3U9JA

Crystal structure of oxidized human fbxl5 hemerythrin like domain
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
157
structure length
157
Chain Sequence
FPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords F-box/LRR-repeat protein 5
publication title The Structural Basis of Iron Sensing by the Human F-box Protein FBXL5.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3u9jA00
2P0NA 3CAXA 3V5XA 3V5ZA 3V5YA 3U9MA 3U9JA
chains in the Genus database with same CATH superfamily
3CAXA 3LLKA 5DQTA 4OIQF 4XEKA 1YZAA 3S90A 4LLCA 2PP4A 1D0ZA 1RJ9B 3NDBB 3N2ZB 4H54A 1HMOA 2ZXWC 2BL2A 2HS5A 2CNWA 4CBEA 1C03A 1HMDA 3Q7LA 3KYIA 1QSPA 2FFHA 2X51A 3Q6MA 4ONSA 4Z9IA 5KYUA 3VRCA 4CDAA 1YZCA 3DAGA 2HMZA 2XSEA 1TR2A 2A68F 2ICWG 3JZ0A 3KYJA 4NCQA 3RH3A 1E83A 1RKEA 1T01A 2OQMA 3RQEA 2OJQA 2QUPA 1AEPA 1LS1A 4JURI 2P6VA 4U5HA 4PACA 2R02A 1O87A 4H4KC 2A0BA 2OU6A 4NC3A 4CS7A 1K05A 3AG2C 3GEEA 3UR3C 5KYWB 2Q00A 3DMDA 4JTCB 5A6BA 4P6IC 1J8YF 3ZIBA 4CS9A 4C7OA 4KNVA 4NTAA 4EUKB 1LIHA 4P9TA 3U8VA 2XM4A 4CSAC 2CW0F 3RQGA 1VOMA 4LERA 2VCAA 4JRZA 2O9XA 1K04A 3LEVA 4PJLA 5B1AC 1SMYF 3LNRA 2IOQA 3TK0A 1YVIA 2XRHA 3CZ6A 4N4WA 5FZTA 1YA9A 2IXPA 3EGDA 3RFYA 1XZQA 5KYWA 1PV3A 3I4UA 1AUEA 4HFFB 1OW8A 2YL7A 4P9FA 1E86A 2TMVP 3WHNA 4DVYP 2EIKC 3TULA 4ZLCA 1LM3B 2DYSC 4PJJA 4L6RA 1F1MA 4YT8A 2PFDA 2EPNA 3W8HA 3AJMA 2AVKA 2GAQA 3M15A 3AG1C 2XS8A 3V5XA 4E7ZA 3HLZA 3C8GB 2WVOA 1Q0FA 1YDIA 2J9UA 3AG4C 4IAQA 2G62A 3KH2A 4XPXA 5JP7A 4DVZA 2WZGA 4EBBA 1D0XA 2VCCA 5CIVA 2DB4A 2HFIA 4C3EA 1T6QA 1BR2A 3JYYA 4JZAA 3FOPA 2HJMA 3DM9B 4A4AA 2NPUA 2PBEA 2DYRC 3AQBA 1VB5A 1OXKA 2OJED 3RF3A 1A7DA 1Z5ZA 3B29A 3W2VA 1LI7A 3MX3A 4MTFA 5JSLA 5KYXB 2R7SA 1M2OA 3FMSA 1LI5A 1Z6AA 4EBJA 1CGOA 256BA 3QW1A 4M63A 5E33A 4JC7A 3RVZA 1A7EA 1XZPA 3DI5A 1I5NA 1V55C 4CS8A 1GQAA 5TJ5E 1WGWA 3DKAA 1VYKA 3C62A 4MVZA 4D4XA 2XL8A 1E84A 1Q0GA 2WZLA 4BPMA 3C7JA 4DJ9A 2ZD9A 3HNJA 3JTLO 1LKXA 2P7VA 2XL4A 3EGXB 4JVSA 4MS2A 5KYXA 3DM5A 4PJMA 1TFOB 1U6HA 2A1DD 2A69F 2L7AA 2OOCA 3KPHA 3O6XA 4U9DA 1OCZC 3NMIA 2Y3GA 3W4YA 4UDVA 3CQZA 4PFOA 1ZHZA 3LNMB 3DJUB 2G3VA 5DQZA 3SXZA 4PR9A 1TWCA 4YT2A 1D1AA 2ZPAA 3NMJA 2YLIA 4JCHA 3RYLA 1A0BA 2QTVA 4XPWA 2EILC 2R7RA 2EINC 4YT5A 1H9GA 4X0RA 2R7QA 2YKZA 2HV6A 4AE4A 1M6TA 5K0IA 2FGYA 4R32A 5DS5A 3EPVA 4G7OF 3EGXA 4WGZA 1NSGB 3U8PA 4E0IA 4CIHA 1HW2A 1K40A 1ZW3A 4AK9A 5F5FA 2PNOA 2HMQA 4G7HF 3J06A 3F46A 1O5HA 2BC5A 2GA0A 2GWWA 2W4BA 3K7DA 3RQFA 1EI7A 1TWAA 4CJGA 1G8XA 3LS1A 1S05A 1JPNA 2ZXOA 4U5CE 1OXBA 2ETSA 3JCUQ 2YWAA 1A7VA 2A0UA 1QZXA 1B68A 2RD9A 2J7PA 1G5ZA 5AC4A 1M56C 4BJ6A 1MMDA 2LCHA 3CSKA 3EG9B 1KTMA 1WN0A 2QY9A 5T3WA 1WATA 3K1HA 3W2WA 2CCYA 1OCRC 2KC3A 4OINF 5D91A 1YYJA 2EIMC 5COGA 1G4WR 4A2NB 2XXAB 1H7IA 3FDQA 2OCCC 4JW1A 5D92A 2XLWA 3IQCA 3TD7A 2Q3TA 2HZ8A 1Q0DA 4J32B 1GS9A 4E0HA 4YWQA 2AWYA 5B3IA 5KYNA 3ZWIA 1PD1A 2XLEA 2NUTA 3S27A 2UUIA 4CJOA 3ZDLA 1LE4A 2R03A 3AQCA 3DE9A 2YQYA 3F47A 3IEEA 2OG2A 4HFKB 5COMA 3T9OA 4D4NA 2H7OA 3LS0A 3ZSUA 1MMAA 4G7ZF 3K1IA 3O55A 2J9VA 3K33A 5EK0A 2OKUA 3GWNA 3SXKA 3WG7C 4OIRF 3S0XA 2GFHA 4FAPB 5B1BC 2VH3A 3EZIA 4G78A 5EGYA 4K1OA 3IQTA 3GM2A 2KK1A 3E9VA 3NG1A 1EKYA 4G0HA 4K7BA 1VK5A 1VMAA 2YL1A 2W9YA 3FAPB 3MYFA 4J7YA 3TJ6A 1E85A 3O39A 4FX5A 1RJ9A 1CGNA 4LDQA 2Y39A 2H8AA 1J8MF 1ZHWA 1Z7Qc 4JKVA 5GPGB 4BJ5C 1OKKA 2R05A 2P0NA 4KI2A 5E3CA 1EA8A 2NSGA 4MVMA 4MQ9F 1FMVA 2EPOA 1KU2A 3EHNA 2L81A 4HE8D 4RBNA 4XQ1A 3V5YA 4ANJA 2B0JA 4XPYA 3ZG1A 2GDCA 2H7VC 3QVYA 1T5OA 4WJ0A 4YK5A 3H65A 4U9EA 5FCLA 2XS1A 2JX0A 3DAFA 3LLIA 4ULVA 2AWCA 3SYNA 4N6CA 2YVKA 1PCXA 2JD3A 2UUHA 2R7TA 2KYHA 3US6A 3VF0A 4U5EE 1JMWA 4BEMJ 4MVOA 4Q7CA 5F5HA 3ASNC 5L0IA 1FFHA 3M1CB 4WABA 1OCCC 2WL8A 1JAFA 1ZW2A 2LD6A 2P61A 3EH2A 1YA7O 3X1OA 2VC9A 3G4ZA 4JCZA 5A6KA 3CEXA 4KBLA 1R5ID 4O6MA 2C04A 4E18A 4DOZA 2J46A 2QNLA 3S84A 3SP1A 4ULWA 3QVZA 3TOLA 2H7BA 2IXMA 5L0CA 4O7GA 3AOUA 1LPEA 3L1MA 2R7VA 5E3AA 2EPLX 3JSZA 3PMRA 3V7OA 2OEXA 1I4ZA 3A9CA 2E87A 1QLEC 3V5ZA 5JT4A 3U9JA 4CDYA 2X0CA 2OEVA 1APCA 1D0YA 4GYTA 3IPMO 3C8GA 3SXMA 3TJ5A 4HEAJ 4YN0B 4CS9C 1Z3IX 3LUTB 4CX9A 1CPQA 2DGJA 3I5QA 4MNDA 4CDVA 3HTKC 1LE2A 3NMKA 3MBGA 2MHRA 2J45A 3QMKA 1FNTc 4AL0A 1Q0MA 2LIGA 1JOGA 5BQIA 4EHPA 2YL3A 3GM3A 3U0CA 3GANA 2NUPB 4JE9A 5CI9A 5L3VA 1NU7D 2A6EF 3W8IA 1NLXA 2Q4FA 2W4MA 1W2WA 2LK4A 3FHDA 4QI2A 4IB4A 4RDAA 5DS4A 5A6AA 5HSWA 3U2LA 3AG3C 3M4BA 3EQLF 3U3BA 3ITFA 1YJGA 2XLMA 3UMIA 2HV7A 4DRIB 2R7XA 3I5PA 2NG1A 2NSFA 2P1AA 3R7CA 2LQGA 4IWBA 1YAUO 1VTMP 3LAYA 3ZC4A 1V54C 4JEBA 1Q0KA 4OD4A 4QI0A 4XWJA 3KL4A 1LS4A 3FOOA 3SEOA 4EWCA 5T3TA 2Q9BA 2AP3A 1V74B 2IXNA 2C03A 3C63A 3L0IA 4LDRA 4MVRA 3PCVA 2IXOA 1AVOB 1YYXA 3H2UA 4MW8A 4XLNF 3BRJA 3EFOB 3M79A 5L0JA 4BJTA 3H2VA 3PDMP 2YLGA 3ATPA 3QW0A 3WAQA 3FAJA 4JIOA 4CS8C 1KNYA 2IM8A 1ZYRF 3JSEO 2D5RB 1FFTC 3ZVRA 1LVKA 3B0UX 4ER9A 1JRAA 3NKDA 5F28E 3AGTA 1U89A 1TQGA 4I1MA 3AGUA 1RMVA 1WOLA 1NG1A 3G4XA 1RKCA 4CIPA 1BR1A 2I15A 3MFNA 1CPRA 2YL0A 1T6UA 2Z15A 3N24A 3U2MA 4W8KA 4OD5A 3EG9A 1N1CA 2MWQA 5KYYB 4F4BA 3NKEA 2L6HA 2DI3A 1TKNA 3X2QC 1BR4A 2XXAA 4IJJA 1T6IA 5AGFA 1NZEA 3EH1A 1M2VB 3M4CA 3TOMA 4DRHB 4MVQA 5AC5A 5JLIA 5L0GA 4XLPF 1IZMA 5DVWA 2KJGA 1YLMA 4KC9A 4NTBA 1VYIA 1MNEA 1OQCA 2Y69C 2R9RB 4Z9HA 3PHF2 2QLAA 3HJCA 4U5BE 3ZTZA 1QKRA 1ZVZA 3DZAA 2M4EA 5KYYA 1ZU4A 3QTHA 5KYUB 3GEHA 4IARA 3DJNB 3RVYA 5BUOA 1NFOA 3DD7A 1WASA 4E7SA 1FTSA 3SNHA 5HV9A 3S28A 1RKEB 2KQ9A 1OCOC 2Q9CA 1M2VA 2Y3BA 2VCBA 1V4AA 2XLVA 1C17M 2AU5A 4I1OB 2VB6A 2VASA 1Z23A 1FMWA 3S29A 2W45A 2CDQA 2JPUA 4BJ6C 3E70C 2IYLD 1HE9A 2LFFA 3JYHA 3U3FA 3T6BA 4C7OB 4Q5SF 3GEIA 3ABLC 2WVNA 3OA1A 4O79A 3JT1A 2EIJC 3HNIA 2WB7A 2ASRA 4LDKA 3T6JA 2G3KA 5JVEA 3R2PA 2HJ3A 2L9JA 4YL0A 2B0HA 1BZ4A 1QPUA 1R4TA 1ZHYA 2HSBA 2XLDA 5T1DB 4JTAB 3LEOA 4MW3A 2XLHA 2YLDA 2CGEA 2XLOA 3B0PA 3EGDB 4K0DA 1G4US 4MVUA 4YJWA 3UMKA 5L0FA 1MNDA 5E2QA 3HNLA 2BE5F 1UG7A 4NY3A 3VYWA 4BEJA 3LJBA 4I44A 4B6IA 2KW3C 4NQFA 3K1IC 4IRUA 3ASOC 2LSEA 2IBFA 3ECSA 4JTDB 4PFPA 3S9OA 1L7CA 2EPMX 4AL1A 3K6BA 3ABMC 2HUJA 4KNWA 4JJFA 5L3QA 4J30B 4YL1A 1HE1A 4DBRA 4FWVA 5B3SC 3OWTA 3UNGC 1VLSA 3IHUA 1BBHA 1ZU5A 4Q4ZF 4EKWA 3VM6A 2J7PD 3DXJF 1A41A 4FESA 4DRJB 3MLGA 3Q6NA 4PK4A 4C3BA 3K66A 4WGYA 2F22A 1O3UA 3MYIA 1M57C 2J9WA 1JPJA 2KGOA 2YHSA 3UGPA 1MMNA 1ORSC 1HY5A 2J0XA 3RW0A 1PD0A 2Q7RA 3ZQYA 3L8JA 1IW7F 2YEVA 5A69A 1S7ZA 5IY5C 1GM5A 2V26A 3L34A 2XM0A 1SR2A 2Q9AA 3U5SA 3SZRA 4LLEA 2FAPB 2EPKX 4EIYA 4OIPF 2QE9A 1WTYA 3VAYA 4XEFA 2R7UA 1T9KA 2HKVA 4C3DA 3KKBA 4N6HA 2KNHA 3DE8A 5L0HA 1RCPA 4AX2A 3B71A 4ZLDA 3DWWA 2J0WA 2MYSA 1Y6DA 1Y4CA 2KSFA 4IAOA 1ST6A 1SF8A 1ORJA 2CNWD 2M64A 3POVA 1BDJB 4QDLA 5BQGA 2LP4A 1EQ1A 3FXHA 4U5FE 2YZSA 3SXYA 3ZTMA 3NYJA 5BQHA 5JS5A 2PF4E 1QQ3A 2WZFA 1RXQA 1OR3A 4LACB 1NU9C 3LESA 2NUPA 3NYLA 5COFA 3EJNA 1VLTA 4GQHA 4AE4B 1H6GA 2WVQA 1OW6A 5A6BD 1OKKD 4CSAA 3IQ6A 2R25A 2V3CC 2R7WA 2L6GA 3EZHA 4N06A 3QZCA 5A6JA 1C02A 4J7TA 3GWLA 1D1BA 4IGGA 3U9MA 1DOWA 3ABKC 3BEHA 4BJ1A 3O10A 4U5DE 3IQ5A 1MQVA 5JRAA 1WWPA 3KMIA 4MTOA 4PJNA 4O6NA 4U5GA 2I8BA 3HKKA 4E17A 1MMGA 3JRTA 3UMHA 2A6HF 4XTKA 1ZHTA 1ZHXA 2YRFA 4Z9JA 4DBQA 4W8PA 4JJGA 1NBBA 3L8IA 2J8WA 4OIOF 3A11A 1H9TA 2J9BA 3C8ZA 4NTFA 1QVXA 1L3PA 1SYQA 2RSEB 5L0DA 3GM1A 4EBKA 2L6FA 1I4YA 1XWJA 3G50A 1D1CA 1JR8A 4BG0A 3EFOA 2R7OA 3UGOA 3GORA 4RD9A 3T6GB 3OEOA 1SZIA 1YARO 2D4UA 3C18A 3RIPA 3B0VC 1FAPB 2LFDA 4BJ5A 4JEAA 2PX3A 1TFKB 4MTGA 3Q7GA 3FVYA 2NUTB 4DXWA 2CYDA 3WODF 4MVSA 4GEHA 4YL3A 1UFBA 1Z63A 5JUAA 2ZXRA 3JRMO 2Y3HA 3B9QA 1E2XA 4XEVA 2XL6A 3HNKA 5CI8A 3RKOF 4YT4A 3T4RA 3ZQVA 3N0TA 3NRHA 1TWGA 1U0BB 3C8GD 1GGQA 1TWHA 2ZXPA 5EHHA 1OW7A 4O6YA 1OR2A 2Y3DA 5DLJA 5DS6A 1CGME 4I3MA 1DOVA 3GODA 1HW1A 3EHMA 1FR0A 2PX0A 3TQOA 3NYMA 1NFNA 2HSQA 1ZZPA 1ORYA
chains in the Genus database with same CATH topology
2P0NA 3CAXA 3V5XA 3V5ZA 3V5YA 3U9MA 3U9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0N A;  3CAX A;  3V5X A;  3V5Z A;  3V5Y A;  3U9M A;  3U9J A; 
#chains in the Genus database with same CATH topology
 3CAX A;  3LLK A;  5DQT A;  4OIQ F;  4XEK A;  1YZA A;  3S90 A;  4LLC A;  2PP4 A;  1D0Z A;  1RJ9 B;  3NDB B;  3N2Z B;  4H54 A;  1HMO A;  2ZXW C;  2BL2 A;  2HS5 A;  2CNW A;  4CBE A;  1C03 A;  1HMD A;  3Q7L A;  3KYI A;  1QSP A;  2FFH A;  2X51 A;  3Q6M A;  4ONS A;  4Z9I A;  5KYU A;  3VRC A;  4CDA A;  1YZC A;  3DAG A;  2HMZ A;  2XSE A;  1TR2 A;  2A68 F;  2ICW G;  3JZ0 A;  3KYJ A;  4NCQ A;  3RH3 A;  1E83 A;  1RKE A;  1T01 A;  2OQM A;  3RQE A;  2OJQ A;  2QUP A;  1AEP A;  1LS1 A;  4JUR I;  2P6V A;  4U5H A;  4PAC A;  2R02 A;  1O87 A;  4H4K C;  2A0B A;  2OU6 A;  4NC3 A;  4CS7 A;  1K05 A;  3AG2 C;  3GEE A;  3UR3 C;  5KYW B;  2Q00 A;  3DMD A;  4JTC B;  5A6B A;  4P6I C;  1J8Y F;  3ZIB A;  4CS9 A;  4C7O A;  4KNV A;  4NTA A;  4EUK B;  1LIH A;  4P9T A;  3U8V A;  2XM4 A;  4CSA C;  2CW0 F;  3RQG A;  1VOM A;  4LER A;  2VCA A;  4JRZ A;  2O9X A;  1K04 A;  3LEV A;  4PJL A;  5B1A C;  1SMY F;  3LNR A;  2IOQ A;  3TK0 A;  1YVI A;  2XRH A;  3CZ6 A;  4N4W A;  5FZT A;  1YA9 A;  2IXP A;  3EGD A;  3RFY A;  1XZQ A;  5KYW A;  1PV3 A;  3I4U A;  1AUE A;  4HFF B;  1OW8 A;  2YL7 A;  4P9F A;  1E86 A;  2TMV P;  3WHN A;  4DVY P;  2EIK C;  3TUL A;  4ZLC A;  1LM3 B;  2DYS C;  4PJJ A;  4L6R A;  1F1M A;  4YT8 A;  2PFD A;  2EPN A;  3W8H A;  3AJM A;  2AVK A;  2GAQ A;  3M15 A;  3AG1 C;  2XS8 A;  3V5X A;  4E7Z A;  3HLZ A;  3C8G B;  2WVO A;  1Q0F A;  1YDI A;  2J9U A;  3AG4 C;  4IAQ A;  2G62 A;  3KH2 A;  4XPX A;  5JP7 A;  4DVZ A;  2WZG A;  4EBB A;  1D0X A;  2VCC A;  5CIV A;  2DB4 A;  2HFI A;  4C3E A;  1T6Q A;  1BR2 A;  3JYY A;  4JZA A;  3FOP A;  2HJM A;  3DM9 B;  4A4A A;  2NPU A;  2PBE A;  2DYR C;  3AQB A;  1VB5 A;  1OXK A;  2OJE D;  3RF3 A;  1A7D A;  1Z5Z A;  3B29 A;  3W2V A;  1LI7 A;  3MX3 A;  4MTF A;  5JSL A;  5KYX B;  2R7S A;  1M2O A;  3FMS A;  1LI5 A;  1Z6A A;  4EBJ A;  1CGO A;  256B A;  3QW1 A;  4M63 A;  5E33 A;  4JC7 A;  3RVZ A;  1A7E A;  1XZP A;  3DI5 A;  1I5N A;  1V55 C;  4CS8 A;  1GQA A;  5TJ5 E;  1WGW A;  3DKA A;  1VYK A;  3C62 A;  4MVZ A;  4D4X A;  2XL8 A;  1E84 A;  1Q0G A;  2WZL A;  4BPM A;  3C7J A;  4DJ9 A;  2ZD9 A;  3HNJ A;  3JTL O;  1LKX A;  2P7V A;  2XL4 A;  3EGX B;  4JVS A;  4MS2 A;  5KYX A;  3DM5 A;  4PJM A;  1TFO B;  1U6H A;  2A1D D;  2A69 F;  2L7A A;  2OOC A;  3KPH A;  3O6X A;  4U9D A;  1OCZ C;  3NMI A;  2Y3G A;  3W4Y A;  4UDV A;  3CQZ A;  4PFO A;  1ZHZ A;  3LNM B;  3DJU B;  2G3V A;  5DQZ A;  3SXZ A;  4PR9 A;  1TWC A;  4YT2 A;  1D1A A;  2ZPA A;  3NMJ A;  2YLI A;  4JCH A;  3RYL A;  1A0B A;  2QTV A;  4XPW A;  2EIL C;  2R7R A;  2EIN C;  4YT5 A;  1H9G A;  4X0R A;  2R7Q A;  2YKZ A;  2HV6 A;  4AE4 A;  1M6T A;  5K0I A;  2FGY A;  4R32 A;  5DS5 A;  3EPV A;  4G7O F;  3EGX A;  4WGZ A;  1NSG B;  3U8P A;  4E0I A;  4CIH A;  1HW2 A;  1K40 A;  1ZW3 A;  4AK9 A;  5F5F A;  2PNO A;  2HMQ A;  4G7H F;  3J06 A;  3F46 A;  1O5H A;  2BC5 A;  2GA0 A;  2GWW A;  2W4B A;  3K7D A;  3RQF A;  1EI7 A;  1TWA A;  4CJG A;  1G8X A;  3LS1 A;  1S05 A;  1JPN A;  2ZXO A;  4U5C E;  1OXB A;  2ETS A;  3JCU Q;  2YWA A;  1A7V A;  2A0U A;  1QZX A;  1B68 A;  2RD9 A;  2J7P A;  1G5Z A;  5AC4 A;  1M56 C;  4BJ6 A;  1MMD A;  2LCH A;  3CSK A;  3EG9 B;  1KTM A;  1WN0 A;  2QY9 A;  5T3W A;  1WAT A;  3K1H A;  3W2W A;  2CCY A;  1OCR C;  2KC3 A;  4OIN F;  5D91 A;  1YYJ A;  2EIM C;  5COG A;  1G4W R;  4A2N B;  2XXA B;  1H7I A;  3FDQ A;  2OCC C;  4JW1 A;  5D92 A;  2XLW A;  3IQC A;  3TD7 A;  2Q3T A;  2HZ8 A;  1Q0D A;  4J32 B;  1GS9 A;  4E0H A;  4YWQ A;  2AWY A;  5B3I A;  5KYN A;  3ZWI A;  1PD1 A;  2XLE A;  2NUT A;  3S27 A;  2UUI A;  4CJO A;  3ZDL A;  1LE4 A;  2R03 A;  3AQC A;  3DE9 A;  2YQY A;  3F47 A;  3IEE A;  2OG2 A;  4HFK B;  5COM A;  3T9O A;  4D4N A;  2H7O A;  3LS0 A;  3ZSU A;  1MMA A;  4G7Z F;  3K1I A;  3O55 A;  2J9V A;  3K33 A;  5EK0 A;  2OKU A;  3GWN A;  3SXK A;  3WG7 C;  4OIR F;  3S0X A;  2GFH A;  4FAP B;  5B1B C;  2VH3 A;  3EZI A;  4G78 A;  5EGY A;  4K1O A;  3IQT A;  3GM2 A;  2KK1 A;  3E9V A;  3NG1 A;  1EKY A;  4G0H A;  4K7B A;  1VK5 A;  1VMA A;  2YL1 A;  2W9Y A;  3FAP B;  3MYF A;  4J7Y A;  3TJ6 A;  1E85 A;  3O39 A;  4FX5 A;  1RJ9 A;  1CGN A;  4LDQ A;  2Y39 A;  2H8A A;  1J8M F;  1ZHW A;  1Z7Q c;  4JKV A;  5GPG B;  4BJ5 C;  1OKK A;  2R05 A;  2P0N A;  4KI2 A;  5E3C A;  1EA8 A;  2NSG A;  4MVM A;  4MQ9 F;  1FMV A;  2EPO A;  1KU2 A;  3EHN A;  2L81 A;  4HE8 D;  4RBN A;  4XQ1 A;  3V5Y A;  4ANJ A;  2B0J A;  4XPY A;  3ZG1 A;  2GDC A;  2H7V C;  3QVY A;  1T5O A;  4WJ0 A;  4YK5 A;  3H65 A;  4U9E A;  5FCL A;  2XS1 A;  2JX0 A;  3DAF A;  3LLI A;  4ULV A;  2AWC A;  3SYN A;  4N6C A;  2YVK A;  1PCX A;  2JD3 A;  2UUH A;  2R7T A;  2KYH A;  3US6 A;  3VF0 A;  4U5E E;  1JMW A;  4BEM J;  4MVO A;  4Q7C A;  5F5H A;  3ASN C;  5L0I A;  1FFH A;  3M1C B;  4WAB A;  1OCC C;  2WL8 A;  1JAF A;  1ZW2 A;  2LD6 A;  2P61 A;  3EH2 A;  1YA7 O;  3X1O A;  2VC9 A;  3G4Z A;  4JCZ A;  5A6K A;  3CEX A;  4KBL A;  1R5I D;  4O6M A;  2C04 A;  4E18 A;  4DOZ A;  2J46 A;  2QNL A;  3S84 A;  3SP1 A;  4ULW A;  3QVZ A;  3TOL A;  2H7B A;  2IXM A;  5L0C A;  4O7G A;  3AOU A;  1LPE A;  3L1M A;  2R7V A;  5E3A A;  2EPL X;  3JSZ A;  3PMR A;  3V7O A;  2OEX A;  1I4Z A;  3A9C A;  2E87 A;  1QLE C;  3V5Z A;  5JT4 A;  3U9J A;  4CDY A;  2X0C A;  2OEV A;  1APC A;  1D0Y A;  4GYT A;  3IPM O;  3C8G A;  3SXM A;  3TJ5 A;  4HEA J;  4YN0 B;  4CS9 C;  1Z3I X;  3LUT B;  4CX9 A;  1CPQ A;  2DGJ A;  3I5Q A;  4MND A;  4CDV A;  3HTK C;  1LE2 A;  3NMK A;  3MBG A;  2MHR A;  2J45 A;  3QMK A;  1FNT c;  4AL0 A;  1Q0M A;  2LIG A;  1JOG A;  5BQI A;  4EHP A;  2YL3 A;  3GM3 A;  3U0C A;  3GAN A;  2NUP B;  4JE9 A;  5CI9 A;  5L3V A;  1NU7 D;  2A6E F;  3W8I A;  1NLX A;  2Q4F A;  2W4M A;  1W2W A;  2LK4 A;  3FHD A;  4QI2 A;  4IB4 A;  4RDA A;  5DS4 A;  5A6A A;  5HSW A;  3U2L A;  3AG3 C;  3M4B A;  3EQL F;  3U3B A;  3ITF A;  1YJG A;  2XLM A;  3UMI A;  2HV7 A;  4DRI B;  2R7X A;  3I5P A;  2NG1 A;  2NSF A;  2P1A A;  3R7C A;  2LQG A;  4IWB A;  1YAU O;  1VTM P;  3LAY A;  3ZC4 A;  1V54 C;  4JEB A;  1Q0K A;  4OD4 A;  4QI0 A;  4XWJ A;  3KL4 A;  1LS4 A;  3FOO A;  3SEO A;  4EWC A;  5T3T A;  2Q9B A;  2AP3 A;  1V74 B;  2IXN A;  2C03 A;  3C63 A;  3L0I A;  4LDR A;  4MVR A;  3PCV A;  2IXO A;  1AVO B;  1YYX A;  3H2U A;  4MW8 A;  4XLN F;  3BRJ A;  3EFO B;  3M79 A;  5L0J A;  4BJT A;  3H2V A;  3PDM P;  2YLG A;  3ATP A;  3QW0 A;  3WAQ A;  3FAJ A;  4JIO A;  4CS8 C;  1KNY A;  2IM8 A;  1ZYR F;  3JSE O;  2D5R B;  1FFT C;  3ZVR A;  1LVK A;  3B0U X;  4ER9 A;  1JRA A;  3NKD A;  5F28 E;  3AGT A;  1U89 A;  1TQG A;  4I1M A;  3AGU A;  1RMV A;  1WOL A;  1NG1 A;  3G4X A;  1RKC A;  4CIP A;  1BR1 A;  2I15 A;  3MFN A;  1CPR A;  2YL0 A;  1T6U A;  2Z15 A;  3N24 A;  3U2M A;  4W8K A;  4OD5 A;  3EG9 A;  1N1C A;  2MWQ A;  5KYY B;  4F4B A;  3NKE A;  2L6H A;  2DI3 A;  1TKN A;  3X2Q C;  1BR4 A;  2XXA A;  4IJJ A;  1T6I A;  5AGF A;  1NZE A;  3EH1 A;  1M2V B;  3M4C A;  3TOM A;  4DRH B;  4MVQ A;  5AC5 A;  5JLI A;  5L0G A;  4XLP F;  1IZM A;  5DVW A;  2KJG A;  1YLM A;  4KC9 A;  4NTB A;  1VYI A;  1MNE A;  1OQC A;  2Y69 C;  2R9R B;  4Z9H A;  3PHF 2;  2QLA A;  3HJC A;  4U5B E;  3ZTZ A;  1QKR A;  1ZVZ A;  3DZA A;  2M4E A;  5KYY A;  1ZU4 A;  3QTH A;  5KYU B;  3GEH A;  4IAR A;  3DJN B;  3RVY A;  5BUO A;  1NFO A;  3DD7 A;  1WAS A;  4E7S A;  1FTS A;  3SNH A;  5HV9 A;  3S28 A;  1RKE B;  2KQ9 A;  1OCO C;  2Q9C A;  1M2V A;  2Y3B A;  2VCB A;  1V4A A;  2XLV A;  1C17 M;  2AU5 A;  4I1O B;  2VB6 A;  2VAS A;  1Z23 A;  1FMW A;  3S29 A;  2W45 A;  2CDQ A;  2JPU A;  4BJ6 C;  3E70 C;  2IYL D;  1HE9 A;  2LFF A;  3JYH A;  3U3F A;  3T6B A;  4C7O B;  4Q5S F;  3GEI A;  3ABL C;  2WVN A;  3OA1 A;  4O79 A;  3JT1 A;  2EIJ C;  3HNI A;  2WB7 A;  2ASR A;  4LDK A;  3T6J A;  2G3K A;  5JVE A;  3R2P A;  2HJ3 A;  2L9J A;  4YL0 A;  2B0H A;  1BZ4 A;  1QPU A;  1R4T A;  1ZHY A;  2HSB A;  2XLD A;  5T1D B;  4JTA B;  3LEO A;  4MW3 A;  2XLH A;  2YLD A;  2CGE A;  2XLO A;  3B0P A;  3EGD B;  4K0D A;  1G4U S;  4MVU A;  4YJW A;  3UMK A;  5L0F A;  1MND A;  5E2Q A;  3HNL A;  2BE5 F;  1UG7 A;  4NY3 A;  3VYW A;  4BEJ A;  3LJB A;  4I44 A;  4B6I A;  2KW3 C;  4NQF A;  3K1I C;  4IRU A;  3ASO C;  2LSE A;  2IBF A;  3ECS A;  4JTD B;  4PFP A;  3S9O A;  1L7C A;  2EPM X;  4AL1 A;  3K6B A;  3ABM C;  2HUJ A;  4KNW A;  4JJF A;  5L3Q A;  4J30 B;  4YL1 A;  1HE1 A;  4DBR A;  4FWV A;  5B3S C;  3OWT A;  3UNG C;  1VLS A;  3IHU A;  1BBH A;  1ZU5 A;  4Q4Z F;  4EKW A;  3VM6 A;  2J7P D;  3DXJ F;  1A41 A;  4FES A;  4DRJ B;  3MLG A;  3Q6N A;  4PK4 A;  4C3B A;  3K66 A;  4WGY A;  2F22 A;  1O3U A;  3MYI A;  1M57 C;  2J9W A;  1JPJ A;  2KGO A;  2YHS A;  3UGP A;  1MMN A;  1ORS C;  1HY5 A;  2J0X A;  3RW0 A;  1PD0 A;  2Q7R A;  3ZQY A;  3L8J A;  1IW7 F;  2YEV A;  5A69 A;  1S7Z A;  5IY5 C;  1GM5 A;  2V26 A;  3L34 A;  2XM0 A;  1SR2 A;  2Q9A A;  3U5S A;  3SZR A;  4LLE A;  2FAP B;  2EPK X;  4EIY A;  4OIP F;  2QE9 A;  1WTY A;  3VAY A;  4XEF A;  2R7U A;  1T9K A;  2HKV A;  4C3D A;  3KKB A;  4N6H A;  2KNH A;  3DE8 A;  5L0H A;  1RCP A;  4AX2 A;  3B71 A;  4ZLD A;  3DWW A;  2J0W A;  2MYS A;  1Y6D A;  1Y4C A;  2KSF A;  4IAO A;  1ST6 A;  1SF8 A;  1ORJ A;  2CNW D;  2M64 A;  3POV A;  1BDJ B;  4QDL A;  5BQG A;  2LP4 A;  1EQ1 A;  3FXH A;  4U5F E;  2YZS A;  3SXY A;  3ZTM A;  3NYJ A;  5BQH A;  5JS5 A;  2PF4 E;  1QQ3 A;  2WZF A;  1RXQ A;  1OR3 A;  4LAC B;  1NU9 C;  3LES A;  2NUP A;  3NYL A;  5COF A;  3EJN A;  1VLT A;  4GQH A;  4AE4 B;  1H6G A;  2WVQ A;  1OW6 A;  5A6B D;  1OKK D;  4CSA A;  3IQ6 A;  2R25 A;  2V3C C;  2R7W A;  2L6G A;  3EZH A;  4N06 A;  3QZC A;  5A6J A;  1C02 A;  4J7T A;  3GWL A;  1D1B A;  4IGG A;  3U9M A;  1DOW A;  3ABK C;  3BEH A;  4BJ1 A;  3O10 A;  4U5D E;  3IQ5 A;  1MQV A;  5JRA A;  1WWP A;  3KMI A;  4MTO A;  4PJN A;  4O6N A;  4U5G A;  2I8B A;  3HKK A;  4E17 A;  1MMG A;  3JRT A;  3UMH A;  2A6H F;  4XTK A;  1ZHT A;  1ZHX A;  2YRF A;  4Z9J A;  4DBQ A;  4W8P A;  4JJG A;  1NBB A;  3L8I A;  2J8W A;  4OIO F;  3A11 A;  1H9T A;  2J9B A;  3C8Z A;  4NTF A;  1QVX A;  1L3P A;  1SYQ A;  2RSE B;  5L0D A;  3GM1 A;  4EBK A;  2L6F A;  1I4Y A;  1XWJ A;  3G50 A;  1D1C A;  1JR8 A;  4BG0 A;  3EFO A;  2R7O A;  3UGO A;  3GOR A;  4RD9 A;  3T6G B;  3OEO A;  1SZI A;  1YAR O;  2D4U A;  3C18 A;  3RIP A;  3B0V C;  1FAP B;  2LFD A;  4BJ5 A;  4JEA A;  2PX3 A;  1TFK B;  4MTG A;  3Q7G A;  3FVY A;  2NUT B;  4DXW A;  2CYD A;  3WOD F;  4MVS A;  4GEH A;  4YL3 A;  1UFB A;  1Z63 A;  5JUA A;  2ZXR A;  3JRM O;  2Y3H A;  3B9Q A;  1E2X A;  4XEV A;  2XL6 A;  3HNK A;  5CI8 A;  3RKO F;  4YT4 A;  3T4R A;  3ZQV A;  3N0T A;  3NRH A;  1TWG A;  1U0B B;  3C8G D;  1GGQ A;  1TWH A;  2ZXP A;  5EHH A;  1OW7 A;  4O6Y A;  1OR2 A;  2Y3D A;  5DLJ A;  5DS6 A;  1CGM E;  4I3M A;  1DOV A;  3GOD A;  1HW1 A;  3EHM A;  1FR0 A;  2PX0 A;  3TQO A;  3NYM A;  1NFN A;  2HSQ A;  1ZZP A;  1ORY A; 
#chains in the Genus database with same CATH homology
 2P0N A;  3CAX A;  3V5X A;  3V5Z A;  3V5Y A;  3U9M A;  3U9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...