1Y6DA

Solution structure and dynamics of luxu from vibrio harveyi, a phosphotransferase protein involved in bacterial quorum sensing
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
114
structure length
114
Chain Sequence
MNTDVLNQQKIEELSAEIGSDNVPVLLDIFLGEMDSYIGTLTELQGSEQLLYLKEISHALKSSAASFGADRLCERAIAIDKKAKANQLQEQGMETSEMLALLHITRDAYRSWTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phosphorelay protein luxU
publication title Solution structure and dynamics of LuxU from Vibrio harveyi, a phosphotransferase protein involved in bacterial quorum sensing.
pubmed doi rcsb
source organism Vibrio harveyi
total genus 34
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1y6dA00
2R25A 3IQTA 1C03A 2LD6A 2OOCA 3MYFA 1I5NA 1QSPA 2LP4A 4PACA 1SR2A 3KYIA 4EUKB 3US6A 1WN0A 1A0BA 1BDJB 2LCHA 1FR0A 1C02A 1OXBA 1OXKA 2Q4FA 1TQGA 3KYJA 4G78A 1YVIA 1Y6DA 2A0BA 3U3BA
chains in the Genus database with same CATH superfamily
4CDYA 4OD4A 1ORSC 4JJFA 3RQGA 5F5HA 2YL3A 3ZTZA 3C8GB 2L6HA 1BZ4A 4RBNA 2HKVA 4MVRA 4XQ1A 5D92A 4IARA 4CSAA 2Y3HA 2Y3BA 3EZIA 4Q5SF 3RF3A 3L0IA 3K1IC 2D5RB 3EG9B 3U2LA 4O6NA 3ZWIA 2IXOA 3HNIA 4B6IA 1J8MF 1TFKB 3S28A 1G4WR 4MTOA 4JEBA 1LE2A 3HLZA 4P9TA 2A6EF 2LQGA 2XL8A 2MWQA 3AG4C 5B1AC 4FAPB 3PDMP 2GAQA 1ZYRF 3ZQVA 3I4UA 3UGPA 4R32A 3OWTA 4G78A 4YWQA 2EPKX 1M6TA 4W8PA 1YA7O 4MW3A 3C62A 4U5GA 2XXAA 3MFNA 4E17A 3HKKA 1Q0DA 1UFBA 2OG2A 1H9GA 3C8ZA 3L8JA 2H7OA 2X51A 3W8IA 1C03A 1ORYA 4DOZA 4LLCA 4LDKA 2OJED 4PK4A 2KGOA 5JUAA 4HE8D 4E0IA 1O87A 5EGYA 2A1DD 4Q4ZF 2LP4A 2H7BA 3GWNA 3FOPA 2AU5A 1D0XA 2JPUA 3WODF 5JS5A 2VH3A 2BL2A 3LLIA 3ATPA 3VRCA 2KNHA 1T6QA 2OCCC 4WGYA 5DS5A 3W8HA 5BQHA 3CAXA 3M15A 3ABLC 2EPNA 1ZVZA 3EHMA 1OXKA 1DOWA 5E3AA 5FZTA 1TQGA 3LNRA 1RMVA 5JT4A 5COGA 5K0IA 3U5SA 3NMJA 2XRHA 1Q0MA 2IBFA 1IZMA 1V54C 2XLVA 3L8IA 1D1CA 2DGJA 2OU6A 3KKBA 2J0XA 2QUPA 3IQTA 3DE8A 2O9XA 3MBGA 2HMQA 5EK0A 5JVEA 1S05A 2KSFA 2R7QA 4MTFA 256BA 2Q3TA 3T4RA 5EHHA 3ZSUA 2DYSC 3UMHA 2J9BA 3S0XA 2Y69C 3TK0A 1LI7A 3N24A 2A0UA 2IYLD 4ULVA 4EKWA 1YYXA 5BQIA 5IY5C 1FR0A 4C3BA 5E33A 1HW1A 5BQGA 3DWWA 2YQYA 5JLIA 1CPQA 3HNLA 1SMYF 3H65A 1Z3IX 4MS2A 3RQFA 5L0JA 2M64A 3ZTMA 4NY3A 4YK5A 2WZLA 5A6BD 4AX2A 3M4BA 1YARO 3IHUA 4HEAJ 2AP3A 3JRTA 4DRIB 2BC5A 4MVMA 3QTHA 2L7AA 4G7ZF 3GWLA 4JZAA 2HS5A 1ZZPA 1LPEA 1RJ9A 1Z6AA 2A68F 2P61A 2RD9A 4NCQA 4DBRA 1QLEC 5KYXA 4KI2A 1M2OA 2WVQA 3AGUA 3ECSA 4PJMA 3S29A 1TWAA 3GORA 4W8KA 1BR4A 2HSQA 5KYUA 3FDQA 2DB4A 3V5YA 2LCHA 1T9KA 4JJGA 1HY5A 2P7VA 2B0JA 1D1AA 3IQ5A 1K04A 4N6CA 4WJ0A 2WVOA 3HTKC 4NQFA 2J7PA 3O39A 1M2VB 1VOMA 2W4MA 1YYJA 3QVYA 2W9YA 3S9OA 1YVIA 4KBLA 4CJOA 4JURI 4KC9A 1UG7A 4G7HF 3U9MA 1WTYA 3C8GA 1PCXA 1F1MA 4MVUA 4O6MA 3GM2A 1NFNA 1PD0A 2G3VA 3Q6MA 5BUOA 3UR3C 1WOLA 4HFKB 4D4NA 3K1IA 3MYIA 2E87A 3PHF2 3POVA 4CDAA 1M56C 1QKRA 1IW7F 5T3WA 2JD3A 4EBJA 1TKNA 4Z9JA 3QZCA 5DS4A 5DS6A 2YHSA 1APCA 2R02A 4H4KC 1HE1A 2IXMA 4NC3A 2QNLA 1FFHA 2P6VA 1Y4CA 1VYKA 3F46A 2NSFA 1E2XA 2H7VC 4JTDB 2HV6A 1BDJB 3VYWA 2GFHA 2OEVA 3JSZA 3L34A 3NG1A 2Q9BA 1LI5A 4GEHA 1LS1A 1SZIA 3RYLA 3FHDA 1C02A 1OXBA 2P0NA 4U5BE 3LS1A 3DJUB 5HV9A 2XM4A 5D91A 3CEXA 4XPXA 3T6GB 4NTFA 4C7OB 5T1DB 4MTGA 1D0YA 4AE4A 3H2VA 2QE9A 5COFA 1I4YA 1JR8A 1KNYA 1W2WA 3OEOA 4LDRA 4XEFA 2R25A 4J32B 4K1OA 2F22A 4JTCB 4U5DE 1JAFA 3TOLA 2R7UA 3VAYA 1JPNA 1M57C 1JRAA 3ZDLA 5L0IA 1GM5A 2FAPB 4PACA 2W4BA 2YL1A 1WGWA 5A69A 1ST6A 4U5EE 2WL8A 3KYIA 2AVKA 2KW3C 3JZ0A 5KYYB 2WZGA 1LKXA 4I1OB 2NUTB 2R9RB 1T6IA 3AOUA 5E3CA 1I4ZA 5DQTA 3TJ5A 1LIHA 3U2MA 4DRHB 4GYTA 4BEJA 3LUTB 3EQLF 2ETSA 3RW0A 1CPRA 1KU2A 1N1CA 2XL4A 2H8AA 1OCRC 4A4AA 4J30B 4E18A 1ZHZA 1CGOA 5L0CA 3B0VC 3NRHA 2L6GA 2XS8A 5AC4A 2CNWA 2OKUA 1K40A 2YLIA 2KJGA 4YT4A 4IAOA 4MVSA 3EHNA 5L0GA 3K66A 2BE5F 2DYRC 2OOCA 4BJ5C 4RDAA 2J9UA 3U8VA 4E7ZA 3CSKA 3SZRA 2YZSA 2J9VA 1BBHA 3LJBA 1VMAA 2R7WA 2Q00A 2VASA 1AVOB 2KYHA 2WVNA 4ULWA 1H9TA 4ER9A 4YN0B 1GQAA 1YZCA 1H6GA 1NBBA 3K7DA 4BJ1A 5A6JA 2XLWA 4CS8C 1ZHYA 2P1AA 4ZLCA 5FCLA 4JVSA 4F4BA 4DBQA 1EA8A 1FTSA 3DI5A 4JW1A 3AG3C 1FMWA 1V74B 3KYJA 3C18A 4JEAA 1LM3B 2EIJC 3LEVA 3N0TA 2I8BA 3G4ZA 1OW6A 3JCUQ 2R7TA 4QDLA 1ZHWA 4XLNF 2R7XA 3UMIA 3GEEA 3QMKA 1JOGA 3GM1A 3MYFA 2VC9A 3CQZA 3NKEA 1T6UA 2ZPAA 4PJLA 1TWCA 4FX5A 4JKVA 5A6AA 5T3TA 4G0HA 1B68A 4ONSA 5COMA 2R05A 1RKEA 3DM5A 4U5FE 2GA0A 3X2QC 1G8XA 1XZQA 4DVZA 2L9JA 4I1MA 4CX9A 3K1HA 1H7IA 4CIHA 1WN0A 2LFDA 2DI3A 4AL1A 1FNTc 4CBEA 3E9VA 1A41A 3JYHA 1NU9C 1RCPA 1FAPB 2VCCA 4JRZA 1M2VA 5KYNA 2R7SA 1O5HA 3IEEA 1U0BB 3AQCA 3X1OA 3K6BA 3E70C 3GANA 4QI2A 3NMIA 2Q9CA 3BEHA 1VK5A 1YZAA 3DMDA 2G62A 2CCYA 3Q6NA 4DRJB 4EIYA 5JP7A 4YT8A 2XXAB 1OCCC 4O79A 3UGOA 2Y3GA 1ZW3A 4LACB 3U9JA 1EI7A 4U5HA 3AG1C 3FOOA 4Q7CA 5F5FA 2A69F 4Z9IA 1QQ3A 4MVOA 4EBKA 1OW7A 2ZXRA 3SNHA 2HV7A 4YL1A 3O6XA 3ZG1A 5HSWA 4JE9A 1VLSA 3SXYA 1A0BA 4OINF 1ZU5A 1NSGB 4N06A 1Q0GA 1RXQA 1YDIA 3LESA 4K0DA 3GODA 3EGXB 4DJ9A 1QVXA 1WASA 3MX3A 4I3MA 3JTLO 5A6KA 2EPOA 4U9DA 2KQ9A 2GDCA 4GQHA 4XPYA 3SXKA 3DJNB 2Q9AA 5A6BA 2RSEB 3AGTA 3SXZA 2YRFA 4IB4A 3GEIA 1TWHA 3F47A 4MQ9F 3B29A 4LERA 3W2WA 2L6FA 3V5XA 4AK9A 3B9QA 1QSPA 3FMSA 1OR3A 4JCZA 3AJMA 4RD9A 1OKKD 3EG9A 3T9OA 1TFOB 1XZPA 5GPGB 3A9CA 4EWCA 3U0CA 3ASNC 2EINC 1ZU4A 1ZHTA 1A7DA 4MVZA 5L3QA 3T6JA 2FFHA 2NG1A 1SF8A 3O55A 1T01A 3B0PA 4BJTA 1E84A 2R7VA 4A2NB 2EIKC 5CI8A 4H54A 5B1BC 3EFOB 4CS9C 4MVQA 5DVWA 3ZC4A 2PBEA 1K05A 1Z7Qc 2KK1A 1Z23A 3FAPB 3SEOA 2CYDA 3TJ6A 1V4AA 4YT5A 4EHPA 2B0HA 1VYIA 2NSGA 3I5QA 5DLJA 3VF0A 2L81A 1NG1A 2ZD9A 4LLEA 2VCBA 2FGYA 3ZQYA 4BJ5A 1YLMA 2YLDA 2J45A 4M63A 2LK4A 5JRAA 1OCOC 3PMRA 4BJ6A 2VCAA 1TR2A 4JTAB 2XM0A 1OW8A 1VB5A 2PF4E 3OA1A 2HZ8A 3EZHA 4JCHA 3LS0A 5KYXB 2YL0A 4LDQA 3ABKC 2EIMC 2IM8A 2C03A 3G4XA 4CS8A 4OD5A 3KPHA 3BRJA 2EPMX 3JYYA 4QI0A 3EGDB 1U89A 3JT1A 3LAYA 3IQ6A 1G5ZA 1QZXA 4OIRF 4IWBA 3NKDA 4C3DA 4MNDA 1RKCA 2PX3A 3N2ZB 1JPJA 4EBBA 2Q4FA 1HMDA 3ZIBA 2QLAA 4IRUA 4L6RA 4XLPF 2HUJA 3FVYA 3L1MA 2GWWA 2ZXWC 2IOQA 4MW8A 4E0HA 1MMNA 2NUPB 3R2PA 2LD6A 3DD7A 3NYJA 4KNVA 4XWJA 3O10A 4JC7A 3FXHA 1E86A 2XLDA 4WABA 3SYNA 4ANJA 4J7TA 1HMOA 3ITFA 3M1CB 1G4US 2C04A 4BJ6C 3W4YA 1NZEA 3C7JA 4Z9HA 2MHRA 2QY9A 3ASOC 3QW1A 4D4XA 1D0ZA 1YA9A 2R03A 4HFFB 3ABMC 3US6A 4BEMJ 3S27A 4IJJA 4CJGA 3NMKA 1U6HA 1XWJA 3EPVA 3HNJA 3QVZA 4U5CE 2EILC 3A11A 5B3IA 4K7BA 3Q7GA 3TD7A 5E2QA 2NPUA 4U9EA 4IAQA 3RVYA 2D4UA 2XS1A 5KYWB 3J06A 4PJNA 4AE4B 4YJWA 3RQEA 1T5OA 1LVKA 3V5ZA 4OIPF 3LLKA 2WZFA 1V55C 2UUHA 2R7OA 4UDVA 4IGGA 2V26A 1HW2A 2LIGA 2YLGA 1E85A 3B0UX 1FFTC 1OCZC 1OR2A 3FAJA 3IQCA 1R5ID 3EJNA 2EPLX 1PV3A 3DXJF 4P6IC 2OJQA 2XLMA 4CSAC 1KTMA 1ORJA 4DXWA 3SP1A 2MYSA 2QTVA 1Z63A 1NFOA 3HNKA 3M4CA 5JSLA 3NDBB 3U3FA 1LE4A 3NYLA 1PD1A 3DM9B 3EGXA 1WWPA 5L0DA 1AEPA 3M79A 3NYMA 2YVKA 1C17M 4C3EA 3RKOF 2PFDA 3AQBA 3UNGC 3WG7C 5CIVA 3S84A 2OEXA 3DZAA 4PR9A 2JX0A 2XL6A 2XLEA 2W45A 2YL7A 1A7VA 4WGZA 3EH1A 2IXNA 2VB6A 3KL4A 3U3BA 3UMKA 3DE9A 1NLXA 3ZVRA 1QPUA 2M4EA 2CW0F 5AC5A 1Q0KA 2J0WA 4BG0A 3S90A 3TOMA 3RH3A 2HMZA 3HJCA 1GS9A 1YJGA 4E7SA 1DOVA 4XTKA 1VTMP 3H2UA 2J8WA 2KC3A 2YWAA 1L3PA 2IXPA 3EFOA 4PFOA 2ASRA 4CS9A 3R7CA 2HSBA 1NU7D 3I5PA 4YT2A 3DAGA 2J7PD 1MMGA 2YEVA 3DAFA 1SYQA 1JMWA 4C7OA 2ICWG 3EH2A 4JIOA 2HJ3A 1AUEA 2ZXPA 3B71A 3C8GD 1ZW2A 3GM3A 5L0FA 2A6HF 1LS4A 5AGFA 2R7RA 2LSEA 1BR2A 4N6HA 3KMIA 3JSEO 4XEVA 3U8PA 1BR1A 2Y39A 3LEOA 3K33A 4XEKA 4AL0A 1CGME 3G50A 1YAUO 1MQVA 1VLTA 3C63A 2OQMA 5KYYA 4G7OF 2PNOA 1J8YF 1RKEB 2AWCA 5TJ5E 2NUTA 4EUKB 3SXMA 5B3SC 1L7CA 3RVZA 3KH2A 3EGDA 4O6YA 1OQCA 2J9WA 3W2VA 5DQZA 4CS7A 1Z5ZA 4OIQF 1S7ZA 4FESA 3WAQA 1R4TA 4N4WA 1MMAA 1O3UA 3Q7LA 3RIPA 2TMVP 4I44A 1MNDA 1GGQA 3T6BA 3AG2C 1EQ1A 4FWVA 1Q0FA 3DKAA 2XSEA 4X0RA 2NUPA 3QW0A 3V7OA 2J46A 2AWYA 2HFIA 2ZXOA 2YKZA 1I5NA 2Q7RA 3GEHA 4PFPA 4P9FA 4DVYP 1CGNA 1E83A 3WHNA 1SR2A 1A7EA 1OKKA 3CZ6A 4PJJA 1WATA 2V3CC 4BPMA 3MLGA 4CDVA 1RJ9B 2XLOA 1EKYA 1FMVA 2CDQA 2UUIA 2HJMA 4J7YA 4KNWA 4YL0A 2CGEA 2PX0A 1MMDA 1TWGA 4XPWA 3RFYA 3VM6A 5L0HA 5KYUB 2XLHA 2G3KA 2Z15A 4YL3A 3PCVA 3TQOA 2Y3DA 2WB7A 2X0CA 2PP4A 1ZHXA 5F28E 4NTBA 5CI9A 3TULA 3IPMO 5KYWA 4ZLDA 4O7GA 4CIPA 5L3VA 3LNMB 2CNWD 1D1BA 1Y6DA 2LFFA 4NTAA 2A0BA 3JRMO 4OIOF 2I15A 1HE9A 1MNEA
chains in the Genus database with same CATH topology
2R25A 3IQTA 1C03A 2LD6A 2OOCA 3MYFA 1I5NA 1QSPA 2LP4A 4PACA 1SR2A 3KYIA 4EUKB 3US6A 1WN0A 1A0BA 1BDJB 2LCHA 1FR0A 1C02A 1OXBA 1OXKA 2Q4FA 1TQGA 3KYJA 4G78A 1YVIA 1Y6DA 2A0BA 3U3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R25 A;  3IQT A;  1C03 A;  2LD6 A;  2OOC A;  3MYF A;  1I5N A;  1QSP A;  2LP4 A;  4PAC A;  1SR2 A;  3KYI A;  4EUK B;  3US6 A;  1WN0 A;  1A0B A;  1BDJ B;  2LCH A;  1FR0 A;  1C02 A;  1OXB A;  1OXK A;  2Q4F A;  1TQG A;  3KYJ A;  4G78 A;  1YVI A;  1Y6D A;  2A0B A;  3U3B A; 
#chains in the Genus database with same CATH topology
 4CDY A;  4OD4 A;  1ORS C;  4JJF A;  3RQG A;  5F5H A;  2YL3 A;  3ZTZ A;  3C8G B;  2L6H A;  1BZ4 A;  4RBN A;  2HKV A;  4MVR A;  4XQ1 A;  5D92 A;  4IAR A;  4CSA A;  2Y3H A;  2Y3B A;  3EZI A;  4Q5S F;  3RF3 A;  3L0I A;  3K1I C;  2D5R B;  3EG9 B;  3U2L A;  4O6N A;  3ZWI A;  2IXO A;  3HNI A;  4B6I A;  1J8M F;  1TFK B;  3S28 A;  1G4W R;  4MTO A;  4JEB A;  1LE2 A;  3HLZ A;  4P9T A;  2A6E F;  2LQG A;  2XL8 A;  2MWQ A;  3AG4 C;  5B1A C;  4FAP B;  3PDM P;  2GAQ A;  1ZYR F;  3ZQV A;  3I4U A;  3UGP A;  4R32 A;  3OWT A;  4G78 A;  4YWQ A;  2EPK X;  1M6T A;  4W8P A;  1YA7 O;  4MW3 A;  3C62 A;  4U5G A;  2XXA A;  3MFN A;  4E17 A;  3HKK A;  1Q0D A;  1UFB A;  2OG2 A;  1H9G A;  3C8Z A;  3L8J A;  2H7O A;  2X51 A;  3W8I A;  1C03 A;  1ORY A;  4DOZ A;  4LLC A;  4LDK A;  2OJE D;  4PK4 A;  2KGO A;  5JUA A;  4HE8 D;  4E0I A;  1O87 A;  5EGY A;  2A1D D;  4Q4Z F;  2LP4 A;  2H7B A;  3GWN A;  3FOP A;  2AU5 A;  1D0X A;  2JPU A;  3WOD F;  5JS5 A;  2VH3 A;  2BL2 A;  3LLI A;  3ATP A;  3VRC A;  2KNH A;  1T6Q A;  2OCC C;  4WGY A;  5DS5 A;  3W8H A;  5BQH A;  3CAX A;  3M15 A;  3ABL C;  2EPN A;  1ZVZ A;  3EHM A;  1OXK A;  1DOW A;  5E3A A;  5FZT A;  1TQG A;  3LNR A;  1RMV A;  5JT4 A;  5COG A;  5K0I A;  3U5S A;  3NMJ A;  2XRH A;  1Q0M A;  2IBF A;  1IZM A;  1V54 C;  2XLV A;  3L8I A;  1D1C A;  2DGJ A;  2OU6 A;  3KKB A;  2J0X A;  2QUP A;  3IQT A;  3DE8 A;  2O9X A;  3MBG A;  2HMQ A;  5EK0 A;  5JVE A;  1S05 A;  2KSF A;  2R7Q A;  4MTF A;  256B A;  2Q3T A;  3T4R A;  5EHH A;  3ZSU A;  2DYS C;  3UMH A;  2J9B A;  3S0X A;  2Y69 C;  3TK0 A;  1LI7 A;  3N24 A;  2A0U A;  2IYL D;  4ULV A;  4EKW A;  1YYX A;  5BQI A;  5IY5 C;  1FR0 A;  4C3B A;  5E33 A;  1HW1 A;  5BQG A;  3DWW A;  2YQY A;  5JLI A;  1CPQ A;  3HNL A;  1SMY F;  3H65 A;  1Z3I X;  4MS2 A;  3RQF A;  5L0J A;  2M64 A;  3ZTM A;  4NY3 A;  4YK5 A;  2WZL A;  5A6B D;  4AX2 A;  3M4B A;  1YAR O;  3IHU A;  4HEA J;  2AP3 A;  3JRT A;  4DRI B;  2BC5 A;  4MVM A;  3QTH A;  2L7A A;  4G7Z F;  3GWL A;  4JZA A;  2HS5 A;  1ZZP A;  1LPE A;  1RJ9 A;  1Z6A A;  2A68 F;  2P61 A;  2RD9 A;  4NCQ A;  4DBR A;  1QLE C;  5KYX A;  4KI2 A;  1M2O A;  2WVQ A;  3AGU A;  3ECS A;  4PJM A;  3S29 A;  1TWA A;  3GOR A;  4W8K A;  1BR4 A;  2HSQ A;  5KYU A;  3FDQ A;  2DB4 A;  3V5Y A;  2LCH A;  1T9K A;  4JJG A;  1HY5 A;  2P7V A;  2B0J A;  1D1A A;  3IQ5 A;  1K04 A;  4N6C A;  4WJ0 A;  2WVO A;  3HTK C;  4NQF A;  2J7P A;  3O39 A;  1M2V B;  1VOM A;  2W4M A;  1YYJ A;  3QVY A;  2W9Y A;  3S9O A;  1YVI A;  4KBL A;  4CJO A;  4JUR I;  4KC9 A;  1UG7 A;  4G7H F;  3U9M A;  1WTY A;  3C8G A;  1PCX A;  1F1M A;  4MVU A;  4O6M A;  3GM2 A;  1NFN A;  1PD0 A;  2G3V A;  3Q6M A;  5BUO A;  3UR3 C;  1WOL A;  4HFK B;  4D4N A;  3K1I A;  3MYI A;  2E87 A;  3PHF 2;  3POV A;  4CDA A;  1M56 C;  1QKR A;  1IW7 F;  5T3W A;  2JD3 A;  4EBJ A;  1TKN A;  4Z9J A;  3QZC A;  5DS4 A;  5DS6 A;  2YHS A;  1APC A;  2R02 A;  4H4K C;  1HE1 A;  2IXM A;  4NC3 A;  2QNL A;  1FFH A;  2P6V A;  1Y4C A;  1VYK A;  3F46 A;  2NSF A;  1E2X A;  2H7V C;  4JTD B;  2HV6 A;  1BDJ B;  3VYW A;  2GFH A;  2OEV A;  3JSZ A;  3L34 A;  3NG1 A;  2Q9B A;  1LI5 A;  4GEH A;  1LS1 A;  1SZI A;  3RYL A;  3FHD A;  1C02 A;  1OXB A;  2P0N A;  4U5B E;  3LS1 A;  3DJU B;  5HV9 A;  2XM4 A;  5D91 A;  3CEX A;  4XPX A;  3T6G B;  4NTF A;  4C7O B;  5T1D B;  4MTG A;  1D0Y A;  4AE4 A;  3H2V A;  2QE9 A;  5COF A;  1I4Y A;  1JR8 A;  1KNY A;  1W2W A;  3OEO A;  4LDR A;  4XEF A;  2R25 A;  4J32 B;  4K1O A;  2F22 A;  4JTC B;  4U5D E;  1JAF A;  3TOL A;  2R7U A;  3VAY A;  1JPN A;  1M57 C;  1JRA A;  3ZDL A;  5L0I A;  1GM5 A;  2FAP B;  4PAC A;  2W4B A;  2YL1 A;  1WGW A;  5A69 A;  1ST6 A;  4U5E E;  2WL8 A;  3KYI A;  2AVK A;  2KW3 C;  3JZ0 A;  5KYY B;  2WZG A;  1LKX A;  4I1O B;  2NUT B;  2R9R B;  1T6I A;  3AOU A;  5E3C A;  1I4Z A;  5DQT A;  3TJ5 A;  1LIH A;  3U2M A;  4DRH B;  4GYT A;  4BEJ A;  3LUT B;  3EQL F;  2ETS A;  3RW0 A;  1CPR A;  1KU2 A;  1N1C A;  2XL4 A;  2H8A A;  1OCR C;  4A4A A;  4J30 B;  4E18 A;  1ZHZ A;  1CGO A;  5L0C A;  3B0V C;  3NRH A;  2L6G A;  2XS8 A;  5AC4 A;  2CNW A;  2OKU A;  1K40 A;  2YLI A;  2KJG A;  4YT4 A;  4IAO A;  4MVS A;  3EHN A;  5L0G A;  3K66 A;  2BE5 F;  2DYR C;  2OOC A;  4BJ5 C;  4RDA A;  2J9U A;  3U8V A;  4E7Z A;  3CSK A;  3SZR A;  2YZS A;  2J9V A;  1BBH A;  3LJB A;  1VMA A;  2R7W A;  2Q00 A;  2VAS A;  1AVO B;  2KYH A;  2WVN A;  4ULW A;  1H9T A;  4ER9 A;  4YN0 B;  1GQA A;  1YZC A;  1H6G A;  1NBB A;  3K7D A;  4BJ1 A;  5A6J A;  2XLW A;  4CS8 C;  1ZHY A;  2P1A A;  4ZLC A;  5FCL A;  4JVS A;  4F4B A;  4DBQ A;  1EA8 A;  1FTS A;  3DI5 A;  4JW1 A;  3AG3 C;  1FMW A;  1V74 B;  3KYJ A;  3C18 A;  4JEA A;  1LM3 B;  2EIJ C;  3LEV A;  3N0T A;  2I8B A;  3G4Z A;  1OW6 A;  3JCU Q;  2R7T A;  4QDL A;  1ZHW A;  4XLN F;  2R7X A;  3UMI A;  3GEE A;  3QMK A;  1JOG A;  3GM1 A;  3MYF A;  2VC9 A;  3CQZ A;  3NKE A;  1T6U A;  2ZPA A;  4PJL A;  1TWC A;  4FX5 A;  4JKV A;  5A6A A;  5T3T A;  4G0H A;  1B68 A;  4ONS A;  5COM A;  2R05 A;  1RKE A;  3DM5 A;  4U5F E;  2GA0 A;  3X2Q C;  1G8X A;  1XZQ A;  4DVZ A;  2L9J A;  4I1M A;  4CX9 A;  3K1H A;  1H7I A;  4CIH A;  1WN0 A;  2LFD A;  2DI3 A;  4AL1 A;  1FNT c;  4CBE A;  3E9V A;  1A41 A;  3JYH A;  1NU9 C;  1RCP A;  1FAP B;  2VCC A;  4JRZ A;  1M2V A;  5KYN A;  2R7S A;  1O5H A;  3IEE A;  1U0B B;  3AQC A;  3X1O A;  3K6B A;  3E70 C;  3GAN A;  4QI2 A;  3NMI A;  2Q9C A;  3BEH A;  1VK5 A;  1YZA A;  3DMD A;  2G62 A;  2CCY A;  3Q6N A;  4DRJ B;  4EIY A;  5JP7 A;  4YT8 A;  2XXA B;  1OCC C;  4O79 A;  3UGO A;  2Y3G A;  1ZW3 A;  4LAC B;  3U9J A;  1EI7 A;  4U5H A;  3AG1 C;  3FOO A;  4Q7C A;  5F5F A;  2A69 F;  4Z9I A;  1QQ3 A;  4MVO A;  4EBK A;  1OW7 A;  2ZXR A;  3SNH A;  2HV7 A;  4YL1 A;  3O6X A;  3ZG1 A;  5HSW A;  4JE9 A;  1VLS A;  3SXY A;  1A0B A;  4OIN F;  1ZU5 A;  1NSG B;  4N06 A;  1Q0G A;  1RXQ A;  1YDI A;  3LES A;  4K0D A;  3GOD A;  3EGX B;  4DJ9 A;  1QVX A;  1WAS A;  3MX3 A;  4I3M A;  3JTL O;  5A6K A;  2EPO A;  4U9D A;  2KQ9 A;  2GDC A;  4GQH A;  4XPY A;  3SXK A;  3DJN B;  2Q9A A;  5A6B A;  2RSE B;  3AGT A;  3SXZ A;  2YRF A;  4IB4 A;  3GEI A;  1TWH A;  3F47 A;  4MQ9 F;  3B29 A;  4LER A;  3W2W A;  2L6F A;  3V5X A;  4AK9 A;  3B9Q A;  1QSP A;  3FMS A;  1OR3 A;  4JCZ A;  3AJM A;  4RD9 A;  1OKK D;  3EG9 A;  3T9O A;  1TFO B;  1XZP A;  5GPG B;  3A9C A;  4EWC A;  3U0C A;  3ASN C;  2EIN C;  1ZU4 A;  1ZHT A;  1A7D A;  4MVZ A;  5L3Q A;  3T6J A;  2FFH A;  2NG1 A;  1SF8 A;  3O55 A;  1T01 A;  3B0P A;  4BJT A;  1E84 A;  2R7V A;  4A2N B;  2EIK C;  5CI8 A;  4H54 A;  5B1B C;  3EFO B;  4CS9 C;  4MVQ A;  5DVW A;  3ZC4 A;  2PBE A;  1K05 A;  1Z7Q c;  2KK1 A;  1Z23 A;  3FAP B;  3SEO A;  2CYD A;  3TJ6 A;  1V4A A;  4YT5 A;  4EHP A;  2B0H A;  1VYI A;  2NSG A;  3I5Q A;  5DLJ A;  3VF0 A;  2L81 A;  1NG1 A;  2ZD9 A;  4LLE A;  2VCB A;  2FGY A;  3ZQY A;  4BJ5 A;  1YLM A;  2YLD A;  2J45 A;  4M63 A;  2LK4 A;  5JRA A;  1OCO C;  3PMR A;  4BJ6 A;  2VCA A;  1TR2 A;  4JTA B;  2XM0 A;  1OW8 A;  1VB5 A;  2PF4 E;  3OA1 A;  2HZ8 A;  3EZH A;  4JCH A;  3LS0 A;  5KYX B;  2YL0 A;  4LDQ A;  3ABK C;  2EIM C;  2IM8 A;  2C03 A;  3G4X A;  4CS8 A;  4OD5 A;  3KPH A;  3BRJ A;  2EPM X;  3JYY A;  4QI0 A;  3EGD B;  1U89 A;  3JT1 A;  3LAY A;  3IQ6 A;  1G5Z A;  1QZX A;  4OIR F;  4IWB A;  3NKD A;  4C3D A;  4MND A;  1RKC A;  2PX3 A;  3N2Z B;  1JPJ A;  4EBB A;  2Q4F A;  1HMD A;  3ZIB A;  2QLA A;  4IRU A;  4L6R A;  4XLP F;  2HUJ A;  3FVY A;  3L1M A;  2GWW A;  2ZXW C;  2IOQ A;  4MW8 A;  4E0H A;  1MMN A;  2NUP B;  3R2P A;  2LD6 A;  3DD7 A;  3NYJ A;  4KNV A;  4XWJ A;  3O10 A;  4JC7 A;  3FXH A;  1E86 A;  2XLD A;  4WAB A;  3SYN A;  4ANJ A;  4J7T A;  1HMO A;  3ITF A;  3M1C B;  1G4U S;  2C04 A;  4BJ6 C;  3W4Y A;  1NZE A;  3C7J A;  4Z9H A;  2MHR A;  2QY9 A;  3ASO C;  3QW1 A;  4D4X A;  1D0Z A;  1YA9 A;  2R03 A;  4HFF B;  3ABM C;  3US6 A;  4BEM J;  3S27 A;  4IJJ A;  4CJG A;  3NMK A;  1U6H A;  1XWJ A;  3EPV A;  3HNJ A;  3QVZ A;  4U5C E;  2EIL C;  3A11 A;  5B3I A;  4K7B A;  3Q7G A;  3TD7 A;  5E2Q A;  2NPU A;  4U9E A;  4IAQ A;  3RVY A;  2D4U A;  2XS1 A;  5KYW B;  3J06 A;  4PJN A;  4AE4 B;  4YJW A;  3RQE A;  1T5O A;  1LVK A;  3V5Z A;  4OIP F;  3LLK A;  2WZF A;  1V55 C;  2UUH A;  2R7O A;  4UDV A;  4IGG A;  2V26 A;  1HW2 A;  2LIG A;  2YLG A;  1E85 A;  3B0U X;  1FFT C;  1OCZ C;  1OR2 A;  3FAJ A;  3IQC A;  1R5I D;  3EJN A;  2EPL X;  1PV3 A;  3DXJ F;  4P6I C;  2OJQ A;  2XLM A;  4CSA C;  1KTM A;  1ORJ A;  4DXW A;  3SP1 A;  2MYS A;  2QTV A;  1Z63 A;  1NFO A;  3HNK A;  3M4C A;  5JSL A;  3NDB B;  3U3F A;  1LE4 A;  3NYL A;  1PD1 A;  3DM9 B;  3EGX A;  1WWP A;  5L0D A;  1AEP A;  3M79 A;  3NYM A;  2YVK A;  1C17 M;  4C3E A;  3RKO F;  2PFD A;  3AQB A;  3UNG C;  3WG7 C;  5CIV A;  3S84 A;  2OEX A;  3DZA A;  4PR9 A;  2JX0 A;  2XL6 A;  2XLE A;  2W45 A;  2YL7 A;  1A7V A;  4WGZ A;  3EH1 A;  2IXN A;  2VB6 A;  3KL4 A;  3U3B A;  3UMK A;  3DE9 A;  1NLX A;  3ZVR A;  1QPU A;  2M4E A;  2CW0 F;  5AC5 A;  1Q0K A;  2J0W A;  4BG0 A;  3S90 A;  3TOM A;  3RH3 A;  2HMZ A;  3HJC A;  1GS9 A;  1YJG A;  4E7S A;  1DOV A;  4XTK A;  1VTM P;  3H2U A;  2J8W A;  2KC3 A;  2YWA A;  1L3P A;  2IXP A;  3EFO A;  4PFO A;  2ASR A;  4CS9 A;  3R7C A;  2HSB A;  1NU7 D;  3I5P A;  4YT2 A;  3DAG A;  2J7P D;  1MMG A;  2YEV A;  3DAF A;  1SYQ A;  1JMW A;  4C7O A;  2ICW G;  3EH2 A;  4JIO A;  2HJ3 A;  1AUE A;  2ZXP A;  3B71 A;  3C8G D;  1ZW2 A;  3GM3 A;  5L0F A;  2A6H F;  1LS4 A;  5AGF A;  2R7R A;  2LSE A;  1BR2 A;  4N6H A;  3KMI A;  3JSE O;  4XEV A;  3U8P A;  1BR1 A;  2Y39 A;  3LEO A;  3K33 A;  4XEK A;  4AL0 A;  1CGM E;  3G50 A;  1YAU O;  1MQV A;  1VLT A;  3C63 A;  2OQM A;  5KYY A;  4G7O F;  2PNO A;  1J8Y F;  1RKE B;  2AWC A;  5TJ5 E;  2NUT A;  4EUK B;  3SXM A;  5B3S C;  1L7C A;  3RVZ A;  3KH2 A;  3EGD A;  4O6Y A;  1OQC A;  2J9W A;  3W2V A;  5DQZ A;  4CS7 A;  1Z5Z A;  4OIQ F;  1S7Z A;  4FES A;  3WAQ A;  1R4T A;  4N4W A;  1MMA A;  1O3U A;  3Q7L A;  3RIP A;  2TMV P;  4I44 A;  1MND A;  1GGQ A;  3T6B A;  3AG2 C;  1EQ1 A;  4FWV A;  1Q0F A;  3DKA A;  2XSE A;  4X0R A;  2NUP A;  3QW0 A;  3V7O A;  2J46 A;  2AWY A;  2HFI A;  2ZXO A;  2YKZ A;  1I5N A;  2Q7R A;  3GEH A;  4PFP A;  4P9F A;  4DVY P;  1CGN A;  1E83 A;  3WHN A;  1SR2 A;  1A7E A;  1OKK A;  3CZ6 A;  4PJJ A;  1WAT A;  2V3C C;  4BPM A;  3MLG A;  4CDV A;  1RJ9 B;  2XLO A;  1EKY A;  1FMV A;  2CDQ A;  2UUI A;  2HJM A;  4J7Y A;  4KNW A;  4YL0 A;  2CGE A;  2PX0 A;  1MMD A;  1TWG A;  4XPW A;  3RFY A;  3VM6 A;  5L0H A;  5KYU B;  2XLH A;  2G3K A;  2Z15 A;  4YL3 A;  3PCV A;  3TQO A;  2Y3D A;  2WB7 A;  2X0C A;  2PP4 A;  1ZHX A;  5F28 E;  4NTB A;  5CI9 A;  3TUL A;  3IPM O;  5KYW A;  4ZLD A;  4O7G A;  4CIP A;  5L3V A;  3LNM B;  2CNW D;  1D1B A;  1Y6D A;  2LFF A;  4NTA A;  2A0B A;  3JRM O;  4OIO F;  2I15 A;  1HE9 A;  1MNE A; 
#chains in the Genus database with same CATH homology
 2R25 A;  3IQT A;  1C03 A;  2LD6 A;  2OOC A;  3MYF A;  1I5N A;  1QSP A;  2LP4 A;  4PAC A;  1SR2 A;  3KYI A;  4EUK B;  3US6 A;  1WN0 A;  1A0B A;  1BDJ B;  2LCH A;  1FR0 A;  1C02 A;  1OXB A;  1OXK A;  2Q4F A;  1TQG A;  3KYJ A;  4G78 A;  1YVI A;  1Y6D A;  2A0B A;  3U3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...