1A7VA

Cytochrome c' from rhodopseudomonas palustris
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
125
structure length
125
Chain Sequence
QTDVIAQRKAILKQMGEATKPIAAMLKGEAKFDQAVVQKSLAAIADDSKKLPALFPADSKTGGDTAALPKIWEDKAKFDDLFAKLAAAATAAQGTIKDEASLKANIGGVLGNCKSCHDDFRAKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Basis for monomer stabilization in Rhodopseudomonas palustris cytochrome c' derived from the crystal structure.
pubmed doi rcsb
molecule tags Electron transport
total genus 46
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1a7vA00
3ZTZA 3FOOA 4EIYA 4JEAA 3L1MA 2QLAA 4L6RA 3U8PA 1YZAA 2J9BA 1YZCA 2XLWA 3FOPA 1JAFA 5JUAA 3M15A 2XL6A 5JT4A 1YYXA 3IQ6A 3VRCA 3NMIA 1E83A 1CPQA 2XLMA 1LM3B 3QVZA 2XLEA 2YLGA 2YLIA 1E84A 4ULVA 1GQAA 4CJOA 1APCA 3IQ5A 4IB4A 1CPRA 1EKYA 3QVYA 4IAQA 4WGZA 1RCPA 3DE8A 1M6TA 1CGNA 2XLHA 256BA 1QQ3A 2XM0A 4CJGA 2YL3A 2YL0A 3M4CA 4JKVA 2CCYA 4N4WA 4JE9A 2XLVA 3C62A 5JVEA 2YKZA 2J8WA 3ZTMA 3TOLA 3TOMA 5B3IA 3ZWIA 4CX9A 2YLDA 1CGOA 3DE9A 1BBHA 4ER9A 5JSLA 4IARA 1E85A 4WGYA 2XLDA 1QPUA 3NMKA 1YYJA 3M4BA 4D4NA 5AGFA 1MQVA 4D4XA 4U9EA 1A7VA 4N6HA 5JP7A 4NC3A 3NMJA 3QW1A 2YL7A 2XM4A 4CDAA 2YL1A 3ZQVA 4JEBA 2XL8A 3C63A 3ZQYA 4CDYA 3M79A 1NBBA 3HNJA 1E86A 4U9DA 3HNKA 4CDVA 5JRAA 5JS5A 3HNLA 1S05A 5JLIA 4CIPA 2BC5A 3HNIA 3QW0A 2XLOA
chains in the Genus database with same CATH superfamily
4WABA 4GYTA 1W2WA 3C8GB 2PF4E 5GPGB 3NYMA 2IOQA 3US6A 3AJMA 4O6NA 4FWVA 2GA0A 1D0XA 1SZIA 3U8PA 3X1OA 4MVOA 3WODF 4AL1A 1YZCA 3IPMO 3SYNA 3B71A 4MTOA 4QI0A 2FFHA 4AE4B 1WASA 3EFOA 1LE2A 1V54C 2A6HF 5CI9A 1J8YF 4YT5A 5L0CA 3M15A 1RMVA 2XXAA 2KYHA 3RVZA 4XPXA 4E0HA 5E3CA 1JOGA 2PBEA 4LLEA 2LSEA 1YARO 1YYXA 4CS8A 4J7TA 2MHRA 4MVSA 1V55C 3BEHA 3JSZA 4JTDB 1E83A 4O6MA 1Q0GA 2LFDA 3U9MA 3SP1A 1I4ZA 5B3SC 2OEXA 1KNYA 4MTGA 3UMHA 1APCA 2NSGA 1Z3IX 4BJ6A 5L0JA 3ZIBA 1JR8A 1D1BA 5L3VA 3EHNA 3QVYA 4IAQA 1C03A 3K7DA 2YZSA 4IJJA 4ONSA 4G7OF 3DE8A 1M2VA 1CGNA 4U5CE 3DZAA 3SXKA 256BA 2YRFA 3RKOF 3AG1C 1XWJA 1JMWA 3C8ZA 3GODA 4M63A 1LI7A 3CZ6A 3VYWA 1LI5A 1A0BA 4KNWA 2LP4A 3HJCA 4EKWA 4JE9A 2HV6A 2XLVA 5A6BA 1TFOB 5JVEA 5KYYB 2YVKA 3MBGA 5E2QA 1QZXA 3ZTMA 3U2LA 1Z7Qc 3T4RA 4XQ1A 5L0GA 3ZWIA 3DM5A 4MTFA 2R7XA 3S90A 3MLGA 4HEAJ 5A6KA 2NUTB 4U5GA 1RJ9B 1UG7A 3K6BA 5BQHA 1FTSA 2YLDA 2AVKA 2VCBA 2VC9A 3DE9A 3ZDLA 4O7GA 4XWJA 1RKCA 4O6YA 4OIOF 5COGA 3TK0A 2AU5A 2C04A 4WGYA 3Q7LA 4DXWA 1Q0FA 1Z23A 1OKKA 3DAFA 3MX3A 3U2MA 3EG9A 3OA1A 2G62A 4JCZA 2H7BA 3NMKA 3LS0A 3V5XA 1VMAA 1O3UA 2L7AA 3IEEA 3U0CA 3M4BA 1MQVA 3C18A 3EGDB 3EGXB 1A7VA 4NC3A 3I5QA 3QW1A 5EK0A 3U9JA 5F5FA 3QMKA 3JSEO 4H4KC 2ZXWC 3RYLA 2YL1A 4PFOA 3S29A 5L0DA 2EIMC 4C7OB 3L8IA 1Z5ZA 2PX0A 3ASOC 2ZXPA 3C63A 3GM1A 4I1MA 4JZAA 4PJNA 2A1DD 3ZQYA 3CAXA 2AWYA 2L6FA 1Q0KA 2B0HA 3L0IA 3TD7A 4Q7CA 4YL1A 3MYFA 4U5FE 1D0ZA 1MMGA 2OJQA 1U0BB 5B1BC 2EPKX 3L8JA 2EPNA 3EZIA 3RF3A 4J7YA 2JPUA 3CEXA 1FR0A 2VCAA 5B1AC 1E86A 4U9DA 4JURI 4PJJA 2WVQA 4IAOA 3JCUQ 2A69F 2OEVA 1J8MF 4DJ9A 2OG2A 3PDMP 1NU7D 2R02A 3EH1A 4E7ZA 3ABLC 1S05A 3B29A 4IRUA 4CS8C 3V5ZA 1EI7A 1ZU5A 2ETSA 2V26A 1Y6DA 1OXKA 2C03A 4YK5A 3R7CA 2Q9BA 2R7UA 1FFHA 3LLKA 5F5HA 1T6QA 4CIHA 2FGYA 2L6HA 3HLZA 3O6XA 4DRIB 3LEOA 2O9XA 4LDKA 4MVZA 4JEAA 4BJ6C 2QLAA 4DBQA 2WZGA 1K05A 4A4AA 2Q9CA 1VYIA 1M57C 2W9YA 4J30B 3AOUA 2KQ9A 3GEEA 4JRZA 2XLWA 3FOPA 4I3MA 2UUHA 1JAFA 4LDQA 3UMKA 3KMIA 1FMVA 2F22A 4P9TA 2W4BA 4CS7A 4E7SA 5BQGA 5JT4A 1I4YA 1OCOC 2GFHA 1KTMA 3CSKA 2TMVP 2RSEB 1TWGA 3E9VA 1LS4A 1RKEB 5DS6A 1XZPA 3NMIA 1T5OA 2A6EF 1Z6AA 2KK1A 3RQGA 3PMRA 3M1CB 1ZU4A 4OD4A 1NFNA 1OW6A 1OW8A 2H7VC 1ORSC 1WGWA 1I5NA 2YLGA 2P1AA 4BJTA 4ULVA 5E33A 1GQAA 1D0YA 2HZ8A 2WVOA 2IM8A 4CJOA 5KYXB 4BJ5C 1FMWA 3SXMA 4G7HF 5KYNA 1WATA 2VASA 1M6TA 3ABMC 3G4XA 3EGXA 4G0HA 1E2XA 5COFA 3DI5A 4A2NB 4AK9A 4EWCA 5BUOA 2XM0A 3ITFA 2EIKC 3JRMO 4XLNF 2YL3A 2LD6A 1C17M 4O79A 3J06A 5A6AA 3TQOA 2GDCA 2Z15A 4MVRA 2J0WA 2CCYA 4N4WA 3F46A 5FZTA 1AVOB 2IXNA 2YKZA 3DWWA 1A41A 3K1IC 3QTHA 3G4ZA 1RXQA 2KW3C 4HFKB 3ZC4A 1Q0MA 2KGOA 2IXOA 2PP4A 3JRTA 3TOMA 2NUPA 3N24A 4C3EA 4C3BA 4K0DA 3PHF2 2QY9A 1OKKD 3S9OA 3N0TA 2Y3HA 2Q00A 4PR9A 4PACA 3IQCA 1VTMP 2OJED 2A0BA 1SMYF 2P7VA 1ZW2A 3V7OA 3T6GB 4E18A 4KI2A 4DOZA 2EPMX 2HSQA 1QPUA 4NTBA 2J9UA 2ZXOA 3RIPA 5KYWB 2ZPAA 1H9TA 3LS1A 3FXHA 3LNMB 1YLMA 4BEMJ 1N1CA 4DBRA 3VF0A 2P6VA 3TJ5A 3W8IA 1HW2A 4D4NA 2CNWA 1MMDA 5AGFA 5COMA 4D4XA 2DYSC 4U9EA 4YJWA 4QDLA 4YN0B 3DKAA 4Z9JA 4FESA 2YL7A 1M56C 2OKUA 2W45A 2AP3A 3L34A 1T01A 2R9RB 3NKEA 4E17A 4J32B 1SR2A 2L81A 1SYQA 2XL8A 4JEBA 3T6BA 4BJ5A 2XS1A 1ZHWA 3X2QC 3GM2A 3UGOA 3POVA 4FAPB 2H8AA 4MNDA 1OR3A 4NY3A 4R32A 4RD9A 5DVWA 2OU6A 4XEVA 3U3BA 4DRJB 3KKBA 4LERA 3WAQA 3SXYA 2IXPA 3T9OA 1LIHA 2WZFA 2RD9A 3JYHA 2HFIA 4CS9A 5KYUB 2R7WA 1OCCC 3NKDA 1NBBA 2EIJC 2AWCA 4PJMA 1H9GA 4PFPA 1AEPA 1T9KA 1ZZPA 1AUEA 1R5ID 2HSBA 2MYSA 3A11A 3HNKA 3E70C 3ABKC 3LJBA 4JC7A 1VOMA 4CDVA 2VB6A 5JRAA 2R7TA 1GM5A 1SF8A 3K1IA 2XS8A 1C02A 3LEVA 2R05A 2VCCA 3C8GA 1VK5A 4F4BA 3RQEA 5JLIA 3SZRA 4CIPA 3HTKC 5L0HA 3TULA 2E87A 3QW0A 2CDQA 4MW3A 4CSAA 1OCZC 3EPVA 3H65A 3EHMA 4OINF 1R4TA 4MVQA 2KNHA 2R25A 1BR2A 4PJLA 4Q5SF 4EIYA 2P61A 3GEHA 4L6RA 2BL2A 1QKRA 3LUTB 1MNEA 1UFBA 2ICWG 1YZAA 3FHDA 3KPHA 4XPYA 2HJMA 4RDAA 3FVYA 3F47A 3EH2A 5AC4A 1S7ZA 4U5BE 3ZVRA 1JPJA 2QTVA 2XL4A 5E3AA 5JUAA 2W4MA 2YWAA 5FCLA 4YT8A 1NFOA 3IQ6A 3GEIA 1TKNA 1K40A 1YVIA 2J45A 4YT2A 1CPQA 2XLMA 3EFOB 3QVZA 2XXAB 2XLEA 1FNTc 4IGGA 4FX5A 4NQFA 2Y3DA 1E84A 1A7DA 1PCXA 1B68A 1OQCA 5KYWA 2J9VA 3JZ0A 1FFTC 2NG1A 3IQ5A 1YDIA 3GM3A 1TWAA 1TR2A 3N2ZB 3EQLF 1O87A 4WGZA 1RCPA 5CIVA 2JD3A 4YL0A 3UNGC 5K0IA 3S0XA 1NZEA 3K1HA 1TWCA 3A9CA 4XPWA 5D92A 3W8HA 5KYYA 3RQFA 1G5ZA 4MVMA 3Q6MA 4P6IC 4CJGA 1ZHTA 4I44A 4OD5A 2HS5A 1MMAA 4LDRA 2VH3A 5L0IA 4JKVA 1O5HA 3RH3A 3UGPA 3EJNA 1M2VB 2NUTA 4NTAA 2YHSA 1RJ9A 3UMIA 3C62A 1HE9A 2HMZA 4KNVA 1D1CA 2OQMA 1BDJB 3TOLA 4EBBA 2DYRC 2V3CC 2DB4A 2EINC 2Q7RA 5B3IA 2Y39A 4IWBA 2J0XA 2XRHA 2G3VA 3MFNA 2ZXRA 1HMDA 2Y3GA 3K66A 2WL8A 5T3TA 3AQCA 3U5SA 4ER9A 5JSLA 1OW7A 2QUPA 3DXJF 4MQ9F 4HFFB 1F1MA 4JVSA 1ZVZA 5HSWA 5A6BD 3CQZA 2B0JA 3EGDA 2QNLA 4BPMA 3R2PA 1YJGA 1MMNA 1D1AA 4CS9C 4JIOA 4JJGA 1WN0A 1YYJA 4AL0A 4X0RA 5EHHA 2PFDA 4C7OA 2R7OA 2DI3A 3EG9B 3B9QA 1T6UA 1ZW3A 4N6HA 2Y69C 1ZHYA 5JP7A 1T6IA 3NG1A 3U8VA 1MNDA 3ZSUA 1VB5A 3DJNB 4Z9HA 5T1DB 5DQTA 4JTCB 4CDAA 3JTLO 2JX0A 2I8BA 1HMOA 4LLCA 4W8KA 3ZQVA 1OXBA 2EILC 3NYJA 3WG7C 3MYIA 4YT4A 2R7RA 4ULWA 1ORJA 4U5DE 4CSAC 2PX3A 2R03A 3NRHA 4KBLA 4C3DA 3NDBB 4MVUA 3AGTA 1EQ1A 2L6GA 3HKKA 4CDYA 3C8GD 3M79A 1NLXA 4U5EE 2QE9A 3S84A 1HY5A 4N6CA 4P9FA 2HJ3A 4QI2A 3HNJA 2J9WA 3S28A 1ORYA 1XZQA 2KSFA 2X51A 3Q7GA 2IBFA 3ASNC 3V5YA 1CGME 1TFKB 4ANJA 3KL4A 1ZHZA 3T6JA 2A68F 2OOCA 2XSEA 1U6HA 2P0NA 4AX2A 4WJ0A 2WB7A 3H2UA 1PV3A 1JRAA 1YAUO 4N06A 2BC5A 2J46A 3HNIA 4JW1A 2XLOA 3LAYA 1QVXA 2J7PA 3NYLA 3ECSA 3WHNA 3ZTZA 1Q0DA 4AE4A 3FOOA 4PK4A 1BR1A 3RW0A 3Q6NA 3B0VC 3AGUA 3L1MA 2WVNA 4E0IA 4ZLCA 1VLSA 4LACB 2DGJA 2J9BA 3VAYA 1ZYRF 1V74B 1RKEA 2X0CA 1LVKA 2EPLX 4EBKA 4Z9IA 2R7QA 2Y3BA 4BG0A 2GAQA 2XL6A 5L3QA 2GWWA 1FAPB 3VM6A 4DVZA 2NSFA 2R7SA 2L9JA 5KYXA 4W8PA 4YL3A 1HE1A 3EZHA 4XTKA 3VRCA 3IHUA 2LCHA 1DOVA 1LM3B 1WOLA 2LK4A 1WWPA 3KH2A 3SXZA 2YLIA 2H7OA 3DJUB 5BQIA 3FAPB 4IB4A 5TJ5E 3W4YA 1CPRA 1NU9C 2FAPB 2HKVA 2IYLD 3ATPA 2LIGA 4NTFA 1A7EA 2HMQA 2HV7A 5EGYA 1EKYA 2ASRA 3B0PA 1EA8A 1V4AA 2XLHA 4G7ZF 2LQGA 1QQ3A 3RFYA 1G8XA 1VLTA 2KJGA 2EPOA 2PNOA 1BR4A 3AQBA 5DQZA 2CGEA 2ZD9A 2R7VA 3SNHA 1G4US 1K04A 1U89A 1ZHXA 1H7IA 2G3KA 2YL0A 3M4CA 3OWTA 3JYYA 4G78A 4JTAB 1PD1A 2Q3TA 4DRHB 4EHPA 4YWQA 3IQTA 1PD0A 1G4WR 5D91A 4XEFA 4KC9A 1TQGA 2J8WA 3S27A 2A0UA 3QZCA 2IXMA 4K1OA 1OR2A 4CX9A 5DS4A 1WTYA 4JCHA 2LFFA 1M2OA 3KYJA 2MWQA 1IZMA 4K7BA 1CGOA 1BBHA 2Q9AA 5CI8A 3LNRA 3LLIA 4XLPF 1L3PA 2NUPB 2HUJA 1Z63A 4IARA 1E85A 2Q4FA 4NCQA 3UR3C 3C7JA 3FDQA 3KYIA 3DD7A 1LE4A 1L7CA 4I1OB 2XLDA 3ZG1A 4BJ1A 2KC3A 1KU2A 4EBJA 4OIPF 2I15A 3RVYA 3GANA 2OCCC 3K33A 4U5HA 4CBEA 1HW1A 1TWHA 1YA7O 4MS2A 3W2VA 5L0FA 3OEOA 1DOWA 4H54A 2YEVA 3GWLA 5DLJA 3AG2C 3GWNA 5HV9A 1NG1A 1VYKA 4XEKA 4ZLDA 3NMJA 1LS1A 3U3FA 5IY5C 3DAGA 3GORA 2XM4A 1BZ4A 3B0UX 2CYDA 1GGQA 2NPUA 4GQHA 3FAJA 3W2WA 3JT1A 3O39A 1JPNA 3SEOA 4Q4ZF 5KYUA 2UUIA 2WZLA 4GEHA 2D5RB 4RBNA 4B6IA 2M64A 1QSPA 2CW0F 3AG4C 3G50A 1LKXA 1NSGB 1QLEC 4BEJA 5AC5A 2CNWD 1ST6A 1GS9A 4JJFA 1H6GA 2M4EA 3I5PA 4OIRF 4UDVA 2D4UA 3O55A 1IW7F 3DMDA 3O10A 3PCVA 5A6JA 2YQYA 2J7PD 1YA9A 3BRJA 3DM9B 5F28E 5T3WA 3TJ6A 5JS5A 1OCRC 4OIQF 3HNLA 5A69A 4DVYP 4HE8D 3LESA 4MW8A 4EUKB 3FMSA 3H2VA 1LPEA 2BE5F 5DS5A 3AG3C 3I4UA 1Y4CA
chains in the Genus database with same CATH topology
3ZTZA 3FOOA 4EIYA 4JEAA 3L1MA 2QLAA 4L6RA 3U8PA 1YZAA 2J9BA 1YZCA 2XLWA 3FOPA 1JAFA 5JUAA 3M15A 2XL6A 5JT4A 1YYXA 3IQ6A 3VRCA 3NMIA 1E83A 1CPQA 2XLMA 1LM3B 3QVZA 2XLEA 2YLGA 2YLIA 1E84A 4ULVA 1GQAA 4CJOA 1APCA 3IQ5A 4IB4A 1CPRA 1EKYA 3QVYA 4IAQA 4WGZA 1RCPA 3DE8A 1M6TA 1CGNA 2XLHA 256BA 1QQ3A 2XM0A 4CJGA 2YL3A 2YL0A 3M4CA 4JKVA 2CCYA 4N4WA 4JE9A 2XLVA 3C62A 5JVEA 2YKZA 2J8WA 3ZTMA 3TOLA 3TOMA 5B3IA 3ZWIA 4CX9A 2YLDA 1CGOA 3DE9A 1BBHA 4ER9A 5JSLA 4IARA 1E85A 4WGYA 2XLDA 1QPUA 3NMKA 1YYJA 3M4BA 4D4NA 5AGFA 1MQVA 4D4XA 4U9EA 1A7VA 4N6HA 5JP7A 4NC3A 3NMJA 3QW1A 2YL7A 2XM4A 4CDAA 2YL1A 3ZQVA 4JEBA 2XL8A 3C63A 3ZQYA 4CDYA 3M79A 1NBBA 3HNJA 1E86A 4U9DA 3HNKA 4CDVA 5JRAA 5JS5A 3HNLA 1S05A 5JLIA 4CIPA 2BC5A 3HNIA 3QW0A 2XLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZTZ A;  3FOO A;  4EIY A;  4JEA A;  3L1M A;  2QLA A;  4L6R A;  3U8P A;  1YZA A;  2J9B A;  1YZC A;  2XLW A;  3FOP A;  1JAF A;  5JUA A;  3M15 A;  2XL6 A;  5JT4 A;  1YYX A;  3IQ6 A;  3VRC A;  3NMI A;  1E83 A;  1CPQ A;  2XLM A;  1LM3 B;  3QVZ A;  2XLE A;  2YLG A;  2YLI A;  1E84 A;  4ULV A;  1GQA A;  4CJO A;  1APC A;  3IQ5 A;  4IB4 A;  1CPR A;  1EKY A;  3QVY A;  4IAQ A;  4WGZ A;  1RCP A;  3DE8 A;  1M6T A;  1CGN A;  2XLH A;  256B A;  1QQ3 A;  2XM0 A;  4CJG A;  2YL3 A;  2YL0 A;  3M4C A;  4JKV A;  2CCY A;  4N4W A;  4JE9 A;  2XLV A;  3C62 A;  5JVE A;  2YKZ A;  2J8W A;  3ZTM A;  3TOL A;  3TOM A;  5B3I A;  3ZWI A;  4CX9 A;  2YLD A;  1CGO A;  3DE9 A;  1BBH A;  4ER9 A;  5JSL A;  4IAR A;  1E85 A;  4WGY A;  2XLD A;  1QPU A;  3NMK A;  1YYJ A;  3M4B A;  4D4N A;  5AGF A;  1MQV A;  4D4X A;  4U9E A;  1A7V A;  4N6H A;  5JP7 A;  4NC3 A;  3NMJ A;  3QW1 A;  2YL7 A;  2XM4 A;  4CDA A;  2YL1 A;  3ZQV A;  4JEB A;  2XL8 A;  3C63 A;  3ZQY A;  4CDY A;  3M79 A;  1NBB A;  3HNJ A;  1E86 A;  4U9D A;  3HNK A;  4CDV A;  5JRA A;  5JS5 A;  3HNL A;  1S05 A;  5JLI A;  4CIP A;  2BC5 A;  3HNI A;  3QW0 A;  2XLO A; 
#chains in the Genus database with same CATH topology
 4WAB A;  4GYT A;  1W2W A;  3C8G B;  2PF4 E;  5GPG B;  3NYM A;  2IOQ A;  3US6 A;  3AJM A;  4O6N A;  4FWV A;  2GA0 A;  1D0X A;  1SZI A;  3U8P A;  3X1O A;  4MVO A;  3WOD F;  4AL1 A;  1YZC A;  3IPM O;  3SYN A;  3B71 A;  4MTO A;  4QI0 A;  2FFH A;  4AE4 B;  1WAS A;  3EFO A;  1LE2 A;  1V54 C;  2A6H F;  5CI9 A;  1J8Y F;  4YT5 A;  5L0C A;  3M15 A;  1RMV A;  2XXA A;  2KYH A;  3RVZ A;  4XPX A;  4E0H A;  5E3C A;  1JOG A;  2PBE A;  4LLE A;  2LSE A;  1YAR O;  1YYX A;  4CS8 A;  4J7T A;  2MHR A;  4MVS A;  1V55 C;  3BEH A;  3JSZ A;  4JTD B;  1E83 A;  4O6M A;  1Q0G A;  2LFD A;  3U9M A;  3SP1 A;  1I4Z A;  5B3S C;  2OEX A;  1KNY A;  4MTG A;  3UMH A;  1APC A;  2NSG A;  1Z3I X;  4BJ6 A;  5L0J A;  3ZIB A;  1JR8 A;  1D1B A;  5L3V A;  3EHN A;  3QVY A;  4IAQ A;  1C03 A;  3K7D A;  2YZS A;  4IJJ A;  4ONS A;  4G7O F;  3DE8 A;  1M2V A;  1CGN A;  4U5C E;  3DZA A;  3SXK A;  256B A;  2YRF A;  3RKO F;  3AG1 C;  1XWJ A;  1JMW A;  3C8Z A;  3GOD A;  4M63 A;  1LI7 A;  3CZ6 A;  3VYW A;  1LI5 A;  1A0B A;  4KNW A;  2LP4 A;  3HJC A;  4EKW A;  4JE9 A;  2HV6 A;  2XLV A;  5A6B A;  1TFO B;  5JVE A;  5KYY B;  2YVK A;  3MBG A;  5E2Q A;  1QZX A;  3ZTM A;  3U2L A;  1Z7Q c;  3T4R A;  4XQ1 A;  5L0G A;  3ZWI A;  3DM5 A;  4MTF A;  2R7X A;  3S90 A;  3MLG A;  4HEA J;  5A6K A;  2NUT B;  4U5G A;  1RJ9 B;  1UG7 A;  3K6B A;  5BQH A;  1FTS A;  2YLD A;  2AVK A;  2VCB A;  2VC9 A;  3DE9 A;  3ZDL A;  4O7G A;  4XWJ A;  1RKC A;  4O6Y A;  4OIO F;  5COG A;  3TK0 A;  2AU5 A;  2C04 A;  4WGY A;  3Q7L A;  4DXW A;  1Q0F A;  1Z23 A;  1OKK A;  3DAF A;  3MX3 A;  3U2M A;  3EG9 A;  3OA1 A;  2G62 A;  4JCZ A;  2H7B A;  3NMK A;  3LS0 A;  3V5X A;  1VMA A;  1O3U A;  2L7A A;  3IEE A;  3U0C A;  3M4B A;  1MQV A;  3C18 A;  3EGD B;  3EGX B;  1A7V A;  4NC3 A;  3I5Q A;  3QW1 A;  5EK0 A;  3U9J A;  5F5F A;  3QMK A;  3JSE O;  4H4K C;  2ZXW C;  3RYL A;  2YL1 A;  4PFO A;  3S29 A;  5L0D A;  2EIM C;  4C7O B;  3L8I A;  1Z5Z A;  2PX0 A;  3ASO C;  2ZXP A;  3C63 A;  3GM1 A;  4I1M A;  4JZA A;  4PJN A;  2A1D D;  3ZQY A;  3CAX A;  2AWY A;  2L6F A;  1Q0K A;  2B0H A;  3L0I A;  3TD7 A;  4Q7C A;  4YL1 A;  3MYF A;  4U5F E;  1D0Z A;  1MMG A;  2OJQ A;  1U0B B;  5B1B C;  2EPK X;  3L8J A;  2EPN A;  3EZI A;  3RF3 A;  4J7Y A;  2JPU A;  3CEX A;  1FR0 A;  2VCA A;  5B1A C;  1E86 A;  4U9D A;  4JUR I;  4PJJ A;  2WVQ A;  4IAO A;  3JCU Q;  2A69 F;  2OEV A;  1J8M F;  4DJ9 A;  2OG2 A;  3PDM P;  1NU7 D;  2R02 A;  3EH1 A;  4E7Z A;  3ABL C;  1S05 A;  3B29 A;  4IRU A;  4CS8 C;  3V5Z A;  1EI7 A;  1ZU5 A;  2ETS A;  2V26 A;  1Y6D A;  1OXK A;  2C03 A;  4YK5 A;  3R7C A;  2Q9B A;  2R7U A;  1FFH A;  3LLK A;  5F5H A;  1T6Q A;  4CIH A;  2FGY A;  2L6H A;  3HLZ A;  3O6X A;  4DRI B;  3LEO A;  2O9X A;  4LDK A;  4MVZ A;  4JEA A;  4BJ6 C;  2QLA A;  4DBQ A;  2WZG A;  1K05 A;  4A4A A;  2Q9C A;  1VYI A;  1M57 C;  2W9Y A;  4J30 B;  3AOU A;  2KQ9 A;  3GEE A;  4JRZ A;  2XLW A;  3FOP A;  4I3M A;  2UUH A;  1JAF A;  4LDQ A;  3UMK A;  3KMI A;  1FMV A;  2F22 A;  4P9T A;  2W4B A;  4CS7 A;  4E7S A;  5BQG A;  5JT4 A;  1I4Y A;  1OCO C;  2GFH A;  1KTM A;  3CSK A;  2TMV P;  2RSE B;  1TWG A;  3E9V A;  1LS4 A;  1RKE B;  5DS6 A;  1XZP A;  3NMI A;  1T5O A;  2A6E F;  1Z6A A;  2KK1 A;  3RQG A;  3PMR A;  3M1C B;  1ZU4 A;  4OD4 A;  1NFN A;  1OW6 A;  1OW8 A;  2H7V C;  1ORS C;  1WGW A;  1I5N A;  2YLG A;  2P1A A;  4BJT A;  4ULV A;  5E33 A;  1GQA A;  1D0Y A;  2HZ8 A;  2WVO A;  2IM8 A;  4CJO A;  5KYX B;  4BJ5 C;  1FMW A;  3SXM A;  4G7H F;  5KYN A;  1WAT A;  2VAS A;  1M6T A;  3ABM C;  3G4X A;  3EGX A;  4G0H A;  1E2X A;  5COF A;  3DI5 A;  4A2N B;  4AK9 A;  4EWC A;  5BUO A;  2XM0 A;  3ITF A;  2EIK C;  3JRM O;  4XLN F;  2YL3 A;  2LD6 A;  1C17 M;  4O79 A;  3J06 A;  5A6A A;  3TQO A;  2GDC A;  2Z15 A;  4MVR A;  2J0W A;  2CCY A;  4N4W A;  3F46 A;  5FZT A;  1AVO B;  2IXN A;  2YKZ A;  3DWW A;  1A41 A;  3K1I C;  3QTH A;  3G4Z A;  1RXQ A;  2KW3 C;  4HFK B;  3ZC4 A;  1Q0M A;  2KGO A;  2IXO A;  2PP4 A;  3JRT A;  3TOM A;  2NUP A;  3N24 A;  4C3E A;  4C3B A;  4K0D A;  3PHF 2;  2QY9 A;  1OKK D;  3S9O A;  3N0T A;  2Y3H A;  2Q00 A;  4PR9 A;  4PAC A;  3IQC A;  1VTM P;  2OJE D;  2A0B A;  1SMY F;  2P7V A;  1ZW2 A;  3V7O A;  3T6G B;  4E18 A;  4KI2 A;  4DOZ A;  2EPM X;  2HSQ A;  1QPU A;  4NTB A;  2J9U A;  2ZXO A;  3RIP A;  5KYW B;  2ZPA A;  1H9T A;  3LS1 A;  3FXH A;  3LNM B;  1YLM A;  4BEM J;  1N1C A;  4DBR A;  3VF0 A;  2P6V A;  3TJ5 A;  3W8I A;  1HW2 A;  4D4N A;  2CNW A;  1MMD A;  5AGF A;  5COM A;  4D4X A;  2DYS C;  4U9E A;  4YJW A;  4QDL A;  4YN0 B;  3DKA A;  4Z9J A;  4FES A;  2YL7 A;  1M56 C;  2OKU A;  2W45 A;  2AP3 A;  3L34 A;  1T01 A;  2R9R B;  3NKE A;  4E17 A;  4J32 B;  1SR2 A;  2L81 A;  1SYQ A;  2XL8 A;  4JEB A;  3T6B A;  4BJ5 A;  2XS1 A;  1ZHW A;  3X2Q C;  3GM2 A;  3UGO A;  3POV A;  4FAP B;  2H8A A;  4MND A;  1OR3 A;  4NY3 A;  4R32 A;  4RD9 A;  5DVW A;  2OU6 A;  4XEV A;  3U3B A;  4DRJ B;  3KKB A;  4LER A;  3WAQ A;  3SXY A;  2IXP A;  3T9O A;  1LIH A;  2WZF A;  2RD9 A;  3JYH A;  2HFI A;  4CS9 A;  5KYU B;  2R7W A;  1OCC C;  3NKD A;  1NBB A;  2EIJ C;  2AWC A;  4PJM A;  1H9G A;  4PFP A;  1AEP A;  1T9K A;  1ZZP A;  1AUE A;  1R5I D;  2HSB A;  2MYS A;  3A11 A;  3HNK A;  3E70 C;  3ABK C;  3LJB A;  4JC7 A;  1VOM A;  4CDV A;  2VB6 A;  5JRA A;  2R7T A;  1GM5 A;  1SF8 A;  3K1I A;  2XS8 A;  1C02 A;  3LEV A;  2R05 A;  2VCC A;  3C8G A;  1VK5 A;  4F4B A;  3RQE A;  5JLI A;  3SZR A;  4CIP A;  3HTK C;  5L0H A;  3TUL A;  2E87 A;  3QW0 A;  2CDQ A;  4MW3 A;  4CSA A;  1OCZ C;  3EPV A;  3H65 A;  3EHM A;  4OIN F;  1R4T A;  4MVQ A;  2KNH A;  2R25 A;  1BR2 A;  4PJL A;  4Q5S F;  4EIY A;  2P61 A;  3GEH A;  4L6R A;  2BL2 A;  1QKR A;  3LUT B;  1MNE A;  1UFB A;  2ICW G;  1YZA A;  3FHD A;  3KPH A;  4XPY A;  2HJM A;  4RDA A;  3FVY A;  3F47 A;  3EH2 A;  5AC4 A;  1S7Z A;  4U5B E;  3ZVR A;  1JPJ A;  2QTV A;  2XL4 A;  5E3A A;  5JUA A;  2W4M A;  2YWA A;  5FCL A;  4YT8 A;  1NFO A;  3IQ6 A;  3GEI A;  1TKN A;  1K40 A;  1YVI A;  2J45 A;  4YT2 A;  1CPQ A;  2XLM A;  3EFO B;  3QVZ A;  2XXA B;  2XLE A;  1FNT c;  4IGG A;  4FX5 A;  4NQF A;  2Y3D A;  1E84 A;  1A7D A;  1PCX A;  1B68 A;  1OQC A;  5KYW A;  2J9V A;  3JZ0 A;  1FFT C;  2NG1 A;  3IQ5 A;  1YDI A;  3GM3 A;  1TWA A;  1TR2 A;  3N2Z B;  3EQL F;  1O87 A;  4WGZ A;  1RCP A;  5CIV A;  2JD3 A;  4YL0 A;  3UNG C;  5K0I A;  3S0X A;  1NZE A;  3K1H A;  1TWC A;  3A9C A;  4XPW A;  5D92 A;  3W8H A;  5KYY A;  3RQF A;  1G5Z A;  4MVM A;  3Q6M A;  4P6I C;  4CJG A;  1ZHT A;  4I44 A;  4OD5 A;  2HS5 A;  1MMA A;  4LDR A;  2VH3 A;  5L0I A;  4JKV A;  1O5H A;  3RH3 A;  3UGP A;  3EJN A;  1M2V B;  2NUT A;  4NTA A;  2YHS A;  1RJ9 A;  3UMI A;  3C62 A;  1HE9 A;  2HMZ A;  4KNV A;  1D1C A;  2OQM A;  1BDJ B;  3TOL A;  4EBB A;  2DYR C;  2V3C C;  2DB4 A;  2EIN C;  2Q7R A;  5B3I A;  2Y39 A;  4IWB A;  2J0X A;  2XRH A;  2G3V A;  3MFN A;  2ZXR A;  1HMD A;  2Y3G A;  3K66 A;  2WL8 A;  5T3T A;  3AQC A;  3U5S A;  4ER9 A;  5JSL A;  1OW7 A;  2QUP A;  3DXJ F;  4MQ9 F;  4HFF B;  1F1M A;  4JVS A;  1ZVZ A;  5HSW A;  5A6B D;  3CQZ A;  2B0J A;  3EGD A;  2QNL A;  4BPM A;  3R2P A;  1YJG A;  1MMN A;  1D1A A;  4CS9 C;  4JIO A;  4JJG A;  1WN0 A;  1YYJ A;  4AL0 A;  4X0R A;  5EHH A;  2PFD A;  4C7O A;  2R7O A;  2DI3 A;  3EG9 B;  3B9Q A;  1T6U A;  1ZW3 A;  4N6H A;  2Y69 C;  1ZHY A;  5JP7 A;  1T6I A;  3NG1 A;  3U8V A;  1MND A;  3ZSU A;  1VB5 A;  3DJN B;  4Z9H A;  5T1D B;  5DQT A;  4JTC B;  4CDA A;  3JTL O;  2JX0 A;  2I8B A;  1HMO A;  4LLC A;  4W8K A;  3ZQV A;  1OXB A;  2EIL C;  3NYJ A;  3WG7 C;  3MYI A;  4YT4 A;  2R7R A;  4ULW A;  1ORJ A;  4U5D E;  4CSA C;  2PX3 A;  2R03 A;  3NRH A;  4KBL A;  4C3D A;  3NDB B;  4MVU A;  3AGT A;  1EQ1 A;  2L6G A;  3HKK A;  4CDY A;  3C8G D;  3M79 A;  1NLX A;  4U5E E;  2QE9 A;  3S84 A;  1HY5 A;  4N6C A;  4P9F A;  2HJ3 A;  4QI2 A;  3HNJ A;  2J9W A;  3S28 A;  1ORY A;  1XZQ A;  2KSF A;  2X51 A;  3Q7G A;  2IBF A;  3ASN C;  3V5Y A;  1CGM E;  1TFK B;  4ANJ A;  3KL4 A;  1ZHZ A;  3T6J A;  2A68 F;  2OOC A;  2XSE A;  1U6H A;  2P0N A;  4AX2 A;  4WJ0 A;  2WB7 A;  3H2U A;  1PV3 A;  1JRA A;  1YAU O;  4N06 A;  2BC5 A;  2J46 A;  3HNI A;  4JW1 A;  2XLO A;  3LAY A;  1QVX A;  2J7P A;  3NYL A;  3ECS A;  3WHN A;  3ZTZ A;  1Q0D A;  4AE4 A;  3FOO A;  4PK4 A;  1BR1 A;  3RW0 A;  3Q6N A;  3B0V C;  3AGU A;  3L1M A;  2WVN A;  4E0I A;  4ZLC A;  1VLS A;  4LAC B;  2DGJ A;  2J9B A;  3VAY A;  1ZYR F;  1V74 B;  1RKE A;  2X0C A;  1LVK A;  2EPL X;  4EBK A;  4Z9I A;  2R7Q A;  2Y3B A;  4BG0 A;  2GAQ A;  2XL6 A;  5L3Q A;  2GWW A;  1FAP B;  3VM6 A;  4DVZ A;  2NSF A;  2R7S A;  2L9J A;  5KYX A;  4W8P A;  4YL3 A;  1HE1 A;  3EZH A;  4XTK A;  3VRC A;  3IHU A;  2LCH A;  1DOV A;  1LM3 B;  1WOL A;  2LK4 A;  1WWP A;  3KH2 A;  3SXZ A;  2YLI A;  2H7O A;  3DJU B;  5BQI A;  3FAP B;  4IB4 A;  5TJ5 E;  3W4Y A;  1CPR A;  1NU9 C;  2FAP B;  2HKV A;  2IYL D;  3ATP A;  2LIG A;  4NTF A;  1A7E A;  2HMQ A;  2HV7 A;  5EGY A;  1EKY A;  2ASR A;  3B0P A;  1EA8 A;  1V4A A;  2XLH A;  4G7Z F;  2LQG A;  1QQ3 A;  3RFY A;  1G8X A;  1VLT A;  2KJG A;  2EPO A;  2PNO A;  1BR4 A;  3AQB A;  5DQZ A;  2CGE A;  2ZD9 A;  2R7V A;  3SNH A;  1G4U S;  1K04 A;  1U89 A;  1ZHX A;  1H7I A;  2G3K A;  2YL0 A;  3M4C A;  3OWT A;  3JYY A;  4G78 A;  4JTA B;  1PD1 A;  2Q3T A;  4DRH B;  4EHP A;  4YWQ A;  3IQT A;  1PD0 A;  1G4W R;  5D91 A;  4XEF A;  4KC9 A;  1TQG A;  2J8W A;  3S27 A;  2A0U A;  3QZC A;  2IXM A;  4K1O A;  1OR2 A;  4CX9 A;  5DS4 A;  1WTY A;  4JCH A;  2LFF A;  1M2O A;  3KYJ A;  2MWQ A;  1IZM A;  4K7B A;  1CGO A;  1BBH A;  2Q9A A;  5CI8 A;  3LNR A;  3LLI A;  4XLP F;  1L3P A;  2NUP B;  2HUJ A;  1Z63 A;  4IAR A;  1E85 A;  2Q4F A;  4NCQ A;  3UR3 C;  3C7J A;  3FDQ A;  3KYI A;  3DD7 A;  1LE4 A;  1L7C A;  4I1O B;  2XLD A;  3ZG1 A;  4BJ1 A;  2KC3 A;  1KU2 A;  4EBJ A;  4OIP F;  2I15 A;  3RVY A;  3GAN A;  2OCC C;  3K33 A;  4U5H A;  4CBE A;  1HW1 A;  1TWH A;  1YA7 O;  4MS2 A;  3W2V A;  5L0F A;  3OEO A;  1DOW A;  4H54 A;  2YEV A;  3GWL A;  5DLJ A;  3AG2 C;  3GWN A;  5HV9 A;  1NG1 A;  1VYK A;  4XEK A;  4ZLD A;  3NMJ A;  1LS1 A;  3U3F A;  5IY5 C;  3DAG A;  3GOR A;  2XM4 A;  1BZ4 A;  3B0U X;  2CYD A;  1GGQ A;  2NPU A;  4GQH A;  3FAJ A;  3W2W A;  3JT1 A;  3O39 A;  1JPN A;  3SEO A;  4Q4Z F;  5KYU A;  2UUI A;  2WZL A;  4GEH A;  2D5R B;  4RBN A;  4B6I A;  2M64 A;  1QSP A;  2CW0 F;  3AG4 C;  3G50 A;  1LKX A;  1NSG B;  1QLE C;  4BEJ A;  5AC5 A;  2CNW D;  1ST6 A;  1GS9 A;  4JJF A;  1H6G A;  2M4E A;  3I5P A;  4OIR F;  4UDV A;  2D4U A;  3O55 A;  1IW7 F;  3DMD A;  3O10 A;  3PCV A;  5A6J A;  2YQY A;  2J7P D;  1YA9 A;  3BRJ A;  3DM9 B;  5F28 E;  5T3W A;  3TJ6 A;  5JS5 A;  1OCR C;  4OIQ F;  3HNL A;  5A69 A;  4DVY P;  4HE8 D;  3LES A;  4MW8 A;  4EUK B;  3FMS A;  3H2V A;  1LPE A;  2BE5 F;  5DS5 A;  3AG3 C;  3I4U A;  1Y4C A; 
#chains in the Genus database with same CATH homology
 3ZTZ A;  3FOO A;  4EIY A;  4JEA A;  3L1M A;  2QLA A;  4L6R A;  3U8P A;  1YZA A;  2J9B A;  1YZC A;  2XLW A;  3FOP A;  1JAF A;  5JUA A;  3M15 A;  2XL6 A;  5JT4 A;  1YYX A;  3IQ6 A;  3VRC A;  3NMI A;  1E83 A;  1CPQ A;  2XLM A;  1LM3 B;  3QVZ A;  2XLE A;  2YLG A;  2YLI A;  1E84 A;  4ULV A;  1GQA A;  4CJO A;  1APC A;  3IQ5 A;  4IB4 A;  1CPR A;  1EKY A;  3QVY A;  4IAQ A;  4WGZ A;  1RCP A;  3DE8 A;  1M6T A;  1CGN A;  2XLH A;  256B A;  1QQ3 A;  2XM0 A;  4CJG A;  2YL3 A;  2YL0 A;  3M4C A;  4JKV A;  2CCY A;  4N4W A;  4JE9 A;  2XLV A;  3C62 A;  5JVE A;  2YKZ A;  2J8W A;  3ZTM A;  3TOL A;  3TOM A;  5B3I A;  3ZWI A;  4CX9 A;  2YLD A;  1CGO A;  3DE9 A;  1BBH A;  4ER9 A;  5JSL A;  4IAR A;  1E85 A;  4WGY A;  2XLD A;  1QPU A;  3NMK A;  1YYJ A;  3M4B A;  4D4N A;  5AGF A;  1MQV A;  4D4X A;  4U9E A;  1A7V A;  4N6H A;  5JP7 A;  4NC3 A;  3NMJ A;  3QW1 A;  2YL7 A;  2XM4 A;  4CDA A;  2YL1 A;  3ZQV A;  4JEB A;  2XL8 A;  3C63 A;  3ZQY A;  4CDY A;  3M79 A;  1NBB A;  3HNJ A;  1E86 A;  4U9D A;  3HNK A;  4CDV A;  5JRA A;  5JS5 A;  3HNL A;  1S05 A;  5JLI A;  4CIP A;  2BC5 A;  3HNI A;  3QW0 A;  2XLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...