3U9JA

Crystal structure of oxidized human fbxl5 hemerythrin like domain
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
157
structure length
157
Chain Sequence
b'FPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box/LRR-repeat protein 5
publication title The Structural Basis of Iron Sensing by the Human F-box Protein FBXL5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 59
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3u9jA00
3V5YA 3U9MA 3CAXA 3U9JA 2P0NA 3V5ZA 3V5XA
chains in the Genus database with same CATH superfamily
2OOCA 1K04A 2R7XA 2MHRA 4EBJA 1LE4A 2Y39A 1VK5A 5E33A 4PJLA 4YK5A 1MMAA 1NZEA 3NYMA 4R32A 2YL7A 4IJJA 4JKVA 3US6A 1EQ1A 4LERA 1Q0KA 4FESA 3ZQVA 3AQCA 5A6BA 4BJ6C 2V3CC 1YYJA 2A6EF 5A6BD 2L6FA 4IB4A 4U5GA 4EWCA 1RKEA 2R7VA 1LE2A 1LPEA 2IYLD 1KNYA 1UFBA 1H7IA 3DJUB 4A4AA 4BPMA 2HKVA 5L0HA 2HFIA 4LDRA 3V5ZA 3K33A 4YT2A 2BC5A 2QE9A 4NY3A 2YKZA 3V5YA 3ZC4A 1Q0MA 5A6JA 2PBEA 2YRFA 1Q0DA 1HMOA 1CGNA 3ECSA 4M63A 3SXKA 3T6BA 1TQGA 3UMHA 4DJ9A 3EHMA 3F46A 256BA 3CEXA 3JYYA 3TULA 2WZGA 2L7AA 1F1MA 1T5OA 3C8GB 2Z15A 2YL0A 1VYIA 2OEXA 2W4BA 5COFA 5E3CA 4BJ1A 5JUAA 2GWWA 4JCZA 2LK4A 1RCPA 3FHDA 3PHF2 1GS9A 1AEPA 2AWCA 4GEHA 4JRZA 2ZXRA 4FX5A 4RDAA 2A69F 3CZ6A 1V55C 1SMYF 3QW1A 4JVSA 4K0DA 4U5DE 4WGYA 4CIPA 5T1DB 2YHSA 2PF4E 3EPVA 2FFHA 4HFFB 2WVQA 3EH2A 2R7QA 2ZXWC 2HMQA 3VAYA 4AK9A 5DQTA 1AUEA 4CS8A 1TFOB 1K05A 2JX0A 1U6HA 4CDAA 4PJNA 2KK1A 2P6VA 2D4UA 1D0YA 4D4NA 3ZWIA 1RMVA 4I3MA 4IARA 4DXWA 2IM8A 5EGYA 2M4EA 4JIOA 1D0XA 3FOPA 1R5ID 2CDQA 2W9YA 3AOUA 3RF3A 4MVZA 4W8KA 3C62A 3S9OA 3ZVRA 5EHHA 4Z9JA 1NSGB 3EFOA 1LI7A 4Q7CA 3ZQYA 1KU2A 4JCHA 3U0CA 3ASNC 1FFTC 1NU7D 1JAFA 1ZVZA 1M2VB 1D1BA 4XPYA 2XSEA 3V5XA 4YL3A 2YLIA 1YJGA 2TMVP 3E9VA 2YWAA 4Q4ZF 4BEJA 4EHPA 3HNJA 2GA0A 3FMSA 4JEBA 3SYNA 2DYRC 3T6GB 1OCRC 1NFNA 4OIQF 1EKYA 1TR2A 2J9WA 2OG2A 3Q7GA 5CI9A 5BQIA 2VC9A 3OA1A 1G4US 1TWAA 5DVWA 1Z5ZA 5BQGA 4XPWA 4MNDA 1MMGA 4XEKA 4O6MA 1M6TA 3UGPA 2YLDA 1PCXA 2DYSC 4LDQA 2Q9CA 3NMIA 3EG9A 1FAPB 2PX3A 1FMWA 3EGDA 1TFKB 4U9EA 4D4XA 3GANA 2IXMA 2NSFA 3N0TA 1ZW2A 2P0NA 2G3KA 2XXAB 1MQVA 1OW6A 4J7YA 3M4CA 2QLAA 1AVOB 1BBHA 3B29A 4KNVA 1E85A 2XLDA 1LS4A 3EJNA 4MTOA 3GM2A 2J9UA 5E2QA 3U2LA 4A2NB 1A41A 2NG1A 4JEAA 1E83A 2KC3A 2HSBA 1WGWA 2HZ8A 3C7JA 1I4YA 1GGQA 5KYWB 2YLGA 3EZHA 2YL1A 3EHNA 4NCQA 4O79A 4AE4B 2P61A 2OU6A 1SZIA 3W4YA 2RSEB 1G8XA 4NQFA 1OR2A 3AG3C 3B0UX 4C3BA 4E7SA 1QKRA 2KQ9A 4PFPA 1T01A 3T4RA 1TWHA 3UMKA 3KH2A 2A0UA 3TOMA 5TJ5E 3RQEA 1L7CA 1Q0GA 2FAPB 4P6IC 2OCCC 4CS9A 1VB5A 3AG2C 3K7DA 4EBBA 3GM1A 4J7TA 1CGOA 1OXBA 4PFOA 2O9XA 3S0XA 3FDQA 4JJFA 3BEHA 4KBLA 5DLJA 2DB4A 5JRAA 2R7UA 5F5FA 3SXZA 4GYTA 3SEOA 3TK0A 2LIGA 2YZSA 1WASA 2J46A 3N24A 3GM3A 5FZTA 2HS5A 2KJGA 3R7CA 2A68F 3ZG1A 4DVYP 1CGME 2OQMA 2KW3C 3K1IC 3A9CA 4I1OB 3FAPB 3POVA 3Q6MA 2Y69C 1A7DA 4CSAC 4W8PA 4LLEA 1D1CA 3FOOA 3HJCA 4LDKA 3Q7LA 3WHNA 3IQ6A 1BZ4A 2R03A 4GQHA 2Q4FA 4YWQA 3VYWA 5B3SC 1BR1A 2ZPAA 2EPNA 4H4KC 3U2MA 2R02A 5L0JA 3U9JA 1VLTA 1BDJB 1JPJA 2L9JA 2XL6A 5JLIA 1HY5A 3CSKA 3KYIA 2WB7A 1EI7A 5D92A 1ORSC 3KYJA 3AQBA 4L6RA 4BJ6A 3RH3A 4FWVA 1XWJA 1ZHXA 1YA9A 2XLMA 4G78A 1L3PA 2IXOA 4YL1A 2Y3GA 3HNKA 4K7BA 4E18A 1ZYRF 3L0IA 5T3TA 2KNHA 5JSLA 4IRUA 1C02A 2ETSA 3HTKC 3LEOA 4NTBA 3DI5A 2ICWG 3DAFA 1A7EA 2IXPA 1C03A 1HE9A 1ORJA 5L0IA 2R7SA 3B0VC 2OEVA 2QUPA 4G0HA 1S05A 4Q5SF 1T6UA 1YAUO 5KYUB 1E2XA 1NLXA 1SR2A 2LFDA 3PDMP 2CNWA 5DS4A 2CNWD 1ZHTA 2H7OA 3KMIA 3QTHA 4IAOA 2GDCA 3T6JA 4XLNF 2AU5A 4JTCB 2LCHA 1R4TA 3LNRA 2VCAA 3C8GA 5JP7A 1WOLA 3C8GD 1YVIA 1V4AA 3JT1A 4JC7A 4U5EE 4XWJA 2M64A 3GORA 4ZLDA 1LVKA 4WABA 1G4WR 5KYXB 2Q00A 2W45A 3IQTA 2XXAA 1OQCA 2E87A 3HKKA 4MTGA 1YARO 1T6IA 3JYHA 4U5BE 5D91A 1O3UA 1Z7Qc 2J45A 3ASOC 2XL8A 3U3BA 4BJTA 1KTMA 3HNIA 5BQHA 3DZAA 3VF0A 4CS8C 2HMZA 1D0ZA 1ZZPA 2UUIA 2EIJC 4XPXA 2RD9A 2XLHA 4EBKA 5A6KA 2R7WA 3JSEO 4ONSA 1WN0A 3L8IA 2R9RB 1VYKA 2WVNA 5KYXA 3AGUA 3TQOA 2PFDA 3UMIA 1LI5A 1MNDA 2W4MA 2HV7A 2XLEA 4MVRA 2IBFA 2PNOA 1WATA 3M15A 4I44A 3GEIA 2QY9A 3RKOF 3ABMC 1Y6DA 2DGJA 1ZHZA 4Z9HA 3B0PA 4OINF 1Z6AA 2H8AA 5L0GA 4OIOF 3QVZA 4MVMA 1J8YF 1JRAA 3EH1A 3DKAA 5CI8A 2XM0A 3IEEA 2OJED 3DAGA 3NRHA 3W2WA 1M2VA 4ANJA 4KI2A 5L0DA 3UGOA 2H7VC 3IQCA 3JZ0A 3IPMO 3ABKC 4YN0B 5EK0A 3AG1C 5AC4A 1V74B 2G3VA 3RIPA 1G5ZA 2P7VA 1M57C 1WTYA 2GAQA 1JMWA 3DM5A 3KL4A 2WVOA 3X1OA 2D5RB 1UG7A 1ST6A 3GEHA 1RKCA 3TD7A 1NBBA 1RJ9B 5COGA 1U0BB 4YT8A 2NUTB 3HNLA 1FR0A 1QSPA 2XS1A 3I5PA 4G7ZF 4Z9IA 4QDLA 3TJ5A 2YL3A 1H9TA 3QZCA 4QI0A 4XLPF 2BL2A 2R7RA 2LSEA 3GWLA 1VTMP 3ZTMA 2NUPB 3NKDA 4I1MA 3EZIA 2OJQA 1T6QA 4H54A 2VCCA 2XM4A 2EPKX 3F47A 3MYIA 1MMDA 4WGZA 4G7HF 1MNEA 1HW1A 1CPQA 1SYQA 2WZLA 5KYYB 1ZHYA 3U8VA 1O5HA 5B1AC 3U9MA 4CJGA 3DE8A 1CPRA 4XEFA 5GPGB 3SP1A 3WODF 1S7ZA 3LLKA 1OKKA 3FXHA 2CCYA 3JTLO 1OKKD 3NYJA 4YT5A 2OKUA 3WAQA 5HV9A 1DOVA 3GEEA 3L34A 5KYWA 3S84A 4ULWA 4N4WA 4AE4A 3DXJF 4HE8D 4N6CA 3H2VA 3JSZA 1ZU5A 1H9GA 1T9KA 4U5HA 1QLEC 3V7OA 2R05A 4BJ5C 1MMNA 2CGEA 2MWQA 3NMKA 3H2UA 4ZLCA 4CBEA 4IGGA 5A69A 4MVSA 3TJ6A 1IW7F 3DJNB 3A11A 3I5QA 1OCCC 3NKEA 1LKXA 2ZXPA 4MTFA 4O6NA 4DRJB 3L1MA 4YT4A 5B3IA 1HE1A 5IY5C 3EGXB 2HJ3A 1LIHA 3SNHA 4DVZA 3LS1A 4N6HA 2WL8A 3MFNA 1OXKA 2AWYA 2XS8A 3NG1A 1NFOA 1HW2A 4U5CE 2J9VA 5F28E 1FTSA 4JTAB 1JR8A 3RFYA 2CW0F 4JZAA 4PK4A 2KYHA 2J8WA 4CSAA 4RD9A 3AG4C 3U3FA 1VMAA 2R7TA 4BG0A 2XLWA 3NYLA 1OCZC 4J30B 5E3AA 3J06A 2C03A 3PCVA 3JRMO 3K1HA 4DRHB 1YZAA 2JPUA 2X51A 4XTKA 4EIYA 3LAYA 3ZDLA 2EPOA 2G62A 2LP4A 4OD4A 1E86A 3FVYA 3RW0A 4P9FA 2EIMC 1EA8A 4MW8A 1O87A 4PR9A 2I8BA 1QPUA 1RKEB 2NSGA 3S28A 5FCLA 2L81A 4UDVA 4WJ0A 4AX2A 2ZXOA 1DOWA 2L6GA 4DRIB 5B1BC 2Q9AA 2BE5F 4BEMJ 3T9OA 4KNWA 2YQYA 1XZPA 4PJMA 5BUOA 1PD1A 1OCOC 1Z3IX 1U89A 2A6HF 2EPMX 4YL0A 2J0WA 2J0XA 3EQLF 4IAQA 2B0JA 4LACB 4DBRA 5L3VA 4ULVA 4CJOA 3AJMA 4PACA 4E0HA 3RYLA 4G7OF 3M4BA 2R25A 4E0IA 2FGYA 5CIVA 4E17A 3IQ5A 4MW3A 3DE9A 3W8HA 5AGFA 2A1DD 4K1OA 4MVUA 5DS6A 2HUJA 2EILC 4O7GA 3ABLC 3O6XA 4PJJA 5L0FA 2AVKA 2AP3A 5KYUA 3RVYA 3O39A 3SXMA 3DD7A 3C8ZA 4O6YA 2P1AA 1TWGA 2V26A 4U5FE 1ZW3A 5A6AA 3C18A 3Q6NA 1YZCA 1V54C 1K40A 4HEAJ 1PD0A 3O10A 1Z23A 1XZQA 2Y3HA 1YLMA 3X2QC 4C3DA 4MS2A 3SXYA 3KPHA 3L8JA 3S90A 4C7OB 1JPNA 3HLZA 2C04A 1YYXA 3G4ZA 4OIPF 3EFOB 3RQFA 2VASA 4DBQA 5KYNA 3QW0A 4MVOA 5L3QA 1ZHWA 3B71A 3LEVA 4C3EA 4XEVA 5T3WA 2LQGA 3CQZA 1C17M 3I4UA 3VM6A 2A0BA 2KGOA 3MX3A 1Z63A 2PX0A 3NDBB 4U9DA 4XQ1A 4MQ9F 3VRCA 4C7OA 1BR2A 2R7OA 1NG1A 3CAXA 5K0IA 3K6BA 5AC5A 3NMJA 4QI2A 1TWCA 3PMRA 3E70C 3O55A 4CDYA 2GFHA 3TOLA 1IZMA 4JURI 1ZU4A 2Q9BA 4RBNA 4CS7A 4E7ZA 3AGTA 1OW7A 2J7PA 4OIRF 2J7PD 2XL4A 3WG7C 2XLVA 3UNGC 2HV6A 2IOQA 2DI3A 2F22A 3EG9B 2CYDA 3EGDB 2IXNA 1QQ3A 2UUHA 5F5HA 1Q0FA 1SF8A 3ZSUA 4EUKB 2YEVA 2PP4A 3ZTZA 3N2ZB 3LJBA 2QNLA 1GQAA 1PV3A 4DOZA 3LLIA 1OR3A 2Y3DA 2EINC 1LS1A 1YA7O 3ATPA 3LESA 1H6GA 4NC3A 2J9BA 1RJ9A 4J32B 2HSQA 2EIKC 1W2WA 2I15A 3LS0A 2NUTA 1I4ZA 2JD3A 1ORYA 4IWBA 1YDIA 5COMA 5DQZA 2WZFA 3OEOA 4JJGA 4KC9A 3U5SA 2ASRA 1HMDA 4JW1A 2Q3TA 3B9QA 4OD5A 4NTFA 2NUPA 2NPUA 4MVQA 1BR4A 1N1CA 1Y4CA 1B68A 3MLGA 3GODA 3MBGA 2VCBA 3ZIBA 4F4BA 3G4XA 2XRHA 3DM9B 3DMDA 1GM5A 3JRTA 1TKNA 5KYYA 1J8MF 3U8PA 3UR3C 3ITFA 1I5NA 4ER9A 4CIHA 1RXQA 3BRJA 2VB6A 2Q7RA 4AL0A 1M2OA 2XLOA 3G50A 3SZRA 3W8IA 5JS5A 3K66A 5JT4A 3IHUA 4HFKB 4BJ5A 1A7VA 1FMVA 1QVXA 3DWWA 4N06A 4FAPB 4LLCA 5L0CA 1D1AA 1LM3B 2B0HA 2EPLX 2L6HA 3M79A 3S27A 3S29A 4CS9C 2VH3A 1VLSA 2ZD9A 3GWNA 3K1IA 3QMKA 1JOGA 1M56C 4JE9A 3LUTB 2LFFA 4YJWA 3RQGA 2QTVA 5DS5A 1A0BA 5HSWA 3LNMB 3JCUQ 3FAJA 1QZXA 3RVZA 3QVYA 3H65A 1APCA 4B6IA 4CX9A 2HJMA 4JTDB 3W2VA 2LD6A 1VOMA 4NTAA 4AL1A 1FNTc 3KKBA 3EGXA 3MYFA 2X0CA 5JVEA 4CDVA 2MYSA 1OW8A 1FFHA 2H7BA 2KSFA 3C63A 4P9TA 2Y3BA 4EKWA 4X0RA 1WWPA 3OWTA 2YVKA 3R2PA 1NU9C 3M1CB 1E84A
chains in the Genus database with same CATH topology
3V5YA 3U9MA 3CAXA 3U9JA 2P0NA 3V5ZA 3V5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5Y A;  3U9M A;  3CAX A;  3U9J A;  2P0N A;  3V5Z A;  3V5X A; 
#chains in the Genus database with same CATH topology
 2OOC A;  1K04 A;  2R7X A;  2MHR A;  4EBJ A;  1LE4 A;  2Y39 A;  1VK5 A;  5E33 A;  4PJL A;  4YK5 A;  1MMA A;  1NZE A;  3NYM A;  4R32 A;  2YL7 A;  4IJJ A;  4JKV A;  3US6 A;  1EQ1 A;  4LER A;  1Q0K A;  4FES A;  3ZQV A;  3AQC A;  5A6B A;  4BJ6 C;  2V3C C;  1YYJ A;  2A6E F;  5A6B D;  2L6F A;  4IB4 A;  4U5G A;  4EWC A;  1RKE A;  2R7V A;  1LE2 A;  1LPE A;  2IYL D;  1KNY A;  1UFB A;  1H7I A;  3DJU B;  4A4A A;  4BPM A;  2HKV A;  5L0H A;  2HFI A;  4LDR A;  3V5Z A;  3K33 A;  4YT2 A;  2BC5 A;  2QE9 A;  4NY3 A;  2YKZ A;  3V5Y A;  3ZC4 A;  1Q0M A;  5A6J A;  2PBE A;  2YRF A;  1Q0D A;  1HMO A;  1CGN A;  3ECS A;  4M63 A;  3SXK A;  3T6B A;  1TQG A;  3UMH A;  4DJ9 A;  3EHM A;  3F46 A;  256B A;  3CEX A;  3JYY A;  3TUL A;  2WZG A;  2L7A A;  1F1M A;  1T5O A;  3C8G B;  2Z15 A;  2YL0 A;  1VYI A;  2OEX A;  2W4B A;  5COF A;  5E3C A;  4BJ1 A;  5JUA A;  2GWW A;  4JCZ A;  2LK4 A;  1RCP A;  3FHD A;  3PHF 2;  1GS9 A;  1AEP A;  2AWC A;  4GEH A;  4JRZ A;  2ZXR A;  4FX5 A;  4RDA A;  2A69 F;  3CZ6 A;  1V55 C;  1SMY F;  3QW1 A;  4JVS A;  4K0D A;  4U5D E;  4WGY A;  4CIP A;  5T1D B;  2YHS A;  2PF4 E;  3EPV A;  2FFH A;  4HFF B;  2WVQ A;  3EH2 A;  2R7Q A;  2ZXW C;  2HMQ A;  3VAY A;  4AK9 A;  5DQT A;  1AUE A;  4CS8 A;  1TFO B;  1K05 A;  2JX0 A;  1U6H A;  4CDA A;  4PJN A;  2KK1 A;  2P6V A;  2D4U A;  1D0Y A;  4D4N A;  3ZWI A;  1RMV A;  4I3M A;  4IAR A;  4DXW A;  2IM8 A;  5EGY A;  2M4E A;  4JIO A;  1D0X A;  3FOP A;  1R5I D;  2CDQ A;  2W9Y A;  3AOU A;  3RF3 A;  4MVZ A;  4W8K A;  3C62 A;  3S9O A;  3ZVR A;  5EHH A;  4Z9J A;  1NSG B;  3EFO A;  1LI7 A;  4Q7C A;  3ZQY A;  1KU2 A;  4JCH A;  3U0C A;  3ASN C;  1FFT C;  1NU7 D;  1JAF A;  1ZVZ A;  1M2V B;  1D1B A;  4XPY A;  2XSE A;  3V5X A;  4YL3 A;  2YLI A;  1YJG A;  2TMV P;  3E9V A;  2YWA A;  4Q4Z F;  4BEJ A;  4EHP A;  3HNJ A;  2GA0 A;  3FMS A;  4JEB A;  3SYN A;  2DYR C;  3T6G B;  1OCR C;  1NFN A;  4OIQ F;  1EKY A;  1TR2 A;  2J9W A;  2OG2 A;  3Q7G A;  5CI9 A;  5BQI A;  2VC9 A;  3OA1 A;  1G4U S;  1TWA A;  5DVW A;  1Z5Z A;  5BQG A;  4XPW A;  4MND A;  1MMG A;  4XEK A;  4O6M A;  1M6T A;  3UGP A;  2YLD A;  1PCX A;  2DYS C;  4LDQ A;  2Q9C A;  3NMI A;  3EG9 A;  1FAP B;  2PX3 A;  1FMW A;  3EGD A;  1TFK B;  4U9E A;  4D4X A;  3GAN A;  2IXM A;  2NSF A;  3N0T A;  1ZW2 A;  2P0N A;  2G3K A;  2XXA B;  1MQV A;  1OW6 A;  4J7Y A;  3M4C A;  2QLA A;  1AVO B;  1BBH A;  3B29 A;  4KNV A;  1E85 A;  2XLD A;  1LS4 A;  3EJN A;  4MTO A;  3GM2 A;  2J9U A;  5E2Q A;  3U2L A;  4A2N B;  1A41 A;  2NG1 A;  4JEA A;  1E83 A;  2KC3 A;  2HSB A;  1WGW A;  2HZ8 A;  3C7J A;  1I4Y A;  1GGQ A;  5KYW B;  2YLG A;  3EZH A;  2YL1 A;  3EHN A;  4NCQ A;  4O79 A;  4AE4 B;  2P61 A;  2OU6 A;  1SZI A;  3W4Y A;  2RSE B;  1G8X A;  4NQF A;  1OR2 A;  3AG3 C;  3B0U X;  4C3B A;  4E7S A;  1QKR A;  2KQ9 A;  4PFP A;  1T01 A;  3T4R A;  1TWH A;  3UMK A;  3KH2 A;  2A0U A;  3TOM A;  5TJ5 E;  3RQE A;  1L7C A;  1Q0G A;  2FAP B;  4P6I C;  2OCC C;  4CS9 A;  1VB5 A;  3AG2 C;  3K7D A;  4EBB A;  3GM1 A;  4J7T A;  1CGO A;  1OXB A;  4PFO A;  2O9X A;  3S0X A;  3FDQ A;  4JJF A;  3BEH A;  4KBL A;  5DLJ A;  2DB4 A;  5JRA A;  2R7U A;  5F5F A;  3SXZ A;  4GYT A;  3SEO A;  3TK0 A;  2LIG A;  2YZS A;  1WAS A;  2J46 A;  3N24 A;  3GM3 A;  5FZT A;  2HS5 A;  2KJG A;  3R7C A;  2A68 F;  3ZG1 A;  4DVY P;  1CGM E;  2OQM A;  2KW3 C;  3K1I C;  3A9C A;  4I1O B;  3FAP B;  3POV A;  3Q6M A;  2Y69 C;  1A7D A;  4CSA C;  4W8P A;  4LLE A;  1D1C A;  3FOO A;  3HJC A;  4LDK A;  3Q7L A;  3WHN A;  3IQ6 A;  1BZ4 A;  2R03 A;  4GQH A;  2Q4F A;  4YWQ A;  3VYW A;  5B3S C;  1BR1 A;  2ZPA A;  2EPN A;  4H4K C;  3U2M A;  2R02 A;  5L0J A;  3U9J A;  1VLT A;  1BDJ B;  1JPJ A;  2L9J A;  2XL6 A;  5JLI A;  1HY5 A;  3CSK A;  3KYI A;  2WB7 A;  1EI7 A;  5D92 A;  1ORS C;  3KYJ A;  3AQB A;  4L6R A;  4BJ6 A;  3RH3 A;  4FWV A;  1XWJ A;  1ZHX A;  1YA9 A;  2XLM A;  4G78 A;  1L3P A;  2IXO A;  4YL1 A;  2Y3G A;  3HNK A;  4K7B A;  4E18 A;  1ZYR F;  3L0I A;  5T3T A;  2KNH A;  5JSL A;  4IRU A;  1C02 A;  2ETS A;  3HTK C;  3LEO A;  4NTB A;  3DI5 A;  2ICW G;  3DAF A;  1A7E A;  2IXP A;  1C03 A;  1HE9 A;  1ORJ A;  5L0I A;  2R7S A;  3B0V C;  2OEV A;  2QUP A;  4G0H A;  1S05 A;  4Q5S F;  1T6U A;  1YAU O;  5KYU B;  1E2X A;  1NLX A;  1SR2 A;  2LFD A;  3PDM P;  2CNW A;  5DS4 A;  2CNW D;  1ZHT A;  2H7O A;  3KMI A;  3QTH A;  4IAO A;  2GDC A;  3T6J A;  4XLN F;  2AU5 A;  4JTC B;  2LCH A;  1R4T A;  3LNR A;  2VCA A;  3C8G A;  5JP7 A;  1WOL A;  3C8G D;  1YVI A;  1V4A A;  3JT1 A;  4JC7 A;  4U5E E;  4XWJ A;  2M64 A;  3GOR A;  4ZLD A;  1LVK A;  4WAB A;  1G4W R;  5KYX B;  2Q00 A;  2W45 A;  3IQT A;  2XXA A;  1OQC A;  2E87 A;  3HKK A;  4MTG A;  1YAR O;  1T6I A;  3JYH A;  4U5B E;  5D91 A;  1O3U A;  1Z7Q c;  2J45 A;  3ASO C;  2XL8 A;  3U3B A;  4BJT A;  1KTM A;  3HNI A;  5BQH A;  3DZA A;  3VF0 A;  4CS8 C;  2HMZ A;  1D0Z A;  1ZZP A;  2UUI A;  2EIJ C;  4XPX A;  2RD9 A;  2XLH A;  4EBK A;  5A6K A;  2R7W A;  3JSE O;  4ONS A;  1WN0 A;  3L8I A;  2R9R B;  1VYK A;  2WVN A;  5KYX A;  3AGU A;  3TQO A;  2PFD A;  3UMI A;  1LI5 A;  1MND A;  2W4M A;  2HV7 A;  2XLE A;  4MVR A;  2IBF A;  2PNO A;  1WAT A;  3M15 A;  4I44 A;  3GEI A;  2QY9 A;  3RKO F;  3ABM C;  1Y6D A;  2DGJ A;  1ZHZ A;  4Z9H A;  3B0P A;  4OIN F;  1Z6A A;  2H8A A;  5L0G A;  4OIO F;  3QVZ A;  4MVM A;  1J8Y F;  1JRA A;  3EH1 A;  3DKA A;  5CI8 A;  2XM0 A;  3IEE A;  2OJE D;  3DAG A;  3NRH A;  3W2W A;  1M2V A;  4ANJ A;  4KI2 A;  5L0D A;  3UGO A;  2H7V C;  3IQC A;  3JZ0 A;  3IPM O;  3ABK C;  4YN0 B;  5EK0 A;  3AG1 C;  5AC4 A;  1V74 B;  2G3V A;  3RIP A;  1G5Z A;  2P7V A;  1M57 C;  1WTY A;  2GAQ A;  1JMW A;  3DM5 A;  3KL4 A;  2WVO A;  3X1O A;  2D5R B;  1UG7 A;  1ST6 A;  3GEH A;  1RKC A;  3TD7 A;  1NBB A;  1RJ9 B;  5COG A;  1U0B B;  4YT8 A;  2NUT B;  3HNL A;  1FR0 A;  1QSP A;  2XS1 A;  3I5P A;  4G7Z F;  4Z9I A;  4QDL A;  3TJ5 A;  2YL3 A;  1H9T A;  3QZC A;  4QI0 A;  4XLP F;  2BL2 A;  2R7R A;  2LSE A;  3GWL A;  1VTM P;  3ZTM A;  2NUP B;  3NKD A;  4I1M A;  3EZI A;  2OJQ A;  1T6Q A;  4H54 A;  2VCC A;  2XM4 A;  2EPK X;  3F47 A;  3MYI A;  1MMD A;  4WGZ A;  4G7H F;  1MNE A;  1HW1 A;  1CPQ A;  1SYQ A;  2WZL A;  5KYY B;  1ZHY A;  3U8V A;  1O5H A;  5B1A C;  3U9M A;  4CJG A;  3DE8 A;  1CPR A;  4XEF A;  5GPG B;  3SP1 A;  3WOD F;  1S7Z A;  3LLK A;  1OKK A;  3FXH A;  2CCY A;  3JTL O;  1OKK D;  3NYJ A;  4YT5 A;  2OKU A;  3WAQ A;  5HV9 A;  1DOV A;  3GEE A;  3L34 A;  5KYW A;  3S84 A;  4ULW A;  4N4W A;  4AE4 A;  3DXJ F;  4HE8 D;  4N6C A;  3H2V A;  3JSZ A;  1ZU5 A;  1H9G A;  1T9K A;  4U5H A;  1QLE C;  3V7O A;  2R05 A;  4BJ5 C;  1MMN A;  2CGE A;  2MWQ A;  3NMK A;  3H2U A;  4ZLC A;  4CBE A;  4IGG A;  5A69 A;  4MVS A;  3TJ6 A;  1IW7 F;  3DJN B;  3A11 A;  3I5Q A;  1OCC C;  3NKE A;  1LKX A;  2ZXP A;  4MTF A;  4O6N A;  4DRJ B;  3L1M A;  4YT4 A;  5B3I A;  1HE1 A;  5IY5 C;  3EGX B;  2HJ3 A;  1LIH A;  3SNH A;  4DVZ A;  3LS1 A;  4N6H A;  2WL8 A;  3MFN A;  1OXK A;  2AWY A;  2XS8 A;  3NG1 A;  1NFO A;  1HW2 A;  4U5C E;  2J9V A;  5F28 E;  1FTS A;  4JTA B;  1JR8 A;  3RFY A;  2CW0 F;  4JZA A;  4PK4 A;  2KYH A;  2J8W A;  4CSA A;  4RD9 A;  3AG4 C;  3U3F A;  1VMA A;  2R7T A;  4BG0 A;  2XLW A;  3NYL A;  1OCZ C;  4J30 B;  5E3A A;  3J06 A;  2C03 A;  3PCV A;  3JRM O;  3K1H A;  4DRH B;  1YZA A;  2JPU A;  2X51 A;  4XTK A;  4EIY A;  3LAY A;  3ZDL A;  2EPO A;  2G62 A;  2LP4 A;  4OD4 A;  1E86 A;  3FVY A;  3RW0 A;  4P9F A;  2EIM C;  1EA8 A;  4MW8 A;  1O87 A;  4PR9 A;  2I8B A;  1QPU A;  1RKE B;  2NSG A;  3S28 A;  5FCL A;  2L81 A;  4UDV A;  4WJ0 A;  4AX2 A;  2ZXO A;  1DOW A;  2L6G A;  4DRI B;  5B1B C;  2Q9A A;  2BE5 F;  4BEM J;  3T9O A;  4KNW A;  2YQY A;  1XZP A;  4PJM A;  5BUO A;  1PD1 A;  1OCO C;  1Z3I X;  1U89 A;  2A6H F;  2EPM X;  4YL0 A;  2J0W A;  2J0X A;  3EQL F;  4IAQ A;  2B0J A;  4LAC B;  4DBR A;  5L3V A;  4ULV A;  4CJO A;  3AJM A;  4PAC A;  4E0H A;  3RYL A;  4G7O F;  3M4B A;  2R25 A;  4E0I A;  2FGY A;  5CIV A;  4E17 A;  3IQ5 A;  4MW3 A;  3DE9 A;  3W8H A;  5AGF A;  2A1D D;  4K1O A;  4MVU A;  5DS6 A;  2HUJ A;  2EIL C;  4O7G A;  3ABL C;  3O6X A;  4PJJ A;  5L0F A;  2AVK A;  2AP3 A;  5KYU A;  3RVY A;  3O39 A;  3SXM A;  3DD7 A;  3C8Z A;  4O6Y A;  2P1A A;  1TWG A;  2V26 A;  4U5F E;  1ZW3 A;  5A6A A;  3C18 A;  3Q6N A;  1YZC A;  1V54 C;  1K40 A;  4HEA J;  1PD0 A;  3O10 A;  1Z23 A;  1XZQ A;  2Y3H A;  1YLM A;  3X2Q C;  4C3D A;  4MS2 A;  3SXY A;  3KPH A;  3L8J A;  3S90 A;  4C7O B;  1JPN A;  3HLZ A;  2C04 A;  1YYX A;  3G4Z A;  4OIP F;  3EFO B;  3RQF A;  2VAS A;  4DBQ A;  5KYN A;  3QW0 A;  4MVO A;  5L3Q A;  1ZHW A;  3B71 A;  3LEV A;  4C3E A;  4XEV A;  5T3W A;  2LQG A;  3CQZ A;  1C17 M;  3I4U A;  3VM6 A;  2A0B A;  2KGO A;  3MX3 A;  1Z63 A;  2PX0 A;  3NDB B;  4U9D A;  4XQ1 A;  4MQ9 F;  3VRC A;  4C7O A;  1BR2 A;  2R7O A;  1NG1 A;  3CAX A;  5K0I A;  3K6B A;  5AC5 A;  3NMJ A;  4QI2 A;  1TWC A;  3PMR A;  3E70 C;  3O55 A;  4CDY A;  2GFH A;  3TOL A;  1IZM A;  4JUR I;  1ZU4 A;  2Q9B A;  4RBN A;  4CS7 A;  4E7Z A;  3AGT A;  1OW7 A;  2J7P A;  4OIR F;  2J7P D;  2XL4 A;  3WG7 C;  2XLV A;  3UNG C;  2HV6 A;  2IOQ A;  2DI3 A;  2F22 A;  3EG9 B;  2CYD A;  3EGD B;  2IXN A;  1QQ3 A;  2UUH A;  5F5H A;  1Q0F A;  1SF8 A;  3ZSU A;  4EUK B;  2YEV A;  2PP4 A;  3ZTZ A;  3N2Z B;  3LJB A;  2QNL A;  1GQA A;  1PV3 A;  4DOZ A;  3LLI A;  1OR3 A;  2Y3D A;  2EIN C;  1LS1 A;  1YA7 O;  3ATP A;  3LES A;  1H6G A;  4NC3 A;  2J9B A;  1RJ9 A;  4J32 B;  2HSQ A;  2EIK C;  1W2W A;  2I15 A;  3LS0 A;  2NUT A;  1I4Z A;  2JD3 A;  1ORY A;  4IWB A;  1YDI A;  5COM A;  5DQZ A;  2WZF A;  3OEO A;  4JJG A;  4KC9 A;  3U5S A;  2ASR A;  1HMD A;  4JW1 A;  2Q3T A;  3B9Q A;  4OD5 A;  4NTF A;  2NUP A;  2NPU A;  4MVQ A;  1BR4 A;  1N1C A;  1Y4C A;  1B68 A;  3MLG A;  3GOD A;  3MBG A;  2VCB A;  3ZIB A;  4F4B A;  3G4X A;  2XRH A;  3DM9 B;  3DMD A;  1GM5 A;  3JRT A;  1TKN A;  5KYY A;  1J8M F;  3U8P A;  3UR3 C;  3ITF A;  1I5N A;  4ER9 A;  4CIH A;  1RXQ A;  3BRJ A;  2VB6 A;  2Q7R A;  4AL0 A;  1M2O A;  2XLO A;  3G50 A;  3SZR A;  3W8I A;  5JS5 A;  3K66 A;  5JT4 A;  3IHU A;  4HFK B;  4BJ5 A;  1A7V A;  1FMV A;  1QVX A;  3DWW A;  4N06 A;  4FAP B;  4LLC A;  5L0C A;  1D1A A;  1LM3 B;  2B0H A;  2EPL X;  2L6H A;  3M79 A;  3S27 A;  3S29 A;  4CS9 C;  2VH3 A;  1VLS A;  2ZD9 A;  3GWN A;  3K1I A;  3QMK A;  1JOG A;  1M56 C;  4JE9 A;  3LUT B;  2LFF A;  4YJW A;  3RQG A;  2QTV A;  5DS5 A;  1A0B A;  5HSW A;  3LNM B;  3JCU Q;  3FAJ A;  1QZX A;  3RVZ A;  3QVY A;  3H65 A;  1APC A;  4B6I A;  4CX9 A;  2HJM A;  4JTD B;  3W2V A;  2LD6 A;  1VOM A;  4NTA A;  4AL1 A;  1FNT c;  3KKB A;  3EGX A;  3MYF A;  2X0C A;  5JVE A;  4CDV A;  2MYS A;  1OW8 A;  1FFH A;  2H7B A;  2KSF A;  3C63 A;  4P9T A;  2Y3B A;  4EKW A;  4X0R A;  1WWP A;  3OWT A;  2YVK A;  3R2P A;  1NU9 C;  3M1C B;  1E84 A; 
#chains in the Genus database with same CATH homology
 3V5Y A;  3U9M A;  3CAX A;  3U9J A;  2P0N A;  3V5Z A;  3V5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...