1A7VA

Cytochrome c' from rhodopseudomonas palustris
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
125
structure length
125
Chain Sequence
QTDVIAQRKAILKQMGEATKPIAAMLKGEAKFDQAVVQKSLAAIADDSKKLPALFPADSKTGGDTAALPKIWEDKAKFDDLFAKLAAAATAAQGTIKDEASLKANIGGVLGNCKSCHDDFRAKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Basis for monomer stabilization in Rhodopseudomonas palustris cytochrome c' derived from the crystal structure.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 46
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1a7vA00
1LM3B 4CDVA 3NMJA 2YL7A 3NMKA 5JSLA 1CGOA 4JE9A 1CPQA 3ZTMA 2YKZA 3IQ6A 2BC5A 4D4XA 5JS5A 3TOMA 3VRCA 1E86A 1M6TA 5B3IA 1MQVA 3ZQYA 5AGFA 2XLDA 3HNIA 3M79A 2XLWA 3L1MA 2XM0A 1YYXA 4N6HA 4U9DA 2XL8A 5JP7A 2XLMA 2J9BA 3ZTZA 3M4BA 3FOPA 3U8PA 4CJOA 4JKVA 3TOLA 1E84A 2XLOA 1YZCA 1CGNA 1CPRA 1APCA 2XM4A 4CDYA 2CCYA 4JEBA 3HNJA 4WGYA 3QW1A 4CX9A 4L6RA 5JVEA 4IB4A 2J8WA 1E83A 3HNLA 3QVZA 3FOOA 5JLIA 1QQ3A 1GQAA 3DE8A 3HNKA 2YL1A 4CDAA 3NMIA 2QLAA 2YLGA 4NC3A 3IQ5A 3C62A 4IARA 1S05A 256BA 1JAFA 4EIYA 1A7VA 1BBHA 3ZWIA 4CJGA 3QVYA 4D4NA 1E85A 2YLDA 5JT4A 3DE9A 4JEAA 4ER9A 3QW0A 2XL6A 4U9EA 2YLIA 2XLHA 4WGZA 1RCPA 2XLEA 1EKYA 1NBBA 2XLVA 1YYJA 4IAQA 5JRAA 3ZQVA 2YL0A 1QPUA 3M4CA 5JUAA 4N4WA 4CIPA 3M15A 3C63A 1YZAA 2YL3A 4ULVA
chains in the Genus database with same CATH superfamily
3S27A 3X2QC 4CDVA 5KYXA 4G0HA 1ORYA 5JSLA 1BR1A 1VYIA 3ABKC 1YARO 3V5ZA 4A4AA 5A6JA 2EPLX 3ZIBA 4PR9A 4MVZA 3SXZA 2L9JA 5AC5A 3QMKA 1CPQA 1LS1A 1VB5A 3DAGA 3GM2A 3LNRA 4NTBA 4O7GA 1DOVA 3B0VC 3K33A 2OU6A 2XXAB 1FTSA 2HMQA 3DZAA 2BC5A 1PD0A 2IM8A 2P1AA 3ATPA 1M6TA 4BJ5A 1U6HA 3GEHA 3POVA 2FAPB 4MW3A 5KYYA 4YL0A 3S90A 4U5HA 1ZHWA 1H6GA 2NPUA 4DVZA 1I5NA 3B29A 3L1MA 2Z15A 3AGUA 2XM0A 4WJ0A 3X1OA 4H54A 1AEPA 3PHF2 1TWCA 2ZXOA 5CI9A 4J7YA 1GS9A 3TD7A 2EPOA 1FFTC 2D4UA 2QUPA 5COGA 2OJQA 4DBRA 4R32A 3S28A 4Q7CA 2QY9A 3AQCA 3VM6A 3LUTB 4DBQA 1NU7D 1IZMA 3WAQA 4MTOA 4AL0A 3I5PA 4DRHB 4JJFA 2L6HA 4BEJA 2H7VC 3LEOA 1TR2A 3CZ6A 3DJNB 3KKBA 1WWPA 2AU5A 5F5HA 4OIOF 2NUTA 4CDYA 4W8PA 2W4MA 1ORJA 4JZAA 2Q7RA 2J9UA 1W2WA 2Q3TA 4FX5A 1ST6A 3DM5A 4WGYA 3C7JA 3QW1A 4ANJA 3VAYA 5DLJA 2RD9A 4L6RA 5JVEA 1ZHZA 3N24A 4Q5SF 1M56C 3CSKA 2NUPB 1LPEA 2VC9A 2P0NA 4FESA 2OEVA 5F28E 4DXWA 4DVYP 5L3QA 4ZLDA 1L3PA 3H2VA 3MBGA 4LDRA 1NSGB 1Z5ZA 4J32B 3JCUQ 4HEAJ 4Z9JA 3L8IA 1QQ3A 3Q7GA 2WB7A 4EUKB 2HJ3A 5FZTA 2YL1A 3AG2C 5DQTA 3UGOA 3RH3A 4JJGA 2V26A 1A7EA 2GDCA 2PX0A 4F4BA 2MYSA 2R7VA 3NMIA 4GEHA 4U5CE 2YLGA 4I1OB 4BPMA 4E7SA 4A2NB 3BEHA 5DQZA 2LFDA 1JR8A 4XPWA 1JMWA 1S05A 3DMDA 1ZYRF 4FWVA 4YT8A 2Q9CA 4PJNA 4KNVA 1F1MA 5T3TA 1OKKD 3QZCA 3KH2A 2WL8A 4PACA 1BBHA 4AX2A 5A69A 3ZWIA 3QVYA 3UMHA 1YDIA 5JT4A 4MVOA 2GWWA 2LD6A 3E70C 3GWLA 3NYMA 3RKOF 3K6BA 1O5HA 4O6NA 1SF8A 2XL6A 4ONSA 3AQBA 2YLIA 1OR3A 1D1AA 2IXMA 2I8BA 3C8ZA 1M2VB 2ZXPA 2XLEA 3SNHA 2AWCA 1KNYA 3LS1A 4IRUA 4J7TA 4BJTA 2LK4A 3S84A 1CGME 2JPUA 1Q0MA 2R9RB 3EG9B 1HE9A 1V54C 3EPVA 2VCAA 1BDJB 4UDVA 1ZVZA 3K1HA 1SR2A 4HE8D 5KYWA 4CIPA 3EH2A 3U8VA 3C63A 3EZIA 1YZAA 1M57C 3T6BA 3N0TA 1A7DA 2P61A 4Z9HA 4NCQA 3VF0A 3ECSA 2BE5F 4BJ5C 5A6BD 2QTVA 2AP3A 4GYTA 3NMJA 4C7OB 2VCCA 2YL7A 1OKKA 3CAXA 3FXHA 3NMKA 2CDQA 3DWWA 3PDMP 1SMYF 2OKUA 2VASA 3WHNA 5A6AA 5A6BA 2J7PD 4NTAA 3W8HA 1A0BA 1OQCA 1YLMA 2KQ9A 4DJ9A 4ULWA 3C8GB 2W9YA 2DGJA 4IAOA 4E18A 1YJGA 5JS5A 3N2ZB 4CS8A 1TFKB 4C7OA 5TJ5E 4E17A 1BZ4A 1E86A 3L34A 3ZQYA 2LFFA 4NQFA 4JCZA 1WOLA 2HV7A 3M79A 2A6HF 2R05A 5AGFA 3EZHA 5L0HA 2IOQA 3O6XA 4XEVA 1T6UA 2WVOA 3VYWA 1Z63A 1ORSC 2LSEA 2R25A 2XL8A 2EIKC 1AVOB 4U9DA 4MTGA 3ITFA 2CYDA 2FGYA 1HE1A 3LAYA 3OA1A 5EK0A 1GM5A 2V3CC 2O9XA 3EQLF 2X0CA 1MNDA 5DS6A 3ASNC 3U8PA 4JTDB 2A68F 1TFOB 4CJOA 2OJED 2ASRA 5BQGA 1U89A 4KNWA 3SXYA 3SZRA 1E84A 3DXJF 3LLKA 1AUEA 2J0XA 4XWJA 2DB4A 1YA9A 1YZCA 2MWQA 1B68A 2UUHA 1Z23A 2YQYA 3JZ0A 3LESA 3S9OA 1APCA 3U3FA 5KYWB 4PK4A 2R7XA 3SXMA 1QKRA 2XRHA 1PV3A 2CCYA 2DYSC 3EJNA 3EGXB 3IQTA 4LACB 1LIHA 4M63A 3C8GA 1FFHA 1D0YA 4CX9A 2YZSA 4IJJA 2Y3BA 1LS4A 4CS8C 1HW2A 4IB4A 3DAFA 4OIRF 2HV6A 1E83A 3RQFA 2Q4FA 3HNLA 1YA7O 1UFBA 4RDAA 3LEVA 4XLPF 1Z7Qc 4FAPB 3FVYA 3NYJA 4GQHA 4C3DA 1GQAA 1J8YF 3DE8A 3JT1A 3NRHA 3O55A 5L0CA 2KK1A 3HNKA 2GAQA 4KC9A 4PJLA 1VK5A 3SXKA 1D0XA 1WN0A 3AG4C 2QLAA 4NC3A 3IQ5A 2Y3GA 3HTKC 1G8XA 1Q0GA 4IARA 3RW0A 4EBJA 3R2PA 3O10A 3RVZA 3ZVRA 1NFNA 2IXOA 3T9OA 3PCVA 3I5QA 3KMIA 3JSZA 1RMVA 2EIJC 2WVQA 4LDKA 3W2VA 1OCCC 1VLSA 2XS8A 4LDQA 2H8AA 2I15A 5E2QA 1E85A 2JX0A 3R7CA 1EQ1A 2FFHA 4JEAA 3UNGC 3CEXA 3V5XA 4BJ6C 1G4WR 2LIGA 2R7QA 3QW0A 4U9EA 5DS5A 4CSAA 3K7DA 2EILC 4JVSA 3G50A 2J45A 3TULA 3B0UX 4MVRA 1YYJA 1ZU4A 3U9MA 1XZPA 2VH3A 2IXPA 4C3EA 1D0ZA 1O87A 1V55C 1YAUO 3M4CA 4P9TA 5DVWA 4LLEA 4HFFB 1VYKA 4YT4A 5COFA 4AL1A 1ZW3A 2M64A 1H9TA 2C03A 2J0WA 1Y6DA 4AK9A 2D5RB 1OR2A 2VB6A 2NUTB 3MYFA 2NG1A 5T1DB 2WZFA 3WG7C 3G4XA 2G3VA 1R5ID 1Z3IX 4QDLA 2AWYA 2M4EA 5L0FA 1KTMA 4J30B 2X51A 2CGEA 5KYYB 4P9FA 2Y3DA 5BQHA 2PX3A 2L6FA 3TQOA 4MVMA 1OW7A 1ZHTA 3RFYA 1H7IA 2A6EF 4EHPA 2HS5A 1ZW2A 3QTHA 4EBKA 1M2VA 1QVXA 2DYRC 3DD7A 4MVSA 1LI7A 2HKVA 3EH1A 4JE9A 4BJ1A 1RKCA 4YN0B 5IY5C 3IHUA 2G3KA 2YKZA 3IQ6A 3JRMO 5B3SC 4NTFA 5EHHA 2OQMA 3F46A 1IW7F 2Y39A 3JSEO 3TOMA 1OW6A 3HKKA 4O6MA 3EGXA 3VRCA 2GFHA 3RIPA 2PFDA 1K04A 1VMAA 1Q0FA 5COMA 4XQ1A 3W4YA 2OEXA 1N1CA 5B1AC 4DRJB 3TJ5A 2WVNA 5KYNA 4CBEA 2J7PA 4QI2A 1YYXA 4N6HA 3ZG1A 1I4YA 3V5YA 1TWAA 3NDBB 4MTFA 3C8GD 2IYLD 2XLMA 3KYIA 3W2WA 1RJ9A 3ZTZA 3M4BA 3DJUB 3EFOA 1OCZC 2G62A 1H9GA 3V7OA 1LVKA 4BEMJ 2R7SA 2HFIA 2PP4A 3TOLA 4MNDA 2EINC 4E0HA 2P7VA 2H7OA 1QLEC 2LQGA 2OOCA 1FR0A 4N06A 1JRAA 2NSFA 1G4US 3TK0A 2XM4A 1OW8A 3A9CA 3RF3A 2VCBA 3MFNA 2WZLA 3W8IA 2TMVP 4AE4A 3K66A 2EPNA 1L7CA 1OCRC 4K0DA 3HNJA 5B1BC 1C03A 2OG2A 5D91A 2BL2A 3US6A 3C18A 5T3WA 4N6CA 5DS4A 3ZC4A 2XSEA 4YK5A 1FNTc 5L0IA 2HJMA 2PBEA 3ASOC 3LS0A 3MLGA 3EHMA 4G7OF 1VLTA 1WASA 3K1IC 4Z9IA 4K1OA 1M2OA 4KI2A 2UUIA 3T6GB 2CNWA 3B9QA 3TJ6A 3GANA 2YVKA 4IWBA 3LLIA 3UMKA 4JC7A 5L0DA 1HY5A 3B0PA 4G78A 1FMVA 4MVUA 1E2XA 4BG0A 4YWQA 3C62A 1I4ZA 4KBLA 256BA 4OIQF 2HMZA 1EA8A 2A0BA 1O3UA 2HSQA 1YVIA 2KW3C 3PMRA 2EPKX 4EIYA 4HFKB 1C17M 2XL4A 5A6KA 2ETSA 2Y69C 4OINF 5EGYA 2R7UA 4CJGA 1HW1A 4D4NA 3B71A 2YLDA 3SEOA 3JYYA 1EI7A 3DE9A 4ER9A 3FDQA 2R7WA 4G7ZF 2A69F 2YRFA 2QNLA 4OD5A 4E0IA 5E3AA 3AG1C 1ZHYA 2XLHA 3K1IA 3Q6MA 4WGZA 4CIHA 2ZXRA 1NBBA 2XLVA 3T6JA 1OXKA 4IAQA 5KYXB 1EKYA 3OEOA 2H7BA 4JTCB 3U3BA 3H65A 3U5SA 3ZQVA 2WZGA 1NU9C 1MNEA 1ZU5A 3GODA 5GPGB 1QSPA 3JRTA 4JCHA 1T6IA 4LLCA 2NSGA 3RQGA 2Y3HA 4N4WA 2W4BA 3AJMA 4NY3A 4QI0A 1KU2A 1UG7A 3Q6NA 3UR3C 3G4ZA 2LCHA 3SYNA 1JPJA 4EWCA 2YL3A 3DM9B 4JW1A 2LP4A 3A11A 3GEIA 2B0JA 2ZXWC 1LM3B 3KPHA 4YL1A 4XLNF 1HMDA 1ZZPA 2KGOA 3J06A 3EFOB 4BJ6A 1RKEA 4XPXA 2L6GA 2NUPA 2YWAA 4YL3A 5K0IA 3LNMB 1WTYA 5L0GA 1CGOA 1HMOA 3ABLC 4PJJA 5CI8A 2YEVA 3ZTMA 3S0XA 2YHSA 4H4KC 1NLXA 3O39A 2R7RA 2HZ8A 4D4XA 2W45A 1NZEA 1K40A 3NKEA 1T9KA 2J46A 1A41A 5B3IA 1MQVA 3S29A 1MMGA 1RKEB 1TQGA 2XLDA 3HNIA 4IGGA 2XLWA 4JIOA 4P6IC 2DI3A 4CS9A 5HV9A 1BR2A 4OIPF 2ZPAA 1OXBA 1TWGA 2A1DD 2L81A 5BUOA 1T6QA 2ICWG 1VOMA 3AGTA 3GEEA 5JP7A 2J9BA 4PFOA 3RVYA 4K7BA 5AC4A 5KYUB 3IEEA 3FOPA 2KYHA 4OD4A 4JRZA 3H2UA 2J9VA 1LI5A 4U5GA 2Q9AA 2IBFA 2OCCC 3M1CB 4JKVA 4O6YA 5BQIA 3L8JA 2XLOA 5HSWA 4B6IA 4U5DE 3F47A 4I44A 1CGNA 4XEFA 3IPMO 1MMDA 5E33A 1CPRA 1NG1A 1SYQA 1U0BB 2F22A 3EGDA 4O79A 4CS7A 4MQ9F 4JEBA 1Q0KA 2R03A 1TKNA 2AVKA 2J9WA 4XPYA 3U9JA 3EGDB 4MVQA 4ZLCA 4Q4ZF 3UGPA 1PD1A 3U2MA 2E87A 2J8WA 2QE9A 3I4UA 4U5BE 5L3VA 3LJBA 2KJGA 4YT5A 2L7AA 1GGQA 1R4TA 3CQZA 2CNWD 4XEKA 3QVZA 4LERA 3U2LA 5CIVA 1MMNA 3FOOA 1LKXA 2KC3A 5E3CA 5JLIA 2KSFA 2RSEB 1XWJA 3MX3A 4RD9A 2R7TA 1T01A 3WODF 1QZXA 4CSAC 1S7ZA 1K05A 1SZIA 2R02A 1V4AA 1Z6AA 2R7OA 3KYJA 4CS9C 4DRIB 4EKWA 3GM3A 1VTMP 2MHRA 3EG9A 3NYLA 4CDAA 3UMIA 4YT2A 2EPMX 4I1MA 4U5EE 4YJWA 5L0JA 3FAPB 1G5ZA 1XZQA 5FCLA 4I3MA 1Y4CA 3EHNA 1LE4A 4DOZA 1FMWA 4JTAB 1WGWA 2KNHA 3DI5A 2HUJA 1JAFA 4PJMA 4X0RA 4XTKA 1A7VA 1V74B 3HLZA 4MW8A 1D1BA 3ZSUA 5F5FA 4W8KA 1RXQA 3FHDA 3JTLO 4RBNA 3FAJA 2IXNA 5D92A 2GA0A 2Q00A 3AOUA 1FAPB 1LE2A 3T4RA 3ZDLA 3OWTA 3ABMC 1RCPA 3RQEA 3SP1A 1J8MF 1ZHXA 2ZD9A 4AE4B 4EBBA 5KYUA 4E7ZA 3BRJA 3GM1A 2PNOA 3GWNA 2EIMC 3AG3C 3MYIA 1OCOC 4JURI 3NG1A 5JRAA 1PCXA 2A0UA 3KL4A 1JPNA 3NKDA 4U5FE 2PF4E 1DOWA 3Q7LA 3U0CA 4WABA 2YL0A 1QPUA 2HSBA 2XS1A 3E9VA 1T5OA 4MS2A 1WATA 5JUAA 3RYLA 3DKAA 1MMAA 2Q9BA 3FMSA 2CW0F 2C04A 1TWHA 1BR4A 1JOGA 3M15A 3JYHA 1RJ9B 1NFOA 4C3BA 3HJCA 2P6VA 2JD3A 2XXAA 1D1CA 3IQCA 3L0IA 4G7HF 3GORA 1C02A 1Q0DA 2B0HA 4PFPA 4ULVA
chains in the Genus database with same CATH topology
1LM3B 4CDVA 3NMJA 2YL7A 3NMKA 5JSLA 1CGOA 4JE9A 1CPQA 3ZTMA 2YKZA 3IQ6A 2BC5A 4D4XA 5JS5A 3TOMA 3VRCA 1E86A 1M6TA 5B3IA 1MQVA 3ZQYA 5AGFA 2XLDA 3HNIA 3M79A 2XLWA 3L1MA 2XM0A 1YYXA 4N6HA 4U9DA 2XL8A 5JP7A 2XLMA 2J9BA 3ZTZA 3M4BA 3FOPA 3U8PA 4CJOA 4JKVA 3TOLA 1E84A 2XLOA 1YZCA 1CGNA 1CPRA 1APCA 2XM4A 4CDYA 2CCYA 4JEBA 3HNJA 4WGYA 3QW1A 4CX9A 4L6RA 5JVEA 4IB4A 2J8WA 1E83A 3HNLA 3QVZA 3FOOA 5JLIA 1QQ3A 1GQAA 3DE8A 3HNKA 2YL1A 4CDAA 3NMIA 2QLAA 2YLGA 4NC3A 3IQ5A 3C62A 4IARA 1S05A 256BA 1JAFA 4EIYA 1A7VA 1BBHA 3ZWIA 4CJGA 3QVYA 4D4NA 1E85A 2YLDA 5JT4A 3DE9A 4JEAA 4ER9A 3QW0A 2XL6A 4U9EA 2YLIA 2XLHA 4WGZA 1RCPA 2XLEA 1EKYA 1NBBA 2XLVA 1YYJA 4IAQA 5JRAA 3ZQVA 2YL0A 1QPUA 3M4CA 5JUAA 4N4WA 4CIPA 3M15A 3C63A 1YZAA 2YL3A 4ULVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LM3 B;  4CDV A;  3NMJ A;  2YL7 A;  3NMK A;  5JSL A;  1CGO A;  4JE9 A;  1CPQ A;  3ZTM A;  2YKZ A;  3IQ6 A;  2BC5 A;  4D4X A;  5JS5 A;  3TOM A;  3VRC A;  1E86 A;  1M6T A;  5B3I A;  1MQV A;  3ZQY A;  5AGF A;  2XLD A;  3HNI A;  3M79 A;  2XLW A;  3L1M A;  2XM0 A;  1YYX A;  4N6H A;  4U9D A;  2XL8 A;  5JP7 A;  2XLM A;  2J9B A;  3ZTZ A;  3M4B A;  3FOP A;  3U8P A;  4CJO A;  4JKV A;  3TOL A;  1E84 A;  2XLO A;  1YZC A;  1CGN A;  1CPR A;  1APC A;  2XM4 A;  4CDY A;  2CCY A;  4JEB A;  3HNJ A;  4WGY A;  3QW1 A;  4CX9 A;  4L6R A;  5JVE A;  4IB4 A;  2J8W A;  1E83 A;  3HNL A;  3QVZ A;  3FOO A;  5JLI A;  1QQ3 A;  1GQA A;  3DE8 A;  3HNK A;  2YL1 A;  4CDA A;  3NMI A;  2QLA A;  2YLG A;  4NC3 A;  3IQ5 A;  3C62 A;  4IAR A;  1S05 A;  256B A;  1JAF A;  4EIY A;  1A7V A;  1BBH A;  3ZWI A;  4CJG A;  3QVY A;  4D4N A;  1E85 A;  2YLD A;  5JT4 A;  3DE9 A;  4JEA A;  4ER9 A;  3QW0 A;  2XL6 A;  4U9E A;  2YLI A;  2XLH A;  4WGZ A;  1RCP A;  2XLE A;  1EKY A;  1NBB A;  2XLV A;  1YYJ A;  4IAQ A;  5JRA A;  3ZQV A;  2YL0 A;  1QPU A;  3M4C A;  5JUA A;  4N4W A;  4CIP A;  3M15 A;  3C63 A;  1YZA A;  2YL3 A;  4ULV A; 
#chains in the Genus database with same CATH topology
 3S27 A;  3X2Q C;  4CDV A;  5KYX A;  4G0H A;  1ORY A;  5JSL A;  1BR1 A;  1VYI A;  3ABK C;  1YAR O;  3V5Z A;  4A4A A;  5A6J A;  2EPL X;  3ZIB A;  4PR9 A;  4MVZ A;  3SXZ A;  2L9J A;  5AC5 A;  3QMK A;  1CPQ A;  1LS1 A;  1VB5 A;  3DAG A;  3GM2 A;  3LNR A;  4NTB A;  4O7G A;  1DOV A;  3B0V C;  3K33 A;  2OU6 A;  2XXA B;  1FTS A;  2HMQ A;  3DZA A;  2BC5 A;  1PD0 A;  2IM8 A;  2P1A A;  3ATP A;  1M6T A;  4BJ5 A;  1U6H A;  3GEH A;  3POV A;  2FAP B;  4MW3 A;  5KYY A;  4YL0 A;  3S90 A;  4U5H A;  1ZHW A;  1H6G A;  2NPU A;  4DVZ A;  1I5N A;  3B29 A;  3L1M A;  2Z15 A;  3AGU A;  2XM0 A;  4WJ0 A;  3X1O A;  4H54 A;  1AEP A;  3PHF 2;  1TWC A;  2ZXO A;  5CI9 A;  4J7Y A;  1GS9 A;  3TD7 A;  2EPO A;  1FFT C;  2D4U A;  2QUP A;  5COG A;  2OJQ A;  4DBR A;  4R32 A;  3S28 A;  4Q7C A;  2QY9 A;  3AQC A;  3VM6 A;  3LUT B;  4DBQ A;  1NU7 D;  1IZM A;  3WAQ A;  4MTO A;  4AL0 A;  3I5P A;  4DRH B;  4JJF A;  2L6H A;  4BEJ A;  2H7V C;  3LEO A;  1TR2 A;  3CZ6 A;  3DJN B;  3KKB A;  1WWP A;  2AU5 A;  5F5H A;  4OIO F;  2NUT A;  4CDY A;  4W8P A;  2W4M A;  1ORJ A;  4JZA A;  2Q7R A;  2J9U A;  1W2W A;  2Q3T A;  4FX5 A;  1ST6 A;  3DM5 A;  4WGY A;  3C7J A;  3QW1 A;  4ANJ A;  3VAY A;  5DLJ A;  2RD9 A;  4L6R A;  5JVE A;  1ZHZ A;  3N24 A;  4Q5S F;  1M56 C;  3CSK A;  2NUP B;  1LPE A;  2VC9 A;  2P0N A;  4FES A;  2OEV A;  5F28 E;  4DXW A;  4DVY P;  5L3Q A;  4ZLD A;  1L3P A;  3H2V A;  3MBG A;  4LDR A;  1NSG B;  1Z5Z A;  4J32 B;  3JCU Q;  4HEA J;  4Z9J A;  3L8I A;  1QQ3 A;  3Q7G A;  2WB7 A;  4EUK B;  2HJ3 A;  5FZT A;  2YL1 A;  3AG2 C;  5DQT A;  3UGO A;  3RH3 A;  4JJG A;  2V26 A;  1A7E A;  2GDC A;  2PX0 A;  4F4B A;  2MYS A;  2R7V A;  3NMI A;  4GEH A;  4U5C E;  2YLG A;  4I1O B;  4BPM A;  4E7S A;  4A2N B;  3BEH A;  5DQZ A;  2LFD A;  1JR8 A;  4XPW A;  1JMW A;  1S05 A;  3DMD A;  1ZYR F;  4FWV A;  4YT8 A;  2Q9C A;  4PJN A;  4KNV A;  1F1M A;  5T3T A;  1OKK D;  3QZC A;  3KH2 A;  2WL8 A;  4PAC A;  1BBH A;  4AX2 A;  5A69 A;  3ZWI A;  3QVY A;  3UMH A;  1YDI A;  5JT4 A;  4MVO A;  2GWW A;  2LD6 A;  3E70 C;  3GWL A;  3NYM A;  3RKO F;  3K6B A;  1O5H A;  4O6N A;  1SF8 A;  2XL6 A;  4ONS A;  3AQB A;  2YLI A;  1OR3 A;  1D1A A;  2IXM A;  2I8B A;  3C8Z A;  1M2V B;  2ZXP A;  2XLE A;  3SNH A;  2AWC A;  1KNY A;  3LS1 A;  4IRU A;  4J7T A;  4BJT A;  2LK4 A;  3S84 A;  1CGM E;  2JPU A;  1Q0M A;  2R9R B;  3EG9 B;  1HE9 A;  1V54 C;  3EPV A;  2VCA A;  1BDJ B;  4UDV A;  1ZVZ A;  3K1H A;  1SR2 A;  4HE8 D;  5KYW A;  4CIP A;  3EH2 A;  3U8V A;  3C63 A;  3EZI A;  1YZA A;  1M57 C;  3T6B A;  3N0T A;  1A7D A;  2P61 A;  4Z9H A;  4NCQ A;  3VF0 A;  3ECS A;  2BE5 F;  4BJ5 C;  5A6B D;  2QTV A;  2AP3 A;  4GYT A;  3NMJ A;  4C7O B;  2VCC A;  2YL7 A;  1OKK A;  3CAX A;  3FXH A;  3NMK A;  2CDQ A;  3DWW A;  3PDM P;  1SMY F;  2OKU A;  2VAS A;  3WHN A;  5A6A A;  5A6B A;  2J7P D;  4NTA A;  3W8H A;  1A0B A;  1OQC A;  1YLM A;  2KQ9 A;  4DJ9 A;  4ULW A;  3C8G B;  2W9Y A;  2DGJ A;  4IAO A;  4E18 A;  1YJG A;  5JS5 A;  3N2Z B;  4CS8 A;  1TFK B;  4C7O A;  5TJ5 E;  4E17 A;  1BZ4 A;  1E86 A;  3L34 A;  3ZQY A;  2LFF A;  4NQF A;  4JCZ A;  1WOL A;  2HV7 A;  3M79 A;  2A6H F;  2R05 A;  5AGF A;  3EZH A;  5L0H A;  2IOQ A;  3O6X A;  4XEV A;  1T6U A;  2WVO A;  3VYW A;  1Z63 A;  1ORS C;  2LSE A;  2R25 A;  2XL8 A;  2EIK C;  1AVO B;  4U9D A;  4MTG A;  3ITF A;  2CYD A;  2FGY A;  1HE1 A;  3LAY A;  3OA1 A;  5EK0 A;  1GM5 A;  2V3C C;  2O9X A;  3EQL F;  2X0C A;  1MND A;  5DS6 A;  3ASN C;  3U8P A;  4JTD B;  2A68 F;  1TFO B;  4CJO A;  2OJE D;  2ASR A;  5BQG A;  1U89 A;  4KNW A;  3SXY A;  3SZR A;  1E84 A;  3DXJ F;  3LLK A;  1AUE A;  2J0X A;  4XWJ A;  2DB4 A;  1YA9 A;  1YZC A;  2MWQ A;  1B68 A;  2UUH A;  1Z23 A;  2YQY A;  3JZ0 A;  3LES A;  3S9O A;  1APC A;  3U3F A;  5KYW B;  4PK4 A;  2R7X A;  3SXM A;  1QKR A;  2XRH A;  1PV3 A;  2CCY A;  2DYS C;  3EJN A;  3EGX B;  3IQT A;  4LAC B;  1LIH A;  4M63 A;  3C8G A;  1FFH A;  1D0Y A;  4CX9 A;  2YZS A;  4IJJ A;  2Y3B A;  1LS4 A;  4CS8 C;  1HW2 A;  4IB4 A;  3DAF A;  4OIR F;  2HV6 A;  1E83 A;  3RQF A;  2Q4F A;  3HNL A;  1YA7 O;  1UFB A;  4RDA A;  3LEV A;  4XLP F;  1Z7Q c;  4FAP B;  3FVY A;  3NYJ A;  4GQH A;  4C3D A;  1GQA A;  1J8Y F;  3DE8 A;  3JT1 A;  3NRH A;  3O55 A;  5L0C A;  2KK1 A;  3HNK A;  2GAQ A;  4KC9 A;  4PJL A;  1VK5 A;  3SXK A;  1D0X A;  1WN0 A;  3AG4 C;  2QLA A;  4NC3 A;  3IQ5 A;  2Y3G A;  3HTK C;  1G8X A;  1Q0G A;  4IAR A;  3RW0 A;  4EBJ A;  3R2P A;  3O10 A;  3RVZ A;  3ZVR A;  1NFN A;  2IXO A;  3T9O A;  3PCV A;  3I5Q A;  3KMI A;  3JSZ A;  1RMV A;  2EIJ C;  2WVQ A;  4LDK A;  3W2V A;  1OCC C;  1VLS A;  2XS8 A;  4LDQ A;  2H8A A;  2I15 A;  5E2Q A;  1E85 A;  2JX0 A;  3R7C A;  1EQ1 A;  2FFH A;  4JEA A;  3UNG C;  3CEX A;  3V5X A;  4BJ6 C;  1G4W R;  2LIG A;  2R7Q A;  3QW0 A;  4U9E A;  5DS5 A;  4CSA A;  3K7D A;  2EIL C;  4JVS A;  3G50 A;  2J45 A;  3TUL A;  3B0U X;  4MVR A;  1YYJ A;  1ZU4 A;  3U9M A;  1XZP A;  2VH3 A;  2IXP A;  4C3E A;  1D0Z A;  1O87 A;  1V55 C;  1YAU O;  3M4C A;  4P9T A;  5DVW A;  4LLE A;  4HFF B;  1VYK A;  4YT4 A;  5COF A;  4AL1 A;  1ZW3 A;  2M64 A;  1H9T A;  2C03 A;  2J0W A;  1Y6D A;  4AK9 A;  2D5R B;  1OR2 A;  2VB6 A;  2NUT B;  3MYF A;  2NG1 A;  5T1D B;  2WZF A;  3WG7 C;  3G4X A;  2G3V A;  1R5I D;  1Z3I X;  4QDL A;  2AWY A;  2M4E A;  5L0F A;  1KTM A;  4J30 B;  2X51 A;  2CGE A;  5KYY B;  4P9F A;  2Y3D A;  5BQH A;  2PX3 A;  2L6F A;  3TQO A;  4MVM A;  1OW7 A;  1ZHT A;  3RFY A;  1H7I A;  2A6E F;  4EHP A;  2HS5 A;  1ZW2 A;  3QTH A;  4EBK A;  1M2V A;  1QVX A;  2DYR C;  3DD7 A;  4MVS A;  1LI7 A;  2HKV A;  3EH1 A;  4JE9 A;  4BJ1 A;  1RKC A;  4YN0 B;  5IY5 C;  3IHU A;  2G3K A;  2YKZ A;  3IQ6 A;  3JRM O;  5B3S C;  4NTF A;  5EHH A;  2OQM A;  3F46 A;  1IW7 F;  2Y39 A;  3JSE O;  3TOM A;  1OW6 A;  3HKK A;  4O6M A;  3EGX A;  3VRC A;  2GFH A;  3RIP A;  2PFD A;  1K04 A;  1VMA A;  1Q0F A;  5COM A;  4XQ1 A;  3W4Y A;  2OEX A;  1N1C A;  5B1A C;  4DRJ B;  3TJ5 A;  2WVN A;  5KYN A;  4CBE A;  2J7P A;  4QI2 A;  1YYX A;  4N6H A;  3ZG1 A;  1I4Y A;  3V5Y A;  1TWA A;  3NDB B;  4MTF A;  3C8G D;  2IYL D;  2XLM A;  3KYI A;  3W2W A;  1RJ9 A;  3ZTZ A;  3M4B A;  3DJU B;  3EFO A;  1OCZ C;  2G62 A;  1H9G A;  3V7O A;  1LVK A;  4BEM J;  2R7S A;  2HFI A;  2PP4 A;  3TOL A;  4MND A;  2EIN C;  4E0H A;  2P7V A;  2H7O A;  1QLE C;  2LQG A;  2OOC A;  1FR0 A;  4N06 A;  1JRA A;  2NSF A;  1G4U S;  3TK0 A;  2XM4 A;  1OW8 A;  3A9C A;  3RF3 A;  2VCB A;  3MFN A;  2WZL A;  3W8I A;  2TMV P;  4AE4 A;  3K66 A;  2EPN A;  1L7C A;  1OCR C;  4K0D A;  3HNJ A;  5B1B C;  1C03 A;  2OG2 A;  5D91 A;  2BL2 A;  3US6 A;  3C18 A;  5T3W A;  4N6C A;  5DS4 A;  3ZC4 A;  2XSE A;  4YK5 A;  1FNT c;  5L0I A;  2HJM A;  2PBE A;  3ASO C;  3LS0 A;  3MLG A;  3EHM A;  4G7O F;  1VLT A;  1WAS A;  3K1I C;  4Z9I A;  4K1O A;  1M2O A;  4KI2 A;  2UUI A;  3T6G B;  2CNW A;  3B9Q A;  3TJ6 A;  3GAN A;  2YVK A;  4IWB A;  3LLI A;  3UMK A;  4JC7 A;  5L0D A;  1HY5 A;  3B0P A;  4G78 A;  1FMV A;  4MVU A;  1E2X A;  4BG0 A;  4YWQ A;  3C62 A;  1I4Z A;  4KBL A;  256B A;  4OIQ F;  2HMZ A;  1EA8 A;  2A0B A;  1O3U A;  2HSQ A;  1YVI A;  2KW3 C;  3PMR A;  2EPK X;  4EIY A;  4HFK B;  1C17 M;  2XL4 A;  5A6K A;  2ETS A;  2Y69 C;  4OIN F;  5EGY A;  2R7U A;  4CJG A;  1HW1 A;  4D4N A;  3B71 A;  2YLD A;  3SEO A;  3JYY A;  1EI7 A;  3DE9 A;  4ER9 A;  3FDQ A;  2R7W A;  4G7Z F;  2A69 F;  2YRF A;  2QNL A;  4OD5 A;  4E0I A;  5E3A A;  3AG1 C;  1ZHY A;  2XLH A;  3K1I A;  3Q6M A;  4WGZ A;  4CIH A;  2ZXR A;  1NBB A;  2XLV A;  3T6J A;  1OXK A;  4IAQ A;  5KYX B;  1EKY A;  3OEO A;  2H7B A;  4JTC B;  3U3B A;  3H65 A;  3U5S A;  3ZQV A;  2WZG A;  1NU9 C;  1MNE A;  1ZU5 A;  3GOD A;  5GPG B;  1QSP A;  3JRT A;  4JCH A;  1T6I A;  4LLC A;  2NSG A;  3RQG A;  2Y3H A;  4N4W A;  2W4B A;  3AJM A;  4NY3 A;  4QI0 A;  1KU2 A;  1UG7 A;  3Q6N A;  3UR3 C;  3G4Z A;  2LCH A;  3SYN A;  1JPJ A;  4EWC A;  2YL3 A;  3DM9 B;  4JW1 A;  2LP4 A;  3A11 A;  3GEI A;  2B0J A;  2ZXW C;  1LM3 B;  3KPH A;  4YL1 A;  4XLN F;  1HMD A;  1ZZP A;  2KGO A;  3J06 A;  3EFO B;  4BJ6 A;  1RKE A;  4XPX A;  2L6G A;  2NUP A;  2YWA A;  4YL3 A;  5K0I A;  3LNM B;  1WTY A;  5L0G A;  1CGO A;  1HMO A;  3ABL C;  4PJJ A;  5CI8 A;  2YEV A;  3ZTM A;  3S0X A;  2YHS A;  4H4K C;  1NLX A;  3O39 A;  2R7R A;  2HZ8 A;  4D4X A;  2W45 A;  1NZE A;  1K40 A;  3NKE A;  1T9K A;  2J46 A;  1A41 A;  5B3I A;  1MQV A;  3S29 A;  1MMG A;  1RKE B;  1TQG A;  2XLD A;  3HNI A;  4IGG A;  2XLW A;  4JIO A;  4P6I C;  2DI3 A;  4CS9 A;  5HV9 A;  1BR2 A;  4OIP F;  2ZPA A;  1OXB A;  1TWG A;  2A1D D;  2L81 A;  5BUO A;  1T6Q A;  2ICW G;  1VOM A;  3AGT A;  3GEE A;  5JP7 A;  2J9B A;  4PFO A;  3RVY A;  4K7B A;  5AC4 A;  5KYU B;  3IEE A;  3FOP A;  2KYH A;  4OD4 A;  4JRZ A;  3H2U A;  2J9V A;  1LI5 A;  4U5G A;  2Q9A A;  2IBF A;  2OCC C;  3M1C B;  4JKV A;  4O6Y A;  5BQI A;  3L8J A;  2XLO A;  5HSW A;  4B6I A;  4U5D E;  3F47 A;  4I44 A;  1CGN A;  4XEF A;  3IPM O;  1MMD A;  5E33 A;  1CPR A;  1NG1 A;  1SYQ A;  1U0B B;  2F22 A;  3EGD A;  4O79 A;  4CS7 A;  4MQ9 F;  4JEB A;  1Q0K A;  2R03 A;  1TKN A;  2AVK A;  2J9W A;  4XPY A;  3U9J A;  3EGD B;  4MVQ A;  4ZLC A;  4Q4Z F;  3UGP A;  1PD1 A;  3U2M A;  2E87 A;  2J8W A;  2QE9 A;  3I4U A;  4U5B E;  5L3V A;  3LJB A;  2KJG A;  4YT5 A;  2L7A A;  1GGQ A;  1R4T A;  3CQZ A;  2CNW D;  4XEK A;  3QVZ A;  4LER A;  3U2L A;  5CIV A;  1MMN A;  3FOO A;  1LKX A;  2KC3 A;  5E3C A;  5JLI A;  2KSF A;  2RSE B;  1XWJ A;  3MX3 A;  4RD9 A;  2R7T A;  1T01 A;  3WOD F;  1QZX A;  4CSA C;  1S7Z A;  1K05 A;  1SZI A;  2R02 A;  1V4A A;  1Z6A A;  2R7O A;  3KYJ A;  4CS9 C;  4DRI B;  4EKW A;  3GM3 A;  1VTM P;  2MHR A;  3EG9 A;  3NYL A;  4CDA A;  3UMI A;  4YT2 A;  2EPM X;  4I1M A;  4U5E E;  4YJW A;  5L0J A;  3FAP B;  1G5Z A;  1XZQ A;  5FCL A;  4I3M A;  1Y4C A;  3EHN A;  1LE4 A;  4DOZ A;  1FMW A;  4JTA B;  1WGW A;  2KNH A;  3DI5 A;  2HUJ A;  1JAF A;  4PJM A;  4X0R A;  4XTK A;  1A7V A;  1V74 B;  3HLZ A;  4MW8 A;  1D1B A;  3ZSU A;  5F5F A;  4W8K A;  1RXQ A;  3FHD A;  3JTL O;  4RBN A;  3FAJ A;  2IXN A;  5D92 A;  2GA0 A;  2Q00 A;  3AOU A;  1FAP B;  1LE2 A;  3T4R A;  3ZDL A;  3OWT A;  3ABM C;  1RCP A;  3RQE A;  3SP1 A;  1J8M F;  1ZHX A;  2ZD9 A;  4AE4 B;  4EBB A;  5KYU A;  4E7Z A;  3BRJ A;  3GM1 A;  2PNO A;  3GWN A;  2EIM C;  3AG3 C;  3MYI A;  1OCO C;  4JUR I;  3NG1 A;  5JRA A;  1PCX A;  2A0U A;  3KL4 A;  1JPN A;  3NKD A;  4U5F E;  2PF4 E;  1DOW A;  3Q7L A;  3U0C A;  4WAB A;  2YL0 A;  1QPU A;  2HSB A;  2XS1 A;  3E9V A;  1T5O A;  4MS2 A;  1WAT A;  5JUA A;  3RYL A;  3DKA A;  1MMA A;  2Q9B A;  3FMS A;  2CW0 F;  2C04 A;  1TWH A;  1BR4 A;  1JOG A;  3M15 A;  3JYH A;  1RJ9 B;  1NFO A;  4C3B A;  3HJC A;  2P6V A;  2JD3 A;  2XXA A;  1D1C A;  3IQC A;  3L0I A;  4G7H F;  3GOR A;  1C02 A;  1Q0D A;  2B0H A;  4PFP A;  4ULV A; 
#chains in the Genus database with same CATH homology
 1LM3 B;  4CDV A;  3NMJ A;  2YL7 A;  3NMK A;  5JSL A;  1CGO A;  4JE9 A;  1CPQ A;  3ZTM A;  2YKZ A;  3IQ6 A;  2BC5 A;  4D4X A;  5JS5 A;  3TOM A;  3VRC A;  1E86 A;  1M6T A;  5B3I A;  1MQV A;  3ZQY A;  5AGF A;  2XLD A;  3HNI A;  3M79 A;  2XLW A;  3L1M A;  2XM0 A;  1YYX A;  4N6H A;  4U9D A;  2XL8 A;  5JP7 A;  2XLM A;  2J9B A;  3ZTZ A;  3M4B A;  3FOP A;  3U8P A;  4CJO A;  4JKV A;  3TOL A;  1E84 A;  2XLO A;  1YZC A;  1CGN A;  1CPR A;  1APC A;  2XM4 A;  4CDY A;  2CCY A;  4JEB A;  3HNJ A;  4WGY A;  3QW1 A;  4CX9 A;  4L6R A;  5JVE A;  4IB4 A;  2J8W A;  1E83 A;  3HNL A;  3QVZ A;  3FOO A;  5JLI A;  1QQ3 A;  1GQA A;  3DE8 A;  3HNK A;  2YL1 A;  4CDA A;  3NMI A;  2QLA A;  2YLG A;  4NC3 A;  3IQ5 A;  3C62 A;  4IAR A;  1S05 A;  256B A;  1JAF A;  4EIY A;  1A7V A;  1BBH A;  3ZWI A;  4CJG A;  3QVY A;  4D4N A;  1E85 A;  2YLD A;  5JT4 A;  3DE9 A;  4JEA A;  4ER9 A;  3QW0 A;  2XL6 A;  4U9E A;  2YLI A;  2XLH A;  4WGZ A;  1RCP A;  2XLE A;  1EKY A;  1NBB A;  2XLV A;  1YYJ A;  4IAQ A;  5JRA A;  3ZQV A;  2YL0 A;  1QPU A;  3M4C A;  5JUA A;  4N4W A;  4CIP A;  3M15 A;  3C63 A;  1YZA A;  2YL3 A;  4ULV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...