1Y6DA

Solution structure and dynamics of luxu from vibrio harveyi, a phosphotransferase protein involved in bacterial quorum sensing
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
114
structure length
114
Chain Sequence
b'MNTDVLNQQKIEELSAEIGSDNVPVLLDIFLGEMDSYIGTLTELQGSEQLLYLKEISHALKSSAASFGADRLCERAIAIDKKAKANQLQEQGMETSEMLALLHITRDAYRSWTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphorelay protein luxU
publication title Solution structure and dynamics of LuxU from Vibrio harveyi, a phosphotransferase protein involved in bacterial quorum sensing.
pubmed doi rcsb
source organism Vibrio harveyi
molecule tags Transferase
total genus 34
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1y6dA00
1BDJB 1WN0A 2LP4A 3MYFA 1A0BA 3IQTA 3U3BA 1OXKA 1C02A 3KYJA 1I5NA 2LD6A 3KYIA 1YVIA 1FR0A 3US6A 1C03A 1SR2A 1OXBA 2LCHA 4EUKB 1QSPA 2Q4FA 2OOCA 4PACA 2R25A 1Y6DA 2A0BA 4G78A 1TQGA
chains in the Genus database with same CATH superfamily
2R7OA 2EINC 1D1BA 1Z5ZA 3FMSA 2CDQA 3S0XA 2M4EA 3MYFA 3DM9B 1D0ZA 1LPEA 2J0XA 3K7DA 3SXZA 3T4RA 3VAYA 4QI0A 1A7VA 3HKKA 2HSQA 4BPMA 3GM1A 3RF3A 4EBJA 5A6JA 2J7PD 3BRJA 3R7CA 3CEXA 2NSGA 3FHDA 2W4BA 2XM4A 3RVZA 4OIOF 3K66A 1YVIA 4IAOA 4MTOA 4IGGA 5A69A 4G0HA 4RDAA 2QE9A 4D4XA 3PHF2 3RQEA 3DJNB 5F5HA 1N1CA 1ZW3A 1ZYRF 3I5QA 2OEXA 4JEAA 4MVZA 3DMDA 3C63A 3S28A 2A0BA 3QVYA 1PCXA 1OCOC 2A68F 1TQGA 1YAUO 3CZ6A 4U9EA 5L0JA 3F47A 4J30B 3SXYA 5HSWA 2R03A 3RQFA 3FXHA 1G8XA 2EPNA 3GWLA 2YVKA 1T6QA 4D4NA 3N0TA 3ZQVA 4EIYA 2XLWA 2DB4A 2OQMA 2J0WA 3FVYA 3GM3A 1EA8A 3I5PA 2PNOA 3VM6A 3CSKA 4Z9HA 4K7BA 4NTFA 3HJCA 1HW2A 4JE9A 3LNRA 1NFNA 3T9OA 4LDQA 1Q0DA 4U5BE 4O7GA 1ORYA 2WZLA 3VF0A 4DBQA 1SMYF 4U5HA 3LS0A 4J7YA 3EGDA 4JW1A 3CQZA 1NFOA 2GWWA 1O87A 3EGDB 2FFHA 3UR3C 3Q6MA 1D1AA 3N2ZB 5A6KA 3F46A 3FAJA 4I44A 1OQCA 1T01A 3TOMA 5L3QA 3ZDLA 3EPVA 1Q0GA 3IQTA 1YZCA 4ONSA 4AX2A 1UG7A 1LI7A 2A69F 2AU5A 2XLHA 3S27A 3PCVA 4HFFB 1VMAA 2ZPAA 4NQFA 5A6AA 3FDQA 5COFA 2XLEA 2KC3A 2CNWA 4MVQA 2EPLX 5AC4A 1QLEC 3KYIA 1IW7F 2R9RB 3AG1C 4HEAJ 2IM8A 3ECSA 3ZVRA 5B3IA 2KNHA 3NYMA 4KI2A 1JOGA 3I4UA 1QSPA 4PFOA 4DRHB 2RSEB 2V26A 1HE1A 3V5YA 4BJTA 1XWJA 3EQLF 1QQ3A 3H2VA 4U5FE 4E18A 2Y3BA 1ORSC 1FTSA 5EHHA 1YYJA 2WVOA 1ZHYA 3R2PA 3AG4C 1LVKA 2OEVA 4HE8D 1RXQA 1HY5A 1TFOB 2BE5F 2M64A 1A41A 2VASA 3IPMO 2J7PA 3OA1A 4FWVA 4IJJA 4KNVA 4LERA 2O9XA 2VCCA 1APCA 1KNYA 4N4WA 3MBGA 3O39A 2LFDA 2IXOA 2HSBA 2DYRC 2UUIA 3A11A 2Q00A 3ASNC 4EHPA 5COGA 4E7SA 4BEJA 1S7ZA 1WASA 1SR2A 2P61A 4MTFA 3TOLA 3W2WA 3ATPA 3T6JA 3MX3A 2YKZA 3L8JA 1VLSA 3EGXA 5D92A 1K05A 2UUHA 3U0CA 3H2UA 1OCZC 1LS1A 3EGXB 4L6RA 1E86A 3U9MA 2ICWG 3K1IA 3EJNA 1PD0A 3OEOA 2VH3A 2ZD9A 1WTYA 5B1BC 2R7QA 1YLMA 2ZXRA 1A0BA 2ZXWC 1C02A 1F1MA 1SYQA 2AP3A 2IBFA 2YLGA 4YL3A 3GANA 1RJ9A 3ZTZA 2WZGA 1T5OA 3EH1A 3M4BA 2RD9A 4U5GA 3M79A 1I5NA 2AVKA 1RJ9B 4C3DA 4KC9A 3U8PA 2EIJC 2XS8A 2Q9AA 4M63A 2H7VC 1Q0MA 2GFHA 1FFTC 3NKDA 4R32A 3WODF 4MVUA 1B68A 1QPUA 4DRJB 1H6GA 4H4KC 3RH3A 1MNDA 3FOOA 4NC3A 3E9VA 2OOCA 2CW0F 2H7OA 3BEHA 4O6MA 4JTDB 4CS9A 5F5FA 3LESA 1NU7D 5L0HA 3K1HA 3LNMB 1GM5A 3C8GD 4YT5A 3B29A 3B0UX 3HNIA 3U5SA 1BDJB 1T9KA 2YQYA 3LLIA 3RKOF 4ANJA 4F4BA 4CSAC 1H9GA 3S84A 3AOUA 3KL4A 5JVEA 1CGME 5A6BA 1IZMA 1G5ZA 3NRHA 1Y4CA 3HNKA 4U5CE 1D0XA 2HFIA 4WJ0A 4XQ1A 3W2VA 1M57C 2IXMA 3E70C 4MVRA 5DS4A 2PBEA 4XLNF 2FAPB 4I1MA 1XZQA 4CS8A 2L6FA 3KPHA 1M56C 4G7OF 2HV6A 3QMKA 2L9JA 2QY9A 3EG9A 4ZLDA 3DAFA 2XL8A 3EG9B 1T6IA 1R5ID 1BR2A 4WABA 4C7OA 1E84A 1Y6DA 1NU9C 5DQZA 1LI5A 1YDIA 3GEIA 2QLAA 2A6EF 2ASRA 3GEEA 1V74B 2L6HA 3KKBA 1DOVA 3NG1A 5DLJA 1HW1A 1UFBA 3ITFA 4JC7A 4MS2A 5DS6A 1JPJA 2YRFA 3W8IA 1L3PA 3NYJA 3H65A 2NG1A 2B0HA 4B6IA 2I15A 2GAQA 4FESA 3L8IA 4X0RA 5E3CA 4CIPA 2HUJA 2L81A 4ZLCA 3WAQA 3GORA 1U89A 4IARA 2QNLA 5CI9A 4JZAA 4JJFA 4YK5A 2YL1A 3DJUB 4OINF 4NY3A 3SEOA 5JSLA 4LDKA 3TULA 3LEOA 4AE4B 4BJ5C 4J7TA 1NSGB 2I8BA 3ASOC 3DZAA 4U5DE 4XWJA 3NDBB 4IB4A 5L3VA 2R7WA 2XLOA 1JR8A 3GEHA 3NKEA 1C17M 2NUPA 3S29A 4C3BA 4EKWA 5EK0A 4MVMA 2EIKC 4MNDA 3ABMC 1ZHZA 3AG2C 1T6UA 2NUPB 3JZ0A 3T6GB 3GWNA 1U0BB 3S90A 1YA7O 1TWAA 2J9BA 3G4XA 4H54A 4O6YA 5DQTA 1GS9A 1JAFA 4FAPB 1ZHWA 3TQOA 3C8ZA 4K1OA 2IXPA 3AJMA 1ZHTA 3SYNA 2H7BA 4DVYP 3B71A 4GEHA 4JRZA 3AQBA 1J8YF 4MW8A 1I4YA 3C18A 3OWTA 3X1OA 3MFNA 4N6CA 3QW1A 4YWQA 3WHNA 1SZIA 2P6VA 3EH2A 3VRCA 5EGYA 1BR1A 3DAGA 3FOPA 3MLGA 1CPRA 3V5XA 1LS4A 2AWCA 4LACB 1C03A 2H8AA 2YLIA 3AGTA 3C8GA 5A6BD 2VCAA 1YYXA 5E33A 5E3AA 3TJ6A 3C8GB 3UNGC 1FMWA 2R7SA 2R25A 2YL0A 4JCZA 3M15A 3VYWA 1RCPA 1OW8A 1VYKA 2A0UA 3DD7A 2D4UA 1HE9A 2VCBA 3UMIA 4E0IA 4XPWA 3W8HA 2Y3HA 1YZAA 3G50A 2HS5A 2Q7RA 3U2MA 1OKKD 3V7OA 3NMKA 3V5ZA 3EZIA 4DBRA 4QI2A 2J8WA 4JURI 1BR4A 2D5RB 1FNTc 1JRAA 1OR2A 4PJNA 1WATA 1QVXA 3DE8A 4Z9IA 5AC5A 2J45A 4KBLA 3EZHA 2L6GA 4DJ9A 3K33A 2LFFA 3ZTMA 3HNJA 3QW0A 5KYWA 1VK5A 2YEVA 4EUKB 3GODA 2R7RA 5DS5A 2Y3DA 256BA 3NMIA 4LLCA 1E85A 1ZU5A 4N6HA 4JKVA 5D91A 1Z3IX 2YWAA 2KGOA 1S05A 4YL1A 2HKVA 5JLIA 3LUTB 1FFHA 2YLDA 1BBHA 5CI8A 5KYUA 2P1AA 3LLKA 4NTAA 2HZ8A 5K0IA 1FMVA 3PDMP 3LEVA 1K04A 1NZEA 1ZVZA 5L0CA 5KYUB 1LIHA 3B9QA 4PJJA 4C3EA 3ZQYA 2Z15A 2J9WA 1PD1A 2XLVA 3KYJA 3LJBA 1AVOB 1TWHA 1MMDA 2GA0A 4JTAB 4ER9A 3AQCA 3EFOA 5FCLA 4Q5SF 3IQ5A 1GQAA 2HJMA 3IEEA 3EFOB 2ETSA 5BQHA 2A6HF 3HNLA 5JS5A 3RIPA 4YT8A 2DI3A 1HMOA 1QZXA 4PACA 1AUEA 1VTMP 1LE2A 3B0VC 1CGOA 5T1DB 4J32B 4CS7A 4G7HF 4ULVA 1H9TA 1E2XA 3ABLC 2MYSA 4BEMJ 2EPOA 1ST6A 4OIQF 2Q9BA 1VLTA 2EIMC 1SF8A 1WOLA 2JPUA 2LP4A 3C62A 4E17A 1OR3A 1OCRC 3DXJF 4JEBA 2R7VA 4HFKB 3ZIBA 3AG3C 1CPQA 5JP7A 1Q0FA 2PX3A 2W45A 3JYHA 4U9DA 3IHUA 4BJ6C 4MQ9F 3DI5A 4RBNA 3RQGA 1A7DA 4FX5A 4MW3A 1XZPA 2BC5A 1MMGA 2BL2A 4IRUA 1U6HA 2XS1A 5KYXA 2P0NA 3C7JA 4MVSA 4EBBA 2R7XA 1M2OA 2J46A 3IQ6A 4XPYA 4CDVA 1OXBA 2X51A 2HMQA 1TWGA 3HLZA 3ZSUA 5BUOA 5L0GA 4YN0B 5B1AC 1OW6A 1OKKA 4XTKA 1R4TA 2QUPA 1Z23A 3MYIA 4C7OB 1WGWA 1O3UA 1RKCA 2IOQA 1AEPA 2JD3A 3NMJA 4YT2A 1M6TA 3RYLA 1RKEA 1WN0A 2NPUA 1V55C 2HMZA 4PK4A 5JUAA 3X2QC 4OD5A 1RKEB 2KK1A 3K1IC 4W8PA 2NUTA 2G62A 2PP4A 2LIGA 1EI7A 5BQIA 4XLPF 1RMVA 2NUTB 4XEVA 4NTBA 2OU6A 3UGPA 1QKRA 2IYLD 3L1MA 3NYLA 5L0DA 2LQGA 5E2QA 3U8VA 3QZCA 3WG7C 2KYHA 4AE4A 4CIHA 2YZSA 1J8MF 2OJQA 3JRTA 2OG2A 4N06A 5KYXB 1FR0A 3S9OA 3LAYA 4K0DA 2XL6A 3JTLO 2LCHA 2Q3TA 4Q7CA 1H7IA 2OKUA 2EPMX 3Q7LA 2G3KA 4GYTA 4KNWA 3ZWIA 1Z63A 3O6XA 2XM0A 2WVQA 2J9VA 2VC9A 2CCYA 2P7VA 2OCCC 2ZXOA 3JSZA 4UDVA 1TFKB 1TWCA 2R02A 2AWYA 2Y3GA 4P9FA 4CS9C 2KJGA 4OIPF 2WB7A 1ZU4A 2R7UA 4G7ZF 2OJED 2YL3A 2L7AA 3JYYA 4E0HA 1VB5A 1MMNA 2DYSC 2KQ9A 4RD9A 1OXKA 3RW0A 3DE9A 3JT1A 5T3WA 5L0FA 1Z6AA 5HV9A 3DWWA 5TJ5E 1OCCC 3U9JA 2EILC 5BQGA 2B0JA 3W4YA 2PFDA 4JVSA 5F28E 4EBKA 1LE4A 1MNEA 3L34A 4PFPA 4YT4A 2HJ3A 2PF4E 3JCUQ 2MHRA 4CS8C 4YL0A 3QTHA 1G4US 5B3SC 2Q4FA 4XPXA 2XLMA 1JPNA 1DOWA 1YJGA 1NBBA 1G4WR 5COMA 4DRIB 1KU2A 2XSEA 4BJ1A 3HTKC 2F22A 2G3VA 3DM5A 5CIVA 3N24A 3SZRA 4CJOA 1VYIA 4DXWA 4CBEA 2Y39A 5GPGB 5KYYA 3RFYA 4AK9A 1ORJA 3LS1A 1ZZPA 5KYYB 5DVWA 3T6BA 1NLXA 4WGZA 3U3BA 5JT4A 2XL4A 2HV7A 3KH2A 3G4ZA 2R05A 4QDLA 3SP1A 1Q0KA 5JRAA 4I1OB 5KYNA 4E7ZA 5FZTA 3AGUA 3ZC4A 4OIRF 4BG0A 4CX9A 1L7CA 4EWCA 1LKXA 1LM3B 4YJWA 1CGNA 1ZW2A 2LSEA 3K6BA 4JIOA 4P6IC 1FAPB 1Z7Qc 2YHSA 4AL0A 1E83A 4LDRA 2X0CA 5KYWB 4IAQA 3M1CB 4CSAA 4A4AA 2WZFA 2WL8A 3CAXA 3J06A 2V3CC 1YARO 1I4ZA 4IWBA 2TMVP 3TK0A 4BJ6A 4CJGA 4AL1A 4DOZA 2FGYA 2LK4A 2R7TA 2W9YA 1EKYA 2KSFA 3M4CA 4JTCB 1A7EA 1MQVA 2IXNA 4P9TA 4DVZA 1V4AA 2LD6A 4O6NA 4A2NB 2XRHA 1JMWA 4NCQA 2EPKX 4MTGA 4CDYA 3ABKC 3B0PA 1HMDA 2C04A 4W8KA 1D0YA 1KTMA 1GGQA 1TKNA 1W2WA 1TR2A 3SNHA 3PMRA 4OD4A 2W4MA 4Q4ZF 5T3TA 2A1DD 3SXMA 3DKAA 2JX0A 2NSFA 4G78A 4Z9JA 2J9UA 4PJMA 3SXKA 2CGEA 3ZG1A 2E87A 2PX0A 3UMHA 3UMKA 4LLEA 1O5HA 4MVOA 2YL7A 3FAPB 2KW3C 4JJGA 1ZHXA 3RVYA 3UGOA 1M2VA 3A9CA 3EHNA 1WWPA 1BZ4A 2Q9CA 5AGFA 4BJ5A 3IQCA 5IY5C 3KMIA 1M2VB 1VOMA 3JRMO 2C03A 4JCHA 1K40A 1OW7A 2CYDA 3O55A 2QTVA 4ULWA 4WGYA 4XEKA 2XLDA 3EHMA 3US6A 2VB6A 4XEFA 2XXAA 3TD7A 3GM2A 3JSEO 2MWQA 4U5EE 1D1CA 2DGJA 2GDCA 4PR9A 1YA9A 2CNWD 2WVNA 3L0IA 4O79A 5L0IA 3TJ5A 3Q7GA 2XXAB 4CDAA 3QVZA 1PV3A 4PJLA 3POVA 1EQ1A 1NG1A 2ZXPA 1MMAA 3Q6NA 3U3FA 2Y69C 4GQHA 1V54C 3U2LA 3O10A 4I3MA
chains in the Genus database with same CATH topology
1BDJB 1WN0A 2LP4A 3MYFA 1A0BA 3IQTA 3U3BA 1OXKA 1C02A 3KYJA 1I5NA 2LD6A 3KYIA 1YVIA 1FR0A 3US6A 1C03A 1SR2A 1OXBA 2LCHA 4EUKB 1QSPA 2Q4FA 2OOCA 4PACA 2R25A 1Y6DA 2A0BA 4G78A 1TQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDJ B;  1WN0 A;  2LP4 A;  3MYF A;  1A0B A;  3IQT A;  3U3B A;  1OXK A;  1C02 A;  3KYJ A;  1I5N A;  2LD6 A;  3KYI A;  1YVI A;  1FR0 A;  3US6 A;  1C03 A;  1SR2 A;  1OXB A;  2LCH A;  4EUK B;  1QSP A;  2Q4F A;  2OOC A;  4PAC A;  2R25 A;  1Y6D A;  2A0B A;  4G78 A;  1TQG A; 
#chains in the Genus database with same CATH topology
 2R7O A;  2EIN C;  1D1B A;  1Z5Z A;  3FMS A;  2CDQ A;  3S0X A;  2M4E A;  3MYF A;  3DM9 B;  1D0Z A;  1LPE A;  2J0X A;  3K7D A;  3SXZ A;  3T4R A;  3VAY A;  4QI0 A;  1A7V A;  3HKK A;  2HSQ A;  4BPM A;  3GM1 A;  3RF3 A;  4EBJ A;  5A6J A;  2J7P D;  3BRJ A;  3R7C A;  3CEX A;  2NSG A;  3FHD A;  2W4B A;  2XM4 A;  3RVZ A;  4OIO F;  3K66 A;  1YVI A;  4IAO A;  4MTO A;  4IGG A;  5A69 A;  4G0H A;  4RDA A;  2QE9 A;  4D4X A;  3PHF 2;  3RQE A;  3DJN B;  5F5H A;  1N1C A;  1ZW3 A;  1ZYR F;  3I5Q A;  2OEX A;  4JEA A;  4MVZ A;  3DMD A;  3C63 A;  3S28 A;  2A0B A;  3QVY A;  1PCX A;  1OCO C;  2A68 F;  1TQG A;  1YAU O;  3CZ6 A;  4U9E A;  5L0J A;  3F47 A;  4J30 B;  3SXY A;  5HSW A;  2R03 A;  3RQF A;  3FXH A;  1G8X A;  2EPN A;  3GWL A;  2YVK A;  1T6Q A;  4D4N A;  3N0T A;  3ZQV A;  4EIY A;  2XLW A;  2DB4 A;  2OQM A;  2J0W A;  3FVY A;  3GM3 A;  1EA8 A;  3I5P A;  2PNO A;  3VM6 A;  3CSK A;  4Z9H A;  4K7B A;  4NTF A;  3HJC A;  1HW2 A;  4JE9 A;  3LNR A;  1NFN A;  3T9O A;  4LDQ A;  1Q0D A;  4U5B E;  4O7G A;  1ORY A;  2WZL A;  3VF0 A;  4DBQ A;  1SMY F;  4U5H A;  3LS0 A;  4J7Y A;  3EGD A;  4JW1 A;  3CQZ A;  1NFO A;  2GWW A;  1O87 A;  3EGD B;  2FFH A;  3UR3 C;  3Q6M A;  1D1A A;  3N2Z B;  5A6K A;  3F46 A;  3FAJ A;  4I44 A;  1OQC A;  1T01 A;  3TOM A;  5L3Q A;  3ZDL A;  3EPV A;  1Q0G A;  3IQT A;  1YZC A;  4ONS A;  4AX2 A;  1UG7 A;  1LI7 A;  2A69 F;  2AU5 A;  2XLH A;  3S27 A;  3PCV A;  4HFF B;  1VMA A;  2ZPA A;  4NQF A;  5A6A A;  3FDQ A;  5COF A;  2XLE A;  2KC3 A;  2CNW A;  4MVQ A;  2EPL X;  5AC4 A;  1QLE C;  3KYI A;  1IW7 F;  2R9R B;  3AG1 C;  4HEA J;  2IM8 A;  3ECS A;  3ZVR A;  5B3I A;  2KNH A;  3NYM A;  4KI2 A;  1JOG A;  3I4U A;  1QSP A;  4PFO A;  4DRH B;  2RSE B;  2V26 A;  1HE1 A;  3V5Y A;  4BJT A;  1XWJ A;  3EQL F;  1QQ3 A;  3H2V A;  4U5F E;  4E18 A;  2Y3B A;  1ORS C;  1FTS A;  5EHH A;  1YYJ A;  2WVO A;  1ZHY A;  3R2P A;  3AG4 C;  1LVK A;  2OEV A;  4HE8 D;  1RXQ A;  1HY5 A;  1TFO B;  2BE5 F;  2M64 A;  1A41 A;  2VAS A;  3IPM O;  2J7P A;  3OA1 A;  4FWV A;  4IJJ A;  4KNV A;  4LER A;  2O9X A;  2VCC A;  1APC A;  1KNY A;  4N4W A;  3MBG A;  3O39 A;  2LFD A;  2IXO A;  2HSB A;  2DYR C;  2UUI A;  3A11 A;  2Q00 A;  3ASN C;  4EHP A;  5COG A;  4E7S A;  4BEJ A;  1S7Z A;  1WAS A;  1SR2 A;  2P61 A;  4MTF A;  3TOL A;  3W2W A;  3ATP A;  3T6J A;  3MX3 A;  2YKZ A;  3L8J A;  1VLS A;  3EGX A;  5D92 A;  1K05 A;  2UUH A;  3U0C A;  3H2U A;  1OCZ C;  1LS1 A;  3EGX B;  4L6R A;  1E86 A;  3U9M A;  2ICW G;  3K1I A;  3EJN A;  1PD0 A;  3OEO A;  2VH3 A;  2ZD9 A;  1WTY A;  5B1B C;  2R7Q A;  1YLM A;  2ZXR A;  1A0B A;  2ZXW C;  1C02 A;  1F1M A;  1SYQ A;  2AP3 A;  2IBF A;  2YLG A;  4YL3 A;  3GAN A;  1RJ9 A;  3ZTZ A;  2WZG A;  1T5O A;  3EH1 A;  3M4B A;  2RD9 A;  4U5G A;  3M79 A;  1I5N A;  2AVK A;  1RJ9 B;  4C3D A;  4KC9 A;  3U8P A;  2EIJ C;  2XS8 A;  2Q9A A;  4M63 A;  2H7V C;  1Q0M A;  2GFH A;  1FFT C;  3NKD A;  4R32 A;  3WOD F;  4MVU A;  1B68 A;  1QPU A;  4DRJ B;  1H6G A;  4H4K C;  3RH3 A;  1MND A;  3FOO A;  4NC3 A;  3E9V A;  2OOC A;  2CW0 F;  2H7O A;  3BEH A;  4O6M A;  4JTD B;  4CS9 A;  5F5F A;  3LES A;  1NU7 D;  5L0H A;  3K1H A;  3LNM B;  1GM5 A;  3C8G D;  4YT5 A;  3B29 A;  3B0U X;  3HNI A;  3U5S A;  1BDJ B;  1T9K A;  2YQY A;  3LLI A;  3RKO F;  4ANJ A;  4F4B A;  4CSA C;  1H9G A;  3S84 A;  3AOU A;  3KL4 A;  5JVE A;  1CGM E;  5A6B A;  1IZM A;  1G5Z A;  3NRH A;  1Y4C A;  3HNK A;  4U5C E;  1D0X A;  2HFI A;  4WJ0 A;  4XQ1 A;  3W2V A;  1M57 C;  2IXM A;  3E70 C;  4MVR A;  5DS4 A;  2PBE A;  4XLN F;  2FAP B;  4I1M A;  1XZQ A;  4CS8 A;  2L6F A;  3KPH A;  1M56 C;  4G7O F;  2HV6 A;  3QMK A;  2L9J A;  2QY9 A;  3EG9 A;  4ZLD A;  3DAF A;  2XL8 A;  3EG9 B;  1T6I A;  1R5I D;  1BR2 A;  4WAB A;  4C7O A;  1E84 A;  1Y6D A;  1NU9 C;  5DQZ A;  1LI5 A;  1YDI A;  3GEI A;  2QLA A;  2A6E F;  2ASR A;  3GEE A;  1V74 B;  2L6H A;  3KKB A;  1DOV A;  3NG1 A;  5DLJ A;  1HW1 A;  1UFB A;  3ITF A;  4JC7 A;  4MS2 A;  5DS6 A;  1JPJ A;  2YRF A;  3W8I A;  1L3P A;  3NYJ A;  3H65 A;  2NG1 A;  2B0H A;  4B6I A;  2I15 A;  2GAQ A;  4FES A;  3L8I A;  4X0R A;  5E3C A;  4CIP A;  2HUJ A;  2L81 A;  4ZLC A;  3WAQ A;  3GOR A;  1U89 A;  4IAR A;  2QNL A;  5CI9 A;  4JZA A;  4JJF A;  4YK5 A;  2YL1 A;  3DJU B;  4OIN F;  4NY3 A;  3SEO A;  5JSL A;  4LDK A;  3TUL A;  3LEO A;  4AE4 B;  4BJ5 C;  4J7T A;  1NSG B;  2I8B A;  3ASO C;  3DZA A;  4U5D E;  4XWJ A;  3NDB B;  4IB4 A;  5L3V A;  2R7W A;  2XLO A;  1JR8 A;  3GEH A;  3NKE A;  1C17 M;  2NUP A;  3S29 A;  4C3B A;  4EKW A;  5EK0 A;  4MVM A;  2EIK C;  4MND A;  3ABM C;  1ZHZ A;  3AG2 C;  1T6U A;  2NUP B;  3JZ0 A;  3T6G B;  3GWN A;  1U0B B;  3S90 A;  1YA7 O;  1TWA A;  2J9B A;  3G4X A;  4H54 A;  4O6Y A;  5DQT A;  1GS9 A;  1JAF A;  4FAP B;  1ZHW A;  3TQO A;  3C8Z A;  4K1O A;  2IXP A;  3AJM A;  1ZHT A;  3SYN A;  2H7B A;  4DVY P;  3B71 A;  4GEH A;  4JRZ A;  3AQB A;  1J8Y F;  4MW8 A;  1I4Y A;  3C18 A;  3OWT A;  3X1O A;  3MFN A;  4N6C A;  3QW1 A;  4YWQ A;  3WHN A;  1SZI A;  2P6V A;  3EH2 A;  3VRC A;  5EGY A;  1BR1 A;  3DAG A;  3FOP A;  3MLG A;  1CPR A;  3V5X A;  1LS4 A;  2AWC A;  4LAC B;  1C03 A;  2H8A A;  2YLI A;  3AGT A;  3C8G A;  5A6B D;  2VCA A;  1YYX A;  5E33 A;  5E3A A;  3TJ6 A;  3C8G B;  3UNG C;  1FMW A;  2R7S A;  2R25 A;  2YL0 A;  4JCZ A;  3M15 A;  3VYW A;  1RCP A;  1OW8 A;  1VYK A;  2A0U A;  3DD7 A;  2D4U A;  1HE9 A;  2VCB A;  3UMI A;  4E0I A;  4XPW A;  3W8H A;  2Y3H A;  1YZA A;  3G50 A;  2HS5 A;  2Q7R A;  3U2M A;  1OKK D;  3V7O A;  3NMK A;  3V5Z A;  3EZI A;  4DBR A;  4QI2 A;  2J8W A;  4JUR I;  1BR4 A;  2D5R B;  1FNT c;  1JRA A;  1OR2 A;  4PJN A;  1WAT A;  1QVX A;  3DE8 A;  4Z9I A;  5AC5 A;  2J45 A;  4KBL A;  3EZH A;  2L6G A;  4DJ9 A;  3K33 A;  2LFF A;  3ZTM A;  3HNJ A;  3QW0 A;  5KYW A;  1VK5 A;  2YEV A;  4EUK B;  3GOD A;  2R7R A;  5DS5 A;  2Y3D A;  256B A;  3NMI A;  4LLC A;  1E85 A;  1ZU5 A;  4N6H A;  4JKV A;  5D91 A;  1Z3I X;  2YWA A;  2KGO A;  1S05 A;  4YL1 A;  2HKV A;  5JLI A;  3LUT B;  1FFH A;  2YLD A;  1BBH A;  5CI8 A;  5KYU A;  2P1A A;  3LLK A;  4NTA A;  2HZ8 A;  5K0I A;  1FMV A;  3PDM P;  3LEV A;  1K04 A;  1NZE A;  1ZVZ A;  5L0C A;  5KYU B;  1LIH A;  3B9Q A;  4PJJ A;  4C3E A;  3ZQY A;  2Z15 A;  2J9W A;  1PD1 A;  2XLV A;  3KYJ A;  3LJB A;  1AVO B;  1TWH A;  1MMD A;  2GA0 A;  4JTA B;  4ER9 A;  3AQC A;  3EFO A;  5FCL A;  4Q5S F;  3IQ5 A;  1GQA A;  2HJM A;  3IEE A;  3EFO B;  2ETS A;  5BQH A;  2A6H F;  3HNL A;  5JS5 A;  3RIP A;  4YT8 A;  2DI3 A;  1HMO A;  1QZX A;  4PAC A;  1AUE A;  1VTM P;  1LE2 A;  3B0V C;  1CGO A;  5T1D B;  4J32 B;  4CS7 A;  4G7H F;  4ULV A;  1H9T A;  1E2X A;  3ABL C;  2MYS A;  4BEM J;  2EPO A;  1ST6 A;  4OIQ F;  2Q9B A;  1VLT A;  2EIM C;  1SF8 A;  1WOL A;  2JPU A;  2LP4 A;  3C62 A;  4E17 A;  1OR3 A;  1OCR C;  3DXJ F;  4JEB A;  2R7V A;  4HFK B;  3ZIB A;  3AG3 C;  1CPQ A;  5JP7 A;  1Q0F A;  2PX3 A;  2W45 A;  3JYH A;  4U9D A;  3IHU A;  4BJ6 C;  4MQ9 F;  3DI5 A;  4RBN A;  3RQG A;  1A7D A;  4FX5 A;  4MW3 A;  1XZP A;  2BC5 A;  1MMG A;  2BL2 A;  4IRU A;  1U6H A;  2XS1 A;  5KYX A;  2P0N A;  3C7J A;  4MVS A;  4EBB A;  2R7X A;  1M2O A;  2J46 A;  3IQ6 A;  4XPY A;  4CDV A;  1OXB A;  2X51 A;  2HMQ A;  1TWG A;  3HLZ A;  3ZSU A;  5BUO A;  5L0G A;  4YN0 B;  5B1A C;  1OW6 A;  1OKK A;  4XTK A;  1R4T A;  2QUP A;  1Z23 A;  3MYI A;  4C7O B;  1WGW A;  1O3U A;  1RKC A;  2IOQ A;  1AEP A;  2JD3 A;  3NMJ A;  4YT2 A;  1M6T A;  3RYL A;  1RKE A;  1WN0 A;  2NPU A;  1V55 C;  2HMZ A;  4PK4 A;  5JUA A;  3X2Q C;  4OD5 A;  1RKE B;  2KK1 A;  3K1I C;  4W8P A;  2NUT A;  2G62 A;  2PP4 A;  2LIG A;  1EI7 A;  5BQI A;  4XLP F;  1RMV A;  2NUT B;  4XEV A;  4NTB A;  2OU6 A;  3UGP A;  1QKR A;  2IYL D;  3L1M A;  3NYL A;  5L0D A;  2LQG A;  5E2Q A;  3U8V A;  3QZC A;  3WG7 C;  2KYH A;  4AE4 A;  4CIH A;  2YZS A;  1J8M F;  2OJQ A;  3JRT A;  2OG2 A;  4N06 A;  5KYX B;  1FR0 A;  3S9O A;  3LAY A;  4K0D A;  2XL6 A;  3JTL O;  2LCH A;  2Q3T A;  4Q7C A;  1H7I A;  2OKU A;  2EPM X;  3Q7L A;  2G3K A;  4GYT A;  4KNW A;  3ZWI A;  1Z63 A;  3O6X A;  2XM0 A;  2WVQ A;  2J9V A;  2VC9 A;  2CCY A;  2P7V A;  2OCC C;  2ZXO A;  3JSZ A;  4UDV A;  1TFK B;  1TWC A;  2R02 A;  2AWY A;  2Y3G A;  4P9F A;  4CS9 C;  2KJG A;  4OIP F;  2WB7 A;  1ZU4 A;  2R7U A;  4G7Z F;  2OJE D;  2YL3 A;  2L7A A;  3JYY A;  4E0H A;  1VB5 A;  1MMN A;  2DYS C;  2KQ9 A;  4RD9 A;  1OXK A;  3RW0 A;  3DE9 A;  3JT1 A;  5T3W A;  5L0F A;  1Z6A A;  5HV9 A;  3DWW A;  5TJ5 E;  1OCC C;  3U9J A;  2EIL C;  5BQG A;  2B0J A;  3W4Y A;  2PFD A;  4JVS A;  5F28 E;  4EBK A;  1LE4 A;  1MNE A;  3L34 A;  4PFP A;  4YT4 A;  2HJ3 A;  2PF4 E;  3JCU Q;  2MHR A;  4CS8 C;  4YL0 A;  3QTH A;  1G4U S;  5B3S C;  2Q4F A;  4XPX A;  2XLM A;  1JPN A;  1DOW A;  1YJG A;  1NBB A;  1G4W R;  5COM A;  4DRI B;  1KU2 A;  2XSE A;  4BJ1 A;  3HTK C;  2F22 A;  2G3V A;  3DM5 A;  5CIV A;  3N24 A;  3SZR A;  4CJO A;  1VYI A;  4DXW A;  4CBE A;  2Y39 A;  5GPG B;  5KYY A;  3RFY A;  4AK9 A;  1ORJ A;  3LS1 A;  1ZZP A;  5KYY B;  5DVW A;  3T6B A;  1NLX A;  4WGZ A;  3U3B A;  5JT4 A;  2XL4 A;  2HV7 A;  3KH2 A;  3G4Z A;  2R05 A;  4QDL A;  3SP1 A;  1Q0K A;  5JRA A;  4I1O B;  5KYN A;  4E7Z A;  5FZT A;  3AGU A;  3ZC4 A;  4OIR F;  4BG0 A;  4CX9 A;  1L7C A;  4EWC A;  1LKX A;  1LM3 B;  4YJW A;  1CGN A;  1ZW2 A;  2LSE A;  3K6B A;  4JIO A;  4P6I C;  1FAP B;  1Z7Q c;  2YHS A;  4AL0 A;  1E83 A;  4LDR A;  2X0C A;  5KYW B;  4IAQ A;  3M1C B;  4CSA A;  4A4A A;  2WZF A;  2WL8 A;  3CAX A;  3J06 A;  2V3C C;  1YAR O;  1I4Z A;  4IWB A;  2TMV P;  3TK0 A;  4BJ6 A;  4CJG A;  4AL1 A;  4DOZ A;  2FGY A;  2LK4 A;  2R7T A;  2W9Y A;  1EKY A;  2KSF A;  3M4C A;  4JTC B;  1A7E A;  1MQV A;  2IXN A;  4P9T A;  4DVZ A;  1V4A A;  2LD6 A;  4O6N A;  4A2N B;  2XRH A;  1JMW A;  4NCQ A;  2EPK X;  4MTG A;  4CDY A;  3ABK C;  3B0P A;  1HMD A;  2C04 A;  4W8K A;  1D0Y A;  1KTM A;  1GGQ A;  1TKN A;  1W2W A;  1TR2 A;  3SNH A;  3PMR A;  4OD4 A;  2W4M A;  4Q4Z F;  5T3T A;  2A1D D;  3SXM A;  3DKA A;  2JX0 A;  2NSF A;  4G78 A;  4Z9J A;  2J9U A;  4PJM A;  3SXK A;  2CGE A;  3ZG1 A;  2E87 A;  2PX0 A;  3UMH A;  3UMK A;  4LLE A;  1O5H A;  4MVO A;  2YL7 A;  3FAP B;  2KW3 C;  4JJG A;  1ZHX A;  3RVY A;  3UGO A;  1M2V A;  3A9C A;  3EHN A;  1WWP A;  1BZ4 A;  2Q9C A;  5AGF A;  4BJ5 A;  3IQC A;  5IY5 C;  3KMI A;  1M2V B;  1VOM A;  3JRM O;  2C03 A;  4JCH A;  1K40 A;  1OW7 A;  2CYD A;  3O55 A;  2QTV A;  4ULW A;  4WGY A;  4XEK A;  2XLD A;  3EHM A;  3US6 A;  2VB6 A;  4XEF A;  2XXA A;  3TD7 A;  3GM2 A;  3JSE O;  2MWQ A;  4U5E E;  1D1C A;  2DGJ A;  2GDC A;  4PR9 A;  1YA9 A;  2CNW D;  2WVN A;  3L0I A;  4O79 A;  5L0I A;  3TJ5 A;  3Q7G A;  2XXA B;  4CDA A;  3QVZ A;  1PV3 A;  4PJL A;  3POV A;  1EQ1 A;  1NG1 A;  2ZXP A;  1MMA A;  3Q6N A;  3U3F A;  2Y69 C;  4GQH A;  1V54 C;  3U2L A;  3O10 A;  4I3M A; 
#chains in the Genus database with same CATH homology
 1BDJ B;  1WN0 A;  2LP4 A;  3MYF A;  1A0B A;  3IQT A;  3U3B A;  1OXK A;  1C02 A;  3KYJ A;  1I5N A;  2LD6 A;  3KYI A;  1YVI A;  1FR0 A;  3US6 A;  1C03 A;  1SR2 A;  1OXB A;  2LCH A;  4EUK B;  1QSP A;  2Q4F A;  2OOC A;  4PAC A;  2R25 A;  1Y6D A;  2A0B A;  4G78 A;  1TQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...