1YDIA

Human vinculin head domain (vh1, 1-258) in complex with human alpha-actinin's vinculin-binding site (residues 731-760)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
263
structure length
256
Chain Sequence
HHHHHMPVFHTRTIESILEPVAQQISHLVIMHEAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords vinculin isoform VCL
publication title Structural Dynamics of {alpha}-Actinin-Vinculin Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
total genus 108
structure length 256
sequence length 263
ec nomenclature
pdb deposition date 2004-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1ydiA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1ydiA01
3RF3A 2GDCA 2IBFA 2L7AA 3T6GB 5L0GA 4E17A 3MYIA 1RKEA 5L0JA 5L0HA 4P9TA 3TJ6A 1H6GA 1ZW3A 4EHPA 1ZVZA 1DOVA 1ST6A 2HSQA 4IGGA 2LQGA 1TR2A 1DOWA 4PR9A 5FZTA 3TJ5A 4ONSA 1U89A 1SYQA 2GWWA 5L0IA 3S90A 4W8PA 5L0CA 3H2VA 2B0HA 1XWJA 5L0DA 1T01A 1RKCA 1U6HA 3H2UA 5L0FA 2X0CA 3VF0A 4DJ9A 1L7CA 3ZDLA 1YDIA 1QKRA 1RKEB 1ZW2A 4E18A 4K1OA
chains in the Genus database with same CATH superfamily
3Q7GA 2XRHA 5HSWA 2Y69C 2YL3A 3LEOA 5L0GA 1E84A 4IRUA 4J32B 4DVZA 3AG3C 1PD0A 4EWCA 2XL8A 3EGXA 1H7IA 3TOMA 2H7OA 1TWGA 3VM6A 2VB6A 1V55C 1VOMA 1LVKA 4YL1A 5E3AA 1I4YA 3C63A 1DOVA 1OKKA 3KH2A 1O5HA 3NDBB 4Q5SF 3LLIA 1VLSA 1BDJB 1VYKA 2ZD9A 4PK4A 3KMIA 3TJ5A 4EBKA 3QW1A 3CAXA 1CGME 3ZG1A 1M56C 4IB4A 1E83A 1JR8A 1XWJA 3TOLA 5DQTA 1EQ1A 3I5QA 1S05A 1BR2A 3AG1C 5JP7A 3FOPA 5L0FA 2X0CA 1RCPA 2XM0A 3ZDLA 2H7VC 2HJMA 4K1OA 3RQGA 1HE9A 4LERA 2YKZA 4IAQA 3LEVA 5HV9A 3FAPB 2L81A 4YT2A 4MVRA 1M2VB 1FFHA 3OA1A 3NYMA 3US6A 2UUIA 2J0WA 4DOZA 3FXHA 3T6JA 3DM5A 4HE8D 3EGDB 4AL1A 2E87A 4AK9A 1WTYA 4J30B 2NUPB 3IPMO 1Q0MA 4YWQA 4WJ0A 2A68F 4JTCB 3RH3A 1XZQA 3AJMA 5D91A 2BC5A 3GODA 3J06A 3VRCA 1WOLA 2GFHA 3QMKA 2C03A 4EBJA 2EPNA 3QTHA 1QSPA 3S84A 2EPLX 2XLMA 2KSFA 1U6HA 2WL8A 2XLHA 3H2UA 3SP1A 3U5SA 3W8HA 3DE9A 3IQ6A 4DRIB 4P6IC 3K1IC 4M63A 4MVZA 5KYWB 1EKYA 3GEHA 3H65A 3IQ5A 3EQLF 2G3KA 1LS4A 3NRHA 1QPUA 1C02A 3DAGA 3ZSUA 2A0BA 4XEFA 2XLVA 4OIPF 2R7UA 1ZHYA 1HW2A 4JKVA 2EPOA 1Y6DA 4MTGA 4XLPF 3WG7C 4YN0B 2LD6A 4DRHB 1GM5A 5A6BD 1R5ID 4CX9A 4U5EE 3MX3A 1NU9C 4N6HA 4PJMA 4IARA 3JRTA 1MNDA 4JZAA 3DWWA 4I1MA 2JX0A 1U89A 1YZCA 2YL7A 3BRJA 3QZCA 4JJGA 3U8PA 4XEKA 1CPQA 1ZHXA 2Q3TA 5L0DA 5KYYA 2X51A 4CS8C 3C8GD 4BEMJ 1C03A 2R03A 1Q0KA 3LS1A 1QLEC 3SXYA 1A7VA 4KC9A 3U9JA 3SXMA 5JUAA 1ORJA 1A7EA 1WATA 1YZAA 3K7DA 2PP4A 3AGUA 4CDYA 4NCQA 4IWBA 5EHHA 4CS8A 2FGYA 1VMAA 2HUJA 2ZXWC 4OINF 2OU6A 3L0IA 1RJ9B 3W2WA 2DB4A 5A6BA 2L6GA 2RSEB 3FOOA 3ZTZA 1RKEA 1SZIA 2KQ9A 2FAPB 1VB5A 2P7VA 3MLGA 1OCCC 1Z3IX 2XL6A 1ZZPA 3M4BA 1R4TA 3V5XA 3EFOB 2OKUA 3FAJA 3BEHA 1K05A 4G0HA 3RQFA 1M2VA 3POVA 4DRJB 4BJ6C 1LM3B 2R9RB 3O6XA 3Q6MA 4JTAB 4IGGA 4U5DE 2WVNA 3DI5A 2R7OA 4FESA 5DLJA 2XLWA 1AUEA 2P61A 2M64A 3QVZA 4BJ6A 1W2WA 3B0UX 1PV3A 2AWYA 3NMIA 4JRZA 4P9FA 5CI8A 1O3UA 4CDVA 2WZGA 3DZAA 4OD5A 4EUKB 1WASA 3UGPA 1VLTA 2H8AA 3NMJA 5T1DB 3U3BA 1VK5A 1QKRA 4U5BE 4EKWA 4CIHA 2V3CC 1Z23A 3N24A 4JVSA 2P1AA 2HSBA 4NC3A 2YQYA 4I44A 2NG1A 1H6GA 5COFA 3SXZA 1SMYF 5CIVA 2HJ3A 3SZRA 1A0BA 4AE4B 5K0IA 4DVYP 2LSEA 3PCVA 4CS9C 1WWPA 3L8IA 2XS1A 1TQGA 3K6BA 4RBNA 3AG4C 5KYUA 5FZTA 5TJ5E 1Q0GA 5BUOA 1T5OA 5L0IA 2YEVA 2ETSA 2HZ8A 4W8PA 2NPUA 4XPXA 1YYJA 2ZXPA 3HJCA 2KC3A 3TK0A 3DE8A 1M57C 3GWLA 4PJLA 4ULWA 3B0VC 2J8WA 4LACB 3ZIBA 5DS5A 2A0UA 1GGQA 4A4AA 3KYJA 4DJ9A 4KBLA 5AC5A 2HFIA 4H54A 2Q9CA 2HV7A 2YL1A 1T6QA 2HKVA 3O55A 5F5HA 4J7YA 4FAPB 5A6JA 4LDQA 3T6GB 4HFFB 4W8KA 5T3WA 3I5PA 4XEVA 1ORSC 2YL0A 4MNDA 3UMKA 4PJJA 3EG9A 1MMNA 2HMQA 2IM8A 2KK1A 2EPKX 3TJ6A 1G8XA 1MMGA 3S0XA 1YAUO 4U5HA 2EINC 4MW8A 3F46A 4F4BA 5A6KA 4JJFA 1LS1A 3CSKA 3UR3C 2ZXRA 3IQTA 3FMSA 3B71A 4OD4A 3B9QA 1CPRA 3ZWIA 2D4UA 1LI5A 4MW3A 4XWJA 1TFOB 3ASNC 3AQCA 4UDVA 3U3FA 2VC9A 4JEAA 3EZIA 3QW0A 1Y4CA 3DMDA 3S29A 4XQ1A 3ZQYA 2J9BA 1ZU5A 1RKCA 3EH1A 3GM3A 2XXAB 2YVKA 3K1HA 3GEIA 3M4CA 5B1AC 1MMAA 2VCBA 2CYDA 3T4RA 5JSLA 3EHNA 3G50A 4JCHA 4JTDB 4GEHA 4JIOA 3RIPA 2WVQA 4PJNA 3R7CA 4DBRA 1OW8A 3RFYA 5E2QA 4ZLCA 1SF8A 1CGOA 1ZHZA 2UUHA 3LNMB 1FAPB 4MQ9F 3U9MA 1Z5ZA 1A7DA 3RYLA 1HMOA 3ASOC 3DD7A 3I4UA 3U0CA 5E3CA 2XM4A 3JT1A 4EHPA 4PFPA 3WODF 2J9UA 4DXWA 2AU5A 5E33A 1T6UA 2OOCA 4LLCA 4XTKA 1YA7O 3T6BA 2Z15A 4CSAC 1QQ3A 2AVKA 3DAFA 2YWAA 4N06A 1DOWA 2VASA 4JCZA 3LS0A 4ONSA 4C7OA 4G7OF 4E7ZA 1YLMA 1O87A 1I5NA 2DI3A 1NZEA 2W9YA 4CSAA 1V74B 1G4WR 3R2PA 4PFOA 3WHNA 3A9CA 3UMIA 5DQZA 1I4ZA 1WGWA 2B0JA 4BJTA 3VF0A 5KYXA 2JD3A 1L7CA 2J9VA 3VAYA 1ZW2A 1TWCA 3EPVA 1OR2A 1ZYRF 3RF3A 2C04A 1B68A 1KU2A 1FNTc 1YYXA 1AVOB 2J0XA 2R05A 3LLKA 1OW6A 4RD9A 3K1IA 5EK0A 3T9OA 1JMWA 3DJUB 3Q7LA 2A6EF 4AX2A 3E9VA 1FMVA 4U5FE 2BE5F 4JEBA 5FCLA 1NFNA 3UNGC 3A11A 2AWCA 3S9OA 3W4YA 2IXPA 2NSGA 3EHMA 3GWNA 2GWWA 2ICWG 5DVWA 4OIRF 2CW0F 3G4ZA 1PCXA 3IQCA 3AQBA 4O7GA 1IZMA 2HMZA 3RW0A 1BZ4A 2PFDA 2ZXOA 4IAOA 1VYIA 1F1MA 1YA9A 4Z9HA 3W8IA 4YT5A 2R7QA 3V5ZA 3JSZA 4LDRA 1ZU4A 4Z9IA 2MWQA 1YDIA 1GS9A 1OCZC 3U8VA 1OCRC 4Z9JA 3EZHA 3NG1A 2OG2A 2I8BA 3ITFA 4JURI 3RQEA 5L0JA 4A2NB 4P9TA 1JRAA 2DYSC 4E0HA 2HV6A 1LPEA 4H4KC 1FR0A 2WZFA 3L8JA 3KKBA 3Q6NA 1OCOC 2P0NA 4Q7CA 2IOQA 2QUPA 4U9EA 2QTVA 3F47A 3O39A 1Z63A 1JAFA 4JW1A 1MNEA 3M79A 4PR9A 1SYQA 1Q0DA 3GORA 2Q00A 3EGDA 3LNRA 3SXKA 5JRAA 3S90A 2XLDA 1UFBA 2NUPA 2YLIA 4G7ZF 4L6RA 3FHDA 2LFFA 1T6IA 5DS4A 2WB7A 2NUTB 4EIYA 1D0XA 4E7SA 3O10A 5B1BC 1XZPA 1J8YF 2LK4A 2WZLA 2OEVA 2Y3GA 4PACA 3PHF2 1NFOA 2Y39A 1NG1A 1TKNA 2GDCA 3W2VA 3JYHA 2XS8A 5BQHA 2QNLA 5KYWA 2OQMA 3FDQA 4C3EA 2LIGA 4CIPA 1TWHA 4NTAA 1H9TA 1YVIA 2A69F 4O6YA 4JE9A 3TQOA 3C18A 3HNJA 1QZXA 3NMKA 5A6AA 4HEAJ 3C62A 1H9GA 3NKEA 5AC4A 3G4XA 2V26A 2VCCA 2Q7RA 2R02A 4YT4A 3PDMP 2HS5A 2RD9A 5JS5A 4CS9A 4CJOA 2VH3A 5BQIA 4MTOA 4C3DA 2MHRA 4E0IA 3AOUA 1FTSA 2Y3BA 4O79A 4BG0A 4LLEA 4K0DA 2MYSA 3OWTA 3DKAA 5DS6A 2QY9A 1BR4A 3ZQVA 3SYNA 3AGTA 4C3BA 3N0TA 1NBBA 2CGEA 2LCHA 3UMHA 2LFDA 1IW7F 3MYFA 3FVYA 4R32A 5L0HA 3SEOA 1JPJA 1RJ9A 4FX5A 3TULA 4U5GA 2TMVP 2YHSA 5COGA 4LDKA 1HY5A 2ASRA 3HNLA 3EJNA 3EH2A 3OEOA 1OXBA 4BPMA 4MVUA 4CJGA 2LQGA 3N2ZB 3JYYA 3RKOF 3EFOA 5JT4A 2M4EA 2WVOA 3AG2C 4CBEA 1S7ZA 3H2VA 2R7VA 1JOGA 1WN0A 5KYNA 1JPNA 4BJ5C 1D0YA 1EA8A 2I15A 3KPHA 3NKDA 2NUTA 4D4NA 1NLXA 1NSGB 2KGOA 3HTKC 2IBFA 2OEXA 1G4US 3JRMO 3LJBA 5D92A 4BJ5A 4YT8A 1CGNA 3L34A 5JLIA 1KNYA 3HKKA 3MYIA 5IY5C 4YK5A 2EILC 2PX3A 1FFTC 1ZHTA 3ABLC 4WGYA 2OJED 1V4AA 4QDLA 3ECSA 3E70C 1D1BA 3S28A 2CDQA 3ZC4A 4MVOA 2R7TA 4GQHA 5KYYB 5F5FA 1MQVA 3LESA 1KTMA 4DBQA 2GAQA 4BJ1A 4BEJA 2QE9A 3K66A 1APCA 2CCYA 4AE4A 2L6FA 3GEEA 3JZ0A 1T01A 3GM1A 3X1OA 2LP4A 1K40A 2R7XA 4ULVA 1D1CA 3CQZA 4N6CA 3UGOA 1RKEB 1OXKA 1QVXA 4E18A 2W4MA 1ORYA 4I1OB 5L3QA 2J45A 3DM9B 3MBGA 1D1AA 1TWAA 256BA 4CDAA 4E17A 1LE2A 4EBBA 4U9DA 2IXOA 1N1CA 2YRFA 1MMDA 4U5CE 1K04A 2XL4A 3C8GB 4NTFA 4JC7A 1OR3A 2G62A 2P6VA 2PF4E 1LKXA 1ST6A 4KNWA 3RVYA 3U2MA 2HSQA 2EPMX 3CZ6A 3U2LA 2R7SA 4G78A 2EIJC 2OCCC 3IHUA 4NTBA 3JCUQ 2B0HA 2R7WA 1T9KA 2EIKC 1UG7A 3ABMC 3HLZA 4MS2A 2EIMC 2IXMA 4KI2A 4MVMA 2YZSA 3IEEA 4QI0A 4B6IA 4GYTA 2Y3DA 4XPWA 2FFHA 5L3VA 4O6NA 1HW1A 2CNWD 5JVEA 1HE1A 1EI7A 3TD7A 2XXAA 1U0BB 4XLNF 2BL2A 3HNIA 1OW7A 3SNHA 3X2QC 3MFNA 2PBEA 3K33A 1E85A 5KYUB 1ZW3A 3V5YA 3LAYA 4XPYA 4AL0A 1FMWA 2Q9BA 5B3IA 5BQGA 1BBHA 2KW3C 2R25A 3HNKA 1YARO 1V54C 2J7PD 3ABKC 3M15A 4NY3A 4X0RA 4D4XA 1VTMP 2O9XA 5T3TA 4ER9A 3V7OA 5EGYA 5A69A 2DYRC 3C7JA 4J7TA 2QLAA 1YJGA 4NQFA 2CNWA 2KNHA 3GM2A 2XLEA 3LUTB 2Q4FA 4FWVA 4OIOF 2A1DD 4MVSA 2A6HF 3EG9B 1SR2A 5F28E 5B3SC 2D5RB 1Q0FA 2F22A 2L7AA 3EGXB 3L1MA 4YL3A 1GQAA 1E86A 2J46A 1A41A 4K7BA 3KL4A 2W4BA 2L9JA 1RMVA 2KJGA 2J7PA 1C17M 4QI2A 3DJNB 4WABA 1ZVZA 2ZPAA 3ATPA 1M6TA 4YJWA 5COMA 3C8ZA 5CI9A 4WGZA 1NU7D 3C8GA 3CEXA 2GA0A 4YL0A 4RDAA 5L0CA 1E2XA 1M2OA 1LE4A 1ZHWA 2OJQA 2IXNA 3B29A 4KNVA 3ZVRA 2H7BA 4MVQA 4ANJA 2W45A 2YLDA 4N4WA 2XLOA 4ZLDA 1RXQA 2Q9AA 2KYHA 4HFKB 4IJJA 2XSEA 2IYLD 2DGJA 2NSFA 4Q4ZF 1BR1A 2R7RA 5GPGB 3NYJA 3JSEO 4CS7A 1HMDA 1L3PA 1AEPA 3VYWA 2PX0A 1G5ZA 4I3MA 3ZTMA 3QVYA 1LIHA 2AP3A 4OIQF 2VCAA 4O6MA 1PD1A 1OQCA 3JTLO 2G3VA 3DXJF 2J9WA 1TFKB 1TR2A 1OKKD 3PMRA 1LI7A 2PNOA 3S27A 5KYXB 1D0ZA 1J8MF 3RVZA 3NYLA 3B0PA 2Y3HA 4G7HF 5AGFA 1Z6AA 4MTFA 2YLGA 3GANA 3KYIA 3M1CB 2L6HA 3WAQA 4C7OB 2JPUA 1Z7Qc
chains in the Genus database with same CATH topology
3RF3A 2GDCA 2IBFA 2L7AA 3T6GB 5L0GA 4E17A 3MYIA 1RKEA 5L0JA 5L0HA 4P9TA 3TJ6A 1H6GA 1ZW3A 4EHPA 1ZVZA 1DOVA 1ST6A 2HSQA 4IGGA 2LQGA 1TR2A 1DOWA 4PR9A 5FZTA 3TJ5A 4ONSA 1U89A 1SYQA 2GWWA 5L0IA 3S90A 4W8PA 5L0CA 3H2VA 2B0HA 1XWJA 5L0DA 1T01A 1RKCA 1U6HA 3H2UA 5L0FA 2X0CA 3VF0A 4DJ9A 1L7CA 3ZDLA 1YDIA 1QKRA 1RKEB 1ZW2A 4E18A 4K1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RF3 A;  2GDC A;  2IBF A;  2L7A A;  3T6G B;  5L0G A;  4E17 A;  3MYI A;  1RKE A;  5L0J A;  5L0H A;  4P9T A;  3TJ6 A;  1H6G A;  1ZW3 A;  4EHP A;  1ZVZ A;  1DOV A;  1ST6 A;  2HSQ A;  4IGG A;  2LQG A;  1TR2 A;  1DOW A;  4PR9 A;  5FZT A;  3TJ5 A;  4ONS A;  1U89 A;  1SYQ A;  2GWW A;  5L0I A;  3S90 A;  4W8P A;  5L0C A;  3H2V A;  2B0H A;  1XWJ A;  5L0D A;  1T01 A;  1RKC A;  1U6H A;  3H2U A;  5L0F A;  2X0C A;  3VF0 A;  4DJ9 A;  1L7C A;  3ZDL A;  1YDI A;  1QKR A;  1RKE B;  1ZW2 A;  4E18 A;  4K1O A; 
#chains in the Genus database with same CATH topology
 3Q7G A;  2XRH A;  5HSW A;  2Y69 C;  2YL3 A;  3LEO A;  5L0G A;  1E84 A;  4IRU A;  4J32 B;  4DVZ A;  3AG3 C;  1PD0 A;  4EWC A;  2XL8 A;  3EGX A;  1H7I A;  3TOM A;  2H7O A;  1TWG A;  3VM6 A;  2VB6 A;  1V55 C;  1VOM A;  1LVK A;  4YL1 A;  5E3A A;  1I4Y A;  3C63 A;  1DOV A;  1OKK A;  3KH2 A;  1O5H A;  3NDB B;  4Q5S F;  3LLI A;  1VLS A;  1BDJ B;  1VYK A;  2ZD9 A;  4PK4 A;  3KMI A;  3TJ5 A;  4EBK A;  3QW1 A;  3CAX A;  1CGM E;  3ZG1 A;  1M56 C;  4IB4 A;  1E83 A;  1JR8 A;  1XWJ A;  3TOL A;  5DQT A;  1EQ1 A;  3I5Q A;  1S05 A;  1BR2 A;  3AG1 C;  5JP7 A;  3FOP A;  5L0F A;  2X0C A;  1RCP A;  2XM0 A;  3ZDL A;  2H7V C;  2HJM A;  4K1O A;  3RQG A;  1HE9 A;  4LER A;  2YKZ A;  4IAQ A;  3LEV A;  5HV9 A;  3FAP B;  2L81 A;  4YT2 A;  4MVR A;  1M2V B;  1FFH A;  3OA1 A;  3NYM A;  3US6 A;  2UUI A;  2J0W A;  4DOZ A;  3FXH A;  3T6J A;  3DM5 A;  4HE8 D;  3EGD B;  4AL1 A;  2E87 A;  4AK9 A;  1WTY A;  4J30 B;  2NUP B;  3IPM O;  1Q0M A;  4YWQ A;  4WJ0 A;  2A68 F;  4JTC B;  3RH3 A;  1XZQ A;  3AJM A;  5D91 A;  2BC5 A;  3GOD A;  3J06 A;  3VRC A;  1WOL A;  2GFH A;  3QMK A;  2C03 A;  4EBJ A;  2EPN A;  3QTH A;  1QSP A;  3S84 A;  2EPL X;  2XLM A;  2KSF A;  1U6H A;  2WL8 A;  2XLH A;  3H2U A;  3SP1 A;  3U5S A;  3W8H A;  3DE9 A;  3IQ6 A;  4DRI B;  4P6I C;  3K1I C;  4M63 A;  4MVZ A;  5KYW B;  1EKY A;  3GEH A;  3H65 A;  3IQ5 A;  3EQL F;  2G3K A;  1LS4 A;  3NRH A;  1QPU A;  1C02 A;  3DAG A;  3ZSU A;  2A0B A;  4XEF A;  2XLV A;  4OIP F;  2R7U A;  1ZHY A;  1HW2 A;  4JKV A;  2EPO A;  1Y6D A;  4MTG A;  4XLP F;  3WG7 C;  4YN0 B;  2LD6 A;  4DRH B;  1GM5 A;  5A6B D;  1R5I D;  4CX9 A;  4U5E E;  3MX3 A;  1NU9 C;  4N6H A;  4PJM A;  4IAR A;  3JRT A;  1MND A;  4JZA A;  3DWW A;  4I1M A;  2JX0 A;  1U89 A;  1YZC A;  2YL7 A;  3BRJ A;  3QZC A;  4JJG A;  3U8P A;  4XEK A;  1CPQ A;  1ZHX A;  2Q3T A;  5L0D A;  5KYY A;  2X51 A;  4CS8 C;  3C8G D;  4BEM J;  1C03 A;  2R03 A;  1Q0K A;  3LS1 A;  1QLE C;  3SXY A;  1A7V A;  4KC9 A;  3U9J A;  3SXM A;  5JUA A;  1ORJ A;  1A7E A;  1WAT A;  1YZA A;  3K7D A;  2PP4 A;  3AGU A;  4CDY A;  4NCQ A;  4IWB A;  5EHH A;  4CS8 A;  2FGY A;  1VMA A;  2HUJ A;  2ZXW C;  4OIN F;  2OU6 A;  3L0I A;  1RJ9 B;  3W2W A;  2DB4 A;  5A6B A;  2L6G A;  2RSE B;  3FOO A;  3ZTZ A;  1RKE A;  1SZI A;  2KQ9 A;  2FAP B;  1VB5 A;  2P7V A;  3MLG A;  1OCC C;  1Z3I X;  2XL6 A;  1ZZP A;  3M4B A;  1R4T A;  3V5X A;  3EFO B;  2OKU A;  3FAJ A;  3BEH A;  1K05 A;  4G0H A;  3RQF A;  1M2V A;  3POV A;  4DRJ B;  4BJ6 C;  1LM3 B;  2R9R B;  3O6X A;  3Q6M A;  4JTA B;  4IGG A;  4U5D E;  2WVN A;  3DI5 A;  2R7O A;  4FES A;  5DLJ A;  2XLW A;  1AUE A;  2P61 A;  2M64 A;  3QVZ A;  4BJ6 A;  1W2W A;  3B0U X;  1PV3 A;  2AWY A;  3NMI A;  4JRZ A;  4P9F A;  5CI8 A;  1O3U A;  4CDV A;  2WZG A;  3DZA A;  4OD5 A;  4EUK B;  1WAS A;  3UGP A;  1VLT A;  2H8A A;  3NMJ A;  5T1D B;  3U3B A;  1VK5 A;  1QKR A;  4U5B E;  4EKW A;  4CIH A;  2V3C C;  1Z23 A;  3N24 A;  4JVS A;  2P1A A;  2HSB A;  4NC3 A;  2YQY A;  4I44 A;  2NG1 A;  1H6G A;  5COF A;  3SXZ A;  1SMY F;  5CIV A;  2HJ3 A;  3SZR A;  1A0B A;  4AE4 B;  5K0I A;  4DVY P;  2LSE A;  3PCV A;  4CS9 C;  1WWP A;  3L8I A;  2XS1 A;  1TQG A;  3K6B A;  4RBN A;  3AG4 C;  5KYU A;  5FZT A;  5TJ5 E;  1Q0G A;  5BUO A;  1T5O A;  5L0I A;  2YEV A;  2ETS A;  2HZ8 A;  4W8P A;  2NPU A;  4XPX A;  1YYJ A;  2ZXP A;  3HJC A;  2KC3 A;  3TK0 A;  3DE8 A;  1M57 C;  3GWL A;  4PJL A;  4ULW A;  3B0V C;  2J8W A;  4LAC B;  3ZIB A;  5DS5 A;  2A0U A;  1GGQ A;  4A4A A;  3KYJ A;  4DJ9 A;  4KBL A;  5AC5 A;  2HFI A;  4H54 A;  2Q9C A;  2HV7 A;  2YL1 A;  1T6Q A;  2HKV A;  3O55 A;  5F5H A;  4J7Y A;  4FAP B;  5A6J A;  4LDQ A;  3T6G B;  4HFF B;  4W8K A;  5T3W A;  3I5P A;  4XEV A;  1ORS C;  2YL0 A;  4MND A;  3UMK A;  4PJJ A;  3EG9 A;  1MMN A;  2HMQ A;  2IM8 A;  2KK1 A;  2EPK X;  3TJ6 A;  1G8X A;  1MMG A;  3S0X A;  1YAU O;  4U5H A;  2EIN C;  4MW8 A;  3F46 A;  4F4B A;  5A6K A;  4JJF A;  1LS1 A;  3CSK A;  3UR3 C;  2ZXR A;  3IQT A;  3FMS A;  3B71 A;  4OD4 A;  3B9Q A;  1CPR A;  3ZWI A;  2D4U A;  1LI5 A;  4MW3 A;  4XWJ A;  1TFO B;  3ASN C;  3AQC A;  4UDV A;  3U3F A;  2VC9 A;  4JEA A;  3EZI A;  3QW0 A;  1Y4C A;  3DMD A;  3S29 A;  4XQ1 A;  3ZQY A;  2J9B A;  1ZU5 A;  1RKC A;  3EH1 A;  3GM3 A;  2XXA B;  2YVK A;  3K1H A;  3GEI A;  3M4C A;  5B1A C;  1MMA A;  2VCB A;  2CYD A;  3T4R A;  5JSL A;  3EHN A;  3G50 A;  4JCH A;  4JTD B;  4GEH A;  4JIO A;  3RIP A;  2WVQ A;  4PJN A;  3R7C A;  4DBR A;  1OW8 A;  3RFY A;  5E2Q A;  4ZLC A;  1SF8 A;  1CGO A;  1ZHZ A;  2UUH A;  3LNM B;  1FAP B;  4MQ9 F;  3U9M A;  1Z5Z A;  1A7D A;  3RYL A;  1HMO A;  3ASO C;  3DD7 A;  3I4U A;  3U0C A;  5E3C A;  2XM4 A;  3JT1 A;  4EHP A;  4PFP A;  3WOD F;  2J9U A;  4DXW A;  2AU5 A;  5E33 A;  1T6U A;  2OOC A;  4LLC A;  4XTK A;  1YA7 O;  3T6B A;  2Z15 A;  4CSA C;  1QQ3 A;  2AVK A;  3DAF A;  2YWA A;  4N06 A;  1DOW A;  2VAS A;  4JCZ A;  3LS0 A;  4ONS A;  4C7O A;  4G7O F;  4E7Z A;  1YLM A;  1O87 A;  1I5N A;  2DI3 A;  1NZE A;  2W9Y A;  4CSA A;  1V74 B;  1G4W R;  3R2P A;  4PFO A;  3WHN A;  3A9C A;  3UMI A;  5DQZ A;  1I4Z A;  1WGW A;  2B0J A;  4BJT A;  3VF0 A;  5KYX A;  2JD3 A;  1L7C A;  2J9V A;  3VAY A;  1ZW2 A;  1TWC A;  3EPV A;  1OR2 A;  1ZYR F;  3RF3 A;  2C04 A;  1B68 A;  1KU2 A;  1FNT c;  1YYX A;  1AVO B;  2J0X A;  2R05 A;  3LLK A;  1OW6 A;  4RD9 A;  3K1I A;  5EK0 A;  3T9O A;  1JMW A;  3DJU B;  3Q7L A;  2A6E F;  4AX2 A;  3E9V A;  1FMV A;  4U5F E;  2BE5 F;  4JEB A;  5FCL A;  1NFN A;  3UNG C;  3A11 A;  2AWC A;  3S9O A;  3W4Y A;  2IXP A;  2NSG A;  3EHM A;  3GWN A;  2GWW A;  2ICW G;  5DVW A;  4OIR F;  2CW0 F;  3G4Z A;  1PCX A;  3IQC A;  3AQB A;  4O7G A;  1IZM A;  2HMZ A;  3RW0 A;  1BZ4 A;  2PFD A;  2ZXO A;  4IAO A;  1VYI A;  1F1M A;  1YA9 A;  4Z9H A;  3W8I A;  4YT5 A;  2R7Q A;  3V5Z A;  3JSZ A;  4LDR A;  1ZU4 A;  4Z9I A;  2MWQ A;  1YDI A;  1GS9 A;  1OCZ C;  3U8V A;  1OCR C;  4Z9J A;  3EZH A;  3NG1 A;  2OG2 A;  2I8B A;  3ITF A;  4JUR I;  3RQE A;  5L0J A;  4A2N B;  4P9T A;  1JRA A;  2DYS C;  4E0H A;  2HV6 A;  1LPE A;  4H4K C;  1FR0 A;  2WZF A;  3L8J A;  3KKB A;  3Q6N A;  1OCO C;  2P0N A;  4Q7C A;  2IOQ A;  2QUP A;  4U9E A;  2QTV A;  3F47 A;  3O39 A;  1Z63 A;  1JAF A;  4JW1 A;  1MNE A;  3M79 A;  4PR9 A;  1SYQ A;  1Q0D A;  3GOR A;  2Q00 A;  3EGD A;  3LNR A;  3SXK A;  5JRA A;  3S90 A;  2XLD A;  1UFB A;  2NUP A;  2YLI A;  4G7Z F;  4L6R A;  3FHD A;  2LFF A;  1T6I A;  5DS4 A;  2WB7 A;  2NUT B;  4EIY A;  1D0X A;  4E7S A;  3O10 A;  5B1B C;  1XZP A;  1J8Y F;  2LK4 A;  2WZL A;  2OEV A;  2Y3G A;  4PAC A;  3PHF 2;  1NFO A;  2Y39 A;  1NG1 A;  1TKN A;  2GDC A;  3W2V A;  3JYH A;  2XS8 A;  5BQH A;  2QNL A;  5KYW A;  2OQM A;  3FDQ A;  4C3E A;  2LIG A;  4CIP A;  1TWH A;  4NTA A;  1H9T A;  1YVI A;  2A69 F;  4O6Y A;  4JE9 A;  3TQO A;  3C18 A;  3HNJ A;  1QZX A;  3NMK A;  5A6A A;  4HEA J;  3C62 A;  1H9G A;  3NKE A;  5AC4 A;  3G4X A;  2V26 A;  2VCC A;  2Q7R A;  2R02 A;  4YT4 A;  3PDM P;  2HS5 A;  2RD9 A;  5JS5 A;  4CS9 A;  4CJO A;  2VH3 A;  5BQI A;  4MTO A;  4C3D A;  2MHR A;  4E0I A;  3AOU A;  1FTS A;  2Y3B A;  4O79 A;  4BG0 A;  4LLE A;  4K0D A;  2MYS A;  3OWT A;  3DKA A;  5DS6 A;  2QY9 A;  1BR4 A;  3ZQV A;  3SYN A;  3AGT A;  4C3B A;  3N0T A;  1NBB A;  2CGE A;  2LCH A;  3UMH A;  2LFD A;  1IW7 F;  3MYF A;  3FVY A;  4R32 A;  5L0H A;  3SEO A;  1JPJ A;  1RJ9 A;  4FX5 A;  3TUL A;  4U5G A;  2TMV P;  2YHS A;  5COG A;  4LDK A;  1HY5 A;  2ASR A;  3HNL A;  3EJN A;  3EH2 A;  3OEO A;  1OXB A;  4BPM A;  4MVU A;  4CJG A;  2LQG A;  3N2Z B;  3JYY A;  3RKO F;  3EFO A;  5JT4 A;  2M4E A;  2WVO A;  3AG2 C;  4CBE A;  1S7Z A;  3H2V A;  2R7V A;  1JOG A;  1WN0 A;  5KYN A;  1JPN A;  4BJ5 C;  1D0Y A;  1EA8 A;  2I15 A;  3KPH A;  3NKD A;  2NUT A;  4D4N A;  1NLX A;  1NSG B;  2KGO A;  3HTK C;  2IBF A;  2OEX A;  1G4U S;  3JRM O;  3LJB A;  5D92 A;  4BJ5 A;  4YT8 A;  1CGN A;  3L34 A;  5JLI A;  1KNY A;  3HKK A;  3MYI A;  5IY5 C;  4YK5 A;  2EIL C;  2PX3 A;  1FFT C;  1ZHT A;  3ABL C;  4WGY A;  2OJE D;  1V4A A;  4QDL A;  3ECS A;  3E70 C;  1D1B A;  3S28 A;  2CDQ A;  3ZC4 A;  4MVO A;  2R7T A;  4GQH A;  5KYY B;  5F5F A;  1MQV A;  3LES A;  1KTM A;  4DBQ A;  2GAQ A;  4BJ1 A;  4BEJ A;  2QE9 A;  3K66 A;  1APC A;  2CCY A;  4AE4 A;  2L6F A;  3GEE A;  3JZ0 A;  1T01 A;  3GM1 A;  3X1O A;  2LP4 A;  1K40 A;  2R7X A;  4ULV A;  1D1C A;  3CQZ A;  4N6C A;  3UGO A;  1RKE B;  1OXK A;  1QVX A;  4E18 A;  2W4M A;  1ORY A;  4I1O B;  5L3Q A;  2J45 A;  3DM9 B;  3MBG A;  1D1A A;  1TWA A;  256B A;  4CDA A;  4E17 A;  1LE2 A;  4EBB A;  4U9D A;  2IXO A;  1N1C A;  2YRF A;  1MMD A;  4U5C E;  1K04 A;  2XL4 A;  3C8G B;  4NTF A;  4JC7 A;  1OR3 A;  2G62 A;  2P6V A;  2PF4 E;  1LKX A;  1ST6 A;  4KNW A;  3RVY A;  3U2M A;  2HSQ A;  2EPM X;  3CZ6 A;  3U2L A;  2R7S A;  4G78 A;  2EIJ C;  2OCC C;  3IHU A;  4NTB A;  3JCU Q;  2B0H A;  2R7W A;  1T9K A;  2EIK C;  1UG7 A;  3ABM C;  3HLZ A;  4MS2 A;  2EIM C;  2IXM A;  4KI2 A;  4MVM A;  2YZS A;  3IEE A;  4QI0 A;  4B6I A;  4GYT A;  2Y3D A;  4XPW A;  2FFH A;  5L3V A;  4O6N A;  1HW1 A;  2CNW D;  5JVE A;  1HE1 A;  1EI7 A;  3TD7 A;  2XXA A;  1U0B B;  4XLN F;  2BL2 A;  3HNI A;  1OW7 A;  3SNH A;  3X2Q C;  3MFN A;  2PBE A;  3K33 A;  1E85 A;  5KYU B;  1ZW3 A;  3V5Y A;  3LAY A;  4XPY A;  4AL0 A;  1FMW A;  2Q9B A;  5B3I A;  5BQG A;  1BBH A;  2KW3 C;  2R25 A;  3HNK A;  1YAR O;  1V54 C;  2J7P D;  3ABK C;  3M15 A;  4NY3 A;  4X0R A;  4D4X A;  1VTM P;  2O9X A;  5T3T A;  4ER9 A;  3V7O A;  5EGY A;  5A69 A;  2DYR C;  3C7J A;  4J7T A;  2QLA A;  1YJG A;  4NQF A;  2CNW A;  2KNH A;  3GM2 A;  2XLE A;  3LUT B;  2Q4F A;  4FWV A;  4OIO F;  2A1D D;  4MVS A;  2A6H F;  3EG9 B;  1SR2 A;  5F28 E;  5B3S C;  2D5R B;  1Q0F A;  2F22 A;  2L7A A;  3EGX B;  3L1M A;  4YL3 A;  1GQA A;  1E86 A;  2J46 A;  1A41 A;  4K7B A;  3KL4 A;  2W4B A;  2L9J A;  1RMV A;  2KJG A;  2J7P A;  1C17 M;  4QI2 A;  3DJN B;  4WAB A;  1ZVZ A;  2ZPA A;  3ATP A;  1M6T A;  4YJW A;  5COM A;  3C8Z A;  5CI9 A;  4WGZ A;  1NU7 D;  3C8G A;  3CEX A;  2GA0 A;  4YL0 A;  4RDA A;  5L0C A;  1E2X A;  1M2O A;  1LE4 A;  1ZHW A;  2OJQ A;  2IXN A;  3B29 A;  4KNV A;  3ZVR A;  2H7B A;  4MVQ A;  4ANJ A;  2W45 A;  2YLD A;  4N4W A;  2XLO A;  4ZLD A;  1RXQ A;  2Q9A A;  2KYH A;  4HFK B;  4IJJ A;  2XSE A;  2IYL D;  2DGJ A;  2NSF A;  4Q4Z F;  1BR1 A;  2R7R A;  5GPG B;  3NYJ A;  3JSE O;  4CS7 A;  1HMD A;  1L3P A;  1AEP A;  3VYW A;  2PX0 A;  1G5Z A;  4I3M A;  3ZTM A;  3QVY A;  1LIH A;  2AP3 A;  4OIQ F;  2VCA A;  4O6M A;  1PD1 A;  1OQC A;  3JTL O;  2G3V A;  3DXJ F;  2J9W A;  1TFK B;  1TR2 A;  1OKK D;  3PMR A;  1LI7 A;  2PNO A;  3S27 A;  5KYX B;  1D0Z A;  1J8M F;  3RVZ A;  3NYL A;  3B0P A;  2Y3H A;  4G7H F;  5AGF A;  1Z6A A;  4MTF A;  2YLG A;  3GAN A;  3KYI A;  3M1C B;  2L6H A;  3WAQ A;  4C7O B;  2JPU A;  1Z7Q c; 
#chains in the Genus database with same CATH homology
 3RF3 A;  2GDC A;  2IBF A;  2L7A A;  3T6G B;  5L0G A;  4E17 A;  3MYI A;  1RKE A;  5L0J A;  5L0H A;  4P9T A;  3TJ6 A;  1H6G A;  1ZW3 A;  4EHP A;  1ZVZ A;  1DOV A;  1ST6 A;  2HSQ A;  4IGG A;  2LQG A;  1TR2 A;  1DOW A;  4PR9 A;  5FZT A;  3TJ5 A;  4ONS A;  1U89 A;  1SYQ A;  2GWW A;  5L0I A;  3S90 A;  4W8P A;  5L0C A;  3H2V A;  2B0H A;  1XWJ A;  5L0D A;  1T01 A;  1RKC A;  1U6H A;  3H2U A;  5L0F A;  2X0C A;  3VF0 A;  4DJ9 A;  1L7C A;  3ZDL A;  1YDI A;  1QKR A;  1RKE B;  1ZW2 A;  4E18 A;  4K1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...