1YDIA

Human vinculin head domain (vh1, 1-258) in complex with human alpha-actinin's vinculin-binding site (residues 731-760)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
263
structure length
256
Chain Sequence
HHHHHMPVFHTRTIESILEPVAQQISHLVIMHEAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Dynamics of {alpha}-Actinin-Vinculin Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
molecule keywords vinculin isoform VCL
total genus 108
structure length 256
sequence length 263
ec nomenclature
pdb deposition date 2004-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1ydiA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1ydiA01
4DJ9A 5L0FA 1ZVZA 2HSQA 4IGGA 3VF0A 5L0HA 5L0DA 1U89A 1RKEA 1T01A 2GDCA 5L0JA 1ST6A 2GWWA 3H2UA 3MYIA 2X0CA 1ZW2A 1H6GA 2LQGA 4EHPA 3T6GB 4P9TA 1RKCA 3TJ6A 4E18A 1YDIA 1DOWA 1L7CA 1RKEB 5L0GA 3TJ5A 1DOVA 4ONSA 4E17A 4K1OA 1ZW3A 4PR9A 3RF3A 3ZDLA 2L7AA 2IBFA 3H2VA 5L0CA 2B0HA 1XWJA 5L0IA 5FZTA 1TR2A 1QKRA 1SYQA 3S90A 1U6HA 4W8PA
chains in the Genus database with same CATH superfamily
1H9GA 2G3VA 4KC9A 4IB4A 1LS1A 4NCQA 3M1CB 4DRJB 5F28E 4LLEA 2R7QA 2LFDA 3B0PA 3FOPA 2Q9CA 3NKEA 4Z9JA 2TMVP 2A6EF 5BQIA 1ORSC 1Y6DA 4O7GA 5HV9A 5JVEA 4ZLDA 2P61A 2XS1A 2VASA 3EG9B 4I1OB 3TJ6A 4CSAC 2CGEA 1VYKA 5TJ5E 3A9CA 3QTHA 4MVUA 5E3AA 1HW1A 3RQFA 5COFA 2J9UA 5DQTA 4JE9A 3PHF2 4MVRA 3TQOA 5A6BA 1RXQA 1G8XA 3C8GA 4BPMA 2IM8A 1EI7A 2QE9A 1UFBA 2J7PD 1M2VA 3HNIA 4PJJA 3WHNA 4E0HA 1NU7D 3S27A 2P0NA 2LIGA 2QTVA 1Z6AA 3GEEA 3IHUA 1TR2A 4JRZA 4YN0B 2XXAA 2R7UA 1KU2A 4JCZA 3S90A 2Y39A 4JKVA 2W45A 4YL0A 1D1AA 2C04A 3S9OA 4O6NA 1CPQA 4G0HA 3S29A 4J7YA 4BJ1A 4C7OA 1C03A 3HNJA 2YLGA 4XTKA 2KW3C 3Q6NA 2J9VA 1CPRA 1K04A 2XXAB 3NDBB 3DM9B 1Z3IX 1YZAA 3MYIA 4W8KA 1OCZC 1ZW2A 3RQGA 3C62A 3PCVA 3U2LA 1HE1A 2A69F 2DYRC 4PACA 3PMRA 2D4UA 2J7PA 2R03A 4BJ5C 4QI2A 1OR3A 2L81A 4G7OF 3TOMA 4MS2A 3AQCA 2XRHA 3TULA 4OIQF 2UUHA 5A6BD 4BEJA 4N6CA 3RF3A 2XS8A 4GEHA 3HLZA 3E70C 2LD6A 4MVSA 4DRIB 5L0CA 3ASNC 1TWAA 3FAJA 3ZTZA 4XWJA 4YT2A 5JUAA 5E2QA 2EILC 1G4WR 2P7VA 3Q7GA 3RFYA 2XLVA 1AVOB 1O87A 4ULWA 2H7OA 2J0XA 3JYHA 5L0HA 4DXWA 1T01A 3NYJA 1SR2A 2R7OA 1LI7A 2EPOA 2GDCA 4LDQA 5DQZA 1O3UA 4E7SA 1OW6A 3JRTA 2KNHA 4N6HA 4NTBA 4YJWA 1FFTC 4BJTA 4YT8A 1A41A 2H7BA 2HFIA 3HTKC 1YLMA 5CI9A 3U2MA 5D91A 3W2WA 2LSEA 3O39A 3U0CA 2R7TA 1AEPA 2WVNA 1ZHYA 1ZHZA 1VMAA 1VB5A 2I8BA 2R05A 3QW0A 3JZ0A 2KK1A 5GPGB 4BEMJ 4CS8C 1GS9A 2Y69C 1ZW3A 4CS8A 1NBBA 2EPKX 4C3BA 2B0JA 2G62A 2Q00A 3B71A 1OKKA 4F4BA 2JPUA 3QW1A 3EGXB 4MW8A 1GQAA 1YAUO 2R7RA 3QZCA 3GORA 4A4AA 4O6YA 5DS5A 1I4YA 4P9FA 4I44A 3U3FA 4DVZA 1QZXA 3CAXA 1D0YA 5KYNA 1HY5A 3JYYA 2Y3GA 3GANA 3LS0A 5JP7A 1GM5A 2LFFA 1EQ1A 2Y3BA 1MNDA 4I3MA 3O6XA 1CGME 4OIOF 1E85A 2R9RB 3C8GB 1M56C 1LKXA 5KYUB 2MWQA 1M2OA 2JD3A 4XLNF 2XM4A 4G7HF 2ZPAA 2NUPB 3ZDLA 2AVKA 2FGYA 4BJ5A 1YZCA 3W4YA 5KYWA 4Q4ZF 2B0HA 4OIPF 4C7OB 3N0TA 3DM5A 1YA7O 5KYXA 3KL4A 3T9OA 3C7JA 3IQ5A 1OCCC 4CX9A 3EGDA 1Z63A 2CNWD 4IJJA 1RMVA 3UMIA 3UNGC 3J06A 3C8ZA 2GWWA 2YZSA 5B1AC 2WB7A 3ASOC 2ETSA 4EHPA 3U9MA 4P9TA 2HJMA 1BBHA 3AG1C 1DOWA 3HNLA 4M63A 1RKEB 2NSFA 4LLCA 4ER9A 2KYHA 3SNHA 3K1IC 3JRMO 4CJOA 1TWGA 3FXHA 4XPXA 2KC3A 1XZPA 3DWWA 1V55C 3DKAA 1OXBA 3HJCA 2LCHA 3C18A 1T6IA 3Q7LA 4RDAA 1NFNA 2EIMC 5L3QA 3AQBA 2D5RB 2ASRA 3DAFA 1T9KA 2OEVA 3EGXA 3S0XA 2HJ3A 2R7VA 3FAPB 1K05A 1Z5ZA 2NUTA 1Q0GA 2I15A 3X2QC 2HV7A 3LLIA 4NTAA 1VTMP 2BC5A 2DI3A 3FOOA 4PK4A 2PF4E 3M4BA 3M15A 2Q7RA 5F5FA 3GM1A 1IZMA 1OCOC 1LI5A 2FFHA 4BJ6A 1YA9A 3RKOF 3AOUA 3FVYA 1PCXA 1ORYA 1TFKB 3AGUA 3TJ5A 3G4XA 2Y3DA 4HFKB 5CIVA 4O79A 5FCLA 2CNWA 3CEXA 2H7VC 1NSGB 3AJMA 1TFOB 1EKYA 4PJMA 3H2VA 4CSAA 1SMYF 3Q6MA 2YL3A 3EHMA 3IQTA 2GAQA 5KYWB 2G3KA 3U3BA 2YVKA 4FWVA 4PJLA 1JR8A 1Z23A 4YL3A 3H65A 1FMVA 3UR3C 2L6HA 2UUIA 2YWAA 3RVZA 2J0WA 3K1HA 4Z9HA 1ORJA 3SXZA 3X1OA 4K0DA 3K6BA 4MTGA 2HMZA 4CDAA 3SYNA 5AC4A 2ZXWC 2X0CA 3MX3A 5COMA 2V26A 5COGA 3SEOA 4MTOA 4U5BE 3T6GB 3CSKA 2M4EA 1QQ3A 1MNEA 2ZXPA 4LACB 2Y3HA 3DJNB 4U9DA 5A6AA 1Q0DA 4U5CE 2NSGA 1NFOA 1V54C 2RD9A 1VYIA 2XLOA 2ZXOA 3EZHA 4CS9C 2CDQA 3DE8A 3HNKA 2IYLD 2KQ9A 4EBBA 3EGDB 1PD1A 1GGQA 3CQZA 3EFOA 3ZSUA 5AC5A 2R02A 4WGYA 2EPLX 3SXMA 3VAYA 2MYSA 3PDMP 2AP3A 3QVZA 3VF0A 1YYXA 2V3CC 2VCCA 1FMWA 4NC3A 4ZLCA 1OXKA 2EIJC 2IXPA 1NLXA 4OD4A 4XEFA 2HSBA 4AL0A 3FDQA 4MVMA 2DB4A 4PJNA 1BZ4A 3DD7A 4U5DE 1YDIA 1E84A 2AWCA 4ULVA 3IPMO 4XPYA 4C3EA 4EIYA 2QNLA 2J9BA 3I5PA 3EJNA 4CBEA 4YL1A 3MLGA 3R2PA 2XL6A 1KTMA 1FFHA 4HEAJ 4JTDB 4RBNA 1WASA 5A69A 1FNTc 4MVOA 2IBFA 3W2VA 5F5HA 2MHRA 4MQ9F 2R7SA 3ZQVA 4RD9A 5L0IA 2NUTB 5FZTA 3W8HA 2ICWG 4XPWA 2M64A 2F22A 1TQGA 4QDLA 1R5ID 3ZTMA 1OW8A 4UDVA 4U5FE 3L34A 2OJQA 3GEHA 1Q0KA 2YL1A 2WVQA 5EHHA 1ST6A 4YT5A 4HFFB 4K7BA 4CIPA 5BUOA 3E9VA 3BRJA 2CYDA 2GA0A 2O9XA 1JRAA 4AK9A 1L7CA 2X51A 2ZXRA 2WZFA 1TWHA 2BE5F 3SP1A 4MTFA 4XEKA 4I1MA 2OU6A 2VH3A 3VRCA 1PD0A 2A0BA 5B1BC 3FMSA 1SF8A 5T3WA 4CDYA 2W4MA 1CGNA 1VOMA 3MYFA 3U8PA 4AL1A 2LK4A 2WL8A 2QUPA 3ZIBA 4LERA 1LM3B 5T3TA 2GFHA 1QKRA 1SYQA 1N1CA 2IXNA 1MMAA 1QVXA 2A0UA 2IXOA 3C63A 3EPVA 4Z9IA 3LLKA 3HKKA 3T4RA 1CGOA 4IAOA 4DJ9A 3EFOB 4DVYP 4EWCA 1YVIA 4DRHB 3MBGA 1J8MF 5E33A 4N06A 5L0DA 2C03A 3CZ6A 3K66A 3LS1A 4IWBA 3ZQYA 1I4ZA 1S7ZA 1B68A 1G4US 1D1CA 2OG2A 4KI2A 2HZ8A 2OJED 4IRUA 4CS7A 1RKCA 5JSLA 4E18A 1KNYA 3EH2A 3DE9A 3VM6A 2WZGA 3O10A 3FHDA 2L6FA 2QLAA 2Q9BA 5B3IA 4K1OA 1A7DA 3TD7A 2EPMX 1D1BA 2YHSA 1WOLA 3BEHA 3KYIA 4U5GA 3EZIA 1BR2A 3T6BA 1Y4CA 5L3VA 2EINC 3U5SA 4BG0A 1D0XA 2A6HF 2PFDA 1I5NA 4HE8D 5B3SC 1E2XA 1Z7Qc 3ZC4A 1OCRC 1RJ9A 4J7TA 5DVWA 3ATPA 1JMWA 1MMDA 5CI8A 4C3DA 3IEEA 5A6JA 4XEVA 2HKVA 2PNOA 2YL0A 3L0IA 3NYLA 4JVSA 3SZRA 5IY5C 1T6UA 2KSFA 2PBEA 3WAQA 1ZZPA 2AU5A 2DGJA 2KJGA 2J8WA 2RSEB 1DOVA 1LPEA 1LS4A 2EIKC 3NMKA 3POVA 1J8YF 4KNVA 4R32A 256BA 1BR1A 1NU9C 2W4BA 3IQ6A 3ITFA 2L7AA 2OCCC 4YWQA 5A6KA 2LP4A 3ZVRA 2XL8A 1LE2A 1FAPB 1XWJA 2XSEA 3LESA 2VB6A 1U0BB 1UG7A 2HUJA 3IQCA 1V74B 2OEXA 3DAGA 2OQMA 2L9JA 4G78A 3V5YA 1E86A 2NG1A 3ABKC 3JT1A 3QMKA 3R7CA 4EUKB 3OEOA 1A7EA 3OWTA 4JJGA 1QLEC 3US6A 4E0IA 4CIHA 2HS5A 1Q0FA 1T6QA 1NZEA 3B0UX 4KBLA 4LDKA 3RYLA 2P1AA 2XLMA 3LJBA 5JT4A 5L0GA 3KKBA 4JW1A 4YK5A 5DS4A 1C02A 1MQVA 1VLTA 3K33A 3LEOA 4MW3A 1M6TA 3LNMB 1ZU4A 4P6IC 3V5ZA 3UGOA 3LNRA 2XL4A 3O55A 4DBRA 4E7ZA 3KH2A 4JC7A 3SXKA 4G7ZF 3KMIA 1V4AA 3G4ZA 4XQ1A 5JLIA 3DI5A 3V5XA 2EPNA 2H8AA 1E83A 2YRFA 3OA1A 3L1MA 3A11A 3SXYA 3WG7C 1U6HA 4U9EA 4W8PA 3EH1A 1ZVZA 4AX2A 3B0VC 3B9QA 1VLSA 2Z15A 1RKEA 1ZHXA 4WABA 5T1DB 2HV6A 1K40A 1M2VB 1TKNA 4FAPB 1SZIA 3AG2C 3JTLO 1BR4A 4O6MA 4YT4A 5BQGA 3RVYA 5JS5A 4CJGA 2XLEA 3GM2A 3GWNA 2YLIA 1OKKD 2XLDA 3N2ZB 1WN0A 3G50A 2IOQA 3TK0A 3ZWIA 5BQHA 4J32B 5DLJA 2YL7A 1VK5A 4GQHA 5KYYA 4OIRF 4JCHA 4MVZA 3NG1A 1JOGA 1LIHA 2WZLA 2Q9AA 2E87A 2Q3TA 1S05A 1HMDA 3RIPA 4KNWA 1RJ9B 4JEAA 4JZAA 2FAPB 5KYYB 2P6VA 2R7XA 4U5EE 3EG9A 4AE4B 1EA8A 1YJGA 2IXMA 1W2WA 3JCUQ 4CS9A 3NKDA 4J30B 3EQLF 1T5OA 2HSQA 1Q0MA 1NG1A 1XZQA 3K7DA 2W9YA 4JTAB 5L0FA 5HSWA 3UMKA 4MNDA 1U89A 3LAYA 3DZAA 5D92A 2VC9A 1MMNA 2J9WA 2PP4A 3KYJA 1FR0A 1H6GA 3QVYA 1M57C 4JJFA 3UMHA 3VYWA 5EK0A 1PV3A 4A2NB 4D4NA 1JPJA 3M4CA 1LVKA 1D0ZA 2PX0A 3DJUB 3GEIA 3U9JA 1AUEA 3RQEA 3EHNA 5JRAA 3K1IA 4EBKA 1QPUA 4PR9A 4QI0A 1ZHTA 3I5QA 5KYUA 4PFPA 3GWLA 4JEBA 2PX3A 1YYJA 4U5HA 4EBJA 3ABLC 2QY9A 3WODF 1IW7F 3LUTB 3AG4C 4BJ6C 1FTSA 1HE9A 3L8JA 2KGOA 1H9TA 3ECSA 2HMQA 1ZYRF 2YEVA 1WTYA 3NMJA 2J45A 3F47A 1RCPA 4OINF 1APCA 1MMGA 4IGGA 1JPNA 3JSEO 2ZD9A 4NY3A 5E3CA 1YARO 1A7VA 5EGYA 5L0JA 4GYTA 1ZHWA 3NMIA 2A1DD 3UGPA 3MFNA 4H54A 3N24A 3GM3A 4Q5SF 2VCBA 3F46A 4DBQA 1TWCA 1HW2A 2NUPA 3AGTA 4L6RA 4XLPF 2OOCA 4ONSA 4OD5A 4MVQA 3NYMA 4E17A 1WGWA 4LDRA 3V7OA 3B29A 1LE4A 1OQCA 1H7IA 3L8IA 2XLWA 2AWYA 4IAQA 4JTCB 4PFOA 3ABMC 5KYXB 4WJ0A 4N4WA 4Q7CA 2R25A 2DYSC 2YLDA 2NPUA 3GODA 2JX0A 3NRHA 3S28A 4X0RA 2A68F 1ZU5A 4NTFA 4WGZA 3C8GD 3T6JA 3W8IA 1G5ZA 3S84A 2BL2A 2Q4FA 2XM0A 1O5HA 4FX5A 3H2UA 4H4KC 2LQGA 1QSPA 3ZG1A 4CDVA 3LEVA 1JAFA 3JSZA 3KPHA 4IARA 2YQYA 2XLHA 2WVOA 3I4UA 3U8VA 4JIOA 1R4TA 5K0IA 2VCAA 1WATA 3RW0A 1BDJB 5DS6A 4ANJA 2CCYA 1OR2A 2CW0F 5AGFA 4D4XA 4EKWA 1WWPA 2L6GA 2J46A 2YKZA 4JURI 4AE4A 1OW7A 4DOZA 1C17M 1L3PA 1HMOA 4FESA 3M79A 3RH3A 1F1MA 2OKUA 3DMDA 4B6IA 4NQFA 3TOLA 3AG3C 3DXJF 2R7WA 1A0BA
chains in the Genus database with same CATH topology
4DJ9A 5L0FA 1ZVZA 2HSQA 4IGGA 3VF0A 5L0HA 5L0DA 1U89A 1RKEA 1T01A 2GDCA 5L0JA 1ST6A 2GWWA 3H2UA 3MYIA 2X0CA 1ZW2A 1H6GA 2LQGA 4EHPA 3T6GB 4P9TA 1RKCA 3TJ6A 4E18A 1YDIA 1DOWA 1L7CA 1RKEB 5L0GA 3TJ5A 1DOVA 4ONSA 4E17A 4K1OA 1ZW3A 4PR9A 3RF3A 3ZDLA 2L7AA 2IBFA 3H2VA 5L0CA 2B0HA 1XWJA 5L0IA 5FZTA 1TR2A 1QKRA 1SYQA 3S90A 1U6HA 4W8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DJ9 A;  5L0F A;  1ZVZ A;  2HSQ A;  4IGG A;  3VF0 A;  5L0H A;  5L0D A;  1U89 A;  1RKE A;  1T01 A;  2GDC A;  5L0J A;  1ST6 A;  2GWW A;  3H2U A;  3MYI A;  2X0C A;  1ZW2 A;  1H6G A;  2LQG A;  4EHP A;  3T6G B;  4P9T A;  1RKC A;  3TJ6 A;  4E18 A;  1YDI A;  1DOW A;  1L7C A;  1RKE B;  5L0G A;  3TJ5 A;  1DOV A;  4ONS A;  4E17 A;  4K1O A;  1ZW3 A;  4PR9 A;  3RF3 A;  3ZDL A;  2L7A A;  2IBF A;  3H2V A;  5L0C A;  2B0H A;  1XWJ A;  5L0I A;  5FZT A;  1TR2 A;  1QKR A;  1SYQ A;  3S90 A;  1U6H A;  4W8P A; 
#chains in the Genus database with same CATH topology
 1H9G A;  2G3V A;  4KC9 A;  4IB4 A;  1LS1 A;  4NCQ A;  3M1C B;  4DRJ B;  5F28 E;  4LLE A;  2R7Q A;  2LFD A;  3B0P A;  3FOP A;  2Q9C A;  3NKE A;  4Z9J A;  2TMV P;  2A6E F;  5BQI A;  1ORS C;  1Y6D A;  4O7G A;  5HV9 A;  5JVE A;  4ZLD A;  2P61 A;  2XS1 A;  2VAS A;  3EG9 B;  4I1O B;  3TJ6 A;  4CSA C;  2CGE A;  1VYK A;  5TJ5 E;  3A9C A;  3QTH A;  4MVU A;  5E3A A;  1HW1 A;  3RQF A;  5COF A;  2J9U A;  5DQT A;  4JE9 A;  3PHF 2;  4MVR A;  3TQO A;  5A6B A;  1RXQ A;  1G8X A;  3C8G A;  4BPM A;  2IM8 A;  1EI7 A;  2QE9 A;  1UFB A;  2J7P D;  1M2V A;  3HNI A;  4PJJ A;  3WHN A;  4E0H A;  1NU7 D;  3S27 A;  2P0N A;  2LIG A;  2QTV A;  1Z6A A;  3GEE A;  3IHU A;  1TR2 A;  4JRZ A;  4YN0 B;  2XXA A;  2R7U A;  1KU2 A;  4JCZ A;  3S90 A;  2Y39 A;  4JKV A;  2W45 A;  4YL0 A;  1D1A A;  2C04 A;  3S9O A;  4O6N A;  1CPQ A;  4G0H A;  3S29 A;  4J7Y A;  4BJ1 A;  4C7O A;  1C03 A;  3HNJ A;  2YLG A;  4XTK A;  2KW3 C;  3Q6N A;  2J9V A;  1CPR A;  1K04 A;  2XXA B;  3NDB B;  3DM9 B;  1Z3I X;  1YZA A;  3MYI A;  4W8K A;  1OCZ C;  1ZW2 A;  3RQG A;  3C62 A;  3PCV A;  3U2L A;  1HE1 A;  2A69 F;  2DYR C;  4PAC A;  3PMR A;  2D4U A;  2J7P A;  2R03 A;  4BJ5 C;  4QI2 A;  1OR3 A;  2L81 A;  4G7O F;  3TOM A;  4MS2 A;  3AQC A;  2XRH A;  3TUL A;  4OIQ F;  2UUH A;  5A6B D;  4BEJ A;  4N6C A;  3RF3 A;  2XS8 A;  4GEH A;  3HLZ A;  3E70 C;  2LD6 A;  4MVS A;  4DRI B;  5L0C A;  3ASN C;  1TWA A;  3FAJ A;  3ZTZ A;  4XWJ A;  4YT2 A;  5JUA A;  5E2Q A;  2EIL C;  1G4W R;  2P7V A;  3Q7G A;  3RFY A;  2XLV A;  1AVO B;  1O87 A;  4ULW A;  2H7O A;  2J0X A;  3JYH A;  5L0H A;  4DXW A;  1T01 A;  3NYJ A;  1SR2 A;  2R7O A;  1LI7 A;  2EPO A;  2GDC A;  4LDQ A;  5DQZ A;  1O3U A;  4E7S A;  1OW6 A;  3JRT A;  2KNH A;  4N6H A;  4NTB A;  4YJW A;  1FFT C;  4BJT A;  4YT8 A;  1A41 A;  2H7B A;  2HFI A;  3HTK C;  1YLM A;  5CI9 A;  3U2M A;  5D91 A;  3W2W A;  2LSE A;  3O39 A;  3U0C A;  2R7T A;  1AEP A;  2WVN A;  1ZHY A;  1ZHZ A;  1VMA A;  1VB5 A;  2I8B A;  2R05 A;  3QW0 A;  3JZ0 A;  2KK1 A;  5GPG B;  4BEM J;  4CS8 C;  1GS9 A;  2Y69 C;  1ZW3 A;  4CS8 A;  1NBB A;  2EPK X;  4C3B A;  2B0J A;  2G62 A;  2Q00 A;  3B71 A;  1OKK A;  4F4B A;  2JPU A;  3QW1 A;  3EGX B;  4MW8 A;  1GQA A;  1YAU O;  2R7R A;  3QZC A;  3GOR A;  4A4A A;  4O6Y A;  5DS5 A;  1I4Y A;  4P9F A;  4I44 A;  3U3F A;  4DVZ A;  1QZX A;  3CAX A;  1D0Y A;  5KYN A;  1HY5 A;  3JYY A;  2Y3G A;  3GAN A;  3LS0 A;  5JP7 A;  1GM5 A;  2LFF A;  1EQ1 A;  2Y3B A;  1MND A;  4I3M A;  3O6X A;  1CGM E;  4OIO F;  1E85 A;  2R9R B;  3C8G B;  1M56 C;  1LKX A;  5KYU B;  2MWQ A;  1M2O A;  2JD3 A;  4XLN F;  2XM4 A;  4G7H F;  2ZPA A;  2NUP B;  3ZDL A;  2AVK A;  2FGY A;  4BJ5 A;  1YZC A;  3W4Y A;  5KYW A;  4Q4Z F;  2B0H A;  4OIP F;  4C7O B;  3N0T A;  3DM5 A;  1YA7 O;  5KYX A;  3KL4 A;  3T9O A;  3C7J A;  3IQ5 A;  1OCC C;  4CX9 A;  3EGD A;  1Z63 A;  2CNW D;  4IJJ A;  1RMV A;  3UMI A;  3UNG C;  3J06 A;  3C8Z A;  2GWW A;  2YZS A;  5B1A C;  2WB7 A;  3ASO C;  2ETS A;  4EHP A;  3U9M A;  4P9T A;  2HJM A;  1BBH A;  3AG1 C;  1DOW A;  3HNL A;  4M63 A;  1RKE B;  2NSF A;  4LLC A;  4ER9 A;  2KYH A;  3SNH A;  3K1I C;  3JRM O;  4CJO A;  1TWG A;  3FXH A;  4XPX A;  2KC3 A;  1XZP A;  3DWW A;  1V55 C;  3DKA A;  1OXB A;  3HJC A;  2LCH A;  3C18 A;  1T6I A;  3Q7L A;  4RDA A;  1NFN A;  2EIM C;  5L3Q A;  3AQB A;  2D5R B;  2ASR A;  3DAF A;  1T9K A;  2OEV A;  3EGX A;  3S0X A;  2HJ3 A;  2R7V A;  3FAP B;  1K05 A;  1Z5Z A;  2NUT A;  1Q0G A;  2I15 A;  3X2Q C;  2HV7 A;  3LLI A;  4NTA A;  1VTM P;  2BC5 A;  2DI3 A;  3FOO A;  4PK4 A;  2PF4 E;  3M4B A;  3M15 A;  2Q7R A;  5F5F A;  3GM1 A;  1IZM A;  1OCO C;  1LI5 A;  2FFH A;  4BJ6 A;  1YA9 A;  3RKO F;  3AOU A;  3FVY A;  1PCX A;  1ORY A;  1TFK B;  3AGU A;  3TJ5 A;  3G4X A;  2Y3D A;  4HFK B;  5CIV A;  4O79 A;  5FCL A;  2CNW A;  3CEX A;  2H7V C;  1NSG B;  3AJM A;  1TFO B;  1EKY A;  4PJM A;  3H2V A;  4CSA A;  1SMY F;  3Q6M A;  2YL3 A;  3EHM A;  3IQT A;  2GAQ A;  5KYW B;  2G3K A;  3U3B A;  2YVK A;  4FWV A;  4PJL A;  1JR8 A;  1Z23 A;  4YL3 A;  3H65 A;  1FMV A;  3UR3 C;  2L6H A;  2UUI A;  2YWA A;  3RVZ A;  2J0W A;  3K1H A;  4Z9H A;  1ORJ A;  3SXZ A;  3X1O A;  4K0D A;  3K6B A;  4MTG A;  2HMZ A;  4CDA A;  3SYN A;  5AC4 A;  2ZXW C;  2X0C A;  3MX3 A;  5COM A;  2V26 A;  5COG A;  3SEO A;  4MTO A;  4U5B E;  3T6G B;  3CSK A;  2M4E A;  1QQ3 A;  1MNE A;  2ZXP A;  4LAC B;  2Y3H A;  3DJN B;  4U9D A;  5A6A A;  1Q0D A;  4U5C E;  2NSG A;  1NFO A;  1V54 C;  2RD9 A;  1VYI A;  2XLO A;  2ZXO A;  3EZH A;  4CS9 C;  2CDQ A;  3DE8 A;  3HNK A;  2IYL D;  2KQ9 A;  4EBB A;  3EGD B;  1PD1 A;  1GGQ A;  3CQZ A;  3EFO A;  3ZSU A;  5AC5 A;  2R02 A;  4WGY A;  2EPL X;  3SXM A;  3VAY A;  2MYS A;  3PDM P;  2AP3 A;  3QVZ A;  3VF0 A;  1YYX A;  2V3C C;  2VCC A;  1FMW A;  4NC3 A;  4ZLC A;  1OXK A;  2EIJ C;  2IXP A;  1NLX A;  4OD4 A;  4XEF A;  2HSB A;  4AL0 A;  3FDQ A;  4MVM A;  2DB4 A;  4PJN A;  1BZ4 A;  3DD7 A;  4U5D E;  1YDI A;  1E84 A;  2AWC A;  4ULV A;  3IPM O;  4XPY A;  4C3E A;  4EIY A;  2QNL A;  2J9B A;  3I5P A;  3EJN A;  4CBE A;  4YL1 A;  3MLG A;  3R2P A;  2XL6 A;  1KTM A;  1FFH A;  4HEA J;  4JTD B;  4RBN A;  1WAS A;  5A69 A;  1FNT c;  4MVO A;  2IBF A;  3W2V A;  5F5H A;  2MHR A;  4MQ9 F;  2R7S A;  3ZQV A;  4RD9 A;  5L0I A;  2NUT B;  5FZT A;  3W8H A;  2ICW G;  4XPW A;  2M64 A;  2F22 A;  1TQG A;  4QDL A;  1R5I D;  3ZTM A;  1OW8 A;  4UDV A;  4U5F E;  3L34 A;  2OJQ A;  3GEH A;  1Q0K A;  2YL1 A;  2WVQ A;  5EHH A;  1ST6 A;  4YT5 A;  4HFF B;  4K7B A;  4CIP A;  5BUO A;  3E9V A;  3BRJ A;  2CYD A;  2GA0 A;  2O9X A;  1JRA A;  4AK9 A;  1L7C A;  2X51 A;  2ZXR A;  2WZF A;  1TWH A;  2BE5 F;  3SP1 A;  4MTF A;  4XEK A;  4I1M A;  2OU6 A;  2VH3 A;  3VRC A;  1PD0 A;  2A0B A;  5B1B C;  3FMS A;  1SF8 A;  5T3W A;  4CDY A;  2W4M A;  1CGN A;  1VOM A;  3MYF A;  3U8P A;  4AL1 A;  2LK4 A;  2WL8 A;  2QUP A;  3ZIB A;  4LER A;  1LM3 B;  5T3T A;  2GFH A;  1QKR A;  1SYQ A;  1N1C A;  2IXN A;  1MMA A;  1QVX A;  2A0U A;  2IXO A;  3C63 A;  3EPV A;  4Z9I A;  3LLK A;  3HKK A;  3T4R A;  1CGO A;  4IAO A;  4DJ9 A;  3EFO B;  4DVY P;  4EWC A;  1YVI A;  4DRH B;  3MBG A;  1J8M F;  5E33 A;  4N06 A;  5L0D A;  2C03 A;  3CZ6 A;  3K66 A;  3LS1 A;  4IWB A;  3ZQY A;  1I4Z A;  1S7Z A;  1B68 A;  1G4U S;  1D1C A;  2OG2 A;  4KI2 A;  2HZ8 A;  2OJE D;  4IRU A;  4CS7 A;  1RKC A;  5JSL A;  4E18 A;  1KNY A;  3EH2 A;  3DE9 A;  3VM6 A;  2WZG A;  3O10 A;  3FHD A;  2L6F A;  2QLA A;  2Q9B A;  5B3I A;  4K1O A;  1A7D A;  3TD7 A;  2EPM X;  1D1B A;  2YHS A;  1WOL A;  3BEH A;  3KYI A;  4U5G A;  3EZI A;  1BR2 A;  3T6B A;  1Y4C A;  5L3V A;  2EIN C;  3U5S A;  4BG0 A;  1D0X A;  2A6H F;  2PFD A;  1I5N A;  4HE8 D;  5B3S C;  1E2X A;  1Z7Q c;  3ZC4 A;  1OCR C;  1RJ9 A;  4J7T A;  5DVW A;  3ATP A;  1JMW A;  1MMD A;  5CI8 A;  4C3D A;  3IEE A;  5A6J A;  4XEV A;  2HKV A;  2PNO A;  2YL0 A;  3L0I A;  3NYL A;  4JVS A;  3SZR A;  5IY5 C;  1T6U A;  2KSF A;  2PBE A;  3WAQ A;  1ZZP A;  2AU5 A;  2DGJ A;  2KJG A;  2J8W A;  2RSE B;  1DOV A;  1LPE A;  1LS4 A;  2EIK C;  3NMK A;  3POV A;  1J8Y F;  4KNV A;  4R32 A;  256B A;  1BR1 A;  1NU9 C;  2W4B A;  3IQ6 A;  3ITF A;  2L7A A;  2OCC C;  4YWQ A;  5A6K A;  2LP4 A;  3ZVR A;  2XL8 A;  1LE2 A;  1FAP B;  1XWJ A;  2XSE A;  3LES A;  2VB6 A;  1U0B B;  1UG7 A;  2HUJ A;  3IQC A;  1V74 B;  2OEX A;  3DAG A;  2OQM A;  2L9J A;  4G78 A;  3V5Y A;  1E86 A;  2NG1 A;  3ABK C;  3JT1 A;  3QMK A;  3R7C A;  4EUK B;  3OEO A;  1A7E A;  3OWT A;  4JJG A;  1QLE C;  3US6 A;  4E0I A;  4CIH A;  2HS5 A;  1Q0F A;  1T6Q A;  1NZE A;  3B0U X;  4KBL A;  4LDK A;  3RYL A;  2P1A A;  2XLM A;  3LJB A;  5JT4 A;  5L0G A;  3KKB A;  4JW1 A;  4YK5 A;  5DS4 A;  1C02 A;  1MQV A;  1VLT A;  3K33 A;  3LEO A;  4MW3 A;  1M6T A;  3LNM B;  1ZU4 A;  4P6I C;  3V5Z A;  3UGO A;  3LNR A;  2XL4 A;  3O55 A;  4DBR A;  4E7Z A;  3KH2 A;  4JC7 A;  3SXK A;  4G7Z F;  3KMI A;  1V4A A;  3G4Z A;  4XQ1 A;  5JLI A;  3DI5 A;  3V5X A;  2EPN A;  2H8A A;  1E83 A;  2YRF A;  3OA1 A;  3L1M A;  3A11 A;  3SXY A;  3WG7 C;  1U6H A;  4U9E A;  4W8P A;  3EH1 A;  1ZVZ A;  4AX2 A;  3B0V C;  3B9Q A;  1VLS A;  2Z15 A;  1RKE A;  1ZHX A;  4WAB A;  5T1D B;  2HV6 A;  1K40 A;  1M2V B;  1TKN A;  4FAP B;  1SZI A;  3AG2 C;  3JTL O;  1BR4 A;  4O6M A;  4YT4 A;  5BQG A;  3RVY A;  5JS5 A;  4CJG A;  2XLE A;  3GM2 A;  3GWN A;  2YLI A;  1OKK D;  2XLD A;  3N2Z B;  1WN0 A;  3G50 A;  2IOQ A;  3TK0 A;  3ZWI A;  5BQH A;  4J32 B;  5DLJ A;  2YL7 A;  1VK5 A;  4GQH A;  5KYY A;  4OIR F;  4JCH A;  4MVZ A;  3NG1 A;  1JOG A;  1LIH A;  2WZL A;  2Q9A A;  2E87 A;  2Q3T A;  1S05 A;  1HMD A;  3RIP A;  4KNW A;  1RJ9 B;  4JEA A;  4JZA A;  2FAP B;  5KYY B;  2P6V A;  2R7X A;  4U5E E;  3EG9 A;  4AE4 B;  1EA8 A;  1YJG A;  2IXM A;  1W2W A;  3JCU Q;  4CS9 A;  3NKD A;  4J30 B;  3EQL F;  1T5O A;  2HSQ A;  1Q0M A;  1NG1 A;  1XZQ A;  3K7D A;  2W9Y A;  4JTA B;  5L0F A;  5HSW A;  3UMK A;  4MND A;  1U89 A;  3LAY A;  3DZA A;  5D92 A;  2VC9 A;  1MMN A;  2J9W A;  2PP4 A;  3KYJ A;  1FR0 A;  1H6G A;  3QVY A;  1M57 C;  4JJF A;  3UMH A;  3VYW A;  5EK0 A;  1PV3 A;  4A2N B;  4D4N A;  1JPJ A;  3M4C A;  1LVK A;  1D0Z A;  2PX0 A;  3DJU B;  3GEI A;  3U9J A;  1AUE A;  3RQE A;  3EHN A;  5JRA A;  3K1I A;  4EBK A;  1QPU A;  4PR9 A;  4QI0 A;  1ZHT A;  3I5Q A;  5KYU A;  4PFP A;  3GWL A;  4JEB A;  2PX3 A;  1YYJ A;  4U5H A;  4EBJ A;  3ABL C;  2QY9 A;  3WOD F;  1IW7 F;  3LUT B;  3AG4 C;  4BJ6 C;  1FTS A;  1HE9 A;  3L8J A;  2KGO A;  1H9T A;  3ECS A;  2HMQ A;  1ZYR F;  2YEV A;  1WTY A;  3NMJ A;  2J45 A;  3F47 A;  1RCP A;  4OIN F;  1APC A;  1MMG A;  4IGG A;  1JPN A;  3JSE O;  2ZD9 A;  4NY3 A;  5E3C A;  1YAR O;  1A7V A;  5EGY A;  5L0J A;  4GYT A;  1ZHW A;  3NMI A;  2A1D D;  3UGP A;  3MFN A;  4H54 A;  3N24 A;  3GM3 A;  4Q5S F;  2VCB A;  3F46 A;  4DBQ A;  1TWC A;  1HW2 A;  2NUP A;  3AGT A;  4L6R A;  4XLP F;  2OOC A;  4ONS A;  4OD5 A;  4MVQ A;  3NYM A;  4E17 A;  1WGW A;  4LDR A;  3V7O A;  3B29 A;  1LE4 A;  1OQC A;  1H7I A;  3L8I A;  2XLW A;  2AWY A;  4IAQ A;  4JTC B;  4PFO A;  3ABM C;  5KYX B;  4WJ0 A;  4N4W A;  4Q7C A;  2R25 A;  2DYS C;  2YLD A;  2NPU A;  3GOD A;  2JX0 A;  3NRH A;  3S28 A;  4X0R A;  2A68 F;  1ZU5 A;  4NTF A;  4WGZ A;  3C8G D;  3T6J A;  3W8I A;  1G5Z A;  3S84 A;  2BL2 A;  2Q4F A;  2XM0 A;  1O5H A;  4FX5 A;  3H2U A;  4H4K C;  2LQG A;  1QSP A;  3ZG1 A;  4CDV A;  3LEV A;  1JAF A;  3JSZ A;  3KPH A;  4IAR A;  2YQY A;  2XLH A;  2WVO A;  3I4U A;  3U8V A;  4JIO A;  1R4T A;  5K0I A;  2VCA A;  1WAT A;  3RW0 A;  1BDJ B;  5DS6 A;  4ANJ A;  2CCY A;  1OR2 A;  2CW0 F;  5AGF A;  4D4X A;  4EKW A;  1WWP A;  2L6G A;  2J46 A;  2YKZ A;  4JUR I;  4AE4 A;  1OW7 A;  4DOZ A;  1C17 M;  1L3P A;  1HMO A;  4FES A;  3M79 A;  3RH3 A;  1F1M A;  2OKU A;  3DMD A;  4B6I A;  4NQF A;  3TOL A;  3AG3 C;  3DXJ F;  2R7W A;  1A0B A; 
#chains in the Genus database with same CATH homology
 4DJ9 A;  5L0F A;  1ZVZ A;  2HSQ A;  4IGG A;  3VF0 A;  5L0H A;  5L0D A;  1U89 A;  1RKE A;  1T01 A;  2GDC A;  5L0J A;  1ST6 A;  2GWW A;  3H2U A;  3MYI A;  2X0C A;  1ZW2 A;  1H6G A;  2LQG A;  4EHP A;  3T6G B;  4P9T A;  1RKC A;  3TJ6 A;  4E18 A;  1YDI A;  1DOW A;  1L7C A;  1RKE B;  5L0G A;  3TJ5 A;  1DOV A;  4ONS A;  4E17 A;  4K1O A;  1ZW3 A;  4PR9 A;  3RF3 A;  3ZDL A;  2L7A A;  2IBF A;  3H2V A;  5L0C A;  2B0H A;  1XWJ A;  5L0I A;  5FZT A;  1TR2 A;  1QKR A;  1SYQ A;  3S90 A;  1U6H A;  4W8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...