1EA8A

Apolipoprotein e3 22kd fragment lys146glu mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
140
structure length
140
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRERLLRDADDLQKRLAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APOLIPOPROTEIN E
publication title Apolipoprotein E3 22Kd Fragment Lys146Gln Mutant
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 65
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2001-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1ea8A00
1AEPA 2KC3A 1YA9A 1BZ4A 1B68A 1OR3A 1NFNA 3S84A 1LE2A 1EA8A 1NFOA 1GS9A 1LPEA 1LS4A 1OR2A 3R2PA 1H7IA 1LE4A 1EQ1A
chains in the Genus database with same CATH superfamily
1YVIA 2IM8A 3FMSA 4IB4A 1ZW2A 1GGQA 3G4XA 2PX3A 2EIMC 3M79A 5BQIA 4W8KA 5A6AA 4JEBA 4NTAA 3EJNA 1I4ZA 3FXHA 3B29A 4XPWA 4YT5A 5L0FA 2L81A 2R9RB 2CCYA 256BA 3V5XA 1PD0A 1BBHA 1VOMA 1F1MA 2JX0A 4NC3A 2VCAA 3CQZA 2VCCA 1Y6DA 4PACA 5A6BD 1WATA 4JTDB 5K0IA 2A6HF 2PP4A 2OJED 4XQ1A 1OR2A 2YVKA 4XLPF 5DLJA 1JPNA 2KQ9A 1VB5A 3LNRA 2YRFA 3EG9A 4OIOF 1K40A 4MVRA 3NYJA 1I5NA 3DAGA 4DBQA 2HFIA 4PJLA 2HSQA 5E33A 3NDBB 1K04A 4JTAB 1LM3B 2J9BA 5T3TA 1HW2A 2EILC 4YT2A 3EHNA 1M2VB 2R7UA 4G0HA 2VH3A 2D4UA 1U6HA 4YJWA 3GM2A 2YLGA 3UR3C 1MNEA 2AU5A 2EPKX 1G4US 5T1DB 2XLMA 2NUPB 3W8IA 1KTMA 3JSZA 3LNMB 3AJMA 1ZU4A 4N06A 2R7RA 1G5ZA 4BG0A 2YHSA 2OOCA 3H2UA 2R03A 3VF0A 1Z3IX 1LS4A 1ZU5A 3QVZA 4MQ9F 2P6VA 3ABKC 4J7YA 1TFOB 4NCQA 2A0BA 3DD7A 3EH1A 1ZZPA 2IXPA 1JAFA 3R2PA 4I1OB 1XZQA 3ITFA 2KK1A 3ASOC 4GEHA 1SF8A 2HJMA 3SXYA 2YWAA 3ZC4A 5GPGB 2EIKC 4QI0A 3N2ZB 4EWCA 3F46A 2R7WA 3M15A 2OCCC 1Z6AA 5E3CA 2Y3BA 1ST6A 1SYQA 5HSWA 3J06A 1LVKA 2EPOA 4Z9HA 4XPXA 5DS4A 5F28E 3GWLA 2NUTA 2XL4A 3W8HA 2H7BA 4GYTA 1OKKA 2CDQA 5L0IA 1OKKD 1LE2A 1NU7D 1RXQA 2YL3A 2XL8A 2ZXOA 3CSKA 3EFOB 4U5CE 3TULA 2IBFA 2P7VA 4B6IA 4KNWA 2M64A 5JT4A 1TKNA 4KBLA 2J46A 4AK9A 4I44A 4IAQA 4CS9A 4ZLCA 1OXKA 5CI9A 3K1IC 4CSAA 4H54A 3JT1A 4DJ9A 2VASA 4MTOA 2HJ3A 2LQGA 2HUJA 2J45A 4IAOA 4LDQA 4R32A 3AG1C 4WABA 3SXKA 1D1AA 5L0JA 1YJGA 3DE8A 4E7SA 3H65A 4CDAA 2P61A 2HKVA 3NYLA 3GEHA 4CS8C 1JPJA 3NKDA 1B68A 5KYWA 1HMOA 2KYHA 4HEAJ 1E86A 2A6EF 2RD9A 4NQFA 4A4AA 1VLSA 3K6BA 3SYNA 5L0CA 3ABMC 1ZVZA 2WZFA 2XL6A 4ONSA 2F22A 1J8YF 1RJ9A 4Z9IA 1JOGA 3MLGA 3T6BA 3U9JA 2HMZA 2GAQA 2B0HA 2XLWA 3GM1A 2C03A 3NKEA 1TR2A 5AC4A 5DS5A 1CPQA 2KGOA 4BJTA 5KYNA 1RKEA 2BC5A 4IGGA 4F4BA 5JLIA 3GEIA 3FAJA 4J32B 2OQMA 1N1CA 3C8GA 1V54C 1EI7A 2B0JA 4YL1A 3LS0A 1OCOC 3QW0A 3AGTA 4MVOA 3V5YA 1PCXA 3KL4A 5L3VA 1R5ID 2W45A 3NG1A 5COGA 2A69F 4N6HA 3U2MA 3LEOA 4MVMA 1JRAA 1VYIA 1O3UA 1C17M 3S27A 2RSEB 4CIPA 2R02A 2ZXRA 4LLEA 3HLZA 4RBNA 2LCHA 2IXNA 2DYSC 2G62A 2LD6A 2A68F 3AG2C 3JTLO 3MX3A 4JC7A 3VRCA 5FCLA 3MYFA 3PMRA 1Q0KA 1JMWA 1OW8A 5B3SC 1NSGB 2LP4A 4Q5SF 4C3BA 1S7ZA 2R7VA 1VMAA 1H7IA 1TWHA 3L0IA 5D91A 1H9GA 3IPMO 3PDMP 1CPRA 3LLIA 2R7TA 1D0XA 2PX0A 3JRTA 3NMKA 1UG7A 4DRIB 1BR2A 2R7QA 2J9WA 1YA9A 4N4WA 2I15A 2EPMX 4DRHB 5DQTA 2J0XA 4BJ5C 3ZTZA 3ASNC 2ZXPA 3K1HA 3S84A 3KYIA 1OCRC 3HTKC 3MYIA 3RYLA 4KI2A 1EA8A 2WB7A 3NRHA 1BR4A 5A6BA 4X0RA 2WVOA 3DJNB 5IY5C 3JSEO 3TJ5A 3DE9A 3W2VA 1JR8A 2J7PD 2KJGA 5JS5A 4CIHA 3SXZA 1FR0A 4H4KC 3ZVRA 3FDQA 5EK0A 3WODF 1DOVA 1FMVA 1SMYF 1E83A 5KYXB 3TJ6A 2HV6A 2QLAA 3X2QC 4MVQA 4ZLDA 3TOMA 1Z63A 1FMWA 2JD3A 3T6GB 1O87A 2H7VC 1OW7A 4FAPB 5HV9A 3ZDLA 1Q0MA 1MMDA 1ORSC 3SZRA 1RJ9B 3SNHA 1D0ZA 3EZIA 1E85A 4NTBA 3I5QA 5D92A 4CDYA 3RQGA 1QZXA 2YEVA 1QKRA 1WOLA 1ZYRF 1NG1A 1K05A 1XZPA 1RCPA 3HNIA 5DS6A 3S9OA 2XS8A 3VM6A 1HMDA 3EGDB 4JURI 2P1AA 1QLEC 1M56C 3U3BA 4UDVA 5CI8A 3GM3A 4IWBA 4MW8A 1V4AA 5KYYA 3B0UX 2XXAA 3OA1A 2ETSA 4HFKB 3C8GB 4M63A 2DI3A 2Q9AA 1QPUA 5KYUB 1ZHZA 1D1BA 2LIGA 2Q3TA 2XLVA 2QY9A 2ZPAA 2HV7A 1SZIA 2VB6A 4O7GA 3R7CA 4JVSA 4MVSA 1HY5A 2Q4FA 1H6GA 2NPUA 4WJ0A 3L8IA 4U5EE 1OXBA 2X0CA 1C03A 4KNVA 2HMQA 1A41A 1M57C 2Q9CA 1SR2A 2YL7A 3RF3A 4DOZA 3WAQA 1MQVA 2R7OA 1GQAA 2CGEA 2DYRC 5EGYA 2R7SA 2ZXWC 2ZD9A 1CGOA 1NZEA 2VC9A 4YL0A 4DXWA 1D1CA 1KU2A 4U9DA 4P6IC 2IYLD 3S29A 1YARO 3E9VA 4RD9A 1CGME 1YZAA 1YAUO 2YKZA 3O6XA 4JJFA 2M4EA 3S28A 3ZSUA 4C3EA 4JE9A 1VYKA 4FESA 5L0HA 3RVZA 2A1DD 4J30B 1HE1A 1LI7A 2CNWD 1YYJA 4U5DE 1R4TA 3EPVA 3Q6MA 4YT4A 3RKOF 3US6A 1EKYA 1TQGA 1T6QA 1YLMA 3UMKA 4E17A 3B71A 3FAPB 3Q7LA 4NY3A 4NTFA 2J9UA 3T6JA 2MYSA 1Y4CA 5AC5A 2OEXA 4EHPA 1OR3A 2MWQA 4PFOA 2Q7RA 4ER9A 2UUHA 2IXMA 1M2OA 4IRUA 1A7VA 4JRZA 4JZAA 4ANJA 4BPMA 2QTVA 2L6HA 1CGNA 4Q7CA 3ATPA 2NSGA 1QVXA 5COMA 3RW0A 3LS1A 5E3AA 4EKWA 4CS9C 2OU6A 4C3DA 4BJ6A 1LPEA 3N24A 3UGOA 1WASA 2J9VA 1A0BA 4CSAC 4AX2A 2PBEA 3EG9B 4FX5A 4P9FA 5BQGA 3SP1A 3VAYA 2Y69C 3DMDA 4G7OF 3NYMA 3CAXA 4C7OA 4BEJA 3U0CA 1KNYA 1LE4A 2Y39A 2YL0A 2D5RB 3AOUA 4PK4A 3U8VA 3POVA 5B1BC 4DVZA 5JRAA 1VTMP 3DWWA 2A0UA 2BE5F 3DAFA 3I4UA 1GM5A 4XWJA 3ZG1A 3ZQYA 5F5HA 3TOLA 2MHRA 4K7BA 4YL3A 3ZIBA 3O39A 4DRJB 4G7ZF 2V3CC 4K1OA 3HKKA 3EHMA 1LIHA 5JSLA 1LI5A 1M2VA 2GDCA 1OCCC 3DZAA 3LEVA 2HSBA 4A2NB 1T9KA 2XXAB 3G4ZA 4MTGA 3K7DA 3T4RA 5BQHA 4IJJA 1TWCA 2P0NA 2QNLA 3F47A 4ULVA 1U89A 3H2VA 4MTFA 3RH3A 3RIPA 3AG4C 1L3PA 1ZW3A 2EPNA 1HW1A 2NUPA 3U3FA 4LACB 3E70C 1TFKB 5L0GA 4OIQF 2FAPB 1MMGA 3KMIA 1QSPA 4JCHA 1FFTC 4OD5A 1UFBA 3U9MA 1H9TA 1NU9C 1MMAA 2DB4A 4W8PA 4E0HA 1FTSA 2ASRA 1E2XA 3S0XA 1I4YA 2WVQA 2VCBA 2NUTB 5T3WA 4LLCA 1Q0GA 3GODA 3QW1A 4LDKA 1D0YA 2HS5A 2XLHA 4GQHA 4U5HA 2OKUA 1C02A 2H7OA 3FOPA 4EBKA 3DXJF 2E87A 3V5ZA 3ZWIA 3NMIA 2KNHA 3C7JA 3IEEA 2EIJC 3LESA 4JJGA 4WGYA 1YDIA 3EZHA 3LAYA 4G78A 1G4WR 4XEVA 1IW7F 2EINC 2W9YA 3QVYA 1OW6A 2FFHA 3C63A 3MBGA 4Z9JA 2ICWG 4K0DA 3BRJA 4MW3A 2J7PA 1APCA 4N6CA 2J8WA 4AL0A 4JIOA 3PHF2 3B0PA 4O6YA 2H8AA 2KSFA 1Q0DA 3ECSA 2WVNA 3EGXA 4HE8D 1VK5A 1EQ1A 3RVYA 3ZTMA 5A69A 2HZ8A 5KYWB 1J8MF 1V55C 2XSEA 1G8XA 4OINF 3FVYA 2XM0A 2YLDA 4MS2A 2NG1A 4YT8A 2Q00A 5A6JA 1BZ4A 1M6TA 2QE9A 3RQFA 1ZHXA 2WZLA 3JRMO 4CJOA 2TMVP 2Y3DA 4IARA 3GWNA 1BR1A 4D4XA 3EH2A 3MFNA 4MNDA 3RQEA 4CDVA 4CBEA 3OEOA 1U0BB 3UMHA 3Q6NA 1ZHYA 3GANA 3WG7C 2V26A 3HNJA 4PFPA 2L6GA 1E84A 5EHHA 4C7OB 1GS9A 1RKEB 1Z23A 4JEAA 3U5SA 3UGPA 1O5HA 2OG2A 3S90A 4PR9A 2CW0F 2LSEA 2XM4A 2YZSA 1YYXA 1T6UA 5AGFA 5TJ5E 1TWGA 3DKAA 3TK0A 4CX9A 1NFOA 1S05A 4J7TA 4OD4A 4JTCB 3KKBA 3K66A 1T01A 1BDJB 4I3MA 1ZHWA 2WL8A 4EUKB 2EPLX 2CYDA 2PFDA 3JZ0A 1AVOB 4XEFA 3QMKA 3HNLA 3FOOA 3SEOA 3SXMA 4AL1A 2I8BA 3BEHA 2C04A 3GEEA 3IQCA 3K33A 1RMVA 3TQOA 1V74B 3KYJA 1A7EA 2W4MA 3TD7A 4P9TA 3DM9B 4ULWA 1PD1A 2L9JA 4QDLA 3V7OA 1IZMA 1LS1A 5A6KA 2G3VA 3WHNA 4PJNA 3M4CA 3N0TA 3HJCA 3UMIA 3LLKA 4QI2A 3O55A 1WTYA 2Y3HA 3KH2A 2XLDA 4MVZA 4OIRF 4YWQA 2CNWA 2IOQA 3G50A 4AE4A 1T6IA 3K1IA 4DBRA 3T9OA 3DM5A 2LK4A 3GORA 3OWTA 5B3IA 4LERA 3NMJA 3W4YA 2R25A 5L3QA 3PCVA 3M1CB 4LDRA 3IQ6A 3DJUB 4CS8A 1PV3A 1LKXA 3M4BA 2YLIA 3JYYA 2PF4E 2XLEA 1MMNA 1W2WA 3CZ6A 5DQZA 5DVWA 3AQCA 3C18A 3LUTB 4YN0B 3EQLF 1NLXA 5JVEA 4XPYA 1VLTA 2J0WA 5JP7A 2JPUA 4CJGA 3EGXB 1FFHA 3L34A 2YQYA 3QZCA 3AG3C 1WWPA 4U9EA 3FHDA 1FAPB 3AQBA 3IHUA 5E2QA 2FGYA 4PJJA 2G3KA 3I5PA 3IQTA 3C8ZA 3KPHA 4U5GA 4JCZA 1TWAA 2AWYA 2X51A 3JYHA 4O6NA 3A11A 1FNTc 1ZHTA 1MNDA 2IXOA 2Z15A 4U5BE 5KYXA 2BL2A 1WN0A 3L8JA 4FWVA 4EBBA 4I1MA 4DVYP 2DGJA 2GFHA 2O9XA 4MVUA 1Z5ZA 1HE9A 2GWWA 2LFDA 4OIPF 4CS7A 3X1OA 2XLOA 2PNOA 4O6MA 4WGZA 3U2LA 5KYYB 4BJ6C 2OJQA 2YL1A 1Q0FA 3B9QA 3C62A 5FZTA 4EBJA 2WZGA 2UUIA 2AP3A 2R05A 2L6FA 4XEKA 4YK5A 4XLNF 3EGDA 5COFA 1ORJA 4E7ZA 5CIVA 4E0IA 2XRHA 1T5OA 2QUPA 3IQ5A 3LJBA 3U8PA 3ABLC 5B1AC 2OEVA 5JUAA 1AEPA 5KYUA 2KC3A 3C8GD 1ORYA 4Q4ZF 3AGUA 3W2WA 1Z7Qc 3JCUQ 4BEMJ 4BJ1A 3DI5A 4O79A 2GA0A 3ZQVA 1YA7O 1NFNA 3UNGC 1XWJA 1A7DA 1L7CA 1QQ3A 1OQCA 2XS1A 4JW1A 4PJMA 3Q7GA 4HFFB 2AWCA 1YZCA 4BJ5A 1OCZC 2NSFA 2KW3C 2AVKA 1RKCA 2L7AA 3L1MA 3O10A 4KC9A 3B0VC 4D4NA 4EIYA 5BUOA 4AE4B 4U5FE 1DOWA 3EFOA 3VYWA 4L6RA 4E18A 2Q9BA 4XTKA 5L0DA 2R7XA 1AUEA 2W4BA 1NBBA 3RFYA 3CEXA 4G7HF 3QTHA 2LFFA 3A9CA 4RDAA 3HNKA 5F5FA 2Y3GA 4JKVA 1WGWA
chains in the Genus database with same CATH topology
1AEPA 2KC3A 1YA9A 1BZ4A 1B68A 1OR3A 1NFNA 3S84A 1LE2A 1EA8A 1NFOA 1GS9A 1LPEA 1LS4A 1OR2A 3R2PA 1H7IA 1LE4A 1EQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AEP A;  2KC3 A;  1YA9 A;  1BZ4 A;  1B68 A;  1OR3 A;  1NFN A;  3S84 A;  1LE2 A;  1EA8 A;  1NFO A;  1GS9 A;  1LPE A;  1LS4 A;  1OR2 A;  3R2P A;  1H7I A;  1LE4 A;  1EQ1 A; 
#chains in the Genus database with same CATH topology
 1YVI A;  2IM8 A;  3FMS A;  4IB4 A;  1ZW2 A;  1GGQ A;  3G4X A;  2PX3 A;  2EIM C;  3M79 A;  5BQI A;  4W8K A;  5A6A A;  4JEB A;  4NTA A;  3EJN A;  1I4Z A;  3FXH A;  3B29 A;  4XPW A;  4YT5 A;  5L0F A;  2L81 A;  2R9R B;  2CCY A;  256B A;  3V5X A;  1PD0 A;  1BBH A;  1VOM A;  1F1M A;  2JX0 A;  4NC3 A;  2VCA A;  3CQZ A;  2VCC A;  1Y6D A;  4PAC A;  5A6B D;  1WAT A;  4JTD B;  5K0I A;  2A6H F;  2PP4 A;  2OJE D;  4XQ1 A;  1OR2 A;  2YVK A;  4XLP F;  5DLJ A;  1JPN A;  2KQ9 A;  1VB5 A;  3LNR A;  2YRF A;  3EG9 A;  4OIO F;  1K40 A;  4MVR A;  3NYJ A;  1I5N A;  3DAG A;  4DBQ A;  2HFI A;  4PJL A;  2HSQ A;  5E33 A;  3NDB B;  1K04 A;  4JTA B;  1LM3 B;  2J9B A;  5T3T A;  1HW2 A;  2EIL C;  4YT2 A;  3EHN A;  1M2V B;  2R7U A;  4G0H A;  2VH3 A;  2D4U A;  1U6H A;  4YJW A;  3GM2 A;  2YLG A;  3UR3 C;  1MNE A;  2AU5 A;  2EPK X;  1G4U S;  5T1D B;  2XLM A;  2NUP B;  3W8I A;  1KTM A;  3JSZ A;  3LNM B;  3AJM A;  1ZU4 A;  4N06 A;  2R7R A;  1G5Z A;  4BG0 A;  2YHS A;  2OOC A;  3H2U A;  2R03 A;  3VF0 A;  1Z3I X;  1LS4 A;  1ZU5 A;  3QVZ A;  4MQ9 F;  2P6V A;  3ABK C;  4J7Y A;  1TFO B;  4NCQ A;  2A0B A;  3DD7 A;  3EH1 A;  1ZZP A;  2IXP A;  1JAF A;  3R2P A;  4I1O B;  1XZQ A;  3ITF A;  2KK1 A;  3ASO C;  4GEH A;  1SF8 A;  2HJM A;  3SXY A;  2YWA A;  3ZC4 A;  5GPG B;  2EIK C;  4QI0 A;  3N2Z B;  4EWC A;  3F46 A;  2R7W A;  3M15 A;  2OCC C;  1Z6A A;  5E3C A;  2Y3B A;  1ST6 A;  1SYQ A;  5HSW A;  3J06 A;  1LVK A;  2EPO A;  4Z9H A;  4XPX A;  5DS4 A;  5F28 E;  3GWL A;  2NUT A;  2XL4 A;  3W8H A;  2H7B A;  4GYT A;  1OKK A;  2CDQ A;  5L0I A;  1OKK D;  1LE2 A;  1NU7 D;  1RXQ A;  2YL3 A;  2XL8 A;  2ZXO A;  3CSK A;  3EFO B;  4U5C E;  3TUL A;  2IBF A;  2P7V A;  4B6I A;  4KNW A;  2M64 A;  5JT4 A;  1TKN A;  4KBL A;  2J46 A;  4AK9 A;  4I44 A;  4IAQ A;  4CS9 A;  4ZLC A;  1OXK A;  5CI9 A;  3K1I C;  4CSA A;  4H54 A;  3JT1 A;  4DJ9 A;  2VAS A;  4MTO A;  2HJ3 A;  2LQG A;  2HUJ A;  2J45 A;  4IAO A;  4LDQ A;  4R32 A;  3AG1 C;  4WAB A;  3SXK A;  1D1A A;  5L0J A;  1YJG A;  3DE8 A;  4E7S A;  3H65 A;  4CDA A;  2P61 A;  2HKV A;  3NYL A;  3GEH A;  4CS8 C;  1JPJ A;  3NKD A;  1B68 A;  5KYW A;  1HMO A;  2KYH A;  4HEA J;  1E86 A;  2A6E F;  2RD9 A;  4NQF A;  4A4A A;  1VLS A;  3K6B A;  3SYN A;  5L0C A;  3ABM C;  1ZVZ A;  2WZF A;  2XL6 A;  4ONS A;  2F22 A;  1J8Y F;  1RJ9 A;  4Z9I A;  1JOG A;  3MLG A;  3T6B A;  3U9J A;  2HMZ A;  2GAQ A;  2B0H A;  2XLW A;  3GM1 A;  2C03 A;  3NKE A;  1TR2 A;  5AC4 A;  5DS5 A;  1CPQ A;  2KGO A;  4BJT A;  5KYN A;  1RKE A;  2BC5 A;  4IGG A;  4F4B A;  5JLI A;  3GEI A;  3FAJ A;  4J32 B;  2OQM A;  1N1C A;  3C8G A;  1V54 C;  1EI7 A;  2B0J A;  4YL1 A;  3LS0 A;  1OCO C;  3QW0 A;  3AGT A;  4MVO A;  3V5Y A;  1PCX A;  3KL4 A;  5L3V A;  1R5I D;  2W45 A;  3NG1 A;  5COG A;  2A69 F;  4N6H A;  3U2M A;  3LEO A;  4MVM A;  1JRA A;  1VYI A;  1O3U A;  1C17 M;  3S27 A;  2RSE B;  4CIP A;  2R02 A;  2ZXR A;  4LLE A;  3HLZ A;  4RBN A;  2LCH A;  2IXN A;  2DYS C;  2G62 A;  2LD6 A;  2A68 F;  3AG2 C;  3JTL O;  3MX3 A;  4JC7 A;  3VRC A;  5FCL A;  3MYF A;  3PMR A;  1Q0K A;  1JMW A;  1OW8 A;  5B3S C;  1NSG B;  2LP4 A;  4Q5S F;  4C3B A;  1S7Z A;  2R7V A;  1VMA A;  1H7I A;  1TWH A;  3L0I A;  5D91 A;  1H9G A;  3IPM O;  3PDM P;  1CPR A;  3LLI A;  2R7T A;  1D0X A;  2PX0 A;  3JRT A;  3NMK A;  1UG7 A;  4DRI B;  1BR2 A;  2R7Q A;  2J9W A;  1YA9 A;  4N4W A;  2I15 A;  2EPM X;  4DRH B;  5DQT A;  2J0X A;  4BJ5 C;  3ZTZ A;  3ASN C;  2ZXP A;  3K1H A;  3S84 A;  3KYI A;  1OCR C;  3HTK C;  3MYI A;  3RYL A;  4KI2 A;  1EA8 A;  2WB7 A;  3NRH A;  1BR4 A;  5A6B A;  4X0R A;  2WVO A;  3DJN B;  5IY5 C;  3JSE O;  3TJ5 A;  3DE9 A;  3W2V A;  1JR8 A;  2J7P D;  2KJG A;  5JS5 A;  4CIH A;  3SXZ A;  1FR0 A;  4H4K C;  3ZVR A;  3FDQ A;  5EK0 A;  3WOD F;  1DOV A;  1FMV A;  1SMY F;  1E83 A;  5KYX B;  3TJ6 A;  2HV6 A;  2QLA A;  3X2Q C;  4MVQ A;  4ZLD A;  3TOM A;  1Z63 A;  1FMW A;  2JD3 A;  3T6G B;  1O87 A;  2H7V C;  1OW7 A;  4FAP B;  5HV9 A;  3ZDL A;  1Q0M A;  1MMD A;  1ORS C;  3SZR A;  1RJ9 B;  3SNH A;  1D0Z A;  3EZI A;  1E85 A;  4NTB A;  3I5Q A;  5D92 A;  4CDY A;  3RQG A;  1QZX A;  2YEV A;  1QKR A;  1WOL A;  1ZYR F;  1NG1 A;  1K05 A;  1XZP A;  1RCP A;  3HNI A;  5DS6 A;  3S9O A;  2XS8 A;  3VM6 A;  1HMD A;  3EGD B;  4JUR I;  2P1A A;  1QLE C;  1M56 C;  3U3B A;  4UDV A;  5CI8 A;  3GM3 A;  4IWB A;  4MW8 A;  1V4A A;  5KYY A;  3B0U X;  2XXA A;  3OA1 A;  2ETS A;  4HFK B;  3C8G B;  4M63 A;  2DI3 A;  2Q9A A;  1QPU A;  5KYU B;  1ZHZ A;  1D1B A;  2LIG A;  2Q3T A;  2XLV A;  2QY9 A;  2ZPA A;  2HV7 A;  1SZI A;  2VB6 A;  4O7G A;  3R7C A;  4JVS A;  4MVS A;  1HY5 A;  2Q4F A;  1H6G A;  2NPU A;  4WJ0 A;  3L8I A;  4U5E E;  1OXB A;  2X0C A;  1C03 A;  4KNV A;  2HMQ A;  1A41 A;  1M57 C;  2Q9C A;  1SR2 A;  2YL7 A;  3RF3 A;  4DOZ A;  3WAQ A;  1MQV A;  2R7O A;  1GQA A;  2CGE A;  2DYR C;  5EGY A;  2R7S A;  2ZXW C;  2ZD9 A;  1CGO A;  1NZE A;  2VC9 A;  4YL0 A;  4DXW A;  1D1C A;  1KU2 A;  4U9D A;  4P6I C;  2IYL D;  3S29 A;  1YAR O;  3E9V A;  4RD9 A;  1CGM E;  1YZA A;  1YAU O;  2YKZ A;  3O6X A;  4JJF A;  2M4E A;  3S28 A;  3ZSU A;  4C3E A;  4JE9 A;  1VYK A;  4FES A;  5L0H A;  3RVZ A;  2A1D D;  4J30 B;  1HE1 A;  1LI7 A;  2CNW D;  1YYJ A;  4U5D E;  1R4T A;  3EPV A;  3Q6M A;  4YT4 A;  3RKO F;  3US6 A;  1EKY A;  1TQG A;  1T6Q A;  1YLM A;  3UMK A;  4E17 A;  3B71 A;  3FAP B;  3Q7L A;  4NY3 A;  4NTF A;  2J9U A;  3T6J A;  2MYS A;  1Y4C A;  5AC5 A;  2OEX A;  4EHP A;  1OR3 A;  2MWQ A;  4PFO A;  2Q7R A;  4ER9 A;  2UUH A;  2IXM A;  1M2O A;  4IRU A;  1A7V A;  4JRZ A;  4JZA A;  4ANJ A;  4BPM A;  2QTV A;  2L6H A;  1CGN A;  4Q7C A;  3ATP A;  2NSG A;  1QVX A;  5COM A;  3RW0 A;  3LS1 A;  5E3A A;  4EKW A;  4CS9 C;  2OU6 A;  4C3D A;  4BJ6 A;  1LPE A;  3N24 A;  3UGO A;  1WAS A;  2J9V A;  1A0B A;  4CSA C;  4AX2 A;  2PBE A;  3EG9 B;  4FX5 A;  4P9F A;  5BQG A;  3SP1 A;  3VAY A;  2Y69 C;  3DMD A;  4G7O F;  3NYM A;  3CAX A;  4C7O A;  4BEJ A;  3U0C A;  1KNY A;  1LE4 A;  2Y39 A;  2YL0 A;  2D5R B;  3AOU A;  4PK4 A;  3U8V A;  3POV A;  5B1B C;  4DVZ A;  5JRA A;  1VTM P;  3DWW A;  2A0U A;  2BE5 F;  3DAF A;  3I4U A;  1GM5 A;  4XWJ A;  3ZG1 A;  3ZQY A;  5F5H A;  3TOL A;  2MHR A;  4K7B A;  4YL3 A;  3ZIB A;  3O39 A;  4DRJ B;  4G7Z F;  2V3C C;  4K1O A;  3HKK A;  3EHM A;  1LIH A;  5JSL A;  1LI5 A;  1M2V A;  2GDC A;  1OCC C;  3DZA A;  3LEV A;  2HSB A;  4A2N B;  1T9K A;  2XXA B;  3G4Z A;  4MTG A;  3K7D A;  3T4R A;  5BQH A;  4IJJ A;  1TWC A;  2P0N A;  2QNL A;  3F47 A;  4ULV A;  1U89 A;  3H2V A;  4MTF A;  3RH3 A;  3RIP A;  3AG4 C;  1L3P A;  1ZW3 A;  2EPN A;  1HW1 A;  2NUP A;  3U3F A;  4LAC B;  3E70 C;  1TFK B;  5L0G A;  4OIQ F;  2FAP B;  1MMG A;  3KMI A;  1QSP A;  4JCH A;  1FFT C;  4OD5 A;  1UFB A;  3U9M A;  1H9T A;  1NU9 C;  1MMA A;  2DB4 A;  4W8P A;  4E0H A;  1FTS A;  2ASR A;  1E2X A;  3S0X A;  1I4Y A;  2WVQ A;  2VCB A;  2NUT B;  5T3W A;  4LLC A;  1Q0G A;  3GOD A;  3QW1 A;  4LDK A;  1D0Y A;  2HS5 A;  2XLH A;  4GQH A;  4U5H A;  2OKU A;  1C02 A;  2H7O A;  3FOP A;  4EBK A;  3DXJ F;  2E87 A;  3V5Z A;  3ZWI A;  3NMI A;  2KNH A;  3C7J A;  3IEE A;  2EIJ C;  3LES A;  4JJG A;  4WGY A;  1YDI A;  3EZH A;  3LAY A;  4G78 A;  1G4W R;  4XEV A;  1IW7 F;  2EIN C;  2W9Y A;  3QVY A;  1OW6 A;  2FFH A;  3C63 A;  3MBG A;  4Z9J A;  2ICW G;  4K0D A;  3BRJ A;  4MW3 A;  2J7P A;  1APC A;  4N6C A;  2J8W A;  4AL0 A;  4JIO A;  3PHF 2;  3B0P A;  4O6Y A;  2H8A A;  2KSF A;  1Q0D A;  3ECS A;  2WVN A;  3EGX A;  4HE8 D;  1VK5 A;  1EQ1 A;  3RVY A;  3ZTM A;  5A69 A;  2HZ8 A;  5KYW B;  1J8M F;  1V55 C;  2XSE A;  1G8X A;  4OIN F;  3FVY A;  2XM0 A;  2YLD A;  4MS2 A;  2NG1 A;  4YT8 A;  2Q00 A;  5A6J A;  1BZ4 A;  1M6T A;  2QE9 A;  3RQF A;  1ZHX A;  2WZL A;  3JRM O;  4CJO A;  2TMV P;  2Y3D A;  4IAR A;  3GWN A;  1BR1 A;  4D4X A;  3EH2 A;  3MFN A;  4MND A;  3RQE A;  4CDV A;  4CBE A;  3OEO A;  1U0B B;  3UMH A;  3Q6N A;  1ZHY A;  3GAN A;  3WG7 C;  2V26 A;  3HNJ A;  4PFP A;  2L6G A;  1E84 A;  5EHH A;  4C7O B;  1GS9 A;  1RKE B;  1Z23 A;  4JEA A;  3U5S A;  3UGP A;  1O5H A;  2OG2 A;  3S90 A;  4PR9 A;  2CW0 F;  2LSE A;  2XM4 A;  2YZS A;  1YYX A;  1T6U A;  5AGF A;  5TJ5 E;  1TWG A;  3DKA A;  3TK0 A;  4CX9 A;  1NFO A;  1S05 A;  4J7T A;  4OD4 A;  4JTC B;  3KKB A;  3K66 A;  1T01 A;  1BDJ B;  4I3M A;  1ZHW A;  2WL8 A;  4EUK B;  2EPL X;  2CYD A;  2PFD A;  3JZ0 A;  1AVO B;  4XEF A;  3QMK A;  3HNL A;  3FOO A;  3SEO A;  3SXM A;  4AL1 A;  2I8B A;  3BEH A;  2C04 A;  3GEE A;  3IQC A;  3K33 A;  1RMV A;  3TQO A;  1V74 B;  3KYJ A;  1A7E A;  2W4M A;  3TD7 A;  4P9T A;  3DM9 B;  4ULW A;  1PD1 A;  2L9J A;  4QDL A;  3V7O A;  1IZM A;  1LS1 A;  5A6K A;  2G3V A;  3WHN A;  4PJN A;  3M4C A;  3N0T A;  3HJC A;  3UMI A;  3LLK A;  4QI2 A;  3O55 A;  1WTY A;  2Y3H A;  3KH2 A;  2XLD A;  4MVZ A;  4OIR F;  4YWQ A;  2CNW A;  2IOQ A;  3G50 A;  4AE4 A;  1T6I A;  3K1I A;  4DBR A;  3T9O A;  3DM5 A;  2LK4 A;  3GOR A;  3OWT A;  5B3I A;  4LER A;  3NMJ A;  3W4Y A;  2R25 A;  5L3Q A;  3PCV A;  3M1C B;  4LDR A;  3IQ6 A;  3DJU B;  4CS8 A;  1PV3 A;  1LKX A;  3M4B A;  2YLI A;  3JYY A;  2PF4 E;  2XLE A;  1MMN A;  1W2W A;  3CZ6 A;  5DQZ A;  5DVW A;  3AQC A;  3C18 A;  3LUT B;  4YN0 B;  3EQL F;  1NLX A;  5JVE A;  4XPY A;  1VLT A;  2J0W A;  5JP7 A;  2JPU A;  4CJG A;  3EGX B;  1FFH A;  3L34 A;  2YQY A;  3QZC A;  3AG3 C;  1WWP A;  4U9E A;  3FHD A;  1FAP B;  3AQB A;  3IHU A;  5E2Q A;  2FGY A;  4PJJ A;  2G3K A;  3I5P A;  3IQT A;  3C8Z A;  3KPH A;  4U5G A;  4JCZ A;  1TWA A;  2AWY A;  2X51 A;  3JYH A;  4O6N A;  3A11 A;  1FNT c;  1ZHT A;  1MND A;  2IXO A;  2Z15 A;  4U5B E;  5KYX A;  2BL2 A;  1WN0 A;  3L8J A;  4FWV A;  4EBB A;  4I1M A;  4DVY P;  2DGJ A;  2GFH A;  2O9X A;  4MVU A;  1Z5Z A;  1HE9 A;  2GWW A;  2LFD A;  4OIP F;  4CS7 A;  3X1O A;  2XLO A;  2PNO A;  4O6M A;  4WGZ A;  3U2L A;  5KYY B;  4BJ6 C;  2OJQ A;  2YL1 A;  1Q0F A;  3B9Q A;  3C62 A;  5FZT A;  4EBJ A;  2WZG A;  2UUI A;  2AP3 A;  2R05 A;  2L6F A;  4XEK A;  4YK5 A;  4XLN F;  3EGD A;  5COF A;  1ORJ A;  4E7Z A;  5CIV A;  4E0I A;  2XRH A;  1T5O A;  2QUP A;  3IQ5 A;  3LJB A;  3U8P A;  3ABL C;  5B1A C;  2OEV A;  5JUA A;  1AEP A;  5KYU A;  2KC3 A;  3C8G D;  1ORY A;  4Q4Z F;  3AGU A;  3W2W A;  1Z7Q c;  3JCU Q;  4BEM J;  4BJ1 A;  3DI5 A;  4O79 A;  2GA0 A;  3ZQV A;  1YA7 O;  1NFN A;  3UNG C;  1XWJ A;  1A7D A;  1L7C A;  1QQ3 A;  1OQC A;  2XS1 A;  4JW1 A;  4PJM A;  3Q7G A;  4HFF B;  2AWC A;  1YZC A;  4BJ5 A;  1OCZ C;  2NSF A;  2KW3 C;  2AVK A;  1RKC A;  2L7A A;  3L1M A;  3O10 A;  4KC9 A;  3B0V C;  4D4N A;  4EIY A;  5BUO A;  4AE4 B;  4U5F E;  1DOW A;  3EFO A;  3VYW A;  4L6R A;  4E18 A;  2Q9B A;  4XTK A;  5L0D A;  2R7X A;  1AUE A;  2W4B A;  1NBB A;  3RFY A;  3CEX A;  4G7H F;  3QTH A;  2LFF A;  3A9C A;  4RDA A;  3HNK A;  5F5F A;  2Y3G A;  4JKV A;  1WGW A; 
#chains in the Genus database with same CATH homology
 1AEP A;  2KC3 A;  1YA9 A;  1BZ4 A;  1B68 A;  1OR3 A;  1NFN A;  3S84 A;  1LE2 A;  1EA8 A;  1NFO A;  1GS9 A;  1LPE A;  1LS4 A;  1OR2 A;  3R2P A;  1H7I A;  1LE4 A;  1EQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...