1EA8A

Apolipoprotein e3 22kd fragment lys146glu mutant
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
140
structure length
140
Chain Sequence
GQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRERLLRDADDLQKRLAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Apolipoprotein E3 22Kd Fragment Lys146Gln Mutant
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
molecule keywords APOLIPOPROTEIN E
total genus 65
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2001-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.20 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Apolipoprotein 1ea8A00
1B68A 1LE2A 1LS4A 1NFNA 1GS9A 1LPEA 1YA9A 1OR2A 1EQ1A 2KC3A 1OR3A 1AEPA 1EA8A 1H7IA 3R2PA 1NFOA 3S84A 1LE4A 1BZ4A
chains in the Genus database with same CATH superfamily
1DOWA 4PJLA 4ZLCA 4BEJA 3ATPA 3FAPB 1YDIA 1TKNA 2XLMA 2MWQA 3S84A 2LK4A 4MTGA 1Q0KA 4CS9A 1RJ9A 1A0BA 2CNWD 4U5HA 4YN0B 1TFOB 4JEAA 4XLNF 3F47A 3QTHA 2EPNA 1TFKB 2LQGA 4RBNA 4N4WA 5KYNA 1KTMA 4PACA 4HFFB 3IHUA 2CNWA 3L0IA 5GPGB 2EPLX 1C02A 2WZFA 3NMIA 3GEHA 5A6BD 3R2PA 1NBBA 3ZC4A 4OIPF 2RD9A 1E83A 3EZHA 1OW7A 3I5PA 3E70C 2OCCC 4Z9HA 4NQFA 3M79A 3K66A 4G78A 4YL3A 5A6AA 2A0BA 2G3VA 3FVYA 1JR8A 2AP3A 3MBGA 1WWPA 1QKRA 5COGA 1R4TA 5DS4A 4MTOA 1IZMA 5JRAA 2ZXRA 1NU7D 2NUTA 2OEVA 2IOQA 2PP4A 1S7ZA 4KBLA 1OW8A 2IM8A 4LERA 4XPWA 3RIPA 3SXZA 4CS9C 4DVZA 4CS8A 5COFA 256BA 3B0PA 1TQGA 2P7VA 1XZPA 3JZ0A 3TOMA 3HNIA 5F5HA 2R7UA 3DJUB 1KNYA 3C8GD 1ZU4A 2L9JA 4IAQA 3AGTA 2XM4A 3K6BA 4ONSA 2A69F 3ZIBA 4F4BA 1V55C 1Q0FA 2Q9BA 3SEOA 1H9GA 4C3EA 3CAXA 4IGGA 3H65A 3ZSUA 3EHMA 5L0IA 2R05A 3G4XA 3HNLA 1WN0A 1Q0DA 3AOUA 5DQZA 4E0HA 5CI8A 5EHHA 4Z9JA 1UFBA 1Q0MA 3ZQYA 3DM5A 1B68A 4XEFA 1RKEA 2Q00A 1OR2A 2KSFA 1D1CA 3EGXA 4IAOA 3W8IA 1NSGB 3LS1A 3QW0A 5A6KA 4M63A 4WJ0A 3WHNA 4H4KC 3RQEA 1F1MA 1U89A 3EH1A 2DYRC 3FHDA 4JEBA 3TD7A 2IXPA 1ZHXA 4FX5A 5K0IA 3U5SA 1H7IA 3V5YA 2R02A 1I4YA 4MVQA 3IQTA 3C8GB 4MQ9F 2G62A 1WASA 3LEVA 4CS8C 4D4XA 3AGUA 3EZIA 1NG1A 3QVYA 1YVIA 3LLKA 2YLDA 2FGYA 4U5DE 3U0CA 2HS5A 3NKEA 3UGPA 3KPHA 4MVOA 3ASNC 3DAGA 3HNJA 1FR0A 2KQ9A 1GGQA 2BL2A 4DXWA 2CGEA 1D1BA 3LLIA 1T6UA 4BJ1A 3ZTZA 4EWCA 3Q6MA 2BE5F 1G5ZA 4IARA 4KNVA 1ZZPA 2ZD9A 1N1CA 1T01A 1GS9A 3HLZA 5B3SC 5L0JA 2EPMX 1RXQA 2XL6A 3EGXB 2JPUA 4WABA 4G7ZF 4JW1A 2A0UA 2LSEA 5FZTA 3JCUQ 4I3MA 3RFYA 5KYXB 5A69A 3B0UX 5D92A 4K1OA 2W9YA 4YL0A 3U3FA 3KYJA 4OIRF 3UNGC 4DBQA 3DD7A 2HMZA 5L0CA 2W45A 2R03A 5KYUA 4BJTA 1VYKA 4PFOA 1HW1A 1LI5A 3T4RA 4DRJB 3ASOC 3ZQVA 2D4UA 2VB6A 1CPRA 4R32A 4CBEA 4U5BE 3JSEO 5L0FA 1HW2A 1M56C 3W8HA 4CJOA 3U8VA 2XL4A 2YKZA 3ZDLA 5KYWB 2W4MA 4JJFA 3MFNA 3SXKA 1K40A 2A6HF 4E7ZA 3T9OA 1MQVA 5E3AA 2KJGA 1PD0A 5DQTA 3DXJF 3GANA 5B3IA 1YZAA 4ULVA 3LS0A 4ANJA 4BJ6C 3RKOF 3EG9B 2KW3C 2HFIA 3QVZA 1ZHTA 1ZW2A 2QUPA 4NCQA 2HMQA 2QLAA 3JTLO 4JC7A 3US6A 4EKWA 2RSEB 4YT5A 3OWTA 5COMA 3IQ6A 1FNTc 2GDCA 2YEVA 4NY3A 1BDJB 3ITFA 3T6BA 1Q0GA 1LIHA 3JSZA 1Z6AA 2NPUA 4GYTA 3V5ZA 2B0JA 3POVA 2LIGA 5E33A 3C7JA 5E3CA 4EBBA 3S9OA 3EJNA 3JRTA 1D1AA 1VLSA 1LS4A 4AL1A 3W4YA 3CEXA 3SP1A 4C3DA 4C7OA 1MNEA 3DE8A 3IQCA 3A11A 3CZ6A 2Q3TA 2AWCA 4CSAA 3U2MA 3DI5A 2LD6A 2VC9A 5JUAA 1NZEA 4JIOA 1U0BB 3GEEA 1XZQA 1G4WR 2NSFA 2LP4A 3B29A 3I4UA 4JCZA 3A9CA 4O7GA 2GAQA 4E7SA 1XWJA 5KYYA 3OA1A 2KGOA 4JTAB 4EHPA 2VCBA 4LACB 3DZAA 4KC9A 1OKKA 2CW0F 4NC3A 1FTSA 1NFOA 2IYLD 5T1DB 5DS5A 3NYLA 3GM3A 1Z63A 2HKVA 1E85A 2R9RB 3WG7C 3RH3A 4O6MA 2XLWA 3RVYA 1MMGA 1T9KA 4U9EA 2EILC 2L81A 3DJNB 2ETSA 1MMAA 1V74B 3RYLA 1ZW3A 4WGYA 5JSLA 1LPEA 2X0CA 2WVQA 3GORA 1TR2A 3FMSA 2EINC 1BR4A 1J8MF 4JKVA 4U5CE 3PHF2 2CCYA 2FAPB 2Y39A 3JT1A 1OW6A 3LNMB 3NYJA 3TJ6A 3UMHA 4QI2A 4LDRA 1TWHA 1H9TA 2P0NA 2PX0A 1OR3A 5CI9A 3ABKC 3EFOA 5IY5C 3JRMO 1K04A 4EBJA 5L3VA 2IXMA 4IB4A 3V5XA 1WTYA 1ZYRF 4RD9A 3R7CA 3GWNA 4OINF 3HTKC 4EIYA 5BUOA 4CIHA 2KK1A 1L7CA 1Z5ZA 2PNOA 3AG3C 4I1OB 5L0GA 4A4AA 1G4US 3C62A 1QLEC 4DJ9A 3UMKA 1Z7Qc 3Q7GA 3U9JA 1Z3IX 1MMNA 2V3CC 2ZXOA 3L34A 4PR9A 4J7TA 4X0RA 1OCCC 1BZ4A 2WVNA 3GWLA 5T3WA 4A2NB 4J7YA 3SNHA 4CDYA 2B0HA 3NKDA 1VK5A 1IW7F 3X1OA 1EI7A 2XLOA 4JJGA 1A41A 3L1MA 3FXHA 3N24A 4O6YA 3NDBB 1WATA 1APCA 2ICWG 3NG1A 3O6XA 3EQLF 1CGOA 4HFKB 1A7DA 2JX0A 3I5QA 4QI0A 4FWVA 3DWWA 1PCXA 3FOPA 4JE9A 3SXYA 1BBHA 1I5NA 2YL7A 3EPVA 3HKKA 2R25A 1EQ1A 4OD5A 2VASA 1E86A 3K33A 1ZHZA 3UR3C 4I44A 1LE4A 4MVSA 1HE9A 1T5OA 1KU2A 2HZ8A 4BJ5C 1O3UA 3U2LA 1SR2A 2EPOA 2GA0A 4P9FA 4ULWA 2ASRA 2QE9A 4DRHB 5A6JA 4XQ1A 1D0YA 1DOVA 5KYYB 2R7RA 3G50A 1VB5A 1LKXA 3V7OA 4HE8D 4XPXA 4LLEA 2PBEA 1S05A 3IQ5A 4N6CA 1Y4CA 5L0DA 2H7OA 1VOMA 4IWBA 3UGOA 4W8PA 4JRZA 3RVZA 2DYSC 3RF3A 1ZHYA 2CDQA 4PJNA 2J8WA 2L7AA 5AC5A 5JT4A 4U5FE 2IBFA 2WZLA 3B0VC 2OQMA 4AK9A 1VMAA 1I4ZA 1M2OA 2X51A 2YWAA 3FOOA 4GEHA 4MW3A 3PDMP 2F22A 4AE4B 1G8XA 3PMRA 1AEPA 2W4BA 4QDLA 4XTKA 2IXNA 2BC5A 2J9WA 2L6FA 3B71A 3SXMA 4AE4A 1SF8A 2R7OA 3QMKA 1YA9A 5F28E 3TULA 1ORYA 3MLGA 3W2WA 1QVXA 3AQCA 2A1DD 4JTDB 1TWGA 2C04A 2R7SA 2R7VA 5JVEA 2XS8A 3F46A 3TJ5A 1ZU5A 2I8BA 2YL1A 2HV6A 3J06A 4MS2A 1ORSC 4XWJA 4Q5SF 3VM6A 3IPMO 1JRAA 2H8AA 4BJ5A 2J0XA 2UUIA 1R5ID 2L6GA 4CJGA 5HSWA 1RKEB 1C03A 2J9BA 4YL1A 3ZTMA 1EKYA 1Y6DA 4W8KA 4D4NA 4EBKA 1O87A 3K1IC 4N6HA 3VF0A 4I1MA 2J9VA 5L0HA 3LEOA 1OCOC 3KH2A 3PCVA 2HJ3A 1Z23A 1SMYF 1EA8A 3U9MA 3ZG1A 4AX2A 2XRHA 2XLEA 3VRCA 5JS5A 1M2VB 2NUPB 1C17M 1FMWA 1FFHA 1HY5A 2LFDA 2Y3GA 3NMJA 4XPYA 4DBRA 2M64A 5HV9A 3HNKA 5AGFA 2MYSA 2ZPAA 3CSKA 4J32B 3MX3A 3O39A 2Q7RA 3TK0A 4FAPB 4YT2A 1NU9C 2NUPA 3K1IA 1V4AA 5AC4A 2P61A 1CGME 3KMIA 3ECSA 2R7XA 4C3BA 4MVUA 1PD1A 4YWQA 1FAPB 3GEIA 5A6BA 5B1AC 3TQOA 4P6IC 3IEEA 2E87A 4OIQF 3RW0A 3VYWA 1K05A 2VH3A 1SYQA 2J46A 1RCPA 3NRHA 3OEOA 3U3BA 3M15A 2VCAA 3EHNA 2YZSA 4JTCB 2XLHA 4L6RA 2V26A 5JP7A 3S0XA 1JMWA 5B1BC 1HMOA 2QNLA 4HEAJ 2A68F 4JCHA 4PFPA 3UMIA 5T3TA 3LESA 2J45A 1NFNA 2FFHA 4H54A 2Q9AA 2XSEA 4YK5A 3DM9B 4E17A 1LVKA 2TMVP 4XLPF 4O6NA 4NTFA 3S28A 2OJQA 3AQBA 3LUTB 3DKAA 4U9DA 5BQIA 2XL8A 4MVRA 4PJMA 1AVOB 2EPKX 2I15A 4LDKA 4G7HF 5DVWA 4KI2A 1FFTC 1FMVA 2YVKA 4B6IA 3ABLC 1VYIA 4MW8A 2DGJA 4U5GA 3M4BA 3T6JA 1LM3B 1OQCA 1T6IA 1CPQA 2VCCA 1RJ9B 1YZCA 2C03A 3TOLA 3NMKA 3VAYA 1MMDA 1ZHWA 2LCHA 2AVKA 1TWCA 4Q7CA 4Z9IA 2AU5A 2IXOA 3B9QA 2OOCA 1OCZC 3L8JA 1H6GA 3GM1A 5DS6A 2PF4E 2R7TA 4YT8A 1BR2A 3Q6NA 2YQYA 2OJED 2A6EF 3MYIA 4BEMJ 4CSAC 3H2VA 5F5FA 2D5RB 2WL8A 2DI3A 4ER9A 5KYUB 3ZWIA 3GM2A 4IJJA 3S90A 3SYNA 5FCLA 3ABMC 2KNHA 4DOZA 1A7VA 4ZLDA 2J7PA 1HE1A 2OEXA 2ZXWC 4EUKB 1UG7A 3RQGA 3WODF 2NUTB 2Q4FA 4YJWA 2ZXPA 3H2UA 4BPMA 4CS7A 1M2VA 5E2QA 1YARO 2J7PD 3AG2C 2YLIA 2DB4A 2H7VC 4MNDA 3MYFA 3EG9A 4K7BA 1L3PA 1VLTA 4RDAA 2WB7A 4K0DA 4XEVA 5L3QA 2P1AA 4U5EE 1ZVZA 2OKUA 4DRIB 5KYWA 2OU6A 4P9TA 1CGNA 2J9UA 2HSQA 3DAFA 4KNWA 1AUEA 4MTFA 1VTMP 1HMDA 1LS1A 4PK4A 4JURI 4BJ6A 3E9VA 4NTBA 1M57C 2L6HA 2NG1A 1MNDA 1E2XA 1JPNA 1RKCA 2Z15A 1OKKD 1QSPA 2HSBA 3EFOB 2XS1A 2PFDA 5D91A 2XXAA 2YHSA 1LE2A 4UDVA 1WOLA 4IRUA 1YAUO 3HJCA 2P6VA 3JYHA 4C7OB 3RQFA 2HV7A 1V54C 2PX3A 2XLVA 2LFFA 2Y3BA 3LJBA 2YLGA 3G4ZA 3C8ZA 3M1CB 3SZRA 3WAQA 5DLJA 2EIMC 3DE9A 2KC3A 4OIOF 3AJMA 1M6TA 2M4EA 2R7QA 3T6GB 3K7DA 3LNRA 2WZGA 4G7OF 3M4CA 4OD4A 3KKBA 1NLXA 3AG1C 1JAFA 1OXKA 4XEKA 5CIVA 2QTVA 1JPJA 5TJ5E 3O10A 4G0HA 3AG4C 3K1HA 2H7BA 1YLMA 2XLDA 3QZCA 4CX9A 1QPUA 1T6QA 1RMVA 4CIPA 4YT4A 1ORJA 2YL3A 5BQGA 3FAJA 4J30B 4E18A 1SZIA 1PV3A 2Q9CA 3O55A 4NTAA 2O9XA 3GODA 3L8IA 1YJGA 2WVOA 3EGDB 3LAYA 3QW1A 4LLCA 4CDVA 1YYJA 5JLIA 4JVSA 2NSGA 2XXAB 2Y3HA 5EK0A 2OG2A 4AL0A 2CYDA 2EIJC 3EH2A 3N0TA 1A7EA 1QZXA 2G3KA 3CQZA 1OCRC 1U6HA 3KL4A 1J8YF 3U8PA 4DVYP 3ZVRA 2Y3DA 1D0XA 2JD3A 1W2WA 3C18A 4WGZA 2YRFA 1GM5A 1ST6A 5KYXA 5EGYA 4JZAA 3FDQA 1YA7O 3C63A 4MVZA 2R7WA 1QQ3A 3BEHA 1WGWA 2EIKC 4LDQA 2GWWA 5BQHA 4PJJA 4MVMA 3KYIA 2XM0A 2HJMA 1D0ZA 1GQAA 1O5HA 3Q7LA 1E84A 2GFHA 3X2QC 4BG0A 1TWAA 1OXBA 1BR1A 1YYXA 3NYMA 4CDAA 1JOGA 3S27A 2UUHA 4FESA 1LI7A 2MHRA 3W2VA 4N06A 3BRJA 2QY9A 3C8GA 3JYYA 4E0IA 2YL0A 2KYHA 2AWYA 2HUJA 4GQHA 4O79A 3N2ZB 2J0WA 3DMDA 3S29A 4Q4ZF 3EGDA 2Y69C
chains in the Genus database with same CATH topology
1B68A 1LE2A 1LS4A 1NFNA 1GS9A 1LPEA 1YA9A 1OR2A 1EQ1A 2KC3A 1OR3A 1AEPA 1EA8A 1H7IA 3R2PA 1NFOA 3S84A 1LE4A 1BZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B68 A;  1LE2 A;  1LS4 A;  1NFN A;  1GS9 A;  1LPE A;  1YA9 A;  1OR2 A;  1EQ1 A;  2KC3 A;  1OR3 A;  1AEP A;  1EA8 A;  1H7I A;  3R2P A;  1NFO A;  3S84 A;  1LE4 A;  1BZ4 A; 
#chains in the Genus database with same CATH topology
 1DOW A;  4PJL A;  4ZLC A;  4BEJ A;  3ATP A;  3FAP B;  1YDI A;  1TKN A;  2XLM A;  2MWQ A;  3S84 A;  2LK4 A;  4MTG A;  1Q0K A;  4CS9 A;  1RJ9 A;  1A0B A;  2CNW D;  4U5H A;  4YN0 B;  1TFO B;  4JEA A;  4XLN F;  3F47 A;  3QTH A;  2EPN A;  1TFK B;  2LQG A;  4RBN A;  4N4W A;  5KYN A;  1KTM A;  4PAC A;  4HFF B;  3IHU A;  2CNW A;  3L0I A;  5GPG B;  2EPL X;  1C02 A;  2WZF A;  3NMI A;  3GEH A;  5A6B D;  3R2P A;  1NBB A;  3ZC4 A;  4OIP F;  2RD9 A;  1E83 A;  3EZH A;  1OW7 A;  3I5P A;  3E70 C;  2OCC C;  4Z9H A;  4NQF A;  3M79 A;  3K66 A;  4G78 A;  4YL3 A;  5A6A A;  2A0B A;  2G3V A;  3FVY A;  1JR8 A;  2AP3 A;  3MBG A;  1WWP A;  1QKR A;  5COG A;  1R4T A;  5DS4 A;  4MTO A;  1IZM A;  5JRA A;  2ZXR A;  1NU7 D;  2NUT A;  2OEV A;  2IOQ A;  2PP4 A;  1S7Z A;  4KBL A;  1OW8 A;  2IM8 A;  4LER A;  4XPW A;  3RIP A;  3SXZ A;  4CS9 C;  4DVZ A;  4CS8 A;  5COF A;  256B A;  3B0P A;  1TQG A;  2P7V A;  1XZP A;  3JZ0 A;  3TOM A;  3HNI A;  5F5H A;  2R7U A;  3DJU B;  1KNY A;  3C8G D;  1ZU4 A;  2L9J A;  4IAQ A;  3AGT A;  2XM4 A;  3K6B A;  4ONS A;  2A69 F;  3ZIB A;  4F4B A;  1V55 C;  1Q0F A;  2Q9B A;  3SEO A;  1H9G A;  4C3E A;  3CAX A;  4IGG A;  3H65 A;  3ZSU A;  3EHM A;  5L0I A;  2R05 A;  3G4X A;  3HNL A;  1WN0 A;  1Q0D A;  3AOU A;  5DQZ A;  4E0H A;  5CI8 A;  5EHH A;  4Z9J A;  1UFB A;  1Q0M A;  3ZQY A;  3DM5 A;  1B68 A;  4XEF A;  1RKE A;  2Q00 A;  1OR2 A;  2KSF A;  1D1C A;  3EGX A;  4IAO A;  3W8I A;  1NSG B;  3LS1 A;  3QW0 A;  5A6K A;  4M63 A;  4WJ0 A;  3WHN A;  4H4K C;  3RQE A;  1F1M A;  1U89 A;  3EH1 A;  2DYR C;  3FHD A;  4JEB A;  3TD7 A;  2IXP A;  1ZHX A;  4FX5 A;  5K0I A;  3U5S A;  1H7I A;  3V5Y A;  2R02 A;  1I4Y A;  4MVQ A;  3IQT A;  3C8G B;  4MQ9 F;  2G62 A;  1WAS A;  3LEV A;  4CS8 C;  4D4X A;  3AGU A;  3EZI A;  1NG1 A;  3QVY A;  1YVI A;  3LLK A;  2YLD A;  2FGY A;  4U5D E;  3U0C A;  2HS5 A;  3NKE A;  3UGP A;  3KPH A;  4MVO A;  3ASN C;  3DAG A;  3HNJ A;  1FR0 A;  2KQ9 A;  1GGQ A;  2BL2 A;  4DXW A;  2CGE A;  1D1B A;  3LLI A;  1T6U A;  4BJ1 A;  3ZTZ A;  4EWC A;  3Q6M A;  2BE5 F;  1G5Z A;  4IAR A;  4KNV A;  1ZZP A;  2ZD9 A;  1N1C A;  1T01 A;  1GS9 A;  3HLZ A;  5B3S C;  5L0J A;  2EPM X;  1RXQ A;  2XL6 A;  3EGX B;  2JPU A;  4WAB A;  4G7Z F;  4JW1 A;  2A0U A;  2LSE A;  5FZT A;  3JCU Q;  4I3M A;  3RFY A;  5KYX B;  5A69 A;  3B0U X;  5D92 A;  4K1O A;  2W9Y A;  4YL0 A;  3U3F A;  3KYJ A;  4OIR F;  3UNG C;  4DBQ A;  3DD7 A;  2HMZ A;  5L0C A;  2W45 A;  2R03 A;  5KYU A;  4BJT A;  1VYK A;  4PFO A;  1HW1 A;  1LI5 A;  3T4R A;  4DRJ B;  3ASO C;  3ZQV A;  2D4U A;  2VB6 A;  1CPR A;  4R32 A;  4CBE A;  4U5B E;  3JSE O;  5L0F A;  1HW2 A;  1M56 C;  3W8H A;  4CJO A;  3U8V A;  2XL4 A;  2YKZ A;  3ZDL A;  5KYW B;  2W4M A;  4JJF A;  3MFN A;  3SXK A;  1K40 A;  2A6H F;  4E7Z A;  3T9O A;  1MQV A;  5E3A A;  2KJG A;  1PD0 A;  5DQT A;  3DXJ F;  3GAN A;  5B3I A;  1YZA A;  4ULV A;  3LS0 A;  4ANJ A;  4BJ6 C;  3RKO F;  3EG9 B;  2KW3 C;  2HFI A;  3QVZ A;  1ZHT A;  1ZW2 A;  2QUP A;  4NCQ A;  2HMQ A;  2QLA A;  3JTL O;  4JC7 A;  3US6 A;  4EKW A;  2RSE B;  4YT5 A;  3OWT A;  5COM A;  3IQ6 A;  1FNT c;  2GDC A;  2YEV A;  4NY3 A;  1BDJ B;  3ITF A;  3T6B A;  1Q0G A;  1LIH A;  3JSZ A;  1Z6A A;  2NPU A;  4GYT A;  3V5Z A;  2B0J A;  3POV A;  2LIG A;  5E33 A;  3C7J A;  5E3C A;  4EBB A;  3S9O A;  3EJN A;  3JRT A;  1D1A A;  1VLS A;  1LS4 A;  4AL1 A;  3W4Y A;  3CEX A;  3SP1 A;  4C3D A;  4C7O A;  1MNE A;  3DE8 A;  3IQC A;  3A11 A;  3CZ6 A;  2Q3T A;  2AWC A;  4CSA A;  3U2M A;  3DI5 A;  2LD6 A;  2VC9 A;  5JUA A;  1NZE A;  4JIO A;  1U0B B;  3GEE A;  1XZQ A;  1G4W R;  2NSF A;  2LP4 A;  3B29 A;  3I4U A;  4JCZ A;  3A9C A;  4O7G A;  2GAQ A;  4E7S A;  1XWJ A;  5KYY A;  3OA1 A;  2KGO A;  4JTA B;  4EHP A;  2VCB A;  4LAC B;  3DZA A;  4KC9 A;  1OKK A;  2CW0 F;  4NC3 A;  1FTS A;  1NFO A;  2IYL D;  5T1D B;  5DS5 A;  3NYL A;  3GM3 A;  1Z63 A;  2HKV A;  1E85 A;  2R9R B;  3WG7 C;  3RH3 A;  4O6M A;  2XLW A;  3RVY A;  1MMG A;  1T9K A;  4U9E A;  2EIL C;  2L81 A;  3DJN B;  2ETS A;  1MMA A;  1V74 B;  3RYL A;  1ZW3 A;  4WGY A;  5JSL A;  1LPE A;  2X0C A;  2WVQ A;  3GOR A;  1TR2 A;  3FMS A;  2EIN C;  1BR4 A;  1J8M F;  4JKV A;  4U5C E;  3PHF 2;  2CCY A;  2FAP B;  2Y39 A;  3JT1 A;  1OW6 A;  3LNM B;  3NYJ A;  3TJ6 A;  3UMH A;  4QI2 A;  4LDR A;  1TWH A;  1H9T A;  2P0N A;  2PX0 A;  1OR3 A;  5CI9 A;  3ABK C;  3EFO A;  5IY5 C;  3JRM O;  1K04 A;  4EBJ A;  5L3V A;  2IXM A;  4IB4 A;  3V5X A;  1WTY A;  1ZYR F;  4RD9 A;  3R7C A;  3GWN A;  4OIN F;  3HTK C;  4EIY A;  5BUO A;  4CIH A;  2KK1 A;  1L7C A;  1Z5Z A;  2PNO A;  3AG3 C;  4I1O B;  5L0G A;  4A4A A;  1G4U S;  3C62 A;  1QLE C;  4DJ9 A;  3UMK A;  1Z7Q c;  3Q7G A;  3U9J A;  1Z3I X;  1MMN A;  2V3C C;  2ZXO A;  3L34 A;  4PR9 A;  4J7T A;  4X0R A;  1OCC C;  1BZ4 A;  2WVN A;  3GWL A;  5T3W A;  4A2N B;  4J7Y A;  3SNH A;  4CDY A;  2B0H A;  3NKD A;  1VK5 A;  1IW7 F;  3X1O A;  1EI7 A;  2XLO A;  4JJG A;  1A41 A;  3L1M A;  3FXH A;  3N24 A;  4O6Y A;  3NDB B;  1WAT A;  1APC A;  2ICW G;  3NG1 A;  3O6X A;  3EQL F;  1CGO A;  4HFK B;  1A7D A;  2JX0 A;  3I5Q A;  4QI0 A;  4FWV A;  3DWW A;  1PCX A;  3FOP A;  4JE9 A;  3SXY A;  1BBH A;  1I5N A;  2YL7 A;  3EPV A;  3HKK A;  2R25 A;  1EQ1 A;  4OD5 A;  2VAS A;  1E86 A;  3K33 A;  1ZHZ A;  3UR3 C;  4I44 A;  1LE4 A;  4MVS A;  1HE9 A;  1T5O A;  1KU2 A;  2HZ8 A;  4BJ5 C;  1O3U A;  3U2L A;  1SR2 A;  2EPO A;  2GA0 A;  4P9F A;  4ULW A;  2ASR A;  2QE9 A;  4DRH B;  5A6J A;  4XQ1 A;  1D0Y A;  1DOV A;  5KYY B;  2R7R A;  3G50 A;  1VB5 A;  1LKX A;  3V7O A;  4HE8 D;  4XPX A;  4LLE A;  2PBE A;  1S05 A;  3IQ5 A;  4N6C A;  1Y4C A;  5L0D A;  2H7O A;  1VOM A;  4IWB A;  3UGO A;  4W8P A;  4JRZ A;  3RVZ A;  2DYS C;  3RF3 A;  1ZHY A;  2CDQ A;  4PJN A;  2J8W A;  2L7A A;  5AC5 A;  5JT4 A;  4U5F E;  2IBF A;  2WZL A;  3B0V C;  2OQM A;  4AK9 A;  1VMA A;  1I4Z A;  1M2O A;  2X51 A;  2YWA A;  3FOO A;  4GEH A;  4MW3 A;  3PDM P;  2F22 A;  4AE4 B;  1G8X A;  3PMR A;  1AEP A;  2W4B A;  4QDL A;  4XTK A;  2IXN A;  2BC5 A;  2J9W A;  2L6F A;  3B71 A;  3SXM A;  4AE4 A;  1SF8 A;  2R7O A;  3QMK A;  1YA9 A;  5F28 E;  3TUL A;  1ORY A;  3MLG A;  3W2W A;  1QVX A;  3AQC A;  2A1D D;  4JTD B;  1TWG A;  2C04 A;  2R7S A;  2R7V A;  5JVE A;  2XS8 A;  3F46 A;  3TJ5 A;  1ZU5 A;  2I8B A;  2YL1 A;  2HV6 A;  3J06 A;  4MS2 A;  1ORS C;  4XWJ A;  4Q5S F;  3VM6 A;  3IPM O;  1JRA A;  2H8A A;  4BJ5 A;  2J0X A;  2UUI A;  1R5I D;  2L6G A;  4CJG A;  5HSW A;  1RKE B;  1C03 A;  2J9B A;  4YL1 A;  3ZTM A;  1EKY A;  1Y6D A;  4W8K A;  4D4N A;  4EBK A;  1O87 A;  3K1I C;  4N6H A;  3VF0 A;  4I1M A;  2J9V A;  5L0H A;  3LEO A;  1OCO C;  3KH2 A;  3PCV A;  2HJ3 A;  1Z23 A;  1SMY F;  1EA8 A;  3U9M A;  3ZG1 A;  4AX2 A;  2XRH A;  2XLE A;  3VRC A;  5JS5 A;  1M2V B;  2NUP B;  1C17 M;  1FMW A;  1FFH A;  1HY5 A;  2LFD A;  2Y3G A;  3NMJ A;  4XPY A;  4DBR A;  2M64 A;  5HV9 A;  3HNK A;  5AGF A;  2MYS A;  2ZPA A;  3CSK A;  4J32 B;  3MX3 A;  3O39 A;  2Q7R A;  3TK0 A;  4FAP B;  4YT2 A;  1NU9 C;  2NUP A;  3K1I A;  1V4A A;  5AC4 A;  2P61 A;  1CGM E;  3KMI A;  3ECS A;  2R7X A;  4C3B A;  4MVU A;  1PD1 A;  4YWQ A;  1FAP B;  3GEI A;  5A6B A;  5B1A C;  3TQO A;  4P6I C;  3IEE A;  2E87 A;  4OIQ F;  3RW0 A;  3VYW A;  1K05 A;  2VH3 A;  1SYQ A;  2J46 A;  1RCP A;  3NRH A;  3OEO A;  3U3B A;  3M15 A;  2VCA A;  3EHN A;  2YZS A;  4JTC B;  2XLH A;  4L6R A;  2V26 A;  5JP7 A;  3S0X A;  1JMW A;  5B1B C;  1HMO A;  2QNL A;  4HEA J;  2A68 F;  4JCH A;  4PFP A;  3UMI A;  5T3T A;  3LES A;  2J45 A;  1NFN A;  2FFH A;  4H54 A;  2Q9A A;  2XSE A;  4YK5 A;  3DM9 B;  4E17 A;  1LVK A;  2TMV P;  4XLP F;  4O6N A;  4NTF A;  3S28 A;  2OJQ A;  3AQB A;  3LUT B;  3DKA A;  4U9D A;  5BQI A;  2XL8 A;  4MVR A;  4PJM A;  1AVO B;  2EPK X;  2I15 A;  4LDK A;  4G7H F;  5DVW A;  4KI2 A;  1FFT C;  1FMV A;  2YVK A;  4B6I A;  3ABL C;  1VYI A;  4MW8 A;  2DGJ A;  4U5G A;  3M4B A;  3T6J A;  1LM3 B;  1OQC A;  1T6I A;  1CPQ A;  2VCC A;  1RJ9 B;  1YZC A;  2C03 A;  3TOL A;  3NMK A;  3VAY A;  1MMD A;  1ZHW A;  2LCH A;  2AVK A;  1TWC A;  4Q7C A;  4Z9I A;  2AU5 A;  2IXO A;  3B9Q A;  2OOC A;  1OCZ C;  3L8J A;  1H6G A;  3GM1 A;  5DS6 A;  2PF4 E;  2R7T A;  4YT8 A;  1BR2 A;  3Q6N A;  2YQY A;  2OJE D;  2A6E F;  3MYI A;  4BEM J;  4CSA C;  3H2V A;  5F5F A;  2D5R B;  2WL8 A;  2DI3 A;  4ER9 A;  5KYU B;  3ZWI A;  3GM2 A;  4IJJ A;  3S90 A;  3SYN A;  5FCL A;  3ABM C;  2KNH A;  4DOZ A;  1A7V A;  4ZLD A;  2J7P A;  1HE1 A;  2OEX A;  2ZXW C;  4EUK B;  1UG7 A;  3RQG A;  3WOD F;  2NUT B;  2Q4F A;  4YJW A;  2ZXP A;  3H2U A;  4BPM A;  4CS7 A;  1M2V A;  5E2Q A;  1YAR O;  2J7P D;  3AG2 C;  2YLI A;  2DB4 A;  2H7V C;  4MND A;  3MYF A;  3EG9 A;  4K7B A;  1L3P A;  1VLT A;  4RDA A;  2WB7 A;  4K0D A;  4XEV A;  5L3Q A;  2P1A A;  4U5E E;  1ZVZ A;  2OKU A;  4DRI B;  5KYW A;  2OU6 A;  4P9T A;  1CGN A;  2J9U A;  2HSQ A;  3DAF A;  4KNW A;  1AUE A;  4MTF A;  1VTM P;  1HMD A;  1LS1 A;  4PK4 A;  4JUR I;  4BJ6 A;  3E9V A;  4NTB A;  1M57 C;  2L6H A;  2NG1 A;  1MND A;  1E2X A;  1JPN A;  1RKC A;  2Z15 A;  1OKK D;  1QSP A;  2HSB A;  3EFO B;  2XS1 A;  2PFD A;  5D91 A;  2XXA A;  2YHS A;  1LE2 A;  4UDV A;  1WOL A;  4IRU A;  1YAU O;  3HJC A;  2P6V A;  3JYH A;  4C7O B;  3RQF A;  2HV7 A;  1V54 C;  2PX3 A;  2XLV A;  2LFF A;  2Y3B A;  3LJB A;  2YLG A;  3G4Z A;  3C8Z A;  3M1C B;  3SZR A;  3WAQ A;  5DLJ A;  2EIM C;  3DE9 A;  2KC3 A;  4OIO F;  3AJM A;  1M6T A;  2M4E A;  2R7Q A;  3T6G B;  3K7D A;  3LNR A;  2WZG A;  4G7O F;  3M4C A;  4OD4 A;  3KKB A;  1NLX A;  3AG1 C;  1JAF A;  1OXK A;  4XEK A;  5CIV A;  2QTV A;  1JPJ A;  5TJ5 E;  3O10 A;  4G0H A;  3AG4 C;  3K1H A;  2H7B A;  1YLM A;  2XLD A;  3QZC A;  4CX9 A;  1QPU A;  1T6Q A;  1RMV A;  4CIP A;  4YT4 A;  1ORJ A;  2YL3 A;  5BQG A;  3FAJ A;  4J30 B;  4E18 A;  1SZI A;  1PV3 A;  2Q9C A;  3O55 A;  4NTA A;  2O9X A;  3GOD A;  3L8I A;  1YJG A;  2WVO A;  3EGD B;  3LAY A;  3QW1 A;  4LLC A;  4CDV A;  1YYJ A;  5JLI A;  4JVS A;  2NSG A;  2XXA B;  2Y3H A;  5EK0 A;  2OG2 A;  4AL0 A;  2CYD A;  2EIJ C;  3EH2 A;  3N0T A;  1A7E A;  1QZX A;  2G3K A;  3CQZ A;  1OCR C;  1U6H A;  3KL4 A;  1J8Y F;  3U8P A;  4DVY P;  3ZVR A;  2Y3D A;  1D0X A;  2JD3 A;  1W2W A;  3C18 A;  4WGZ A;  2YRF A;  1GM5 A;  1ST6 A;  5KYX A;  5EGY A;  4JZA A;  3FDQ A;  1YA7 O;  3C63 A;  4MVZ A;  2R7W A;  1QQ3 A;  3BEH A;  1WGW A;  2EIK C;  4LDQ A;  2GWW A;  5BQH A;  4PJJ A;  4MVM A;  3KYI A;  2XM0 A;  2HJM A;  1D0Z A;  1GQA A;  1O5H A;  3Q7L A;  1E84 A;  2GFH A;  3X2Q C;  4BG0 A;  1TWA A;  1OXB A;  1BR1 A;  1YYX A;  3NYM A;  4CDA A;  1JOG A;  3S27 A;  2UUH A;  4FES A;  1LI7 A;  2MHR A;  3W2V A;  4N06 A;  3BRJ A;  2QY9 A;  3C8G A;  3JYY A;  4E0I A;  2YL0 A;  2KYH A;  2AWY A;  2HUJ A;  4GQH A;  4O79 A;  3N2Z B;  2J0W A;  3DMD A;  3S29 A;  4Q4Z F;  3EGD A;  2Y69 C; 
#chains in the Genus database with same CATH homology
 1B68 A;  1LE2 A;  1LS4 A;  1NFN A;  1GS9 A;  1LPE A;  1YA9 A;  1OR2 A;  1EQ1 A;  2KC3 A;  1OR3 A;  1AEP A;  1EA8 A;  1H7I A;  3R2P A;  1NFO A;  3S84 A;  1LE4 A;  1BZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...