1YDIA

Human vinculin head domain (vh1, 1-258) in complex with human alpha-actinin's vinculin-binding site (residues 731-760)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
263
structure length
256
Chain Sequence
HHHHHMPVFHTRTIESILEPVAQQISHLVIMHEAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion, structural protein
molecule keywords vinculin isoform VCL
publication title Structural Dynamics of {alpha}-Actinin-Vinculin Interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 256
sequence length 263
ec nomenclature
pdb deposition date 2004-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1ydiA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1ydiA01
2GDCA 1YDIA 1U89A 1ST6A 1RKCA 3VF0A 4E17A 4K1OA 5L0GA 5L0HA 3MYIA 2IBFA 5L0JA 3H2VA 1ZW3A 3S90A 1U6HA 2GWWA 2LQGA 1T01A 4DJ9A 4E18A 5L0CA 1ZW2A 1RKEA 2L7AA 4W8PA 1L7CA 2B0HA 2X0CA 3RF3A 1SYQA 3TJ6A 4IGGA 2HSQA 3ZDLA 1DOVA 5L0IA 3H2UA 3TJ5A 1ZVZA 4EHPA 5FZTA 1QKRA 5L0DA 1DOWA 4ONSA 4P9TA 5L0FA 1H6GA 1TR2A 1RKEB 3T6GB 4PR9A 1XWJA
chains in the Genus database with same CATH superfamily
3IQ5A 3MLGA 5HSWA 3NKEA 3Q7GA 2J7PA 3PDMP 3VM6A 5L3VA 4UDVA 2IBFA 2LCHA 4XEFA 3U2LA 4E0HA 1W2WA 1O87A 2KW3C 1Z6AA 2YL1A 4WGZA 4G7ZF 1T01A 4DJ9A 4MQ9F 3OA1A 4JCHA 2YLGA 1MMGA 3RYLA 4XWJA 4BJ5C 4ZLCA 2OEVA 3DXJF 3N0TA 4NC3A 1WOLA 5A6KA 3LS1A 3O39A 3GM2A 4JJFA 4PFPA 1YA7O 4ULWA 1SF8A 2YLIA 3GWNA 4A2NB 4EBKA 2AWYA 2XM0A 1TWGA 2XLHA 1RJ9B 3JT1A 3S28A 3V5XA 1ZHTA 3AG1C 2GFHA 3EGDA 3R7CA 4C3EA 3N24A 1Z7Qc 1FFHA 3T6JA 4MVRA 1TWAA 2P61A 3PHF2 2XXAB 3HNJA 3EQLF 2I8BA 3ITFA 5DQZA 1V55C 4JTAB 1TFOB 2R7WA 3EPVA 3JCUQ 2NSFA 4RDAA 1OR2A 3RH3A 2LQGA 3EFOB 4D4NA 2KSFA 4XLPF 1MMNA 4I44A 4H4KC 1WGWA 3LUTB 4W8PA 2C03A 3ZDLA 1LS4A 2B0JA 1TFKB 2V26A 4JIOA 2IXNA 1YARO 4W8KA 3A9CA 3S9OA 1LI5A 5GPGB 2J9VA 3M4BA 1LI7A 3WODF 4BJ1A 5DVWA 1F1MA 1M2OA 1NFOA 3NKDA 1OXBA 2WZGA 3DI5A 4IAOA 4J7TA 4U5EE 5BQIA 4PFOA 1D0ZA 1S7ZA 4CS9A 3S0XA 3U9MA 2M64A 4QDLA 1LKXA 1UG7A 1A7VA 3AJMA 1LPEA 2VB6A 1D0XA 3U0CA 3C8ZA 3LESA 4OIOF 3FAJA 2J0XA 3M1CB 1H9TA 4AE4B 4M63A 2TMVP 2GA0A 3HKKA 2P0NA 1BZ4A 2IXMA 4IGGA 2HSQA 2AU5A 2QNLA 2WZFA 4ULVA 1DOVA 1ZHXA 2XLMA 3KKBA 2L6GA 1CGNA 2HJMA 3E70C 3EH1A 4GQHA 2D4UA 1G5ZA 2R7OA 2LP4A 1QPUA 3MBGA 1PCXA 2XLVA 4AX2A 1Q0DA 2YEVA 2EIMC 1SR2A 1TR2A 4Z9JA 3EG9B 3ZWIA 4HFKB 2OG2A 1RXQA 4PR9A 3T6GB 1VTMP 2WZLA 3VF0A 1U89A 3LNMB 2A6EF 2R7TA 1YZAA 3K1HA 5CI8A 4O79A 3MYIA 1J8YF 1RJ9A 3IPMO 3NYMA 2NG1A 4HE8D 4JKVA 3VRCA 3V5ZA 4JZAA 2X51A 1EA8A 4K0DA 4CSAC 3RVYA 3U3FA 1JPJA 2EINC 3DD7A 2R7SA 2YHSA 3U3BA 3QW1A 2XXAA 1E83A 1D1AA 2KJGA 2OKUA 3T6BA 2PX3A 5F28E 1A0BA 1G4WR 3L8JA 1OW6A 2PF4E 4JEAA 3RFYA 2R7VA 3C8GB 1BBHA 1HE1A 2HJ3A 1Q0FA 2YQYA 1G8XA 1GGQA 3S27A 5COMA 1V74B 5JSLA 3B29A 3HNIA 4J32B 5JVEA 4O6YA 2J7PD 1D1BA 5L0HA 4EUKB 3W2WA 1UFBA 3AQBA 3PCVA 3SEOA 3JYHA 2Q00A 2G3VA 3IQ6A 4WABA 5HV9A 1YA9A 1ZW2A 1OCZC 2Q4FA 3K1IC 3N2ZB 3OEOA 4AK9A 2E87A 1M6TA 2B0HA 3EZHA 3Q6NA 2W4BA 3QVYA 4O7GA 2X0CA 3SNHA 1YYJA 2FGYA 2LSEA 3Q6MA 3TJ6A 3G50A 1WTYA 3DJUB 3T9OA 3ZTMA 1JRAA 1LM3B 2A0UA 3B71A 2LD6A 4JCZA 1T6IA 2NUTB 2ICWG 2Q9CA 4I1OB 5L3QA 1ZU5A 5KYYB 3F46A 3IQCA 1B68A 2DYSC 2VC9A 2RSEB 4L6RA 4RBNA 3ABLC 5COGA 2NPUA 1RKEB 2WVNA 2A68F 3VYWA 4DBQA 3SXYA 3WHNA 1YYXA 1GQAA 1CPQA 2YL0A 3C18A 3DE9A 3FAPB 4MTOA 4K1OA 4IRUA 4MVSA 4EIYA 5AGFA 1N1CA 2J9BA 3W4YA 1ORJA 2LFFA 2XS8A 4FAPB 5BQHA 1Z5ZA 2QLAA 2Y69C 4KC9A 4MVQA 4QI0A 4U5FE 1NZEA 3AG4C 3G4ZA 4JVSA 4CS7A 2UUIA 1OCOC 2EIKC 4U5DE 1NBBA 4JTDB 3EGXA 3L34A 2ZD9A 4DRJB 2CGEA 3IEEA 2CNWA 2OQMA 2XLWA 1VMAA 4YL3A 5TJ5E 4KBLA 1OKKA 5B3IA 1T9KA 3W8HA 1C17M 3LNRA 4N4WA 4X0RA 3KYJA 5KYUA 4ZLDA 3ABKC 4LACB 2Y3DA 1QKRA 4ONSA 4AL0A 1VLTA 3JRMO 5L0FA 3F47A 1CGOA 4MNDA 4PK4A 1D1CA 2Q9BA 1TWCA 3LS0A 4EBJA 1GS9A 2GAQA 4JW1A 4E7ZA 5COFA 5E3CA 3GORA 3QTHA 2BL2A 1YLMA 1RCPA 5CIVA 1M57C 1OCCC 4DVYP 4Z9IA 3OWTA 3PMRA 2KQ9A 3I5PA 3RIPA 3C8GA 3K1IA 1O5HA 3UGPA 1OQCA 2A0BA 2GWWA 4BJTA 2QE9A 3K7DA 2AP3A 1M56C 3JTLO 4IAQA 4XQ1A 1IW7F 2Q3TA 4EWCA 1FTSA 3GM1A 1MMAA 2R7QA 2XS1A 4OIQF 3U8VA 4OIPF 1OW8A 3ZSUA 3H65A 2Y3BA 3HJCA 3U5SA 1ZHZA 5KYXB 3O55A 1Z3IX 1DOWA 4MS2A 3JRTA 3NMIA 4MW3A 5T1DB 3T4RA 1EKYA 5L0IA 2R25A 3MFNA 4C7OB 4P6IC 3LJBA 3DMDA 4YK5A 1D0YA 1BR1A 2J0WA 3AGUA 4MW8A 5A6AA 3ECSA 1HW2A 1VK5A 1IZMA 1ORSC 4ER9A 4N6CA 2NUTA 5KYYA 3SXKA 2LFDA 5FCLA 2OCCC 3RKOF 3RQFA 4MVUA 5JRAA 3S90A 3WAQA 3M79A 2HFIA 5L0CA 5BQGA 1XZQA 3B9QA 4IB4A 4BJ5A 1EQ1A 1OXKA 3AQCA 3ZQYA 2YL3A 4CS8C 4CDYA 2J46A 4JJGA 1VYKA 2IYLD 5B1AC 1SYQA 3ZC4A 4BEMJ 3UNGC 4PJJA 3KL4A 4BPMA 5B3SC 3RW0A 1JPNA 1YJGA 2XM4A 4YJWA 2XL8A 4BJ6C 5K0IA 1MMDA 2P6VA 1OW7A 3U9JA 2YVKA 3U8PA 1PD0A 4E7SA 1HE9A 2ZXRA 1Y4CA 3AGTA 3DM5A 5A6BD 1NG1A 3NDBB 2JPUA 2HV7A 2A69F 2ZXPA 5BUOA 5A69A 5JUAA 4LDQA 4DOZA 1VLSA 2GDCA 2Y39A 1XZPA 5E33A 5DS5A 1BR2A 3DWWA 3CAXA 1H7IA 4OIRF 3UGOA 1I5NA 3H2VA 1LVKA 2O9XA 2OU6A 3FDQA 1ORYA 1YVIA 3MX3A 2L81A 2R02A 1PD1A 3FMSA 2JD3A 1EI7A 5T3TA 1O3UA 1RMVA 2OOCA 2VCAA 4OINF 1HY5A 3NMJA 1ZHYA 1ZYRF 1BDJB 3UR3C 4G7OF 1AVOB 3QVZA 3O6XA 4C3DA 3LEVA 2HMQA 5L0DA 2EPLX 3UMHA 4YWQA 2XRHA 3EFOA 5IY5C 4XEKA 1QZXA 2A6HF 2YLDA 5T3WA 4CDVA 2YL7A 2EPOA 1T5OA 3GANA 2L9JA 5EK0A 2WB7A 3EHNA 3CEXA 5JLIA 2R9RB 4JTCB 4NTBA 4U5CE 3G4XA 3HLZA 4NQFA 4WJ0A 3DZAA 5D91A 3K6BA 2VH3A 4DVZA 5A6JA 3O10A 2UUHA 1E2XA 2YRFA 2HZ8A 1VB5A 3EGDB 3FHDA 1AEPA 4C7OA 2W9YA 2CW0F 5AC5A 3GEEA 3TQOA 2CNWD 1ZZPA 3QW0A 1E84A 2L6HA 2MYSA 3HNKA 1OKKD 5CI9A 1NSGB 1CPRA 1E85A 1Q0KA 5F5FA 1NU7D 3E9VA 2ZXWC 4JC7A 4PJLA 2JX0A 4BEJA 2HMZA 3EHMA 1C02A 1T6QA 3I4UA 2G3KA 2LIGA 4NTAA 3AG2C 4CIHA 1TWHA 4Q7CA 4XEVA 2XLOA 4AE4A 4KI2A 4NY3A 1OCRC 2BC5A 4LLEA 4JRZA 3X2QC 3C62A 2A1DD 4RD9A 4CSAA 4O6MA 2EILC 5KYWB 1G4US 3L8IA 1E86A 2R7RA 4JURI 3C7JA 1Q0MA 4K7BA 2R05A 4U9EA 3I5QA 1QVXA 4LDRA 3ZIBA 1JOGA 4CJGA 3EG9A 1APCA 3GODA 2DGJA 1ZHWA 2WVOA 4FESA 3CSKA 4FWVA 4LLCA 4P9FA 1K04A 3V7OA 1OR3A 3ZQVA 1QLEC 2C04A 4EHPA 5FZTA 5KYNA 4WGYA 3TOLA 3U2MA 3UMIA 3ATPA 2FFHA 3FOOA 4OD4A 2W45A 4OD5A 2J45A 2PP4A 3L0IA 1HMOA 1Y6DA 3NYJA 5DS4A 1KTMA 3EZIA 3B0PA 4DRIB 1RKCA 4KNVA 4O6NA 2P1AA 1WASA 1MNDA 3ZTZA 2AVKA 4CS9C 1WATA 4EKWA 2VASA 5L0JA 3NYLA 4I1MA 1LS1A 4GEHA 2XL4A 3RQGA 2W4MA 2WVQA 3DJNB 3BEHA 1MNEA 3ABMC 3IHUA 4E18A 2IXOA 2H7BA 3SXMA 3US6A 1GM5A 1Z23A 2J9WA 4IJJA 2PNOA 3RQEA 2VCCA 2IXPA 2QTVA 3K33A 3RF3A 4Z9HA 2DB4A 4XLNF 2OJED 3JZ0A 3DAGA 3KPHA 4LDKA 1FMWA 4XPYA 3UMKA 4CIPA 1BR4A 1JAFA 1FAPB 3HNLA 4I3MA 4NTFA 3EH2A 3CZ6A 2YZSA 3W2VA 2YWAA 1TKNA 1WWPA 2Q7RA 1MQVA 1VYIA 3MYFA 1LE4A 1LE2A 3X1OA 4H54A 2XL6A 2YKZA 5EGYA 2EPMX 1A41A 4E17A 3TULA 1ST6A 5L0GA 2RD9A 3IQTA 3LLIA 4B6IA 4IWBA 5E2QA 4F4BA 1NFNA 4U5GA 2MWQA 4EBBA 1ZW3A 2OEXA 4YL1A 1A7DA 1I4YA 4IARA 2CDQA 3GWLA 3JYYA 3M4CA 1M2VB 3ASOC 4MVMA 3K66A 2DYRC 1RKEA 3FVYA 2HV6A 3NG1A 3ASNC 1I4ZA 1SMYF 1V4AA 3NRHA 1TQGA 3EJNA 3TK0A 2CCYA 4Q5SF 2R7XA 1FMVA 3H2UA 1NLXA 1L3PA 3SYNA 1R5ID 2HS5A 5KYWA 5B1BC 3ZVRA 3AOUA 3HTKC 4MVZA 3BRJA 1SZIA 3V5YA 1Q0GA 2NUPB 1VOMA 4MVOA 5DQTA 4XPXA 1ZU4A 4NCQA 3TOMA 4GYTA 3AG3C 3J06A 2ZPAA 4HEAJ 4C3BA 2J8WA 3QMKA 2G62A 2XSEA 3DAFA 2PFDA 2KGOA 2Q9AA 2ETSA 1QQ3A 2XLDA 1HMDA 5DS6A 4MTFA 3DE8A 4LERA 2WL8A 4CDAA 1Z63A 2BE5F 1KNYA 4FX5A 3C63A 4AL1A 3KMIA 2KC3A 3POVA 2KK1A 2ZXOA 4YT5A 3TJ5A 1JR8A 2KNHA 1LIHA 1V54C 4XTKA 2HSBA 2XLEA 5F5HA 256BA 4CBEA 3B0VC 4PACA 4YT2A 1PV3A 5JS5A 1QSPA 1K40A 3EGXB 1XWJA 4DRHB 4HFFB 4BG0A 4CJOA 3TD7A 3DKAA 3S84A 2QUPA 4E0IA 1FFTC 2OJQA 1R4TA 1JMWA 2EPKX 3CQZA 5KYUB 2F22A 3LLKA 5KYXA 3R2PA 4ANJA 2MHRA 4CS8A 5E3AA 4N06A 4MTGA 4JEBA 3WG7C 3LEOA 2L7AA 3FOPA 1YZCA 3KH2A 1L7CA 2R03A 4CX9A 1C03A 2HKVA 4BJ6A 2FAPB 1K05A 3KYIA 2DI3A 4U9DA 4YL0A 3SXZA 2Z15A 4XPWA 5JT4A 1ZVZA 2Y3HA 2PBEA 3W8IA 1J8MF 2AWCA 3GM3A 4P9TA 1M2VA 3SZRA 1H6GA 4YT8A 5A6BA 4G7HF 1A7EA 2LK4A 4PJNA 4U5HA 2PX0A 4R32A 1U0BB 2P7VA 2CYDA 1YAUO 2NSGA 4D4XA 1FNTc 4G78A 1YDIA 4N6HA 5JP7A 3QZCA 4DXWA 3VAYA 4A4AA 3RVZA 4QI2A 2R7UA 2H7VC 4KNWA 4G0HA 5DLJA 4DBRA 2L6FA 3A11A 3S29A 2H7OA 2EIJC 3GEIA 3C8GD 2NUPA 1U6HA 2QY9A 3Q7LA 4YN0B 4J7YA 2H8AA 2EPNA 2VCBA 3FXHA 2V3CC 3LAYA 3B0UX 2D5RB 1KU2A 3DM9B 2I15A 2J9UA 2M4EA 3M15A 4J30B 4PJMA 1T6UA 3GEHA 2IM8A 1NU9C 1AUEA 3ZG1A 1S05A 1CGME 3L1MA 5EHHA 2ASRA 3SP1A 2HUJA 3NMKA 5D92A 4U5BE 2Y3GA 4JE9A 1FR0A 2KYHA 1HW1A 5AC4A 1H9GA 4YT4A 3JSEO 1WN0A 3JSZA 2IOQA 4Q4ZF
chains in the Genus database with same CATH topology
2GDCA 1YDIA 1U89A 1ST6A 1RKCA 3VF0A 4E17A 4K1OA 5L0GA 5L0HA 3MYIA 2IBFA 5L0JA 3H2VA 1ZW3A 3S90A 1U6HA 2GWWA 2LQGA 1T01A 4DJ9A 4E18A 5L0CA 1ZW2A 1RKEA 2L7AA 4W8PA 1L7CA 2B0HA 2X0CA 3RF3A 1SYQA 3TJ6A 4IGGA 2HSQA 3ZDLA 1DOVA 5L0IA 3H2UA 3TJ5A 1ZVZA 4EHPA 5FZTA 1QKRA 5L0DA 1DOWA 4ONSA 4P9TA 5L0FA 1H6GA 1TR2A 1RKEB 3T6GB 4PR9A 1XWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GDC A;  1YDI A;  1U89 A;  1ST6 A;  1RKC A;  3VF0 A;  4E17 A;  4K1O A;  5L0G A;  5L0H A;  3MYI A;  2IBF A;  5L0J A;  3H2V A;  1ZW3 A;  3S90 A;  1U6H A;  2GWW A;  2LQG A;  1T01 A;  4DJ9 A;  4E18 A;  5L0C A;  1ZW2 A;  1RKE A;  2L7A A;  4W8P A;  1L7C A;  2B0H A;  2X0C A;  3RF3 A;  1SYQ A;  3TJ6 A;  4IGG A;  2HSQ A;  3ZDL A;  1DOV A;  5L0I A;  3H2U A;  3TJ5 A;  1ZVZ A;  4EHP A;  5FZT A;  1QKR A;  5L0D A;  1DOW A;  4ONS A;  4P9T A;  5L0F A;  1H6G A;  1TR2 A;  1RKE B;  3T6G B;  4PR9 A;  1XWJ A; 
#chains in the Genus database with same CATH topology
 3IQ5 A;  3MLG A;  5HSW A;  3NKE A;  3Q7G A;  2J7P A;  3PDM P;  3VM6 A;  5L3V A;  4UDV A;  2IBF A;  2LCH A;  4XEF A;  3U2L A;  4E0H A;  1W2W A;  1O87 A;  2KW3 C;  1Z6A A;  2YL1 A;  4WGZ A;  4G7Z F;  1T01 A;  4DJ9 A;  4MQ9 F;  3OA1 A;  4JCH A;  2YLG A;  1MMG A;  3RYL A;  4XWJ A;  4BJ5 C;  4ZLC A;  2OEV A;  3DXJ F;  3N0T A;  4NC3 A;  1WOL A;  5A6K A;  3LS1 A;  3O39 A;  3GM2 A;  4JJF A;  4PFP A;  1YA7 O;  4ULW A;  1SF8 A;  2YLI A;  3GWN A;  4A2N B;  4EBK A;  2AWY A;  2XM0 A;  1TWG A;  2XLH A;  1RJ9 B;  3JT1 A;  3S28 A;  3V5X A;  1ZHT A;  3AG1 C;  2GFH A;  3EGD A;  3R7C A;  4C3E A;  3N24 A;  1Z7Q c;  1FFH A;  3T6J A;  4MVR A;  1TWA A;  2P61 A;  3PHF 2;  2XXA B;  3HNJ A;  3EQL F;  2I8B A;  3ITF A;  5DQZ A;  1V55 C;  4JTA B;  1TFO B;  2R7W A;  3EPV A;  3JCU Q;  2NSF A;  4RDA A;  1OR2 A;  3RH3 A;  2LQG A;  3EFO B;  4D4N A;  2KSF A;  4XLP F;  1MMN A;  4I44 A;  4H4K C;  1WGW A;  3LUT B;  4W8P A;  2C03 A;  3ZDL A;  1LS4 A;  2B0J A;  1TFK B;  2V26 A;  4JIO A;  2IXN A;  1YAR O;  4W8K A;  3A9C A;  3S9O A;  1LI5 A;  5GPG B;  2J9V A;  3M4B A;  1LI7 A;  3WOD F;  4BJ1 A;  5DVW A;  1F1M A;  1M2O A;  1NFO A;  3NKD A;  1OXB A;  2WZG A;  3DI5 A;  4IAO A;  4J7T A;  4U5E E;  5BQI A;  4PFO A;  1D0Z A;  1S7Z A;  4CS9 A;  3S0X A;  3U9M A;  2M64 A;  4QDL A;  1LKX A;  1UG7 A;  1A7V A;  3AJM A;  1LPE A;  2VB6 A;  1D0X A;  3U0C A;  3C8Z A;  3LES A;  4OIO F;  3FAJ A;  2J0X A;  3M1C B;  1H9T A;  4AE4 B;  4M63 A;  2TMV P;  2GA0 A;  3HKK A;  2P0N A;  1BZ4 A;  2IXM A;  4IGG A;  2HSQ A;  2AU5 A;  2QNL A;  2WZF A;  4ULV A;  1DOV A;  1ZHX A;  2XLM A;  3KKB A;  2L6G A;  1CGN A;  2HJM A;  3E70 C;  3EH1 A;  4GQH A;  2D4U A;  1G5Z A;  2R7O A;  2LP4 A;  1QPU A;  3MBG A;  1PCX A;  2XLV A;  4AX2 A;  1Q0D A;  2YEV A;  2EIM C;  1SR2 A;  1TR2 A;  4Z9J A;  3EG9 B;  3ZWI A;  4HFK B;  2OG2 A;  1RXQ A;  4PR9 A;  3T6G B;  1VTM P;  2WZL A;  3VF0 A;  1U89 A;  3LNM B;  2A6E F;  2R7T A;  1YZA A;  3K1H A;  5CI8 A;  4O79 A;  3MYI A;  1J8Y F;  1RJ9 A;  3IPM O;  3NYM A;  2NG1 A;  4HE8 D;  4JKV A;  3VRC A;  3V5Z A;  4JZA A;  2X51 A;  1EA8 A;  4K0D A;  4CSA C;  3RVY A;  3U3F A;  1JPJ A;  2EIN C;  3DD7 A;  2R7S A;  2YHS A;  3U3B A;  3QW1 A;  2XXA A;  1E83 A;  1D1A A;  2KJG A;  2OKU A;  3T6B A;  2PX3 A;  5F28 E;  1A0B A;  1G4W R;  3L8J A;  1OW6 A;  2PF4 E;  4JEA A;  3RFY A;  2R7V A;  3C8G B;  1BBH A;  1HE1 A;  2HJ3 A;  1Q0F A;  2YQY A;  1G8X A;  1GGQ A;  3S27 A;  5COM A;  1V74 B;  5JSL A;  3B29 A;  3HNI A;  4J32 B;  5JVE A;  4O6Y A;  2J7P D;  1D1B A;  5L0H A;  4EUK B;  3W2W A;  1UFB A;  3AQB A;  3PCV A;  3SEO A;  3JYH A;  2Q00 A;  2G3V A;  3IQ6 A;  4WAB A;  5HV9 A;  1YA9 A;  1ZW2 A;  1OCZ C;  2Q4F A;  3K1I C;  3N2Z B;  3OEO A;  4AK9 A;  2E87 A;  1M6T A;  2B0H A;  3EZH A;  3Q6N A;  2W4B A;  3QVY A;  4O7G A;  2X0C A;  3SNH A;  1YYJ A;  2FGY A;  2LSE A;  3Q6M A;  3TJ6 A;  3G50 A;  1WTY A;  3DJU B;  3T9O A;  3ZTM A;  1JRA A;  1LM3 B;  2A0U A;  3B71 A;  2LD6 A;  4JCZ A;  1T6I A;  2NUT B;  2ICW G;  2Q9C A;  4I1O B;  5L3Q A;  1ZU5 A;  5KYY B;  3F46 A;  3IQC A;  1B68 A;  2DYS C;  2VC9 A;  2RSE B;  4L6R A;  4RBN A;  3ABL C;  5COG A;  2NPU A;  1RKE B;  2WVN A;  2A68 F;  3VYW A;  4DBQ A;  3SXY A;  3WHN A;  1YYX A;  1GQA A;  1CPQ A;  2YL0 A;  3C18 A;  3DE9 A;  3FAP B;  4MTO A;  4K1O A;  4IRU A;  4MVS A;  4EIY A;  5AGF A;  1N1C A;  2J9B A;  3W4Y A;  1ORJ A;  2LFF A;  2XS8 A;  4FAP B;  5BQH A;  1Z5Z A;  2QLA A;  2Y69 C;  4KC9 A;  4MVQ A;  4QI0 A;  4U5F E;  1NZE A;  3AG4 C;  3G4Z A;  4JVS A;  4CS7 A;  2UUI A;  1OCO C;  2EIK C;  4U5D E;  1NBB A;  4JTD B;  3EGX A;  3L34 A;  2ZD9 A;  4DRJ B;  2CGE A;  3IEE A;  2CNW A;  2OQM A;  2XLW A;  1VMA A;  4YL3 A;  5TJ5 E;  4KBL A;  1OKK A;  5B3I A;  1T9K A;  3W8H A;  1C17 M;  3LNR A;  4N4W A;  4X0R A;  3KYJ A;  5KYU A;  4ZLD A;  3ABK C;  4LAC B;  2Y3D A;  1QKR A;  4ONS A;  4AL0 A;  1VLT A;  3JRM O;  5L0F A;  3F47 A;  1CGO A;  4MND A;  4PK4 A;  1D1C A;  2Q9B A;  1TWC A;  3LS0 A;  4EBJ A;  1GS9 A;  2GAQ A;  4JW1 A;  4E7Z A;  5COF A;  5E3C A;  3GOR A;  3QTH A;  2BL2 A;  1YLM A;  1RCP A;  5CIV A;  1M57 C;  1OCC C;  4DVY P;  4Z9I A;  3OWT A;  3PMR A;  2KQ9 A;  3I5P A;  3RIP A;  3C8G A;  3K1I A;  1O5H A;  3UGP A;  1OQC A;  2A0B A;  2GWW A;  4BJT A;  2QE9 A;  3K7D A;  2AP3 A;  1M56 C;  3JTL O;  4IAQ A;  4XQ1 A;  1IW7 F;  2Q3T A;  4EWC A;  1FTS A;  3GM1 A;  1MMA A;  2R7Q A;  2XS1 A;  4OIQ F;  3U8V A;  4OIP F;  1OW8 A;  3ZSU A;  3H65 A;  2Y3B A;  3HJC A;  3U5S A;  1ZHZ A;  5KYX B;  3O55 A;  1Z3I X;  1DOW A;  4MS2 A;  3JRT A;  3NMI A;  4MW3 A;  5T1D B;  3T4R A;  1EKY A;  5L0I A;  2R25 A;  3MFN A;  4C7O B;  4P6I C;  3LJB A;  3DMD A;  4YK5 A;  1D0Y A;  1BR1 A;  2J0W A;  3AGU A;  4MW8 A;  5A6A A;  3ECS A;  1HW2 A;  1VK5 A;  1IZM A;  1ORS C;  4ER9 A;  4N6C A;  2NUT A;  5KYY A;  3SXK A;  2LFD A;  5FCL A;  2OCC C;  3RKO F;  3RQF A;  4MVU A;  5JRA A;  3S90 A;  3WAQ A;  3M79 A;  2HFI A;  5L0C A;  5BQG A;  1XZQ A;  3B9Q A;  4IB4 A;  4BJ5 A;  1EQ1 A;  1OXK A;  3AQC A;  3ZQY A;  2YL3 A;  4CS8 C;  4CDY A;  2J46 A;  4JJG A;  1VYK A;  2IYL D;  5B1A C;  1SYQ A;  3ZC4 A;  4BEM J;  3UNG C;  4PJJ A;  3KL4 A;  4BPM A;  5B3S C;  3RW0 A;  1JPN A;  1YJG A;  2XM4 A;  4YJW A;  2XL8 A;  4BJ6 C;  5K0I A;  1MMD A;  2P6V A;  1OW7 A;  3U9J A;  2YVK A;  3U8P A;  1PD0 A;  4E7S A;  1HE9 A;  2ZXR A;  1Y4C A;  3AGT A;  3DM5 A;  5A6B D;  1NG1 A;  3NDB B;  2JPU A;  2HV7 A;  2A69 F;  2ZXP A;  5BUO A;  5A69 A;  5JUA A;  4LDQ A;  4DOZ A;  1VLS A;  2GDC A;  2Y39 A;  1XZP A;  5E33 A;  5DS5 A;  1BR2 A;  3DWW A;  3CAX A;  1H7I A;  4OIR F;  3UGO A;  1I5N A;  3H2V A;  1LVK A;  2O9X A;  2OU6 A;  3FDQ A;  1ORY A;  1YVI A;  3MX3 A;  2L81 A;  2R02 A;  1PD1 A;  3FMS A;  2JD3 A;  1EI7 A;  5T3T A;  1O3U A;  1RMV A;  2OOC A;  2VCA A;  4OIN F;  1HY5 A;  3NMJ A;  1ZHY A;  1ZYR F;  1BDJ B;  3UR3 C;  4G7O F;  1AVO B;  3QVZ A;  3O6X A;  4C3D A;  3LEV A;  2HMQ A;  5L0D A;  2EPL X;  3UMH A;  4YWQ A;  2XRH A;  3EFO A;  5IY5 C;  4XEK A;  1QZX A;  2A6H F;  2YLD A;  5T3W A;  4CDV A;  2YL7 A;  2EPO A;  1T5O A;  3GAN A;  2L9J A;  5EK0 A;  2WB7 A;  3EHN A;  3CEX A;  5JLI A;  2R9R B;  4JTC B;  4NTB A;  4U5C E;  3G4X A;  3HLZ A;  4NQF A;  4WJ0 A;  3DZA A;  5D91 A;  3K6B A;  2VH3 A;  4DVZ A;  5A6J A;  3O10 A;  2UUH A;  1E2X A;  2YRF A;  2HZ8 A;  1VB5 A;  3EGD B;  3FHD A;  1AEP A;  4C7O A;  2W9Y A;  2CW0 F;  5AC5 A;  3GEE A;  3TQO A;  2CNW D;  1ZZP A;  3QW0 A;  1E84 A;  2L6H A;  2MYS A;  3HNK A;  1OKK D;  5CI9 A;  1NSG B;  1CPR A;  1E85 A;  1Q0K A;  5F5F A;  1NU7 D;  3E9V A;  2ZXW C;  4JC7 A;  4PJL A;  2JX0 A;  4BEJ A;  2HMZ A;  3EHM A;  1C02 A;  1T6Q A;  3I4U A;  2G3K A;  2LIG A;  4NTA A;  3AG2 C;  4CIH A;  1TWH A;  4Q7C A;  4XEV A;  2XLO A;  4AE4 A;  4KI2 A;  4NY3 A;  1OCR C;  2BC5 A;  4LLE A;  4JRZ A;  3X2Q C;  3C62 A;  2A1D D;  4RD9 A;  4CSA A;  4O6M A;  2EIL C;  5KYW B;  1G4U S;  3L8I A;  1E86 A;  2R7R A;  4JUR I;  3C7J A;  1Q0M A;  4K7B A;  2R05 A;  4U9E A;  3I5Q A;  1QVX A;  4LDR A;  3ZIB A;  1JOG A;  4CJG A;  3EG9 A;  1APC A;  3GOD A;  2DGJ A;  1ZHW A;  2WVO A;  4FES A;  3CSK A;  4FWV A;  4LLC A;  4P9F A;  1K04 A;  3V7O A;  1OR3 A;  3ZQV A;  1QLE C;  2C04 A;  4EHP A;  5FZT A;  5KYN A;  4WGY A;  3TOL A;  3U2M A;  3UMI A;  3ATP A;  2FFH A;  3FOO A;  4OD4 A;  2W45 A;  4OD5 A;  2J45 A;  2PP4 A;  3L0I A;  1HMO A;  1Y6D A;  3NYJ A;  5DS4 A;  1KTM A;  3EZI A;  3B0P A;  4DRI B;  1RKC A;  4KNV A;  4O6N A;  2P1A A;  1WAS A;  1MND A;  3ZTZ A;  2AVK A;  4CS9 C;  1WAT A;  4EKW A;  2VAS A;  5L0J A;  3NYL A;  4I1M A;  1LS1 A;  4GEH A;  2XL4 A;  3RQG A;  2W4M A;  2WVQ A;  3DJN B;  3BEH A;  1MNE A;  3ABM C;  3IHU A;  4E18 A;  2IXO A;  2H7B A;  3SXM A;  3US6 A;  1GM5 A;  1Z23 A;  2J9W A;  4IJJ A;  2PNO A;  3RQE A;  2VCC A;  2IXP A;  2QTV A;  3K33 A;  3RF3 A;  4Z9H A;  2DB4 A;  4XLN F;  2OJE D;  3JZ0 A;  3DAG A;  3KPH A;  4LDK A;  1FMW A;  4XPY A;  3UMK A;  4CIP A;  1BR4 A;  1JAF A;  1FAP B;  3HNL A;  4I3M A;  4NTF A;  3EH2 A;  3CZ6 A;  2YZS A;  3W2V A;  2YWA A;  1TKN A;  1WWP A;  2Q7R A;  1MQV A;  1VYI A;  3MYF A;  1LE4 A;  1LE2 A;  3X1O A;  4H54 A;  2XL6 A;  2YKZ A;  5EGY A;  2EPM X;  1A41 A;  4E17 A;  3TUL A;  1ST6 A;  5L0G A;  2RD9 A;  3IQT A;  3LLI A;  4B6I A;  4IWB A;  5E2Q A;  4F4B A;  1NFN A;  4U5G A;  2MWQ A;  4EBB A;  1ZW3 A;  2OEX A;  4YL1 A;  1A7D A;  1I4Y A;  4IAR A;  2CDQ A;  3GWL A;  3JYY A;  3M4C A;  1M2V B;  3ASO C;  4MVM A;  3K66 A;  2DYR C;  1RKE A;  3FVY A;  2HV6 A;  3NG1 A;  3ASN C;  1I4Z A;  1SMY F;  1V4A A;  3NRH A;  1TQG A;  3EJN A;  3TK0 A;  2CCY A;  4Q5S F;  2R7X A;  1FMV A;  3H2U A;  1NLX A;  1L3P A;  3SYN A;  1R5I D;  2HS5 A;  5KYW A;  5B1B C;  3ZVR A;  3AOU A;  3HTK C;  4MVZ A;  3BRJ A;  1SZI A;  3V5Y A;  1Q0G A;  2NUP B;  1VOM A;  4MVO A;  5DQT A;  4XPX A;  1ZU4 A;  4NCQ A;  3TOM A;  4GYT A;  3AG3 C;  3J06 A;  2ZPA A;  4HEA J;  4C3B A;  2J8W A;  3QMK A;  2G62 A;  2XSE A;  3DAF A;  2PFD A;  2KGO A;  2Q9A A;  2ETS A;  1QQ3 A;  2XLD A;  1HMD A;  5DS6 A;  4MTF A;  3DE8 A;  4LER A;  2WL8 A;  4CDA A;  1Z63 A;  2BE5 F;  1KNY A;  4FX5 A;  3C63 A;  4AL1 A;  3KMI A;  2KC3 A;  3POV A;  2KK1 A;  2ZXO A;  4YT5 A;  3TJ5 A;  1JR8 A;  2KNH A;  1LIH A;  1V54 C;  4XTK A;  2HSB A;  2XLE A;  5F5H A;  256B A;  4CBE A;  3B0V C;  4PAC A;  4YT2 A;  1PV3 A;  5JS5 A;  1QSP A;  1K40 A;  3EGX B;  1XWJ A;  4DRH B;  4HFF B;  4BG0 A;  4CJO A;  3TD7 A;  3DKA A;  3S84 A;  2QUP A;  4E0I A;  1FFT C;  2OJQ A;  1R4T A;  1JMW A;  2EPK X;  3CQZ A;  5KYU B;  2F22 A;  3LLK A;  5KYX A;  3R2P A;  4ANJ A;  2MHR A;  4CS8 A;  5E3A A;  4N06 A;  4MTG A;  4JEB A;  3WG7 C;  3LEO A;  2L7A A;  3FOP A;  1YZC A;  3KH2 A;  1L7C A;  2R03 A;  4CX9 A;  1C03 A;  2HKV A;  4BJ6 A;  2FAP B;  1K05 A;  3KYI A;  2DI3 A;  4U9D A;  4YL0 A;  3SXZ A;  2Z15 A;  4XPW A;  5JT4 A;  1ZVZ A;  2Y3H A;  2PBE A;  3W8I A;  1J8M F;  2AWC A;  3GM3 A;  4P9T A;  1M2V A;  3SZR A;  1H6G A;  4YT8 A;  5A6B A;  4G7H F;  1A7E A;  2LK4 A;  4PJN A;  4U5H A;  2PX0 A;  4R32 A;  1U0B B;  2P7V A;  2CYD A;  1YAU O;  2NSG A;  4D4X A;  1FNT c;  4G78 A;  1YDI A;  4N6H A;  5JP7 A;  3QZC A;  4DXW A;  3VAY A;  4A4A A;  3RVZ A;  4QI2 A;  2R7U A;  2H7V C;  4KNW A;  4G0H A;  5DLJ A;  4DBR A;  2L6F A;  3A11 A;  3S29 A;  2H7O A;  2EIJ C;  3GEI A;  3C8G D;  2NUP A;  1U6H A;  2QY9 A;  3Q7L A;  4YN0 B;  4J7Y A;  2H8A A;  2EPN A;  2VCB A;  3FXH A;  2V3C C;  3LAY A;  3B0U X;  2D5R B;  1KU2 A;  3DM9 B;  2I15 A;  2J9U A;  2M4E A;  3M15 A;  4J30 B;  4PJM A;  1T6U A;  3GEH A;  2IM8 A;  1NU9 C;  1AUE A;  3ZG1 A;  1S05 A;  1CGM E;  3L1M A;  5EHH A;  2ASR A;  3SP1 A;  2HUJ A;  3NMK A;  5D92 A;  4U5B E;  2Y3G A;  4JE9 A;  1FR0 A;  2KYH A;  1HW1 A;  5AC4 A;  1H9G A;  4YT4 A;  3JSE O;  1WN0 A;  3JSZ A;  2IOQ A;  4Q4Z F; 
#chains in the Genus database with same CATH homology
 2GDC A;  1YDI A;  1U89 A;  1ST6 A;  1RKC A;  3VF0 A;  4E17 A;  4K1O A;  5L0G A;  5L0H A;  3MYI A;  2IBF A;  5L0J A;  3H2V A;  1ZW3 A;  3S90 A;  1U6H A;  2GWW A;  2LQG A;  1T01 A;  4DJ9 A;  4E18 A;  5L0C A;  1ZW2 A;  1RKE A;  2L7A A;  4W8P A;  1L7C A;  2B0H A;  2X0C A;  3RF3 A;  1SYQ A;  3TJ6 A;  4IGG A;  2HSQ A;  3ZDL A;  1DOV A;  5L0I A;  3H2U A;  3TJ5 A;  1ZVZ A;  4EHP A;  5FZT A;  1QKR A;  5L0D A;  1DOW A;  4ONS A;  4P9T A;  5L0F A;  1H6G A;  1TR2 A;  1RKE B;  3T6G B;  4PR9 A;  1XWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...