4C3DA

Hrsv m2-1, p422 crystal form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
165
Chain Sequence
LGSMSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDKSLDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX M2-1
publication title Crystal Structure of the Essential Transcription Antiterminator M2-1 Protein of Human Respiratory Syncytial Virus and Implications of its Phosphorylation.
pubmed doi rcsb
source organism Human respiratory syncytial virus
molecule tags Viral protein
total genus 59
structure length 165
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06436 Pneumovirus_M2 Pneumovirus matrix protein 2 (M2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4c3dA00
4C3DA 4CS8C 4C3BA 4CSAA 4CSAC 2L9JA 4CS9A 4CS7A 4CS9C 4C3EA 4CS8A
chains in the Genus database with same CATH superfamily
2Q4FA 1MMAA 2WZGA 2Y3DA 4G0HA 4PFOA 3W8IA 1ZU5A 2Q3TA 3OEOA 4BJ6A 3EGDB 1YZAA 1UG7A 2D5RB 1EQ1A 4J7YA 5AGFA 2IXNA 1WASA 1ZZPA 1R4TA 2J46A 3A11A 4YT8A 3JRTA 5L0CA 2XM0A 3FHDA 3KMIA 4MVRA 3JZ0A 1A7EA 2EILC 2KJGA 3ABKC 4HFFB 4DVYP 1O3UA 1MQVA 3X1OA 3IHUA 3RVYA 3U0CA 2HZ8A 2LK4A 3ITFA 2HSBA 4CS8C 2XRHA 1BR1A 4NTAA 1MNEA 1NU9C 3WAQA 1RKCA 4O6YA 4OIRF 2HFIA 3AJMA 4XPXA 4MVMA 2C04A 3T9OA 3UMKA 1FNTc 1D0YA 4JE9A 1HY5A 4ZLDA 3OWTA 2E87A 1TFKB 1XZQA 4KI2A 3RKOF 2L9JA 2Y69C 1SMYF 2GWWA 1OR3A 4NY3A 4RD9A 1C03A 2CCYA 4JCZA 2J9VA 4X0RA 1OCCC 3G4ZA 4DOZA 2G3VA 3TQOA 3U3FA 3PDMP 3ASOC 3QVZA 4ANJA 4LDQA 2Y3BA 1OCZC 2F22A 1Z3IX 4C3EA 1J8YF 1YARO 1JPJA 3QTHA 4AL0A 4E17A 2YEVA 5AC4A 3NDBB 3NKDA 1EI7A 4AK9A 4CJGA 5JUAA 1NZEA 4GEHA 4IAQA 1F1MA 2L6GA 3NYJA 4NC3A 3KYJA 2EPMX 3ZQYA 5TJ5E 3QVYA 1E84A 5A6KA 1VLTA 3L34A 3NMIA 2NUTB 1E83A 2ASRA 1YJGA 3EGDA 3ZIBA 1YZCA 2LIGA 3T4RA 4CDVA 1BBHA 256BA 1M2OA 5K0IA 4OIPF 2CGEA 4CS9C 1Q0FA 2A1DD 3I4UA 3LS1A 4XEFA 5L0HA 4XWJA 1ZHXA 4EUKB 5JT4A 4W8PA 4N4WA 2CNWA 2EINC 3W8HA 1OQCA 3RH3A 3RIPA 5KYUB 3ZTMA 3GWLA 3DXJF 2VCAA 4OIOF 3C8GB 3EJNA 2HJMA 1NFNA 3K1HA 1K04A 2J0XA 4O79A 2CYDA 4BJ5A 5DQTA 1Y6DA 4EBBA 4C3BA 2H8AA 2A6HF 4YT2A 5HV9A 2G62A 4XEKA 3NYMA 3NMJA 4JCHA 3DD7A 1K05A 1BR2A 1Y4CA 5T1DB 2P61A 1T9KA 2ZXRA 2PX3A 1C17M 3GANA 4K0DA 4MS2A 3ZQVA 3TD7A 1Z63A 1Z7Qc 5EGYA 1ST6A 4FWVA 5KYYB 4O7GA 1O87A 2I8BA 2KQ9A 4EBJA 2NSFA 2YWAA 2R25A 3MFNA 4KBLA 4YN0B 4E7SA 2EPLX 2FFHA 2QLAA 1H7IA 1V55C 3EZIA 3T6BA 5L0GA 3MBGA 5E2QA 2HV7A 3Q6NA 1FR0A 1D0ZA 1KU2A 3US6A 3TULA 2XS8A 3FXHA 2R7TA 3DWWA 2NUTA 3DKAA 4YK5A 2A69F 3L8JA 5GPGB 3O10A 4EIYA 3CAXA 5E3AA 5AC5A 2HSQA 2O9XA 1MMNA 1ZHWA 1TR2A 3JRMO 1T01A 3FVYA 3U3BA 1NG1A 3BEHA 1FFTC 3E9VA 1OCRC 3M15A 4JEBA 3HLZA 3B0UX 5B3SC 4K1OA 1FFHA 3NKEA 1NSGB 1YA9A 4RDAA 2XLMA 5KYUA 3VF0A 1SF8A 1VLSA 4CJOA 3C8GA 4P9FA 1AEPA 2IXOA 3FOPA 2YLIA 3EG9B 1HW2A 1V74B 4CSAC 1AVOB 2H7OA 4Z9IA 4WABA 1TQGA 1V4AA 4PACA 1VYIA 5BQGA 1Z5ZA 3F47A 1LS4A 1LS1A 1M2VB 3H2UA 3ECSA 3KL4A 4LACB 5L3VA 2VB6A 4U5BE 3WHNA 3DAFA 1D1BA 1OW8A 2R02A 2ZPAA 3CSKA 5KYYA 2KW3C 2LP4A 1ZW3A 1RCPA 4DJ9A 1Q0KA 2G3KA 2Q9AA 2BC5A 5KYWB 3NYLA 1T6UA 4E7ZA 1CPRA 3IQ6A 4C3DA 5F28E 5L0IA 1CGOA 2YLGA 4GYTA 1TFOB 1TKNA 3JSZA 3U8PA 1N1CA 2W4BA 3G4XA 3A9CA 3K66A 4MVQA 2QTVA 1CPQA 4IRUA 3HNJA 3KPHA 4N6HA 1RMVA 5T3TA 2J9BA 3VYWA 1LI7A 1K40A 4CBEA 4MVUA 1OW6A 4MTFA 2OU6A 3ZG1A 4M63A 4EBKA 2R05A 4DBQA 2LD6A 3EGXB 3EG9A 1EA8A 2NUPA 3C8ZA 4FESA 3L0IA 4PFPA 1BR4A 3U8VA 2ZXOA 1D0XA 4JIOA 2UUHA 5EK0A 3ABLC 1Q0MA 3I5PA 2EPOA 4JKVA 1M2VA 1R5ID 3Q7LA 1VYKA 4XPWA 4JC7A 3SXMA 4XQ1A 2R7RA 3UGPA 2GA0A 2MYSA 2R7QA 3TJ6A 4WJ0A 1RJ9B 4CDAA 4DXWA 5B3IA 2DYRC 2WVNA 3GEEA 3MYFA 1ZHYA 3IPMO 3L8IA 5D92A 2CW0F 3TOMA 1GS9A 5A6BA 2Y3HA 4MVOA 4I1OB 4D4NA 3C7JA 4Q4ZF 2VCCA 1QVXA 1ZVZA 4YL3A 2KSFA 2YLDA 3AQBA 4YT5A 2YL0A 5A69A 2OEXA 1ZU4A 5COFA 2B0JA 1GM5A 2J9UA 3N2ZB 3MX3A 1LVKA 4GQHA 4Q7CA 4B6IA 3GM2A 2P6VA 4JEAA 4YWQA 1YLMA 3ZSUA 2HV6A 2QE9A 4ER9A 1YYXA 2ZXPA 3EPVA 3GORA 1D1AA 2M64A 4PJMA 4MTGA 2WVQA 5FZTA 3S9OA 2GFHA 3SXKA 2X51A 2EPNA 1A41A 2YL1A 4FX5A 2OCCC 2XXAB 3DM9B 1PCXA 3B29A 1JPNA 2VC9A 1A7DA 2MWQA 2EIJC 3EGXA 3ZTZA 5CI9A 3R7CA 3U2LA 4J7TA 4YT4A 3W4YA 1GQAA 2ICWG 2YZSA 1U6HA 4NCQA 4HE8D 1RKEB 4OIQF 2IOQA 1O5HA 4JRZA 3LJBA 2XL4A 3O39A 3QW1A 4IGGA 3ZWIA 1APCA 3ZDLA 3HKKA 1RJ9A 2DB4A 1OXBA 2YKZA 3OA1A 1CGME 2KK1A 3ATPA 4I1MA 4KNVA 1U89A 4C7OB 1JRAA 4BJ6C 4KC9A 2R7UA 3QW0A 4U9DA 4ZLCA 4JJGA 4YJWA 2H7BA 1I4YA 3IEEA 3LS0A 3JYYA 3MYIA 4I44A 4AE4B 3FOOA 3H2VA 3ZC4A 3B9QA 4P9TA 3VAYA 2XS1A 1YAUO 3C18A 3K1IA 3G50A 4BEJA 1IZMA 1HMOA 2VCBA 3H65A 4JTCB 3IQTA 4PK4A 2HUJA 5JVEA 1H9TA 1ORSC 2RSEB 2AVKA 2L81A 1TWAA 2EPKX 3GEIA 1VMAA 4MVZA 4RBNA 4JZAA 2J7PD 4EKWA 2KYHA 2NG1A 2Q7RA 2HKVA 1SR2A 3X2QC 2WZLA 3AGUA 1EKYA 5BQHA 5KYNA 1JOGA 1FMVA 2Y3GA 3V5YA 2AWYA 4P6IC 2Z15A 1JAFA 2OQMA 2FAPB 1W2WA 4PJJA 1RKEA 1JR8A 1LM3B 1OKKD 1SYQA 3ASNC 1DOWA 4LDRA 1IW7F 3LLIA 2Q9BA 3GM3A 2HMQA 2W9YA 1BZ4A 3AG2C 5CIVA 1E85A 3JTLO 2YHSA 3C63A 2V26A 3BRJA 4W8KA 4C7OA 3FAJA 4MVSA 2W45A 4LDKA 5B1AC 2A0BA 3LEOA 2LQGA 2OOCA 3W2VA 4PR9A 1BDJB 1UFBA 2A68F 2P7VA 2R03A 3EQLF 4XLNF 1SZIA 4WGYA 3V5ZA 4AE4A 4CS8A 4Q5SF 4IJJA 3JCUQ 4WGZA 3UMHA 1I5NA 1VK5A 2AWCA 2IM8A 2OG2A 1HE1A 1MNDA 3DJUB 3M4CA 4G78A 2YL3A 2R7SA 3I5QA 4MQ9F 2IXPA 5F5FA 1TWGA 3VM6A 3TJ5A 5BUOA 4PJLA 3V7OA 2NPUA 4BJ5C 1QKRA 1WTYA 2XLOA 4IAOA 1MMDA 4QDLA 1KTMA 1QQ3A 3F46A 3FMSA 3IQ5A 2YRFA 2Y39A 3SXYA 3EHNA 3EFOB 2HMZA 3PMRA 1LPEA 3IQCA 1E2XA 1TWHA 1ZW2A 2GAQA 1CGNA 4JTDB 4MTOA 3RFYA 3QMKA 3HNLA 1A7VA 3SNHA 2A0UA 4ULVA 3FDQA 4L6RA 2L6FA 2QNLA 1H9GA 2H7VC 5D91A 3RVZA 4CIHA 1G4WR 2YVKA 3B71A 3DJNB 3RF3A 5FCLA 2QY9A 3PHF2 3S29A 3K6BA 4LLCA 3SXZA 2D4UA 3AG1C 1NFOA 5E3CA 1HW1A 2P1AA 4OD4A 4XLPF 1M57C 2M4EA 5JLIA 4JTAB 2PBEA 4N6CA 3U5SA 4HFKB 3EH2A 2ETSA 1D1CA 2TMVP 4UDVA 3GM1A 5EHHA 2XLWA 5JP7A 1L3PA 4CS9A 1Q0DA 2DI3A 2Q00A 3MLGA 1NBBA 1Q0GA 3JYHA 3L1MA 2XM4A 4BEMJ 2XLVA 2J8WA 2OJED 4G7OF 4D4XA 4QI2A 4A2NB 4OINF 4O6MA 1NU7D 4U9EA 3DE9A 4CDYA 4XTKA 5HSWA 2NSGA 5L3QA 1I4ZA 5L0JA 5KYWA 3ZVRA 1WATA 3CEXA 4FAPB 2CNWD 2JD3A 4Z9JA 2QUPA 3M4BA 1M6TA 1L7CA 3Q6MA 3EFOA 3SYNA 3LEVA 1ZHTA 2FGYA 3LNMB 3M79A 1LKXA 4MW8A 3LUTB 3POVA 4A4AA 3DMDA 4NQFA 5KYXB 3EHMA 1WN0A 2V3CC 3E70C 3U2MA 1XZPA 2ZD9A 3GWNA 5DVWA 3UGOA 3B0VC 2DYSC 3ABMC 4O6NA 3KKBA 1DOVA 3M1CB 5DS4A 5L0FA 4DRJB 3QZCA 1KNYA 1V54C 4BJTA 5F5HA 1WWPA 3CQZA 4LERA 3J06A 4KNWA 4AL1A 1VB5A 3HTKC 1GGQA 2DGJA 4N06A 2L7AA 2EIMC 2VASA 5DS6A 1MMGA 2R9RB 4DBRA 2WZFA 2YQYA 2XLEA 1TWCA 2WVOA 4HEAJ 1E86A 1NLXA 2J0WA 4U5DE 1G4US 1G5ZA 3JSEO 1ORYA 3EZHA 3T6GB 4G7ZF 4DVZA 1OCOC 3UNGC 5JRAA 3T6JA 4H54A 5E33A 4YL0A 4CIPA 2RD9A 1WOLA 1YVIA 3PCVA 5B1BC 2OEVA 4BPMA 4CSAA 5JSLA 1B68A 4J32B 1PV3A 2R7OA 2R7VA 5DS5A 2XL6A 2XLHA 4BG0A 3HNKA 3C8GD 1QSPA 1HE9A 3S27A 3UR3C 2C03A 4E18A 2PX0A 5KYXA 1VTMP 4ONSA 1LE4A 3NG1A 3DE8A 3V5XA 1T5OA 3KH2A 2BL2A 2IBFA 3S28A 2XSEA 4IARA 2X0CA 1FTSA 2LFDA 1Z6AA 3O6XA 3Q7GA 2I15A 4IB4A 2XL8A 3K33A 3K7DA 4U5FE 4ULWA 1U0BB 1PD0A 2PNOA 2XXAA 4XPYA 5CI8A 5A6JA 3LESA 5L0DA 4YL1A 1OW7A 2KGOA 3RQGA 3HJCA 4EWCA 3B0PA 1A0BA 3R2PA 4NTFA 4MW3A 3SZRA 4AX2A 4EHPA 3AG4C 4Z9HA 2B0HA 3GEHA 3U9JA 2GDCA 2A6EF 1S7ZA 3N0TA 4IWBA 4U5EE 1H6GA 1XWJA 4XEVA 3WODF 1LIHA 3EH1A 5T3WA 1JMWA 2HJ3A 2MHRA 1PD1A 2P0NA 2YL7A 4BJ1A 4CS7A 3VRCA 3RQEA 1T6QA 4QI0A 2LCHA 3AG3C 3KYIA 2Q9CA 3UMIA 5DQZA 5COMA 3AGTA 3S90A 1FMWA 2ZXWC 3RYLA 4LLEA 2WL8A 3JT1A 3WG7C 4E0IA 1QZXA 3AOUA 3TK0A 2PFDA 4J30B 4DRIB 2KC3A 2LFFA 5COGA 1J8MF 1QPUA 1G8XA 2W4MA 4MNDA 2JPUA 3TOLA 2HS5A 4CX9A 4K7BA 1HMDA 3RW0A 1WGWA 1YA7O 4I3MA 3S0XA 3DM5A 4NTBA 4JVSA 2NUPB 2IXMA 1AUEA 3DAGA 3S84A 1VOMA 5BQIA 3AQCA 1M56C 3C62A 3FAPB 1ORJA 4PJNA 5JS5A 4U5HA 1OXKA 3DI5A 1FAPB 2VH3A 4R32A 4F4BA 5A6BD 2J7PA 1LI5A 1QLEC 2BE5F 2WB7A 1LE2A 3K1IC 3LLKA 3NRHA 5DLJA 2R7WA 1YDIA 1OR2A 2PF4E 1S05A 1T6IA 1YYJA 4JJFA 1ZHZA 2KNHA 2PP4A 5IY5C 2OKUA 2L6HA 2XLDA 3W2WA 5A6AA 3RQFA 3SEOA 3LNRA 4G7HF 3U9MA 4OD5A 1Z23A 1ZYRF 2JX0A 2J9WA 3HNIA 1C02A 2UUIA 3DZAA 2AP3A 1OKKA 4JURI 3SP1A 3O55A 2EIKC 4U5CE 4E0HA 3CZ6A 2R7XA 2J45A 2AU5A 2LSEA 2IYLD 4JW1A 3N24A 2CDQA 3GODA 4H4KC 3NMKA 4U5GA 3LAYA 2OJQA 1RXQA 4DRHB
chains in the Genus database with same CATH topology
1MMAA 2WZGA 2Y3DA 4G0HA 4PFOA 3W8IA 1ZU5A 2Q3TA 3OEOA 4BJ6A 3EGDB 2D5RB 2IXNA 2J46A 4YT8A 3JRTA 3FHDA 3KMIA 2EILC 2KJGA 3ABKC 4HFFB 4DVYP 3X1OA 3ITFA 4CS8C 2XRHA 1BR1A 1MNEA 1NU9C 4O6YA 4OIRF 2C04A 3UMKA 1D0YA 4ZLDA 3OWTA 2E87A 4KI2A 3RKOF 2L9JA 2Y69C 1SMYF 4NY3A 4RD9A 2J9VA 4X0RA 1OCCC 4DOZA 2G3VA 3ASOC 4ANJA 2Y3BA 1OCZC 1Z3IX 4C3EA 1J8YF 1JPJA 2YEVA 3NDBB 3NKDA 4AK9A 1NZEA 4GEHA 3NYJA 3L34A 2NUTB 3EGDA 3ZIBA 3T4RA 1M2OA 4OIPF 2CGEA 4CS9C 3I4UA 2A1DD 3LS1A 4XWJA 1ZHXA 2CNWA 2EINC 3W8HA 3RH3A 5KYUB 3RIPA 3DXJF 4OIOF 3EJNA 3K1HA 4O79A 2J0XA 4BJ5A 4EBBA 5DQTA 4C3BA 4YT2A 2A6HF 2G62A 3NYMA 4JCHA 3DD7A 1BR2A 5T1DB 3GANA 2ZXRA 2PX3A 4K0DA 3TD7A 1Z63A 5EGYA 1ST6A 4FWVA 5KYYB 4O7GA 1O87A 2I8BA 2KQ9A 4YN0B 4E7SA 4KBLA 2FFHA 1V55C 3EZIA 3T6BA 5E2QA 2HV7A 3Q6NA 1D0ZA 1KU2A 2R7TA 2NUTA 2A69F 5E3AA 2O9XA 1MMNA 1ZHWA 1TR2A 3FVYA 1NG1A 3E9VA 1FFTC 1OCRC 3HLZA 3B0UX 5B3SC 1FFHA 3NKEA 4RDAA 5KYUA 1SF8A 2IXOA 3EG9B 4CSAC 2H7OA 1VYIA 1Z5ZA 3F47A 1LS1A 1M2VB 3KL4A 3ECSA 4LACB 5L3VA 4OIQF 2VB6A 4U5BE 3DAFA 1D1BA 2ZPAA 3CSKA 5KYYA 2KW3C 2G3KA 2Q9AA 5KYWB 3NYLA 4E7ZA 4C3DA 4GYTA 1TKNA 3JSZA 1N1CA 2W4BA 3K66A 2QTVA 4IRUA 5T3TA 3VYWA 4CBEA 3ZG1A 4M63A 4DBQA 4FESA 3EGXB 3EG9A 2NUPA 3L0IA 4PFPA 1BR4A 2ZXOA 1D0XA 3ABLC 3I5PA 1M2VA 3Q7LA 3UGPA 1VYKA 2R7RA 2MYSA 2R7QA 4WJ0A 1RJ9B 2DYRC 2WVNA 1ZHYA 5D92A 2CW0F 2Y3HA 4I1OB 4Q4ZF 3AQBA 4YT5A 1ZU4A 2B0JA 2J9UA 3N2ZB 3MX3A 1LVKA 4Q7CA 4B6IA 2P6VA 4YWQA 3ZSUA 2HV6A 2ZXPA 3EPVA 1D1AA 4PJMA 2WVQA 2GFHA 2X51A 4FX5A 2OCCC 2XXAB 3DM9B 1PCXA 1JPNA 2MWQA 3EGXA 2EIJC 5CI9A 4YT4A 2YZSA 4HE8D 2IOQA 1O5HA 3LJBA 2XL4A 3O39A 1RJ9A 3OA1A 4I1MA 4KNVA 4C7OB 4BJ6C 4KC9A 2R7UA 4ZLCA 4JJGA 4YJWA 2H7BA 3IEEA 3LS0A 4I44A 4AE4B 3ZC4A 3B9QA 3VAYA 4BEJA 1IZMA 3H65A 4PK4A 2L81A 1TWAA 4RBNA 1VMAA 4JZAA 2J7PD 2NG1A 3X2QC 2WZLA 5KYNA 1FMVA 2Y3GA 4P6IC 2Z15A 1W2WA 4PJJA 1OKKD 3ASNC 1IW7F 3LLIA 2Q9BA 2W9YA 3AG2C 2YHSA 2V26A 4W8KA 4C7OA 3FAJA 2W45A 5B1AC 3W2VA 2A68F 2P7VA 3EQLF 4XLNF 1SZIA 4AE4A 4CS8A 4Q5SF 4IJJA 3JCUQ 3UMHA 1VK5A 2OG2A 1MNDA 3DJUB 5F5FA 2R7SA 3I5QA 4MQ9F 2IXPA 1TWGA 5BUOA 4PJLA 3V7OA 4BJ5C 4IAOA 1MMDA 4QDLA 3F46A 2Y39A 3EHNA 3EFOB 3PMRA 1TWHA 3RFYA 3QMKA 3SNHA 3FDQA 4CIHA 2H7VC 5D91A 3DJNB 5FCLA 2QY9A 3PHF2 3S29A 3K6BA 4LLCA 3AG1C 5E3CA 4OD4A 4XLPF 1M57C 2M4EA 4HFKB 3EH2A 1D1CA 5EHHA 4CS9A 3MLGA 3JYHA 4G7OF 4QI2A 4A2NB 4OINF 4O6MA 1NU7D 4XTKA 5HSWA 5L3QA 5KYWA 3ZVRA 2CNWD 2JD3A 3Q6MA 3EFOA 3SYNA 3LEVA 1ZHTA 2FGYA 1LKXA 3POVA 3DMDA 5KYXB 3EHMA 2V3CC 3E70C 3UGOA 5DVWA 3B0VC 2DYSC 3ABMC 4O6NA 3KKBA 3M1CB 5DS4A 3QZCA 1V54C 4BJTA 5F5HA 3CQZA 4LERA 4KNWA 4N06A 3HTKC 2DGJA 2VASA 2EIMC 5DS6A 1MMGA 4DBRA 2WZFA 1TWCA 2WVOA 4HEAJ 2J0WA 4U5DE 3EZHA 4G7ZF 4DVZA 1OCOC 3UNGC 3T6JA 5E33A 5B1BC 4CSAA 4J32B 2R7VA 2R7OA 5DS5A 4BG0A 3UR3C 3S27A 2C03A 2PX0A 5KYXA 3NG1A 3KH2A 3S28A 2XSEA 1FTSA 3O6XA 1Z6AA 3Q7GA 3K33A 4U5FE 3K7DA 4ULWA 1PD0A 2XXAA 5CI8A 3LESA 2KGOA 4EWCA 3HJCA 3B0PA 3SZRA 4AX2A 3AG4C 3N0TA 2A6EF 1S7ZA 4IWBA 4U5EE 3WODF 3EH1A 5T3WA 1PD1A 4CS7A 4BJ1A 4QI0A 3AG3C 2Q9CA 3UMIA 5DQZA 1FMWA 2ZXWC 3RYLA 4LLEA 2WL8A 3JT1A 3WG7C 1QZXA 2PFDA 4J30B 1J8MF 1G8XA 2W4MA 4MNDA 4K7BA 1WGWA 4I3MA 3S0XA 3DM5A 4JVSA 2NUPB 2IXMA 3DAGA 1VOMA 3AQCA 1M56C 4PJNA 4U5HA 2VH3A 4F4BA 3LLKA 1QLEC 2BE5F 2J7PA 2WB7A 3K1IC 3NRHA 2R7WA 5DLJA 2PF4E 4JJFA 5IY5C 1ZHZA 2KNHA 2PP4A 3W2WA 3SEOA 3LNRA 4G7HF 4OD5A 1Z23A 1ZYRF 2J9WA 3DZAA 1OKKA 4JURI 3SP1A 2R7XA 2EIKC 4U5CE 3CZ6A 2J45A 2LSEA 2IYLD 4JW1A 3N24A 2CDQA 3GODA 4H4KC 4U5GA 3LAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3D A;  4CS8 C;  4C3B A;  4CSA A;  4CSA C;  2L9J A;  4CS9 A;  4CS7 A;  4CS9 C;  4C3E A;  4CS8 A; 
#chains in the Genus database with same CATH topology
 2Q4F A;  1MMA A;  2WZG A;  2Y3D A;  4G0H A;  4PFO A;  3W8I A;  1ZU5 A;  2Q3T A;  3OEO A;  4BJ6 A;  3EGD B;  1YZA A;  1UG7 A;  2D5R B;  1EQ1 A;  4J7Y A;  5AGF A;  2IXN A;  1WAS A;  1ZZP A;  1R4T A;  2J46 A;  3A11 A;  4YT8 A;  3JRT A;  5L0C A;  2XM0 A;  3FHD A;  3KMI A;  4MVR A;  3JZ0 A;  1A7E A;  2EIL C;  2KJG A;  3ABK C;  4HFF B;  4DVY P;  1O3U A;  1MQV A;  3X1O A;  3IHU A;  3RVY A;  3U0C A;  2HZ8 A;  2LK4 A;  3ITF A;  2HSB A;  4CS8 C;  2XRH A;  1BR1 A;  4NTA A;  1MNE A;  1NU9 C;  3WAQ A;  1RKC A;  4O6Y A;  4OIR F;  2HFI A;  3AJM A;  4XPX A;  4MVM A;  2C04 A;  3T9O A;  3UMK A;  1FNT c;  1D0Y A;  4JE9 A;  1HY5 A;  4ZLD A;  3OWT A;  2E87 A;  1TFK B;  1XZQ A;  4KI2 A;  3RKO F;  2L9J A;  2Y69 C;  1SMY F;  2GWW A;  1OR3 A;  4NY3 A;  4RD9 A;  1C03 A;  2CCY A;  4JCZ A;  2J9V A;  4X0R A;  1OCC C;  3G4Z A;  4DOZ A;  2G3V A;  3TQO A;  3U3F A;  3PDM P;  3ASO C;  3QVZ A;  4ANJ A;  4LDQ A;  2Y3B A;  1OCZ C;  2F22 A;  1Z3I X;  4C3E A;  1J8Y F;  1YAR O;  1JPJ A;  3QTH A;  4AL0 A;  4E17 A;  2YEV A;  5AC4 A;  3NDB B;  3NKD A;  1EI7 A;  4AK9 A;  4CJG A;  5JUA A;  1NZE A;  4GEH A;  4IAQ A;  1F1M A;  2L6G A;  3NYJ A;  4NC3 A;  3KYJ A;  2EPM X;  3ZQY A;  5TJ5 E;  3QVY A;  1E84 A;  5A6K A;  1VLT A;  3L34 A;  3NMI A;  2NUT B;  1E83 A;  2ASR A;  1YJG A;  3EGD A;  3ZIB A;  1YZC A;  2LIG A;  3T4R A;  4CDV A;  1BBH A;  256B A;  1M2O A;  5K0I A;  4OIP F;  2CGE A;  4CS9 C;  1Q0F A;  2A1D D;  3I4U A;  3LS1 A;  4XEF A;  5L0H A;  4XWJ A;  1ZHX A;  4EUK B;  5JT4 A;  4W8P A;  4N4W A;  2CNW A;  2EIN C;  3W8H A;  1OQC A;  3RH3 A;  3RIP A;  5KYU B;  3ZTM A;  3GWL A;  3DXJ F;  2VCA A;  4OIO F;  3C8G B;  3EJN A;  2HJM A;  1NFN A;  3K1H A;  1K04 A;  2J0X A;  4O79 A;  2CYD A;  4BJ5 A;  5DQT A;  1Y6D A;  4EBB A;  4C3B A;  2H8A A;  2A6H F;  4YT2 A;  5HV9 A;  2G62 A;  4XEK A;  3NYM A;  3NMJ A;  4JCH A;  3DD7 A;  1K05 A;  1BR2 A;  1Y4C A;  5T1D B;  2P61 A;  1T9K A;  2ZXR A;  2PX3 A;  1C17 M;  3GAN A;  4K0D A;  4MS2 A;  3ZQV A;  3TD7 A;  1Z63 A;  1Z7Q c;  5EGY A;  1ST6 A;  4FWV A;  5KYY B;  4O7G A;  1O87 A;  2I8B A;  2KQ9 A;  4EBJ A;  2NSF A;  2YWA A;  2R25 A;  3MFN A;  4KBL A;  4YN0 B;  4E7S A;  2EPL X;  2FFH A;  2QLA A;  1H7I A;  1V55 C;  3EZI A;  3T6B A;  5L0G A;  3MBG A;  5E2Q A;  2HV7 A;  3Q6N A;  1FR0 A;  1D0Z A;  1KU2 A;  3US6 A;  3TUL A;  2XS8 A;  3FXH A;  2R7T A;  3DWW A;  2NUT A;  3DKA A;  4YK5 A;  2A69 F;  3L8J A;  5GPG B;  3O10 A;  4EIY A;  3CAX A;  5E3A A;  5AC5 A;  2HSQ A;  2O9X A;  1MMN A;  1ZHW A;  1TR2 A;  3JRM O;  1T01 A;  3FVY A;  3U3B A;  1NG1 A;  3BEH A;  1FFT C;  3E9V A;  1OCR C;  3M15 A;  4JEB A;  3HLZ A;  3B0U X;  5B3S C;  4K1O A;  1FFH A;  3NKE A;  1NSG B;  1YA9 A;  4RDA A;  2XLM A;  5KYU A;  3VF0 A;  1SF8 A;  1VLS A;  4CJO A;  3C8G A;  4P9F A;  1AEP A;  2IXO A;  3FOP A;  2YLI A;  3EG9 B;  1HW2 A;  1V74 B;  4CSA C;  1AVO B;  2H7O A;  4Z9I A;  4WAB A;  1TQG A;  1V4A A;  4PAC A;  1VYI A;  5BQG A;  1Z5Z A;  3F47 A;  1LS4 A;  1LS1 A;  1M2V B;  3H2U A;  3ECS A;  3KL4 A;  4LAC B;  5L3V A;  2VB6 A;  4U5B E;  3WHN A;  3DAF A;  1D1B A;  1OW8 A;  2R02 A;  2ZPA A;  3CSK A;  5KYY A;  2KW3 C;  2LP4 A;  1ZW3 A;  1RCP A;  4DJ9 A;  1Q0K A;  2G3K A;  2Q9A A;  2BC5 A;  5KYW B;  3NYL A;  1T6U A;  4E7Z A;  1CPR A;  3IQ6 A;  4C3D A;  5F28 E;  5L0I A;  1CGO A;  2YLG A;  4GYT A;  1TFO B;  1TKN A;  3JSZ A;  3U8P A;  1N1C A;  2W4B A;  3G4X A;  3A9C A;  3K66 A;  4MVQ A;  2QTV A;  1CPQ A;  4IRU A;  3HNJ A;  3KPH A;  4N6H A;  1RMV A;  5T3T A;  2J9B A;  3VYW A;  1LI7 A;  1K40 A;  4CBE A;  4MVU A;  1OW6 A;  4MTF A;  2OU6 A;  3ZG1 A;  4M63 A;  4EBK A;  2R05 A;  4DBQ A;  2LD6 A;  3EGX B;  3EG9 A;  1EA8 A;  2NUP A;  3C8Z A;  4FES A;  3L0I A;  4PFP A;  1BR4 A;  3U8V A;  2ZXO A;  1D0X A;  4JIO A;  2UUH A;  5EK0 A;  3ABL C;  1Q0M A;  3I5P A;  2EPO A;  4JKV A;  1M2V A;  1R5I D;  3Q7L A;  1VYK A;  4XPW A;  4JC7 A;  3SXM A;  4XQ1 A;  2R7R A;  3UGP A;  2GA0 A;  2MYS A;  2R7Q A;  3TJ6 A;  4WJ0 A;  1RJ9 B;  4CDA A;  4DXW A;  5B3I A;  2DYR C;  2WVN A;  3GEE A;  3MYF A;  1ZHY A;  3IPM O;  3L8I A;  5D92 A;  2CW0 F;  3TOM A;  1GS9 A;  5A6B A;  2Y3H A;  4MVO A;  4I1O B;  4D4N A;  3C7J A;  4Q4Z F;  2VCC A;  1QVX A;  1ZVZ A;  4YL3 A;  2KSF A;  2YLD A;  3AQB A;  4YT5 A;  2YL0 A;  5A69 A;  2OEX A;  1ZU4 A;  5COF A;  2B0J A;  1GM5 A;  2J9U A;  3N2Z B;  3MX3 A;  1LVK A;  4GQH A;  4Q7C A;  4B6I A;  3GM2 A;  2P6V A;  4JEA A;  4YWQ A;  1YLM A;  3ZSU A;  2HV6 A;  2QE9 A;  4ER9 A;  1YYX A;  2ZXP A;  3EPV A;  3GOR A;  1D1A A;  2M64 A;  4PJM A;  4MTG A;  2WVQ A;  5FZT A;  3S9O A;  2GFH A;  3SXK A;  2X51 A;  2EPN A;  1A41 A;  2YL1 A;  4FX5 A;  2OCC C;  2XXA B;  3DM9 B;  1PCX A;  3B29 A;  1JPN A;  2VC9 A;  1A7D A;  2MWQ A;  2EIJ C;  3EGX A;  3ZTZ A;  5CI9 A;  3R7C A;  3U2L A;  4J7T A;  4YT4 A;  3W4Y A;  1GQA A;  2ICW G;  2YZS A;  1U6H A;  4NCQ A;  4HE8 D;  1RKE B;  4OIQ F;  2IOQ A;  1O5H A;  4JRZ A;  3LJB A;  2XL4 A;  3O39 A;  3QW1 A;  4IGG A;  3ZWI A;  1APC A;  3ZDL A;  3HKK A;  1RJ9 A;  2DB4 A;  1OXB A;  2YKZ A;  3OA1 A;  1CGM E;  2KK1 A;  3ATP A;  4I1M A;  4KNV A;  1U89 A;  4C7O B;  1JRA A;  4BJ6 C;  4KC9 A;  2R7U A;  3QW0 A;  4U9D A;  4ZLC A;  4JJG A;  4YJW A;  2H7B A;  1I4Y A;  3IEE A;  3LS0 A;  3JYY A;  3MYI A;  4I44 A;  4AE4 B;  3FOO A;  3H2V A;  3ZC4 A;  3B9Q A;  4P9T A;  3VAY A;  2XS1 A;  1YAU O;  3C18 A;  3K1I A;  3G50 A;  4BEJ A;  1IZM A;  1HMO A;  2VCB A;  3H65 A;  4JTC B;  3IQT A;  4PK4 A;  2HUJ A;  5JVE A;  1H9T A;  1ORS C;  2RSE B;  2AVK A;  2L81 A;  1TWA A;  2EPK X;  3GEI A;  1VMA A;  4MVZ A;  4RBN A;  4JZA A;  2J7P D;  4EKW A;  2KYH A;  2NG1 A;  2Q7R A;  2HKV A;  1SR2 A;  3X2Q C;  2WZL A;  3AGU A;  1EKY A;  5BQH A;  5KYN A;  1JOG A;  1FMV A;  2Y3G A;  3V5Y A;  2AWY A;  4P6I C;  2Z15 A;  1JAF A;  2OQM A;  2FAP B;  1W2W A;  4PJJ A;  1RKE A;  1JR8 A;  1LM3 B;  1OKK D;  1SYQ A;  3ASN C;  1DOW A;  4LDR A;  1IW7 F;  3LLI A;  2Q9B A;  3GM3 A;  2HMQ A;  2W9Y A;  1BZ4 A;  3AG2 C;  5CIV A;  1E85 A;  3JTL O;  2YHS A;  3C63 A;  2V26 A;  3BRJ A;  4W8K A;  4C7O A;  3FAJ A;  4MVS A;  2W45 A;  4LDK A;  5B1A C;  2A0B A;  3LEO A;  2LQG A;  2OOC A;  3W2V A;  4PR9 A;  1BDJ B;  1UFB A;  2A68 F;  2P7V A;  2R03 A;  3EQL F;  4XLN F;  1SZI A;  4WGY A;  3V5Z A;  4AE4 A;  4CS8 A;  4Q5S F;  4IJJ A;  3JCU Q;  4WGZ A;  3UMH A;  1I5N A;  1VK5 A;  2AWC A;  2IM8 A;  2OG2 A;  1HE1 A;  1MND A;  3DJU B;  3M4C A;  4G78 A;  2YL3 A;  2R7S A;  3I5Q A;  4MQ9 F;  2IXP A;  5F5F A;  1TWG A;  3VM6 A;  3TJ5 A;  5BUO A;  4PJL A;  3V7O A;  2NPU A;  4BJ5 C;  1QKR A;  1WTY A;  2XLO A;  4IAO A;  1MMD A;  4QDL A;  1KTM A;  1QQ3 A;  3F46 A;  3FMS A;  3IQ5 A;  2YRF A;  2Y39 A;  3SXY A;  3EHN A;  3EFO B;  2HMZ A;  3PMR A;  1LPE A;  3IQC A;  1E2X A;  1TWH A;  1ZW2 A;  2GAQ A;  1CGN A;  4JTD B;  4MTO A;  3RFY A;  3QMK A;  3HNL A;  1A7V A;  3SNH A;  2A0U A;  4ULV A;  3FDQ A;  4L6R A;  2L6F A;  2QNL A;  1H9G A;  2H7V C;  5D91 A;  3RVZ A;  4CIH A;  1G4W R;  2YVK A;  3B71 A;  3DJN B;  3RF3 A;  5FCL A;  2QY9 A;  3PHF 2;  3S29 A;  3K6B A;  4LLC A;  3SXZ A;  2D4U A;  3AG1 C;  1NFO A;  5E3C A;  1HW1 A;  2P1A A;  4OD4 A;  4XLP F;  1M57 C;  2M4E A;  5JLI A;  4JTA B;  2PBE A;  4N6C A;  3U5S A;  4HFK B;  3EH2 A;  2ETS A;  1D1C A;  2TMV P;  4UDV A;  3GM1 A;  5EHH A;  2XLW A;  5JP7 A;  1L3P A;  4CS9 A;  1Q0D A;  2DI3 A;  2Q00 A;  3MLG A;  1NBB A;  1Q0G A;  3JYH A;  3L1M A;  2XM4 A;  4BEM J;  2XLV A;  2J8W A;  2OJE D;  4G7O F;  4D4X A;  4QI2 A;  4A2N B;  4OIN F;  4O6M A;  1NU7 D;  4U9E A;  3DE9 A;  4CDY A;  4XTK A;  5HSW A;  2NSG A;  5L3Q A;  1I4Z A;  5L0J A;  5KYW A;  3ZVR A;  1WAT A;  3CEX A;  4FAP B;  2CNW D;  2JD3 A;  4Z9J A;  2QUP A;  3M4B A;  1M6T A;  1L7C A;  3Q6M A;  3EFO A;  3SYN A;  3LEV A;  1ZHT A;  2FGY A;  3LNM B;  3M79 A;  1LKX A;  4MW8 A;  3LUT B;  3POV A;  4A4A A;  3DMD A;  4NQF A;  5KYX B;  3EHM A;  1WN0 A;  2V3C C;  3E70 C;  3U2M A;  1XZP A;  2ZD9 A;  3GWN A;  5DVW A;  3UGO A;  3B0V C;  2DYS C;  3ABM C;  4O6N A;  3KKB A;  1DOV A;  3M1C B;  5DS4 A;  5L0F A;  4DRJ B;  3QZC A;  1KNY A;  1V54 C;  4BJT A;  5F5H A;  1WWP A;  3CQZ A;  4LER A;  3J06 A;  4KNW A;  4AL1 A;  1VB5 A;  3HTK C;  1GGQ A;  2DGJ A;  4N06 A;  2L7A A;  2EIM C;  2VAS A;  5DS6 A;  1MMG A;  2R9R B;  4DBR A;  2WZF A;  2YQY A;  2XLE A;  1TWC A;  2WVO A;  4HEA J;  1E86 A;  1NLX A;  2J0W A;  4U5D E;  1G4U S;  1G5Z A;  3JSE O;  1ORY A;  3EZH A;  3T6G B;  4G7Z F;  4DVZ A;  1OCO C;  3UNG C;  5JRA A;  3T6J A;  4H54 A;  5E33 A;  4YL0 A;  4CIP A;  2RD9 A;  1WOL A;  1YVI A;  3PCV A;  5B1B C;  2OEV A;  4BPM A;  4CSA A;  5JSL A;  1B68 A;  4J32 B;  1PV3 A;  2R7O A;  2R7V A;  5DS5 A;  2XL6 A;  2XLH A;  4BG0 A;  3HNK A;  3C8G D;  1QSP A;  1HE9 A;  3S27 A;  3UR3 C;  2C03 A;  4E18 A;  2PX0 A;  5KYX A;  1VTM P;  4ONS A;  1LE4 A;  3NG1 A;  3DE8 A;  3V5X A;  1T5O A;  3KH2 A;  2BL2 A;  2IBF A;  3S28 A;  2XSE A;  4IAR A;  2X0C A;  1FTS A;  2LFD A;  1Z6A A;  3O6X A;  3Q7G A;  2I15 A;  4IB4 A;  2XL8 A;  3K33 A;  3K7D A;  4U5F E;  4ULW A;  1U0B B;  1PD0 A;  2PNO A;  2XXA A;  4XPY A;  5CI8 A;  5A6J A;  3LES A;  5L0D A;  4YL1 A;  1OW7 A;  2KGO A;  3RQG A;  3HJC A;  4EWC A;  3B0P A;  1A0B A;  3R2P A;  4NTF A;  4MW3 A;  3SZR A;  4AX2 A;  4EHP A;  3AG4 C;  4Z9H A;  2B0H A;  3GEH A;  3U9J A;  2GDC A;  2A6E F;  1S7Z A;  3N0T A;  4IWB A;  4U5E E;  1H6G A;  1XWJ A;  4XEV A;  3WOD F;  1LIH A;  3EH1 A;  5T3W A;  1JMW A;  2HJ3 A;  2MHR A;  1PD1 A;  2P0N A;  2YL7 A;  4BJ1 A;  4CS7 A;  3VRC A;  3RQE A;  1T6Q A;  4QI0 A;  2LCH A;  3AG3 C;  3KYI A;  2Q9C A;  3UMI A;  5DQZ A;  5COM A;  3AGT A;  3S90 A;  1FMW A;  2ZXW C;  3RYL A;  4LLE A;  2WL8 A;  3JT1 A;  3WG7 C;  4E0I A;  1QZX A;  3AOU A;  3TK0 A;  2PFD A;  4J30 B;  4DRI B;  2KC3 A;  2LFF A;  5COG A;  1J8M F;  1QPU A;  1G8X A;  2W4M A;  4MND A;  2JPU A;  3TOL A;  2HS5 A;  4CX9 A;  4K7B A;  1HMD A;  3RW0 A;  1WGW A;  1YA7 O;  4I3M A;  3S0X A;  3DM5 A;  4NTB A;  4JVS A;  2NUP B;  2IXM A;  1AUE A;  3DAG A;  3S84 A;  1VOM A;  5BQI A;  3AQC A;  1M56 C;  3C62 A;  3FAP B;  1ORJ A;  4PJN A;  5JS5 A;  4U5H A;  1OXK A;  3DI5 A;  1FAP B;  2VH3 A;  4R32 A;  4F4B A;  5A6B D;  2J7P A;  1LI5 A;  1QLE C;  2BE5 F;  2WB7 A;  1LE2 A;  3K1I C;  3LLK A;  3NRH A;  5DLJ A;  2R7W A;  1YDI A;  1OR2 A;  2PF4 E;  1S05 A;  1T6I A;  1YYJ A;  4JJF A;  1ZHZ A;  2KNH A;  2PP4 A;  5IY5 C;  2OKU A;  2L6H A;  2XLD A;  3W2W A;  5A6A A;  3RQF A;  3SEO A;  3LNR A;  4G7H F;  3U9M A;  4OD5 A;  1Z23 A;  1ZYR F;  2JX0 A;  2J9W A;  3HNI A;  1C02 A;  2UUI A;  3DZA A;  2AP3 A;  1OKK A;  4JUR I;  3SP1 A;  3O55 A;  2EIK C;  4U5C E;  4E0H A;  3CZ6 A;  2R7X A;  2J45 A;  2AU5 A;  2LSE A;  2IYL D;  4JW1 A;  3N24 A;  2CDQ A;  3GOD A;  4H4K C;  3NMK A;  4U5G A;  3LAY A;  2OJQ A;  1RXQ A;  4DRH B; 
#chains in the Genus database with same CATH homology
 1MMA A;  2WZG A;  2Y3D A;  4G0H A;  4PFO A;  3W8I A;  1ZU5 A;  2Q3T A;  3OEO A;  4BJ6 A;  3EGD B;  2D5R B;  2IXN A;  2J46 A;  4YT8 A;  3JRT A;  3FHD A;  3KMI A;  2EIL C;  2KJG A;  3ABK C;  4HFF B;  4DVY P;  3X1O A;  3ITF A;  4CS8 C;  2XRH A;  1BR1 A;  1MNE A;  1NU9 C;  4O6Y A;  4OIR F;  2C04 A;  3UMK A;  1D0Y A;  4ZLD A;  3OWT A;  2E87 A;  4KI2 A;  3RKO F;  2L9J A;  2Y69 C;  1SMY F;  4NY3 A;  4RD9 A;  2J9V A;  4X0R A;  1OCC C;  4DOZ A;  2G3V A;  3ASO C;  4ANJ A;  2Y3B A;  1OCZ C;  1Z3I X;  4C3E A;  1J8Y F;  1JPJ A;  2YEV A;  3NDB B;  3NKD A;  4AK9 A;  1NZE A;  4GEH A;  3NYJ A;  3L34 A;  2NUT B;  3EGD A;  3ZIB A;  3T4R A;  1M2O A;  4OIP F;  2CGE A;  4CS9 C;  3I4U A;  2A1D D;  3LS1 A;  4XWJ A;  1ZHX A;  2CNW A;  2EIN C;  3W8H A;  3RH3 A;  5KYU B;  3RIP A;  3DXJ F;  4OIO F;  3EJN A;  3K1H A;  4O79 A;  2J0X A;  4BJ5 A;  4EBB A;  5DQT A;  4C3B A;  4YT2 A;  2A6H F;  2G62 A;  3NYM A;  4JCH A;  3DD7 A;  1BR2 A;  5T1D B;  3GAN A;  2ZXR A;  2PX3 A;  4K0D A;  3TD7 A;  1Z63 A;  5EGY A;  1ST6 A;  4FWV A;  5KYY B;  4O7G A;  1O87 A;  2I8B A;  2KQ9 A;  4YN0 B;  4E7S A;  4KBL A;  2FFH A;  1V55 C;  3EZI A;  3T6B A;  5E2Q A;  2HV7 A;  3Q6N A;  1D0Z A;  1KU2 A;  2R7T A;  2NUT A;  2A69 F;  5E3A A;  2O9X A;  1MMN A;  1ZHW A;  1TR2 A;  3FVY A;  1NG1 A;  3E9V A;  1FFT C;  1OCR C;  3HLZ A;  3B0U X;  5B3S C;  1FFH A;  3NKE A;  4RDA A;  5KYU A;  1SF8 A;  2IXO A;  3EG9 B;  4CSA C;  2H7O A;  1VYI A;  1Z5Z A;  3F47 A;  1LS1 A;  1M2V B;  3KL4 A;  3ECS A;  4LAC B;  5L3V A;  4OIQ F;  2VB6 A;  4U5B E;  3DAF A;  1D1B A;  2ZPA A;  3CSK A;  5KYY A;  2KW3 C;  2G3K A;  2Q9A A;  5KYW B;  3NYL A;  4E7Z A;  4C3D A;  4GYT A;  1TKN A;  3JSZ A;  1N1C A;  2W4B A;  3K66 A;  2QTV A;  4IRU A;  5T3T A;  3VYW A;  4CBE A;  3ZG1 A;  4M63 A;  4DBQ A;  4FES A;  3EGX B;  3EG9 A;  2NUP A;  3L0I A;  4PFP A;  1BR4 A;  2ZXO A;  1D0X A;  3ABL C;  3I5P A;  1M2V A;  3Q7L A;  3UGP A;  1VYK A;  2R7R A;  2MYS A;  2R7Q A;  4WJ0 A;  1RJ9 B;  2DYR C;  2WVN A;  1ZHY A;  5D92 A;  2CW0 F;  2Y3H A;  4I1O B;  4Q4Z F;  3AQB A;  4YT5 A;  1ZU4 A;  2B0J A;  2J9U A;  3N2Z B;  3MX3 A;  1LVK A;  4Q7C A;  4B6I A;  2P6V A;  4YWQ A;  3ZSU A;  2HV6 A;  2ZXP A;  3EPV A;  1D1A A;  4PJM A;  2WVQ A;  2GFH A;  2X51 A;  4FX5 A;  2OCC C;  2XXA B;  3DM9 B;  1PCX A;  1JPN A;  2MWQ A;  3EGX A;  2EIJ C;  5CI9 A;  4YT4 A;  2YZS A;  4HE8 D;  2IOQ A;  1O5H A;  3LJB A;  2XL4 A;  3O39 A;  1RJ9 A;  3OA1 A;  4I1M A;  4KNV A;  4C7O B;  4BJ6 C;  4KC9 A;  2R7U A;  4ZLC A;  4JJG A;  4YJW A;  2H7B A;  3IEE A;  3LS0 A;  4I44 A;  4AE4 B;  3ZC4 A;  3B9Q A;  3VAY A;  4BEJ A;  1IZM A;  3H65 A;  4PK4 A;  2L81 A;  1TWA A;  4RBN A;  1VMA A;  4JZA A;  2J7P D;  2NG1 A;  3X2Q C;  2WZL A;  5KYN A;  1FMV A;  2Y3G A;  4P6I C;  2Z15 A;  1W2W A;  4PJJ A;  1OKK D;  3ASN C;  1IW7 F;  3LLI A;  2Q9B A;  2W9Y A;  3AG2 C;  2YHS A;  2V26 A;  4W8K A;  4C7O A;  3FAJ A;  2W45 A;  5B1A C;  3W2V A;  2A68 F;  2P7V A;  3EQL F;  4XLN F;  1SZI A;  4AE4 A;  4CS8 A;  4Q5S F;  4IJJ A;  3JCU Q;  3UMH A;  1VK5 A;  2OG2 A;  1MND A;  3DJU B;  5F5F A;  2R7S A;  3I5Q A;  4MQ9 F;  2IXP A;  1TWG A;  5BUO A;  4PJL A;  3V7O A;  4BJ5 C;  4IAO A;  1MMD A;  4QDL A;  3F46 A;  2Y39 A;  3EHN A;  3EFO B;  3PMR A;  1TWH A;  3RFY A;  3QMK A;  3SNH A;  3FDQ A;  4CIH A;  2H7V C;  5D91 A;  3DJN B;  5FCL A;  2QY9 A;  3PHF 2;  3S29 A;  3K6B A;  4LLC A;  3AG1 C;  5E3C A;  4OD4 A;  4XLP F;  1M57 C;  2M4E A;  4HFK B;  3EH2 A;  1D1C A;  5EHH A;  4CS9 A;  3MLG A;  3JYH A;  4G7O F;  4QI2 A;  4A2N B;  4OIN F;  4O6M A;  1NU7 D;  4XTK A;  5HSW A;  5L3Q A;  5KYW A;  3ZVR A;  2CNW D;  2JD3 A;  3Q6M A;  3EFO A;  3SYN A;  3LEV A;  1ZHT A;  2FGY A;  1LKX A;  3POV A;  3DMD A;  5KYX B;  3EHM A;  2V3C C;  3E70 C;  3UGO A;  5DVW A;  3B0V C;  2DYS C;  3ABM C;  4O6N A;  3KKB A;  3M1C B;  5DS4 A;  3QZC A;  1V54 C;  4BJT A;  5F5H A;  3CQZ A;  4LER A;  4KNW A;  4N06 A;  3HTK C;  2DGJ A;  2VAS A;  2EIM C;  5DS6 A;  1MMG A;  4DBR A;  2WZF A;  1TWC A;  2WVO A;  4HEA J;  2J0W A;  4U5D E;  3EZH A;  4G7Z F;  4DVZ A;  1OCO C;  3UNG C;  3T6J A;  5E33 A;  5B1B C;  4CSA A;  4J32 B;  2R7V A;  2R7O A;  5DS5 A;  4BG0 A;  3UR3 C;  3S27 A;  2C03 A;  2PX0 A;  5KYX A;  3NG1 A;  3KH2 A;  3S28 A;  2XSE A;  1FTS A;  3O6X A;  1Z6A A;  3Q7G A;  3K33 A;  4U5F E;  3K7D A;  4ULW A;  1PD0 A;  2XXA A;  5CI8 A;  3LES A;  2KGO A;  4EWC A;  3HJC A;  3B0P A;  3SZR A;  4AX2 A;  3AG4 C;  3N0T A;  2A6E F;  1S7Z A;  4IWB A;  4U5E E;  3WOD F;  3EH1 A;  5T3W A;  1PD1 A;  4CS7 A;  4BJ1 A;  4QI0 A;  3AG3 C;  2Q9C A;  3UMI A;  5DQZ A;  1FMW A;  2ZXW C;  3RYL A;  4LLE A;  2WL8 A;  3JT1 A;  3WG7 C;  1QZX A;  2PFD A;  4J30 B;  1J8M F;  1G8X A;  2W4M A;  4MND A;  4K7B A;  1WGW A;  4I3M A;  3S0X A;  3DM5 A;  4JVS A;  2NUP B;  2IXM A;  3DAG A;  1VOM A;  3AQC A;  1M56 C;  4PJN A;  4U5H A;  2VH3 A;  4F4B A;  3LLK A;  1QLE C;  2BE5 F;  2J7P A;  2WB7 A;  3K1I C;  3NRH A;  2R7W A;  5DLJ A;  2PF4 E;  4JJF A;  5IY5 C;  1ZHZ A;  2KNH A;  2PP4 A;  3W2W A;  3SEO A;  3LNR A;  4G7H F;  4OD5 A;  1Z23 A;  1ZYR F;  2J9W A;  3DZA A;  1OKK A;  4JUR I;  3SP1 A;  2R7X A;  2EIK C;  4U5C E;  3CZ6 A;  2J45 A;  2LSE A;  2IYL D;  4JW1 A;  3N24 A;  2CDQ A;  3GOD A;  4H4K C;  4U5G A;  3LAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...