1Y6DA

Solution structure and dynamics of luxu from vibrio harveyi, a phosphotransferase protein involved in bacterial quorum sensing
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
114
structure length
114
Chain Sequence
MNTDVLNQQKIEELSAEIGSDNVPVLLDIFLGEMDSYIGTLTELQGSEQLLYLKEISHALKSSAASFGADRLCERAIAIDKKAKANQLQEQGMETSEMLALLHITRDAYRSWTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphorelay protein luxU
publication title Solution structure and dynamics of LuxU from Vibrio harveyi, a phosphotransferase protein involved in bacterial quorum sensing.
pubmed doi rcsb
source organism Vibrio harveyi
molecule tags Transferase
total genus 34
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2004-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 1y6dA00
1Y6DA 3U3BA 1YVIA 1SR2A 1C03A 1C02A 2LP4A 1FR0A 3MYFA 3US6A 3KYIA 1QSPA 3IQTA 4PACA 2Q4FA 4G78A 1OXKA 1TQGA 3KYJA 1BDJB 1WN0A 1I5NA 2OOCA 2A0BA 2LCHA 2LD6A 1A0BA 4EUKB 1OXBA 2R25A
chains in the Genus database with same CATH superfamily
1Y6DA 1OR2A 2KGOA 4XLPF 3ZDLA 3AQCA 1ORJA 3L0IA 2QTVA 2VH3A 5CIVA 2IYLD 5KYUA 1H7IA 5E3CA 2HUJA 3TOMA 2GA0A 2EIJC 1ZU5A 4A2NB 2PX0A 4IAQA 1U89A 1ORYA 4PACA 1ZHWA 2FAPB 4MTFA 1SF8A 4Z9HA 2Q4FA 1NU7D 5L0DA 3K1IA 4ULWA 1VYKA 3VF0A 4I3MA 3C18A 3FAJA 3NYLA 2XLMA 2J46A 2Y69C 3O55A 4CIHA 2OOCA 5DS4A 2VB6A 4YN0B 2NSFA 1MQVA 3TJ6A 2XLDA 5JRAA 2HMZA 1R4TA 2P61A 3R2PA 3J06A 4EKWA 4OD5A 5GPGB 3E9VA 1HMDA 2J9BA 1T01A 2A6HF 4IAOA 3RH3A 3TQOA 2EILC 2L6FA 3EGXB 5AC5A 3NRHA 3RKOF 4YL0A 1FNTc 2R03A 2Y3BA 3ASNC 4NQFA 3VM6A 2LP4A 3QMKA 4FAPB 1A7EA 5KYYB 5L0IA 1MMDA 1M57C 3L34A 3ABKC 2YZSA 4BEMJ 4LDRA 3UR3C 2PNOA 3UMHA 2M64A 4YT2A 2P1AA 3AG4C 3NMKA 3S28A 2J0WA 4XPXA 4E0HA 3B0UX 4E17A 3GEIA 2WVOA 2A1DD 2J0XA 1FMWA 2LFFA 5FZTA 2HV6A 4U5GA 4OINF 4OIRF 3T6JA 3N24A 5A6KA 3I4UA 1E85A 2L7AA 2HV7A 3SXZA 4C3DA 2DYRC 2R7TA 4O6NA 3DAGA 4O79A 3RVZA 3FXHA 4QI0A 3W8HA 3B0VC 5COGA 3QTHA 4J7YA 4G0HA 4XLNF 1Q0MA 5DQZA 2L81A 3AG1C 1ZHXA 3Q6MA 2EPNA 4NC3A 4XEVA 2PBEA 2YKZA 3U8VA 3OA1A 4LLCA 2XSEA 3U9MA 1L7CA 1ST6A 3JRMO 1YZAA 4DRHB 1Z7Qc 1GQAA 4RD9A 5L0HA 3POVA 2Y3HA 3HNKA 2ZXWC 2X51A 2MHRA 1PD0A 4FESA 3H2VA 3M4CA 3UMKA 4JEAA 1O5HA 3MFNA 3ECSA 2C03A 1C17M 3TD7A 2E87A 2Q9AA 5L0JA 3QVZA 4AX2A 1O3UA 3WAQA 2WB7A 3JCUQ 2KSFA 2XXAB 4LDKA 3MLGA 4BG0A 3A11A 3AQBA 1TWHA 3GWLA 3SNHA 4BJ5C 4E7SA 2M4EA 1YVIA 2JD3A 4YL3A 4A4AA 3JT1A 1SZIA 2G3VA 4CDAA 5A6BA 2OEXA 1D0ZA 4PK4A 5JT4A 4MVZA 4X0RA 1E2XA 5IY5C 3NMIA 4IJJA 2P0NA 4CSAC 4U5FE 3PCVA 5L0GA 1JPNA 2OKUA 3JSZA 5DLJA 4O6YA 5BQGA 2L6GA 1CGNA 5L0FA 4NTBA 1YLMA 4N6HA 1QZXA 2LD6A 1LI5A 3QZCA 3DJNB 2R7UA 4ULVA 3EPVA 1OXBA 4BJ1A 2AWYA 3EGDA 3F47A 1AUEA 1F1MA 4OIOF 1J8YF 2HZ8A 4OD4A 4PFPA 1E86A 2KJGA 3AG3C 1V54C 1VOMA 2XLEA 1D0YA 3US6A 4B6IA 2XS1A 3KMIA 1Q0GA 3RFYA 4CS8C 3GEHA 1SYQA 1NBBA 1FFHA 4G78A 1OXKA 1TQGA 3DM5A 4MTOA 4G7ZF 4PFOA 2CNWA 1Z63A 2A69F 4YK5A 5KYUB 1K05A 4XTKA 1I5NA 2V26A 5TJ5E 3EHMA 3WODF 3RQEA 1M2OA 3EG9A 2H7BA 1G8XA 3H2UA 4HFKB 4J7TA 1IZMA 2H7VC 3GEEA 3IEEA 2G62A 4JTCB 4PJNA 4DBQA 2OG2A 3L8IA 5EGYA 4QDLA 3PHF2 3G50A 4BEJA 4MVUA 1Z3IX 2WL8A 2IBFA 3CSKA 1RKEA 2XM4A 3DMDA 3DZAA 3N2ZB 3DM9B 4PJMA 2J9UA 1BZ4A 3EH2A 3LNRA 4HFFB 3DXJF 4RDAA 1J8MF 5D91A 2P6VA 3LESA 3CZ6A 2Q7RA 5KYNA 3QW0A 5CI8A 1ZVZA 3HNLA 3U2LA 4FWVA 2MYSA 1PV3A 2XS8A 3HNIA 2LSEA 2GDCA 1RXQA 3KKBA 4ER9A 2WZGA 3E70C 1K04A 3HTKC 5D92A 3C8GA 2AU5A 2J45A 1YYXA 3ZC4A 4DRIB 5JVEA 4OIPF 3SP1A 4U5CE 3G4ZA 3LAYA 5EHHA 1Q0DA 2YLGA 1PD1A 2JX0A 2ZPAA 5K0IA 5HSWA 4JCHA 2XLHA 3UGOA 5BUOA 2OEVA 3S27A 4JJFA 5EK0A 3K33A 1NFNA 1Z5ZA 2OCCC 3CEXA 4JJGA 3X2QC 2PX3A 2QNLA 1CGME 1I4ZA 3KYIA 1QSPA 2D5RB 2AVKA 1RCPA 3ZG1A 4JRZA 3NDBB 1FTSA 3O39A 4JTDB 5FCLA 2I8BA 1GS9A 1ZHZA 1ORSC 2B0HA 3IHUA 3KYJA 4U5HA 4WGZA 2HJMA 4K7BA 4CS9A 2IXNA 3S9OA 5E33A 4P9FA 3SEOA 4K0DA 1YJGA 3PDMP 2R7XA 2YL7A 1GGQA 1V74B 4ZLDA 4O6MA 2ICWG 3AJMA 3Q7LA 1HY5A 4H54A 2Q9BA 2EPOA 3CQZA 4JZAA 1OQCA 4NTFA 4O7GA 2YL3A 4PJLA 2KW3C 2CW0F 3Q7GA 3CAXA 4MS2A 4XEFA 4MQ9F 1TFOB 2NUPA 3GANA 4DBRA 3GM3A 2CDQA 2NUTA 1BBHA 4C3BA 2R7WA 5JSLA 5T3TA 2YLDA 4MNDA 2XLOA 4EHPA 1RKCA 3RVYA 3S0XA 4YL1A 1ZW2A 3JSEO 3LEVA 1YAUO 5B1BC 3EZHA 3LNMB 4ZLCA 2BL2A 1W2WA 4DJ9A 2R7OA 3IQTA 3K1IC 2VCCA 2FFHA 4N6CA 3FAPB 1G5ZA 1NLXA 2Q3TA 5E2QA 2IXMA 4H4KC 4LLEA 3RQFA 4YT8A 3ASOC 3JTLO 4MW3A 3OWTA 2LFDA 4JCZA 4J30B 1UG7A 2KNHA 3HLZA 1JPJA 4AL0A 4E0IA 4G7OF 4WJ0A 2IOQA 3K6BA 1E84A 2XRHA 3W2VA 2DB4A 4MVRA 4Q7CA 1M56C 2HS5A 3M79A 256BA 4NY3A 2R25A 4I1MA 1OKKA 4XPYA 4K1OA 3LEOA 1BR4A 2KC3A 3T9OA 1WTYA 4UDVA 3WHNA 1BR1A 3IQCA 4NCQA 3UNGC 1WOLA 2YQYA 4PR9A 5BQHA 3U2MA 1UFBA 1ZW3A 4R32A 3ZWIA 1WASA 1ZZPA 4BJ6A 4JEBA 4KNWA 4CS9C 3LLKA 1SMYF 2J7PA 5JLIA 1Z6AA 2Q9CA 2UUHA 4JIOA 3EGDB 3Q6NA 3T6BA 3TK0A 1H9GA 4BJTA 3W8IA 4CX9A 2QY9A 1G4WR 1V55C 2WVNA 2YWAA 2R7QA 4WABA 4YJWA 4YWQA 2NSGA 1CPRA 2HSQA 5A6BD 3G4XA 3FOOA 4DVZA 2EPLX 2NPUA 1ZHYA 5BQIA 4GYTA 5KYWB 1DOWA 2WVQA 4N06A 4HE8D 3WG7C 2YLIA 2OJED 4P6IC 2KYHA 4GEHA 4LERA 4MVQA 1NU9C 3TJ5A 2L6HA 3VAYA 3ZQYA 4DXWA 1VLSA 3JYYA 3O10A 1MNDA 5HV9A 1OW7A 4Q4ZF 1U0BB 3RW0A 3EG9B 3KPHA 1MMAA 1VLTA 4CJOA 3S84A 1FMVA 2OU6A 1IW7F 1Q0KA 2VC9A 1YARO 2GAQA 1HW1A 3GORA 3LJBA 3AOUA 4YT5A 3VYWA 3HNJA 2OJQA 5A69A 2TMVP 1Q0FA 5JUAA 3C63A 2HKVA 3GODA 1U6HA 2W45A 3K1HA 2Z15A 3NMJA 4KBLA 1RKEB 1VYIA 2HFIA 2O9XA 2J8WA 2L9JA 3B0PA 4KNVA 1V4AA 1WWPA 3LUTB 4XPWA 4EIYA 2LCHA 3OEOA 5JS5A 2EPKX 3IQ5A 5KYXA 2I15A 2XL6A 3QW1A 5L3VA 1APCA 4OIQF 1A41A 2DGJA 1QVXA 3M4BA 4ONSA 2V3CC 3A9CA 3DI5A 1TKNA 1WGWA 2CNWD 3ABLC 1L3PA 2EPMX 1LE2A 1OCZC 4AE4A 1HW2A 1RJ9A 1VTMP 4J32B 2PP4A 2YEVA 4C7OA 2X0CA 2YL0A 2CYDA 3U8PA 1C03A 1FAPB 2ZD9A 3NKEA 3V5ZA 1NFOA 3L1MA 4CS7A 4E7ZA 1H9TA 3MYFA 1OW8A 1RMVA 2YVKA 3C8GB 3V5YA 4EBJA 5DS6A 4AK9A 2LK4A 2XM0A 1HMOA 4MTGA 4JC7A 2QUPA 4U5DE 4U9EA 1VB5A 4LACB 3U5SA 3K7DA 2A68F 1T6IA 3KH2A 1MMNA 4IWBA 3F46A 2W9YA 2R7VA 3EFOA 3K66A 3T6GB 2W4MA 4C3EA 3SYNA 4AL1A 3R7CA 3VRCA 3PMRA 1JAFA 1JMWA 1B68A 1D1BA 1H6GA 3LS0A 4IRUA 5B3SC 3ZVRA 4EBKA 1SR2A 2Y39A 1OCCC 3TULA 3SXYA 1EQ1A 3UGPA 2A6EF 4D4XA 2QLAA 2R7RA 1CPQA 3C8GD 3RF3A 1M2VA 5COFA 1QQ3A 4CJGA 1KNYA 1GM5A 4M63A 3ITFA 1BR2A 1TFKB 3M15A 2YHSA 4NTAA 4XQ1A 2NUPB 1N1CA 2WZFA 5AGFA 2NUTB 2IM8A 4U9DA 1WN0A 4RBNA 3NYJA 2XLVA 5T1DB 1PCXA 3C8ZA 1YDIA 3NKDA 3U0CA 1LS1A 2YL1A 1A0BA 4JE9A 3EHNA 4XWJA 1LPEA 1CGOA 3ZTMA 3JRTA 2WZLA 1EKYA 2Y3DA 1FFTC 3MBGA 1A7DA 4QI2A 1NSGB 1VMAA 2VCBA 1XWJA 2GWWA 1D1AA 3TOLA 3B29A 4MVOA 1S05A 2MWQA 2AP3A 3GM1A 2YRFA 1G4US 1Z23A 1QLEC 3FMSA 4I44A 4W8KA 3U9JA 4BJ5A 2ETSA 1ZU4A 1TWAA 2H7OA 1O87A 4IGGA 2OQMA 2RD9A 4D4NA 2C04A 4XEKA 1TWGA 1LIHA 2QE9A 3SXMA 4MW8A 3BRJA 3EGXA 4JW1A 1EA8A 1HE1A 2EIKC 3AG2C 4JURI 3V5XA 1AVOB 3ZIBA 4CSAA 3DE8A 1ZHTA 3FOPA 5KYYA 2CCYA 3RQGA 5L3QA 2ZXOA 1QPUA 2XLWA 3UMIA 4LDQA 3U3FA 3ZTZA 3W4YA 4G7HF 3H65A 3C7JA 4Z9IA 1LS4A 2UUIA 3QVYA 2AWCA 3SXKA 1NG1A 5JP7A 1JRAA 4DVYP 2B0JA 5AC4A 1OCOC 1R5ID 3EZIA 3GWNA 4DOZA 1TWCA 1WATA 1C02A 1K40A 3S29A 2EIMC 2LIGA 1JR8A 1LE4A 2IXPA 3IPMO 3ZSUA 2J9WA 5F5FA 4IB4A 2PFDA 3AGTA 2CGEA 3IQ6A 1KU2A 1OKKD 3I5QA 3M1CB 5COMA 3JZ0A 4GQHA 4CDVA 3AGUA 3T4RA 4CS8A 4U5EE 1BDJB 2XL4A 2XL8A 3FDQA 3DKAA 3DD7A 1LI7A 3GM2A 2R02A 1E83A 4YT4A 4E18A 3NG1A 1MNEA 1OR3A 1T6QA 5DS5A 3HKKA 4MVMA 4WGYA 1T6UA 1DOVA 4IARA 4HEAJ 2J7PD 2KQ9A 2R7SA 5L0CA 3O6XA 3DE9A 1I4YA 3S90A 1A7VA 3EJNA 2ZXRA 2ZXPA 1S7ZA 2DYSC 3X1OA 3U3BA 4ANJA 2P7VA 1XZQA 4CBEA 4EWCA 1D0XA 2RSEB 1HE9A 4DRJB 3EH1A 5KYXB 5F5HA 1YYJA 1AEPA 4Q5SF 1YA7O 2Y3GA 1VK5A 2VCAA 5A6JA 2BC5A 1LKXA 5B1AC 3FHDA 1T9KA 2J9VA 3ZQVA 3DAFA 4Z9JA 3HJCA 3B71A 3EQLF 2Q00A 1D1CA 2XXAA 1KTMA 4AE4B 1RJ9B 3MYIA 2LQGA 4P9TA 5F28E 4C7OB 4KC9A 5DVWA 2D4UA 2A0BA 3KL4A 3DWWA 1LVKA 1T5OA 3N0TA 3JYHA 4KI2A 3B9QA 3BEHA 3LLIA 2F22A 3L8JA 4JTAB 4N4WA 4MVSA 4CDYA 1ZYRF 2IXOA 5CI9A 4EBBA 2EINC 4BPMA 4BJ6C 2H8AA 1OW6A 2ASRA 3ABMC 2R05A 1JOGA 1OCRC 1TR2A 2W4BA 3I5PA 1YA9A 4JVSA 1FR0A 5KYWA 1EI7A 3EFOB 3V7OA 2KK1A 1Y4CA 4U5BE 3LS1A 4CIPA 5B3IA 2VASA 2HSBA 5E3AA 2G3KA 2A0UA 2FGYA 1XZPA 2GFHA 3DJUB 2JPUA 3MX3A 2PF4E 4FX5A 2HMQA 1M6TA 2BE5F 2DI3A 4I1OB 3RIPA 1LM3B 3W2WA 3FVYA 2NG1A 1YZCA 3ATPA 1QKRA 3NYMA 4L6RA 4JKVA 3SZRA 5DQTA 4W8PA 5A6AA 1M2VB 2HJ3A 4PJJA 4EUKB 5T3WA 4F4BA 2R9RB 3RYLA 1NZEA 3C62A 1MMGA
chains in the Genus database with same CATH topology
1Y6DA 3U3BA 1YVIA 1SR2A 1C03A 1C02A 2LP4A 1FR0A 3MYFA 3US6A 3KYIA 1QSPA 3IQTA 4PACA 2Q4FA 4G78A 1OXKA 1TQGA 3KYJA 1BDJB 1WN0A 1I5NA 2OOCA 2A0BA 2LCHA 2LD6A 1A0BA 4EUKB 1OXBA 2R25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y6D A;  3U3B A;  1YVI A;  1SR2 A;  1C03 A;  1C02 A;  2LP4 A;  1FR0 A;  3MYF A;  3US6 A;  3KYI A;  1QSP A;  3IQT A;  4PAC A;  2Q4F A;  4G78 A;  1OXK A;  1TQG A;  3KYJ A;  1BDJ B;  1WN0 A;  1I5N A;  2OOC A;  2A0B A;  2LCH A;  2LD6 A;  1A0B A;  4EUK B;  1OXB A;  2R25 A; 
#chains in the Genus database with same CATH topology
 1Y6D A;  1OR2 A;  2KGO A;  4XLP F;  3ZDL A;  3AQC A;  1ORJ A;  3L0I A;  2QTV A;  2VH3 A;  5CIV A;  2IYL D;  5KYU A;  1H7I A;  5E3C A;  2HUJ A;  3TOM A;  2GA0 A;  2EIJ C;  1ZU5 A;  4A2N B;  2PX0 A;  4IAQ A;  1U89 A;  1ORY A;  4PAC A;  1ZHW A;  2FAP B;  4MTF A;  1SF8 A;  4Z9H A;  2Q4F A;  1NU7 D;  5L0D A;  3K1I A;  4ULW A;  1VYK A;  3VF0 A;  4I3M A;  3C18 A;  3FAJ A;  3NYL A;  2XLM A;  2J46 A;  2Y69 C;  3O55 A;  4CIH A;  2OOC A;  5DS4 A;  2VB6 A;  4YN0 B;  2NSF A;  1MQV A;  3TJ6 A;  2XLD A;  5JRA A;  2HMZ A;  1R4T A;  2P61 A;  3R2P A;  3J06 A;  4EKW A;  4OD5 A;  5GPG B;  3E9V A;  1HMD A;  2J9B A;  1T01 A;  2A6H F;  4IAO A;  3RH3 A;  3TQO A;  2EIL C;  2L6F A;  3EGX B;  5AC5 A;  3NRH A;  3RKO F;  4YL0 A;  1FNT c;  2R03 A;  2Y3B A;  3ASN C;  4NQF A;  3VM6 A;  2LP4 A;  3QMK A;  4FAP B;  1A7E A;  5KYY B;  5L0I A;  1MMD A;  1M57 C;  3L34 A;  3ABK C;  2YZS A;  4BEM J;  4LDR A;  3UR3 C;  2PNO A;  3UMH A;  2M64 A;  4YT2 A;  2P1A A;  3AG4 C;  3NMK A;  3S28 A;  2J0W A;  4XPX A;  4E0H A;  3B0U X;  4E17 A;  3GEI A;  2WVO A;  2A1D D;  2J0X A;  1FMW A;  2LFF A;  5FZT A;  2HV6 A;  4U5G A;  4OIN F;  4OIR F;  3T6J A;  3N24 A;  5A6K A;  3I4U A;  1E85 A;  2L7A A;  2HV7 A;  3SXZ A;  4C3D A;  2DYR C;  2R7T A;  4O6N A;  3DAG A;  4O79 A;  3RVZ A;  3FXH A;  4QI0 A;  3W8H A;  3B0V C;  5COG A;  3QTH A;  4J7Y A;  4G0H A;  4XLN F;  1Q0M A;  5DQZ A;  2L81 A;  3AG1 C;  1ZHX A;  3Q6M A;  2EPN A;  4NC3 A;  4XEV A;  2PBE A;  2YKZ A;  3U8V A;  3OA1 A;  4LLC A;  2XSE A;  3U9M A;  1L7C A;  1ST6 A;  3JRM O;  1YZA A;  4DRH B;  1Z7Q c;  1GQA A;  4RD9 A;  5L0H A;  3POV A;  2Y3H A;  3HNK A;  2ZXW C;  2X51 A;  2MHR A;  1PD0 A;  4FES A;  3H2V A;  3M4C A;  3UMK A;  4JEA A;  1O5H A;  3MFN A;  3ECS A;  2C03 A;  1C17 M;  3TD7 A;  2E87 A;  2Q9A A;  5L0J A;  3QVZ A;  4AX2 A;  1O3U A;  3WAQ A;  2WB7 A;  3JCU Q;  2KSF A;  2XXA B;  4LDK A;  3MLG A;  4BG0 A;  3A11 A;  3AQB A;  1TWH A;  3GWL A;  3SNH A;  4BJ5 C;  4E7S A;  2M4E A;  1YVI A;  2JD3 A;  4YL3 A;  4A4A A;  3JT1 A;  1SZI A;  2G3V A;  4CDA A;  5A6B A;  2OEX A;  1D0Z A;  4PK4 A;  5JT4 A;  4MVZ A;  4X0R A;  1E2X A;  5IY5 C;  3NMI A;  4IJJ A;  2P0N A;  4CSA C;  4U5F E;  3PCV A;  5L0G A;  1JPN A;  2OKU A;  3JSZ A;  5DLJ A;  4O6Y A;  5BQG A;  2L6G A;  1CGN A;  5L0F A;  4NTB A;  1YLM A;  4N6H A;  1QZX A;  2LD6 A;  1LI5 A;  3QZC A;  3DJN B;  2R7U A;  4ULV A;  3EPV A;  1OXB A;  4BJ1 A;  2AWY A;  3EGD A;  3F47 A;  1AUE A;  1F1M A;  4OIO F;  1J8Y F;  2HZ8 A;  4OD4 A;  4PFP A;  1E86 A;  2KJG A;  3AG3 C;  1V54 C;  1VOM A;  2XLE A;  1D0Y A;  3US6 A;  4B6I A;  2XS1 A;  3KMI A;  1Q0G A;  3RFY A;  4CS8 C;  3GEH A;  1SYQ A;  1NBB A;  1FFH A;  4G78 A;  1OXK A;  1TQG A;  3DM5 A;  4MTO A;  4G7Z F;  4PFO A;  2CNW A;  1Z63 A;  2A69 F;  4YK5 A;  5KYU B;  1K05 A;  4XTK A;  1I5N A;  2V26 A;  5TJ5 E;  3EHM A;  3WOD F;  3RQE A;  1M2O A;  3EG9 A;  2H7B A;  1G8X A;  3H2U A;  4HFK B;  4J7T A;  1IZM A;  2H7V C;  3GEE A;  3IEE A;  2G62 A;  4JTC B;  4PJN A;  4DBQ A;  2OG2 A;  3L8I A;  5EGY A;  4QDL A;  3PHF 2;  3G50 A;  4BEJ A;  4MVU A;  1Z3I X;  2WL8 A;  2IBF A;  3CSK A;  1RKE A;  2XM4 A;  3DMD A;  3DZA A;  3N2Z B;  3DM9 B;  4PJM A;  2J9U A;  1BZ4 A;  3EH2 A;  3LNR A;  4HFF B;  3DXJ F;  4RDA A;  1J8M F;  5D91 A;  2P6V A;  3LES A;  3CZ6 A;  2Q7R A;  5KYN A;  3QW0 A;  5CI8 A;  1ZVZ A;  3HNL A;  3U2L A;  4FWV A;  2MYS A;  1PV3 A;  2XS8 A;  3HNI A;  2LSE A;  2GDC A;  1RXQ A;  3KKB A;  4ER9 A;  2WZG A;  3E70 C;  1K04 A;  3HTK C;  5D92 A;  3C8G A;  2AU5 A;  2J45 A;  1YYX A;  3ZC4 A;  4DRI B;  5JVE A;  4OIP F;  3SP1 A;  4U5C E;  3G4Z A;  3LAY A;  5EHH A;  1Q0D A;  2YLG A;  1PD1 A;  2JX0 A;  2ZPA A;  5K0I A;  5HSW A;  4JCH A;  2XLH A;  3UGO A;  5BUO A;  2OEV A;  3S27 A;  4JJF A;  5EK0 A;  3K33 A;  1NFN A;  1Z5Z A;  2OCC C;  3CEX A;  4JJG A;  3X2Q C;  2PX3 A;  2QNL A;  1CGM E;  1I4Z A;  3KYI A;  1QSP A;  2D5R B;  2AVK A;  1RCP A;  3ZG1 A;  4JRZ A;  3NDB B;  1FTS A;  3O39 A;  4JTD B;  5FCL A;  2I8B A;  1GS9 A;  1ZHZ A;  1ORS C;  2B0H A;  3IHU A;  3KYJ A;  4U5H A;  4WGZ A;  2HJM A;  4K7B A;  4CS9 A;  2IXN A;  3S9O A;  5E33 A;  4P9F A;  3SEO A;  4K0D A;  1YJG A;  3PDM P;  2R7X A;  2YL7 A;  1GGQ A;  1V74 B;  4ZLD A;  4O6M A;  2ICW G;  3AJM A;  3Q7L A;  1HY5 A;  4H54 A;  2Q9B A;  2EPO A;  3CQZ A;  4JZA A;  1OQC A;  4NTF A;  4O7G A;  2YL3 A;  4PJL A;  2KW3 C;  2CW0 F;  3Q7G A;  3CAX A;  4MS2 A;  4XEF A;  4MQ9 F;  1TFO B;  2NUP A;  3GAN A;  4DBR A;  3GM3 A;  2CDQ A;  2NUT A;  1BBH A;  4C3B A;  2R7W A;  5JSL A;  5T3T A;  2YLD A;  4MND A;  2XLO A;  4EHP A;  1RKC A;  3RVY A;  3S0X A;  4YL1 A;  1ZW2 A;  3JSE O;  3LEV A;  1YAU O;  5B1B C;  3EZH A;  3LNM B;  4ZLC A;  2BL2 A;  1W2W A;  4DJ9 A;  2R7O A;  3IQT A;  3K1I C;  2VCC A;  2FFH A;  4N6C A;  3FAP B;  1G5Z A;  1NLX A;  2Q3T A;  5E2Q A;  2IXM A;  4H4K C;  4LLE A;  3RQF A;  4YT8 A;  3ASO C;  3JTL O;  4MW3 A;  3OWT A;  2LFD A;  4JCZ A;  4J30 B;  1UG7 A;  2KNH A;  3HLZ A;  1JPJ A;  4AL0 A;  4E0I A;  4G7O F;  4WJ0 A;  2IOQ A;  3K6B A;  1E84 A;  2XRH A;  3W2V A;  2DB4 A;  4MVR A;  4Q7C A;  1M56 C;  2HS5 A;  3M79 A;  256B A;  4NY3 A;  2R25 A;  4I1M A;  1OKK A;  4XPY A;  4K1O A;  3LEO A;  1BR4 A;  2KC3 A;  3T9O A;  1WTY A;  4UDV A;  3WHN A;  1BR1 A;  3IQC A;  4NCQ A;  3UNG C;  1WOL A;  2YQY A;  4PR9 A;  5BQH A;  3U2M A;  1UFB A;  1ZW3 A;  4R32 A;  3ZWI A;  1WAS A;  1ZZP A;  4BJ6 A;  4JEB A;  4KNW A;  4CS9 C;  3LLK A;  1SMY F;  2J7P A;  5JLI A;  1Z6A A;  2Q9C A;  2UUH A;  4JIO A;  3EGD B;  3Q6N A;  3T6B A;  3TK0 A;  1H9G A;  4BJT A;  3W8I A;  4CX9 A;  2QY9 A;  1G4W R;  1V55 C;  2WVN A;  2YWA A;  2R7Q A;  4WAB A;  4YJW A;  4YWQ A;  2NSG A;  1CPR A;  2HSQ A;  5A6B D;  3G4X A;  3FOO A;  4DVZ A;  2EPL X;  2NPU A;  1ZHY A;  5BQI A;  4GYT A;  5KYW B;  1DOW A;  2WVQ A;  4N06 A;  4HE8 D;  3WG7 C;  2YLI A;  2OJE D;  4P6I C;  2KYH A;  4GEH A;  4LER A;  4MVQ A;  1NU9 C;  3TJ5 A;  2L6H A;  3VAY A;  3ZQY A;  4DXW A;  1VLS A;  3JYY A;  3O10 A;  1MND A;  5HV9 A;  1OW7 A;  4Q4Z F;  1U0B B;  3RW0 A;  3EG9 B;  3KPH A;  1MMA A;  1VLT A;  4CJO A;  3S84 A;  1FMV A;  2OU6 A;  1IW7 F;  1Q0K A;  2VC9 A;  1YAR O;  2GAQ A;  1HW1 A;  3GOR A;  3LJB A;  3AOU A;  4YT5 A;  3VYW A;  3HNJ A;  2OJQ A;  5A69 A;  2TMV P;  1Q0F A;  5JUA A;  3C63 A;  2HKV A;  3GOD A;  1U6H A;  2W45 A;  3K1H A;  2Z15 A;  3NMJ A;  4KBL A;  1RKE B;  1VYI A;  2HFI A;  2O9X A;  2J8W A;  2L9J A;  3B0P A;  4KNV A;  1V4A A;  1WWP A;  3LUT B;  4XPW A;  4EIY A;  2LCH A;  3OEO A;  5JS5 A;  2EPK X;  3IQ5 A;  5KYX A;  2I15 A;  2XL6 A;  3QW1 A;  5L3V A;  1APC A;  4OIQ F;  1A41 A;  2DGJ A;  1QVX A;  3M4B A;  4ONS A;  2V3C C;  3A9C A;  3DI5 A;  1TKN A;  1WGW A;  2CNW D;  3ABL C;  1L3P A;  2EPM X;  1LE2 A;  1OCZ C;  4AE4 A;  1HW2 A;  1RJ9 A;  1VTM P;  4J32 B;  2PP4 A;  2YEV A;  4C7O A;  2X0C A;  2YL0 A;  2CYD A;  3U8P A;  1C03 A;  1FAP B;  2ZD9 A;  3NKE A;  3V5Z A;  1NFO A;  3L1M A;  4CS7 A;  4E7Z A;  1H9T A;  3MYF A;  1OW8 A;  1RMV A;  2YVK A;  3C8G B;  3V5Y A;  4EBJ A;  5DS6 A;  4AK9 A;  2LK4 A;  2XM0 A;  1HMO A;  4MTG A;  4JC7 A;  2QUP A;  4U5D E;  4U9E A;  1VB5 A;  4LAC B;  3U5S A;  3K7D A;  2A68 F;  1T6I A;  3KH2 A;  1MMN A;  4IWB A;  3F46 A;  2W9Y A;  2R7V A;  3EFO A;  3K66 A;  3T6G B;  2W4M A;  4C3E A;  3SYN A;  4AL1 A;  3R7C A;  3VRC A;  3PMR A;  1JAF A;  1JMW A;  1B68 A;  1D1B A;  1H6G A;  3LS0 A;  4IRU A;  5B3S C;  3ZVR A;  4EBK A;  1SR2 A;  2Y39 A;  1OCC C;  3TUL A;  3SXY A;  1EQ1 A;  3UGP A;  2A6E F;  4D4X A;  2QLA A;  2R7R A;  1CPQ A;  3C8G D;  3RF3 A;  1M2V A;  5COF A;  1QQ3 A;  4CJG A;  1KNY A;  1GM5 A;  4M63 A;  3ITF A;  1BR2 A;  1TFK B;  3M15 A;  2YHS A;  4NTA A;  4XQ1 A;  2NUP B;  1N1C A;  2WZF A;  5AGF A;  2NUT B;  2IM8 A;  4U9D A;  1WN0 A;  4RBN A;  3NYJ A;  2XLV A;  5T1D B;  1PCX A;  3C8Z A;  1YDI A;  3NKD A;  3U0C A;  1LS1 A;  2YL1 A;  1A0B A;  4JE9 A;  3EHN A;  4XWJ A;  1LPE A;  1CGO A;  3ZTM A;  3JRT A;  2WZL A;  1EKY A;  2Y3D A;  1FFT C;  3MBG A;  1A7D A;  4QI2 A;  1NSG B;  1VMA A;  2VCB A;  1XWJ A;  2GWW A;  1D1A A;  3TOL A;  3B29 A;  4MVO A;  1S05 A;  2MWQ A;  2AP3 A;  3GM1 A;  2YRF A;  1G4U S;  1Z23 A;  1QLE C;  3FMS A;  4I44 A;  4W8K A;  3U9J A;  4BJ5 A;  2ETS A;  1ZU4 A;  1TWA A;  2H7O A;  1O87 A;  4IGG A;  2OQM A;  2RD9 A;  4D4N A;  2C04 A;  4XEK A;  1TWG A;  1LIH A;  2QE9 A;  3SXM A;  4MW8 A;  3BRJ A;  3EGX A;  4JW1 A;  1EA8 A;  1HE1 A;  2EIK C;  3AG2 C;  4JUR I;  3V5X A;  1AVO B;  3ZIB A;  4CSA A;  3DE8 A;  1ZHT A;  3FOP A;  5KYY A;  2CCY A;  3RQG A;  5L3Q A;  2ZXO A;  1QPU A;  2XLW A;  3UMI A;  4LDQ A;  3U3F A;  3ZTZ A;  3W4Y A;  4G7H F;  3H65 A;  3C7J A;  4Z9I A;  1LS4 A;  2UUI A;  3QVY A;  2AWC A;  3SXK A;  1NG1 A;  5JP7 A;  1JRA A;  4DVY P;  2B0J A;  5AC4 A;  1OCO C;  1R5I D;  3EZI A;  3GWN A;  4DOZ A;  1TWC A;  1WAT A;  1C02 A;  1K40 A;  3S29 A;  2EIM C;  2LIG A;  1JR8 A;  1LE4 A;  2IXP A;  3IPM O;  3ZSU A;  2J9W A;  5F5F A;  4IB4 A;  2PFD A;  3AGT A;  2CGE A;  3IQ6 A;  1KU2 A;  1OKK D;  3I5Q A;  3M1C B;  5COM A;  3JZ0 A;  4GQH A;  4CDV A;  3AGU A;  3T4R A;  4CS8 A;  4U5E E;  1BDJ B;  2XL4 A;  2XL8 A;  3FDQ A;  3DKA A;  3DD7 A;  1LI7 A;  3GM2 A;  2R02 A;  1E83 A;  4YT4 A;  4E18 A;  3NG1 A;  1MNE A;  1OR3 A;  1T6Q A;  5DS5 A;  3HKK A;  4MVM A;  4WGY A;  1T6U A;  1DOV A;  4IAR A;  4HEA J;  2J7P D;  2KQ9 A;  2R7S A;  5L0C A;  3O6X A;  3DE9 A;  1I4Y A;  3S90 A;  1A7V A;  3EJN A;  2ZXR A;  2ZXP A;  1S7Z A;  2DYS C;  3X1O A;  3U3B A;  4ANJ A;  2P7V A;  1XZQ A;  4CBE A;  4EWC A;  1D0X A;  2RSE B;  1HE9 A;  4DRJ B;  3EH1 A;  5KYX B;  5F5H A;  1YYJ A;  1AEP A;  4Q5S F;  1YA7 O;  2Y3G A;  1VK5 A;  2VCA A;  5A6J A;  2BC5 A;  1LKX A;  5B1A C;  3FHD A;  1T9K A;  2J9V A;  3ZQV A;  3DAF A;  4Z9J A;  3HJC A;  3B71 A;  3EQL F;  2Q00 A;  1D1C A;  2XXA A;  1KTM A;  4AE4 B;  1RJ9 B;  3MYI A;  2LQG A;  4P9T A;  5F28 E;  4C7O B;  4KC9 A;  5DVW A;  2D4U A;  2A0B A;  3KL4 A;  3DWW A;  1LVK A;  1T5O A;  3N0T A;  3JYH A;  4KI2 A;  3B9Q A;  3BEH A;  3LLI A;  2F22 A;  3L8J A;  4JTA B;  4N4W A;  4MVS A;  4CDY A;  1ZYR F;  2IXO A;  5CI9 A;  4EBB A;  2EIN C;  4BPM A;  4BJ6 C;  2H8A A;  1OW6 A;  2ASR A;  3ABM C;  2R05 A;  1JOG A;  1OCR C;  1TR2 A;  2W4B A;  3I5P A;  1YA9 A;  4JVS A;  1FR0 A;  5KYW A;  1EI7 A;  3EFO B;  3V7O A;  2KK1 A;  1Y4C A;  4U5B E;  3LS1 A;  4CIP A;  5B3I A;  2VAS A;  2HSB A;  5E3A A;  2G3K A;  2A0U A;  2FGY A;  1XZP A;  2GFH A;  3DJU B;  2JPU A;  3MX3 A;  2PF4 E;  4FX5 A;  2HMQ A;  1M6T A;  2BE5 F;  2DI3 A;  4I1O B;  3RIP A;  1LM3 B;  3W2W A;  3FVY A;  2NG1 A;  1YZC A;  3ATP A;  1QKR A;  3NYM A;  4L6R A;  4JKV A;  3SZR A;  5DQT A;  4W8P A;  5A6A A;  1M2V B;  2HJ3 A;  4PJJ A;  4EUK B;  5T3W A;  4F4B A;  2R9R B;  3RYL A;  1NZE A;  3C62 A;  1MMG A; 
#chains in the Genus database with same CATH homology
 1Y6D A;  3U3B A;  1YVI A;  1SR2 A;  1C03 A;  1C02 A;  2LP4 A;  1FR0 A;  3MYF A;  3US6 A;  3KYI A;  1QSP A;  3IQT A;  4PAC A;  2Q4F A;  4G78 A;  1OXK A;  1TQG A;  3KYJ A;  1BDJ B;  1WN0 A;  1I5N A;  2OOC A;  2A0B A;  2LCH A;  2LD6 A;  1A0B A;  4EUK B;  1OXB A;  2R25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...