1EA8A

Apolipoprotein e3 22kd fragment lys146glu mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
140
structure length
140
Chain Sequence
b'GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRERLLRDADDLQKRLAVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPROTEIN E
publication title Apolipoprotein E3 22Kd Fragment Lys146Gln Mutant
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 65
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2001-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1ea8A00
3R2PA 1LPEA 1LS4A 1OR3A 1LE2A 1GS9A 1OR2A 1NFOA 1EQ1A 1LE4A 3S84A 1EA8A 1NFNA 1AEPA 1B68A 1H7IA 2KC3A 1BZ4A 1YA9A
chains in the Genus database with same CATH superfamily
1SYQA 1ORYA 4ULWA 2WZLA 3U9MA 4CBEA 4U5GA 2EILC 3NKDA 4XPXA 5FCLA 5COFA 4G7OF 4DRJB 3JYYA 2R9RB 1LS4A 2KYHA 5BQIA 1V4AA 1S7ZA 4QDLA 1VLTA 3JRTA 2HS5A 3V5ZA 2VASA 1Y6DA 1GGQA 2QUPA 2UUHA 5JSLA 3ZTMA 4BJTA 4JTCB 4X0RA 1OW7A 1FMWA 1ZVZA 3VM6A 1EA8A 4AE4B 1LM3B 4YL0A 1SR2A 1CGNA 3HKKA 4CDAA 5CI8A 3GM3A 3FOPA 1R5ID 3DI5A 2P1AA 3A11A 5KYXA 4FESA 2KJGA 1RKEA 2QNLA 2KK1A 2YZSA 1QVXA 3PMRA 5HSWA 2R7RA 4DBQA 2MWQA 2MYSA 3TJ6A 3EJNA 1WGWA 4U5BE 1Y4CA 4DVYP 3G50A 1RMVA 2QTVA 3NMIA 4PFPA 2A6HF 3EG9A 3G4ZA 1HE9A 2R02A 4LDRA 4U9EA 4MVZA 1YYJA 4CIHA 3RKOF 4N6HA 1AVOB 3C8GD 1DOWA 5E3CA 4AK9A 4PK4A 1N1CA 3H65A 4IGGA 1OXBA 3C8ZA 3HJCA 3UMIA 4BG0A 3U2LA 4ZLDA 3IHUA 4IWBA 4IB4A 2H7BA 2C04A 1NU7D 1ORJA 2YL3A 3ZSUA 1VK5A 1MMNA 2GA0A 1R4TA 3L34A 3UR3C 2A68F 3U3BA 1HW1A 3M4BA 3OWTA 4KNWA 2KSFA 3DAFA 5JRAA 2M64A 4YN0B 5A6AA 3S9OA 3MLGA 256BA 1CPRA 1TFOB 2AWCA 5KYUA 3MX3A 2ZD9A 3HNJA 3LAYA 2VH3A 3RIPA 1PD1A 3SYNA 2Q7RA 2ZXPA 4C3DA 1YA7O 5KYWA 2PX3A 2Q3TA 2LQGA 3K1IC 5L0JA 4Q7CA 3EHNA 1D0ZA 3ZQYA 4Q5SF 1XZPA 3LS1A 3OA1A 4NQFA 4YJWA 3IQCA 4XWJA 3S84A 1G8XA 2Q00A 1PD0A 1ZYRF 4QI0A 3KMIA 1EI7A 4LDQA 4NY3A 4W8KA 3C18A 2AP3A 4XPYA 4EBJA 1H6GA 2LFDA 1TR2A 3FAPB 4DBRA 1OCZC 3PDMP 4U5HA 3JCUQ 3C63A 4EBBA 2NSFA 2DGJA 1TWHA 1WWPA 4FWVA 5DS5A 1D0YA 3SXZA 5KYYB 1IZMA 1NG1A 2Y3BA 3H2VA 4IARA 3EG9B 2XL6A 4O7GA 3EZIA 3U5SA 4BJ1A 3W2VA 3DMDA 5K0IA 4I1MA 1GM5A 3JT1A 1K40A 3N24A 4KI2A 3HTKC 1ZW2A 3H2UA 3I4UA 2Q9BA 3HLZA 2X0CA 5DQTA 1YZCA 3ABMC 1Z5ZA 4IJJA 5BQGA 2QLAA 3KYJA 1M2VA 4G0HA 4W8PA 1BR2A 3DWWA 3RQEA 1MMAA 1T9KA 2XLOA 3VYWA 3AQBA 1CGME 4B6IA 4CS7A 4JW1A 1KU2A 2YQYA 4JZAA 2HFIA 3UGPA 4CSAC 4C7OB 2OEXA 4BEMJ 4A4AA 2L6FA 3C7JA 1YZAA 4RD9A 3ZG1A 3ATPA 3ECSA 3EFOB 3CQZA 4YWQA 4XLPF 2XLWA 3POVA 2YKZA 2WVQA 1OCCC 2KNHA 3V7OA 3US6A 1V74B 1M56C 2P7VA 3QVYA 1RJ9B 3OEOA 4XLNF 4E0IA 1ZHZA 3O55A 4LACB 3ASOC 4HFKB 4JTDB 4JIOA 2VCBA 3T9OA 2VCCA 3IQ6A 4JVSA 5KYWB 3LEOA 4YL1A 1E2XA 4Z9HA 2EPNA 2NG1A 2XLDA 3LJBA 4U5CE 1OXKA 2XL4A 1NFNA 4H4KC 3IQ5A 4MW3A 2A69F 4MVUA 5DS6A 5L0GA 3ZTZA 1TWAA 2CNWD 2HMQA 3FXHA 1E86A 1C17M 4ONSA 3M1CB 1Q0FA 5JT4A 3U2MA 1I4YA 5E3AA 3N0TA 3T6JA 1ZHYA 2FFHA 3EH2A 1VOMA 2Q9CA 2IM8A 4C3EA 3MBGA 4XTKA 5D91A 1Q0MA 4RBNA 3ABKC 1H9TA 2R7UA 3R7CA 2Y39A 2XRHA 3TOLA 1Z23A 3W8HA 2NPUA 2OCCC 1RXQA 1VB5A 2I15A 3HNLA 3LESA 2J0WA 2A0BA 2AWYA 3SNHA 2ASRA 5EGYA 2XXAA 3PHF2 1T01A 3GWNA 2BL2A 1FNTc 1TWGA 3M4CA 2YLGA 4MNDA 1JOGA 2D4UA 2L9JA 2A6EF 3C8GA 1PCXA 1A7VA 3DAGA 3ZDLA 5COGA 3DM5A 3FAJA 1QSPA 2NUTA 2EPLX 2ZXOA 3ASNC 5B1AC 1T5OA 2Y3DA 1G4US 2XL8A 2VB6A 3IEEA 1A41A 2WB7A 4CS8C 3S0XA 4ULVA 2R7SA 4OIQF 1FAPB 4JC7A 3NMJA 3SXKA 3RYLA 2CGEA 2J7PA 3EGDA 5T3WA 4CDVA 1T6QA 2PNOA 3ZQVA 4LLEA 3GWLA 3SXYA 3B71A 4JURI 4H54A 2HV7A 3VF0A 4PFOA 3EHMA 1ZHTA 2Y3GA 5A6KA 1E83A 3J06A 2G3KA 4J30B 4OD5A 2JPUA 3EGXA 4CS9C 1T6IA 4XEFA 3SZRA 2QE9A 3DJUB 4XEVA 4G78A 3AG4C 3FOOA 1AEPA 5DVWA 4FX5A 1J8MF 2OOCA 2HMZA 2P0NA 5JLIA 1HMDA 1HY5A 3LNRA 4XPWA 3AGTA 3PCVA 1ORSC 4PJLA 5B1BC 2J7PD 2IXPA 3NKEA 4KC9A 4YT5A 5B3SC 1YYXA 4OIPF 2NUPA 3GM1A 3UNGC 4LDKA 4DVZA 3R2PA 3QW1A 1YARO 1IW7F 2WVOA 2XLVA 1OCOC 3O39A 4JE9A 5L0DA 3NYMA 4KBLA 5A6JA 3JRMO 3K6BA 4HE8D 4K1OA 4WGZA 2J0XA 4O6NA 3NG1A 1VLSA 1MMGA 3WG7C 2EPKX 2KQ9A 1QQ3A 2KW3C 4JEBA 4C3BA 3LLIA 4MTOA 3EH1A 3BRJA 4BJ6A 4GQHA 2V3CC 4NTFA 2LK4A 2RSEB 4QI2A 2AU5A 3GORA 4E18A 3GEHA 4Z9JA 4EKWA 1JPJA 1T6UA 2C03A 3FHDA 4YT2A 3A9CA 1B68A 3SEOA 5B3IA 1GQAA 4N6CA 4FAPB 2OKUA 4MTGA 2HV6A 3AG1C 3EPVA 4AL1A 3QMKA 4LERA 2R7VA 2OG2A 1A0BA 2OJED 2R03A 1LKXA 2IBFA 3Q7GA 4BJ5C 1W2WA 1RKEB 5KYXB 3B0VC 2XM0A 2W4BA 2YWAA 2CDQA 5BUOA 3TULA 1BR4A 2FAPB 3K33A 1LPEA 3RW0A 1AUEA 4K0DA 2JX0A 2PX0A 3I5PA 4IRUA 1O3UA 5FZTA 3AJMA 1I5NA 3RF3A 4A2NB 4E7SA 1VTMP 1V55C 1ZU5A 4MTFA 3U8PA 2IXOA 2L6GA 2XS8A 5DQZA 1O87A 1YLMA 3HNIA 1MQVA 3Q6NA 2B0JA 4XEKA 4XQ1A 5COMA 1WTYA 2TMVP 1CPQA 1MNDA 1FFTC 3MFNA 4NC3A 2FGYA 2GAQA 2YRFA 3GEEA 5EHHA 2RD9A 3BEHA 2R05A 1OKKA 2ZXWC 4J7TA 1ZU4A 3K7DA 2LSEA 3KPHA 2Z15A 1G4WR 1K04A 1LS1A 5A69A 1O5HA 2DI3A 4RDAA 1M57C 4YT4A 4YT8A 1BR1A 3JYHA 4I44A 5BQHA 3DXJF 1Z3IX 2CNWA 1OW6A 4LLCA 4MW8A 3T6BA 5A6BD 1WASA 1JRAA 5KYUB 4E17A 2DYRC 1XWJA 2H8AA 3TJ5A 1E84A 3F46A 4O6YA 2GDCA 1U89A 1NLXA 3G4XA 2DYSC 4CS9A 5L0HA 2ICWG 4AE4A 5D92A 1OR2A 3LLKA 4MQ9F 1OKKD 2M4EA 1KNYA 5KYNA 4Q4ZF 2IXNA 2B0HA 3CEXA 4GYTA 3U9JA 3GM2A 4PJJA 3NYLA 3S29A 4E7ZA 1KTMA 1VMAA 1L7CA 3AOUA 4E0HA 1YAUO 2H7OA 4NTBA 4ER9A 2CW0F 5DS4A 2YLDA 5HV9A 2EIJC 3CZ6A 4JJGA 1M6TA 2XLEA 1QLEC 3M15A 4DRIB 4P6IC 3NDBB 5L3QA 3DE9A 5AC4A 3S90A 3NYJA 2PBEA 4P9FA 4PR9A 2XS1A 3RFYA 5L3VA 2HZ8A 2HKVA 3QVZA 5CIVA 2J9WA 2GFHA 4J32B 1TKNA 5TJ5E 3TD7A 4UDVA 1VYKA 2OQMA 2J46A 3RVZA 1SF8A 3E9VA 4JKVA 3Q7LA 1Q0DA 2UUIA 2VCAA 3I5QA 2JD3A 3K1IA 3NRHA 1RKCA 4F4BA 1Q0KA 4MVQA 2J45A 4O79A 4JEAA 4HFFB 5F28E 4WJ0A 3ZC4A 3C62A 3DZAA 3M79A 3DE8A 1U6HA 1HMOA 3WAQA 5L0FA 4CIPA 2DB4A 3WODF 5L0IA 3U8VA 4DRHB 1ZW3A 4EIYA 1TFKB 1RCPA 4EBKA 1M2VB 2J9BA 2QY9A 3B29A 3RQFA 2HSBA 3DJNB 1CGOA 1YVIA 5JUAA 2Q4FA 3FDQA 1U0BB 3U0CA 1SMYF 3L8JA 3RH3A 1QKRA 3F47A 3X1OA 3SP1A 2O9XA 3HNKA 4N06A 1Z7Qc 1MMDA 3AGUA 4U9DA 4OIOF 2KGOA 2YL7A 4AX2A 2R7QA 3DD7A 4R32A 1LE2A 3QZCA 4AL0A 2IYLD 2CYDA 3K66A 3JZ0A 1LIHA 1OW8A 2YLIA 3V5XA 2P6VA 3ABLC 2LP4A 4MS2A 3W4YA 1EQ1A 3U3FA 1WN0A 2GWWA 3UMHA 2J9VA 2LFFA 4OD4A 1YDIA 5JVEA 1ZHWA 4NTAA 1J8YF 4M63A 4CSAA 3L1MA 1M2OA 2MHRA 4JRZA 1D0XA 2OJQA 1JPNA 5KYYA 3QW0A 1K05A 4MVOA 4WGYA 5IY5C 3CSKA 2NSGA 2WZFA 1F1MA 2AVKA 1NZEA 1APCA 4YL3A 3SXMA 5F5HA 3FVYA 4DJ9A 3B0PA 3LEVA 2L7AA 4EHPA 2WVNA 4G7ZF 2YL0A 2YEVA 5DLJA 2WL8A 2YHSA 4GEHA 3UGOA 2OEVA 3LNMB 3TK0A 4ANJA 4JCHA 1D1BA 1TWCA 3W8IA 1BDJB 3KL4A 2L6HA 3O6XA 1FFHA 1MNEA 3FMSA 3S28A 3QTHA 4EWCA 1C03A 1FMVA 4CJGA 2XXAB 1WOLA 1NFOA 2R7WA 1UFBA 1L3PA 3N2ZB 3L0IA 2J8WA 3Q6MA 4CDYA 4C7OA 3IQTA 1FR0A 2HSQA 3C8GB 2E87A 2D5RB 2PP4A 3KKBA 4MVSA 4DXWA 2W45A 5L0CA 3EFOA 2NUTB 4BPMA 2IXMA 1OCRC 3B0UX 1D1CA 5E33A 4P9TA 2Q9AA 2R25A 4K7BA 4U5DE 3TOMA 1RJ9A 5F5FA 3ITFA 2G3VA 5AC5A 5E2QA 3UMKA 3X2QC 4CJOA 1JR8A 3GEIA 1VYIA 1OR3A 1OQCA 2P61A 3EGDB 2V26A 5AGFA 3JSEO 3RQGA 3ZWIA 4JJFA 2L81A 3LS0A 2EINC 2IOQA 4WABA 3MYIA 3VAYA 1QZXA 3WHNA 2XLMA 5A6BA 4OINF 5JS5A 2R7TA 1Z63A 2Y3HA 5CI9A 2XLHA 3GANA 3EGXB 3DKAA 2I8BA 2J9UA 1H7IA 4YK5A 2VC9A 2ZXRA 1E85A 4CS8A 4D4XA 1SZIA 3L8IA 2PF4E 1HW2A 2W4MA 1G5ZA 2EPMX 1NSGB 2XSEA 1A7DA 1WATA 2XM4A 3EZHA 4L6RA 5GPGB 2ZPAA 2X51A 3B9QA 2NUPB 1JAFA 1TQGA 2YVKA 2HJ3A 3S27A 2EIMC 1YJGA 1ST6A 4MVRA 4BEJA 4D4NA 4OIRF 3ZVRA 4PACA 1XZQA 4IAQA 3NMKA 3W2WA 4PJNA 1GS9A 3JTLO 2A1DD 1LI7A 2WZGA 2BE5F 2H7VC 1NU9C 1S05A 2R7XA 1ZHXA 3AG2C 1LE4A 3V5YA 4U5FE 4PJMA 4JTAB 4N4WA 3LUTB 3IPMO 4JCZA 4NCQA 2PFDA 3AG3C 2LIGA 4IAOA 3T6GB 2HJMA 1HE1A 3ZIBA 1BBHA 5EK0A 1PV3A 3RVYA 1NBBA 2YL1A 1FTSA 1LI5A 3JSZA 2Y69C 3KH2A 5JP7A 2F22A 2R7OA 1LVKA 3DM9B 3MYFA 5T1DB 5T3TA 1Q0GA 3E70C 2W9YA 1D1AA 4U5EE 2A0UA 4CX9A 4EUKB 1JMWA 4G7HF 3EQLF 2CCYA 4J7YA 2LCHA 2EPOA 2LD6A 1UG7A 1V54C 3KYIA 3O10A 4I3MA 1Z6AA 1A7EA 3K1HA 4BJ6C 4ZLCA 3T4RA 3VRCA 1EKYA 4HEAJ 1QPUA 4I1OB 4MVMA 4KNVA 3GODA 3CAXA 1H9GA 2EIKC 4Z9IA 1DOVA 2OU6A 3AQCA 1ZZPA 2ETSA 2HUJA 2KC3A 1C02A 1I4ZA 2BC5A 1BZ4A 2G62A 4O6MA 3TQOA 1YA9A 4BJ5A 4DOZA
chains in the Genus database with same CATH topology
3R2PA 1LPEA 1LS4A 1OR3A 1LE2A 1GS9A 1OR2A 1NFOA 1EQ1A 1LE4A 3S84A 1EA8A 1NFNA 1AEPA 1B68A 1H7IA 2KC3A 1BZ4A 1YA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R2P A;  1LPE A;  1LS4 A;  1OR3 A;  1LE2 A;  1GS9 A;  1OR2 A;  1NFO A;  1EQ1 A;  1LE4 A;  3S84 A;  1EA8 A;  1NFN A;  1AEP A;  1B68 A;  1H7I A;  2KC3 A;  1BZ4 A;  1YA9 A; 
#chains in the Genus database with same CATH topology
 1SYQ A;  1ORY A;  4ULW A;  2WZL A;  3U9M A;  4CBE A;  4U5G A;  2EIL C;  3NKD A;  4XPX A;  5FCL A;  5COF A;  4G7O F;  4DRJ B;  3JYY A;  2R9R B;  1LS4 A;  2KYH A;  5BQI A;  1V4A A;  1S7Z A;  4QDL A;  1VLT A;  3JRT A;  2HS5 A;  3V5Z A;  2VAS A;  1Y6D A;  1GGQ A;  2QUP A;  2UUH A;  5JSL A;  3ZTM A;  4BJT A;  4JTC B;  4X0R A;  1OW7 A;  1FMW A;  1ZVZ A;  3VM6 A;  1EA8 A;  4AE4 B;  1LM3 B;  4YL0 A;  1SR2 A;  1CGN A;  3HKK A;  4CDA A;  5CI8 A;  3GM3 A;  3FOP A;  1R5I D;  3DI5 A;  2P1A A;  3A11 A;  5KYX A;  4FES A;  2KJG A;  1RKE A;  2QNL A;  2KK1 A;  2YZS A;  1QVX A;  3PMR A;  5HSW A;  2R7R A;  4DBQ A;  2MWQ A;  2MYS A;  3TJ6 A;  3EJN A;  1WGW A;  4U5B E;  1Y4C A;  4DVY P;  3G50 A;  1RMV A;  2QTV A;  3NMI A;  4PFP A;  2A6H F;  3EG9 A;  3G4Z A;  1HE9 A;  2R02 A;  4LDR A;  4U9E A;  4MVZ A;  1YYJ A;  4CIH A;  3RKO F;  4N6H A;  1AVO B;  3C8G D;  1DOW A;  5E3C A;  4AK9 A;  4PK4 A;  1N1C A;  3H65 A;  4IGG A;  1OXB A;  3C8Z A;  3HJC A;  3UMI A;  4BG0 A;  3U2L A;  4ZLD A;  3IHU A;  4IWB A;  4IB4 A;  2H7B A;  2C04 A;  1NU7 D;  1ORJ A;  2YL3 A;  3ZSU A;  1VK5 A;  1MMN A;  2GA0 A;  1R4T A;  3L34 A;  3UR3 C;  2A68 F;  3U3B A;  1HW1 A;  3M4B A;  3OWT A;  4KNW A;  2KSF A;  3DAF A;  5JRA A;  2M64 A;  4YN0 B;  5A6A A;  3S9O A;  3MLG A;  256B A;  1CPR A;  1TFO B;  2AWC A;  5KYU A;  3MX3 A;  2ZD9 A;  3HNJ A;  3LAY A;  2VH3 A;  3RIP A;  1PD1 A;  3SYN A;  2Q7R A;  2ZXP A;  4C3D A;  1YA7 O;  5KYW A;  2PX3 A;  2Q3T A;  2LQG A;  3K1I C;  5L0J A;  4Q7C A;  3EHN A;  1D0Z A;  3ZQY A;  4Q5S F;  1XZP A;  3LS1 A;  3OA1 A;  4NQF A;  4YJW A;  3IQC A;  4XWJ A;  3S84 A;  1G8X A;  2Q00 A;  1PD0 A;  1ZYR F;  4QI0 A;  3KMI A;  1EI7 A;  4LDQ A;  4NY3 A;  4W8K A;  3C18 A;  2AP3 A;  4XPY A;  4EBJ A;  1H6G A;  2LFD A;  1TR2 A;  3FAP B;  4DBR A;  1OCZ C;  3PDM P;  4U5H A;  3JCU Q;  3C63 A;  4EBB A;  2NSF A;  2DGJ A;  1TWH A;  1WWP A;  4FWV A;  5DS5 A;  1D0Y A;  3SXZ A;  5KYY B;  1IZM A;  1NG1 A;  2Y3B A;  3H2V A;  4IAR A;  3EG9 B;  2XL6 A;  4O7G A;  3EZI A;  3U5S A;  4BJ1 A;  3W2V A;  3DMD A;  5K0I A;  4I1M A;  1GM5 A;  3JT1 A;  1K40 A;  3N24 A;  4KI2 A;  3HTK C;  1ZW2 A;  3H2U A;  3I4U A;  2Q9B A;  3HLZ A;  2X0C A;  5DQT A;  1YZC A;  3ABM C;  1Z5Z A;  4IJJ A;  5BQG A;  2QLA A;  3KYJ A;  1M2V A;  4G0H A;  4W8P A;  1BR2 A;  3DWW A;  3RQE A;  1MMA A;  1T9K A;  2XLO A;  3VYW A;  3AQB A;  1CGM E;  4B6I A;  4CS7 A;  4JW1 A;  1KU2 A;  2YQY A;  4JZA A;  2HFI A;  3UGP A;  4CSA C;  4C7O B;  2OEX A;  4BEM J;  4A4A A;  2L6F A;  3C7J A;  1YZA A;  4RD9 A;  3ZG1 A;  3ATP A;  3ECS A;  3EFO B;  3CQZ A;  4YWQ A;  4XLP F;  2XLW A;  3POV A;  2YKZ A;  2WVQ A;  1OCC C;  2KNH A;  3V7O A;  3US6 A;  1V74 B;  1M56 C;  2P7V A;  3QVY A;  1RJ9 B;  3OEO A;  4XLN F;  4E0I A;  1ZHZ A;  3O55 A;  4LAC B;  3ASO C;  4HFK B;  4JTD B;  4JIO A;  2VCB A;  3T9O A;  2VCC A;  3IQ6 A;  4JVS A;  5KYW B;  3LEO A;  4YL1 A;  1E2X A;  4Z9H A;  2EPN A;  2NG1 A;  2XLD A;  3LJB A;  4U5C E;  1OXK A;  2XL4 A;  1NFN A;  4H4K C;  3IQ5 A;  4MW3 A;  2A69 F;  4MVU A;  5DS6 A;  5L0G A;  3ZTZ A;  1TWA A;  2CNW D;  2HMQ A;  3FXH A;  1E86 A;  1C17 M;  4ONS A;  3M1C B;  1Q0F A;  5JT4 A;  3U2M A;  1I4Y A;  5E3A A;  3N0T A;  3T6J A;  1ZHY A;  2FFH A;  3EH2 A;  1VOM A;  2Q9C A;  2IM8 A;  4C3E A;  3MBG A;  4XTK A;  5D91 A;  1Q0M A;  4RBN A;  3ABK C;  1H9T A;  2R7U A;  3R7C A;  2Y39 A;  2XRH A;  3TOL A;  1Z23 A;  3W8H A;  2NPU A;  2OCC C;  1RXQ A;  1VB5 A;  2I15 A;  3HNL A;  3LES A;  2J0W A;  2A0B A;  2AWY A;  3SNH A;  2ASR A;  5EGY A;  2XXA A;  3PHF 2;  1T01 A;  3GWN A;  2BL2 A;  1FNT c;  1TWG A;  3M4C A;  2YLG A;  4MND A;  1JOG A;  2D4U A;  2L9J A;  2A6E F;  3C8G A;  1PCX A;  1A7V A;  3DAG A;  3ZDL A;  5COG A;  3DM5 A;  3FAJ A;  1QSP A;  2NUT A;  2EPL X;  2ZXO A;  3ASN C;  5B1A C;  1T5O A;  2Y3D A;  1G4U S;  2XL8 A;  2VB6 A;  3IEE A;  1A41 A;  2WB7 A;  4CS8 C;  3S0X A;  4ULV A;  2R7S A;  4OIQ F;  1FAP B;  4JC7 A;  3NMJ A;  3SXK A;  3RYL A;  2CGE A;  2J7P A;  3EGD A;  5T3W A;  4CDV A;  1T6Q A;  2PNO A;  3ZQV A;  4LLE A;  3GWL A;  3SXY A;  3B71 A;  4JUR I;  4H54 A;  2HV7 A;  3VF0 A;  4PFO A;  3EHM A;  1ZHT A;  2Y3G A;  5A6K A;  1E83 A;  3J06 A;  2G3K A;  4J30 B;  4OD5 A;  2JPU A;  3EGX A;  4CS9 C;  1T6I A;  4XEF A;  3SZR A;  2QE9 A;  3DJU B;  4XEV A;  4G78 A;  3AG4 C;  3FOO A;  1AEP A;  5DVW A;  4FX5 A;  1J8M F;  2OOC A;  2HMZ A;  2P0N A;  5JLI A;  1HMD A;  1HY5 A;  3LNR A;  4XPW A;  3AGT A;  3PCV A;  1ORS C;  4PJL A;  5B1B C;  2J7P D;  2IXP A;  3NKE A;  4KC9 A;  4YT5 A;  5B3S C;  1YYX A;  4OIP F;  2NUP A;  3GM1 A;  3UNG C;  4LDK A;  4DVZ A;  3R2P A;  3QW1 A;  1YAR O;  1IW7 F;  2WVO A;  2XLV A;  1OCO C;  3O39 A;  4JE9 A;  5L0D A;  3NYM A;  4KBL A;  5A6J A;  3JRM O;  3K6B A;  4HE8 D;  4K1O A;  4WGZ A;  2J0X A;  4O6N A;  3NG1 A;  1VLS A;  1MMG A;  3WG7 C;  2EPK X;  2KQ9 A;  1QQ3 A;  2KW3 C;  4JEB A;  4C3B A;  3LLI A;  4MTO A;  3EH1 A;  3BRJ A;  4BJ6 A;  4GQH A;  2V3C C;  4NTF A;  2LK4 A;  2RSE B;  4QI2 A;  2AU5 A;  3GOR A;  4E18 A;  3GEH A;  4Z9J A;  4EKW A;  1JPJ A;  1T6U A;  2C03 A;  3FHD A;  4YT2 A;  3A9C A;  1B68 A;  3SEO A;  5B3I A;  1GQA A;  4N6C A;  4FAP B;  2OKU A;  4MTG A;  2HV6 A;  3AG1 C;  3EPV A;  4AL1 A;  3QMK A;  4LER A;  2R7V A;  2OG2 A;  1A0B A;  2OJE D;  2R03 A;  1LKX A;  2IBF A;  3Q7G A;  4BJ5 C;  1W2W A;  1RKE B;  5KYX B;  3B0V C;  2XM0 A;  2W4B A;  2YWA A;  2CDQ A;  5BUO A;  3TUL A;  1BR4 A;  2FAP B;  3K33 A;  1LPE A;  3RW0 A;  1AUE A;  4K0D A;  2JX0 A;  2PX0 A;  3I5P A;  4IRU A;  1O3U A;  5FZT A;  3AJM A;  1I5N A;  3RF3 A;  4A2N B;  4E7S A;  1VTM P;  1V55 C;  1ZU5 A;  4MTF A;  3U8P A;  2IXO A;  2L6G A;  2XS8 A;  5DQZ A;  1O87 A;  1YLM A;  3HNI A;  1MQV A;  3Q6N A;  2B0J A;  4XEK A;  4XQ1 A;  5COM A;  1WTY A;  2TMV P;  1CPQ A;  1MND A;  1FFT C;  3MFN A;  4NC3 A;  2FGY A;  2GAQ A;  2YRF A;  3GEE A;  5EHH A;  2RD9 A;  3BEH A;  2R05 A;  1OKK A;  2ZXW C;  4J7T A;  1ZU4 A;  3K7D A;  2LSE A;  3KPH A;  2Z15 A;  1G4W R;  1K04 A;  1LS1 A;  5A69 A;  1O5H A;  2DI3 A;  4RDA A;  1M57 C;  4YT4 A;  4YT8 A;  1BR1 A;  3JYH A;  4I44 A;  5BQH A;  3DXJ F;  1Z3I X;  2CNW A;  1OW6 A;  4LLC A;  4MW8 A;  3T6B A;  5A6B D;  1WAS A;  1JRA A;  5KYU B;  4E17 A;  2DYR C;  1XWJ A;  2H8A A;  3TJ5 A;  1E84 A;  3F46 A;  4O6Y A;  2GDC A;  1U89 A;  1NLX A;  3G4X A;  2DYS C;  4CS9 A;  5L0H A;  2ICW G;  4AE4 A;  5D92 A;  1OR2 A;  3LLK A;  4MQ9 F;  1OKK D;  2M4E A;  1KNY A;  5KYN A;  4Q4Z F;  2IXN A;  2B0H A;  3CEX A;  4GYT A;  3U9J A;  3GM2 A;  4PJJ A;  3NYL A;  3S29 A;  4E7Z A;  1KTM A;  1VMA A;  1L7C A;  3AOU A;  4E0H A;  1YAU O;  2H7O A;  4NTB A;  4ER9 A;  2CW0 F;  5DS4 A;  2YLD A;  5HV9 A;  2EIJ C;  3CZ6 A;  4JJG A;  1M6T A;  2XLE A;  1QLE C;  3M15 A;  4DRI B;  4P6I C;  3NDB B;  5L3Q A;  3DE9 A;  5AC4 A;  3S90 A;  3NYJ A;  2PBE A;  4P9F A;  4PR9 A;  2XS1 A;  3RFY A;  5L3V A;  2HZ8 A;  2HKV A;  3QVZ A;  5CIV A;  2J9W A;  2GFH A;  4J32 B;  1TKN A;  5TJ5 E;  3TD7 A;  4UDV A;  1VYK A;  2OQM A;  2J46 A;  3RVZ A;  1SF8 A;  3E9V A;  4JKV A;  3Q7L A;  1Q0D A;  2UUI A;  2VCA A;  3I5Q A;  2JD3 A;  3K1I A;  3NRH A;  1RKC A;  4F4B A;  1Q0K A;  4MVQ A;  2J45 A;  4O79 A;  4JEA A;  4HFF B;  5F28 E;  4WJ0 A;  3ZC4 A;  3C62 A;  3DZA A;  3M79 A;  3DE8 A;  1U6H A;  1HMO A;  3WAQ A;  5L0F A;  4CIP A;  2DB4 A;  3WOD F;  5L0I A;  3U8V A;  4DRH B;  1ZW3 A;  4EIY A;  1TFK B;  1RCP A;  4EBK A;  1M2V B;  2J9B A;  2QY9 A;  3B29 A;  3RQF A;  2HSB A;  3DJN B;  1CGO A;  1YVI A;  5JUA A;  2Q4F A;  3FDQ A;  1U0B B;  3U0C A;  1SMY F;  3L8J A;  3RH3 A;  1QKR A;  3F47 A;  3X1O A;  3SP1 A;  2O9X A;  3HNK A;  4N06 A;  1Z7Q c;  1MMD A;  3AGU A;  4U9D A;  4OIO F;  2KGO A;  2YL7 A;  4AX2 A;  2R7Q A;  3DD7 A;  4R32 A;  1LE2 A;  3QZC A;  4AL0 A;  2IYL D;  2CYD A;  3K66 A;  3JZ0 A;  1LIH A;  1OW8 A;  2YLI A;  3V5X A;  2P6V A;  3ABL C;  2LP4 A;  4MS2 A;  3W4Y A;  1EQ1 A;  3U3F A;  1WN0 A;  2GWW A;  3UMH A;  2J9V A;  2LFF A;  4OD4 A;  1YDI A;  5JVE A;  1ZHW A;  4NTA A;  1J8Y F;  4M63 A;  4CSA A;  3L1M A;  1M2O A;  2MHR A;  4JRZ A;  1D0X A;  2OJQ A;  1JPN A;  5KYY A;  3QW0 A;  1K05 A;  4MVO A;  4WGY A;  5IY5 C;  3CSK A;  2NSG A;  2WZF A;  1F1M A;  2AVK A;  1NZE A;  1APC A;  4YL3 A;  3SXM A;  5F5H A;  3FVY A;  4DJ9 A;  3B0P A;  3LEV A;  2L7A A;  4EHP A;  2WVN A;  4G7Z F;  2YL0 A;  2YEV A;  5DLJ A;  2WL8 A;  2YHS A;  4GEH A;  3UGO A;  2OEV A;  3LNM B;  3TK0 A;  4ANJ A;  4JCH A;  1D1B A;  1TWC A;  3W8I A;  1BDJ B;  3KL4 A;  2L6H A;  3O6X A;  1FFH A;  1MNE A;  3FMS A;  3S28 A;  3QTH A;  4EWC A;  1C03 A;  1FMV A;  4CJG A;  2XXA B;  1WOL A;  1NFO A;  2R7W A;  1UFB A;  1L3P A;  3N2Z B;  3L0I A;  2J8W A;  3Q6M A;  4CDY A;  4C7O A;  3IQT A;  1FR0 A;  2HSQ A;  3C8G B;  2E87 A;  2D5R B;  2PP4 A;  3KKB A;  4MVS A;  4DXW A;  2W45 A;  5L0C A;  3EFO A;  2NUT B;  4BPM A;  2IXM A;  1OCR C;  3B0U X;  1D1C A;  5E33 A;  4P9T A;  2Q9A A;  2R25 A;  4K7B A;  4U5D E;  3TOM A;  1RJ9 A;  5F5F A;  3ITF A;  2G3V A;  5AC5 A;  5E2Q A;  3UMK A;  3X2Q C;  4CJO A;  1JR8 A;  3GEI A;  1VYI A;  1OR3 A;  1OQC A;  2P61 A;  3EGD B;  2V26 A;  5AGF A;  3JSE O;  3RQG A;  3ZWI A;  4JJF A;  2L81 A;  3LS0 A;  2EIN C;  2IOQ A;  4WAB A;  3MYI A;  3VAY A;  1QZX A;  3WHN A;  2XLM A;  5A6B A;  4OIN F;  5JS5 A;  2R7T A;  1Z63 A;  2Y3H A;  5CI9 A;  2XLH A;  3GAN A;  3EGX B;  3DKA A;  2I8B A;  2J9U A;  1H7I A;  4YK5 A;  2VC9 A;  2ZXR A;  1E85 A;  4CS8 A;  4D4X A;  1SZI A;  3L8I A;  2PF4 E;  1HW2 A;  2W4M A;  1G5Z A;  2EPM X;  1NSG B;  2XSE A;  1A7D A;  1WAT A;  2XM4 A;  3EZH A;  4L6R A;  5GPG B;  2ZPA A;  2X51 A;  3B9Q A;  2NUP B;  1JAF A;  1TQG A;  2YVK A;  2HJ3 A;  3S27 A;  2EIM C;  1YJG A;  1ST6 A;  4MVR A;  4BEJ A;  4D4N A;  4OIR F;  3ZVR A;  4PAC A;  1XZQ A;  4IAQ A;  3NMK A;  3W2W A;  4PJN A;  1GS9 A;  3JTL O;  2A1D D;  1LI7 A;  2WZG A;  2BE5 F;  2H7V C;  1NU9 C;  1S05 A;  2R7X A;  1ZHX A;  3AG2 C;  1LE4 A;  3V5Y A;  4U5F E;  4PJM A;  4JTA B;  4N4W A;  3LUT B;  3IPM O;  4JCZ A;  4NCQ A;  2PFD A;  3AG3 C;  2LIG A;  4IAO A;  3T6G B;  2HJM A;  1HE1 A;  3ZIB A;  1BBH A;  5EK0 A;  1PV3 A;  3RVY A;  1NBB A;  2YL1 A;  1FTS A;  1LI5 A;  3JSZ A;  2Y69 C;  3KH2 A;  5JP7 A;  2F22 A;  2R7O A;  1LVK A;  3DM9 B;  3MYF A;  5T1D B;  5T3T A;  1Q0G A;  3E70 C;  2W9Y A;  1D1A A;  4U5E E;  2A0U A;  4CX9 A;  4EUK B;  1JMW A;  4G7H F;  3EQL F;  2CCY A;  4J7Y A;  2LCH A;  2EPO A;  2LD6 A;  1UG7 A;  1V54 C;  3KYI A;  3O10 A;  4I3M A;  1Z6A A;  1A7E A;  3K1H A;  4BJ6 C;  4ZLC A;  3T4R A;  3VRC A;  1EKY A;  4HEA J;  1QPU A;  4I1O B;  4MVM A;  4KNV A;  3GOD A;  3CAX A;  1H9G A;  2EIK C;  4Z9I A;  1DOV A;  2OU6 A;  3AQC A;  1ZZP A;  2ETS A;  2HUJ A;  2KC3 A;  1C02 A;  1I4Z A;  2BC5 A;  1BZ4 A;  2G62 A;  4O6M A;  3TQO A;  1YA9 A;  4BJ5 A;  4DOZ A; 
#chains in the Genus database with same CATH homology
 3R2P A;  1LPE A;  1LS4 A;  1OR3 A;  1LE2 A;  1GS9 A;  1OR2 A;  1NFO A;  1EQ1 A;  1LE4 A;  3S84 A;  1EA8 A;  1NFN A;  1AEP A;  1B68 A;  1H7I A;  2KC3 A;  1BZ4 A;  1YA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...