4C3DA

Hrsv m2-1, p422 crystal form
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
177
structure length
165
Chain Sequence
LGSMSRRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDKSLDRTEEYALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Essential Transcription Antiterminator M2-1 Protein of Human Respiratory Syncytial Virus and Implications of its Phosphorylation.
pubmed doi rcsb
source organism Human respiratory syncytial virus
molecule tags Viral protein
molecule keywords MATRIX M2-1
total genus 59
structure length 165
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06436 Pneumovirus_M2 Pneumovirus matrix protein 2 (M2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4c3dA00
4CS7A 4C3DA 4CS9C 4CSAC 4CS9A 4CSAA 2L9JA 4C3BA 4C3EA 4CS8A 4CS8C
chains in the Genus database with same CATH superfamily
3IQCA 2R03A 2R05A 3RFYA 2YHSA 2YEVA 5DS4A 2P1AA 1TWHA 5BQHA 3I5QA 1GQAA 1LE2A 2BC5A 1YA7O 3FHDA 2FFHA 4AE4A 3GEEA 4EHPA 2ZPAA 2Q00A 4WGYA 5A6AA 3QW1A 5DQTA 2W45A 1OCRC 3HNKA 4XEFA 3TQOA 4BG0A 2XLOA 3NMJA 4U5BE 2OCCC 2R25A 3VF0A 1OW7A 3K1HA 1T6UA 1VMAA 5JP7A 3I5PA 4KI2A 1JOGA 1N1CA 2L6GA 3X2QC 3TULA 1RJ9A 4K7BA 2JPUA 1DOWA 3EHNA 1VYKA 2YVKA 1D0ZA 2J0WA 3U9MA 4KNVA 2CDQA 2UUIA 2A68F 5JUAA 3VRCA 1SF8A 3EQLF 2OEVA 3DZAA 1ORYA 2YLDA 2Z15A 5EHHA 3M15A 4C7OA 1Z23A 1JMWA 2HUJA 4XLNF 2XLDA 4JURI 2NSGA 4X0RA 4JE9A 1HW1A 2KNHA 3L8IA 4EBBA 2A1DD 2WZGA 1MMAA 3ABLC 4JEBA 4U5GA 4YT8A 3AG3C 1ZU5A 2AWYA 4YT2A 3QZCA 1GS9A 1Q0GA 1H7IA 5COGA 4XLPF 4OIQF 3GM3A 3C8GB 1ZHXA 2QY9A 4MTOA 4ER9A 1F1MA 4LACB 3U2LA 2IM8A 3ZSUA 3SXYA 4EBJA 1LI5A 2Y39A 1HE1A 4BJ6A 2EIMC 2ASRA 1WN0A 4C3BA 2ETSA 4BEJA 1HMDA 2HZ8A 2OEXA 5AC4A 5EGYA 2KQ9A 4IARA 3DAGA 2YQYA 3KMIA 3ZTZA 3C63A 2P6VA 2OQMA 4K0DA 3TK0A 3LUTB 4GEHA 4MVUA 4Q7CA 2XLEA 1E85A 1FAPB 1BZ4A 3AGUA 4BJ6C 4YN0B 1S05A 2DB4A 3V5ZA 3FVYA 4XPXA 1M2VB 5E2QA 1CPQA 1MMDA 2IXNA 3HNLA 4Z9HA 2GAQA 4XQ1A 4U5EE 1M2VA 4YJWA 3RKOF 1XZPA 1CGME 3WODF 1DOVA 3W8IA 4ANJA 3EGDA 3TD7A 5L0CA 2IYLD 1G5ZA 4OIOF 3JTLO 2WB7A 3LLIA 4D4XA 2PX3A 4OD4A 4PJNA 1VYIA 2X51A 3FAPB 4YL1A 4OIRF 2OOCA 1BR4A 4H4KC 3NYMA 3EG9A 4J30B 4E7ZA 2OJED 3U8PA 4PFOA 1T5OA 4RBNA 2Y3HA 3GWLA 1UFBA 3LNMB 4NTFA 5F5FA 1OR2A 2XLHA 3EFOB 5BUOA 1A41A 3AGTA 3OEOA 4FX5A 5E3CA 2WZLA 5KYNA 2J9VA 2B0HA 5K0IA 2QLAA 1WTYA 3PDMP 3NYLA 3C62A 4JJFA 3SP1A 3GM2A 2ZXWC 1LS1A 3CAXA 4AE4B 1E83A 5A6JA 5HSWA 1ORSC 1EI7A 2XSEA 3Q6NA 4IAOA 4YK5A 2M64A 4BPMA 256BA 4CBEA 5L3VA 3NRHA 2YL0A 4XEKA 1A7VA 4IWBA 4PJMA 1CGOA 2LFFA 1VB5A 3S9OA 3H65A 3JYHA 2WZFA 4LDKA 5HV9A 1T6IA 2BL2A 2LIGA 2Q9BA 2W4MA 4EKWA 4CSAA 1FR0A 3AG4C 5CI9A 2HFIA 2VC9A 5IY5C 1A0BA 1JPNA 3BRJA 3G50A 2CCYA 4FWVA 2ZXOA 3K7DA 3M4CA 4JTDB 5T1DB 1EKYA 2D4UA 4NC3A 3NKDA 5DS5A 2W9YA 2R7QA 4QDLA 4CS8A 4CIHA 1AEPA 1QSPA 4KNWA 2O9XA 3DAFA 1VLSA 5KYUA 1XZQA 2LK4A 3FOOA 4J7TA 2VCAA 4O7GA 2E87A 2J9WA 5DS6A 5L3QA 3S0XA 2B0JA 2DI3A 3MFNA 2FAPB 4N6HA 5BQGA 3G4XA 3ZC4A 1O3UA 3C8GA 2D5RB 3DE8A 4R32A 3DD7A 1RCPA 4EWCA 1E84A 1U0BB 2RSEB 3LEVA 2XS8A 2VASA 3KL4A 2EPMX 4WGZA 4G7ZF 2WVOA 4DBQA 2OU6A 4G78A 1A7DA 1TQGA 3Q7LA 1TKNA 5T3WA 1M6TA 1YAUO 3ATPA 2KYHA 4I44A 5BQIA 1NZEA 1TFKB 3UGPA 4G7OF 3T9OA 3K1IA 3RQGA 4HFKB 2LCHA 3GORA 3CQZA 1MQVA 1M2OA 1RKCA 5AC5A 1V4AA 2YL1A 1PD0A 4WABA 5E3AA 4XPYA 4U9DA 3IQ6A 2YL3A 2OKUA 2C04A 1MMGA 1LM3B 2J0XA 3L34A 1JAFA 4B6IA 4MW8A 3T6GB 3K33A 3T6BA 1E86A 3MBGA 1GGQA 3SXKA 2EILC 3ABMC 4N6CA 4NTBA 3WHNA 2J8WA 3EH2A 1I4YA 4BJTA 4C3EA 4MVRA 4U5HA 3A11A 1NG1A 5L0HA 1M57C 4E0HA 1OXKA 2P7VA 1PV3A 3C7JA 2IXPA 3EGDB 3DM5A 4MQ9F 3EGXA 3KKBA 4P9FA 2FGYA 4ULWA 2IXMA 1GM5A 4EBKA 2PBEA 3LESA 3G4ZA 1MNDA 1ZHYA 3GODA 4ZLDA 4I1MA 1JR8A 5L0IA 3RVYA 2YLGA 4A2NB 2MYSA 3NDBB 4U9EA 4L6RA 2R7SA 5T3TA 3GEIA 4AK9A 3L8JA 3K66A 1VOMA 2YRFA 1M56C 1YZAA 2XL8A 1BBHA 2CNWD 2EPKX 5E33A 2HS5A 3DE9A 3LNRA 3VAYA 2QNLA 3T4RA 5KYWB 5D91A 1RKEA 3W2WA 3W4YA 4CSAC 4JC7A 4E17A 2AVKA 3CZ6A 1EQ1A 3M4BA 3ZG1A 3DMDA 2VH3A 5EK0A 3W2VA 1WGWA 4PACA 2A6EF 3T6JA 2H7OA 3EG9B 3S28A 1OW8A 5A6BD 5L0GA 1ZU4A 1SR2A 2Y3GA 1SMYF 4PFPA 3UNGC 4G7HF 1D0XA 2PX0A 2J9BA 3IEEA 3N0TA 3UMIA 2XM0A 2CGEA 4NQFA 3FDQA 4FAPB 3DKAA 4NCQA 4YT5A 2ZXPA 3DJNB 2GFHA 1G4US 2R02A 3QVZA 1K40A 1NU9C 3RYLA 2VCCA 2NUTA 2CW0F 1MMNA 1T9KA 4CS7A 3RQEA 1D0YA 4CJGA 3TOLA 2A6HF 3IQTA 4P9TA 3ASNC 5KYUB 1V54C 4CS8C 1OCOC 3UR3C 3WAQA 1ZVZA 2IBFA 2KW3C 3GEHA 3GM1A 3J06A 3DJUB 1ZHTA 3DXJF 1TFOB 2L81A 4DRIB 1VTMP 1G8XA 1RXQA 1ST6A 3DM9B 5F28E 4LDQA 3S29A 3JRMO 4QI0A 5KYXA 5JLIA 1OW6A 2MHRA 1PCXA 1TWAA 1C17M 2KSFA 1YYXA 3TJ5A 2X0CA 2G62A 2NUPB 4MVQA 1KNYA 1YARO 3ABKC 4JIOA 3NMKA 1T01A 1YLMA 4XEVA 4H54A 2IOQA 3V5YA 1BDJB 3MX3A 2A0BA 1APCA 3O6XA 3ZWIA 1LI7A 3SYNA 4CDYA 1AVOB 3MYIA 3F46A 4DRJB 2HV6A 2XRHA 4IB4A 5JSLA 2NPUA 3LS0A 1L3PA 4OINF 3PCVA 1HY5A 4YT4A 1WWPA 1O87A 2G3VA 2R7WA 2TMVP 1SZIA 1U89A 2OG2A 5B1BC 3LEOA 2H7VC 1OXBA 3S27A 3S84A 4PJJA 4Q4ZF 3IPMO 4PJLA 4JW1A 3OWTA 1V74B 2WVNA 3KH2A 1C02A 4AL0A 3EGXB 1WOLA 2HMQA 4O6YA 5TJ5E 4GYTA 1FMVA 5AGFA 3POVA 3O55A 2H8AA 3AJMA 3FMSA 3FOPA 1CPRA 1Z63A 2Q3TA 2Q7RA 1QPUA 3E9VA 2H7BA 3UMKA 4D4NA 2R7RA 3EZHA 1K04A 4IRUA 2LD6A 3KYIA 4F4BA 1VK5A 5D92A 4U5DE 3ZQYA 2JX0A 3KYJA 1W2WA 4EUKB 4CX9A 3EHMA 2Q9CA 1RKEB 3PHF2 2CNWA 1NFNA 2Y69C 4WJ0A 4RD9A 5JVEA 1ZHZA 1NLXA 2JD3A 2CYDA 2AU5A 1G4WR 3C18A 2HKVA 4HFFB 4W8KA 4IGGA 1ZHWA 2DYRC 1QKRA 2YKZA 1LPEA 3CEXA 2NUPA 3O10A 1UG7A 3V5XA 5KYXB 4N4WA 1Z7Qc 2Y3DA 2DYSC 3L1MA 4DJ9A 3RIPA 5KYYA 4MVZA 1NSGB 1PD1A 3EJNA 3EPVA 3L0IA 3Q7GA 4RDAA 1T6QA 3R2PA 3X1OA 2EIKC 2M4EA 4FESA 4HEAJ 4DOZA 2EPOA 4AX2A 1D1CA 1MNEA 4LLCA 1JPJA 2HSQA 2V26A 4ONSA 4UDVA 5KYWA 3C8ZA 3JYYA 3B71A 5JT4A 1NBBA 1Q0DA 1D1BA 4LDRA 1LKXA 1YA9A 2VB6A 4DRHB 1FTSA 3ITFA 3HNIA 3V7OA 3ZQVA 2F22A 4N06A 2R7TA 2GDCA 4IJJA 3ZIBA 2QUPA 3CSKA 4MS2A 3JSEO 1OR3A 2XS1A 3JRTA 3JSZA 3QMKA 4O6NA 4OD5A 4ZLCA 5FCLA 4BJ1A 4YWQA 3OA1A 1E2XA 2W4BA 2EPLX 1IZMA 4XPWA 2YWAA 1Z3IX 3RW0A 4BEMJ 2YL7A 1B68A 4K1OA 2J45A 3SNHA 1K05A 5B1AC 3ECSA 4NY3A 3S90A 3AG1C 4AL1A 3U3FA 4KBLA 4JVSA 4I3MA 1Q0MA 3GANA 2XLVA 4MNDA 4JRZA 3B9QA 2KC3A 4I1OB 1ZW3A 2NSFA 2WVQA 5CIVA 3F47A 1QVXA 1U6HA 1KTMA 1OCCC 4J7YA 3ZTMA 3MLGA 3JZ0A 4P6IC 1C03A 3U2MA 4DXWA 1YDIA 3VYWA 2XLWA 1NFOA 2HJ3A 5L0FA 1WATA 3W8HA 4CIPA 2HSBA 1LIHA 2EPNA 2L6FA 3QTHA 3QW0A 2I15A 5A69A 1LE4A 3M79A 2XXAA 1H6GA 2IXOA 1HW2A 2L6HA 3JT1A 3ZDLA 1YYJA 4JTCB 3FAJA 2GA0A 3TOMA 3HNJA 3US6A 1FFTC 2R7OA 3UMHA 4QI2A 4LLEA 2XM4A 3NMIA 5CI8A 4O79A 1H9TA 3U8VA 3EZIA 4U5CE 1BR2A 2A69F 3U9JA 3SZRA 3B0UX 1QQ3A 3SXZA 3HLZA 1Y4CA 1HMOA 4JZAA 1CGNA 4W8PA 3U5SA 1IW7F 1LS4A 2DGJA 5DVWA 2A0UA 1J8MF 5KYYB 2PP4A 3RQFA 4O6MA 4DVYP 3QVYA 5A6KA 1LVKA 1TWGA 1ZZPA 1QZXA 1RMVA 1HE9A 4JTAB 2XXAB 1I5NA 2PFDA 2WL8A 4Q5SF 2KK1A 3K6BA 4HE8D 3EH1A 4JJGA 4CS9C 4CDVA 3RH3A 3RVZA 3LLKA 3N24A 1O5HA 2G3KA 2NUTB 1V55C 2UUHA 3I4UA 3B0PA 1KU2A 4IAQA 4BJ5A 2RD9A 1R5ID 1YVIA 3MYFA 3LJBA 2ICWG 2AP3A 3AG2C 2PF4E 1XWJA 3HTKC 3LAYA 2EINC 1FFHA 2Q9AA 3Q6MA 4NTAA 4XWJA 3RF3A 4A4AA 2LP4A 2KGOA 4PK4A 2LQGA 3PMRA 1R4TA 5DLJA 4C3DA 3IHUA 3GWNA 3JCUQ 3E70C 3M1CB 2P0NA 3HKKA 4LERA 2AWCA 1QLEC 2J9UA 4CS9A 1OCZC 5FZTA 4E7SA 3LS1A 4KC9A 3R7CA 1AUEA 1YJGA 2V3CC 3FXHA 1SYQA 2ZD9A 3H2UA 2BE5F 1OQCA 2MWQA 3EFOA 3BEHA 3IQ5A 5L0JA 2P61A 4ULVA 3B0VC 2R7VA 2XL6A 5B3SC 5DQZA 2KJGA 4MW3A 4XTKA 2QTVA 4OIPF 4BJ5C 2Q4FA 2Y3BA 1VLTA 2HV7A 4M63A 4DBRA 2R7XA 2EIJC 3NG1A 4DVZA 1Y6DA 4E0IA 2LSEA 2XLMA 1J8YF 1FMWA 1FNTc 1OKKD 1D1AA 1OKKA 3A9CA 4JCZA 5L0DA 3NKEA 1L7CA 2HMZA 3C8GD 4Z9JA 2R7UA 1I4ZA 2XL4A 4CJOA 3K1IC 1Z5ZA 2L7AA 1RJ9B 1H9GA 3KPHA 2LFDA 3N2ZB 4U5FE 1ORJA 1ZYRF 2R9RB 2I8BA 5JS5A 3DI5A 3TJ6A 2NG1A 5COFA 5JRAA 1YZCA 1S7ZA 1EA8A 2C03A 2J7PD 3AOUA 4MTFA 1BR1A 3AQBA 3HJCA 4MVOA 4Z9IA 5F5HA 3ASOC 2YLIA 2L9JA 2PNOA 5GPGB 2OJQA 4JEAA 3VM6A 3U3BA 5A6BA 1Z6AA 2HJMA 3O39A 4GQHA 5COMA 3SEOA 4EIYA 3AQCA 4MVMA 4PR9A 2ZXRA 1JRAA 2YZSA 2J7PA 1A7EA 5B3IA 2VCBA 2GWWA 1TWCA 3ZVRA 3UGOA 1Q0FA 3NYJA 4CDAA 4YL3A 1TR2A 3WG7C 2J46A 2QE9A 4MVSA 1Q0KA 3H2VA 4YL0A 1NU7D 1ZW2A 4G0HA 4JKVA 3U0CA 4E18A 3SXMA 4J32B 3B29A 1WASA 4C7OB 4MTGA 4JCHA 3DWWA
chains in the Genus database with same CATH topology
3RFYA 5DS4A 2YHSA 2YEVA 1TWHA 3I5QA 3FHDA 2FFHA 4AE4A 2ZPAA 5DQTA 2W45A 1OCRC 4BG0A 4U5BE 2OCCC 3K1HA 1VMAA 4KI2A 3I5PA 1N1CA 3X2QC 1RJ9A 4K7BA 3EHNA 1VYKA 1D0ZA 2J0WA 4KNVA 2CDQA 2A68F 1SF8A 3EQLF 3DZAA 4C7OA 2Z15A 5EHHA 1Z23A 4XLNF 4JURI 4X0RA 2KNHA 4EBBA 2A1DD 2WZGA 1MMAA 3ABLC 4U5GA 3AG3C 1ZU5A 4YT2A 3QZCA 4OIQF 4XLPF 1ZHXA 2QY9A 4LACB 3ZSUA 2Y39A 4BJ6A 2EIMC 4C3BA 4BEJA 5EGYA 2KQ9A 3DAGA 3KMIA 2P6VA 4K0DA 4GEHA 4Q7CA 4BJ6C 4YN0B 3FVYA 1M2VB 5E2QA 1MMDA 2IXNA 3RKOF 4U5EE 1M2VA 4YJWA 3WODF 3W8IA 4ANJA 3EGDA 3TD7A 2IYLD 4OIOF 3LLIA 2WB7A 2PX3A 4OD4A 4PJNA 1VYIA 2X51A 4OIRF 1BR4A 4H4KC 3NYMA 3EG9A 4J30B 4E7ZA 4PFOA 4RBNA 2Y3HA 5F5FA 3EFOB 5BUOA 5E3CA 3OEOA 4FX5A 2WZLA 5KYNA 2J9VA 3NYLA 4JJFA 3SP1A 2ZXWC 1LS1A 4AE4B 5HSWA 3Q6NA 2XSEA 4IAOA 4CBEA 5L3VA 3NRHA 4IWBA 4PJMA 3H65A 3JYHA 2WZFA 2W4MA 2Q9BA 4CSAA 3AG4C 5CI9A 5IY5C 1JPNA 4FWVA 2ZXOA 3K7DA 5T1DB 3NKDA 5DS5A 2W9YA 2R7QA 4QDLA 4CS8A 4CIHA 4KNWA 2O9XA 3DAFA 5KYUA 4O7GA 5DS6A 2E87A 2J9WA 5L3QA 3S0XA 2B0JA 3ZC4A 2D5RB 3DD7A 4EWCA 3LEVA 4G7ZF 2VASA 3KL4A 2WVOA 4DBQA 3Q7LA 1TKNA 5T3WA 4I44A 1NZEA 3UGPA 4G7OF 4HFKB 3CQZA 1M2OA 1PD0A 5E3AA 2C04A 1MMGA 2J0XA 3L34A 4B6IA 3K33A 3T6BA 2EILC 3ABMC 4BJTA 4C3EA 3EH2A 4U5HA 1NG1A 1M57C 2P7VA 3EGDB 2IXPA 3DM5A 4MQ9F 3EGXA 3KKBA 4ULWA 2FGYA 2IXMA 3LESA 1MNDA 1ZHYA 3GODA 4ZLDA 4I1MA 3NDBB 4A2NB 2MYSA 2R7SA 5T3TA 4AK9A 3K66A 1VOMA 1M56C 2CNWD 5E33A 3LNRA 3VAYA 3T4RA 5KYWB 5D91A 3W2WA 4CSAC 3CZ6A 3ZG1A 3DMDA 2VH3A 3W2VA 1WGWA 2A6EF 3T6JA 2H7OA 3EG9B 3S28A 1ZU4A 3UNGC 2Y3GA 1SMYF 4PFPA 4G7HF 1D0XA 2PX0A 3IEEA 3N0TA 3UMIA 2CGEA 3FDQA 4YT5A 2ZXPA 3DJNB 2GFHA 1NU9C 3RYLA 2NUTA 2CW0F 1MMNA 4CS7A 1D0YA 2A6HF 3ASNC 5KYUB 1V54C 4CS8C 1OCOC 3UR3C 2KW3C 3DJUB 1ZHTA 3DXJF 2L81A 1G8XA 1ST6A 3DM9B 3S29A 4QI0A 5KYXA 1PCXA 1TWAA 2G62A 2NUPB 3ABKC 2IOQA 3MX3A 3O6XA 3SYNA 3F46A 2HV6A 2XRHA 3LS0A 4OINF 4YT4A 2R7WA 1O87A 2G3VA 1SZIA 2OG2A 5B1BC 2H7VC 3S27A 4Q4ZF 4PJJA 4PJLA 4JW1A 3OWTA 2WVNA 3KH2A 3EGXB 4O6YA 4GYTA 1FMVA 3POVA 1Z63A 2Q3TA 3E9VA 2H7BA 3UMKA 2R7RA 3EZHA 4IRUA 4F4BA 1VK5A 5D92A 4U5DE 1W2WA 3EHMA 2Q9CA 3PHF2 2CNWA 2Y69C 4WJ0A 4RD9A 1ZHZA 2JD3A 4HFFB 4W8KA 1ZHWA 2DYRC 2NUPA 5KYXB 2Y3DA 2DYSC 3RIPA 5KYYA 1PD1A 3EJNA 3EPVA 3L0IA 3Q7GA 4RDAA 3X1OA 2EIKC 2M4EA 4FESA 4HEAJ 4DOZA 4AX2A 1D1CA 1MNEA 4LLCA 1JPJA 2V26A 5KYWA 1D1BA 1LKXA 2VB6A 1FTSA 3ITFA 3V7OA 4N06A 2R7TA 4IJJA 3ZIBA 3CSKA 3JSZA 3JRTA 3QMKA 4O6NA 4OD5A 4ZLCA 5FCLA 4BJ1A 4YWQA 3OA1A 2W4BA 1IZMA 1Z3IX 2J45A 3SNHA 5B1AC 3ECSA 4NY3A 3AG1C 4KBLA 4JVSA 4I3MA 3GANA 4MNDA 3B9QA 4I1OB 2WVQA 3F47A 1OCCC 3MLGA 4P6IC 3VYWA 3W8HA 2XXAA 2IXOA 3JT1A 3FAJA 1FFTC 2R7OA 3UMHA 4QI2A 4LLEA 5CI8A 4O79A 3EZIA 4U5CE 1BR2A 2A69F 3B0UX 3SZRA 3HLZA 4JZAA 1IW7F 2DGJA 5DVWA 1J8MF 5KYYB 2PP4A 4O6MA 4DVYP 1LVKA 1TWGA 1QZXA 2XXAB 2PFDA 2WL8A 4Q5SF 3K6BA 4HE8D 3EH1A 4JJGA 4CS9C 3RH3A 3LLKA 3N24A 1O5HA 2G3KA 2NUTB 1V55C 3I4UA 4DVZA 3B0PA 1KU2A 4BJ5A 3LJBA 3AG2C 3HTKC 2PF4E 3Q6MA 3LAYA 2EINC 1FFHA 2Q9AA 4XWJA 2KGOA 4PK4A 3PMRA 5DLJA 4C3DA 3JCUQ 3E70C 3M1CB 4LERA 1QLEC 2J9UA 4CS9A 1OCZC 4E7SA 3LS1A 4KC9A 2V3CC 2BE5F 2MWQA 3EFOA 3B0VC 2R7VA 5B3SC 5DQZA 2KJGA 4XTKA 2QTVA 4OIPF 4BJ5C 2Y3BA 4M63A 2HV7A 2R7XA 4DBRA 2EIJC 3NG1A 2LSEA 1J8YF 1FMWA 1OKKD 1D1AA 1OKKA 3NKEA 2R7UA 2XL4A 3K1IC 1Z5ZA 1RJ9B 3N2ZB 4U5FE 1ZYRF 2I8BA 2NG1A 1S7ZA 2J7PD 2C03A 1BR1A 3AQBA 3HJCA 5F5HA 3ASOC 2L9JA 1Z6AA 3O39A 4YT8A 3SEOA 3AQCA 2ZXRA 2YZSA 2J7PA 3ZVRA 1TWCA 3UGOA 3NYJA 1TR2A 3WG7C 2J46A 1NU7D 4G0HA 4J32B 4C7OB 4JCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CS7 A;  4C3D A;  4CS9 C;  4CSA C;  4CS9 A;  4CSA A;  2L9J A;  4C3B A;  4C3E A;  4CS8 A;  4CS8 C; 
#chains in the Genus database with same CATH topology
 3IQC A;  2R03 A;  2R05 A;  3RFY A;  2YHS A;  2YEV A;  5DS4 A;  2P1A A;  1TWH A;  5BQH A;  3I5Q A;  1GQA A;  1LE2 A;  2BC5 A;  1YA7 O;  3FHD A;  2FFH A;  4AE4 A;  3GEE A;  4EHP A;  2ZPA A;  2Q00 A;  4WGY A;  5A6A A;  3QW1 A;  5DQT A;  2W45 A;  1OCR C;  3HNK A;  4XEF A;  3TQO A;  4BG0 A;  2XLO A;  3NMJ A;  4U5B E;  2OCC C;  2R25 A;  3VF0 A;  1OW7 A;  3K1H A;  1T6U A;  1VMA A;  5JP7 A;  3I5P A;  4KI2 A;  1JOG A;  1N1C A;  2L6G A;  3X2Q C;  3TUL A;  1RJ9 A;  4K7B A;  2JPU A;  1DOW A;  3EHN A;  1VYK A;  2YVK A;  1D0Z A;  2J0W A;  3U9M A;  4KNV A;  2CDQ A;  2UUI A;  2A68 F;  5JUA A;  3VRC A;  1SF8 A;  3EQL F;  2OEV A;  3DZA A;  1ORY A;  2YLD A;  2Z15 A;  5EHH A;  3M15 A;  4C7O A;  1Z23 A;  1JMW A;  2HUJ A;  4XLN F;  2XLD A;  4JUR I;  2NSG A;  4X0R A;  4JE9 A;  1HW1 A;  2KNH A;  3L8I A;  4EBB A;  2A1D D;  2WZG A;  1MMA A;  3ABL C;  4JEB A;  4U5G A;  4YT8 A;  3AG3 C;  1ZU5 A;  2AWY A;  4YT2 A;  3QZC A;  1GS9 A;  1Q0G A;  1H7I A;  5COG A;  4XLP F;  4OIQ F;  3GM3 A;  3C8G B;  1ZHX A;  2QY9 A;  4MTO A;  4ER9 A;  1F1M A;  4LAC B;  3U2L A;  2IM8 A;  3ZSU A;  3SXY A;  4EBJ A;  1LI5 A;  2Y39 A;  1HE1 A;  4BJ6 A;  2EIM C;  2ASR A;  1WN0 A;  4C3B A;  2ETS A;  4BEJ A;  1HMD A;  2HZ8 A;  2OEX A;  5AC4 A;  5EGY A;  2KQ9 A;  4IAR A;  3DAG A;  2YQY A;  3KMI A;  3ZTZ A;  3C63 A;  2P6V A;  2OQM A;  4K0D A;  3TK0 A;  3LUT B;  4GEH A;  4MVU A;  4Q7C A;  2XLE A;  1E85 A;  1FAP B;  1BZ4 A;  3AGU A;  4BJ6 C;  4YN0 B;  1S05 A;  2DB4 A;  3V5Z A;  3FVY A;  4XPX A;  1M2V B;  5E2Q A;  1CPQ A;  1MMD A;  2IXN A;  3HNL A;  4Z9H A;  2GAQ A;  4XQ1 A;  4U5E E;  1M2V A;  4YJW A;  3RKO F;  1XZP A;  1CGM E;  3WOD F;  1DOV A;  3W8I A;  4ANJ A;  3EGD A;  3TD7 A;  5L0C A;  2IYL D;  1G5Z A;  4OIO F;  3JTL O;  2WB7 A;  3LLI A;  4D4X A;  2PX3 A;  4OD4 A;  4PJN A;  1VYI A;  2X51 A;  3FAP B;  4YL1 A;  4OIR F;  2OOC A;  1BR4 A;  4H4K C;  3NYM A;  3EG9 A;  4J30 B;  4E7Z A;  2OJE D;  3U8P A;  4PFO A;  1T5O A;  4RBN A;  2Y3H A;  3GWL A;  1UFB A;  3LNM B;  4NTF A;  5F5F A;  1OR2 A;  2XLH A;  3EFO B;  5BUO A;  1A41 A;  3AGT A;  3OEO A;  4FX5 A;  5E3C A;  2WZL A;  5KYN A;  2J9V A;  2B0H A;  5K0I A;  2QLA A;  1WTY A;  3PDM P;  3NYL A;  3C62 A;  4JJF A;  3SP1 A;  3GM2 A;  2ZXW C;  1LS1 A;  3CAX A;  4AE4 B;  1E83 A;  5A6J A;  5HSW A;  1ORS C;  1EI7 A;  2XSE A;  3Q6N A;  4IAO A;  4YK5 A;  2M64 A;  4BPM A;  256B A;  4CBE A;  5L3V A;  3NRH A;  2YL0 A;  4XEK A;  1A7V A;  4IWB A;  4PJM A;  1CGO A;  2LFF A;  1VB5 A;  3S9O A;  3H65 A;  3JYH A;  2WZF A;  4LDK A;  5HV9 A;  1T6I A;  2BL2 A;  2LIG A;  2Q9B A;  2W4M A;  4EKW A;  4CSA A;  1FR0 A;  3AG4 C;  5CI9 A;  2HFI A;  2VC9 A;  5IY5 C;  1A0B A;  1JPN A;  3BRJ A;  3G50 A;  2CCY A;  4FWV A;  2ZXO A;  3K7D A;  3M4C A;  4JTD B;  5T1D B;  1EKY A;  2D4U A;  4NC3 A;  3NKD A;  5DS5 A;  2W9Y A;  2R7Q A;  4QDL A;  4CS8 A;  4CIH A;  1AEP A;  1QSP A;  4KNW A;  2O9X A;  3DAF A;  1VLS A;  5KYU A;  1XZQ A;  2LK4 A;  3FOO A;  4J7T A;  2VCA A;  4O7G A;  2E87 A;  2J9W A;  5DS6 A;  5L3Q A;  3S0X A;  2B0J A;  2DI3 A;  3MFN A;  2FAP B;  4N6H A;  5BQG A;  3G4X A;  3ZC4 A;  1O3U A;  3C8G A;  2D5R B;  3DE8 A;  4R32 A;  3DD7 A;  1RCP A;  4EWC A;  1E84 A;  1U0B B;  2RSE B;  3LEV A;  2XS8 A;  2VAS A;  3KL4 A;  2EPM X;  4WGZ A;  4G7Z F;  2WVO A;  4DBQ A;  2OU6 A;  4G78 A;  1A7D A;  1TQG A;  3Q7L A;  1TKN A;  5T3W A;  1M6T A;  1YAU O;  3ATP A;  2KYH A;  4I44 A;  5BQI A;  1NZE A;  1TFK B;  3UGP A;  4G7O F;  3T9O A;  3K1I A;  3RQG A;  4HFK B;  2LCH A;  3GOR A;  3CQZ A;  1MQV A;  1M2O A;  1RKC A;  5AC5 A;  1V4A A;  2YL1 A;  1PD0 A;  4WAB A;  5E3A A;  4XPY A;  4U9D A;  3IQ6 A;  2YL3 A;  2OKU A;  2C04 A;  1MMG A;  1LM3 B;  2J0X A;  3L34 A;  1JAF A;  4B6I A;  4MW8 A;  3T6G B;  3K33 A;  3T6B A;  1E86 A;  3MBG A;  1GGQ A;  3SXK A;  2EIL C;  3ABM C;  4N6C A;  4NTB A;  3WHN A;  2J8W A;  3EH2 A;  1I4Y A;  4BJT A;  4C3E A;  4MVR A;  4U5H A;  3A11 A;  1NG1 A;  5L0H A;  1M57 C;  4E0H A;  1OXK A;  2P7V A;  1PV3 A;  3C7J A;  2IXP A;  3EGD B;  3DM5 A;  4MQ9 F;  3EGX A;  3KKB A;  4P9F A;  2FGY A;  4ULW A;  2IXM A;  1GM5 A;  4EBK A;  2PBE A;  3LES A;  3G4Z A;  1MND A;  1ZHY A;  3GOD A;  4ZLD A;  4I1M A;  1JR8 A;  5L0I A;  3RVY A;  2YLG A;  4A2N B;  2MYS A;  3NDB B;  4U9E A;  4L6R A;  2R7S A;  5T3T A;  3GEI A;  4AK9 A;  3L8J A;  3K66 A;  1VOM A;  2YRF A;  1M56 C;  1YZA A;  2XL8 A;  1BBH A;  2CNW D;  2EPK X;  5E33 A;  2HS5 A;  3DE9 A;  3LNR A;  3VAY A;  2QNL A;  3T4R A;  5KYW B;  5D91 A;  1RKE A;  3W2W A;  3W4Y A;  4CSA C;  4JC7 A;  4E17 A;  2AVK A;  3CZ6 A;  1EQ1 A;  3M4B A;  3ZG1 A;  3DMD A;  2VH3 A;  5EK0 A;  3W2V A;  1WGW A;  4PAC A;  2A6E F;  3T6J A;  2H7O A;  3EG9 B;  3S28 A;  1OW8 A;  5A6B D;  5L0G A;  1ZU4 A;  1SR2 A;  2Y3G A;  1SMY F;  4PFP A;  3UNG C;  4G7H F;  1D0X A;  2PX0 A;  2J9B A;  3IEE A;  3N0T A;  3UMI A;  2XM0 A;  2CGE A;  4NQF A;  3FDQ A;  4FAP B;  3DKA A;  4NCQ A;  4YT5 A;  2ZXP A;  3DJN B;  2GFH A;  1G4U S;  2R02 A;  3QVZ A;  1K40 A;  1NU9 C;  3RYL A;  2VCC A;  2NUT A;  2CW0 F;  1MMN A;  1T9K A;  4CS7 A;  3RQE A;  1D0Y A;  4CJG A;  3TOL A;  2A6H F;  3IQT A;  4P9T A;  3ASN C;  5KYU B;  1V54 C;  4CS8 C;  1OCO C;  3UR3 C;  3WAQ A;  1ZVZ A;  2IBF A;  2KW3 C;  3GEH A;  3GM1 A;  3J06 A;  3DJU B;  1ZHT A;  3DXJ F;  1TFO B;  2L81 A;  4DRI B;  1VTM P;  1G8X A;  1RXQ A;  1ST6 A;  3DM9 B;  5F28 E;  4LDQ A;  3S29 A;  3JRM O;  4QI0 A;  5KYX A;  5JLI A;  1OW6 A;  2MHR A;  1PCX A;  1TWA A;  1C17 M;  2KSF A;  1YYX A;  3TJ5 A;  2X0C A;  2G62 A;  2NUP B;  4MVQ A;  1KNY A;  1YAR O;  3ABK C;  4JIO A;  3NMK A;  1T01 A;  1YLM A;  4XEV A;  4H54 A;  2IOQ A;  3V5Y A;  1BDJ B;  3MX3 A;  2A0B A;  1APC A;  3O6X A;  3ZWI A;  1LI7 A;  3SYN A;  4CDY A;  1AVO B;  3MYI A;  3F46 A;  4DRJ B;  2HV6 A;  2XRH A;  4IB4 A;  5JSL A;  2NPU A;  3LS0 A;  1L3P A;  4OIN F;  3PCV A;  1HY5 A;  4YT4 A;  1WWP A;  1O87 A;  2G3V A;  2R7W A;  2TMV P;  1SZI A;  1U89 A;  2OG2 A;  5B1B C;  3LEO A;  2H7V C;  1OXB A;  3S27 A;  3S84 A;  4PJJ A;  4Q4Z F;  3IPM O;  4PJL A;  4JW1 A;  3OWT A;  1V74 B;  2WVN A;  3KH2 A;  1C02 A;  4AL0 A;  3EGX B;  1WOL A;  2HMQ A;  4O6Y A;  5TJ5 E;  4GYT A;  1FMV A;  5AGF A;  3POV A;  3O55 A;  2H8A A;  3AJM A;  3FMS A;  3FOP A;  1CPR A;  1Z63 A;  2Q3T A;  2Q7R A;  1QPU A;  3E9V A;  2H7B A;  3UMK A;  4D4N A;  2R7R A;  3EZH A;  1K04 A;  4IRU A;  2LD6 A;  3KYI A;  4F4B A;  1VK5 A;  5D92 A;  4U5D E;  3ZQY A;  2JX0 A;  3KYJ A;  1W2W A;  4EUK B;  4CX9 A;  3EHM A;  2Q9C A;  1RKE B;  3PHF 2;  2CNW A;  1NFN A;  2Y69 C;  4WJ0 A;  4RD9 A;  5JVE A;  1ZHZ A;  1NLX A;  2JD3 A;  2CYD A;  2AU5 A;  1G4W R;  3C18 A;  2HKV A;  4HFF B;  4W8K A;  4IGG A;  1ZHW A;  2DYR C;  1QKR A;  2YKZ A;  1LPE A;  3CEX A;  2NUP A;  3O10 A;  1UG7 A;  3V5X A;  5KYX B;  4N4W A;  1Z7Q c;  2Y3D A;  2DYS C;  3L1M A;  4DJ9 A;  3RIP A;  5KYY A;  4MVZ A;  1NSG B;  1PD1 A;  3EJN A;  3EPV A;  3L0I A;  3Q7G A;  4RDA A;  1T6Q A;  3R2P A;  3X1O A;  2EIK C;  2M4E A;  4FES A;  4HEA J;  4DOZ A;  2EPO A;  4AX2 A;  1D1C A;  1MNE A;  4LLC A;  1JPJ A;  2HSQ A;  2V26 A;  4ONS A;  4UDV A;  5KYW A;  3C8Z A;  3JYY A;  3B71 A;  5JT4 A;  1NBB A;  1Q0D A;  1D1B A;  4LDR A;  1LKX A;  1YA9 A;  2VB6 A;  4DRH B;  1FTS A;  3ITF A;  3HNI A;  3V7O A;  3ZQV A;  2F22 A;  4N06 A;  2R7T A;  2GDC A;  4IJJ A;  3ZIB A;  2QUP A;  3CSK A;  4MS2 A;  3JSE O;  1OR3 A;  2XS1 A;  3JRT A;  3JSZ A;  3QMK A;  4O6N A;  4OD5 A;  4ZLC A;  5FCL A;  4BJ1 A;  4YWQ A;  3OA1 A;  1E2X A;  2W4B A;  2EPL X;  1IZM A;  4XPW A;  2YWA A;  1Z3I X;  3RW0 A;  4BEM J;  2YL7 A;  1B68 A;  4K1O A;  2J45 A;  3SNH A;  1K05 A;  5B1A C;  3ECS A;  4NY3 A;  3S90 A;  3AG1 C;  4AL1 A;  3U3F A;  4KBL A;  4JVS A;  4I3M A;  1Q0M A;  3GAN A;  2XLV A;  4MND A;  4JRZ A;  3B9Q A;  2KC3 A;  4I1O B;  1ZW3 A;  2NSF A;  2WVQ A;  5CIV A;  3F47 A;  1QVX A;  1U6H A;  1KTM A;  1OCC C;  4J7Y A;  3ZTM A;  3MLG A;  3JZ0 A;  4P6I C;  1C03 A;  3U2M A;  4DXW A;  1YDI A;  3VYW A;  2XLW A;  1NFO A;  2HJ3 A;  5L0F A;  1WAT A;  3W8H A;  4CIP A;  2HSB A;  1LIH A;  2EPN A;  2L6F A;  3QTH A;  3QW0 A;  2I15 A;  5A69 A;  1LE4 A;  3M79 A;  2XXA A;  1H6G A;  2IXO A;  1HW2 A;  2L6H A;  3JT1 A;  3ZDL A;  1YYJ A;  4JTC B;  3FAJ A;  2GA0 A;  3TOM A;  3HNJ A;  3US6 A;  1FFT C;  2R7O A;  3UMH A;  4QI2 A;  4LLE A;  2XM4 A;  3NMI A;  5CI8 A;  4O79 A;  1H9T A;  3U8V A;  3EZI A;  4U5C E;  1BR2 A;  2A69 F;  3U9J A;  3SZR A;  3B0U X;  1QQ3 A;  3SXZ A;  3HLZ A;  1Y4C A;  1HMO A;  4JZA A;  1CGN A;  4W8P A;  3U5S A;  1IW7 F;  1LS4 A;  2DGJ A;  5DVW A;  2A0U A;  1J8M F;  5KYY B;  2PP4 A;  3RQF A;  4O6M A;  4DVY P;  3QVY A;  5A6K A;  1LVK A;  1TWG A;  1ZZP A;  1QZX A;  1RMV A;  1HE9 A;  4JTA B;  2XXA B;  1I5N A;  2PFD A;  2WL8 A;  4Q5S F;  2KK1 A;  3K6B A;  4HE8 D;  3EH1 A;  4JJG A;  4CS9 C;  4CDV A;  3RH3 A;  3RVZ A;  3LLK A;  3N24 A;  1O5H A;  2G3K A;  2NUT B;  1V55 C;  2UUH A;  3I4U A;  3B0P A;  1KU2 A;  4IAQ A;  4BJ5 A;  2RD9 A;  1R5I D;  1YVI A;  3MYF A;  3LJB A;  2ICW G;  2AP3 A;  3AG2 C;  2PF4 E;  1XWJ A;  3HTK C;  3LAY A;  2EIN C;  1FFH A;  2Q9A A;  3Q6M A;  4NTA A;  4XWJ A;  3RF3 A;  4A4A A;  2LP4 A;  2KGO A;  4PK4 A;  2LQG A;  3PMR A;  1R4T A;  5DLJ A;  4C3D A;  3IHU A;  3GWN A;  3JCU Q;  3E70 C;  3M1C B;  2P0N A;  3HKK A;  4LER A;  2AWC A;  1QLE C;  2J9U A;  4CS9 A;  1OCZ C;  5FZT A;  4E7S A;  3LS1 A;  4KC9 A;  3R7C A;  1AUE A;  1YJG A;  2V3C C;  3FXH A;  1SYQ A;  2ZD9 A;  3H2U A;  2BE5 F;  1OQC A;  2MWQ A;  3EFO A;  3BEH A;  3IQ5 A;  5L0J A;  2P61 A;  4ULV A;  3B0V C;  2R7V A;  2XL6 A;  5B3S C;  5DQZ A;  2KJG A;  4MW3 A;  4XTK A;  2QTV A;  4OIP F;  4BJ5 C;  2Q4F A;  2Y3B A;  1VLT A;  2HV7 A;  4M63 A;  4DBR A;  2R7X A;  2EIJ C;  3NG1 A;  4DVZ A;  1Y6D A;  4E0I A;  2LSE A;  2XLM A;  1J8Y F;  1FMW A;  1FNT c;  1OKK D;  1D1A A;  1OKK A;  3A9C A;  4JCZ A;  5L0D A;  3NKE A;  1L7C A;  2HMZ A;  3C8G D;  4Z9J A;  2R7U A;  1I4Z A;  2XL4 A;  4CJO A;  3K1I C;  1Z5Z A;  2L7A A;  1RJ9 B;  1H9G A;  3KPH A;  2LFD A;  3N2Z B;  4U5F E;  1ORJ A;  1ZYR F;  2R9R B;  2I8B A;  5JS5 A;  3DI5 A;  3TJ6 A;  2NG1 A;  5COF A;  5JRA A;  1YZC A;  1S7Z A;  1EA8 A;  2C03 A;  2J7P D;  3AOU A;  4MTF A;  1BR1 A;  3AQB A;  3HJC A;  4MVO A;  4Z9I A;  5F5H A;  3ASO C;  2YLI A;  2L9J A;  2PNO A;  5GPG B;  2OJQ A;  4JEA A;  3VM6 A;  3U3B A;  5A6B A;  1Z6A A;  2HJM A;  3O39 A;  4GQH A;  5COM A;  3SEO A;  4EIY A;  3AQC A;  4MVM A;  4PR9 A;  2ZXR A;  1JRA A;  2YZS A;  2J7P A;  1A7E A;  5B3I A;  2VCB A;  2GWW A;  1TWC A;  3ZVR A;  3UGO A;  1Q0F A;  3NYJ A;  4CDA A;  4YL3 A;  1TR2 A;  3WG7 C;  2J46 A;  2QE9 A;  4MVS A;  1Q0K A;  3H2V A;  4YL0 A;  1NU7 D;  1ZW2 A;  4G0H A;  4JKV A;  3U0C A;  4E18 A;  3SXM A;  4J32 B;  3B29 A;  1WAS A;  4C7O B;  4MTG A;  4JCH A;  3DWW A; 
#chains in the Genus database with same CATH homology
 3RFY A;  5DS4 A;  2YHS A;  2YEV A;  1TWH A;  3I5Q A;  3FHD A;  2FFH A;  4AE4 A;  2ZPA A;  5DQT A;  2W45 A;  1OCR C;  4BG0 A;  4U5B E;  2OCC C;  3K1H A;  1VMA A;  4KI2 A;  3I5P A;  1N1C A;  3X2Q C;  1RJ9 A;  4K7B A;  3EHN A;  1VYK A;  1D0Z A;  2J0W A;  4KNV A;  2CDQ A;  2A68 F;  1SF8 A;  3EQL F;  3DZA A;  4C7O A;  2Z15 A;  5EHH A;  1Z23 A;  4XLN F;  4JUR I;  4X0R A;  2KNH A;  4EBB A;  2A1D D;  2WZG A;  1MMA A;  3ABL C;  4U5G A;  3AG3 C;  1ZU5 A;  4YT2 A;  3QZC A;  4OIQ F;  4XLP F;  1ZHX A;  2QY9 A;  4LAC B;  3ZSU A;  2Y39 A;  4BJ6 A;  2EIM C;  4C3B A;  4BEJ A;  5EGY A;  2KQ9 A;  3DAG A;  3KMI A;  2P6V A;  4K0D A;  4GEH A;  4Q7C A;  4BJ6 C;  4YN0 B;  3FVY A;  1M2V B;  5E2Q A;  1MMD A;  2IXN A;  3RKO F;  4U5E E;  1M2V A;  4YJW A;  3WOD F;  3W8I A;  4ANJ A;  3EGD A;  3TD7 A;  2IYL D;  4OIO F;  3LLI A;  2WB7 A;  2PX3 A;  4OD4 A;  4PJN A;  1VYI A;  2X51 A;  4OIR F;  1BR4 A;  4H4K C;  3NYM A;  3EG9 A;  4J30 B;  4E7Z A;  4PFO A;  4RBN A;  2Y3H A;  5F5F A;  3EFO B;  5BUO A;  5E3C A;  3OEO A;  4FX5 A;  2WZL A;  5KYN A;  2J9V A;  3NYL A;  4JJF A;  3SP1 A;  2ZXW C;  1LS1 A;  4AE4 B;  5HSW A;  3Q6N A;  2XSE A;  4IAO A;  4CBE A;  5L3V A;  3NRH A;  4IWB A;  4PJM A;  3H65 A;  3JYH A;  2WZF A;  2W4M A;  2Q9B A;  4CSA A;  3AG4 C;  5CI9 A;  5IY5 C;  1JPN A;  4FWV A;  2ZXO A;  3K7D A;  5T1D B;  3NKD A;  5DS5 A;  2W9Y A;  2R7Q A;  4QDL A;  4CS8 A;  4CIH A;  4KNW A;  2O9X A;  3DAF A;  5KYU A;  4O7G A;  5DS6 A;  2E87 A;  2J9W A;  5L3Q A;  3S0X A;  2B0J A;  3ZC4 A;  2D5R B;  3DD7 A;  4EWC A;  3LEV A;  4G7Z F;  2VAS A;  3KL4 A;  2WVO A;  4DBQ A;  3Q7L A;  1TKN A;  5T3W A;  4I44 A;  1NZE A;  3UGP A;  4G7O F;  4HFK B;  3CQZ A;  1M2O A;  1PD0 A;  5E3A A;  2C04 A;  1MMG A;  2J0X A;  3L34 A;  4B6I A;  3K33 A;  3T6B A;  2EIL C;  3ABM C;  4BJT A;  4C3E A;  3EH2 A;  4U5H A;  1NG1 A;  1M57 C;  2P7V A;  3EGD B;  2IXP A;  3DM5 A;  4MQ9 F;  3EGX A;  3KKB A;  4ULW A;  2FGY A;  2IXM A;  3LES A;  1MND A;  1ZHY A;  3GOD A;  4ZLD A;  4I1M A;  3NDB B;  4A2N B;  2MYS A;  2R7S A;  5T3T A;  4AK9 A;  3K66 A;  1VOM A;  1M56 C;  2CNW D;  5E33 A;  3LNR A;  3VAY A;  3T4R A;  5KYW B;  5D91 A;  3W2W A;  4CSA C;  3CZ6 A;  3ZG1 A;  3DMD A;  2VH3 A;  3W2V A;  1WGW A;  2A6E F;  3T6J A;  2H7O A;  3EG9 B;  3S28 A;  1ZU4 A;  3UNG C;  2Y3G A;  1SMY F;  4PFP A;  4G7H F;  1D0X A;  2PX0 A;  3IEE A;  3N0T A;  3UMI A;  2CGE A;  3FDQ A;  4YT5 A;  2ZXP A;  3DJN B;  2GFH A;  1NU9 C;  3RYL A;  2NUT A;  2CW0 F;  1MMN A;  4CS7 A;  1D0Y A;  2A6H F;  3ASN C;  5KYU B;  1V54 C;  4CS8 C;  1OCO C;  3UR3 C;  2KW3 C;  3DJU B;  1ZHT A;  3DXJ F;  2L81 A;  1G8X A;  1ST6 A;  3DM9 B;  3S29 A;  4QI0 A;  5KYX A;  1PCX A;  1TWA A;  2G62 A;  2NUP B;  3ABK C;  2IOQ A;  3MX3 A;  3O6X A;  3SYN A;  3F46 A;  2HV6 A;  2XRH A;  3LS0 A;  4OIN F;  4YT4 A;  2R7W A;  1O87 A;  2G3V A;  1SZI A;  2OG2 A;  5B1B C;  2H7V C;  3S27 A;  4Q4Z F;  4PJJ A;  4PJL A;  4JW1 A;  3OWT A;  2WVN A;  3KH2 A;  3EGX B;  4O6Y A;  4GYT A;  1FMV A;  3POV A;  1Z63 A;  2Q3T A;  3E9V A;  2H7B A;  3UMK A;  2R7R A;  3EZH A;  4IRU A;  4F4B A;  1VK5 A;  5D92 A;  4U5D E;  1W2W A;  3EHM A;  2Q9C A;  3PHF 2;  2CNW A;  2Y69 C;  4WJ0 A;  4RD9 A;  1ZHZ A;  2JD3 A;  4HFF B;  4W8K A;  1ZHW A;  2DYR C;  2NUP A;  5KYX B;  2Y3D A;  2DYS C;  3RIP A;  5KYY A;  1PD1 A;  3EJN A;  3EPV A;  3L0I A;  3Q7G A;  4RDA A;  3X1O A;  2EIK C;  2M4E A;  4FES A;  4HEA J;  4DOZ A;  4AX2 A;  1D1C A;  1MNE A;  4LLC A;  1JPJ A;  2V26 A;  5KYW A;  1D1B A;  1LKX A;  2VB6 A;  1FTS A;  3ITF A;  3V7O A;  4N06 A;  2R7T A;  4IJJ A;  3ZIB A;  3CSK A;  3JSZ A;  3JRT A;  3QMK A;  4O6N A;  4OD5 A;  4ZLC A;  5FCL A;  4BJ1 A;  4YWQ A;  3OA1 A;  2W4B A;  1IZM A;  1Z3I X;  2J45 A;  3SNH A;  5B1A C;  3ECS A;  4NY3 A;  3AG1 C;  4KBL A;  4JVS A;  4I3M A;  3GAN A;  4MND A;  3B9Q A;  4I1O B;  2WVQ A;  3F47 A;  1OCC C;  3MLG A;  4P6I C;  3VYW A;  3W8H A;  2XXA A;  2IXO A;  3JT1 A;  3FAJ A;  1FFT C;  2R7O A;  3UMH A;  4QI2 A;  4LLE A;  5CI8 A;  4O79 A;  3EZI A;  4U5C E;  1BR2 A;  2A69 F;  3B0U X;  3SZR A;  3HLZ A;  4JZA A;  1IW7 F;  2DGJ A;  5DVW A;  1J8M F;  5KYY B;  2PP4 A;  4O6M A;  4DVY P;  1LVK A;  1TWG A;  1QZX A;  2XXA B;  2PFD A;  2WL8 A;  4Q5S F;  3K6B A;  4HE8 D;  3EH1 A;  4JJG A;  4CS9 C;  3RH3 A;  3LLK A;  3N24 A;  1O5H A;  2G3K A;  2NUT B;  1V55 C;  3I4U A;  4DVZ A;  3B0P A;  1KU2 A;  4BJ5 A;  3LJB A;  3AG2 C;  3HTK C;  2PF4 E;  3Q6M A;  3LAY A;  2EIN C;  1FFH A;  2Q9A A;  4XWJ A;  2KGO A;  4PK4 A;  3PMR A;  5DLJ A;  4C3D A;  3JCU Q;  3E70 C;  3M1C B;  4LER A;  1QLE C;  2J9U A;  4CS9 A;  1OCZ C;  4E7S A;  3LS1 A;  4KC9 A;  2V3C C;  2BE5 F;  2MWQ A;  3EFO A;  3B0V C;  2R7V A;  5B3S C;  5DQZ A;  2KJG A;  4XTK A;  2QTV A;  4OIP F;  4BJ5 C;  2Y3B A;  4M63 A;  2HV7 A;  2R7X A;  4DBR A;  2EIJ C;  3NG1 A;  2LSE A;  1J8Y F;  1FMW A;  1OKK D;  1D1A A;  1OKK A;  3NKE A;  2R7U A;  2XL4 A;  3K1I C;  1Z5Z A;  1RJ9 B;  3N2Z B;  4U5F E;  1ZYR F;  2I8B A;  2NG1 A;  1S7Z A;  2J7P D;  2C03 A;  1BR1 A;  3AQB A;  3HJC A;  5F5H A;  3ASO C;  2L9J A;  1Z6A A;  3O39 A;  4YT8 A;  3SEO A;  3AQC A;  2ZXR A;  2YZS A;  2J7P A;  3ZVR A;  1TWC A;  3UGO A;  3NYJ A;  1TR2 A;  3WG7 C;  2J46 A;  1NU7 D;  4G0H A;  4J32 B;  4C7O B;  4JCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...