1YDIA

Human vinculin head domain (vh1, 1-258) in complex with human alpha-actinin's vinculin-binding site (residues 731-760)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
263
structure length
256
Chain Sequence
HHHHHMPVFHTRTIESILEPVAQQISHLVIMHEAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords vinculin isoform VCL
publication title Structural Dynamics of {alpha}-Actinin-Vinculin Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, structural protein
total genus 108
structure length 256
sequence length 263
ec nomenclature
pdb deposition date 2004-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1ydiA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1ydiA01
1RKCA 4K1OA 1TR2A 2HSQA 1H6GA 1ST6A 2X0CA 1U6HA 4E17A 5L0DA 2LQGA 3RF3A 4EHPA 5L0FA 1SYQA 3TJ6A 5L0HA 3S90A 4ONSA 2GWWA 1QKRA 1ZW2A 5L0CA 1RKEA 1DOVA 4E18A 4PR9A 2IBFA 5FZTA 3MYIA 1T01A 5L0IA 2B0HA 1L7CA 3VF0A 1RKEB 3T6GB 1U89A 3H2UA 4W8PA 4IGGA 1ZVZA 5L0JA 1ZW3A 4P9TA 1XWJA 1DOWA 1YDIA 2L7AA 3ZDLA 3TJ5A 5L0GA 3H2VA 4DJ9A 2GDCA
chains in the Genus database with same CATH superfamily
2LD6A 3M15A 2Y3DA 3NRHA 1QPUA 1Y6DA 2YRFA 1MQVA 1CPQA 3RQGA 5L0FA 1SYQA 3FAJA 3K33A 2KSFA 3GWNA 3RFYA 1ZHWA 2HFIA 4Q5SF 2LIGA 2XLWA 3W2WA 5A6BA 3K1IC 2XLMA 3LUTB 2D5RB 3QVYA 1OR3A 2ETSA 4CIHA 5BQGA 4LACB 1L3PA 1S05A 1QVXA 1A7VA 1XZPA 4JTCB 3U5SA 2G3VA 1QLEC 1JAFA 2RSEB 4PACA 2V3CC 2CDQA 4U5DE 1U89A 5E3AA 3IQCA 5DS6A 1R5ID 1ZZPA 3IQ5A 4PJLA 5B1AC 3CZ6A 3SNHA 3SXZA 4BEJA 3MYFA 4NTFA 2HMZA 2KGOA 4XPWA 1GQAA 5KYUA 3RQEA 4A2NB 1G4US 1TWCA 4BJ1A 4K7BA 2HSQA 1T9KA 1MMNA 2Q4FA 1M2VA 1FTSA 1HE9A 3C18A 2C04A 3ABMC 3KYIA 4H54A 4J7TA 4YT2A 3BEHA 4YT4A 4AE4A 5EHHA 3O39A 3Q7GA 1H7IA 2A6EF 3M4BA 5JVEA 2J0WA 1QKRA 5JS5A 1Y4CA 1I4YA 2HJMA 2HV6A 1D1AA 4Q4ZF 1G8XA 1TKNA 2J46A 4JJFA 2R25A 3SXKA 3EQLF 1LI7A 1OW8A 3VF0A 4OIRF 3RH3A 2IXNA 3CEXA 4HFKB 5DQTA 3O10A 1PCXA 3K66A 2VASA 1BR2A 1JMWA 4P9TA 1WATA 1B68A 1SMYF 3HNJA 4L6RA 4MVRA 5A6JA 1ORJA 4KNWA 2WL8A 2EPKX 1FNTc 3E70C 3GM3A 3NYJA 1M57C 4WJ0A 4HEAJ 3EFOB 4D4XA 4XQ1A 4BJ5C 1MMAA 4JE9A 3WAQA 3EGXB 3JCUQ 2CNWA 1YVIA 3B71A 3EPVA 4KNVA 4I1MA 5D91A 2OEXA 2H7VC 2P61A 4G7ZF 2J9WA 1Z3IX 3HTKC 3ECSA 2Y3GA 2J7PA 4Q7CA 5A6KA 2R7RA 1PV3A 1MNDA 2HJ3A 2WZFA 1ZYRF 3GM1A 3OEOA 4MS2A 2GFHA 3IQTA 4MVSA 1FR0A 1E83A 3SYNA 1WGWA 2R05A 5EGYA 3LJBA 3LNRA 1ZW3A 2A0UA 2H7BA 2WZGA 3FOOA 3X2QC 3C8ZA 1QZXA 2GA0A 2ZPAA 3DAGA 3M4CA 2NSFA 2G3KA 2MHRA 2YWAA 2ZXOA 1YYJA 3NKEA 3NYLA 4MVQA 4HE8D 3SEOA 5AC4A 3LS0A 2IXMA 4CS9C 3F46A 1H6GA 3FOPA 3B0UX 4CJGA 2A68F 2ICWG 2KNHA 2XSEA 2LQGA 4G7HF 4EHPA 1ZHYA 1N1CA 3RQFA 3MFNA 4FESA 2OJQA 4JTAB 2OCCC 3AG3C 3NMKA 3ZQYA 5DS4A 1MMGA 4JCZA 4E0IA 2HV7A 1LI5A 3S84A 3AG2C 1T01A 1NU7D 3W4YA 2PNOA 2ZD9A 4RDAA 3V5XA 3C8GD 3CSKA 2JD3A 1C02A 2OOCA 4JEBA 4IJJA 4I3MA 5B1BC 3SZRA 2LFDA 4JIOA 3ZTMA 1JPJA 5CI8A 3V5ZA 1KTMA 4LLCA 1H9GA 2XL8A 2EPMX 2Y69C 4O6YA 5COGA 1KNYA 2Q7RA 4E0HA 3AG1C 1OR2A 5L0JA 1G4WR 2Q9BA 1YYXA 1J8YF 2RD9A 2I8BA 3AJMA 4E18A 5BQIA 3EFOA 3TQOA 4E7SA 3EHNA 1GM5A 1C17M 3EGXA 3ATPA 3RF3A 5L3VA 3FHDA 3GANA 1VYIA 4PK4A 1TWHA 4EUKB 5KYUB 3TJ6A 2XLEA 5L0HA 1ZU5A 3L0IA 3QZCA 4EKWA 5DLJA 4BEMJ 3S29A 2XL6A 1APCA 1T6IA 1TFOB 2I15A 1TFKB 4PR9A 3V5YA 4CX9A 1L7CA 3Q6NA 3IPMO 5K0IA 2FAPB 2QY9A 5L0IA 1CGOA 1RKEB 2R02A 3JSEO 2IM8A 3DKAA 1OW6A 2HMQA 3AGUA 1LKXA 3H2UA 1SF8A 2CCYA 3E9VA 4YJWA 4ZLCA 2FFHA 4H4KC 1BR4A 2HUJA 5TJ5E 2M4EA 4X0RA 3H65A 1LE4A 3N2ZB 4BJTA 1UFBA 3JTLO 2IYLD 2R7SA 1Z5ZA 2R7UA 2GDCA 2PF4E 1AUEA 4CDVA 1A7EA 1XZQA 5JT4A 3U8PA 2XM0A 1W2WA 4XEVA 4MVOA 2TMVP 4O7GA 3NMJA 4D4NA 1CPRA 2D4UA 3S90A 1RCPA 2YZSA 4YL3A 2LCHA 3NDBB 4NTAA 2XS1A 4QI2A 2P0NA 3M1CB 3N0TA 4NTBA 2NPUA 2G62A 1SZIA 3DXJF 1HW2A 1RMVA 3EHMA 1JRAA 2EPLX 4JZAA 4W8KA 5KYYB 5HSWA 4WGYA 4ULWA 1J8MF 1NU9C 1HMOA 2KQ9A 2Y39A 2E87A 5COFA 2OKUA 3HNKA 3ABLC 3LAYA 1XWJA 5JRAA 4YK5A 1NFNA 1ZU4A 1OKKD 2C03A 4PJJA 1MMDA 1OCZC 2WZLA 1VLSA 1K04A 4K1OA 3I5QA 5FZTA 3K7DA 2PP4A 4XEFA 1NSGB 3EH1A 1A41A 3ITFA 4ANJA 4E7ZA 3GODA 5JLIA 4G78A 3T9OA 1ZHTA 4RBNA 2CYDA 4BPMA 4U5EE 3PMRA 5GPGB 3VRCA 4C3BA 1OW7A 2XM4A 4GEHA 3SXYA 1RKEA 4AL1A 2F22A 5A6BD 2WB7A 3AOUA 3GEIA 5CIVA 1JPNA 4MTFA 2W9YA 1M2OA 2BE5F 4ZLDA 3VAYA 2NUTB 5JUAA 5JSLA 2O9XA 2Z15A 5T3TA 3QW1A 2NG1A 2LFFA 4MTOA 2J9VA 3ASNC 5AC5A 3UGOA 2OG2A 3W8HA 4DBRA 5DVWA 3WODF 3EG9B 4CJOA 2NSGA 3LS1A 4U5HA 2BL2A 4OIOF 3LEOA 1ST6A 3K6BA 2PX0A 2IOQA 1OCRC 3LLKA 2R7VA 3ZWIA 3HNLA 5KYWB 4N4WA 3LLIA 2VC9A 2UUHA 3UMKA 1RJ9B 3FAPB 1LIHA 4UDVA 4XLPF 4JKVA 2L81A 4CDYA 4OINF 4AX2A 5KYYA 3RVYA 2AVKA 4R32A 2MWQA 4OIQF 2OEVA 4BJ6C 5B3IA 2Q3TA 4XWJA 1VYKA 1YA7O 2PX3A 3K1HA 4MW3A 3T6GB 3S0XA 1EQ1A 5D92A 3Q6MA 4MVZA 1A0BA 2R7WA 2R7TA 1NZEA 1ZHXA 2WVNA 2OJED 2L7AA 1LVKA 4OD4A 2AWCA 4PFPA 3KMIA 5L0GA 4LDKA 1NBBA 2P6VA 3T4RA 4YT5A 4KI2A 1RKCA 4FWVA 4IARA 4JJGA 3EGDB 3FDQA 2YL7A 2L6HA 3DWWA 4JEAA 2XXAA 3M79A 256BA 4MTGA 1LS1A 4CIPA 4IRUA 2ASRA 3HJCA 2NUTA 1V4AA 3WG7C 1Z63A 2CNWD 1D0ZA 4XEKA 1BDJB 2QLAA 4CS8A 4U5CE 3NYMA 4O6NA 2W45A 4PJNA 3U9JA 3DI5A 3EG9A 3DMDA 3KYJA 1Z23A 1OXKA 3TK0A 3US6A 4IB4A 1E2XA 1FFHA 3U3FA 4DRIB 5E2QA 4JCHA 1OCCC 2R7QA 3F47A 4P6IC 1WWPA 1NLXA 2A6HF 3S9OA 2LSEA 4MW8A 3U8VA 3UNGC 5KYWA 3TULA 2YL1A 3TOMA 3CQZA 3ZC4A 1RJ9A 3QMKA 2QTVA 2L9JA 2XL4A 1O3UA 1OQCA 1LM3B 2JPUA 3AQBA 1VLTA 2LP4A 2AWYA 4IWBA 5COMA 3RW0A 2BC5A 3UR3C 4AK9A 5F5FA 1GS9A 2HZ8A 2WVOA 3Q7LA 4BG0A 2HS5A 2A0BA 2OU6A 3GWLA 4XTKA 3UMIA 5L3QA 1WASA 1YAUO 5DQZA 1E86A 2QNLA 2YLGA 4NC3A 1VOMA 2YQYA 4XLNF 1CGME 4CS9A 2VH3A 1O5HA 1BBHA 4CSAA 2P7VA 3C63A 1D1BA 4W8PA 2YKZA 2QE9A 4PJMA 2DB4A 3ABKC 3KL4A 1WTYA 4JW1A 3EGDA 3GORA 3QTHA 2GAQA 2J45A 4NY3A 3V7OA 1UG7A 4Z9HA 3J06A 4C7OA 2L6FA 3ZG1A 2A69F 5A69A 4IAOA 2JX0A 4K0DA 4YN0B 3T6JA 3ZIBA 4I44A 2XS8A 4DRHB 4E17A 1I4ZA 3R7CA 5KYXB 3A11A 3ZSUA 4NCQA 1DOVA 4YWQA 1BZ4A 3S28A 2L6GA 3QW0A 1K05A 3U0CA 2NUPB 1F1MA 2DI3A 4J30B 4M63A 4N6HA 5HV9A 1G5ZA 1WOLA 4I1OB 2Y3BA 4P9FA 3JYYA 4CBEA 4EBJA 2KK1A 1OKKA 4G0HA 1VTMP 1EA8A 1M6TA 1LE2A 3FMSA 4IGGA 3RIPA 3JYHA 2P1AA 4MNDA 3U2MA 4JVSA 2A1DD 4LERA 4QI0A 3RVZA 4EIYA 2ZXRA 1FAPB 3QVZA 1FMVA 3EZHA 3JT1A 1A7DA 3UMHA 5T1DB 3JRTA 2B0JA 3C7JA 2GWWA 1VMAA 5AGFA 3MLGA 4YL0A 3TD7A 5L0CA 2IXPA 3POVA 3PCVA 3S27A 1FFTC 2QUPA 2IXOA 3NG1A 4WGZA 4CDAA 2J9BA 1Q0KA 1R4TA 1Q0MA 3GM2A 2VCBA 4XPXA 3LNMB 5IY5C 5KYNA 2XXAB 2R7XA 1YJGA 3BRJA 3C8GB 3ZVRA 1LS4A 1Z7Qc 3LEVA 3U2LA 1TQGA 1QQ3A 3O6XA 4U5GA 2EIJC 1JR8A 1NFOA 2EPNA 2PFDA 2YHSA 3DAFA 3JSZA 4JC7A 4DRJB 5B3SC 3B0PA 3K1IA 2AU5A 4QDLA 2X0CA 1U6HA 1I5NA 1VB5A 5KYXA 4ER9A 4GYTA 5DS5A 1HY5A 2CW0F 3NMIA 4ONSA 4PFOA 4CS7A 1Q0GA 3G4ZA 5EK0A 4U9DA 3C62A 3GEHA 2NUPA 3EH2A 3U9MA 5A6AA 4JTDB 4HFFB 3AG4C 5T3WA 1AVOB 3DE9A 4XPYA 2Q9AA 2WVQA 3OWTA 4MVMA 5F5HA 1BR1A 4MVUA 2AP3A 2J0XA 2DGJA 4N6CA 1HMDA 2VCCA 1D0YA 3ZQVA 1MNEA 1YA9A 1EKYA 2YLIA 4Z9JA 1E84A 1T5OA 4CS8C 3JRMO 2PBEA 2XLVA 1V55C 2H7OA 2VB6A 3HNIA 3T6BA 3IHUA 3ZDLA 4B6IA 1IZMA 2KJGA 2ZXPA 3W8IA 1TR2A 2EINC 1PD1A 5F28E 1ORSC 5L0DA 4LDQA 4FX5A 2EIMC 1TWAA 4JRZA 4C7OB 2XRHA 1OCOC 1YLMA 1H9TA 3C8GA 4ULVA 3RKOF 2XLOA 3MYIA 2M64A 3VM6A 1EI7A 4KC9A 4U9EA 1E85A 4OIPF 4JURI 3DE8A 4DVZA 3A9CA 5JP7A 2KW3C 3L8IA 3NKDA 1C03A 3DM9B 1K40A 1S7ZA 2EIKC 3DJNB 1YZAA 4NQFA 3SP1A 3SXMA 2J7PD 1M56C 2V26A 2ZXWC 4OD5A 3ZTZA 3PHF2 3I5PA 4A4AA 2HKVA 3DD7A 4BJ5A 4G7OF 4DOZA 2YL0A 2EILC 2Q00A 3H2VA 4DJ9A 5BUOA 2FGYA 2H8AA 3MBGA 1T6QA 2X51A 4LDRA 3RYLA 2DYRC 2UUIA 4FAPB 4CSAC 1U0BB 2MYSA 1Q0DA 1LPEA 4O6MA 2R7OA 4C3DA 2HSBA 4BJ6A 3FXHA 1JOGA 4RD9A 1YZCA 2W4BA 1D1CA 1D0XA 1GGQA 3EJNA 3IEEA 4AL0A 1ZW2A 2Y3HA 3G4XA 2J8WA 4EBBA 4EBKA 3HKKA 1KU2A 3KH2A 3KKBA 1V74B 1AEPA 1T6UA 1YARO 2W4MA 2B0HA 3DJUB 3I4UA 3R2PA 4O79A 4YL1A 4EWCA 4C3EA 4YT8A 1HE1A 3L1MA 3MX3A 3WHNA 3X1OA 4DXWA 1RXQA 1SR2A 1ZHZA 3B9QA 3O55A 3AGTA 3LESA 4GQHA 3CAXA 5CI9A 1DOWA 1HW1A 3ASOC 4DBQA 1YDIA 3B0VC 2KYHA 4N06A 4WABA 4MQ9F 1Q0FA 3G50A 1OXBA 2VCAA 3N24A 3JZ0A 1V54C 1IW7F 4KBLA 3B29A 3DZAA 2YEVA 3W2VA 4DVYP 2EPOA 3L34A 2DYSC 3GEEA 4J32B 5BQHA 1M2VB 3IQ6A 1CGNA 3DM5A 5FCLA 2J9UA 4J7YA 2XLHA 3OA1A 4AE4B 2OQMA 2YLDA 1QSPA 2IBFA 1O87A 3L8JA 4IAQA 1Z6AA 4Z9IA 3TOLA 3KPHA 4F4BA 4U5BE 3PDMP 3U3BA 1NG1A 4U5FE 1FMWA 2YL3A 1VK5A 3HLZA 2R03A 1PD0A 2YVKA 5E3CA 1ORYA 2LK4A 3FVYA 4LLEA 1ZVZA 1WN0A 2R9RB 1TWGA 2XLDA 3AQCA 3EZIA 3UGPA 2KC3A 2Q9CA 5E33A 3TJ5A 2CGEA 3VYWA
chains in the Genus database with same CATH topology
1RKCA 4K1OA 1TR2A 2HSQA 1H6GA 1ST6A 2X0CA 1U6HA 4E17A 5L0DA 2LQGA 3RF3A 4EHPA 5L0FA 1SYQA 3TJ6A 5L0HA 3S90A 4ONSA 2GWWA 1QKRA 1ZW2A 5L0CA 1RKEA 1DOVA 4E18A 4PR9A 2IBFA 5FZTA 3MYIA 1T01A 5L0IA 2B0HA 1L7CA 3VF0A 1RKEB 3T6GB 1U89A 3H2UA 4W8PA 4IGGA 1ZVZA 5L0JA 1ZW3A 4P9TA 1XWJA 1DOWA 1YDIA 2L7AA 3ZDLA 3TJ5A 5L0GA 3H2VA 4DJ9A 2GDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKC A;  4K1O A;  1TR2 A;  2HSQ A;  1H6G A;  1ST6 A;  2X0C A;  1U6H A;  4E17 A;  5L0D A;  2LQG A;  3RF3 A;  4EHP A;  5L0F A;  1SYQ A;  3TJ6 A;  5L0H A;  3S90 A;  4ONS A;  2GWW A;  1QKR A;  1ZW2 A;  5L0C A;  1RKE A;  1DOV A;  4E18 A;  4PR9 A;  2IBF A;  5FZT A;  3MYI A;  1T01 A;  5L0I A;  2B0H A;  1L7C A;  3VF0 A;  1RKE B;  3T6G B;  1U89 A;  3H2U A;  4W8P A;  4IGG A;  1ZVZ A;  5L0J A;  1ZW3 A;  4P9T A;  1XWJ A;  1DOW A;  1YDI A;  2L7A A;  3ZDL A;  3TJ5 A;  5L0G A;  3H2V A;  4DJ9 A;  2GDC A; 
#chains in the Genus database with same CATH topology
 2LD6 A;  3M15 A;  2Y3D A;  3NRH A;  1QPU A;  1Y6D A;  2YRF A;  1MQV A;  1CPQ A;  3RQG A;  5L0F A;  1SYQ A;  3FAJ A;  3K33 A;  2KSF A;  3GWN A;  3RFY A;  1ZHW A;  2HFI A;  4Q5S F;  2LIG A;  2XLW A;  3W2W A;  5A6B A;  3K1I C;  2XLM A;  3LUT B;  2D5R B;  3QVY A;  1OR3 A;  2ETS A;  4CIH A;  5BQG A;  4LAC B;  1L3P A;  1S05 A;  1QVX A;  1A7V A;  1XZP A;  4JTC B;  3U5S A;  2G3V A;  1QLE C;  1JAF A;  2RSE B;  4PAC A;  2V3C C;  2CDQ A;  4U5D E;  1U89 A;  5E3A A;  3IQC A;  5DS6 A;  1R5I D;  1ZZP A;  3IQ5 A;  4PJL A;  5B1A C;  3CZ6 A;  3SNH A;  3SXZ A;  4BEJ A;  3MYF A;  4NTF A;  2HMZ A;  2KGO A;  4XPW A;  1GQA A;  5KYU A;  3RQE A;  4A2N B;  1G4U S;  1TWC A;  4BJ1 A;  4K7B A;  2HSQ A;  1T9K A;  1MMN A;  2Q4F A;  1M2V A;  1FTS A;  1HE9 A;  3C18 A;  2C04 A;  3ABM C;  3KYI A;  4H54 A;  4J7T A;  4YT2 A;  3BEH A;  4YT4 A;  4AE4 A;  5EHH A;  3O39 A;  3Q7G A;  1H7I A;  2A6E F;  3M4B A;  5JVE A;  2J0W A;  1QKR A;  5JS5 A;  1Y4C A;  1I4Y A;  2HJM A;  2HV6 A;  1D1A A;  4Q4Z F;  1G8X A;  1TKN A;  2J46 A;  4JJF A;  2R25 A;  3SXK A;  3EQL F;  1LI7 A;  1OW8 A;  3VF0 A;  4OIR F;  3RH3 A;  2IXN A;  3CEX A;  4HFK B;  5DQT A;  3O10 A;  1PCX A;  3K66 A;  2VAS A;  1BR2 A;  1JMW A;  4P9T A;  1WAT A;  1B68 A;  1SMY F;  3HNJ A;  4L6R A;  4MVR A;  5A6J A;  1ORJ A;  4KNW A;  2WL8 A;  2EPK X;  1FNT c;  3E70 C;  3GM3 A;  3NYJ A;  1M57 C;  4WJ0 A;  4HEA J;  3EFO B;  4D4X A;  4XQ1 A;  4BJ5 C;  1MMA A;  4JE9 A;  3WAQ A;  3EGX B;  3JCU Q;  2CNW A;  1YVI A;  3B71 A;  3EPV A;  4KNV A;  4I1M A;  5D91 A;  2OEX A;  2H7V C;  2P61 A;  4G7Z F;  2J9W A;  1Z3I X;  3HTK C;  3ECS A;  2Y3G A;  2J7P A;  4Q7C A;  5A6K A;  2R7R A;  1PV3 A;  1MND A;  2HJ3 A;  2WZF A;  1ZYR F;  3GM1 A;  3OEO A;  4MS2 A;  2GFH A;  3IQT A;  4MVS A;  1FR0 A;  1E83 A;  3SYN A;  1WGW A;  2R05 A;  5EGY A;  3LJB A;  3LNR A;  1ZW3 A;  2A0U A;  2H7B A;  2WZG A;  3FOO A;  3X2Q C;  3C8Z A;  1QZX A;  2GA0 A;  2ZPA A;  3DAG A;  3M4C A;  2NSF A;  2G3K A;  2MHR A;  2YWA A;  2ZXO A;  1YYJ A;  3NKE A;  3NYL A;  4MVQ A;  4HE8 D;  3SEO A;  5AC4 A;  3LS0 A;  2IXM A;  4CS9 C;  3F46 A;  1H6G A;  3FOP A;  3B0U X;  4CJG A;  2A68 F;  2ICW G;  2KNH A;  2XSE A;  2LQG A;  4G7H F;  4EHP A;  1ZHY A;  1N1C A;  3RQF A;  3MFN A;  4FES A;  2OJQ A;  4JTA B;  2OCC C;  3AG3 C;  3NMK A;  3ZQY A;  5DS4 A;  1MMG A;  4JCZ A;  4E0I A;  2HV7 A;  1LI5 A;  3S84 A;  3AG2 C;  1T01 A;  1NU7 D;  3W4Y A;  2PNO A;  2ZD9 A;  4RDA A;  3V5X A;  3C8G D;  3CSK A;  2JD3 A;  1C02 A;  2OOC A;  4JEB A;  4IJJ A;  4I3M A;  5B1B C;  3SZR A;  2LFD A;  4JIO A;  3ZTM A;  1JPJ A;  5CI8 A;  3V5Z A;  1KTM A;  4LLC A;  1H9G A;  2XL8 A;  2EPM X;  2Y69 C;  4O6Y A;  5COG A;  1KNY A;  2Q7R A;  4E0H A;  3AG1 C;  1OR2 A;  5L0J A;  1G4W R;  2Q9B A;  1YYX A;  1J8Y F;  2RD9 A;  2I8B A;  3AJM A;  4E18 A;  5BQI A;  3EFO A;  3TQO A;  4E7S A;  3EHN A;  1GM5 A;  1C17 M;  3EGX A;  3ATP A;  3RF3 A;  5L3V A;  3FHD A;  3GAN A;  1VYI A;  4PK4 A;  1TWH A;  4EUK B;  5KYU B;  3TJ6 A;  2XLE A;  5L0H A;  1ZU5 A;  3L0I A;  3QZC A;  4EKW A;  5DLJ A;  4BEM J;  3S29 A;  2XL6 A;  1APC A;  1T6I A;  1TFO B;  2I15 A;  1TFK B;  4PR9 A;  3V5Y A;  4CX9 A;  1L7C A;  3Q6N A;  3IPM O;  5K0I A;  2FAP B;  2QY9 A;  5L0I A;  1CGO A;  1RKE B;  2R02 A;  3JSE O;  2IM8 A;  3DKA A;  1OW6 A;  2HMQ A;  3AGU A;  1LKX A;  3H2U A;  1SF8 A;  2CCY A;  3E9V A;  4YJW A;  4ZLC A;  2FFH A;  4H4K C;  1BR4 A;  2HUJ A;  5TJ5 E;  2M4E A;  4X0R A;  3H65 A;  1LE4 A;  3N2Z B;  4BJT A;  1UFB A;  3JTL O;  2IYL D;  2R7S A;  1Z5Z A;  2R7U A;  2GDC A;  2PF4 E;  1AUE A;  4CDV A;  1A7E A;  1XZQ A;  5JT4 A;  3U8P A;  2XM0 A;  1W2W A;  4XEV A;  4MVO A;  2TMV P;  4O7G A;  3NMJ A;  4D4N A;  1CPR A;  2D4U A;  3S90 A;  1RCP A;  2YZS A;  4YL3 A;  2LCH A;  3NDB B;  4NTA A;  2XS1 A;  4QI2 A;  2P0N A;  3M1C B;  3N0T A;  4NTB A;  2NPU A;  2G62 A;  1SZI A;  3DXJ F;  1HW2 A;  1RMV A;  3EHM A;  1JRA A;  2EPL X;  4JZA A;  4W8K A;  5KYY B;  5HSW A;  4WGY A;  4ULW A;  1J8M F;  1NU9 C;  1HMO A;  2KQ9 A;  2Y39 A;  2E87 A;  5COF A;  2OKU A;  3HNK A;  3ABL C;  3LAY A;  1XWJ A;  5JRA A;  4YK5 A;  1NFN A;  1ZU4 A;  1OKK D;  2C03 A;  4PJJ A;  1MMD A;  1OCZ C;  2WZL A;  1VLS A;  1K04 A;  4K1O A;  3I5Q A;  5FZT A;  3K7D A;  2PP4 A;  4XEF A;  1NSG B;  3EH1 A;  1A41 A;  3ITF A;  4ANJ A;  4E7Z A;  3GOD A;  5JLI A;  4G78 A;  3T9O A;  1ZHT A;  4RBN A;  2CYD A;  4BPM A;  4U5E E;  3PMR A;  5GPG B;  3VRC A;  4C3B A;  1OW7 A;  2XM4 A;  4GEH A;  3SXY A;  1RKE A;  4AL1 A;  2F22 A;  5A6B D;  2WB7 A;  3AOU A;  3GEI A;  5CIV A;  1JPN A;  4MTF A;  2W9Y A;  1M2O A;  2BE5 F;  4ZLD A;  3VAY A;  2NUT B;  5JUA A;  5JSL A;  2O9X A;  2Z15 A;  5T3T A;  3QW1 A;  2NG1 A;  2LFF A;  4MTO A;  2J9V A;  3ASN C;  5AC5 A;  3UGO A;  2OG2 A;  3W8H A;  4DBR A;  5DVW A;  3WOD F;  3EG9 B;  4CJO A;  2NSG A;  3LS1 A;  4U5H A;  2BL2 A;  4OIO F;  3LEO A;  1ST6 A;  3K6B A;  2PX0 A;  2IOQ A;  1OCR C;  3LLK A;  2R7V A;  3ZWI A;  3HNL A;  5KYW B;  4N4W A;  3LLI A;  2VC9 A;  2UUH A;  3UMK A;  1RJ9 B;  3FAP B;  1LIH A;  4UDV A;  4XLP F;  4JKV A;  2L81 A;  4CDY A;  4OIN F;  4AX2 A;  5KYY A;  3RVY A;  2AVK A;  4R32 A;  2MWQ A;  4OIQ F;  2OEV A;  4BJ6 C;  5B3I A;  2Q3T A;  4XWJ A;  1VYK A;  1YA7 O;  2PX3 A;  3K1H A;  4MW3 A;  3T6G B;  3S0X A;  1EQ1 A;  5D92 A;  3Q6M A;  4MVZ A;  1A0B A;  2R7W A;  2R7T A;  1NZE A;  1ZHX A;  2WVN A;  2OJE D;  2L7A A;  1LVK A;  4OD4 A;  2AWC A;  4PFP A;  3KMI A;  5L0G A;  4LDK A;  1NBB A;  2P6V A;  3T4R A;  4YT5 A;  4KI2 A;  1RKC A;  4FWV A;  4IAR A;  4JJG A;  3EGD B;  3FDQ A;  2YL7 A;  2L6H A;  3DWW A;  4JEA A;  2XXA A;  3M79 A;  256B A;  4MTG A;  1LS1 A;  4CIP A;  4IRU A;  2ASR A;  3HJC A;  2NUT A;  1V4A A;  3WG7 C;  1Z63 A;  2CNW D;  1D0Z A;  4XEK A;  1BDJ B;  2QLA A;  4CS8 A;  4U5C E;  3NYM A;  4O6N A;  2W45 A;  4PJN A;  3U9J A;  3DI5 A;  3EG9 A;  3DMD A;  3KYJ A;  1Z23 A;  1OXK A;  3TK0 A;  3US6 A;  4IB4 A;  1E2X A;  1FFH A;  3U3F A;  4DRI B;  5E2Q A;  4JCH A;  1OCC C;  2R7Q A;  3F47 A;  4P6I C;  1WWP A;  1NLX A;  2A6H F;  3S9O A;  2LSE A;  4MW8 A;  3U8V A;  3UNG C;  5KYW A;  3TUL A;  2YL1 A;  3TOM A;  3CQZ A;  3ZC4 A;  1RJ9 A;  3QMK A;  2QTV A;  2L9J A;  2XL4 A;  1O3U A;  1OQC A;  1LM3 B;  2JPU A;  3AQB A;  1VLT A;  2LP4 A;  2AWY A;  4IWB A;  5COM A;  3RW0 A;  2BC5 A;  3UR3 C;  4AK9 A;  5F5F A;  1GS9 A;  2HZ8 A;  2WVO A;  3Q7L A;  4BG0 A;  2HS5 A;  2A0B A;  2OU6 A;  3GWL A;  4XTK A;  3UMI A;  5L3Q A;  1WAS A;  1YAU O;  5DQZ A;  1E86 A;  2QNL A;  2YLG A;  4NC3 A;  1VOM A;  2YQY A;  4XLN F;  1CGM E;  4CS9 A;  2VH3 A;  1O5H A;  1BBH A;  4CSA A;  2P7V A;  3C63 A;  1D1B A;  4W8P A;  2YKZ A;  2QE9 A;  4PJM A;  2DB4 A;  3ABK C;  3KL4 A;  1WTY A;  4JW1 A;  3EGD A;  3GOR A;  3QTH A;  2GAQ A;  2J45 A;  4NY3 A;  3V7O A;  1UG7 A;  4Z9H A;  3J06 A;  4C7O A;  2L6F A;  3ZG1 A;  2A69 F;  5A69 A;  4IAO A;  2JX0 A;  4K0D A;  4YN0 B;  3T6J A;  3ZIB A;  4I44 A;  2XS8 A;  4DRH B;  4E17 A;  1I4Z A;  3R7C A;  5KYX B;  3A11 A;  3ZSU A;  4NCQ A;  1DOV A;  4YWQ A;  1BZ4 A;  3S28 A;  2L6G A;  3QW0 A;  1K05 A;  3U0C A;  2NUP B;  1F1M A;  2DI3 A;  4J30 B;  4M63 A;  4N6H A;  5HV9 A;  1G5Z A;  1WOL A;  4I1O B;  2Y3B A;  4P9F A;  3JYY A;  4CBE A;  4EBJ A;  2KK1 A;  1OKK A;  4G0H A;  1VTM P;  1EA8 A;  1M6T A;  1LE2 A;  3FMS A;  4IGG A;  3RIP A;  3JYH A;  2P1A A;  4MND A;  3U2M A;  4JVS A;  2A1D D;  4LER A;  4QI0 A;  3RVZ A;  4EIY A;  2ZXR A;  1FAP B;  3QVZ A;  1FMV A;  3EZH A;  3JT1 A;  1A7D A;  3UMH A;  5T1D B;  3JRT A;  2B0J A;  3C7J A;  2GWW A;  1VMA A;  5AGF A;  3MLG A;  4YL0 A;  3TD7 A;  5L0C A;  2IXP A;  3POV A;  3PCV A;  3S27 A;  1FFT C;  2QUP A;  2IXO A;  3NG1 A;  4WGZ A;  4CDA A;  2J9B A;  1Q0K A;  1R4T A;  1Q0M A;  3GM2 A;  2VCB A;  4XPX A;  3LNM B;  5IY5 C;  5KYN A;  2XXA B;  2R7X A;  1YJG A;  3BRJ A;  3C8G B;  3ZVR A;  1LS4 A;  1Z7Q c;  3LEV A;  3U2L A;  1TQG A;  1QQ3 A;  3O6X A;  4U5G A;  2EIJ C;  1JR8 A;  1NFO A;  2EPN A;  2PFD A;  2YHS A;  3DAF A;  3JSZ A;  4JC7 A;  4DRJ B;  5B3S C;  3B0P A;  3K1I A;  2AU5 A;  4QDL A;  2X0C A;  1U6H A;  1I5N A;  1VB5 A;  5KYX A;  4ER9 A;  4GYT A;  5DS5 A;  1HY5 A;  2CW0 F;  3NMI A;  4ONS A;  4PFO A;  4CS7 A;  1Q0G A;  3G4Z A;  5EK0 A;  4U9D A;  3C62 A;  3GEH A;  2NUP A;  3EH2 A;  3U9M A;  5A6A A;  4JTD B;  4HFF B;  3AG4 C;  5T3W A;  1AVO B;  3DE9 A;  4XPY A;  2Q9A A;  2WVQ A;  3OWT A;  4MVM A;  5F5H A;  1BR1 A;  4MVU A;  2AP3 A;  2J0X A;  2DGJ A;  4N6C A;  1HMD A;  2VCC A;  1D0Y A;  3ZQV A;  1MNE A;  1YA9 A;  1EKY A;  2YLI A;  4Z9J A;  1E84 A;  1T5O A;  4CS8 C;  3JRM O;  2PBE A;  2XLV A;  1V55 C;  2H7O A;  2VB6 A;  3HNI A;  3T6B A;  3IHU A;  3ZDL A;  4B6I A;  1IZM A;  2KJG A;  2ZXP A;  3W8I A;  1TR2 A;  2EIN C;  1PD1 A;  5F28 E;  1ORS C;  5L0D A;  4LDQ A;  4FX5 A;  2EIM C;  1TWA A;  4JRZ A;  4C7O B;  2XRH A;  1OCO C;  1YLM A;  1H9T A;  3C8G A;  4ULV A;  3RKO F;  2XLO A;  3MYI A;  2M64 A;  3VM6 A;  1EI7 A;  4KC9 A;  4U9E A;  1E85 A;  4OIP F;  4JUR I;  3DE8 A;  4DVZ A;  3A9C A;  5JP7 A;  2KW3 C;  3L8I A;  3NKD A;  1C03 A;  3DM9 B;  1K40 A;  1S7Z A;  2EIK C;  3DJN B;  1YZA A;  4NQF A;  3SP1 A;  3SXM A;  2J7P D;  1M56 C;  2V26 A;  2ZXW C;  4OD5 A;  3ZTZ A;  3PHF 2;  3I5P A;  4A4A A;  2HKV A;  3DD7 A;  4BJ5 A;  4G7O F;  4DOZ A;  2YL0 A;  2EIL C;  2Q00 A;  3H2V A;  4DJ9 A;  5BUO A;  2FGY A;  2H8A A;  3MBG A;  1T6Q A;  2X51 A;  4LDR A;  3RYL A;  2DYR C;  2UUI A;  4FAP B;  4CSA C;  1U0B B;  2MYS A;  1Q0D A;  1LPE A;  4O6M A;  2R7O A;  4C3D A;  2HSB A;  4BJ6 A;  3FXH A;  1JOG A;  4RD9 A;  1YZC A;  2W4B A;  1D1C A;  1D0X A;  1GGQ A;  3EJN A;  3IEE A;  4AL0 A;  1ZW2 A;  2Y3H A;  3G4X A;  2J8W A;  4EBB A;  4EBK A;  3HKK A;  1KU2 A;  3KH2 A;  3KKB A;  1V74 B;  1AEP A;  1T6U A;  1YAR O;  2W4M A;  2B0H A;  3DJU B;  3I4U A;  3R2P A;  4O79 A;  4YL1 A;  4EWC A;  4C3E A;  4YT8 A;  1HE1 A;  3L1M A;  3MX3 A;  3WHN A;  3X1O A;  4DXW A;  1RXQ A;  1SR2 A;  1ZHZ A;  3B9Q A;  3O55 A;  3AGT A;  3LES A;  4GQH A;  3CAX A;  5CI9 A;  1DOW A;  1HW1 A;  3ASO C;  4DBQ A;  1YDI A;  3B0V C;  2KYH A;  4N06 A;  4WAB A;  4MQ9 F;  1Q0F A;  3G50 A;  1OXB A;  2VCA A;  3N24 A;  3JZ0 A;  1V54 C;  1IW7 F;  4KBL A;  3B29 A;  3DZA A;  2YEV A;  3W2V A;  4DVY P;  2EPO A;  3L34 A;  2DYS C;  3GEE A;  4J32 B;  5BQH A;  1M2V B;  3IQ6 A;  1CGN A;  3DM5 A;  5FCL A;  2J9U A;  4J7Y A;  2XLH A;  3OA1 A;  4AE4 B;  2OQM A;  2YLD A;  1QSP A;  2IBF A;  1O87 A;  3L8J A;  4IAQ A;  1Z6A A;  4Z9I A;  3TOL A;  3KPH A;  4F4B A;  4U5B E;  3PDM P;  3U3B A;  1NG1 A;  4U5F E;  1FMW A;  2YL3 A;  1VK5 A;  3HLZ A;  2R03 A;  1PD0 A;  2YVK A;  5E3C A;  1ORY A;  2LK4 A;  3FVY A;  4LLE A;  1ZVZ A;  1WN0 A;  2R9R B;  1TWG A;  2XLD A;  3AQC A;  3EZI A;  3UGP A;  2KC3 A;  2Q9C A;  5E33 A;  3TJ5 A;  2CGE A;  3VYW A; 
#chains in the Genus database with same CATH homology
 1RKC A;  4K1O A;  1TR2 A;  2HSQ A;  1H6G A;  1ST6 A;  2X0C A;  1U6H A;  4E17 A;  5L0D A;  2LQG A;  3RF3 A;  4EHP A;  5L0F A;  1SYQ A;  3TJ6 A;  5L0H A;  3S90 A;  4ONS A;  2GWW A;  1QKR A;  1ZW2 A;  5L0C A;  1RKE A;  1DOV A;  4E18 A;  4PR9 A;  2IBF A;  5FZT A;  3MYI A;  1T01 A;  5L0I A;  2B0H A;  1L7C A;  3VF0 A;  1RKE B;  3T6G B;  1U89 A;  3H2U A;  4W8P A;  4IGG A;  1ZVZ A;  5L0J A;  1ZW3 A;  4P9T A;  1XWJ A;  1DOW A;  1YDI A;  2L7A A;  3ZDL A;  3TJ5 A;  5L0G A;  3H2V A;  4DJ9 A;  2GDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...