1C17M

A1c12 subcomplex of f1fo atp synthase
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
171
structure length
142
Chain Sequence
HGKSKLIAPLALTIFVWVFLMNLMDLLPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMALGVFILILFYSIKMKSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPWAIFHILIITLQAFIFMVLTIVYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords ATP SYNTHASE SUBUNIT C
publication title Structural changes linked to proton translocation by subunit c of the ATP synthase.
pubmed doi rcsb
source organism Escherichia coli
total genus 54
structure length 142
sequence length 171
ec nomenclature
pdb deposition date 1999-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.220 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ATP synthase, F0 complex, subunit A 1c17M00
1C17M
chains in the Genus database with same CATH superfamily
1C03A 1YZAA 2G62A 3EHNA 1A41A 1NU9C 2EPKX 2G3KA 1HY5A 2MHRA 5COGA 4BEMJ 4P9FA 3RFYA 4KC9A 4L6RA 1W2WA 2W9YA 1H7IA 3AJMA 4K1OA 2WZLA 3LS0A 4NTBA 1H9GA 1H9TA 3SXMA 2HSBA 3DAFA 1L3PA 4HFKB 2LSEA 2J9VA 3M4BA 4MS2A 3SXZA 3S0XA 3C7JA 1L7CA 1I5NA 2Z15A 1ORJA 4JC7A 5COFA 5CI9A 3IHUA 3JSZA 4NTAA 5EGYA 2OQMA 2UUHA 3AQCA 3LAYA 2NUPB 2WVOA 2XM0A 2YLGA 4ULVA 3WHNA 5KYUA 1M2VB 1WN0A 1WOLA 4U5FE 4EHPA 4G7HF 2XXAB 5T3WA 2Q9AA 3DAGA 4JW1A 1MMGA 2H7BA 5GPGB 1GS9A 3RVYA 2R7VA 1JMWA 1T5OA 2Y39A 3RVZA 3OEOA 3IEEA 4I1MA 2R25A 1LKXA 4MVZA 3EH1A 4DVZA 3C8ZA 2XS1A 4EWCA 3GM3A 4PJLA 1LI7A 5KYYB 4WGZA 3C8GA 1VLSA 2ZXOA 1ZU4A 1EA8A 3DMDA 2H7VC 4BG0A 5JVEA 1UFBA 4U5EE 1G4US 2KGOA 1NSGB 2OEXA 3K1IA 1BDJB 3K7DA 4JRZA 4A2NB 4RD9A 2YKZA 2IM8A 2YL3A 5E2QA 3WG7C 1OCRC 4FESA 4JCHA 4XPWA 2LK4A 1AUEA 3NMIA 2Y3HA 3FOOA 3M4CA 4YT5A 2YLDA 3M1CB 5JUAA 5IY5C 1D1AA 3LUTB 2XL6A 3ZC4A 3NMJA 1JPJA 5T3TA 3ASNC 3GWNA 3I4UA 3RH3A 3B0PA 3I5PA 3HNLA 4A4AA 2QUPA 1A7EA 2PF4E 4YT4A 2X0CA 2IBFA 2DI3A 4JJGA 3KH2A 3W8HA 1G8XA 2Q3TA 5F28E 1ZYRF 3QVYA 1ZW3A 1TFKB 3TULA 3JZ0A 3U8PA 4BJ1A 1ZHYA 2IXPA 4KI2A 5L0CA 1D0XA 2HSQA 2ETSA 3LESA 4DBRA 1Z63A 4ZLDA 1G4WR 3L0IA 3S29A 1OW7A 4BJTA 4BJ6C 4MVOA 1QLEC 5JS5A 1OKKD 1QSPA 4ONSA 4OIRF 1Z3IX 2ZPAA 4LERA 4D4NA 5AC4A 5KYWA 4G7ZF 3GM2A 1T01A 3SEOA 5A6JA 2IOQA 2HKVA 3F46A 4MVUA 2OU6A 1HMOA 3TOMA 1WASA 4GEHA 2R02A 4MQ9F 2I8BA 4EBBA 1TFOB 5F5FA 4ULWA 3MLGA 2J9BA 2WZGA 3E9VA 1FMVA 1ORSC 3LEOA 2P7VA 2NSGA 4HEAJ 2XSEA 2VC9A 2B0HA 1IW7F 5EK0A 3AG1C 3VYWA 1UG7A 1SMYF 1Q0MA 3SP1A 2RD9A 5L0DA 4YL3A 2LD6A 2R7UA 4C3BA 3MBGA 4F4BA 1Q0GA 2VCAA 3EGDB 3C8GB 1ZHTA 4LDRA 4PFPA 3ZQVA 2LCHA 2GAQA 2R03A 3NMKA 4IAQA 5JP7A 3T9OA 4UDVA 2FGYA 3VM6A 2AWCA 1OR2A 2XL4A 1LE4A 5KYXA 2HMQA 1OW8A 4N6HA 5BUOA 1C17M 2GDCA 3EH2A 3EZHA 4JCZA 3ZVRA 4WABA 4LDKA 2LFFA 4LDQA 3U5SA 1FR0A 4EKWA 3ASOC 2A68F 3TD7A 4OINF 3HNIA 4Z9JA 5E3AA 3B9QA 4YT2A 2PP4A 4MTGA 1JOGA 1LM3B 4G78A 3X1OA 1RMVA 2BE5F 2NSFA 4LACB 3ABKC 3LLIA 5DVWA 4MVSA 3U9JA 3LNMB 4O7GA 2R05A 4XEKA 1MQVA 1SF8A 4XWJA 5COMA 1MMAA 5L3VA 1K05A 1FNTc 2M4EA 4RDAA 1AEPA 2KNHA 1SZIA 3W2WA 4JEAA 4KNWA 2OG2A 4IB4A 4W8KA 4XEVA 3U9MA 2CW0F 1A7VA 4DRIB 3TJ6A 1OCZC 2R9RB 3UMIA 2PX3A 2AP3A 4K7BA 3H2VA 1E86A 4N06A 4YK5A 1HE9A 4E0IA 4G0HA 4B6IA 2HV6A 4PACA 1XZPA 1CGNA 1VYKA 2J46A 3FMSA 3N2ZB 4P6IC 5F5HA 1YVIA 3A9CA 4MW8A 1IZMA 1R4TA 3ABMC 4FWVA 4HE8D 5FCLA 3QMKA 1QQ3A 1FFTC 2AU5A 3KKBA 4CS7A 1DOVA 4JTCB 4AL1A 1BR1A 3DE8A 2J7PD 2QNLA 2HV7A 2YQYA 4OIQF 2V26A 1V74B 1O87A 1OXKA 2L6FA 3V5YA 5T1DB 4JE9A 4XLPF 2A1DD 1K40A 1YA9A 3EPVA 1E85A 5E33A 2R7RA 1LVKA 4YN0B 3W2VA 2P61A 1Q0DA 1OCCC 3HLZA 3OA1A 4OD5A 5DQZA 1SYQA 3UGPA 3AG2C 2ZD9A 4QI2A 3L8IA 2OJQA 4OD4A 3V5ZA 2IXMA 2Y3GA 3O6XA 4E0HA 4E7SA 3EZIA 3NRHA 1T9KA 4CSAA 5B1BC 1OXBA 3J06A 3LLKA 1PD1A 1OCOC 3EG9B 4U5BE 2WL8A 4Z9HA 1FAPB 3RW0A 3SZRA 1E2XA 2HJ3A 3VRCA 1HW1A 3NYLA 2WZFA 1VK5A 3CZ6A 4XPYA 4FAPB 3U3BA 1B68A 1O3UA 3DWWA 3AQBA 3SNHA 4Z9IA 3FHDA 4PFOA 2L7AA 1C02A 3N24A 1GQAA 1WGWA 4DXWA 5B3SC 5A6KA 2J45A 2EPOA 3RYLA 3RKOF 4IWBA 3QTHA 4J7TA 2CGEA 5DLJA 3EGXB 4CDYA 1RJ9B 1V4AA 1HW2A 4Q5SF 3EHMA 3MX3A 2DGJA 2E87A 1XZQA 3GEHA 4C7OB 1BZ4A 4DOZA 5JLIA 1U0BB 3HTKC 3KPHA 1I4YA 2H8AA 4G7OF 3L1MA 2QY9A 4AE4A 2ZXPA 2R7OA 3QVZA 2Q00A 3EQLF 5AGFA 2RSEB 1FFHA 2EIMC 2L9JA 2NUTB 3B71A 1ZVZA 3T6JA 4E7ZA 1YZCA 2YRFA 4BJ5A 2IYLD 1D1CA 1Y4CA 1YJGA 2A0UA 4GQHA 1MMDA 3K1IC 4XQ1A 2CYDA 2QLAA 1M57C 3HKKA 4K0DA 5L3QA 1D0ZA 3WODF 3UNGC 4NTFA 3ZTZA 5A6BD 2QTVA 2OOCA 1M6TA 3FXHA 3E70C 2IXNA 3VF0A 1VMAA 3IQ6A 4U5HA 1S05A 1D0YA 4JURI 4LLEA 3H65A 1H6GA 4PJMA 1CGOA 3O10A 4KBLA 4YL1A 1BR4A 2WB7A 4I3MA 5KYUB 3GORA 3NDBB 2YL1A 3OWTA 2XLWA 4MNDA 2TMVP 3DM9B 4U5GA 2V3CC 3RQFA 2J0WA 1J8YF 2FAPB 4O6MA 3SXKA 2W4BA 4XEFA 1XWJA 2J9UA 3I5QA 5AC5A 1OKKA 1VLTA 1Z5ZA 3LNRA 4O6NA 1Q0FA 1APCA 2EILC 2Q9BA 3L34A 1KTMA 3RQEA 3PDMP 2KW3C 3HNKA 1JAFA 4PK4A 4CIHA 2YLIA 1E83A 2C04A 2HJMA 1ZHZA 3BRJA 1LE2A 2IXOA 3DD7A 2LP4A 3ZWIA 4P9TA 1KNYA 3V5XA 1QPUA 3G4XA 2NUPA 3SXYA 4EBJA 2FFHA 3H2UA 3T4RA 3Q7LA 1Q0KA 1QVXA 2XXAA 2AVKA 2YEVA 2O9XA 3AG4C 3JYHA 3MFNA 3Q7GA 4MW3A 3K1HA 1YA7O 2YL7A 3UGOA 4H54A 3AGUA 3EFOA 2EPMX 1NU7D 5FZTA 4Q7CA 3TOLA 2P1AA 4CS9C 1E84A 1O5HA 1VOMA 4MVRA 5B1AC 1Z6AA 1T6IA 3K6BA 1G5ZA 4JEBA 4WGYA 3TJ5A 4PJNA 1I4ZA 1YYJA 3T6BA 2PX0A 4DBQA 2B0JA 2YZSA 5DS4A 2KSFA 4YWQA 1TWHA 2GWWA 2Q9CA 3JTLO 2CNWD 3GM1A 5HV9A 1JRAA 3S84A 4CJOA 3AGTA 3B0UX 2Q4FA 3K66A 5L0IA 2DB4A 4D4XA 1TQGA 2KQ9A 3IQTA 2YWAA 3DXJF 4ANJA 2LIGA 1NFNA 1GGQA 256BA 3FVYA 2OEVA 5D91A 1S7ZA 2XLVA 2G3VA 4JJFA 1Z7Qc 4I1OB 2HZ8A 3CQZA 2R7XA 4E18A 4AK9A 2XLMA 3A11A 1YAUO 3IPMO 4CJGA 1NZEA 3RIPA 1WATA 2W4MA 3O55A 3N0TA 5L0JA 1NLXA 3CSKA 1JPNA 4M63A 5BQHA 3PHF2 2MWQA 2P6VA 4IARA 1NBBA 3KMIA 2A6EF 2J8WA 3F47A 1TR2A 3PMRA 1ST6A 3HJCA 3Q6NA 4FX5A 4JIOA 4XTKA 1N1CA 3HNJA 5JSLA 3C18A 3SYNA 4W8PA 1Z23A 3MYFA 3KYJA 3ZIBA 2J7PA 2CCYA 2VCCA 4WJ0A 1EI7A 4U5CE 2ZXRA 1LI5A 1WWPA 2DYSC 3JYYA 1OR3A 5KYXB 1MNEA 5TJ5E 1M56C 2PNOA 3EJNA 4MVMA 4U9EA 4JTAB 2LFDA 5L0HA 1EQ1A 4XLNF 3C8GD 1JR8A 3U2LA 3JT1A 2A69F 4CBEA 2WVNA 3FAJA 3UMKA 3DZAA 5JT4A 3FDQA 1TWCA 2OCCC 2YHSA 4PJJA 5CIVA 4I44A 4J30B 1RKEA 2M64A 3ABLC 2JPUA 1EKYA 4MVQA 4MTOA 2XLHA 3TK0A 3NYJA 3IQ5A 3EFOB 2ZXWC 2R7SA 1A7DA 4J32B 4R32A 3GEIA 2XS8A 2R7QA 4IAOA 1TKNA 2Y69C 3RF3A 1RKCA 3U3FA 4U5DE 2ASRA 4CIPA 4BEJA 3EGDA 3M79A 1WTYA 3ZQYA 1Y6DA 4CSAC 3DE9A 1AVOB 1ZW2A 2DYRC 2JD3A 3NKDA 3GODA 3JCUQ 1RXQA 1BBHA 1BR2A 2A6HF 1M2OA 2VCBA 5JRAA 1A0BA 2EINC 2VH3A 4MTFA 4DRHB 1LIHA 1YLMA 2QE9A 3DJNB 2VASA 4BJ6A 4JVSA 4Q4ZF 2ICWG 3CEXA 1PD0A 2W45A 2A0BA 1D1BA 3S27A 3V7OA 4JTDB 4YT8A 4CDVA 2BL2A 1VB5A 2UUIA 1DOWA 1LS1A 1CPQA 1PCXA 2KC3A 2YL0A 3LEVA 2L6HA 4CS8A 4E17A 1U6HA 2KJGA 2L81A 1CPRA 1ZHXA 2NG1A 4IGGA 4XPXA 2PFDA 3GWLA 3LS1A 5L0GA 2EPLX 3GANA 1SR2A 1T6UA 3PCVA 4IRUA 3DKAA 3DJUB 4X0RA 1MMNA 3UR3C 1QKRA 3IQCA 4CDAA 1HE1A 3W4YA 4BJ5C 2KYHA 5A6BA 5EHHA 2J0XA 2Y3BA 3QW0A 1T6QA 2AWYA 3LJBA 5D92A 2D5RB 4O79A 4BPMA 5A6AA 1ZHWA 3QW1A 1KU2A 2YVKA 3GEEA 3ITFA 3ZSUA 4EIYA 2LQGA 1FTSA 3K33A 2C03A 5BQGA 1QZXA 1GM5A 3WAQA 1LPEA 4H4KC 3ATPA 2D4UA 2OJED 4NY3A 1PV3A 1V54C 3G4ZA 4LLCA 2VB6A 3US6A 3U0CA 4CS8C 3BEHA 3NYMA 5KYWB 4JZAA 1CGME 4CS9A 4NQFA 1ZZPA 4O6YA 2XLEA 2MYSA 2XLOA 4JKVA 2Q7RA 3W8IA 1YARO 4EUKB 5B3IA 3POVA 4RBNA 3S90A 1ORYA 3R7CA 1MNDA 1R5ID 1RKEB 4YL0A 2H7OA 4C3EA 2XLDA 1J8MF 3JRTA 1M2VA 2I15A 4QI0A 1LS4A 3Q6MA 4KNVA 3S9OA 3T6GB 1FMWA 1TWAA 1RCPA 4DRJB 4OIPF 3L8JA 2BC5A 2GA0A 2JX0A 3S28A 3ZDLA 4DJ9A 2GFHA 5DQTA 1OQCA 4AE4B 1K04A 1HMDA 3AG3C 3DI5A 3R2PA 1OW6A 2OKUA 3B29A 5DS6A 4ER9A 2J9WA 5L0FA 2EIJC 5BQIA 2WVQA 1YDIA 3RQGA 4EBKA 5KYYA 3EG9A 4GYTA 5K0IA 2P0NA 2KK1A 2NPUA 3JRMO 3G50A 3KYIA 4NCQA 4CX9A 3ECSA 3U8VA 1ZU5A 3TQOA 1TWGA 5A69A 1U89A 4J7YA 4OIOF 1YYXA 2EPNA 3QZCA 1NFOA 2F22A 4N6CA 2CDQA 3JSEO 3FOPA 3O39A 3AOUA 1VTMP 2HUJA 2PBEA 2XRHA 2X51A 4N4WA 3ZTMA 4DVYP 3CAXA 3NKEA 3X2QC 3ZG1A 4PR9A 4AX2A 2XL8A 2R7WA 5HSWA 3NG1A 3EGXA 1RJ9A 3DM5A 3VAYA 2Y3DA 4AL0A 4IJJA 3M15A 1F1MA 4QDLA 3C62A 5E3CA 3UMHA 4C7OA 4U9DA 3KL4A 2XM4A 1V55C 4YJWA 3B0VC 3FAPB 3MYIA 2HFIA 2CNWA 2L6GA 3U2MA 4C3DA 4ZLCA 2HS5A 3C63A 4NC3A 5CI8A 5DS5A 4HFFB 2R7TA 1VYIA 5KYNA 2EIKC 1NG1A 2NUTA 2HMZA
chains in the Genus database with same CATH topology
1C17M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C17 M; 
#chains in the Genus database with same CATH topology
 1C03 A;  1YZA A;  2G62 A;  3EHN A;  1A41 A;  1NU9 C;  2EPK X;  2G3K A;  1HY5 A;  2MHR A;  5COG A;  4BEM J;  4P9F A;  3RFY A;  4KC9 A;  4L6R A;  1W2W A;  2W9Y A;  1H7I A;  3AJM A;  4K1O A;  2WZL A;  3LS0 A;  4NTB A;  1H9G A;  1H9T A;  3SXM A;  2HSB A;  3DAF A;  1L3P A;  4HFK B;  2LSE A;  2J9V A;  3M4B A;  4MS2 A;  3SXZ A;  3S0X A;  3C7J A;  1L7C A;  1I5N A;  2Z15 A;  1ORJ A;  4JC7 A;  5COF A;  5CI9 A;  3IHU A;  3JSZ A;  4NTA A;  5EGY A;  2OQM A;  2UUH A;  3AQC A;  3LAY A;  2NUP B;  2WVO A;  2XM0 A;  2YLG A;  4ULV A;  3WHN A;  5KYU A;  1M2V B;  1WN0 A;  1WOL A;  4U5F E;  4EHP A;  4G7H F;  2XXA B;  5T3W A;  2Q9A A;  3DAG A;  4JW1 A;  1MMG A;  2H7B A;  5GPG B;  1GS9 A;  3RVY A;  2R7V A;  1JMW A;  1T5O A;  2Y39 A;  3RVZ A;  3OEO A;  3IEE A;  4I1M A;  2R25 A;  1LKX A;  4MVZ A;  3EH1 A;  4DVZ A;  3C8Z A;  2XS1 A;  4EWC A;  3GM3 A;  4PJL A;  1LI7 A;  5KYY B;  4WGZ A;  3C8G A;  1VLS A;  2ZXO A;  1ZU4 A;  1EA8 A;  3DMD A;  2H7V C;  4BG0 A;  5JVE A;  1UFB A;  4U5E E;  1G4U S;  2KGO A;  1NSG B;  2OEX A;  3K1I A;  1BDJ B;  3K7D A;  4JRZ A;  4A2N B;  4RD9 A;  2YKZ A;  2IM8 A;  2YL3 A;  5E2Q A;  3WG7 C;  1OCR C;  4FES A;  4JCH A;  4XPW A;  2LK4 A;  1AUE A;  3NMI A;  2Y3H A;  3FOO A;  3M4C A;  4YT5 A;  2YLD A;  3M1C B;  5JUA A;  5IY5 C;  1D1A A;  3LUT B;  2XL6 A;  3ZC4 A;  3NMJ A;  1JPJ A;  5T3T A;  3ASN C;  3GWN A;  3I4U A;  3RH3 A;  3B0P A;  3I5P A;  3HNL A;  4A4A A;  2QUP A;  1A7E A;  2PF4 E;  4YT4 A;  2X0C A;  2IBF A;  2DI3 A;  4JJG A;  3KH2 A;  3W8H A;  1G8X A;  2Q3T A;  5F28 E;  1ZYR F;  3QVY A;  1ZW3 A;  1TFK B;  3TUL A;  3JZ0 A;  3U8P A;  4BJ1 A;  1ZHY A;  2IXP A;  4KI2 A;  5L0C A;  1D0X A;  2HSQ A;  2ETS A;  3LES A;  4DBR A;  1Z63 A;  4ZLD A;  1G4W R;  3L0I A;  3S29 A;  1OW7 A;  4BJT A;  4BJ6 C;  4MVO A;  1QLE C;  5JS5 A;  1OKK D;  1QSP A;  4ONS A;  4OIR F;  1Z3I X;  2ZPA A;  4LER A;  4D4N A;  5AC4 A;  5KYW A;  4G7Z F;  3GM2 A;  1T01 A;  3SEO A;  5A6J A;  2IOQ A;  2HKV A;  3F46 A;  4MVU A;  2OU6 A;  1HMO A;  3TOM A;  1WAS A;  4GEH A;  2R02 A;  4MQ9 F;  2I8B A;  4EBB A;  1TFO B;  5F5F A;  4ULW A;  3MLG A;  2J9B A;  2WZG A;  3E9V A;  1FMV A;  1ORS C;  3LEO A;  2P7V A;  2NSG A;  4HEA J;  2XSE A;  2VC9 A;  2B0H A;  1IW7 F;  5EK0 A;  3AG1 C;  3VYW A;  1UG7 A;  1SMY F;  1Q0M A;  3SP1 A;  2RD9 A;  5L0D A;  4YL3 A;  2LD6 A;  2R7U A;  4C3B A;  3MBG A;  4F4B A;  1Q0G A;  2VCA A;  3EGD B;  3C8G B;  1ZHT A;  4LDR A;  4PFP A;  3ZQV A;  2LCH A;  2GAQ A;  2R03 A;  3NMK A;  4IAQ A;  5JP7 A;  3T9O A;  4UDV A;  2FGY A;  3VM6 A;  2AWC A;  1OR2 A;  2XL4 A;  1LE4 A;  5KYX A;  2HMQ A;  1OW8 A;  4N6H A;  5BUO A;  1C17 M;  2GDC A;  3EH2 A;  3EZH A;  4JCZ A;  3ZVR A;  4WAB A;  4LDK A;  2LFF A;  4LDQ A;  3U5S A;  1FR0 A;  4EKW A;  3ASO C;  2A68 F;  3TD7 A;  4OIN F;  3HNI A;  4Z9J A;  5E3A A;  3B9Q A;  4YT2 A;  2PP4 A;  4MTG A;  1JOG A;  1LM3 B;  4G78 A;  3X1O A;  1RMV A;  2BE5 F;  2NSF A;  4LAC B;  3ABK C;  3LLI A;  5DVW A;  4MVS A;  3U9J A;  3LNM B;  4O7G A;  2R05 A;  4XEK A;  1MQV A;  1SF8 A;  4XWJ A;  5COM A;  1MMA A;  5L3V A;  1K05 A;  1FNT c;  2M4E A;  4RDA A;  1AEP A;  2KNH A;  1SZI A;  3W2W A;  4JEA A;  4KNW A;  2OG2 A;  4IB4 A;  4W8K A;  4XEV A;  3U9M A;  2CW0 F;  1A7V A;  4DRI B;  3TJ6 A;  1OCZ C;  2R9R B;  3UMI A;  2PX3 A;  2AP3 A;  4K7B A;  3H2V A;  1E86 A;  4N06 A;  4YK5 A;  1HE9 A;  4E0I A;  4G0H A;  4B6I A;  2HV6 A;  4PAC A;  1XZP A;  1CGN A;  1VYK A;  2J46 A;  3FMS A;  3N2Z B;  4P6I C;  5F5H A;  1YVI A;  3A9C A;  4MW8 A;  1IZM A;  1R4T A;  3ABM C;  4FWV A;  4HE8 D;  5FCL A;  3QMK A;  1QQ3 A;  1FFT C;  2AU5 A;  3KKB A;  4CS7 A;  1DOV A;  4JTC B;  4AL1 A;  1BR1 A;  3DE8 A;  2J7P D;  2QNL A;  2HV7 A;  2YQY A;  4OIQ F;  2V26 A;  1V74 B;  1O87 A;  1OXK A;  2L6F A;  3V5Y A;  5T1D B;  4JE9 A;  4XLP F;  2A1D D;  1K40 A;  1YA9 A;  3EPV A;  1E85 A;  5E33 A;  2R7R A;  1LVK A;  4YN0 B;  3W2V A;  2P61 A;  1Q0D A;  1OCC C;  3HLZ A;  3OA1 A;  4OD5 A;  5DQZ A;  1SYQ A;  3UGP A;  3AG2 C;  2ZD9 A;  4QI2 A;  3L8I A;  2OJQ A;  4OD4 A;  3V5Z A;  2IXM A;  2Y3G A;  3O6X A;  4E0H A;  4E7S A;  3EZI A;  3NRH A;  1T9K A;  4CSA A;  5B1B C;  1OXB A;  3J06 A;  3LLK A;  1PD1 A;  1OCO C;  3EG9 B;  4U5B E;  2WL8 A;  4Z9H A;  1FAP B;  3RW0 A;  3SZR A;  1E2X A;  2HJ3 A;  3VRC A;  1HW1 A;  3NYL A;  2WZF A;  1VK5 A;  3CZ6 A;  4XPY A;  4FAP B;  3U3B A;  1B68 A;  1O3U A;  3DWW A;  3AQB A;  3SNH A;  4Z9I A;  3FHD A;  4PFO A;  2L7A A;  1C02 A;  3N24 A;  1GQA A;  1WGW A;  4DXW A;  5B3S C;  5A6K A;  2J45 A;  2EPO A;  3RYL A;  3RKO F;  4IWB A;  3QTH A;  4J7T A;  2CGE A;  5DLJ A;  3EGX B;  4CDY A;  1RJ9 B;  1V4A A;  1HW2 A;  4Q5S F;  3EHM A;  3MX3 A;  2DGJ A;  2E87 A;  1XZQ A;  3GEH A;  4C7O B;  1BZ4 A;  4DOZ A;  5JLI A;  1U0B B;  3HTK C;  3KPH A;  1I4Y A;  2H8A A;  4G7O F;  3L1M A;  2QY9 A;  4AE4 A;  2ZXP A;  2R7O A;  3QVZ A;  2Q00 A;  3EQL F;  5AGF A;  2RSE B;  1FFH A;  2EIM C;  2L9J A;  2NUT B;  3B71 A;  1ZVZ A;  3T6J A;  4E7Z A;  1YZC A;  2YRF A;  4BJ5 A;  2IYL D;  1D1C A;  1Y4C A;  1YJG A;  2A0U A;  4GQH A;  1MMD A;  3K1I C;  4XQ1 A;  2CYD A;  2QLA A;  1M57 C;  3HKK A;  4K0D A;  5L3Q A;  1D0Z A;  3WOD F;  3UNG C;  4NTF A;  3ZTZ A;  5A6B D;  2QTV A;  2OOC A;  1M6T A;  3FXH A;  3E70 C;  2IXN A;  3VF0 A;  1VMA A;  3IQ6 A;  4U5H A;  1S05 A;  1D0Y A;  4JUR I;  4LLE A;  3H65 A;  1H6G A;  4PJM A;  1CGO A;  3O10 A;  4KBL A;  4YL1 A;  1BR4 A;  2WB7 A;  4I3M A;  5KYU B;  3GOR A;  3NDB B;  2YL1 A;  3OWT A;  2XLW A;  4MND A;  2TMV P;  3DM9 B;  4U5G A;  2V3C C;  3RQF A;  2J0W A;  1J8Y F;  2FAP B;  4O6M A;  3SXK A;  2W4B A;  4XEF A;  1XWJ A;  2J9U A;  3I5Q A;  5AC5 A;  1OKK A;  1VLT A;  1Z5Z A;  3LNR A;  4O6N A;  1Q0F A;  1APC A;  2EIL C;  2Q9B A;  3L34 A;  1KTM A;  3RQE A;  3PDM P;  2KW3 C;  3HNK A;  1JAF A;  4PK4 A;  4CIH A;  2YLI A;  1E83 A;  2C04 A;  2HJM A;  1ZHZ A;  3BRJ A;  1LE2 A;  2IXO A;  3DD7 A;  2LP4 A;  3ZWI A;  4P9T A;  1KNY A;  3V5X A;  1QPU A;  3G4X A;  2NUP A;  3SXY A;  4EBJ A;  2FFH A;  3H2U A;  3T4R A;  3Q7L A;  1Q0K A;  1QVX A;  2XXA A;  2AVK A;  2YEV A;  2O9X A;  3AG4 C;  3JYH A;  3MFN A;  3Q7G A;  4MW3 A;  3K1H A;  1YA7 O;  2YL7 A;  3UGO A;  4H54 A;  3AGU A;  3EFO A;  2EPM X;  1NU7 D;  5FZT A;  4Q7C A;  3TOL A;  2P1A A;  4CS9 C;  1E84 A;  1O5H A;  1VOM A;  4MVR A;  5B1A C;  1Z6A A;  1T6I A;  3K6B A;  1G5Z A;  4JEB A;  4WGY A;  3TJ5 A;  4PJN A;  1I4Z A;  1YYJ A;  3T6B A;  2PX0 A;  4DBQ A;  2B0J A;  2YZS A;  5DS4 A;  2KSF A;  4YWQ A;  1TWH A;  2GWW A;  2Q9C A;  3JTL O;  2CNW D;  3GM1 A;  5HV9 A;  1JRA A;  3S84 A;  4CJO A;  3AGT A;  3B0U X;  2Q4F A;  3K66 A;  5L0I A;  2DB4 A;  4D4X A;  1TQG A;  2KQ9 A;  3IQT A;  2YWA A;  3DXJ F;  4ANJ A;  2LIG A;  1NFN A;  1GGQ A;  256B A;  3FVY A;  2OEV A;  5D91 A;  1S7Z A;  2XLV A;  2G3V A;  4JJF A;  1Z7Q c;  4I1O B;  2HZ8 A;  3CQZ A;  2R7X A;  4E18 A;  4AK9 A;  2XLM A;  3A11 A;  1YAU O;  3IPM O;  4CJG A;  1NZE A;  3RIP A;  1WAT A;  2W4M A;  3O55 A;  3N0T A;  5L0J A;  1NLX A;  3CSK A;  1JPN A;  4M63 A;  5BQH A;  3PHF 2;  2MWQ A;  2P6V A;  4IAR A;  1NBB A;  3KMI A;  2A6E F;  2J8W A;  3F47 A;  1TR2 A;  3PMR A;  1ST6 A;  3HJC A;  3Q6N A;  4FX5 A;  4JIO A;  4XTK A;  1N1C A;  3HNJ A;  5JSL A;  3C18 A;  3SYN A;  4W8P A;  1Z23 A;  3MYF A;  3KYJ A;  3ZIB A;  2J7P A;  2CCY A;  2VCC A;  4WJ0 A;  1EI7 A;  4U5C E;  2ZXR A;  1LI5 A;  1WWP A;  2DYS C;  3JYY A;  1OR3 A;  5KYX B;  1MNE A;  5TJ5 E;  1M56 C;  2PNO A;  3EJN A;  4MVM A;  4U9E A;  4JTA B;  2LFD A;  5L0H A;  1EQ1 A;  4XLN F;  3C8G D;  1JR8 A;  3U2L A;  3JT1 A;  2A69 F;  4CBE A;  2WVN A;  3FAJ A;  3UMK A;  3DZA A;  5JT4 A;  3FDQ A;  1TWC A;  2OCC C;  2YHS A;  4PJJ A;  5CIV A;  4I44 A;  4J30 B;  1RKE A;  2M64 A;  3ABL C;  2JPU A;  1EKY A;  4MVQ A;  4MTO A;  2XLH A;  3TK0 A;  3NYJ A;  3IQ5 A;  3EFO B;  2ZXW C;  2R7S A;  1A7D A;  4J32 B;  4R32 A;  3GEI A;  2XS8 A;  2R7Q A;  4IAO A;  1TKN A;  2Y69 C;  3RF3 A;  1RKC A;  3U3F A;  4U5D E;  2ASR A;  4CIP A;  4BEJ A;  3EGD A;  3M79 A;  1WTY A;  3ZQY A;  1Y6D A;  4CSA C;  3DE9 A;  1AVO B;  1ZW2 A;  2DYR C;  2JD3 A;  3NKD A;  3GOD A;  3JCU Q;  1RXQ A;  1BBH A;  1BR2 A;  2A6H F;  1M2O A;  2VCB A;  5JRA A;  1A0B A;  2EIN C;  2VH3 A;  4MTF A;  4DRH B;  1LIH A;  1YLM A;  2QE9 A;  3DJN B;  2VAS A;  4BJ6 A;  4JVS A;  4Q4Z F;  2ICW G;  3CEX A;  1PD0 A;  2W45 A;  2A0B A;  1D1B A;  3S27 A;  3V7O A;  4JTD B;  4YT8 A;  4CDV A;  2BL2 A;  1VB5 A;  2UUI A;  1DOW A;  1LS1 A;  1CPQ A;  1PCX A;  2KC3 A;  2YL0 A;  3LEV A;  2L6H A;  4CS8 A;  4E17 A;  1U6H A;  2KJG A;  2L81 A;  1CPR A;  1ZHX A;  2NG1 A;  4IGG A;  4XPX A;  2PFD A;  3GWL A;  3LS1 A;  5L0G A;  2EPL X;  3GAN A;  1SR2 A;  1T6U A;  3PCV A;  4IRU A;  3DKA A;  3DJU B;  4X0R A;  1MMN A;  3UR3 C;  1QKR A;  3IQC A;  4CDA A;  1HE1 A;  3W4Y A;  4BJ5 C;  2KYH A;  5A6B A;  5EHH A;  2J0X A;  2Y3B A;  3QW0 A;  1T6Q A;  2AWY A;  3LJB A;  5D92 A;  2D5R B;  4O79 A;  4BPM A;  5A6A A;  1ZHW A;  3QW1 A;  1KU2 A;  2YVK A;  3GEE A;  3ITF A;  3ZSU A;  4EIY A;  2LQG A;  1FTS A;  3K33 A;  2C03 A;  5BQG A;  1QZX A;  1GM5 A;  3WAQ A;  1LPE A;  4H4K C;  3ATP A;  2D4U A;  2OJE D;  4NY3 A;  1PV3 A;  1V54 C;  3G4Z A;  4LLC A;  2VB6 A;  3US6 A;  3U0C A;  4CS8 C;  3BEH A;  3NYM A;  5KYW B;  4JZA A;  1CGM E;  4CS9 A;  4NQF A;  1ZZP A;  4O6Y A;  2XLE A;  2MYS A;  2XLO A;  4JKV A;  2Q7R A;  3W8I A;  1YAR O;  4EUK B;  5B3I A;  3POV A;  4RBN A;  3S90 A;  1ORY A;  3R7C A;  1MND A;  1R5I D;  1RKE B;  4YL0 A;  2H7O A;  4C3E A;  2XLD A;  1J8M F;  3JRT A;  1M2V A;  2I15 A;  4QI0 A;  1LS4 A;  3Q6M A;  4KNV A;  3S9O A;  3T6G B;  1FMW A;  1TWA A;  1RCP A;  4DRJ B;  4OIP F;  3L8J A;  2BC5 A;  2GA0 A;  2JX0 A;  3S28 A;  3ZDL A;  4DJ9 A;  2GFH A;  5DQT A;  1OQC A;  4AE4 B;  1K04 A;  1HMD A;  3AG3 C;  3DI5 A;  3R2P A;  1OW6 A;  2OKU A;  3B29 A;  5DS6 A;  4ER9 A;  2J9W A;  5L0F A;  2EIJ C;  5BQI A;  2WVQ A;  1YDI A;  3RQG A;  4EBK A;  5KYY A;  3EG9 A;  4GYT A;  5K0I A;  2P0N A;  2KK1 A;  2NPU A;  3JRM O;  3G50 A;  3KYI A;  4NCQ A;  4CX9 A;  3ECS A;  3U8V A;  1ZU5 A;  3TQO A;  1TWG A;  5A69 A;  1U89 A;  4J7Y A;  4OIO F;  1YYX A;  2EPN A;  3QZC A;  1NFO A;  2F22 A;  4N6C A;  2CDQ A;  3JSE O;  3FOP A;  3O39 A;  3AOU A;  1VTM P;  2HUJ A;  2PBE A;  2XRH A;  2X51 A;  4N4W A;  3ZTM A;  4DVY P;  3CAX A;  3NKE A;  3X2Q C;  3ZG1 A;  4PR9 A;  4AX2 A;  2XL8 A;  2R7W A;  5HSW A;  3NG1 A;  3EGX A;  1RJ9 A;  3DM5 A;  3VAY A;  2Y3D A;  4AL0 A;  4IJJ A;  3M15 A;  1F1M A;  4QDL A;  3C62 A;  5E3C A;  3UMH A;  4C7O A;  4U9D A;  3KL4 A;  2XM4 A;  1V55 C;  4YJW A;  3B0V C;  3FAP B;  3MYI A;  2HFI A;  2CNW A;  2L6G A;  3U2M A;  4C3D A;  4ZLC A;  2HS5 A;  3C63 A;  4NC3 A;  5CI8 A;  5DS5 A;  4HFF B;  2R7T A;  1VYI A;  5KYN A;  2EIK C;  1NG1 A;  2NUT A;  2HMZ A; 
#chains in the Genus database with same CATH homology
 1C17 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...