1A7VA

Cytochrome c' from rhodopseudomonas palustris
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
125
structure length
125
Chain Sequence
b'QTDVIAQRKAILKQMGEATKPIAAMLKGEAKFDQAVVQKSLAAIADDSKKLPALFPADSKTGGDTAALPKIWEDKAKFDDLFAKLAAAATAAQGTIKDEASLKANIGGVLGNCKSCHDDFRAKKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
molecule tags Electron transport
publication title Basis for monomer stabilization in Rhodopseudomonas palustris cytochrome c' derived from the crystal structure.
pubmed doi rcsb
total genus 46
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1a7vA00
4N4WA 2J9BA 2YLDA 3ZTZA 3ZQVA 4ER9A 4CJOA 1MQVA 4U9DA 1QQ3A 3U8PA 2YL7A 3C62A 3VRCA 5JRAA 2XM0A 2XLWA 3TOMA 4NC3A 4CJGA 4JKVA 1YZAA 3NMKA 3TOLA 1M6TA 2CCYA 3DE9A 2YL3A 4D4XA 5JSLA 3HNKA 1E83A 1CPQA 4WGZA 5AGFA 2XLDA 2BC5A 3DE8A 1NBBA 1E84A 5JT4A 3IQ5A 1E85A 1QPUA 3C63A 3HNIA 1YZCA 3NMIA 2XL8A 1CPRA 1YYXA 4CIPA 4CDVA 1CGNA 2XM4A 4CDYA 3FOPA 5JVEA 2XLMA 3L1MA 4IB4A 3M15A 3ZWIA 4IAQA 5JP7A 4N6HA 4EIYA 4IARA 2YKZA 4U9EA 1YYJA 1E86A 5JUAA 4JEBA 2XLEA 4ULVA 2YL1A 3QVZA 2J8WA 1BBHA 3HNJA 3FOOA 3QW1A 1JAFA 2XLVA 2YLGA 1APCA 3M79A 1CGOA 4L6RA 1RCPA 3QW0A 1A7VA 3M4CA 3M4BA 5JS5A 5B3IA 2XLHA 3NMJA 2YL0A 3IQ6A 4CDAA 5JLIA 3HNLA 256BA 4JE9A 2XLOA 1EKYA 1GQAA 4JEAA 4CX9A 1LM3B 3ZQYA 4D4NA 2XL6A 2YLIA 3QVYA 3ZTMA 1S05A 2QLAA 4WGYA
chains in the Genus database with same CATH superfamily
1Z23A 1OCCC 2J9BA 3ZTZA 4ER9A 4FESA 2A6HF 2EPLX 2LSEA 3K6BA 1TR2A 1MQVA 2NUTB 3HKKA 4MW8A 4NY3A 4EKWA 3GODA 4U9DA 3VYWA 2R7SA 4Q5SF 3U8PA 1JRAA 3L8JA 3Q7GA 2DB4A 3K1HA 1OQCA 4MVOA 2KC3A 5B1BC 2J0WA 2HV6A 2L9JA 2QUPA 2Y39A 2KJGA 2J9WA 3LESA 3LJBA 1J8MF 3LNRA 3DAGA 3TOMA 2ASRA 4BJTA 5E2QA 2F22A 2HV7A 2KYHA 4FAPB 2L6FA 3NMKA 2LCHA 1VTMP 5L0DA 3I5PA 5K0IA 2VH3A 4YN0B 1TFOB 1HW2A 1NG1A 3AJMA 5L0FA 1D1BA 3I5QA 4NQFA 3EGXB 4JJFA 1ZHYA 3LEOA 4JC7A 2R7RA 1R4TA 3N24A 4JW1A 3T6JA 3TQOA 3DWWA 4EUKB 4XQ1A 2NUTA 5DS4A 1CPQA 3EQLF 4WGZA 4XLPF 4KI2A 2LQGA 2HZ8A 3AOUA 4DRHB 2A0UA 1QKRA 1NSGB 2NUPB 2R05A 2KNHA 2UUHA 2VC9A 2J46A 1NFOA 4C7OA 1E85A 5T1DB 2V3CC 1R5ID 3AG4C 3EZIA 1V4AA 1E2XA 4H54A 1YZCA 2VASA 3NMIA 1AUEA 1TWAA 1F1MA 3TJ6A 4JTDB 1YYXA 2DI3A 2PX3A 3KPHA 4PJLA 1ZVZA 1WGWA 4YT5A 2JPUA 2Q3TA 2LK4A 4O79A 4DRIB 3DM9B 5JVEA 1BR2A 3HLZA 3L1MA 1OKKA 3M15A 3MLGA 3ZWIA 1TWCA 3O10A 1WASA 2V26A 4P9FA 1OW6A 3TD7A 3VAYA 3EG9B 4MTFA 4G7ZF 4ZLDA 3LS0A 4UDVA 1G8XA 3ABMC 3O55A 4IARA 2NSFA 4EIYA 4U5FE 1LI5A 3PCVA 1WATA 1V55C 1YYJA 4OD5A 2C03A 4EBJA 2KSFA 3EZHA 4C7OB 3ITFA 1HMDA 2ZXWC 3DKAA 4ULVA 1SR2A 4YL1A 3KYIA 2HS5A 2R03A 5A6KA 3LS1A 2KK1A 1BBHA 3HNJA 3V5YA 1ZZPA 1BDJB 2J9UA 4B6IA 5IY5C 5KYUB 4GEHA 1Q0MA 2DYRC 1GGQA 5CIVA 5F28E 1JAFA 2YLGA 3DJNB 3GEEA 4IGGA 2IXNA 3OEOA 5E3CA 3UGOA 3JRMO 3EJNA 1RXQA 2XSEA 1LE2A 2RSEB 1JPNA 3JCUQ 2R7WA 4RD9A 5L0HA 1M2OA 2HKVA 1G4US 4MVRA 3NDBB 1A7VA 4JTCB 3ZVRA 3EH2A 3RQFA 1YJGA 2EIKC 2NSGA 3RW0A 5D92A 2LFDA 1JPJA 4PK4A 4LERA 3E9VA 5FZTA 2ZXRA 3ZG1A 3VM6A 4CDAA 2HJMA 3S28A 4U5GA 3CEXA 2YQYA 4LDKA 2A0BA 2WVOA 4CS9A 4A2NB 1RMVA 1YA9A 3C8ZA 4JURI 4JEAA 2BE5F 5COFA 3C7JA 5HSWA 4CX9A 1RJ9A 2GAQA 3C8GA 2X0CA 3S9OA 1CGME 1H9GA 3AQCA 2P1AA 3H2UA 3T6BA 1LM3B 3FVYA 5BQIA 3QVYA 1D1AA 1FAPB 5DQZA 1TWHA 2TMVP 1QSPA 2O9XA 3B9QA 4ULWA 4DXWA 3NKEA 4YL0A 5KYNA 1S05A 2NG1A 2CGEA 2WB7A 3B29A 2LFFA 4N4WA 3SEOA 1Z6AA 3ZQVA 5FCLA 4CJOA 4MQ9F 1K05A 3IQCA 1Q0FA 4MTGA 3SYNA 4CS7A 3DJUB 1LE4A 5CI9A 5L0GA 1T6QA 2ZPAA 3V7OA 1ORYA 2CNWD 1FMWA 2LP4A 3G50A 3IHUA 2FFHA 3W2WA 1Z63A 3NKDA 1OXKA 2GFHA 4JZAA 1A41A 3ZDLA 4OIOF 3DXJF 4QI2A 2JD3A 4PFOA 2E87A 4JCHA 1WWPA 4BJ6C 1IW7F 1YZAA 3T6GB 2PNOA 3U2MA 4I1MA 2CCYA 1WN0A 4EWCA 2YL3A 5EGYA 3SXYA 2H7VC 2W4MA 3F46A 4Z9JA 1LIHA 1WOLA 3LLKA 2NUPA 3G4ZA 4NTAA 4G7HF 5BQHA 3HNKA 4W8KA 3UNGC 3UGPA 4PR9A 4F4BA 5L3VA 5AC4A 4OIQF 2LIGA 4JTAB 2PX0A 3Q6MA 1TFKB 2BC5A 3WG7C 1NBBA 1ZYRF 3LEVA 1E84A 4CSAA 3KL4A 1W2WA 2Y69C 1U6HA 3B0PA 3C63A 3HNIA 1ORSC 1RKEA 4AK9A 3I4UA 1LI7A 2I15A 2HMQA 2IYLD 2M64A 2W45A 4XPYA 1OR3A 4KC9A 5L0IA 1CPRA 1OCZC 4YJWA 4P6IC 3WHNA 4CIPA 4J7YA 5KYYB 3NRHA 1CGNA 1L3PA 1I4ZA 4CDYA 4CSAC 2L6HA 4YK5A 2PP4A 3BRJA 3FAJA 2Q9AA 3GWNA 1N1CA 2XLMA 4XEFA 2AVKA 3EGDB 2OKUA 2P61A 3JSZA 4IB4A 4ONSA 4IAQA 5JP7A 3T4RA 2CYDA 3GEHA 4LDRA 5KYUA 1M57C 1HE9A 2RD9A 4JJGA 1RKCA 3J06A 2DYSC 3SXKA 4U9EA 1E86A 1MNEA 5JUAA 3X2QC 4K1OA 5A6BD 1LPEA 1PV3A 3QTHA 1ZHWA 3QVZA 2Z15A 2CDQA 4XEVA 1OKKD 1PCXA 3GWLA 5DS6A 1NZEA 1BR4A 4RBNA 2HSQA 1OR2A 1V54C 3FHDA 3KKBA 2EIJC 1ZHZA 2ETSA 2MYSA 3Q7LA 3F47A 5COMA 2AP3A 4QI0A 4EBBA 1FTSA 3M79A 5KYWA 1TKNA 3K33A 3X1OA 3IEEA 3W8HA 1CGOA 2WVNA 2VB6A 2IXPA 2WVQA 1O5HA 5JS5A 2R7XA 4NCQA 4IRUA 2H8AA 5BQGA 5B3IA 2IBFA 3Q6NA 2IXMA 1Q0GA 2XLHA 4J7TA 1HW1A 3S90A 1WTYA 3O6XA 4GYTA 2CW0F 4MW3A 4YT2A 1VOMA 2Y3BA 4DVZA 3EFOB 4I3MA 1LS1A 4YL3A 2FGYA 2C04A 3H2VA 3OA1A 4CS8A 3FDQA 4XPWA 1EKYA 4O6MA 1GQAA 4CS9C 4H4KC 4LDQA 2HSBA 3RF3A 4P9TA 1TQGA 1GS9A 2EINC 4AE4A 4BJ1A 3RH3A 2YZSA 2EPMX 2A6EF 5EK0A 1Z7Qc 2LD6A 2XL6A 3ZSUA 3ZTMA 2YRFA 3AG1C 1OW8A 3KH2A 4AL1A 3POVA 4HFFB 4OIPF 2QLAA 4MVQA 2G62A 1SMYF 2A68F 3ASOC 4GQHA 2XXAB 2R9RB 3PMRA 4CIHA 4IAOA 4KNWA 3UMKA 2J9VA 2Y3HA 4OINF 1H7IA 1T6IA 3EH1A 2EIMC 1ZHXA 2YL7A 3LAYA 3T9OA 4E7ZA 1Q0DA 2OU6A 1RJ9B 2P0NA 3C8GB 5JRAA 1H9TA 4CBEA 1K40A 5KYXA 1V74B 4G78A 4O6NA 4IWBA 3DMDA 4PACA 4U5BE 4XWJA 1JOGA 4YT8A 4Q4ZF 2G3VA 3H65A 4J32B 4JKVA 4AE4B 1MNDA 1ZU5A 4C3EA 4CJGA 2J45A 4N06A 3TOLA 1QLEC 3RVYA 3U0CA 1YLMA 4XPXA 2BL2A 4D4XA 2DGJA 1A7EA 3TK0A 4BG0A 4Z9IA 4K7BA 3JSEO 3BEHA 5COGA 2XL4A 1FR0A 2AWCA 3NYJA 2EILC 4DOZA 1E83A 3UMIA 5DS5A 4YWQA 4EHPA 3C18A 2B0JA 4MS2A 1M2VB 2UUIA 3C8GD 3LLIA 3UMHA 4AL0A 5JT4A 4U5CE 4Z9HA 3EHMA 4G7OF 3GM1A 3IQ5A 3U2LA 2QTVA 3QZCA 5KYYA 1QPUA 3RIPA 3DM5A 2OEXA 3PHF2 3CZ6A 1PD0A 3KMIA 3MYFA 3ATPA 3EPVA 4YT4A 2R7QA 1XZPA 5E3AA 1FFHA 1Z3IX 4RDAA 4CDVA 4A4AA 3B0VC 2KGOA 4O6YA 3E70C 1U89A 3LNMB 1PD1A 3S29A 2D5RB 2QY9A 4DRJB 1AEPA 1YDIA 1KU2A 2R7OA 3NG1A 3ZIBA 5L0JA 2WL8A 3GM3A 2A69F 5DQTA 5EHHA 1GM5A 3FAPB 2IXOA 1LVKA 3AGUA 4MVUA 2Q9CA 2YHSA 4WJ0A 5TJ5E 1ZHTA 1OW7A 1LKXA 4I44A 4U5HA 4QDLA 5A69A 1Z5ZA 4LACB 4JCZA 2R25A 3LUTB 3RYLA 3L8IA 2ICWG 5AC5A 1KTMA 1L7CA 2J8WA 3CAXA 2GA0A 2EPNA 5KYWB 3U5SA 1NU9C 1Y6DA 3FOOA 2HUJA 2CNWA 2YEVA 4I1OB 4MVMA 2QE9A 1G5ZA 1APCA 4XLNF 5A6JA 5F5FA 4KNVA 4XEKA 1BZ4A 3U8VA 1HY5A 3SNHA 1ST6A 3EFOA 1EI7A 1T01A 1VMAA 4MVZA 3B71A 1NFNA 3W8IA 1DOWA 1RCPA 3QW0A 3M4CA 1HMOA 3FMSA 2OQMA 4E0HA 3AG2C 1YARO 3NYLA 3A9CA 4MNDA 3NMJA 3U3BA 2YL0A 3A11A 1G4WR 3JYHA 3GM2A 4PFPA 3HNLA 2P7VA 3EHNA 2X51A 4PJJA 2YVKA 256BA 3ZC4A 2KQ9A 3K1IC 3RFYA 2Q7RA 3W4YA 2G3KA 1MMAA 2HMZA 4HE8D 1MMNA 1YVIA 4JE9A 1U0BB 4AX2A 2OJQA 4JVSA 2IM8A 1Q0KA 3R7CA 3V5XA 2XXAA 1EQ1A 3UR3C 3R2PA 3ZQYA 2I8BA 2HJ3A 4D4NA 2YLIA 2AU5A 3EGXA 1VB5A 2A1DD 1EA8A 1I5NA 1A0BA 2J7PA 3VF0A 3MFNA 2IOQA 4BJ5A 4WABA 1D0YA 3NYMA 4NTFA 5T3WA 2YLDA 2XRHA 5D91A 2J7PD 3U3FA 4E17A 1VYKA 3JTLO 4R32A 4KBLA 2H7OA 5B1AC 5KYXB 3IPMO 2GWWA 3WODF 1QQ3A 1D1CA 2MWQA 4M63A 4CS8C 3C62A 3VRCA 3U9MA 4OD4A 1QVXA 1JR8A 4HEAJ 1ZU4A 2XM0A 1C03A 2XLWA 1M56C 1T6UA 1KNYA 1OCOC 1JMWA 1ZW2A 2W9YA 2Y3DA 4NC3A 5DVWA 1SYQA 1T9KA 3FXHA 5L3QA 3RVZA 3K66A 3S27A 4K0DA 2XS8A 1K04A 1M6TA 2FAPB 2Q00A 3US6A 1MMDA 3W2VA 2WZGA 2PFDA 2WZFA 1UG7A 3DE9A 3MX3A 5JSLA 1AVOB 5A6AA 1FNTc 2D4UA 2OEVA 1C17M 3MYIA 5T3TA 3WAQA 4DBRA 4IJJA 1S7ZA 1NU7D 4E0IA 3DAFA 2GDCA 4EBKA 3DZAA 4DVYP 4BEJA 5AGFA 2PF4E 2XLDA 3DE8A 2QNLA 2AWYA 4E7SA 3SZRA 3RQGA 3RKOF 3B0UX 2W4BA 3JRTA 1HE1A 2L81A 4W8PA 4BPMA 5HV9A 3N0TA 2OOCA 1D0ZA 5A6BA 1TWGA 2WZLA 3L0IA 1A7DA 2EPOA 2XL8A 4J30B 4MTOA 3GORA 1B68A 2JX0A 3ECSA 3KYJA 3V5ZA 4BEMJ 5L0CA 4BJ6A 1XZQA 1OXBA 4MVSA 3SP1A 2R7UA 5GPGB 1FFTC 2XM4A 4DJ9A 3FOPA 3OWTA 3CQZA 2EPKX 3AG3C 2L7AA 3ABLC 1O3UA 4HFKB 3QMKA 3SXMA 2H7BA 1VLTA 4E18A 3GANA 3K7DA 3DD7A 2R7VA 4OIRF 1ORJA 3GEIA 2OJED 1YAUO 4N6HA 4PJNA 5CI8A 3U9JA 5B3SC 1NLXA 3K1IA 2HFIA 2YKZA 2VCCA 2P6VA 2J0XA 3HTKC 3TULA 4BJ5C 4JEBA 1O87A 2XLEA 1XWJA 2MHRA 2YL1A 3HJCA 4Q7CA 2Q4FA 5F5HA 2B0HA 3N2ZB 4NTBA 1YA7O 1VLSA 2OG2A 3QW1A 4FX5A 4LLCA 1VYIA 2XLVA 4U5DE 5E33A 3IQTA 3S0XA 4C3DA 4O7GA 2OCCC 3SXZA 1SF8A 2KW3C 1OCRC 1UFBA 3G4XA 3DI5A 1MMGA 3RQEA 3ASNC 2R02A 3L34A 4L6RA 2M4EA 3M4BA 4JIOA 2ZXOA 1SZIA 2VCAA 2PBEA 4LLEA 4N6CA 2R7TA 2L6GA 2Q9BA 3JT1A 1RKEB 1J8YF 1DOVA 1FMVA 2ZD9A 4DBQA 5BUOA 2Y3GA 1VK5A 3IQ6A 5JLIA 3JZ0A 3JYYA 3S84A 2ZXPA 4ANJA 4C3BA 3CSKA 5DLJA 3M1CB 3ABKC 1C02A 4G0HA 1M2VA 4PJMA 2YWAA 2XLOA 4FWVA 4JRZA 1H6GA 1BR1A 4ZLCA 1D0XA 2NPUA 3EG9A 2XS1A 1ZW3A 1IZMA 3EGDA 3MBGA 2VCBA 4X0RA 1LS4A 4XTKA 1QZXA 3PDMP 3AQBA 3O39A 1Y4CA 4U5EE 1I4YA 3AGTA 3TJ5A 1T5OA 4WGYA
chains in the Genus database with same CATH topology
4N4WA 2J9BA 2YLDA 3ZTZA 3ZQVA 4ER9A 4CJOA 1MQVA 4U9DA 1QQ3A 3U8PA 2YL7A 3C62A 3VRCA 5JRAA 2XM0A 2XLWA 3TOMA 4NC3A 4CJGA 4JKVA 1YZAA 3NMKA 3TOLA 1M6TA 2CCYA 3DE9A 2YL3A 4D4XA 5JSLA 3HNKA 1E83A 1CPQA 4WGZA 5AGFA 2XLDA 2BC5A 3DE8A 1NBBA 1E84A 5JT4A 3IQ5A 1E85A 1QPUA 3C63A 3HNIA 1YZCA 3NMIA 2XL8A 1CPRA 1YYXA 4CIPA 4CDVA 1CGNA 2XM4A 4CDYA 3FOPA 5JVEA 2XLMA 3L1MA 4IB4A 3M15A 3ZWIA 4IAQA 5JP7A 4N6HA 4EIYA 4IARA 2YKZA 4U9EA 1YYJA 1E86A 5JUAA 4JEBA 2XLEA 4ULVA 2YL1A 3QVZA 2J8WA 1BBHA 3HNJA 3FOOA 3QW1A 1JAFA 2XLVA 2YLGA 1APCA 3M79A 1CGOA 4L6RA 1RCPA 3QW0A 1A7VA 3M4CA 3M4BA 5JS5A 5B3IA 2XLHA 3NMJA 2YL0A 3IQ6A 4CDAA 5JLIA 3HNLA 256BA 4JE9A 2XLOA 1EKYA 1GQAA 4JEAA 4CX9A 1LM3B 3ZQYA 4D4NA 2XL6A 2YLIA 3QVYA 3ZTMA 1S05A 2QLAA 4WGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4W A;  2J9B A;  2YLD A;  3ZTZ A;  3ZQV A;  4ER9 A;  4CJO A;  1MQV A;  4U9D A;  1QQ3 A;  3U8P A;  2YL7 A;  3C62 A;  3VRC A;  5JRA A;  2XM0 A;  2XLW A;  3TOM A;  4NC3 A;  4CJG A;  4JKV A;  1YZA A;  3NMK A;  3TOL A;  1M6T A;  2CCY A;  3DE9 A;  2YL3 A;  4D4X A;  5JSL A;  3HNK A;  1E83 A;  1CPQ A;  4WGZ A;  5AGF A;  2XLD A;  2BC5 A;  3DE8 A;  1NBB A;  1E84 A;  5JT4 A;  3IQ5 A;  1E85 A;  1QPU A;  3C63 A;  3HNI A;  1YZC A;  3NMI A;  2XL8 A;  1CPR A;  1YYX A;  4CIP A;  4CDV A;  1CGN A;  2XM4 A;  4CDY A;  3FOP A;  5JVE A;  2XLM A;  3L1M A;  4IB4 A;  3M15 A;  3ZWI A;  4IAQ A;  5JP7 A;  4N6H A;  4EIY A;  4IAR A;  2YKZ A;  4U9E A;  1YYJ A;  1E86 A;  5JUA A;  4JEB A;  2XLE A;  4ULV A;  2YL1 A;  3QVZ A;  2J8W A;  1BBH A;  3HNJ A;  3FOO A;  3QW1 A;  1JAF A;  2XLV A;  2YLG A;  1APC A;  3M79 A;  1CGO A;  4L6R A;  1RCP A;  3QW0 A;  1A7V A;  3M4C A;  3M4B A;  5JS5 A;  5B3I A;  2XLH A;  3NMJ A;  2YL0 A;  3IQ6 A;  4CDA A;  5JLI A;  3HNL A;  256B A;  4JE9 A;  2XLO A;  1EKY A;  1GQA A;  4JEA A;  4CX9 A;  1LM3 B;  3ZQY A;  4D4N A;  2XL6 A;  2YLI A;  3QVY A;  3ZTM A;  1S05 A;  2QLA A;  4WGY A; 
#chains in the Genus database with same CATH topology
 1Z23 A;  1OCC C;  2J9B A;  3ZTZ A;  4ER9 A;  4FES A;  2A6H F;  2EPL X;  2LSE A;  3K6B A;  1TR2 A;  1MQV A;  2NUT B;  3HKK A;  4MW8 A;  4NY3 A;  4EKW A;  3GOD A;  4U9D A;  3VYW A;  2R7S A;  4Q5S F;  3U8P A;  1JRA A;  3L8J A;  3Q7G A;  2DB4 A;  3K1H A;  1OQC A;  4MVO A;  2KC3 A;  5B1B C;  2J0W A;  2HV6 A;  2L9J A;  2QUP A;  2Y39 A;  2KJG A;  2J9W A;  3LES A;  3LJB A;  1J8M F;  3LNR A;  3DAG A;  3TOM A;  2ASR A;  4BJT A;  5E2Q A;  2F22 A;  2HV7 A;  2KYH A;  4FAP B;  2L6F A;  3NMK A;  2LCH A;  1VTM P;  5L0D A;  3I5P A;  5K0I A;  2VH3 A;  4YN0 B;  1TFO B;  1HW2 A;  1NG1 A;  3AJM A;  5L0F A;  1D1B A;  3I5Q A;  4NQF A;  3EGX B;  4JJF A;  1ZHY A;  3LEO A;  4JC7 A;  2R7R A;  1R4T A;  3N24 A;  4JW1 A;  3T6J A;  3TQO A;  3DWW A;  4EUK B;  4XQ1 A;  2NUT A;  5DS4 A;  1CPQ A;  3EQL F;  4WGZ A;  4XLP F;  4KI2 A;  2LQG A;  2HZ8 A;  3AOU A;  4DRH B;  2A0U A;  1QKR A;  1NSG B;  2NUP B;  2R05 A;  2KNH A;  2UUH A;  2VC9 A;  2J46 A;  1NFO A;  4C7O A;  1E85 A;  5T1D B;  2V3C C;  1R5I D;  3AG4 C;  3EZI A;  1V4A A;  1E2X A;  4H54 A;  1YZC A;  2VAS A;  3NMI A;  1AUE A;  1TWA A;  1F1M A;  3TJ6 A;  4JTD B;  1YYX A;  2DI3 A;  2PX3 A;  3KPH A;  4PJL A;  1ZVZ A;  1WGW A;  4YT5 A;  2JPU A;  2Q3T A;  2LK4 A;  4O79 A;  4DRI B;  3DM9 B;  5JVE A;  1BR2 A;  3HLZ A;  3L1M A;  1OKK A;  3M15 A;  3MLG A;  3ZWI A;  1TWC A;  3O10 A;  1WAS A;  2V26 A;  4P9F A;  1OW6 A;  3TD7 A;  3VAY A;  3EG9 B;  4MTF A;  4G7Z F;  4ZLD A;  3LS0 A;  4UDV A;  1G8X A;  3ABM C;  3O55 A;  4IAR A;  2NSF A;  4EIY A;  4U5F E;  1LI5 A;  3PCV A;  1WAT A;  1V55 C;  1YYJ A;  4OD5 A;  2C03 A;  4EBJ A;  2KSF A;  3EZH A;  4C7O B;  3ITF A;  1HMD A;  2ZXW C;  3DKA A;  4ULV A;  1SR2 A;  4YL1 A;  3KYI A;  2HS5 A;  2R03 A;  5A6K A;  3LS1 A;  2KK1 A;  1BBH A;  3HNJ A;  3V5Y A;  1ZZP A;  1BDJ B;  2J9U A;  4B6I A;  5IY5 C;  5KYU B;  4GEH A;  1Q0M A;  2DYR C;  1GGQ A;  5CIV A;  5F28 E;  1JAF A;  2YLG A;  3DJN B;  3GEE A;  4IGG A;  2IXN A;  3OEO A;  5E3C A;  3UGO A;  3JRM O;  3EJN A;  1RXQ A;  2XSE A;  1LE2 A;  2RSE B;  1JPN A;  3JCU Q;  2R7W A;  4RD9 A;  5L0H A;  1M2O A;  2HKV A;  1G4U S;  4MVR A;  3NDB B;  1A7V A;  4JTC B;  3ZVR A;  3EH2 A;  3RQF A;  1YJG A;  2EIK C;  2NSG A;  3RW0 A;  5D92 A;  2LFD A;  1JPJ A;  4PK4 A;  4LER A;  3E9V A;  5FZT A;  2ZXR A;  3ZG1 A;  3VM6 A;  4CDA A;  2HJM A;  3S28 A;  4U5G A;  3CEX A;  2YQY A;  4LDK A;  2A0B A;  2WVO A;  4CS9 A;  4A2N B;  1RMV A;  1YA9 A;  3C8Z A;  4JUR I;  4JEA A;  2BE5 F;  5COF A;  3C7J A;  5HSW A;  4CX9 A;  1RJ9 A;  2GAQ A;  3C8G A;  2X0C A;  3S9O A;  1CGM E;  1H9G A;  3AQC A;  2P1A A;  3H2U A;  3T6B A;  1LM3 B;  3FVY A;  5BQI A;  3QVY A;  1D1A A;  1FAP B;  5DQZ A;  1TWH A;  2TMV P;  1QSP A;  2O9X A;  3B9Q A;  4ULW A;  4DXW A;  3NKE A;  4YL0 A;  5KYN A;  1S05 A;  2NG1 A;  2CGE A;  2WB7 A;  3B29 A;  2LFF A;  4N4W A;  3SEO A;  1Z6A A;  3ZQV A;  5FCL A;  4CJO A;  4MQ9 F;  1K05 A;  3IQC A;  1Q0F A;  4MTG A;  3SYN A;  4CS7 A;  3DJU B;  1LE4 A;  5CI9 A;  5L0G A;  1T6Q A;  2ZPA A;  3V7O A;  1ORY A;  2CNW D;  1FMW A;  2LP4 A;  3G50 A;  3IHU A;  2FFH A;  3W2W A;  1Z63 A;  3NKD A;  1OXK A;  2GFH A;  4JZA A;  1A41 A;  3ZDL A;  4OIO F;  3DXJ F;  4QI2 A;  2JD3 A;  4PFO A;  2E87 A;  4JCH A;  1WWP A;  4BJ6 C;  1IW7 F;  1YZA A;  3T6G B;  2PNO A;  3U2M A;  4I1M A;  2CCY A;  1WN0 A;  4EWC A;  2YL3 A;  5EGY A;  3SXY A;  2H7V C;  2W4M A;  3F46 A;  4Z9J A;  1LIH A;  1WOL A;  3LLK A;  2NUP A;  3G4Z A;  4NTA A;  4G7H F;  5BQH A;  3HNK A;  4W8K A;  3UNG C;  3UGP A;  4PR9 A;  4F4B A;  5L3V A;  5AC4 A;  4OIQ F;  2LIG A;  4JTA B;  2PX0 A;  3Q6M A;  1TFK B;  2BC5 A;  3WG7 C;  1NBB A;  1ZYR F;  3LEV A;  1E84 A;  4CSA A;  3KL4 A;  1W2W A;  2Y69 C;  1U6H A;  3B0P A;  3C63 A;  3HNI A;  1ORS C;  1RKE A;  4AK9 A;  3I4U A;  1LI7 A;  2I15 A;  2HMQ A;  2IYL D;  2M64 A;  2W45 A;  4XPY A;  1OR3 A;  4KC9 A;  5L0I A;  1CPR A;  1OCZ C;  4YJW A;  4P6I C;  3WHN A;  4CIP A;  4J7Y A;  5KYY B;  3NRH A;  1CGN A;  1L3P A;  1I4Z A;  4CDY A;  4CSA C;  2L6H A;  4YK5 A;  2PP4 A;  3BRJ A;  3FAJ A;  2Q9A A;  3GWN A;  1N1C A;  2XLM A;  4XEF A;  2AVK A;  3EGD B;  2OKU A;  2P61 A;  3JSZ A;  4IB4 A;  4ONS A;  4IAQ A;  5JP7 A;  3T4R A;  2CYD A;  3GEH A;  4LDR A;  5KYU A;  1M57 C;  1HE9 A;  2RD9 A;  4JJG A;  1RKC A;  3J06 A;  2DYS C;  3SXK A;  4U9E A;  1E86 A;  1MNE A;  5JUA A;  3X2Q C;  4K1O A;  5A6B D;  1LPE A;  1PV3 A;  3QTH A;  1ZHW A;  3QVZ A;  2Z15 A;  2CDQ A;  4XEV A;  1OKK D;  1PCX A;  3GWL A;  5DS6 A;  1NZE A;  1BR4 A;  4RBN A;  2HSQ A;  1OR2 A;  1V54 C;  3FHD A;  3KKB A;  2EIJ C;  1ZHZ A;  2ETS A;  2MYS A;  3Q7L A;  3F47 A;  5COM A;  2AP3 A;  4QI0 A;  4EBB A;  1FTS A;  3M79 A;  5KYW A;  1TKN A;  3K33 A;  3X1O A;  3IEE A;  3W8H A;  1CGO A;  2WVN A;  2VB6 A;  2IXP A;  2WVQ A;  1O5H A;  5JS5 A;  2R7X A;  4NCQ A;  4IRU A;  2H8A A;  5BQG A;  5B3I A;  2IBF A;  3Q6N A;  2IXM A;  1Q0G A;  2XLH A;  4J7T A;  1HW1 A;  3S90 A;  1WTY A;  3O6X A;  4GYT A;  2CW0 F;  4MW3 A;  4YT2 A;  1VOM A;  2Y3B A;  4DVZ A;  3EFO B;  4I3M A;  1LS1 A;  4YL3 A;  2FGY A;  2C04 A;  3H2V A;  3OA1 A;  4CS8 A;  3FDQ A;  4XPW A;  1EKY A;  4O6M A;  1GQA A;  4CS9 C;  4H4K C;  4LDQ A;  2HSB A;  3RF3 A;  4P9T A;  1TQG A;  1GS9 A;  2EIN C;  4AE4 A;  4BJ1 A;  3RH3 A;  2YZS A;  2EPM X;  2A6E F;  5EK0 A;  1Z7Q c;  2LD6 A;  2XL6 A;  3ZSU A;  3ZTM A;  2YRF A;  3AG1 C;  1OW8 A;  3KH2 A;  4AL1 A;  3POV A;  4HFF B;  4OIP F;  2QLA A;  4MVQ A;  2G62 A;  1SMY F;  2A68 F;  3ASO C;  4GQH A;  2XXA B;  2R9R B;  3PMR A;  4CIH A;  4IAO A;  4KNW A;  3UMK A;  2J9V A;  2Y3H A;  4OIN F;  1H7I A;  1T6I A;  3EH1 A;  2EIM C;  1ZHX A;  2YL7 A;  3LAY A;  3T9O A;  4E7Z A;  1Q0D A;  2OU6 A;  1RJ9 B;  2P0N A;  3C8G B;  5JRA A;  1H9T A;  4CBE A;  1K40 A;  5KYX A;  1V74 B;  4G78 A;  4O6N A;  4IWB A;  3DMD A;  4PAC A;  4U5B E;  4XWJ A;  1JOG A;  4YT8 A;  4Q4Z F;  2G3V A;  3H65 A;  4J32 B;  4JKV A;  4AE4 B;  1MND A;  1ZU5 A;  4C3E A;  4CJG A;  2J45 A;  4N06 A;  3TOL A;  1QLE C;  3RVY A;  3U0C A;  1YLM A;  4XPX A;  2BL2 A;  4D4X A;  2DGJ A;  1A7E A;  3TK0 A;  4BG0 A;  4Z9I A;  4K7B A;  3JSE O;  3BEH A;  5COG A;  2XL4 A;  1FR0 A;  2AWC A;  3NYJ A;  2EIL C;  4DOZ A;  1E83 A;  3UMI A;  5DS5 A;  4YWQ A;  4EHP A;  3C18 A;  2B0J A;  4MS2 A;  1M2V B;  2UUI A;  3C8G D;  3LLI A;  3UMH A;  4AL0 A;  5JT4 A;  4U5C E;  4Z9H A;  3EHM A;  4G7O F;  3GM1 A;  3IQ5 A;  3U2L A;  2QTV A;  3QZC A;  5KYY A;  1QPU A;  3RIP A;  3DM5 A;  2OEX A;  3PHF 2;  3CZ6 A;  1PD0 A;  3KMI A;  3MYF A;  3ATP A;  3EPV A;  4YT4 A;  2R7Q A;  1XZP A;  5E3A A;  1FFH A;  1Z3I X;  4RDA A;  4CDV A;  4A4A A;  3B0V C;  2KGO A;  4O6Y A;  3E70 C;  1U89 A;  3LNM B;  1PD1 A;  3S29 A;  2D5R B;  2QY9 A;  4DRJ B;  1AEP A;  1YDI A;  1KU2 A;  2R7O A;  3NG1 A;  3ZIB A;  5L0J A;  2WL8 A;  3GM3 A;  2A69 F;  5DQT A;  5EHH A;  1GM5 A;  3FAP B;  2IXO A;  1LVK A;  3AGU A;  4MVU A;  2Q9C A;  2YHS A;  4WJ0 A;  5TJ5 E;  1ZHT A;  1OW7 A;  1LKX A;  4I44 A;  4U5H A;  4QDL A;  5A69 A;  1Z5Z A;  4LAC B;  4JCZ A;  2R25 A;  3LUT B;  3RYL A;  3L8I A;  2ICW G;  5AC5 A;  1KTM A;  1L7C A;  2J8W A;  3CAX A;  2GA0 A;  2EPN A;  5KYW B;  3U5S A;  1NU9 C;  1Y6D A;  3FOO A;  2HUJ A;  2CNW A;  2YEV A;  4I1O B;  4MVM A;  2QE9 A;  1G5Z A;  1APC A;  4XLN F;  5A6J A;  5F5F A;  4KNV A;  4XEK A;  1BZ4 A;  3U8V A;  1HY5 A;  3SNH A;  1ST6 A;  3EFO A;  1EI7 A;  1T01 A;  1VMA A;  4MVZ A;  3B71 A;  1NFN A;  3W8I A;  1DOW A;  1RCP A;  3QW0 A;  3M4C A;  1HMO A;  3FMS A;  2OQM A;  4E0H A;  3AG2 C;  1YAR O;  3NYL A;  3A9C A;  4MND A;  3NMJ A;  3U3B A;  2YL0 A;  3A11 A;  1G4W R;  3JYH A;  3GM2 A;  4PFP A;  3HNL A;  2P7V A;  3EHN A;  2X51 A;  4PJJ A;  2YVK A;  256B A;  3ZC4 A;  2KQ9 A;  3K1I C;  3RFY A;  2Q7R A;  3W4Y A;  2G3K A;  1MMA A;  2HMZ A;  4HE8 D;  1MMN A;  1YVI A;  4JE9 A;  1U0B B;  4AX2 A;  2OJQ A;  4JVS A;  2IM8 A;  1Q0K A;  3R7C A;  3V5X A;  2XXA A;  1EQ1 A;  3UR3 C;  3R2P A;  3ZQY A;  2I8B A;  2HJ3 A;  4D4N A;  2YLI A;  2AU5 A;  3EGX A;  1VB5 A;  2A1D D;  1EA8 A;  1I5N A;  1A0B A;  2J7P A;  3VF0 A;  3MFN A;  2IOQ A;  4BJ5 A;  4WAB A;  1D0Y A;  3NYM A;  4NTF A;  5T3W A;  2YLD A;  2XRH A;  5D91 A;  2J7P D;  3U3F A;  4E17 A;  1VYK A;  3JTL O;  4R32 A;  4KBL A;  2H7O A;  5B1A C;  5KYX B;  3IPM O;  2GWW A;  3WOD F;  1QQ3 A;  1D1C A;  2MWQ A;  4M63 A;  4CS8 C;  3C62 A;  3VRC A;  3U9M A;  4OD4 A;  1QVX A;  1JR8 A;  4HEA J;  1ZU4 A;  2XM0 A;  1C03 A;  2XLW A;  1M56 C;  1T6U A;  1KNY A;  1OCO C;  1JMW A;  1ZW2 A;  2W9Y A;  2Y3D A;  4NC3 A;  5DVW A;  1SYQ A;  1T9K A;  3FXH A;  5L3Q A;  3RVZ A;  3K66 A;  3S27 A;  4K0D A;  2XS8 A;  1K04 A;  1M6T A;  2FAP B;  2Q00 A;  3US6 A;  1MMD A;  3W2V A;  2WZG A;  2PFD A;  2WZF A;  1UG7 A;  3DE9 A;  3MX3 A;  5JSL A;  1AVO B;  5A6A A;  1FNT c;  2D4U A;  2OEV A;  1C17 M;  3MYI A;  5T3T A;  3WAQ A;  4DBR A;  4IJJ A;  1S7Z A;  1NU7 D;  4E0I A;  3DAF A;  2GDC A;  4EBK A;  3DZA A;  4DVY P;  4BEJ A;  5AGF A;  2PF4 E;  2XLD A;  3DE8 A;  2QNL A;  2AWY A;  4E7S A;  3SZR A;  3RQG A;  3RKO F;  3B0U X;  2W4B A;  3JRT A;  1HE1 A;  2L81 A;  4W8P A;  4BPM A;  5HV9 A;  3N0T A;  2OOC A;  1D0Z A;  5A6B A;  1TWG A;  2WZL A;  3L0I A;  1A7D A;  2EPO A;  2XL8 A;  4J30 B;  4MTO A;  3GOR A;  1B68 A;  2JX0 A;  3ECS A;  3KYJ A;  3V5Z A;  4BEM J;  5L0C A;  4BJ6 A;  1XZQ A;  1OXB A;  4MVS A;  3SP1 A;  2R7U A;  5GPG B;  1FFT C;  2XM4 A;  4DJ9 A;  3FOP A;  3OWT A;  3CQZ A;  2EPK X;  3AG3 C;  2L7A A;  3ABL C;  1O3U A;  4HFK B;  3QMK A;  3SXM A;  2H7B A;  1VLT A;  4E18 A;  3GAN A;  3K7D A;  3DD7 A;  2R7V A;  4OIR F;  1ORJ A;  3GEI A;  2OJE D;  1YAU O;  4N6H A;  4PJN A;  5CI8 A;  3U9J A;  5B3S C;  1NLX A;  3K1I A;  2HFI A;  2YKZ A;  2VCC A;  2P6V A;  2J0X A;  3HTK C;  3TUL A;  4BJ5 C;  4JEB A;  1O87 A;  2XLE A;  1XWJ A;  2MHR A;  2YL1 A;  3HJC A;  4Q7C A;  2Q4F A;  5F5H A;  2B0H A;  3N2Z B;  4NTB A;  1YA7 O;  1VLS A;  2OG2 A;  3QW1 A;  4FX5 A;  4LLC A;  1VYI A;  2XLV A;  4U5D E;  5E33 A;  3IQT A;  3S0X A;  4C3D A;  4O7G A;  2OCC C;  3SXZ A;  1SF8 A;  2KW3 C;  1OCR C;  1UFB A;  3G4X A;  3DI5 A;  1MMG A;  3RQE A;  3ASN C;  2R02 A;  3L34 A;  4L6R A;  2M4E A;  3M4B A;  4JIO A;  2ZXO A;  1SZI A;  2VCA A;  2PBE A;  4LLE A;  4N6C A;  2R7T A;  2L6G A;  2Q9B A;  3JT1 A;  1RKE B;  1J8Y F;  1DOV A;  1FMV A;  2ZD9 A;  4DBQ A;  5BUO A;  2Y3G A;  1VK5 A;  3IQ6 A;  5JLI A;  3JZ0 A;  3JYY A;  3S84 A;  2ZXP A;  4ANJ A;  4C3B A;  3CSK A;  5DLJ A;  3M1C B;  3ABK C;  1C02 A;  4G0H A;  1M2V A;  4PJM A;  2YWA A;  2XLO A;  4FWV A;  4JRZ A;  1H6G A;  1BR1 A;  4ZLC A;  1D0X A;  2NPU A;  3EG9 A;  2XS1 A;  1ZW3 A;  1IZM A;  3EGD A;  3MBG A;  2VCB A;  4X0R A;  1LS4 A;  4XTK A;  1QZX A;  3PDM P;  3AQB A;  3O39 A;  1Y4C A;  4U5E E;  1I4Y A;  3AGT A;  3TJ5 A;  1T5O A;  4WGY A; 
#chains in the Genus database with same CATH homology
 4N4W A;  2J9B A;  2YLD A;  3ZTZ A;  3ZQV A;  4ER9 A;  4CJO A;  1MQV A;  4U9D A;  1QQ3 A;  3U8P A;  2YL7 A;  3C62 A;  3VRC A;  5JRA A;  2XM0 A;  2XLW A;  3TOM A;  4NC3 A;  4CJG A;  4JKV A;  1YZA A;  3NMK A;  3TOL A;  1M6T A;  2CCY A;  3DE9 A;  2YL3 A;  4D4X A;  5JSL A;  3HNK A;  1E83 A;  1CPQ A;  4WGZ A;  5AGF A;  2XLD A;  2BC5 A;  3DE8 A;  1NBB A;  1E84 A;  5JT4 A;  3IQ5 A;  1E85 A;  1QPU A;  3C63 A;  3HNI A;  1YZC A;  3NMI A;  2XL8 A;  1CPR A;  1YYX A;  4CIP A;  4CDV A;  1CGN A;  2XM4 A;  4CDY A;  3FOP A;  5JVE A;  2XLM A;  3L1M A;  4IB4 A;  3M15 A;  3ZWI A;  4IAQ A;  5JP7 A;  4N6H A;  4EIY A;  4IAR A;  2YKZ A;  4U9E A;  1YYJ A;  1E86 A;  5JUA A;  4JEB A;  2XLE A;  4ULV A;  2YL1 A;  3QVZ A;  2J8W A;  1BBH A;  3HNJ A;  3FOO A;  3QW1 A;  1JAF A;  2XLV A;  2YLG A;  1APC A;  3M79 A;  1CGO A;  4L6R A;  1RCP A;  3QW0 A;  1A7V A;  3M4C A;  3M4B A;  5JS5 A;  5B3I A;  2XLH A;  3NMJ A;  2YL0 A;  3IQ6 A;  4CDA A;  5JLI A;  3HNL A;  256B A;  4JE9 A;  2XLO A;  1EKY A;  1GQA A;  4JEA A;  4CX9 A;  1LM3 B;  3ZQY A;  4D4N A;  2XL6 A;  2YLI A;  3QVY A;  3ZTM A;  1S05 A;  2QLA A;  4WGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...