;  3MFN A;  5DQZ A;  3DMD A;  4NTF A;  3RQG A;  3S9O A;  1BR4 A;  2A0U A;  4BJ1 A;  2KYH A;  5DS4 A;  3RIP A;  2OEX A;  2YKZ A;  2IXP A;  2Y3D A;  1DOW A;  5B1A C; 
#chains in the Genus database with same CATH homology
 4KI2 A;  4F4B A;  1NU9 C;  1TKN A;  4O7G A;  2J9V A;  2WVN A;  4QI0 A;  1LKX A;  4EBB A;  4BG0 A;  1NG1 A;  2R7V A;  3DJN B;  3UMK A;  3EGD B;  2DGJ A;  4MND A;  3X1O A;  2H7V C;  1MMD A;  2J45 A;  4YWQ A;  2YHS A;  3NRH A;  4J32 B;  3EPV A;  3Q7G A;  3TD7 A;  1Z5Z A;  2A68 F;  4CS7 A;  3L0I A;  4BJ6 A;  2EIL C;  2R7U A;  3EZH A;  2Y3B A;  2ZXP A;  3OWT A;  3IEE A;  4ZLC A;  4LER A;  2XXA A;  3WG7 C;  2YZS A;  4C3E A;  1OKK D;  4OIQ F;  4RBN A;  5CI9 A;  4K7B A;  2Q9A A;  2R7R A;  5E3C A;  2PP4 A;  4U5F E;  1PD0 A;  2G3V A;  4K0D A;  3E70 C;  4DOZ A;  2PX3 A;  2A69 F;  3SP1 A;  3CQZ A;  2V26 A;  2Q9B A;  1SMY F;  2Q3T A;  4BEJ A;  2NG1 A;  2WVO A;  4J30 B;  2Y3H A;  3ZSU A;  2R7S A;  3EHN A;  1FFH A;  3DD7 A;  4G7O F;  1M56 C;  3W8I A;  4IRU A;  2J7P D;  4OD5 A;  3RH3 A;  2O9X A;  2L81 A;  4BJT A;  4U5E E;  2R7W A;  2W45 A;  2MYS A;  1JPN A;  2PF4 E;  3SEO A;  1D1B A;  2J9W A;  2R7Q A;  5F5H A;  3S29 A;  2P6V A;  1FFT C;  3PHF 2;  1IZM A;  3Q7L A;  4YT4 A;  1MMN A;  2CGE A;  2IXO A;  3EJN A;  2E87 A;  4JCH A;  3AQC A;  2Z15 A;  4IWB A;  1Z63 A;  3T4R A;  4PK4 A;  3HJC A;  4LLC A;  3JRT A;  3I5P A;  1TWA A;  2C03 A;  2WVQ A;  4RD9 A;  2NUP A;  1FTS A;  5KYY B;  1TWG A;  1TWH A;  4U5B E;  4AE4 A;  2C04 A;  2W4B A;  3B9Q A;  2KQ9 A;  2VH3 A;  4OIR F;  3V7O A;  4Q4Z F;  1D0Y A;  4FX5 A;  1TR2 A;  1ST6 A;  2QTV A;  1J8Y F;  4OD4 A;  3KKB A;  3UMH A;  1VYK A;  2KW3 C;  4U5G A;  2ZXR A;  1Z6A A;  4PJJ A;  4KC9 A;  2QY9 A;  4AK9 A;  3SYN A;  4FES A;  3JT1 A;  4AE4 B;  1ZHT A;  2Y69 C;  1OCO C;  4OIN F;  1ZHW A;  4AX2 A;  1OCR C;  1VK5 A;  4JUR I;  1O87 A;  3K6B A;  4PJM A;  3GOD A;  4YT2 A;  2Y3G A;  3EGX A;  4CS8 C;  3I5Q A;  2W9Y A;  5BUO A;  3E9V A;  3M1C B;  3NYM A;  3EHM A;  5D91 A;  3X2Q C;  1TWC A;  2PFD A;  1Z23 A;  5DS6 A;  2EIN C;  3K1H A;  3S0X A;  2J46 A;  4HE8 D;  4PJN A;  1O5H A;  3LEV A;  4A2N B;  3NYL A;  3RKO F;  3RFY A;  3AG2 C;  4EWC A;  4OIO F;  5HSW A;  3HLZ A;  3T6J A;  2M4E A;  1BR1 A;  4RDA A;  5E2Q A;  3NDB B;  2OG2 A;  1D1A A;  2CNW D;  2KJG A;  3DAF A;  1VYI A;  3ECS A;  4O6Y A;  3EQL F;  2EIJ C;  3EFO A;  5DS5 A;  3B0U X;  4W8K A;  3JSZ A;  3AG4 C;  5DLJ A;  4U5H A;  2D5R B;  2Q9C A;  3QMK A;  4E7Z A;  2EIM C;  3K7D A;  3ZC4 A;  4DVY P;  3O6X A;  1M2V B;  2X51 A;  5KYU A;  5E3A A;  3EH2 A;  2R7T A;  1SZI A;  3JYH A;  5T3T A;  1RJ9 A;  3DM5 A;  2J7P A;  3DJU B;  1ZU5 A;  5F5F A;  3ABL C;  4CS9 C;  4U5C E;  2HV7 A;  2XL4 A;  5KYW A;  4PFO A;  5T1D B;  3O39 A;  4DVZ A;  3Q6M A;  3CZ6 A;  4FWV A;  3VYW A;  3NKE A;  2JD3 A;  3GAN A;  4BJ5 C;  3Q6N A;  3W8H A;  3LJB A;  3DZA A;  3S28 A;  3KH2 A;  3ASN C;  4YT5 A;  3HTK C;  1V54 C;  3ASO C;  3DAG A;  2MWQ A;  4PFP A;  1IW7 F;  1OKK A;  2LSE A;  3AG1 C;  4G0H A;  3UGP A;  1Z3I X;  2IXM A;  3L34 A;  3UGO A;  3UMI A;  2P7V A;  2ZPA A;  1QLE C;  3FHD A;  2I8B A;  1M2O A;  5IY5 C;  2H7B A;  4ANJ A;  2DYR C;  5T3W A;  2J0W A;  3LES A;  1KU2 A;  1JPJ A;  3N0T A;  1W2W A;  3FDQ A;  5L3Q A;  4YJW A;  1ZYR F;  3PMR A;  5EGY A;  2W4M A;  4JVS A;  4BJ5 A;  2FGY A;  4IJJ A;  4HFK B;  1SF8 A;  4O6M A;  1VOM A;  2B0J A;  2HV6 A;  2XSE A;  4C3B A;  4CBE A;  3DXJ F;  4YN0 B;  1VMA A;  5B1B C;  3T6B A;  4KBL A;  3ABK C;  4ULW A;  1MNE A;  3EFO B;  1BR2 A;  2IOQ A;  2WL8 A;  3N2Z B;  3OA1 A;  2GFH A;  3SNH A;  4C7O B;  2NUP B;  3KMI A;  5CI8 A;  1FMW A;  4I1M A;  5DQT A;  1ZHZ A;  4N06 A;  1M2V A;  3EZI A;  3NKD A;  4I3M A;  5D92 A;  5DVW A;  3ZIB A;  3K66 A;  3LLI A;  1WGW A;  3ABM C;  3JCU Q;  3EG9 B;  4HEA J;  2IYL D;  4CS9 A;  2VB6 A;  4M63 A;  5KYN A;  4C7O A;  1N1C A;  3I4U A;  4E7S A;  2NUT A;  4OIP F;  3CSK A;  1NU7 D;  2L9J A;  1PCX A;  3EGD A;  3MX3 A;  1QZX A;  4I44 A;  3UR3 C;  1G8X A;  2R7X A;  2A6H F;  2BE5 F;  3AQB A;  3H65 A;  3K33 A;  3LAY A;  2FFH A;  2KGO A;  3WOD F;  5KYX B;  2A1D D;  2Y39 A;  4QDL A;  4DBQ A;  3K1I C;  4XLN F;  1MMG A;  1ZHX A;  2WZL A;  1J8M F;  2J0X A;  3ZVR A;  5KYX A;  4ZLD A;  4JW1 A;  4QI2 A;  1FMV A;  2WB7 A;  4NY3 A;  3EGX B;  2VAS A;  4YT8 A;  4Q7C A;  3W2W A;  3KL4 A;  2DYS C;  4BJ6 C;  4O79 A;  3ITF A;  2J9U A;  2WZF A;  4G7H F;  2XXA B;  3OEO A;  4C3D A;  4LLE A;  4XTK A;  2NUT B;  4KNW A;  5KYY A;  5E33 A;  4MQ9 F;  1D0X A;  5KYW B;  4CSA A;  4Q5S F;  1V55 C;  1D0Z A;  3EG9 A;  4DBR A;  4P6I C;  4CS8 A;  3QZC A;  4U5D E;  2G3K A;  3LS0 A;  4CIH A;  3N24 A;  2XRH A;  3SZR A;  4G7Z F;  4O6N A;  2YEV A;  2WZG A;  3S27 A;  2R7O A;  2CW0 F;  5FCL A;  4CSA C;  1PD1 A;  3B0V C;  5L3V A;  3NYJ A;  4H4K C;  1M57 C;  4JZA A;  4XWJ A;  2V3C C;  4I1O B;  1MND A;  1LVK A;  1ZU4 A;  2H7O A;  3LLK A;  3RYL A;  2ZXO A;  4GEH A;  4LAC B;  5EHH A;  1D1C A;  2A6E F;  1NZE A;  2EIK C;  2KNH A;  3AG3 C;  1S7Z A;  4X0R A;  2G62 A;  1RJ9 B;  1ZHY A;  3VAY A;  3B0P A;  5KYU B;  4IAO A;  4HFF B;  1OCZ C;  2CDQ A;  2IXN A;  2OCC C;  3F47 A;  2PX0 A;  1LS1 A;  3EH1 A;  2CNW A;  1MMA A;  4JJG A;  3UNG C;  4B6I A;  3FAJ A;  3LS1 A;  3FVY A;  4XLP F;  3DM9 B;  2ZXW C;  4JJF A;  3NG1 A;  4GYT A;  3F46 A;  3W2V A;  1OCC C;  4KNV A;  3LNR A;  4WJ0 A;  3POV A;  4PJL A;  3MLG A;  3ZG1 A;  5B3S C;  5DQZ A;  3DMD A;  1BR4 A;  4BJ1 A;  5DS4 A;  3RIP A;  2IXP A;  2Y3D A;  5B1A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...