1A7VA

Cytochrome c' from rhodopseudomonas palustris
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
125
structure length
125
Chain Sequence
QTDVIAQRKAILKQMGEATKPIAAMLKGEAKFDQAVVQKSLAAIADDSKKLPALFPADSKTGGDTAALPKIWEDKAKFDDLFAKLAAAATAAQGTIKDEASLKANIGGVLGNCKSCHDDFRAKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Basis for monomer stabilization in Rhodopseudomonas palustris cytochrome c' derived from the crystal structure.
pubmed doi rcsb
total genus 46
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1a7vA00
2XL6A 1E85A 2XL8A 4JE9A 4CX9A 5JUAA 3HNIA 2YL3A 4D4XA 3ZTZA 3NMIA 4EIYA 1CGNA 4JEBA 2YL1A 2J8WA 3ZQVA 1M6TA 3QVZA 2XLEA 3L1MA 1EKYA 2XLDA 3QVYA 5JLIA 2YL7A 4U9EA 3C63A 4CJOA 4U9DA 4WGYA 1YZCA 2XM0A 3QW1A 3IQ6A 1CPRA 4IARA 3TOLA 1CGOA 3C62A 2YLIA 3TOMA 1BBHA 3M4BA 3VRCA 2XLHA 4N6HA 1CPQA 3HNLA 2XLVA 3FOPA 1QQ3A 4ULVA 3HNKA 4CJGA 5B3IA 2CCYA 1RCPA 2YLDA 3M79A 5JP7A 1YYXA 4JKVA 3HNJA 4N4WA 1A7VA 2XM4A 1QPUA 1E86A 5JT4A 3DE9A 5JSLA 4WGZA 2YLGA 5AGFA 4CDAA 1YYJA 3ZQYA 3ZTMA 1E83A 4IAQA 2YKZA 256BA 3M4CA 3NMJA 1S05A 2XLOA 5JVEA 2YL0A 3FOOA 2XLWA 3QW0A 3NMKA 4ER9A 3M15A 2QLAA 4D4NA 4IB4A 4JEAA 1GQAA 4L6RA 3ZWIA 5JRAA 1JAFA 4NC3A 2BC5A 5JS5A 1NBBA 1YZAA 3DE8A 4CDYA 1LM3B 4CDVA 1MQVA 4CIPA 1E84A 2XLMA 3U8PA 3IQ5A 2J9BA 1APCA
chains in the Genus database with same CATH superfamily
1KNYA 1D1BA 3EGDB 1MMNA 1YVIA 4U5BE 4XWJA 1GM5A 2ICWG 3U9JA 1HMOA 4CX9A 4HFKB 4O6NA 3OEOA 2M64A 3GORA 4WJ0A 3NYMA 2QNLA 2KQ9A 1A7EA 4MQ9F 4MW3A 5F28E 5JUAA 5L0JA 1VYIA 4D4XA 2AU5A 2LIGA 4MVQA 1FR0A 2Q7RA 4BG0A 1ZHTA 2J8WA 2QTVA 3FAJA 3ZQVA 3FMSA 1GS9A 3QVZA 2XLDA 3S90A 3EHMA 4U9EA 3SXMA 3JTLO 1C02A 3C63A 4U9DA 1KU2A 3NKDA 3EHNA 3ZIBA 2FGYA 2Y3DA 3GWLA 1OW8A 3X1OA 3F47A 4B6IA 4IGGA 3PCVA 3G4XA 4Z9IA 4NTAA 2YWAA 4JIOA 3S0XA 1OCZC 1CPRA 2VB6A 4O6YA 3X2QC 4ANJA 1CGOA 5L0DA 1KTMA 1BR4A 3B71A 3C62A 3EJNA 2XS1A 2IXOA 3C8GA 3CSKA 2HV7A 3L34A 5BQHA 3TOMA 3UNGC 3UGOA 3U2LA 3SEOA 3NG1A 3M4BA 4PFOA 2OJED 2D5RB 3T4RA 1OCCC 1EI7A 2VCBA 4JTAB 2YZSA 4ULWA 4DJ9A 3FHDA 3HNKA 4MVRA 4MVZA 2CCYA 1QSPA 2XSEA 2YLDA 4O7GA 2CNWA 4Q5SF 1Q0MA 4XQ1A 2XS8A 1OXBA 2GA0A 3N0TA 1EQ1A 2VCCA 3C8ZA 2R7SA 3NYJA 1Q0KA 4XPXA 2A68F 3GWNA 4CSAC 1NU7D 3H65A 3V5XA 3LS1A 2A69F 1A7VA 1D0ZA 3VAYA 2PBEA 2ZD9A 5B1AC 1D1AA 2CNWD 2KSFA 4JURI 3U8VA 2KGOA 3AQBA 2OKUA 1MMGA 1WWPA 3MYIA 4IAOA 4YL0A 4PJJA 1HY5A 3I5PA 2R03A 1B68A 1LKXA 2LQGA 4G7OF 4JJFA 4RD9A 1OCRC 3CAXA 3ZTMA 4DBRA 1HMDA 1NU9C 1S7ZA 3MFNA 4I3MA 4YT2A 5KYWA 1QLEC 4E0HA 3M4CA 2OEXA 5CI9A 4C3BA 5KYUA 1N1CA 4EUKB 4LDKA 1YLMA 2EPMX 3FOOA 1OKKA 4M63A 1OCOC 1BR1A 1ORYA 1LPEA 2EIJC 5COMA 5DS4A 3QW0A 1OW6A 1QKRA 1U6HA 5BQIA 3GODA 3GANA 1VMAA 1V4AA 3PDMP 3CEXA 5A6KA 1YARO 5E2QA 3K6BA 4I1MA 3K1IC 3C8GB 4JEAA 4BJ5A 4L6RA 3RQFA 1Q0DA 4MVOA 5JRAA 2X51A 3KMIA 3HKKA 1JAFA 4FWVA 1LVKA 3WODF 5L3VA 2OEVA 4NC3A 4IRUA 2IXNA 1NBBA 2VC9A 4KBLA 4NTBA 4OIPF 3O10A 1O3UA 1WATA 2HKVA 3CZ6A 3DE8A 1OW7A 4FAPB 3QTHA 1T5OA 4XLNF 3EFOA 1U0BB 2IBFA 1LM3B 1AEPA 2AP3A 4CDVA 3G50A 3B0VC 2Y69C 4JCZA 2FFHA 1D0XA 1NFOA 3JZ0A 3PHF2 5DS5A 3IQ5A 4LLCA 1VOMA 4YT4A 3EZIA 1APCA 2ZXPA 4MVMA 3DMDA 1ORSC 2DGJA 2R05A 2F22A 2XL8A 2R7RA 4KI2A 2R7OA 4JE9A 1RKCA 3HLZA 3ZG1A 4DVYP 3LNRA 1YA7O 3HNIA 3SYNA 5AC4A 2D4UA 3NMIA 2NUPB 1PD0A 2J0WA 2W4BA 2YL1A 4OIRF 1FFHA 1YJGA 3DKAA 2L6HA 3OWTA 3T6GB 1E2XA 1H7IA 4GEHA 1QZXA 1HE9A 2PF4E 3DZAA 3KYIA 3NKEA 1J8YF 3MBGA 4IWBA 5EK0A 5KYWB 5KYNA 3LEVA 5A6AA 1ZHZA 4XLPF 3T6BA 3O6XA 4OD4A 3MLGA 4N06A 1Y6DA 1C17M 1MNEA 2VCAA 4N6CA 3B0UX 3RVZA 3ZDLA 2WL8A 5L0GA 1K05A 2DB4A 1BR2A 2H7BA 1WTYA 2HUJA 3IQ6A 3LJBA 4JVSA 4YK5A 1GGQA 5B1BC 1BDJB 3TQOA 4PFPA 1T9KA 3GM1A 3DWWA 1PV3A 4J7TA 4N6HA 4MTGA 2WZGA 2H7VC 1JMWA 1VB5A 4ULVA 3RQEA 3WAQA 5B3IA 2FAPB 4OIOF 1JRAA 3EFOB 5A69A 4U5DE 2Y3HA 4QDLA 3DM5A 5TJ5E 4WABA 2J45A 3NDBB 3RVYA 1H6GA 5JP7A 4OIQF 3LLKA 2TMVP 2O9XA 1M2VA 1VK5A 3HNJA 2L7AA 1AUEA 2W9YA 1FTSA 2BL2A 4RDAA 2EPOA 5FZTA 1E86A 1YA9A 2ASRA 2J7PA 2L9JA 4XPYA 4CS9A 4G0HA 3UMIA 3RF3A 2HSQA 2LCHA 3V5ZA 4CS7A 5L0CA 2B0JA 1DOWA 3B9QA 3SP1A 4FESA 2YRFA 2NUTB 1M2OA 4QI0A 3N24A 2Z15A 4AL0A 2ETSA 2LFFA 1E83A 1ZYRF 3RW0A 4H4KC 3S9OA 1AVOB 256BA 3LUTB 4LDRA 2CYDA 3W8HA 2J7PD 1W2WA 1WASA 3WHNA 3S27A 5F5HA 5JVEA 5EHHA 1O87A 1ZHXA 4X0RA 4AE4A 4EBJA 5T3WA 3HJCA 4K1OA 3RIPA 3EGXB 3ZSUA 1T01A 4JRZA 4BEJA 5KYYA 1QVXA 1HE1A 2G62A 2Y3GA 3NMKA 3FXHA 4P9TA 1EKYA 3H2VA 4ER9A 5L0IA 1R5ID 3W2WA 2OCCC 2LD6A 4A2NB 4JTDB 3CQZA 5L0HA 4G7HF 1VTMP 4DXWA 3ECSA 4XTKA 3IPMO 4E7ZA 5HSWA 2VH3A 1CGME 4I1OB 4BJ5C 4Q7CA 5KYXA 2C03A 3AGTA 3Q7LA 1NZEA 1G4WR 2BC5A 4MNDA 1K04A 2V26A 3WG7C 4EWCA 4EBKA 1G5ZA 2L6GA 1VLTA 1I5NA 3EG9A 4R32A 3SXYA 3UMKA 4CDYA 2KW3C 4NY3A 3DD7A 3B29A 1M57C 2CGEA 1SZIA 3DJUB 2E87A 2EINC 2XL4A 2J9BA 3U3FA 5DVWA 3LEOA 2XL6A 1HW1A 1E84A 2RSEB 3OA1A 2IM8A 1R4TA 4YL1A 4IJJA 1E85A 2PFDA 2AWYA 1XZQA 3V7OA 1SMYF 2WZFA 3C18A 1OXKA 3M1CB 4MTFA 2X0CA 3DI5A 1I4ZA 3TJ6A 3ZC4A 3GM3A 2YL3A 3L8JA 3KPHA 3ZTZA 5DS6A 3QZCA 1G8XA 2XXAA 2ZXOA 2MYSA 2CW0F 4LACB 1M6TA 1SF8A 3EPVA 4FX5A 4ONSA 2EPLX 4U5FE 1A7DA 2PP4A 4W8PA 3QVYA 5E33A 3RYLA 5HV9A 5JLIA 2PX3A 4LLEA 1UG7A 2I15A 2Q4FA 2Y3BA 3E9VA 1TQGA 4GYTA 3VM6A 3ATPA 4WGYA 4BJ1A 4DRIB 4NQFA 1H9TA 2L81A 5B3SC 1ZU4A 5FCLA 3EGDA 2XM0A 3L8IA 3R2PA 4PJNA 2IXPA 4J7YA 4LERA 3W2VA 1MMAA 4CS8A 4CIHA 1RJ9A 2EIKC 4MVUA 4MW8A 4JJGA 4Z9JA 3BEHA 1RXQA 3TD7A 3VRCA 2WZLA 2HJ3A 4E18A 2HV6A 5EGYA 2EPKX 2C04A 2Q00A 1ZVZA 2XLVA 3FOPA 5D91A 2OG2A 3AG2C 2HJMA 4F4BA 4CJGA 4DRJB 2HFIA 2OQMA 1RCPA 4PR9A 1NFNA 1NSGB 1OR2A 4JZAA 4KNVA 2GWWA 2J9WA 3UR3C 1A41A 3DM9B 3T6JA 5KYUB 3JT1A 2AVKA 2Q9CA 2KK1A 2R7QA 3EH1A 3K33A 3M79A 4CBEA 2LSEA 2B0HA 3SXZA 4EKWA 3U2MA 2P7VA 3K66A 3ASOC 3U3BA 4EHPA 3US6A 2OU6A 4MTOA 5AC5A 3DJNB 1TR2A 1TWCA 1Z5ZA 3RFYA 5JT4A 4UDVA 3GEEA 4YT5A 4DBQA 5BUOA 3DE9A 3SZRA 4U5CE 3O39A 4J30B 5DLJA 4CS9C 1Z23A 5A6BA 1TWHA 2KYHA 1TFKB 2WVQA 3Q7GA 1RMVA 2YLGA 3ZVRA 4U5GA 5T1DB 2WB7A 3AG1C 1V54C 3RH3A 1YYJA 3ZQYA 4CDAA 2XRHA 3U5SA 4IAQA 2YKZA 2EILC 3MX3A 4JW1A 5CI8A 1NLXA 2AWCA 1S05A 2Q9AA 2RD9A 3B0PA 3FVYA 2YL0A 2PNOA 5A6BD 1PCXA 2YHSA 3GEHA 1V55C 5IY5C 1FMWA 1UFBA 3ABLC 3DAFA 4NTFA 2LP4A 3JCUQ 1VYKA 2HMZA 2QLAA 2R7VA 1RJ9B 1C03A 1ZU5A 4D4NA 1LI5A 3NYLA 1NG1A 1D0YA 1ST6A 2CDQA 3NRHA 3S29A 1TWGA 3ASNC 4HE8D 4AX2A 3G4ZA 1Y4CA 2GAQA 3LNMB 4YJWA 1MNDA 1YAUO 4NCQA 1RKEA 5DQTA 2R7WA 1G4US 1YZAA 3GEIA 3LS0A 4O6MA 3EH2A 3Q6MA 2IOQA 4BJ6A 1HW2A 2DYRC 4K0DA 5K0IA 2R9RB 2IXMA 3JYHA 2YVKA 4OINF 1MQVA 3S28A 4JTCB 3TULA 2EPNA 2XLMA 1LS1A 3U8PA 2Y39A 1LE2A 2WVNA 3EZHA 5COFA 1XZPA 4DOZA 5L3QA 5BQGA 2QUPA 3J06A 5E3AA 2R02A 2JX0A 1SR2A 5GPGB 3IHUA 4DVZA 3W8IA 1JOGA 1WOLA 2A6HF 1ZW3A 2KJGA 3KKBA 2M4EA 3LAYA 3VYWA 2P0NA 3BRJA 2DI3A 5CIVA 1Z6AA 4MS2A 4JCHA 1Z63A 2V3CC 2HMQA 2YEVA 2HS5A 4PACA 4EIYA 1LI7A 1CGNA 3IEEA 5L0FA 4C7OA 4JEBA 4Z9HA 3VF0A 3UGPA 2EIMC 1M56C 3KYJA 1EA8A 3W4YA 2XLEA 2OJQA 1TKNA 3L1MA 3SNHA 3S84A 1T6IA 2PX0A 4GQHA 3TJ5A 3U9MA 2ZXWC 3C8GD 2DYSC 2YL7A 3R7CA 4E0IA 2R7XA 3AQCA 4CJOA 2LK4A 1WGWA 3IQCA 1ZW2A 5T3TA 1T6UA 3N2ZB 3K7DA 4MVSA 1YZCA 1M2VB 3AG4C 3PMRA 4XPWA 3E70C 1FAPB 1LS4A 2G3VA 3QW1A 1ZHYA 3C7JA 3POVA 3A11A 3FDQA 1V74B 2VASA 2ZPAA 3DXJF 2J9UA 3K1HA 4IARA 4O79A 3TOLA 1L3PA 1FNTc 4PK4A 4CS8C 2HSBA 2LFDA 2YLIA 1WN0A 2UUIA 3JRTA 4XEKA 1BBHA 2IYLD 2NSFA 4ZLCA 4OD5A 4U5HA 4BPMA 2XLHA 1RKEB 2J9VA 1JR8A 2NUPA 2UUHA 3MYFA 1CPQA 3F46A 4HEAJ 1ZZPA 3HNLA 2GFHA 3TK0A 1QQ3A 1F1MA 3ITFA 4AK9A 4EBBA 2P61A 4G7ZF 2JD3A 3JSEO 4U5EE 4YN0B 3ABKC 3FAPB 1JPJA 2R25A 2ZXRA 1VLSA 3JYYA 4G78A 4K7BA 4W8KA 1JPNA 2A0BA 2KC3A 2L6FA 4AE4B 2H8AA 1YYXA 3DAGA 3KL4A 2NPUA 3Q6NA 4BEMJ 5KYYB 4CSAA 5F5FA 4YL3A 1FFTC 4JKVA 2J0XA 4E17A 3L0IA 2OOCA 4N4WA 1YDIA 2W45A 3A9CA 3EQLF 1K40A 2XM4A 1BZ4A 3I4UA 2GDCA 3GM2A 1QPUA 2YQYA 3UMHA 3HTKC 3U0CA 2P1AA 3IQTA 4JC7A 5D92A 1OKKD 5JSLA 5KYXB 2I8BA 4BJTA 1Q0FA 5DQZA 4C7OB 4P9FA 4WGZA 2WVOA 1OQCA 5AGFA 2A6EF 4H54A 2G3KA 3T9OA 4ZLDA 3RKOF 4AL1A 3EG9B 4PJLA 4RBNA 1A0BA 1T6QA 1H9GA 1XWJA 3NMJA 2XLOA 3LESA 4Q4ZF 1L7CA 4C3EA 1IZMA 1FMVA 1Z3IX 2QE9A 2XLWA 3JSZA 3RQGA 2MHRA 2NG1A 4DRHB 3O55A 1Z7Qc 4E7SA 3JRMO 3ABMC 1SYQA 5COGA 2Q9BA 3AJMA 4HFFB 4XEFA 1J8MF 1OR3A 1ORJA 2Q3TA 2MWQA 2QY9A 3K1IA 2P6VA 3M15A 4J32B 1U89A 1TWAA 4KC9A 4IB4A 1GQAA 2HZ8A 3V5YA 3ZWIA 4QI2A 2A0UA 3LLIA 1I4YA 3AG3C 3I5QA 2W4MA 4YT8A 5A6JA 5JS5A 2XXAB 2A1DD 1PD1A 1Q0GA 1IW7F 2J46A 1DOVA 1O5HA 2NUTA 1LIHA 1MMDA 3AGUA 4PJMA 4A4AA 1LE4A 4P6IC 4LDQA 2BE5F 2R7TA 3AOUA 4BJ6C 4C3DA 4XEVA 1TFOB 2NSGA 4YWQA 2KNHA 1ZHWA 4I44A 5E3CA 4CIPA 2R7UA 1D1CA 3KH2A 4KNWA 3SXKA 2JPUA 3QMKA 3H2UA 3EGXA 2H7OA
chains in the Genus database with same CATH topology
2XL6A 1E85A 2XL8A 4JE9A 4CX9A 5JUAA 3HNIA 2YL3A 4D4XA 3ZTZA 3NMIA 4EIYA 1CGNA 4JEBA 2YL1A 2J8WA 3ZQVA 1M6TA 3QVZA 2XLEA 3L1MA 1EKYA 2XLDA 3QVYA 5JLIA 2YL7A 4U9EA 3C63A 4CJOA 4U9DA 4WGYA 1YZCA 2XM0A 3QW1A 3IQ6A 1CPRA 4IARA 3TOLA 1CGOA 3C62A 2YLIA 3TOMA 1BBHA 3M4BA 3VRCA 2XLHA 4N6HA 1CPQA 3HNLA 2XLVA 3FOPA 1QQ3A 4ULVA 3HNKA 4CJGA 5B3IA 2CCYA 1RCPA 2YLDA 3M79A 5JP7A 1YYXA 4JKVA 3HNJA 4N4WA 1A7VA 2XM4A 1QPUA 1E86A 5JT4A 3DE9A 5JSLA 4WGZA 2YLGA 5AGFA 4CDAA 1YYJA 3ZQYA 3ZTMA 1E83A 4IAQA 2YKZA 256BA 3M4CA 3NMJA 1S05A 2XLOA 5JVEA 2YL0A 3FOOA 2XLWA 3QW0A 3NMKA 4ER9A 3M15A 2QLAA 4D4NA 4IB4A 4JEAA 1GQAA 4L6RA 3ZWIA 5JRAA 1JAFA 4NC3A 2BC5A 5JS5A 1NBBA 1YZAA 3DE8A 4CDYA 1LM3B 4CDVA 1MQVA 4CIPA 1E84A 2XLMA 3U8PA 3IQ5A 2J9BA 1APCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XL6 A;  1E85 A;  2XL8 A;  4JE9 A;  4CX9 A;  5JUA A;  3HNI A;  2YL3 A;  4D4X A;  3ZTZ A;  3NMI A;  4EIY A;  1CGN A;  4JEB A;  2YL1 A;  2J8W A;  3ZQV A;  1M6T A;  3QVZ A;  2XLE A;  3L1M A;  1EKY A;  2XLD A;  3QVY A;  5JLI A;  2YL7 A;  4U9E A;  3C63 A;  4CJO A;  4U9D A;  4WGY A;  1YZC A;  2XM0 A;  3QW1 A;  3IQ6 A;  1CPR A;  4IAR A;  3TOL A;  1CGO A;  3C62 A;  2YLI A;  3TOM A;  1BBH A;  3M4B A;  3VRC A;  2XLH A;  4N6H A;  1CPQ A;  3HNL A;  2XLV A;  3FOP A;  1QQ3 A;  4ULV A;  3HNK A;  4CJG A;  5B3I A;  2CCY A;  1RCP A;  2YLD A;  3M79 A;  5JP7 A;  1YYX A;  4JKV A;  3HNJ A;  4N4W A;  1A7V A;  2XM4 A;  1QPU A;  1E86 A;  5JT4 A;  3DE9 A;  5JSL A;  4WGZ A;  2YLG A;  5AGF A;  4CDA A;  1YYJ A;  3ZQY A;  3ZTM A;  1E83 A;  4IAQ A;  2YKZ A;  256B A;  3M4C A;  3NMJ A;  1S05 A;  2XLO A;  5JVE A;  2YL0 A;  3FOO A;  2XLW A;  3QW0 A;  3NMK A;  4ER9 A;  3M15 A;  2QLA A;  4D4N A;  4IB4 A;  4JEA A;  1GQA A;  4L6R A;  3ZWI A;  5JRA A;  1JAF A;  4NC3 A;  2BC5 A;  5JS5 A;  1NBB A;  1YZA A;  3DE8 A;  4CDY A;  1LM3 B;  4CDV A;  1MQV A;  4CIP A;  1E84 A;  2XLM A;  3U8P A;  3IQ5 A;  2J9B A;  1APC A; 
#chains in the Genus database with same CATH topology
 1KNY A;  1D1B A;  3EGD B;  1MMN A;  1YVI A;  4U5B E;  4XWJ A;  1GM5 A;  2ICW G;  3U9J A;  1HMO A;  4CX9 A;  4HFK B;  4O6N A;  3OEO A;  2M64 A;  3GOR A;  4WJ0 A;  3NYM A;  2QNL A;  2KQ9 A;  1A7E A;  4MQ9 F;  4MW3 A;  5F28 E;  5JUA A;  5L0J A;  1VYI A;  4D4X A;  2AU5 A;  2LIG A;  4MVQ A;  1FR0 A;  2Q7R A;  4BG0 A;  1ZHT A;  2J8W A;  2QTV A;  3FAJ A;  3ZQV A;  3FMS A;  1GS9 A;  3QVZ A;  2XLD A;  3S90 A;  3EHM A;  4U9E A;  3SXM A;  3JTL O;  1C02 A;  3C63 A;  4U9D A;  1KU2 A;  3NKD A;  3EHN A;  3ZIB A;  2FGY A;  2Y3D A;  3GWL A;  1OW8 A;  3X1O A;  3F47 A;  4B6I A;  4IGG A;  3PCV A;  3G4X A;  4Z9I A;  4NTA A;  2YWA A;  4JIO A;  3S0X A;  1OCZ C;  1CPR A;  2VB6 A;  4O6Y A;  3X2Q C;  4ANJ A;  1CGO A;  5L0D A;  1KTM A;  1BR4 A;  3B71 A;  3C62 A;  3EJN A;  2XS1 A;  2IXO A;  3C8G A;  3CSK A;  2HV7 A;  3L34 A;  5BQH A;  3TOM A;  3UNG C;  3UGO A;  3U2L A;  3SEO A;  3NG1 A;  3M4B A;  4PFO A;  2OJE D;  2D5R B;  3T4R A;  1OCC C;  1EI7 A;  2VCB A;  4JTA B;  2YZS A;  4ULW A;  4DJ9 A;  3FHD A;  3HNK A;  4MVR A;  4MVZ A;  2CCY A;  1QSP A;  2XSE A;  2YLD A;  4O7G A;  2CNW A;  4Q5S F;  1Q0M A;  4XQ1 A;  2XS8 A;  1OXB A;  2GA0 A;  3N0T A;  1EQ1 A;  2VCC A;  3C8Z A;  2R7S A;  3NYJ A;  1Q0K A;  4XPX A;  2A68 F;  3GWN A;  4CSA C;  1NU7 D;  3H65 A;  3V5X A;  3LS1 A;  2A69 F;  1A7V A;  1D0Z A;  3VAY A;  2PBE A;  2ZD9 A;  5B1A C;  1D1A A;  2CNW D;  2KSF A;  4JUR I;  3U8V A;  2KGO A;  3AQB A;  2OKU A;  1MMG A;  1WWP A;  3MYI A;  4IAO A;  4YL0 A;  4PJJ A;  1HY5 A;  3I5P A;  2R03 A;  1B68 A;  1LKX A;  2LQG A;  4G7O F;  4JJF A;  4RD9 A;  1OCR C;  3CAX A;  3ZTM A;  4DBR A;  1HMD A;  1NU9 C;  1S7Z A;  3MFN A;  4I3M A;  4YT2 A;  5KYW A;  1QLE C;  4E0H A;  3M4C A;  2OEX A;  5CI9 A;  4C3B A;  5KYU A;  1N1C A;  4EUK B;  4LDK A;  1YLM A;  2EPM X;  3FOO A;  1OKK A;  4M63 A;  1OCO C;  1BR1 A;  1ORY A;  1LPE A;  2EIJ C;  5COM A;  5DS4 A;  3QW0 A;  1OW6 A;  1QKR A;  1U6H A;  5BQI A;  3GOD A;  3GAN A;  1VMA A;  1V4A A;  3PDM P;  3CEX A;  5A6K A;  1YAR O;  5E2Q A;  3K6B A;  4I1M A;  3K1I C;  3C8G B;  4JEA A;  4BJ5 A;  4L6R A;  3RQF A;  1Q0D A;  4MVO A;  5JRA A;  2X51 A;  3KMI A;  3HKK A;  1JAF A;  4FWV A;  1LVK A;  3WOD F;  5L3V A;  2OEV A;  4NC3 A;  4IRU A;  2IXN A;  1NBB A;  2VC9 A;  4KBL A;  4NTB A;  4OIP F;  3O10 A;  1O3U A;  1WAT A;  2HKV A;  3CZ6 A;  3DE8 A;  1OW7 A;  4FAP B;  3QTH A;  1T5O A;  4XLN F;  3EFO A;  1U0B B;  2IBF A;  1LM3 B;  1AEP A;  2AP3 A;  4CDV A;  3G50 A;  3B0V C;  2Y69 C;  4JCZ A;  2FFH A;  1D0X A;  1NFO A;  3JZ0 A;  3PHF 2;  5DS5 A;  3IQ5 A;  4LLC A;  1VOM A;  4YT4 A;  3EZI A;  1APC A;  2ZXP A;  4MVM A;  3DMD A;  1ORS C;  2DGJ A;  2R05 A;  2F22 A;  2XL8 A;  2R7R A;  4KI2 A;  2R7O A;  4JE9 A;  1RKC A;  3HLZ A;  3ZG1 A;  4DVY P;  3LNR A;  1YA7 O;  3HNI A;  3SYN A;  5AC4 A;  2D4U A;  3NMI A;  2NUP B;  1PD0 A;  2J0W A;  2W4B A;  2YL1 A;  4OIR F;  1FFH A;  1YJG A;  3DKA A;  2L6H A;  3OWT A;  3T6G B;  1E2X A;  1H7I A;  4GEH A;  1QZX A;  1HE9 A;  2PF4 E;  3DZA A;  3KYI A;  3NKE A;  1J8Y F;  3MBG A;  4IWB A;  5EK0 A;  5KYW B;  5KYN A;  3LEV A;  5A6A A;  1ZHZ A;  4XLP F;  3T6B A;  3O6X A;  4OD4 A;  3MLG A;  4N06 A;  1Y6D A;  1C17 M;  1MNE A;  2VCA A;  4N6C A;  3B0U X;  3RVZ A;  3ZDL A;  2WL8 A;  5L0G A;  1K05 A;  2DB4 A;  1BR2 A;  2H7B A;  1WTY A;  2HUJ A;  3IQ6 A;  3LJB A;  4JVS A;  4YK5 A;  1GGQ A;  5B1B C;  1BDJ B;  3TQO A;  4PFP A;  1T9K A;  3GM1 A;  3DWW A;  1PV3 A;  4J7T A;  4N6H A;  4MTG A;  2WZG A;  2H7V C;  1JMW A;  1VB5 A;  4ULV A;  3RQE A;  3WAQ A;  5B3I A;  2FAP B;  4OIO F;  1JRA A;  3EFO B;  5A69 A;  4U5D E;  2Y3H A;  4QDL A;  3DM5 A;  5TJ5 E;  4WAB A;  2J45 A;  3NDB B;  3RVY A;  1H6G A;  5JP7 A;  4OIQ F;  3LLK A;  2TMV P;  2O9X A;  1M2V A;  1VK5 A;  3HNJ A;  2L7A A;  1AUE A;  2W9Y A;  1FTS A;  2BL2 A;  4RDA A;  2EPO A;  5FZT A;  1E86 A;  1YA9 A;  2ASR A;  2J7P A;  2L9J A;  4XPY A;  4CS9 A;  4G0H A;  3UMI A;  3RF3 A;  2HSQ A;  2LCH A;  3V5Z A;  4CS7 A;  5L0C A;  2B0J A;  1DOW A;  3B9Q A;  3SP1 A;  4FES A;  2YRF A;  2NUT B;  1M2O A;  4QI0 A;  3N24 A;  2Z15 A;  4AL0 A;  2ETS A;  2LFF A;  1E83 A;  1ZYR F;  3RW0 A;  4H4K C;  3S9O A;  1AVO B;  256B A;  3LUT B;  4LDR A;  2CYD A;  3W8H A;  2J7P D;  1W2W A;  1WAS A;  3WHN A;  3S27 A;  5F5H A;  5JVE A;  5EHH A;  1O87 A;  1ZHX A;  4X0R A;  4AE4 A;  4EBJ A;  5T3W A;  3HJC A;  4K1O A;  3RIP A;  3EGX B;  3ZSU A;  1T01 A;  4JRZ A;  4BEJ A;  5KYY A;  1QVX A;  1HE1 A;  2G62 A;  2Y3G A;  3NMK A;  3FXH A;  4P9T A;  1EKY A;  3H2V A;  4ER9 A;  5L0I A;  1R5I D;  3W2W A;  2OCC C;  2LD6 A;  4A2N B;  4JTD B;  3CQZ A;  5L0H A;  4G7H F;  1VTM P;  4DXW A;  3ECS A;  4XTK A;  3IPM O;  4E7Z A;  5HSW A;  2VH3 A;  1CGM E;  4I1O B;  4BJ5 C;  4Q7C A;  5KYX A;  2C03 A;  3AGT A;  3Q7L A;  1NZE A;  1G4W R;  2BC5 A;  4MND A;  1K04 A;  2V26 A;  3WG7 C;  4EWC A;  4EBK A;  1G5Z A;  2L6G A;  1VLT A;  1I5N A;  3EG9 A;  4R32 A;  3SXY A;  3UMK A;  4CDY A;  2KW3 C;  4NY3 A;  3DD7 A;  3B29 A;  1M57 C;  2CGE A;  1SZI A;  3DJU B;  2E87 A;  2EIN C;  2XL4 A;  2J9B A;  3U3F A;  5DVW A;  3LEO A;  2XL6 A;  1HW1 A;  1E84 A;  2RSE B;  3OA1 A;  2IM8 A;  1R4T A;  4YL1 A;  4IJJ A;  1E85 A;  2PFD A;  2AWY A;  1XZQ A;  3V7O A;  1SMY F;  2WZF A;  3C18 A;  1OXK A;  3M1C B;  4MTF A;  2X0C A;  3DI5 A;  1I4Z A;  3TJ6 A;  3ZC4 A;  3GM3 A;  2YL3 A;  3L8J A;  3KPH A;  3ZTZ A;  5DS6 A;  3QZC A;  1G8X A;  2XXA A;  2ZXO A;  2MYS A;  2CW0 F;  4LAC B;  1M6T A;  1SF8 A;  3EPV A;  4FX5 A;  4ONS A;  2EPL X;  4U5F E;  1A7D A;  2PP4 A;  4W8P A;  3QVY A;  5E33 A;  3RYL A;  5HV9 A;  5JLI A;  2PX3 A;  4LLE A;  1UG7 A;  2I15 A;  2Q4F A;  2Y3B A;  3E9V A;  1TQG A;  4GYT A;  3VM6 A;  3ATP A;  4WGY A;  4BJ1 A;  4DRI B;  4NQF A;  1H9T A;  2L81 A;  5B3S C;  1ZU4 A;  5FCL A;  3EGD A;  2XM0 A;  3L8I A;  3R2P A;  4PJN A;  2IXP A;  4J7Y A;  4LER A;  3W2V A;  1MMA A;  4CS8 A;  4CIH A;  1RJ9 A;  2EIK C;  4MVU A;  4MW8 A;  4JJG A;  4Z9J A;  3BEH A;  1RXQ A;  3TD7 A;  3VRC A;  2WZL A;  2HJ3 A;  4E18 A;  2HV6 A;  5EGY A;  2EPK X;  2C04 A;  2Q00 A;  1ZVZ A;  2XLV A;  3FOP A;  5D91 A;  2OG2 A;  3AG2 C;  2HJM A;  4F4B A;  4CJG A;  4DRJ B;  2HFI A;  2OQM A;  1RCP A;  4PR9 A;  1NFN A;  1NSG B;  1OR2 A;  4JZA A;  4KNV A;  2GWW A;  2J9W A;  3UR3 C;  1A41 A;  3DM9 B;  3T6J A;  5KYU B;  3JT1 A;  2AVK A;  2Q9C A;  2KK1 A;  2R7Q A;  3EH1 A;  3K33 A;  3M79 A;  4CBE A;  2LSE A;  2B0H A;  3SXZ A;  4EKW A;  3U2M A;  2P7V A;  3K66 A;  3ASO C;  3U3B A;  4EHP A;  3US6 A;  2OU6 A;  4MTO A;  5AC5 A;  3DJN B;  1TR2 A;  1TWC A;  1Z5Z A;  3RFY A;  5JT4 A;  4UDV A;  3GEE A;  4YT5 A;  4DBQ A;  5BUO A;  3DE9 A;  3SZR A;  4U5C E;  3O39 A;  4J30 B;  5DLJ A;  4CS9 C;  1Z23 A;  5A6B A;  1TWH A;  2KYH A;  1TFK B;  2WVQ A;  3Q7G A;  1RMV A;  2YLG A;  3ZVR A;  4U5G A;  5T1D B;  2WB7 A;  3AG1 C;  1V54 C;  3RH3 A;  1YYJ A;  3ZQY A;  4CDA A;  2XRH A;  3U5S A;  4IAQ A;  2YKZ A;  2EIL C;  3MX3 A;  4JW1 A;  5CI8 A;  1NLX A;  2AWC A;  1S05 A;  2Q9A A;  2RD9 A;  3B0P A;  3FVY A;  2YL0 A;  2PNO A;  5A6B D;  1PCX A;  2YHS A;  3GEH A;  1V55 C;  5IY5 C;  1FMW A;  1UFB A;  3ABL C;  3DAF A;  4NTF A;  2LP4 A;  3JCU Q;  1VYK A;  2HMZ A;  2QLA A;  2R7V A;  1RJ9 B;  1C03 A;  1ZU5 A;  4D4N A;  1LI5 A;  3NYL A;  1NG1 A;  1D0Y A;  1ST6 A;  2CDQ A;  3NRH A;  3S29 A;  1TWG A;  3ASN C;  4HE8 D;  4AX2 A;  3G4Z A;  1Y4C A;  2GAQ A;  3LNM B;  4YJW A;  1MND A;  1YAU O;  4NCQ A;  1RKE A;  5DQT A;  2R7W A;  1G4U S;  1YZA A;  3GEI A;  3LS0 A;  4O6M A;  3EH2 A;  3Q6M A;  2IOQ A;  4BJ6 A;  1HW2 A;  2DYR C;  4K0D A;  5K0I A;  2R9R B;  2IXM A;  3JYH A;  2YVK A;  4OIN F;  1MQV A;  3S28 A;  4JTC B;  3TUL A;  2EPN A;  2XLM A;  1LS1 A;  3U8P A;  2Y39 A;  1LE2 A;  2WVN A;  3EZH A;  5COF A;  1XZP A;  4DOZ A;  5L3Q A;  5BQG A;  2QUP A;  3J06 A;  5E3A A;  2R02 A;  2JX0 A;  1SR2 A;  5GPG B;  3IHU A;  4DVZ A;  3W8I A;  1JOG A;  1WOL A;  2A6H F;  1ZW3 A;  2KJG A;  3KKB A;  2M4E A;  3LAY A;  3VYW A;  2P0N A;  3BRJ A;  2DI3 A;  5CIV A;  1Z6A A;  4MS2 A;  4JCH A;  1Z63 A;  2V3C C;  2HMQ A;  2YEV A;  2HS5 A;  4PAC A;  4EIY A;  1LI7 A;  1CGN A;  3IEE A;  5L0F A;  4C7O A;  4JEB A;  4Z9H A;  3VF0 A;  3UGP A;  2EIM C;  1M56 C;  3KYJ A;  1EA8 A;  3W4Y A;  2XLE A;  2OJQ A;  1TKN A;  3L1M A;  3SNH A;  3S84 A;  1T6I A;  2PX0 A;  4GQH A;  3TJ5 A;  3U9M A;  2ZXW C;  3C8G D;  2DYS C;  2YL7 A;  3R7C A;  4E0I A;  2R7X A;  3AQC A;  4CJO A;  2LK4 A;  1WGW A;  3IQC A;  1ZW2 A;  5T3T A;  1T6U A;  3N2Z B;  3K7D A;  4MVS A;  1YZC A;  1M2V B;  3AG4 C;  3PMR A;  4XPW A;  3E70 C;  1FAP B;  1LS4 A;  2G3V A;  3QW1 A;  1ZHY A;  3C7J A;  3POV A;  3A11 A;  3FDQ A;  1V74 B;  2VAS A;  2ZPA A;  3DXJ F;  2J9U A;  3K1H A;  4IAR A;  4O79 A;  3TOL A;  1L3P A;  1FNT c;  4PK4 A;  4CS8 C;  2HSB A;  2LFD A;  2YLI A;  1WN0 A;  2UUI A;  3JRT A;  4XEK A;  1BBH A;  2IYL D;  2NSF A;  4ZLC A;  4OD5 A;  4U5H A;  4BPM A;  2XLH A;  1RKE B;  2J9V A;  1JR8 A;  2NUP A;  2UUH A;  3MYF A;  1CPQ A;  3F46 A;  4HEA J;  1ZZP A;  3HNL A;  2GFH A;  3TK0 A;  1QQ3 A;  1F1M A;  3ITF A;  4AK9 A;  4EBB A;  2P61 A;  4G7Z F;  2JD3 A;  3JSE O;  4U5E E;  4YN0 B;  3ABK C;  3FAP B;  1JPJ A;  2R25 A;  2ZXR A;  1VLS A;  3JYY A;  4G78 A;  4K7B A;  4W8K A;  1JPN A;  2A0B A;  2KC3 A;  2L6F A;  4AE4 B;  2H8A A;  1YYX A;  3DAG A;  3KL4 A;  2NPU A;  3Q6N A;  4BEM J;  5KYY B;  4CSA A;  5F5F A;  4YL3 A;  1FFT C;  4JKV A;  2J0X A;  4E17 A;  3L0I A;  2OOC A;  4N4W A;  1YDI A;  2W45 A;  3A9C A;  3EQL F;  1K40 A;  2XM4 A;  1BZ4 A;  3I4U A;  2GDC A;  3GM2 A;  1QPU A;  2YQY A;  3UMH A;  3HTK C;  3U0C A;  2P1A A;  3IQT A;  4JC7 A;  5D92 A;  1OKK D;  5JSL A;  5KYX B;  2I8B A;  4BJT A;  1Q0F A;  5DQZ A;  4C7O B;  4P9F A;  4WGZ A;  2WVO A;  1OQC A;  5AGF A;  2A6E F;  4H54 A;  2G3K A;  3T9O A;  4ZLD A;  3RKO F;  4AL1 A;  3EG9 B;  4PJL A;  4RBN A;  1A0B A;  1T6Q A;  1H9G A;  1XWJ A;  3NMJ A;  2XLO A;  3LES A;  4Q4Z F;  1L7C A;  4C3E A;  1IZM A;  1FMV A;  1Z3I X;  2QE9 A;  2XLW A;  3JSZ A;  3RQG A;  2MHR A;  2NG1 A;  4DRH B;  3O55 A;  1Z7Q c;  4E7S A;  3JRM O;  3ABM C;  1SYQ A;  5COG A;  2Q9B A;  3AJM A;  4HFF B;  4XEF A;  1J8M F;  1OR3 A;  1ORJ A;  2Q3T A;  2MWQ A;  2QY9 A;  3K1I A;  2P6V A;  3M15 A;  4J32 B;  1U89 A;  1TWA A;  4KC9 A;  4IB4 A;  1GQA A;  2HZ8 A;  3V5Y A;  3ZWI A;  4QI2 A;  2A0U A;  3LLI A;  1I4Y A;  3AG3 C;  3I5Q A;  2W4M A;  4YT8 A;  5A6J A;  5JS5 A;  2XXA B;  2A1D D;  1PD1 A;  1Q0G A;  1IW7 F;  2J46 A;  1DOV A;  1O5H A;  2NUT A;  1LIH A;  1MMD A;  3AGU A;  4PJM A;  4A4A A;  1LE4 A;  4P6I C;  4LDQ A;  2BE5 F;  2R7T A;  3AOU A;  4BJ6 C;  4C3D A;  4XEV A;  1TFO B;  2NSG A;  4YWQ A;  2KNH A;  1ZHW A;  4I44 A;  5E3C A;  4CIP A;  2R7U A;  1D1C A;  3KH2 A;  4KNW A;  3SXK A;  2JPU A;  3QMK A;  3H2U A;  3EGX A;  2H7O A; 
#chains in the Genus database with same CATH homology
 2XL6 A;  1E85 A;  2XL8 A;  4JE9 A;  4CX9 A;  5JUA A;  3HNI A;  2YL3 A;  4D4X A;  3ZTZ A;  3NMI A;  4EIY A;  1CGN A;  4JEB A;  2YL1 A;  2J8W A;  3ZQV A;  1M6T A;  3QVZ A;  2XLE A;  3L1M A;  1EKY A;  2XLD A;  3QVY A;  5JLI A;  2YL7 A;  4U9E A;  3C63 A;  4CJO A;  4U9D A;  4WGY A;  1YZC A;  2XM0 A;  3QW1 A;  3IQ6 A;  1CPR A;  4IAR A;  3TOL A;  1CGO A;  3C62 A;  2YLI A;  3TOM A;  1BBH A;  3M4B A;  3VRC A;  2XLH A;  4N6H A;  1CPQ A;  3HNL A;  2XLV A;  3FOP A;  1QQ3 A;  4ULV A;  3HNK A;  4CJG A;  5B3I A;  2CCY A;  1RCP A;  2YLD A;  3M79 A;  5JP7 A;  1YYX A;  4JKV A;  3HNJ A;  4N4W A;  1A7V A;  2XM4 A;  1QPU A;  1E86 A;  5JT4 A;  3DE9 A;  5JSL A;  4WGZ A;  2YLG A;  5AGF A;  4CDA A;  1YYJ A;  3ZQY A;  3ZTM A;  1E83 A;  4IAQ A;  2YKZ A;  256B A;  3M4C A;  3NMJ A;  1S05 A;  2XLO A;  5JVE A;  2YL0 A;  3FOO A;  2XLW A;  3QW0 A;  3NMK A;  4ER9 A;  3M15 A;  2QLA A;  4D4N A;  4IB4 A;  4JEA A;  1GQA A;  4L6R A;  3ZWI A;  5JRA A;  1JAF A;  4NC3 A;  2BC5 A;  5JS5 A;  1NBB A;  1YZA A;  3DE8 A;  4CDY A;  1LM3 B;  4CDV A;  1MQV A;  4CIP A;  1E84 A;  2XLM A;  3U8P A;  3IQ5 A;  2J9B A;  1APC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...