1EA8A

Apolipoprotein e3 22kd fragment lys146glu mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
140
structure length
140
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRERLLRDADDLQKRLAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords APOLIPOPROTEIN E
publication title Apolipoprotein E3 22Kd Fragment Lys146Gln Mutant
rcsb
source organism Homo sapiens
total genus 65
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2001-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1ea8A00
1EA8A 1LS4A 1B68A 2KC3A 1OR2A 1BZ4A 1EQ1A 1AEPA 3S84A 1H7IA 1LE2A 1NFNA 1LPEA 1NFOA 3R2PA 1GS9A 1OR3A 1LE4A 1YA9A
chains in the Genus database with same CATH superfamily
4YL0A 3TOLA 1JAFA 2HV6A 1OCRC 2R03A 2XXAA 4Z9JA 3UGPA 1JOGA 1Q0KA 1GM5A 1D1BA 1LVKA 1M2VB 1OR2A 4MVMA 1JMWA 1ORJA 1A7DA 1JRAA 3ZG1A 3ABLC 3DWWA 4XQ1A 4EWCA 2LIGA 2JPUA 2DGJA 2Y69C 4X0RA 5DS6A 1T6IA 2JD3A 1SR2A 2VCBA 2YLIA 3M1CB 1H7IA 5BQGA 3SNHA 1FTSA 3EFOA 1OW8A 1D0XA 4P9TA 2XLEA 3SXMA 3N24A 2P7VA 2YLGA 1WATA 3Q6MA 3W2VA 3S28A 3G50A 1OW7A 1Y6DA 2J45A 2YKZA 1LS1A 2WZGA 1Z7Qc 3UNGC 5L0IA 3FHDA 2IYLD 1V55C 2PP4A 3GANA 2RD9A 5L0DA 4HFFB 2Y3HA 4JW1A 4LDKA 4MVQA 1VMAA 5K0IA 4CJGA 4YT8A 3L0IA 2PX3A 1NG1A 3OWTA 4AE4A 3S0XA 1G4US 3SYNA 1A7EA 4P9FA 5CI8A 4EIYA 2GA0A 2NG1A 3T6GB 4MVUA 3FXHA 4KC9A 5L0CA 4JCHA 1TWCA 2LSEA 4N6CA 3J06A 3U8PA 1YLMA 1LI7A 2O9XA 3GORA 3GM1A 3K1IA 5D91A 1DOWA 1A41A 1HMOA 1ZHTA 5L3QA 4YN0B 2EILC 4OIRF 2VCCA 3KYJA 5L0JA 1E85A 3ABMC 4LACB 3TD7A 4KI2A 3U2MA 3LNMB 2DI3A 1CPQA 4MVSA 1RJ9B 2ICWG 4CJOA 4KNWA 3RW0A 3TQOA 2OOCA 1V4AA 5DQZA 1B68A 4XLPF 1FFHA 4MTFA 4CSAA 1LIHA 2WB7A 1PCXA 1HY5A 2XL8A 3K1HA 2IBFA 2WVQA 1RMVA 2OEXA 1YJGA 2PX0A 1C03A 3PHF2 2AVKA 2LCHA 4MW3A 2YLDA 1VK5A 3U3BA 3AG4C 4I1MA 1RCPA 1VOMA 3W4YA 1E2XA 1T9KA 2ZXRA 4JE9A 1ZW2A 2P0NA 4BJ1A 5BUOA 4NTAA 4MVZA 4OD4A 3MFNA 4WJ0A 4H4KC 1ZU5A 1Z3IX 1L7CA 2YZSA 4DVYP 5L3VA 1GS9A 3NMIA 3U8VA 1Q0MA 3NYJA 4U5DE 1YAUO 1FMWA 1OCZC 2YL7A 3JSEO 1AUEA 4XPWA 3LEOA 4BJ6C 4YT2A 2KNHA 3RQEA 1RKEA 4JIOA 4BG0A 5KYXB 1OKKA 3RKOF 1TFKB 2J9WA 3C8GA 1ST6A 3T9OA 3PDMP 4JEBA 2DYRC 5T3TA 1N1CA 1PD0A 3C18A 3R7CA 3ZC4A 2R7OA 3US6A 4J32B 1ZYRF 2XM4A 5HV9A 3SP1A 4ZLDA 2L6FA 2GDCA 2MHRA 4CS8A 4PJNA 2NPUA 3LLIA 1VYIA 1H9TA 2Y39A 1NFNA 3EGDA 2QE9A 4JTCB 3TULA 3O55A 2R7SA 256BA 2WVNA 2W4MA 3MX3A 2OQMA 2UUIA 2EIJC 2CCYA 4ULWA 2OU6A 3JT1A 3EFOB 2H8AA 4DJ9A 3M79A 1C17M 5E2QA 5E3CA 2KSFA 5KYUB 2C04A 1HMDA 3KMIA 1U6HA 5T1DB 3N0TA 3EHNA 4U9EA 2CW0F 2QNLA 1RXQA 3RH3A 3HNKA 2J8WA 1VLTA 1SF8A 4ONSA 5E3AA 5DLJA 3RVYA 3QW1A 1EQ1A 3VM6A 3C63A 3DI5A 5JP7A 3UGOA 1ZHYA 2WZFA 4JCZA 5B3IA 4EUKB 1NZEA 3UMIA 3CQZA 4EBBA 4U5EE 3HLZA 1EI7A 2ZXPA 2QY9A 3NG1A 5HSWA 3ASOC 3GWNA 2PBEA 2V26A 3QVYA 1OCCC 2XLVA 4G7OF 1JPNA 4BEMJ 3EPVA 4IB4A 4PJMA 4U9DA 3TJ6A 2R7QA 3DM5A 3OA1A 3ABKC 2NUTA 3CZ6A 4K7BA 4HFKB 4JTAB 3ASNC 3HNJA 3T4RA 2J9UA 3ZIBA 2A1DD 3LESA 4OD5A 2R7TA 5KYYA 2A0UA 2X0CA 1QPUA 3NDBB 1YYJA 2HV7A 1A0BA 2EPNA 1NU7D 1V74B 2HSQA 2YVKA 2KC3A 1APCA 3O39A 1CGOA 1WOLA 2CGEA 5E33A 5A6BA 2IXNA 3F46A 3S27A 3WG7C 3L34A 4YK5A 1MQVA 4LLCA 4MVRA 2R7VA 1M2OA 4CS9C 3EG9A 1OQCA 3FVYA 4E7SA 1UG7A 4IRUA 5JLIA 2XLOA 1E83A 3FMSA 4BJ5C 3RYLA 3JSZA 4B6IA 1YDIA 2YHSA 3DMDA 2OKUA 3JRMO 4FAPB 3IEEA 5FCLA 4U5HA 1I4ZA 2XS8A 2IM8A 2JX0A 2EINC 1ORSC 1M6TA 2HUJA 2R05A 2AP3A 2W4BA 2XL6A 3B29A 3K6BA 1V54C 2KK1A 1T01A 5COFA 4MS2A 2G3VA 3ZWIA 5CIVA 4YL3A 2XS1A 2XRHA 1NBBA 2IXPA 2A68F 4U5FE 2Q9BA 4O79A 4XTKA 4KNVA 1R4TA 1TFOB 4N06A 1DOVA 1KU2A 4J7YA 1FNTc 3DKAA 4RBNA 1R5ID 1HE9A 1T6UA 3C8GB 4XEFA 3K33A 3TJ5A 3EH2A 4Z9HA 4HEAJ 4RDAA 1AVOB 5IY5C 5AC4A 3NMJA 1H6GA 3B0VC 1TKNA 2BE5F 5JUAA 3B0UX 2J7PA 3M4CA 4GQHA 2M4EA 3A11A 4E17A 3RQGA 4BEJA 3VAYA 4QI2A 1SYQA 1CPRA 1J8YF 2CNWA 4JZAA 1ZW3A 1C02A 3C8ZA 3KYIA 2V3CC 4OIOF 4BJ6A 3DJNB 3IQ6A 3K7DA 1M56C 3MYIA 3OEOA 2L7AA 4I1OB 5AGFA 4BJTA 3L1MA 3CSKA 4NC3A 2L6HA 3JYHA 1CGME 4JJFA 2OJQA 3VYWA 4G7ZF 4MVOA 3U0CA 1U89A 1YZAA 2YEVA 1BR2A 3M15A 3PCVA 3WHNA 4EBJA 5BQHA 5F28E 2XLMA 3DE9A 4QI0A 2Q7RA 5JSLA 2H7VC 2AU5A 2HS5A 1SZIA 2Q3TA 4Q7CA 1L3PA 2PFDA 3A9CA 3KH2A 3PMRA 4P6IC 2R7RA 2Q00A 2GFHA 3LS1A 2L81A 3GODA 3IPMO 2Q4FA 4IGGA 1YA9A 1LKXA 2NSFA 2A6HF 3Q6NA 2I8BA 4CIPA 4C7OA 1VB5A 1LS4A 1HE1A 4EKWA 2R25A 2EPLX 2C03A 4A4AA 3QW0A 5DQTA 2NUTB 1YYXA 2OCCC 3FAPB 3IQTA 2OG2A 3LEVA 5A6KA 1YVIA 3AG2C 3ATPA 1XWJA 1I4YA 1BDJB 3U2LA 3NYMA 4DBQA 5L0FA 4L6RA 2VH3A 5KYYB 2HJMA 3K1IC 4YT5A 4JRZA 4U5CE 3MLGA 3EJNA 2XXAB 3S9OA 1QKRA 2YL1A 1YARO 3K66A 4Z9IA 2QUPA 2XM0A 2OEVA 1WN0A 2J9VA 3EH1A 4JKVA 2LK4A 2VB6A 4XPYA 4YWQA 3W2WA 4IAOA 1KTMA 1OW6A 1PV3A 3NMKA 4JC7A 5A69A 3EG9B 4WGYA 5TJ5E 1KNYA 4E7ZA 5B3SC 2H7OA 3NKEA 4QDLA 5BQIA 4MTGA 3AGUA 2QLAA 2HJ3A 1H9GA 1YZCA 3WODF 2J0XA 3KPHA 2J46A 3Q7GA 4DBRA 4I3MA 1TWGA 2L6GA 1QVXA 1D1CA 2KQ9A 5D92A 1K05A 1Q0DA 3DD7A 5L0GA 2KYHA 3O6XA 3VF0A 3O10A 2NSGA 4JTDB 1E84A 2WVOA 3JZ0A 2AWYA 1I5NA 2HKVA 1NSGB 2D5RB 2W9YA 3DE8A 3U9MA 1LE2A 3AG1C 3QZCA 2W45A 1TQGA 2HSBA 3EHMA 4O6NA 4AE4B 5F5FA 4LDQA 4OIPF 1M57C 2G62A 2XLDA 5DVWA 5B1BC 4DRIB 3DZAA 1RJ9A 4WGZA 5KYWA 3ECSA 1G5ZA 4BJ5A 2LQGA 2KGOA 3HTKC 4C3DA 3R2PA 4PR9A 4BPMA 4D4NA 1G8XA 3UR3C 2YL3A 1Z63A 2GWWA 2OJED 4CS7A 3I5PA 1QZXA 3DJUB 1T6QA 5COGA 4DXWA 1E86A 2UUHA 1K04A 2GAQA 3EGXA 2PNOA 3L8IA 3G4ZA 1CGNA 3JRTA 4MTOA 4MNDA 5A6AA 2LD6A 3H2UA 4O6YA 4DRJB 2FAPB 4CS8C 4EHPA 5EGYA 2VASA 3AGTA 1ZHWA 2H7BA 3IQ5A 3U5SA 1LI5A 3RVZA 4NY3A 3TK0A 2EIKC 1EKYA 3UMKA 3HNIA 4XWJA 2TMVP 1GGQA 2EPOA 2IXMA 4FX5A 5GPGB 4N4WA 1OXKA 3C7JA 3GEHA 4XLNF 2KJGA 1Z5ZA 3EZHA 1ZHZA 2P6VA 3LAYA 1BR4A 4M63A 5A6JA 1S7ZA 3FDQA 5L0HA 2FFHA 2YRFA 2ZPAA 3SXKA 4W8PA 1O87A 1FAPB 2YQYA 4C3EA 3X2QC 4CX9A 1O3UA 2EPMX 2A69F 1ORYA 4JVSA 4MQ9F 3B9QA 1EA8A 1QQ3A 1WASA 2Y3GA 3AQCA 5B1AC 4IJJA 4O7GA 1PD1A 1VLSA 3IHUA 3QVZA 4WABA 3HKKA 2MYSA 4U5GA 5CI9A 4DVZA 4PK4A 5EHHA 1JR8A 3Q7LA 4IAQA 4I44A 4ANJA 1BBHA 1Z6AA 1RKEB 4HE8D 4C7OB 2DYSC 4XEKA 3LLKA 3FAJA 4LERA 2BC5A 2FGYA 5KYUA 1XZPA 4GEHA 1D0ZA 3FOPA 2WL8A 1OKKD 3C8GD 3DXJF 1BR1A 4K1OA 3UMHA 1WTYA 3FOOA 3W8HA 4CDVA 5AC5A 2LP4A 4G7HF 1FFTC 2YWAA 4JURI 4H54A 3B0PA 4K0DA 1VTMP 3EGDB 2NUPA 4XEVA 3GEIA 4R32A 1W2WA 1WWPA 1FMVA 3DAGA 4ULVA 4Q4ZF 1LM3B 4YL1A 2L9JA 3H2VA 2R9RB 1QLEC 4PACA 3C62A 1Q0FA 1AEPA 3NKDA 4FWVA 3AQBA 2ASRA 4G78A 1VYKA 2ZXWC 1RKCA 4J30B 3X1OA 4YJWA 4AK9A 2IOQA 5JT4A 1T5OA 1O5HA 4IARA 2ETSA 5FZTA 4IWBA 2J9BA 5COMA 3V5XA 5EK0A 1S05A 3SXYA 2X51A 4AX2A 4XPXA 3B71A 1F1MA 1LPEA 1NFOA 1HW1A 3LNRA 1Z23A 3MBGA 1OCOC 1XZQA 3EQLF 1G4WR 1M2VA 1MNEA 3LJBA 3ZQYA 3DM9B 3ZSUA 3KL4A 2MWQA 2PF4E 1MMAA 3CEXA 3ZVRA 3W8IA 4E18A 4O6MA 1IW7F 5KYWB 4E0HA 3G4XA 3AOUA 3SZRA 4F4BA 3SEOA 2XLWA 3JCUQ 2B0JA 3AG3C 1BZ4A 1TWHA 2J0WA 4W8KA 4OINF 5JRAA 2HMQA 3I5QA 1ZHXA 2HMZA 1MMNA 3EZIA 3F47A 3ZQVA 4A2NB 4MW8A 4CIHA 2R7XA 3EGXB 3KKBA 2M64A 1ZU4A 4CDAA 4AL0A 4ER9A 3VRCA 3T6JA 1Y4CA 4E0IA 3IQCA 4YT4A 2P61A 3AJMA 5A6BD 2EPKX 2A6EF 3V7OA 4LDRA 4N6HA 1U0BB 1Q0GA 3I4UA 3RIPA 2F22A 1TR2A 2D4UA 2VC9A 3HNLA 3S90A 1ZVZA 4Q5SF 1D1AA 1MMDA 2WZLA 4CSAC 3BRJA 5T3WA 3ZDLA 4DRHB 3RFYA 2KW3C 3LS0A 2Q9CA 4DOZA 3T6BA 3E9VA 2XL4A 4LLEA 1J8MF 4NCQA 1NLXA 2HFIA 3V5YA 3NRHA 2Y3DA 4JJGA 3GEEA 2QTVA 4PJJA 1ZZPA 3CAXA 3GM3A 4UDVA 3V5ZA 3RF3A 3NYLA 2HZ8A 2LFDA 3DAFA 3S29A 1HW2A 4PFOA 1QSPA 2XSEA 3ZTZA 1UFBA 4CS9A 3BEHA 5JS5A 4G0HA 1JPJA 4NTBA 5KYNA 1IZMA 2CYDA 4FESA 4OIQF 2E87A 2ZD9A 2P1AA 3M4BA 2CDQA 4ZLCA 3E70C 1D0YA 2A0BA 4NQFA 3WAQA 2YL0A 1LE4A 3QTHA 2BL2A 2DB4A 2G3KA 1YA7O 2IXOA 4GYTA 2LFFA 1MMGA 3HJCA 5F5HA 3ZTMA 2VCAA 2R02A 3N2ZB 4C3BA 3MYFA 1NU9C 1GQAA 2I15A 5DS5A 1FR0A 2Z15A 3QMKA 1SMYF 4NTFA 2NUPB 4PJLA 3L8JA 5JVEA 4RD9A 3SXZA 2EIMC 2R7UA 3S84A 2J7PD 4U5BE 4PFPA 4AL1A 4CBEA 5DS4A 4EBKA 3U9JA 2CNWD 3H65A 2R7WA 3JYYA 2ZXOA 3GWLA 3U3FA 1TWAA 1WGWA 1OXBA 4KBLA 2Y3BA 3LUTB 5KYXA 1K40A 2Q9AA 2XLHA 3POVA 2AWCA 4CDYA 4D4XA 1MNDA 3RQFA 1A7VA 1OR3A 3ITFA 4JEAA 3TOMA 2B0HA 3JTLO 4J7TA 2RSEB 3GM2A
chains in the Genus database with same CATH topology
1EA8A 1LS4A 1B68A 2KC3A 1OR2A 1BZ4A 1EQ1A 1AEPA 3S84A 1H7IA 1LE2A 1NFNA 1LPEA 1NFOA 3R2PA 1GS9A 1OR3A 1LE4A 1YA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EA8 A;  1LS4 A;  1B68 A;  2KC3 A;  1OR2 A;  1BZ4 A;  1EQ1 A;  1AEP A;  3S84 A;  1H7I A;  1LE2 A;  1NFN A;  1LPE A;  1NFO A;  3R2P A;  1GS9 A;  1OR3 A;  1LE4 A;  1YA9 A; 
#chains in the Genus database with same CATH topology
 4YL0 A;  3TOL A;  1JAF A;  2HV6 A;  1OCR C;  2R03 A;  2XXA A;  4Z9J A;  3UGP A;  1JOG A;  1Q0K A;  1GM5 A;  1D1B A;  1LVK A;  1M2V B;  1OR2 A;  4MVM A;  1JMW A;  1ORJ A;  1A7D A;  1JRA A;  3ZG1 A;  3ABL C;  3DWW A;  4XQ1 A;  4EWC A;  2LIG A;  2JPU A;  2DGJ A;  2Y69 C;  4X0R A;  5DS6 A;  1T6I A;  2JD3 A;  1SR2 A;  2VCB A;  2YLI A;  3M1C B;  1H7I A;  5BQG A;  3SNH A;  1FTS A;  3EFO A;  1OW8 A;  1D0X A;  4P9T A;  2XLE A;  3SXM A;  3N24 A;  2P7V A;  2YLG A;  1WAT A;  3Q6M A;  3W2V A;  3S28 A;  3G50 A;  1OW7 A;  1Y6D A;  2J45 A;  2YKZ A;  1LS1 A;  2WZG A;  1Z7Q c;  3UNG C;  5L0I A;  3FHD A;  2IYL D;  1V55 C;  2PP4 A;  3GAN A;  2RD9 A;  5L0D A;  4HFF B;  2Y3H A;  4JW1 A;  4LDK A;  4MVQ A;  1VMA A;  5K0I A;  4CJG A;  4YT8 A;  3L0I A;  2PX3 A;  1NG1 A;  3OWT A;  4AE4 A;  3S0X A;  1G4U S;  3SYN A;  1A7E A;  4P9F A;  5CI8 A;  4EIY A;  2GA0 A;  2NG1 A;  3T6G B;  4MVU A;  3FXH A;  4KC9 A;  5L0C A;  4JCH A;  1TWC A;  2LSE A;  4N6C A;  3J06 A;  3U8P A;  1YLM A;  1LI7 A;  2O9X A;  3GOR A;  3GM1 A;  3K1I A;  5D91 A;  1DOW A;  1A41 A;  1HMO A;  1ZHT A;  5L3Q A;  4YN0 B;  2EIL C;  4OIR F;  2VCC A;  3KYJ A;  5L0J A;  1E85 A;  3ABM C;  4LAC B;  3TD7 A;  4KI2 A;  3U2M A;  3LNM B;  2DI3 A;  1CPQ A;  4MVS A;  1RJ9 B;  2ICW G;  4CJO A;  4KNW A;  3RW0 A;  3TQO A;  2OOC A;  1V4A A;  5DQZ A;  1B68 A;  4XLP F;  1FFH A;  4MTF A;  4CSA A;  1LIH A;  2WB7 A;  1PCX A;  1HY5 A;  2XL8 A;  3K1H A;  2IBF A;  2WVQ A;  1RMV A;  2OEX A;  1YJG A;  2PX0 A;  1C03 A;  3PHF 2;  2AVK A;  2LCH A;  4MW3 A;  2YLD A;  1VK5 A;  3U3B A;  3AG4 C;  4I1M A;  1RCP A;  1VOM A;  3W4Y A;  1E2X A;  1T9K A;  2ZXR A;  4JE9 A;  1ZW2 A;  2P0N A;  4BJ1 A;  5BUO A;  4NTA A;  4MVZ A;  4OD4 A;  3MFN A;  4WJ0 A;  4H4K C;  1ZU5 A;  1Z3I X;  1L7C A;  2YZS A;  4DVY P;  5L3V A;  1GS9 A;  3NMI A;  3U8V A;  1Q0M A;  3NYJ A;  4U5D E;  1YAU O;  1FMW A;  1OCZ C;  2YL7 A;  3JSE O;  1AUE A;  4XPW A;  3LEO A;  4BJ6 C;  4YT2 A;  2KNH A;  3RQE A;  1RKE A;  4JIO A;  4BG0 A;  5KYX B;  1OKK A;  3RKO F;  1TFK B;  2J9W A;  3C8G A;  1ST6 A;  3T9O A;  3PDM P;  4JEB A;  2DYR C;  5T3T A;  1N1C A;  1PD0 A;  3C18 A;  3R7C A;  3ZC4 A;  2R7O A;  3US6 A;  4J32 B;  1ZYR F;  2XM4 A;  5HV9 A;  3SP1 A;  4ZLD A;  2L6F A;  2GDC A;  2MHR A;  4CS8 A;  4PJN A;  2NPU A;  3LLI A;  1VYI A;  1H9T A;  2Y39 A;  1NFN A;  3EGD A;  2QE9 A;  4JTC B;  3TUL A;  3O55 A;  2R7S A;  256B A;  2WVN A;  2W4M A;  3MX3 A;  2OQM A;  2UUI A;  2EIJ C;  2CCY A;  4ULW A;  2OU6 A;  3JT1 A;  3EFO B;  2H8A A;  4DJ9 A;  3M79 A;  1C17 M;  5E2Q A;  5E3C A;  2KSF A;  5KYU B;  2C04 A;  1HMD A;  3KMI A;  1U6H A;  5T1D B;  3N0T A;  3EHN A;  4U9E A;  2CW0 F;  2QNL A;  1RXQ A;  3RH3 A;  3HNK A;  2J8W A;  1VLT A;  1SF8 A;  4ONS A;  5E3A A;  5DLJ A;  3RVY A;  3QW1 A;  1EQ1 A;  3VM6 A;  3C63 A;  3DI5 A;  5JP7 A;  3UGO A;  1ZHY A;  2WZF A;  4JCZ A;  5B3I A;  4EUK B;  1NZE A;  3UMI A;  3CQZ A;  4EBB A;  4U5E E;  3HLZ A;  1EI7 A;  2ZXP A;  2QY9 A;  3NG1 A;  5HSW A;  3ASO C;  3GWN A;  2PBE A;  2V26 A;  3QVY A;  1OCC C;  2XLV A;  4G7O F;  1JPN A;  4BEM J;  3EPV A;  4IB4 A;  4PJM A;  4U9D A;  3TJ6 A;  2R7Q A;  3DM5 A;  3OA1 A;  3ABK C;  2NUT A;  3CZ6 A;  4K7B A;  4HFK B;  4JTA B;  3ASN C;  3HNJ A;  3T4R A;  2J9U A;  3ZIB A;  2A1D D;  3LES A;  4OD5 A;  2R7T A;  5KYY A;  2A0U A;  2X0C A;  1QPU A;  3NDB B;  1YYJ A;  2HV7 A;  1A0B A;  2EPN A;  1NU7 D;  1V74 B;  2HSQ A;  2YVK A;  2KC3 A;  1APC A;  3O39 A;  1CGO A;  1WOL A;  2CGE A;  5E33 A;  5A6B A;  2IXN A;  3F46 A;  3S27 A;  3WG7 C;  3L34 A;  4YK5 A;  1MQV A;  4LLC A;  4MVR A;  2R7V A;  1M2O A;  4CS9 C;  3EG9 A;  1OQC A;  3FVY A;  4E7S A;  1UG7 A;  4IRU A;  5JLI A;  2XLO A;  1E83 A;  3FMS A;  4BJ5 C;  3RYL A;  3JSZ A;  4B6I A;  1YDI A;  2YHS A;  3DMD A;  2OKU A;  3JRM O;  4FAP B;  3IEE A;  5FCL A;  4U5H A;  1I4Z A;  2XS8 A;  2IM8 A;  2JX0 A;  2EIN C;  1ORS C;  1M6T A;  2HUJ A;  2R05 A;  2AP3 A;  2W4B A;  2XL6 A;  3B29 A;  3K6B A;  1V54 C;  2KK1 A;  1T01 A;  5COF A;  4MS2 A;  2G3V A;  3ZWI A;  5CIV A;  4YL3 A;  2XS1 A;  2XRH A;  1NBB A;  2IXP A;  2A68 F;  4U5F E;  2Q9B A;  4O79 A;  4XTK A;  4KNV A;  1R4T A;  1TFO B;  4N06 A;  1DOV A;  1KU2 A;  4J7Y A;  1FNT c;  3DKA A;  4RBN A;  1R5I D;  1HE9 A;  1T6U A;  3C8G B;  4XEF A;  3K33 A;  3TJ5 A;  3EH2 A;  4Z9H A;  4HEA J;  4RDA A;  1AVO B;  5IY5 C;  5AC4 A;  3NMJ A;  1H6G A;  3B0V C;  1TKN A;  2BE5 F;  5JUA A;  3B0U X;  2J7P A;  3M4C A;  4GQH A;  2M4E A;  3A11 A;  4E17 A;  3RQG A;  4BEJ A;  3VAY A;  4QI2 A;  1SYQ A;  1CPR A;  1J8Y F;  2CNW A;  4JZA A;  1ZW3 A;  1C02 A;  3C8Z A;  3KYI A;  2V3C C;  4OIO F;  4BJ6 A;  3DJN B;  3IQ6 A;  3K7D A;  1M56 C;  3MYI A;  3OEO A;  2L7A A;  4I1O B;  5AGF A;  4BJT A;  3L1M A;  3CSK A;  4NC3 A;  2L6H A;  3JYH A;  1CGM E;  4JJF A;  2OJQ A;  3VYW A;  4G7Z F;  4MVO A;  3U0C A;  1U89 A;  1YZA A;  2YEV A;  1BR2 A;  3M15 A;  3PCV A;  3WHN A;  4EBJ A;  5BQH A;  5F28 E;  2XLM A;  3DE9 A;  4QI0 A;  2Q7R A;  5JSL A;  2H7V C;  2AU5 A;  2HS5 A;  1SZI A;  2Q3T A;  4Q7C A;  1L3P A;  2PFD A;  3A9C A;  3KH2 A;  3PMR A;  4P6I C;  2R7R A;  2Q00 A;  2GFH A;  3LS1 A;  2L81 A;  3GOD A;  3IPM O;  2Q4F A;  4IGG A;  1YA9 A;  1LKX A;  2NSF A;  2A6H F;  3Q6N A;  2I8B A;  4CIP A;  4C7O A;  1VB5 A;  1LS4 A;  1HE1 A;  4EKW A;  2R25 A;  2EPL X;  2C03 A;  4A4A A;  3QW0 A;  5DQT A;  2NUT B;  1YYX A;  2OCC C;  3FAP B;  3IQT A;  2OG2 A;  3LEV A;  5A6K A;  1YVI A;  3AG2 C;  3ATP A;  1XWJ A;  1I4Y A;  1BDJ B;  3U2L A;  3NYM A;  4DBQ A;  5L0F A;  4L6R A;  2VH3 A;  5KYY B;  2HJM A;  3K1I C;  4YT5 A;  4JRZ A;  4U5C E;  3MLG A;  3EJN A;  2XXA B;  3S9O A;  1QKR A;  2YL1 A;  1YAR O;  3K66 A;  4Z9I A;  2QUP A;  2XM0 A;  2OEV A;  1WN0 A;  2J9V A;  3EH1 A;  4JKV A;  2LK4 A;  2VB6 A;  4XPY A;  4YWQ A;  3W2W A;  4IAO A;  1KTM A;  1OW6 A;  1PV3 A;  3NMK A;  4JC7 A;  5A69 A;  3EG9 B;  4WGY A;  5TJ5 E;  1KNY A;  4E7Z A;  5B3S C;  2H7O A;  3NKE A;  4QDL A;  5BQI A;  4MTG A;  3AGU A;  2QLA A;  2HJ3 A;  1H9G A;  1YZC A;  3WOD F;  2J0X A;  3KPH A;  2J46 A;  3Q7G A;  4DBR A;  4I3M A;  1TWG A;  2L6G A;  1QVX A;  1D1C A;  2KQ9 A;  5D92 A;  1K05 A;  1Q0D A;  3DD7 A;  5L0G A;  2KYH A;  3O6X A;  3VF0 A;  3O10 A;  2NSG A;  4JTD B;  1E84 A;  2WVO A;  3JZ0 A;  2AWY A;  1I5N A;  2HKV A;  1NSG B;  2D5R B;  2W9Y A;  3DE8 A;  3U9M A;  1LE2 A;  3AG1 C;  3QZC A;  2W45 A;  1TQG A;  2HSB A;  3EHM A;  4O6N A;  4AE4 B;  5F5F A;  4LDQ A;  4OIP F;  1M57 C;  2G62 A;  2XLD A;  5DVW A;  5B1B C;  4DRI B;  3DZA A;  1RJ9 A;  4WGZ A;  5KYW A;  3ECS A;  1G5Z A;  4BJ5 A;  2LQG A;  2KGO A;  3HTK C;  4C3D A;  3R2P A;  4PR9 A;  4BPM A;  4D4N A;  1G8X A;  3UR3 C;  2YL3 A;  1Z63 A;  2GWW A;  2OJE D;  4CS7 A;  3I5P A;  1QZX A;  3DJU B;  1T6Q A;  5COG A;  4DXW A;  1E86 A;  2UUH A;  1K04 A;  2GAQ A;  3EGX A;  2PNO A;  3L8I A;  3G4Z A;  1CGN A;  3JRT A;  4MTO A;  4MND A;  5A6A A;  2LD6 A;  3H2U A;  4O6Y A;  4DRJ B;  2FAP B;  4CS8 C;  4EHP A;  5EGY A;  2VAS A;  3AGT A;  1ZHW A;  2H7B A;  3IQ5 A;  3U5S A;  1LI5 A;  3RVZ A;  4NY3 A;  3TK0 A;  2EIK C;  1EKY A;  3UMK A;  3HNI A;  4XWJ A;  2TMV P;  1GGQ A;  2EPO A;  2IXM A;  4FX5 A;  5GPG B;  4N4W A;  1OXK A;  3C7J A;  3GEH A;  4XLN F;  2KJG A;  1Z5Z A;  3EZH A;  1ZHZ A;  2P6V A;  3LAY A;  1BR4 A;  4M63 A;  5A6J A;  1S7Z A;  3FDQ A;  5L0H A;  2FFH A;  2YRF A;  2ZPA A;  3SXK A;  4W8P A;  1O87 A;  1FAP B;  2YQY A;  4C3E A;  3X2Q C;  4CX9 A;  1O3U A;  2EPM X;  2A69 F;  1ORY A;  4JVS A;  4MQ9 F;  3B9Q A;  1EA8 A;  1QQ3 A;  1WAS A;  2Y3G A;  3AQC A;  5B1A C;  4IJJ A;  4O7G A;  1PD1 A;  1VLS A;  3IHU A;  3QVZ A;  4WAB A;  3HKK A;  2MYS A;  4U5G A;  5CI9 A;  4DVZ A;  4PK4 A;  5EHH A;  1JR8 A;  3Q7L A;  4IAQ A;  4I44 A;  4ANJ A;  1BBH A;  1Z6A A;  1RKE B;  4HE8 D;  4C7O B;  2DYS C;  4XEK A;  3LLK A;  3FAJ A;  4LER A;  2BC5 A;  2FGY A;  5KYU A;  1XZP A;  4GEH A;  1D0Z A;  3FOP A;  2WL8 A;  1OKK D;  3C8G D;  3DXJ F;  1BR1 A;  4K1O A;  3UMH A;  1WTY A;  3FOO A;  3W8H A;  4CDV A;  5AC5 A;  2LP4 A;  4G7H F;  1FFT C;  2YWA A;  4JUR I;  4H54 A;  3B0P A;  4K0D A;  1VTM P;  3EGD B;  2NUP A;  4XEV A;  3GEI A;  4R32 A;  1W2W A;  1WWP A;  1FMV A;  3DAG A;  4ULV A;  4Q4Z F;  1LM3 B;  4YL1 A;  2L9J A;  3H2V A;  2R9R B;  1QLE C;  4PAC A;  3C62 A;  1Q0F A;  1AEP A;  3NKD A;  4FWV A;  3AQB A;  2ASR A;  4G78 A;  1VYK A;  2ZXW C;  1RKC A;  4J30 B;  3X1O A;  4YJW A;  4AK9 A;  2IOQ A;  5JT4 A;  1T5O A;  1O5H A;  4IAR A;  2ETS A;  5FZT A;  4IWB A;  2J9B A;  5COM A;  3V5X A;  5EK0 A;  1S05 A;  3SXY A;  2X51 A;  4AX2 A;  4XPX A;  3B71 A;  1F1M A;  1LPE A;  1NFO A;  1HW1 A;  3LNR A;  1Z23 A;  3MBG A;  1OCO C;  1XZQ A;  3EQL F;  1G4W R;  1M2V A;  1MNE A;  3LJB A;  3ZQY A;  3DM9 B;  3ZSU A;  3KL4 A;  2MWQ A;  2PF4 E;  1MMA A;  3CEX A;  3ZVR A;  3W8I A;  4E18 A;  4O6M A;  1IW7 F;  5KYW B;  4E0H A;  3G4X A;  3AOU A;  3SZR A;  4F4B A;  3SEO A;  2XLW A;  3JCU Q;  2B0J A;  3AG3 C;  1BZ4 A;  1TWH A;  2J0W A;  4W8K A;  4OIN F;  5JRA A;  2HMQ A;  3I5Q A;  1ZHX A;  2HMZ A;  1MMN A;  3EZI A;  3F47 A;  3ZQV A;  4A2N B;  4MW8 A;  4CIH A;  2R7X A;  3EGX B;  3KKB A;  2M64 A;  1ZU4 A;  4CDA A;  4AL0 A;  4ER9 A;  3VRC A;  3T6J A;  1Y4C A;  4E0I A;  3IQC A;  4YT4 A;  2P61 A;  3AJM A;  5A6B D;  2EPK X;  2A6E F;  3V7O A;  4LDR A;  4N6H A;  1U0B B;  1Q0G A;  3I4U A;  3RIP A;  2F22 A;  1TR2 A;  2D4U A;  2VC9 A;  3HNL A;  3S90 A;  1ZVZ A;  4Q5S F;  1D1A A;  1MMD A;  2WZL A;  4CSA C;  3BRJ A;  5T3W A;  3ZDL A;  4DRH B;  3RFY A;  2KW3 C;  3LS0 A;  2Q9C A;  4DOZ A;  3T6B A;  3E9V A;  2XL4 A;  4LLE A;  1J8M F;  4NCQ A;  1NLX A;  2HFI A;  3V5Y A;  3NRH A;  2Y3D A;  4JJG A;  3GEE A;  2QTV A;  4PJJ A;  1ZZP A;  3CAX A;  3GM3 A;  4UDV A;  3V5Z A;  3RF3 A;  3NYL A;  2HZ8 A;  2LFD A;  3DAF A;  3S29 A;  1HW2 A;  4PFO A;  1QSP A;  2XSE A;  3ZTZ A;  1UFB A;  4CS9 A;  3BEH A;  5JS5 A;  4G0H A;  1JPJ A;  4NTB A;  5KYN A;  1IZM A;  2CYD A;  4FES A;  4OIQ F;  2E87 A;  2ZD9 A;  2P1A A;  3M4B A;  2CDQ A;  4ZLC A;  3E70 C;  1D0Y A;  2A0B A;  4NQF A;  3WAQ A;  2YL0 A;  1LE4 A;  3QTH A;  2BL2 A;  2DB4 A;  2G3K A;  1YA7 O;  2IXO A;  4GYT A;  2LFF A;  1MMG A;  3HJC A;  5F5H A;  3ZTM A;  2VCA A;  2R02 A;  3N2Z B;  4C3B A;  3MYF A;  1NU9 C;  1GQA A;  2I15 A;  5DS5 A;  1FR0 A;  2Z15 A;  3QMK A;  1SMY F;  4NTF A;  2NUP B;  4PJL A;  3L8J A;  5JVE A;  4RD9 A;  3SXZ A;  2EIM C;  2R7U A;  3S84 A;  2J7P D;  4U5B E;  4PFP A;  4AL1 A;  4CBE A;  5DS4 A;  4EBK A;  3U9J A;  2CNW D;  3H65 A;  2R7W A;  3JYY A;  2ZXO A;  3GWL A;  3U3F A;  1TWA A;  1WGW A;  1OXB A;  4KBL A;  2Y3B A;  3LUT B;  5KYX A;  1K40 A;  2Q9A A;  2XLH A;  3POV A;  2AWC A;  4CDY A;  4D4X A;  1MND A;  3RQF A;  1A7V A;  1OR3 A;  3ITF A;  4JEA A;  3TOM A;  2B0H A;  3JTL O;  4J7T A;  2RSE B;  3GM2 A; 
#chains in the Genus database with same CATH homology
 1EA8 A;  1LS4 A;  1B68 A;  2KC3 A;  1OR2 A;  1BZ4 A;  1EQ1 A;  1AEP A;  3S84 A;  1H7I A;  1LE2 A;  1NFN A;  1LPE A;  1NFO A;  3R2P A;  1GS9 A;  1OR3 A;  1LE4 A;  1YA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...