1EA8A

Apolipoprotein e3 22kd fragment lys146glu mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
140
structure length
140
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRERLLRDADDLQKRLAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Apolipoprotein E3 22Kd Fragment Lys146Gln Mutant
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords APOLIPOPROTEIN E
total genus 65
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2001-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1ea8A00
1EA8A 2KC3A 1B68A 3S84A 1AEPA 1OR3A 1LE4A 1GS9A 1H7IA 1BZ4A 1LS4A 1EQ1A 1LPEA 1NFNA 1OR2A 1YA9A 1LE2A 3R2PA 1NFOA
chains in the Genus database with same CATH superfamily
3K6BA 5HV9A 1YJGA 3FMSA 4JIOA 1O5HA 4EBKA 1KTMA 2KK1A 4XLPF 1ST6A 3ZTZA 2XRHA 3K1IC 3KYIA 4NCQA 3HNIA 3S27A 5L0CA 4YJWA 3MFNA 1OCOC 4K7BA 3OA1A 4OD5A 5KYYA 5HSWA 1K05A 1KU2A 2QY9A 2PX3A 3GODA 4LACB 3VF0A 3ZTMA 1T6QA 2G62A 2J0WA 2WL8A 3RH3A 4PJNA 5DS6A 1ZYRF 3Q6MA 4JVSA 2Q7RA 4KC9A 2J7PA 3T9OA 3V5ZA 5DQTA 2EPKX 5T3TA 3TQOA 1A7VA 1I5NA 1XWJA 4IRUA 4LDKA 3S90A 2XL4A 3TD7A 1S05A 1D1CA 3Q7LA 1M57C 1ZHYA 3EFOA 3RQGA 1Q0MA 2EPNA 4G78A 2P1AA 2J9UA 4MTOA 2J9WA 4O79A 3NYMA 3IQCA 2L6FA 1T6IA 4IJJA 4CDAA 1IW7F 3GORA 4KI2A 4IARA 4AK9A 4XEKA 3EH2A 3PHF2 2PF4E 2Q9BA 3NYJA 4U5BE 4BJ6A 2OKUA 3LLIA 1A0BA 4MW8A 2A0UA 5B1BC 1MNEA 2IBFA 1OCCC 1RKEA 2CDQA 4XQ1A 1LIHA 3EZIA 4XEVA 3JSEO 3LNRA 3WODF 1I4ZA 2CYDA 4C7OA 3ZQYA 1J8MF 4MVQA 5K0IA 3Q7GA 3S28A 3LNMB 2LP4A 2EPOA 4LLCA 3HJCA 3SXKA 1NLXA 3EZHA 1V74B 3EHNA 3S29A 2XXAA 1G4US 2ASRA 4LERA 4R32A 1RCPA 5D91A 4BPMA 3CAXA 3RW0A 1YZCA 2IOQA 3JSZA 2QTVA 2LFDA 2OQMA 4YL1A 1LVKA 3N2ZB 2YL0A 4MNDA 2AWCA 1M2OA 3DM5A 5KYNA 2VB6A 3B0PA 1F1MA 4ZLDA 4G7OF 4N4WA 4CS8C 4BJ6C 2EPLX 2PP4A 3QTHA 4JC7A 2X0CA 3W8IA 3BRJA 1D1AA 2IXMA 4E0HA 1VK5A 3NMKA 1FMWA 1YARO 4CBEA 2P61A 1EKYA 4D4XA 3SP1A 5COGA 4KNVA 1RMVA 2R7UA 3V7OA 4UDVA 1VYIA 3VAYA 4CDVA 2GA0A 4EHPA 3FHDA 3ZDLA 3C8GB 1Z5ZA 3VYWA 1YA9A 3RKOF 2AU5A 2KYHA 1E83A 2RSEB 3GWLA 2GWWA 5BQHA 1G5ZA 2X51A 2YRFA 3B29A 2MWQA 1C03A 3FOPA 4LLEA 4NTBA 4X0RA 3AG3C 2XM4A 2NUPA 2R7XA 4MVUA 2XL6A 4PFOA 1HW2A 2R7SA 3DM9B 3ZWIA 1VLTA 2VCBA 3SNHA 3DJUB 2YEVA 3DE8A 3OEOA 3C18A 4WABA 4XPYA 1OW8A 1D0XA 3RYLA 1OQCA 2L6GA 3ZVRA 5AC4A 3A9CA 4K1OA 2KJGA 4IWBA 2J45A 5A69A 3SZRA 2QLAA 2VCCA 1SMYF 5FCLA 4C3DA 2XLHA 5BQIA 2DYSC 1Q0KA 3FVYA 5AGFA 3EGDB 4GQHA 1NBBA 3QW0A 3T6BA 3C8GD 2L81A 3QW1A 4CJGA 3L1MA 3HNJA 3MYIA 5B1AC 4DXWA 3DXJF 2Z15A 3LLKA 4FAPB 4C3BA 2XM0A 4ER9A 2Q4FA 3MX3A 4NQFA 5TJ5E 3M15A 1RKCA 3AG2C 4JZAA 1BBHA 4MVRA 3X1OA 1H9TA 5A6JA 1M6TA 3L8IA 1OCZC 3EH1A 2ETSA 4XWJA 1Z63A 4U5CE 4MVZA 2XLWA 4ANJA 3FAJA 4EWCA 2LIGA 5COFA 1SYQA 4CJOA 1O87A 1ZHZA 3UGPA 1TFKB 1TFOB 2G3KA 1N1CA 1ZZPA 3C8ZA 1TQGA 3CQZA 2DI3A 1NG1A 256BA 3I4UA 1JAFA 1SR2A 2NUTA 5CIVA 4EBJA 4ULWA 4MVOA 1GGQA 3FDQA 1VOMA 3DKAA 2AWYA 1YYXA 1IZMA 1TWHA 2G3VA 4E7ZA 3SXYA 2VC9A 2ZXWC 2W45A 4J32B 3DWWA 2XLOA 4P6IC 4XEFA 4A2NB 4A4AA 4EIYA 1UG7A 4YT2A 2R03A 1BZ4A 2FFHA 3UMHA 1ZHTA 4MTGA 4AE4A 2LQGA 2L6HA 1NSGB 2B0JA 4P9TA 1HE9A 2NSGA 3SYNA 4BJ5C 1CPRA 2HMZA 4MQ9F 3ASNC 2DB4A 4I44A 1LS4A 5KYYB 4W8PA 1J8YF 2J9BA 2LSEA 2A68F 3LAYA 2XLVA 2OEXA 3UGOA 4JJGA 1D0ZA 1EQ1A 1LI5A 4U5DE 2P7VA 4MTFA 3SEOA 3NRHA 4RD9A 1MMAA 3CSKA 3DZAA 5JP7A 2EINC 3ATPA 3H65A 2EPMX 3K33A 4MVMA 5E2QA 2NSFA 1GS9A 2HUJA 2MYSA 2FGYA 4DOZA 2NUPB 2NUTB 2JD3A 3K1IA 3LS1A 2HV6A 1A7DA 4M63A 2A0BA 2Y39A 1GM5A 1OCRC 2W9YA 4XTKA 2DGJA 2LCHA 3EQLF 3OWTA 5A6AA 4PJLA 1LPEA 2PNOA 1S7ZA 2OU6A 2PBEA 2PFDA 5F28E 5L0IA 1KNYA 3I5QA 3C8GA 4PJJA 5JSLA 2HZ8A 2ZD9A 3T6JA 4BJ5A 5L0GA 2XL8A 4E17A 1OXKA 2Y3HA 2UUHA 4O7GA 3WAQA 5BQGA 1JMWA 1C17M 2IXNA 1V54C 2EIKC 5L0JA 3AGTA 4JTCB 3LESA 3GEHA 2KQ9A 1WTYA 1L7CA 2A6EF 2VASA 1OKKA 3KYJA 3LS0A 4NC3A 3X2QC 5IY5C 3I5PA 2LK4A 4RDAA 3ZIBA 2I8BA 3T4RA 3ASOC 3L34A 2YVKA 3EPVA 4C7OB 1VMAA 1K40A 2A6HF 5COMA 5EK0A 1BR2A 2WZLA 1JRAA 2HS5A 4XLNF 2AVKA 2LD6A 2M64A 2IM8A 3WHNA 1TWAA 4HFFB 3W2WA 4DRHB 3SXZA 3GM2A 2DYRC 2OOCA 3HTKC 3JCUQ 4JTDB 4W8KA 1Q0GA 4OD4A 2BE5F 3ECSA 4DRIB 2KSFA 2RD9A 3KKBA 4PACA 3NMJA 3EJNA 3AG1C 5AC5A 4DRJB 2B0HA 1A7EA 1FFHA 3DAGA 4EUKB 4OIQF 3JZ0A 3G50A 3IQ6A 1WGWA 2CW0F 1YYJA 1H6GA 1V55C 4FX5A 4CDYA 4N6CA 2J7PD 1JPNA 2Q9AA 2ZXPA 2WZFA 5E3AA 4KBLA 4ONSA 4AL0A 1PV3A 4JRZA 4MW3A 3CZ6A 4ZLCA 3JRTA 3TJ6A 5L3VA 1ZU4A 1YVIA 1GQAA 3VM6A 5EHHA 4NTAA 1E85A 1NZEA 3PDMP 4HEAJ 3JTLO 4EBBA 1B68A 1QKRA 2YKZA 3B9QA 3CEXA 3EGDA 1G4WR 4IAQA 4AX2A 1MNDA 4C3EA 2NPUA 3RF3A 2R7VA 5DLJA 2WVOA 5KYXA 1LE2A 2IYLD 4QI2A 1EA8A 1QLEC 4IAOA 5FZTA 3EGXB 4JE9A 3TOLA 5B3IA 2HFIA 2GFHA 1AVOB 3O10A 3ZQVA 1MMDA 4KNWA 4F4BA 2YLIA 3Q6NA 3JYYA 2HMQA 1QVXA 1Z6AA 3GWNA 1CGME 3A11A 4BEJA 2XXAB 4YN0B 1A41A 2J0XA 2XLEA 4ULVA 3ZSUA 3MLGA 1EI7A 1QPUA 5B3SC 4CIPA 5JUAA 2L7AA 4O6YA 5JVEA 1ZU5A 1T01A 4PJMA 3RVYA 1UFBA 2OJQA 4QDLA 3EFOB 3IHUA 3KL4A 3ZC4A 4PFPA 3W8HA 4Q4ZF 3PMRA 3RIPA 3RQFA 3F46A 3B71A 2P0NA 4DBRA 4JEBA 1R4TA 2D5RB 1Q0DA 3U9MA 1K04A 1ZW2A 4OIOF 2ICWG 1TR2A 4DBQA 3K1HA 3K7DA 4JW1A 2D4UA 5D92A 1MMGA 5DQZA 3IQTA 3KMIA 4JCHA 1WOLA 2HV7A 2M4EA 2YLGA 4OINF 4CSAC 3C62A 1ZHWA 1DOWA 1VYKA 2I15A 2Q9CA 2JX0A 4I1MA 3POVA 2A69F 1YZAA 4EKWA 1YA7O 3J06A 4YL0A 1NFNA 4QI0A 4DVYP 4Z9HA 1OR2A 1WASA 1XZPA 5DS4A 4BJTA 3RVZA 1HW1A 2Y3GA 4CS9A 4E18A 1U0BB 1QQ3A 2BC5A 4YT8A 1U89A 2YL1A 4FWVA 2R05A 2W4BA 3U8PA 1WWPA 3AJMA 1DOVA 1RJ9A 4PR9A 1OW6A 3NKEA 1JR8A 1AUEA 1FMVA 3B0VC 1T5OA 1ZVZA 5DVWA 1Z7Qc 1FAPB 2CNWD 3FAPB 3W2VA 3RFYA 4DVZA 2YL3A 4JCZA 2OCCC 3M1CB 3U3BA 5KYUB 4G7HF 3TJ5A 1LM3B 1OXBA 2O9XA 2Y3BA 1R5ID 1Z23A 3FOOA 1AEPA 1APCA 1SZIA 4I1OB 3AOUA 2C04A 2ZXOA 4JJFA 4YK5A 4CSAA 3K66A 1ORJA 1VB5A 3IPMO 4XPXA 4IB4A 2GDCA 2FAPB 1FFTC 2Q00A 2XLMA 3PCVA 4WGYA 3DI5A 2ZPAA 4O6NA 3U8VA 3V5YA 4CX9A 2HSBA 1VTMP 1VLSA 4AL1A 3GEEA 4YWQA 3H2UA 1M56C 1MQVA 1T9KA 4WGZA 3E70C 4MS2A 5A6BD 2OG2A 3U3FA 1WATA 2HKVA 3GM3A 2YHSA 5JS5A 1C02A 1HE1A 1OKKD 1PD0A 4E0IA 2J46A 4N6HA 3NDBB 3M4CA 3N24A 1Z3IX 3MBGA 4K0DA 3KH2A 1D1BA 4CS9C 5L0FA 5F5FA 3DAFA 3LEOA 1FTSA 2KW3C 3S0XA 3U9JA 1Q0FA 1PCXA 2R7QA 4H54A 4D4NA 2L9JA 2EILC 4U5GA 2R7OA 1NFOA 1O3UA 3E9VA 3JRMO 2PX0A 5CI9A 3H2VA 4YT5A 2EIJC 3T6GB 1LE4A 4BJ1A 5DS5A 3B0UX 2HJ3A 3QVZA 3LUTB 2C03A 1NU7D 3O6XA 4B6IA 4HE8D 2V3CC 1U6HA 2OEVA 4MVSA 3U2MA 1CPQA 1TKNA 1E84A 2ZXRA 3JT1A 2YQYA 3V5XA 1PD1A 4E7SA 3M79A 1W2WA 1CGOA 2BL2A 1YLMA 3AG4C 3G4ZA 4LDRA 4RBNA 2YZSA 4U9DA 5A6BA 4L6RA 3U2LA 3NMIA 5L0DA 1FNTc 3U0CA 3UR3C 4BG0A 3DMDA 3C63A 2E87A 1E2XA 2CNWA 3HKKA 3QMKA 4G0HA 4CIHA 2YWAA 4P9FA 1G8XA 1ORYA 4U5HA 4IGGA 2YLDA 1Y6DA 2A1DD 4I3MA 3QVYA 2KGOA 5BUOA 3EGXA 2WVNA 3O39A 2R9RB 4O6MA 3UMIA 4CS7A 4JURI 1FR0A 3HLZA 2IXOA 2H8AA 3ABMC 1E86A 2VCAA 1LI7A 3GANA 4N06A 1CGNA 3G4XA 3WG7C 3QZCA 3DD7A 3IEEA 4GYTA 1BR1A 2KNHA 3NYLA 4JEAA 5KYWA 3R2PA 2MHRA 1HMOA 4DJ9A 1ZW3A 4FESA 3GM1A 5F5HA 3BEHA 3L0IA 5L3QA 2XLDA 3HNLA 1YDIA 4WJ0A 2R7WA 1M2VB 2QE9A 2H7VC 1BR4A 2CCYA 2XS8A 3LEVA 3M4BA 2WB7A 5GPGB 2VH3A 2Y69C 2J9VA 1WN0A 2QNLA 2QUPA 3KPHA 4U5EE 2LFFA 4AE4B 5JLIA 5EGYA 4NY3A 3F47A 3ABLC 2Q3TA 4JTAB 1ZHXA 2WZGA 4GEHA 4U9EA 2CGEA 1QZXA 1SF8A 3ITFA 1HY5A 5JT4A 1M2VA 1RJ9B 1RKEB 4CS8A 4G7ZF 5E3CA 1OW7A 2R7TA 3DJNB 3GEIA 2H7BA 2XS1A 3VRCA 2HJMA 1QSPA 3S84A 4OIRF 2R02A 1RXQA 1MMNA 3TULA 3HNKA 2J8WA 1I4YA 2UUIA 3JYHA 4YT4A 4Q5SF 3TOMA 1T6UA 2F22A 3LJBA 3EG9B 5KYWB 3SXMA 3R7CA 3IQ5A 4J30B 5CI8A 3DE9A 1HMDA 1NU9C 3US6A 1XZQA 2H7OA 1H7IA 1LKXA 4J7YA 4U5FE 3ABKC 1TWGA 3EG9A 3UNGC 3C7JA 5T3WA 1BDJB 4H4KC 3AQBA 4HFKB 1H9GA 2P6VA 2JPUA 2HSQA 3W4YA 4BEMJ 2Y3DA 1D0YA 2NG1A 2XSEA 5JRAA 5E33A 2R7RA 5KYXB 2GAQA 2TMVP 2EIMC 4NTFA 3L8JA 4OIPF 4Z9JA 1L3PA 3EHMA 3U5SA 3UMKA 2W4MA 3ZG1A 2V26A 3AGUA 3N0TA 1Y4CA 3NG1A 4PK4A 1LS1A 2R25A 1TWCA 1ORSC 1V4AA 1YAUO 2IXPA 4J7TA 3RQEA 4Q7CA 3S9OA 5A6KA 2AP3A 4Z9IA 5L0HA 2KC3A 1JOGA 4XPWA 1OR3A 3FXHA 5KYUA 3NKDA 4YL3A 1JPJA 3AQCA 4JKVA 5T1DB 3TK0A 2WVQA 2OJED 2YL7A 3O55A 4LDQA 3MYFA
chains in the Genus database with same CATH topology
1EA8A 2KC3A 1B68A 3S84A 1AEPA 1OR3A 1LE4A 1GS9A 1H7IA 1BZ4A 1LS4A 1EQ1A 1LPEA 1NFNA 1OR2A 1YA9A 1LE2A 3R2PA 1NFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EA8 A;  2KC3 A;  1B68 A;  3S84 A;  1AEP A;  1OR3 A;  1LE4 A;  1GS9 A;  1H7I A;  1BZ4 A;  1LS4 A;  1EQ1 A;  1LPE A;  1NFN A;  1OR2 A;  1YA9 A;  1LE2 A;  3R2P A;  1NFO A; 
#chains in the Genus database with same CATH topology
 3K6B A;  5HV9 A;  1YJG A;  3FMS A;  4JIO A;  1O5H A;  4EBK A;  1KTM A;  2KK1 A;  4XLP F;  1ST6 A;  3ZTZ A;  2XRH A;  3K1I C;  3KYI A;  4NCQ A;  3HNI A;  3S27 A;  5L0C A;  4YJW A;  3MFN A;  1OCO C;  4K7B A;  3OA1 A;  4OD5 A;  5KYY A;  5HSW A;  1K05 A;  1KU2 A;  2QY9 A;  2PX3 A;  3GOD A;  4LAC B;  3VF0 A;  3ZTM A;  1T6Q A;  2G62 A;  2J0W A;  2WL8 A;  3RH3 A;  4PJN A;  5DS6 A;  1ZYR F;  3Q6M A;  4JVS A;  2Q7R A;  4KC9 A;  2J7P A;  3T9O A;  3V5Z A;  5DQT A;  2EPK X;  5T3T A;  3TQO A;  1A7V A;  1I5N A;  1XWJ A;  4IRU A;  4LDK A;  3S90 A;  2XL4 A;  3TD7 A;  1S05 A;  1D1C A;  3Q7L A;  1M57 C;  1ZHY A;  3EFO A;  3RQG A;  1Q0M A;  2EPN A;  4G78 A;  2P1A A;  2J9U A;  4MTO A;  2J9W A;  4O79 A;  3NYM A;  3IQC A;  2L6F A;  1T6I A;  4IJJ A;  4CDA A;  1IW7 F;  3GOR A;  4KI2 A;  4IAR A;  4AK9 A;  4XEK A;  3EH2 A;  3PHF 2;  2PF4 E;  2Q9B A;  3NYJ A;  4U5B E;  4BJ6 A;  2OKU A;  3LLI A;  1A0B A;  4MW8 A;  2A0U A;  5B1B C;  1MNE A;  2IBF A;  1OCC C;  1RKE A;  2CDQ A;  4XQ1 A;  1LIH A;  3EZI A;  4XEV A;  3JSE O;  3LNR A;  3WOD F;  1I4Z A;  2CYD A;  4C7O A;  3ZQY A;  1J8M F;  4MVQ A;  5K0I A;  3Q7G A;  3S28 A;  3LNM B;  2LP4 A;  2EPO A;  4LLC A;  3HJC A;  3SXK A;  1NLX A;  3EZH A;  1V74 B;  3EHN A;  3S29 A;  2XXA A;  1G4U S;  2ASR A;  4LER A;  4R32 A;  1RCP A;  5D91 A;  4BPM A;  3CAX A;  3RW0 A;  1YZC A;  2IOQ A;  3JSZ A;  2QTV A;  2LFD A;  2OQM A;  4YL1 A;  1LVK A;  3N2Z B;  2YL0 A;  4MND A;  2AWC A;  1M2O A;  3DM5 A;  5KYN A;  2VB6 A;  3B0P A;  1F1M A;  4ZLD A;  4G7O F;  4N4W A;  4CS8 C;  4BJ6 C;  2EPL X;  2PP4 A;  3QTH A;  4JC7 A;  2X0C A;  3W8I A;  3BRJ A;  1D1A A;  2IXM A;  4E0H A;  1VK5 A;  3NMK A;  1FMW A;  1YAR O;  4CBE A;  2P61 A;  1EKY A;  4D4X A;  3SP1 A;  5COG A;  4KNV A;  1RMV A;  2R7U A;  3V7O A;  4UDV A;  1VYI A;  3VAY A;  4CDV A;  2GA0 A;  4EHP A;  3FHD A;  3ZDL A;  3C8G B;  1Z5Z A;  3VYW A;  1YA9 A;  3RKO F;  2AU5 A;  2KYH A;  1E83 A;  2RSE B;  3GWL A;  2GWW A;  5BQH A;  1G5Z A;  2X51 A;  2YRF A;  3B29 A;  2MWQ A;  1C03 A;  3FOP A;  4LLE A;  4NTB A;  4X0R A;  3AG3 C;  2XM4 A;  2NUP A;  2R7X A;  4MVU A;  2XL6 A;  4PFO A;  1HW2 A;  2R7S A;  3DM9 B;  3ZWI A;  1VLT A;  2VCB A;  3SNH A;  3DJU B;  2YEV A;  3DE8 A;  3OEO A;  3C18 A;  4WAB A;  4XPY A;  1OW8 A;  1D0X A;  3RYL A;  1OQC A;  2L6G A;  3ZVR A;  5AC4 A;  3A9C A;  4K1O A;  2KJG A;  4IWB A;  2J45 A;  5A69 A;  3SZR A;  2QLA A;  2VCC A;  1SMY F;  5FCL A;  4C3D A;  2XLH A;  5BQI A;  2DYS C;  1Q0K A;  3FVY A;  5AGF A;  3EGD B;  4GQH A;  1NBB A;  3QW0 A;  3T6B A;  3C8G D;  2L81 A;  3QW1 A;  4CJG A;  3L1M A;  3HNJ A;  3MYI A;  5B1A C;  4DXW A;  3DXJ F;  2Z15 A;  3LLK A;  4FAP B;  4C3B A;  2XM0 A;  4ER9 A;  2Q4F A;  3MX3 A;  4NQF A;  5TJ5 E;  3M15 A;  1RKC A;  3AG2 C;  4JZA A;  1BBH A;  4MVR A;  3X1O A;  1H9T A;  5A6J A;  1M6T A;  3L8I A;  1OCZ C;  3EH1 A;  2ETS A;  4XWJ A;  1Z63 A;  4U5C E;  4MVZ A;  2XLW A;  4ANJ A;  3FAJ A;  4EWC A;  2LIG A;  5COF A;  1SYQ A;  4CJO A;  1O87 A;  1ZHZ A;  3UGP A;  1TFK B;  1TFO B;  2G3K A;  1N1C A;  1ZZP A;  3C8Z A;  1TQG A;  3CQZ A;  2DI3 A;  1NG1 A;  256B A;  3I4U A;  1JAF A;  1SR2 A;  2NUT A;  5CIV A;  4EBJ A;  4ULW A;  4MVO A;  1GGQ A;  3FDQ A;  1VOM A;  3DKA A;  2AWY A;  1YYX A;  1IZM A;  1TWH A;  2G3V A;  4E7Z A;  3SXY A;  2VC9 A;  2ZXW C;  2W45 A;  4J32 B;  3DWW A;  2XLO A;  4P6I C;  4XEF A;  4A2N B;  4A4A A;  4EIY A;  1UG7 A;  4YT2 A;  2R03 A;  1BZ4 A;  2FFH A;  3UMH A;  1ZHT A;  4MTG A;  4AE4 A;  2LQG A;  2L6H A;  1NSG B;  2B0J A;  4P9T A;  1HE9 A;  2NSG A;  3SYN A;  4BJ5 C;  1CPR A;  2HMZ A;  4MQ9 F;  3ASN C;  2DB4 A;  4I44 A;  1LS4 A;  5KYY B;  4W8P A;  1J8Y F;  2J9B A;  2LSE A;  2A68 F;  3LAY A;  2XLV A;  2OEX A;  3UGO A;  4JJG A;  1D0Z A;  1EQ1 A;  1LI5 A;  4U5D E;  2P7V A;  4MTF A;  3SEO A;  3NRH A;  4RD9 A;  1MMA A;  3CSK A;  3DZA A;  5JP7 A;  2EIN C;  3ATP A;  3H65 A;  2EPM X;  3K33 A;  4MVM A;  5E2Q A;  2NSF A;  1GS9 A;  2HUJ A;  2MYS A;  2FGY A;  4DOZ A;  2NUP B;  2NUT B;  2JD3 A;  3K1I A;  3LS1 A;  2HV6 A;  1A7D A;  4M63 A;  2A0B A;  2Y39 A;  1GM5 A;  1OCR C;  2W9Y A;  4XTK A;  2DGJ A;  2LCH A;  3EQL F;  3OWT A;  5A6A A;  4PJL A;  1LPE A;  2PNO A;  1S7Z A;  2OU6 A;  2PBE A;  2PFD A;  5F28 E;  5L0I A;  1KNY A;  3I5Q A;  3C8G A;  4PJJ A;  5JSL A;  2HZ8 A;  2ZD9 A;  3T6J A;  4BJ5 A;  5L0G A;  2XL8 A;  4E17 A;  1OXK A;  2Y3H A;  2UUH A;  4O7G A;  3WAQ A;  5BQG A;  1JMW A;  1C17 M;  2IXN A;  1V54 C;  2EIK C;  5L0J A;  3AGT A;  4JTC B;  3LES A;  3GEH A;  2KQ9 A;  1WTY A;  1L7C A;  2A6E F;  2VAS A;  1OKK A;  3KYJ A;  3LS0 A;  4NC3 A;  3X2Q C;  5IY5 C;  3I5P A;  2LK4 A;  4RDA A;  3ZIB A;  2I8B A;  3T4R A;  3ASO C;  3L34 A;  2YVK A;  3EPV A;  4C7O B;  1VMA A;  1K40 A;  2A6H F;  5COM A;  5EK0 A;  1BR2 A;  2WZL A;  1JRA A;  2HS5 A;  4XLN F;  2AVK A;  2LD6 A;  2M64 A;  2IM8 A;  3WHN A;  1TWA A;  4HFF B;  3W2W A;  4DRH B;  3SXZ A;  3GM2 A;  2DYR C;  2OOC A;  3HTK C;  3JCU Q;  4JTD B;  4W8K A;  1Q0G A;  4OD4 A;  2BE5 F;  3ECS A;  4DRI B;  2KSF A;  2RD9 A;  3KKB A;  4PAC A;  3NMJ A;  3EJN A;  3AG1 C;  5AC5 A;  4DRJ B;  2B0H A;  1A7E A;  1FFH A;  3DAG A;  4EUK B;  4OIQ F;  3JZ0 A;  3G50 A;  3IQ6 A;  1WGW A;  2CW0 F;  1YYJ A;  1H6G A;  1V55 C;  4FX5 A;  4CDY A;  4N6C A;  2J7P D;  1JPN A;  2Q9A A;  2ZXP A;  2WZF A;  5E3A A;  4KBL A;  4ONS A;  4AL0 A;  1PV3 A;  4JRZ A;  4MW3 A;  3CZ6 A;  4ZLC A;  3JRT A;  3TJ6 A;  5L3V A;  1ZU4 A;  1YVI A;  1GQA A;  3VM6 A;  5EHH A;  4NTA A;  1E85 A;  1NZE A;  3PDM P;  4HEA J;  3JTL O;  4EBB A;  1B68 A;  1QKR A;  2YKZ A;  3B9Q A;  3CEX A;  3EGD A;  1G4W R;  4IAQ A;  4AX2 A;  1MND A;  4C3E A;  2NPU A;  3RF3 A;  2R7V A;  5DLJ A;  2WVO A;  5KYX A;  1LE2 A;  2IYL D;  4QI2 A;  1EA8 A;  1QLE C;  4IAO A;  5FZT A;  3EGX B;  4JE9 A;  3TOL A;  5B3I A;  2HFI A;  2GFH A;  1AVO B;  3O10 A;  3ZQV A;  1MMD A;  4KNW A;  4F4B A;  2YLI A;  3Q6N A;  3JYY A;  2HMQ A;  1QVX A;  1Z6A A;  3GWN A;  1CGM E;  3A11 A;  4BEJ A;  2XXA B;  4YN0 B;  1A41 A;  2J0X A;  2XLE A;  4ULV A;  3ZSU A;  3MLG A;  1EI7 A;  1QPU A;  5B3S C;  4CIP A;  5JUA A;  2L7A A;  4O6Y A;  5JVE A;  1ZU5 A;  1T01 A;  4PJM A;  3RVY A;  1UFB A;  2OJQ A;  4QDL A;  3EFO B;  3IHU A;  3KL4 A;  3ZC4 A;  4PFP A;  3W8H A;  4Q4Z F;  3PMR A;  3RIP A;  3RQF A;  3F46 A;  3B71 A;  2P0N A;  4DBR A;  4JEB A;  1R4T A;  2D5R B;  1Q0D A;  3U9M A;  1K04 A;  1ZW2 A;  4OIO F;  2ICW G;  1TR2 A;  4DBQ A;  3K1H A;  3K7D A;  4JW1 A;  2D4U A;  5D92 A;  1MMG A;  5DQZ A;  3IQT A;  3KMI A;  4JCH A;  1WOL A;  2HV7 A;  2M4E A;  2YLG A;  4OIN F;  4CSA C;  3C62 A;  1ZHW A;  1DOW A;  1VYK A;  2I15 A;  2Q9C A;  2JX0 A;  4I1M A;  3POV A;  2A69 F;  1YZA A;  4EKW A;  1YA7 O;  3J06 A;  4YL0 A;  1NFN A;  4QI0 A;  4DVY P;  4Z9H A;  1OR2 A;  1WAS A;  1XZP A;  5DS4 A;  4BJT A;  3RVZ A;  1HW1 A;  2Y3G A;  4CS9 A;  4E18 A;  1U0B B;  1QQ3 A;  2BC5 A;  4YT8 A;  1U89 A;  2YL1 A;  4FWV A;  2R05 A;  2W4B A;  3U8P A;  1WWP A;  3AJM A;  1DOV A;  1RJ9 A;  4PR9 A;  1OW6 A;  3NKE A;  1JR8 A;  1AUE A;  1FMV A;  3B0V C;  1T5O A;  1ZVZ A;  5DVW A;  1Z7Q c;  1FAP B;  2CNW D;  3FAP B;  3W2V A;  3RFY A;  4DVZ A;  2YL3 A;  4JCZ A;  2OCC C;  3M1C B;  3U3B A;  5KYU B;  4G7H F;  3TJ5 A;  1LM3 B;  1OXB A;  2O9X A;  2Y3B A;  1R5I D;  1Z23 A;  3FOO A;  1AEP A;  1APC A;  1SZI A;  4I1O B;  3AOU A;  2C04 A;  2ZXO A;  4JJF A;  4YK5 A;  4CSA A;  3K66 A;  1ORJ A;  1VB5 A;  3IPM O;  4XPX A;  4IB4 A;  2GDC A;  2FAP B;  1FFT C;  2Q00 A;  2XLM A;  3PCV A;  4WGY A;  3DI5 A;  2ZPA A;  4O6N A;  3U8V A;  3V5Y A;  4CX9 A;  2HSB A;  1VTM P;  1VLS A;  4AL1 A;  3GEE A;  4YWQ A;  3H2U A;  1M56 C;  1MQV A;  1T9K A;  4WGZ A;  3E70 C;  4MS2 A;  5A6B D;  2OG2 A;  3U3F A;  1WAT A;  2HKV A;  3GM3 A;  2YHS A;  5JS5 A;  1C02 A;  1HE1 A;  1OKK D;  1PD0 A;  4E0I A;  2J46 A;  4N6H A;  3NDB B;  3M4C A;  3N24 A;  1Z3I X;  3MBG A;  4K0D A;  3KH2 A;  1D1B A;  4CS9 C;  5L0F A;  5F5F A;  3DAF A;  3LEO A;  1FTS A;  2KW3 C;  3S0X A;  3U9J A;  1Q0F A;  1PCX A;  2R7Q A;  4H54 A;  4D4N A;  2L9J A;  2EIL C;  4U5G A;  2R7O A;  1NFO A;  1O3U A;  3E9V A;  3JRM O;  2PX0 A;  5CI9 A;  3H2V A;  4YT5 A;  2EIJ C;  3T6G B;  1LE4 A;  4BJ1 A;  5DS5 A;  3B0U X;  2HJ3 A;  3QVZ A;  3LUT B;  2C03 A;  1NU7 D;  3O6X A;  4B6I A;  4HE8 D;  2V3C C;  1U6H A;  2OEV A;  4MVS A;  3U2M A;  1CPQ A;  1TKN A;  1E84 A;  2ZXR A;  3JT1 A;  2YQY A;  3V5X A;  1PD1 A;  4E7S A;  3M79 A;  1W2W A;  1CGO A;  2BL2 A;  1YLM A;  3AG4 C;  3G4Z A;  4LDR A;  4RBN A;  2YZS A;  4U9D A;  5A6B A;  4L6R A;  3U2L A;  3NMI A;  5L0D A;  1FNT c;  3U0C A;  3UR3 C;  4BG0 A;  3DMD A;  3C63 A;  2E87 A;  1E2X A;  2CNW A;  3HKK A;  3QMK A;  4G0H A;  4CIH A;  2YWA A;  4P9F A;  1G8X A;  1ORY A;  4U5H A;  4IGG A;  2YLD A;  1Y6D A;  2A1D D;  4I3M A;  3QVY A;  2KGO A;  5BUO A;  3EGX A;  2WVN A;  3O39 A;  2R9R B;  4O6M A;  3UMI A;  4CS7 A;  4JUR I;  1FR0 A;  3HLZ A;  2IXO A;  2H8A A;  3ABM C;  1E86 A;  2VCA A;  1LI7 A;  3GAN A;  4N06 A;  1CGN A;  3G4X A;  3WG7 C;  3QZC A;  3DD7 A;  3IEE A;  4GYT A;  1BR1 A;  2KNH A;  3NYL A;  4JEA A;  5KYW A;  3R2P A;  2MHR A;  1HMO A;  4DJ9 A;  1ZW3 A;  4FES A;  3GM1 A;  5F5H A;  3BEH A;  3L0I A;  5L3Q A;  2XLD A;  3HNL A;  1YDI A;  4WJ0 A;  2R7W A;  1M2V B;  2QE9 A;  2H7V C;  1BR4 A;  2CCY A;  2XS8 A;  3LEV A;  3M4B A;  2WB7 A;  5GPG B;  2VH3 A;  2Y69 C;  2J9V A;  1WN0 A;  2QNL A;  2QUP A;  3KPH A;  4U5E E;  2LFF A;  4AE4 B;  5JLI A;  5EGY A;  4NY3 A;  3F47 A;  3ABL C;  2Q3T A;  4JTA B;  1ZHX A;  2WZG A;  4GEH A;  4U9E A;  2CGE A;  1QZX A;  1SF8 A;  3ITF A;  1HY5 A;  5JT4 A;  1M2V A;  1RJ9 B;  1RKE B;  4CS8 A;  4G7Z F;  5E3C A;  1OW7 A;  2R7T A;  3DJN B;  3GEI A;  2H7B A;  2XS1 A;  3VRC A;  2HJM A;  1QSP A;  3S84 A;  4OIR F;  2R02 A;  1RXQ A;  1MMN A;  3TUL A;  3HNK A;  2J8W A;  1I4Y A;  2UUI A;  3JYH A;  4YT4 A;  4Q5S F;  3TOM A;  1T6U A;  2F22 A;  3LJB A;  3EG9 B;  5KYW B;  3SXM A;  3R7C A;  3IQ5 A;  4J30 B;  5CI8 A;  3DE9 A;  1HMD A;  1NU9 C;  3US6 A;  1XZQ A;  2H7O A;  1H7I A;  1LKX A;  4J7Y A;  4U5F E;  3ABK C;  1TWG A;  3EG9 A;  3UNG C;  3C7J A;  5T3W A;  1BDJ B;  4H4K C;  3AQB A;  4HFK B;  1H9G A;  2P6V A;  2JPU A;  2HSQ A;  3W4Y A;  4BEM J;  2Y3D A;  1D0Y A;  2NG1 A;  2XSE A;  5JRA A;  5E33 A;  2R7R A;  5KYX B;  2GAQ A;  2TMV P;  2EIM C;  4NTF A;  3L8J A;  4OIP F;  4Z9J A;  1L3P A;  3EHM A;  3U5S A;  3UMK A;  2W4M A;  3ZG1 A;  2V26 A;  3AGU A;  3N0T A;  1Y4C A;  3NG1 A;  4PK4 A;  1LS1 A;  2R25 A;  1TWC A;  1ORS C;  1V4A A;  1YAU O;  2IXP A;  4J7T A;  3RQE A;  4Q7C A;  3S9O A;  5A6K A;  2AP3 A;  4Z9I A;  5L0H A;  2KC3 A;  1JOG A;  4XPW A;  1OR3 A;  3FXH A;  5KYU A;  3NKD A;  4YL3 A;  1JPJ A;  3AQC A;  4JKV A;  5T1D B;  3TK0 A;  2WVQ A;  2OJE D;  2YL7 A;  3O55 A;  4LDQ A;  3MYF A; 
#chains in the Genus database with same CATH homology
 1EA8 A;  2KC3 A;  1B68 A;  3S84 A;  1AEP A;  1OR3 A;  1LE4 A;  1GS9 A;  1H7I A;  1BZ4 A;  1LS4 A;  1EQ1 A;  1LPE A;  1NFN A;  1OR2 A;  1YA9 A;  1LE2 A;  3R2P A;  1NFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...