3U9JA

Crystal structure of oxidized human fbxl5 hemerythrin like domain
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
157
structure length
157
Chain Sequence
FPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box/LRR-repeat protein 5
publication title The Structural Basis of Iron Sensing by the Human F-box Protein FBXL5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 59
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3u9jA00
3V5XA 3V5ZA 3U9MA 3U9JA 2P0NA 3CAXA 3V5YA
chains in the Genus database with same CATH superfamily
3TK0A 3GEEA 3U3BA 4XEKA 3ZIBA 2UUIA 3QVZA 5A6JA 2L6GA 2OOCA 2CNWA 1LI5A 2KGOA 3RVZA 3ZTZA 5EK0A 5E2QA 2KK1A 2V26A 1CGME 5DQTA 1OCZC 1A0BA 2OCCC 4EUKB 4JCHA 3DE9A 5BUOA 1RXQA 3J06A 3O39A 2XM0A 4I1OB 4BJ1A 3K33A 4ULWA 2OKUA 4K0DA 4NCQA 3LAYA 3R7CA 1JPJA 5B3IA 2GDCA 2DYRC 2KW3C 5E3AA 1YA9A 3R2PA 1UFBA 1V4AA 1I5NA 3DKAA 1EA8A 3H65A 3DMDA 4BJ6A 5TJ5E 4E7SA 2A68F 3RIPA 4GQHA 2B0HA 2P7VA 4O79A 1CGOA 4MVQA 2YL7A 2XS1A 3CZ6A 3POVA 1R4TA 1OW8A 1D0YA 1VK5A 4NQFA 2ZXWC 3HTKC 1F1MA 2HSBA 4MW3A 3NDBB 4N06A 4XPXA 4QDLA 1ZZPA 4E0HA 2R7WA 2L9JA 1ST6A 4EWCA 1FTSA 4C3BA 2CYDA 4RDAA 3GWNA 4R32A 3K1IC 2KYHA 4QI2A 3X1OA 4U5DE 5COGA 1BR2A 3M15A 2VCAA 1HW2A 3EPVA 2E87A 1W2WA 3C8ZA 4OD5A 2EPNA 1Q0KA 4U9EA 1ZHXA 3ZVRA 3EG9A 3V5ZA 3RH3A 5BQHA 3HJCA 4BPMA 2EIKC 3TJ5A 2C03A 4AE4B 1Z3IX 3MLGA 256BA 2Y69C 2ZXRA 3T6BA 4YT8A 4PFOA 2XLDA 4XEVA 2HUJA 3UMKA 2NUPB 2LIGA 3B29A 3QVYA 2YLIA 4JZAA 2GFHA 4DBRA 3S90A 1RMVA 5CI8A 4YT5A 3AGUA 2HSQA 3SP1A 4RD9A 5T3TA 4WGZA 4J32B 5JT4A 4JIOA 1OCCC 1VYIA 2FGYA 4MTFA 3W2WA 4A2NB 2VB6A 2WZFA 2EIJC 2IYLD 1A7DA 5KYNA 3DJNB 2W4MA 1PV3A 4PJNA 2IXMA 4JEBA 4BJ5C 3U2LA 1C17M 1NG1A 3CEXA 3IHUA 1H6GA 5D91A 2R03A 1M2VA 2PFDA 4EBJA 2G3VA 1XWJA 1ZU5A 1CGNA 1UG7A 4FESA 3RVYA 3V7OA 1NFOA 1ORYA 4IGGA 1Z23A 2MHRA 1Q0MA 1WASA 4WABA 3G4XA 3KYIA 3GEIA 1WWPA 2EPLX 3EHMA 4LDKA 1JAFA 1SF8A 1RCPA 4CS7A 4DXWA 3BEHA 3U5SA 3C18A 4OIOF 1U89A 2AWYA 3S0XA 2XS8A 5COMA 4B6IA 1FFHA 3MFNA 1D0XA 5DS5A 3U3FA 1APCA 2YZSA 1MMGA 3GANA 4YJWA 2RSEB 3FHDA 3DAFA 3CSKA 3LEVA 4U9DA 4PK4A 1FR0A 2C04A 3F47A 3NYJA 5L0JA 1Z7Qc 1J8MF 4ZLCA 3RQFA 4N4WA 4GYTA 5KYWB 1RJ9A 3FXHA 1OXKA 1QSPA 3UR3C 3FMSA 3JCUQ 2QE9A 2MYSA 2YHSA 3EGXB 3JRTA 3LJBA 2DB4A 2VH3A 1NBBA 4HFKB 1O87A 3SXKA 3W8HA 4FAPB 1YVIA 2XLEA 1OCRC 2WB7A 2ASRA 3DAGA 4DJ9A 4PJJA 3DI5A 2EIMC 4OIRF 3HNJA 5JS5A 2R02A 2RD9A 4G0HA 2LQGA 4BEJA 2D4UA 3M4BA 4O6NA 1VLSA 2ZXOA 3AQCA 4KNWA 3S29A 4CDVA 4O6YA 3U9JA 5AC5A 2P0NA 3O10A 5FZTA 1QQ3A 4N6HA 4JURI 1NLXA 2XL4A 1MMAA 3FVYA 3IQCA 4NTFA 4J30B 1Q0DA 3A9CA 4MTOA 4JC7A 3US6A 3AOUA 3DM9B 1XZQA 1Q0FA 2J7PD 5A6AA 3EGDA 1E86A 3UMHA 5F5HA 5L0DA 3ABMC 3JTLO 4O6MA 4YT2A 1MMNA 4BJTA 1YZAA 1A41A 3RW0A 2XLWA 3AG2C 3KKBA 3LS0A 2DYSC 4MVZA 1G5ZA 4C3EA 2AWCA 3NKDA 2Y3BA 1T6QA 1D0ZA 4K7BA 1SR2A 2CCYA 2L6HA 1Z6AA 2CW0F 3CQZA 4XPWA 3SXYA 5L0GA 4BJ5A 1SYQA 2A6HF 3KPHA 1QZXA 1VB5A 2ZD9A 4IB4A 1E83A 3LS1A 1E85A 1Z63A 1TFKB 1Q0GA 4DRJB 2W9YA 2YL1A 4Q4ZF 2HV7A 2F22A 2I15A 1JRAA 2XL6A 4E17A 5GPGB 5AC4A 3HNIA 4M63A 4C7OA 4UDVA 4U5HA 2HJ3A 1H9GA 1QKRA 2DGJA 3EH1A 3GM1A 1PD1A 3RKOF 4EIYA 2IXPA 1SMYF 1A7VA 2J8WA 4U5GA 3M79A 4E18A 2AU5A 3E9VA 2TMVP 2OQMA 2YWAA 3DZAA 4C7OB 3JYYA 3FDQA 5EGYA 4A4AA 1T9KA 2XLVA 3ABKC 2PBEA 3EG9B 3S9OA 1D1BA 3KYJA 4DVZA 4EBBA 3DE8A 2LD6A 1O5HA 4PACA 4CJGA 3OWTA 2G62A 2PX3A 2VC9A 4PJMA 4W8PA 3ASOC 3JRMO 4OD4A 4Q5SF 1NU7D 3DJUB 2IOQA 2Y3HA 4AL0A 4D4NA 4J7YA 3NKEA 4BG0A 5KYUB 1ZYRF 1YARO 4XTKA 1E2XA 4YL1A 5JP7A 4CDYA 3EZIA 3DXJF 2H7BA 4YWQA 2A0UA 1AEPA 1HW1A 2GA0A 3ZTMA 1D1CA 1LM3B 2BE5F 2J46A 2OU6A 4BEMJ 1YLMA 4XEFA 2P6VA 4PFPA 3RQGA 1N1CA 2Y3GA 2NUTA 3IPMO 2Q9BA 4JJFA 3Q7LA 5F28E 4CDAA 1ZU4A 3RFYA 4U5EE 4ER9A 1LPEA 1A7EA 3ECSA 2XLOA 3FAPB 4LERA 4W8KA 1ZHZA 3O6XA 1K04A 1M2VB 1T5OA 3ZWIA 4CS8C 3JSEO 2QTVA 3C8GD 2AVKA 2LCHA 2KQ9A 2QLAA 1YJGA 4QI0A 5DVWA 3PDMP 2XSEA 2M4EA 1EKYA 3EFOA 5DQZA 3UGOA 1E84A 1U0BB 5CI9A 2XXAA 3GM3A 2H7OA 4L6RA 4AX2A 2XLMA 3VF0A 1OCOC 5A69A 2PP4A 4NTAA 1TQGA 3EHNA 4MNDA 5KYXA 2R05A 2Q7RA 1ZHYA 3L1MA 4E7ZA 1PCXA 4LACB 5HV9A 2YL3A 1LVKA 4JCZA 4P9TA 2J9BA 4JRZA 2H8AA 4LLEA 1BZ4A 3B71A 3T6JA 2HZ8A 2R7UA 1TWCA 3NYLA 3LESA 2DI3A 1R5ID 4G78A 4H54A 4IAOA 3EZHA 1GQAA 4JVSA 5A6BD 1EQ1A 2EINC 2Z15A 1K05A 2VCBA 3AJMA 1MNDA 3EJNA 3K1HA 4HE8D 4YL3A 3E70C 1S05A 1CPQA 1G8XA 1RJ9B 3PCVA 4MQ9F 5L0FA 2R7TA 2YEVA 2R9RB 3GEHA 4Z9IA 5E3CA 1BR1A 2R7OA 1J8YF 5EHHA 2W45A 5T3WA 3VRCA 2VCCA 4DVYP 4IRUA 3KL4A 2A1DD 1AVOB 1IW7F 1WATA 2UUHA 4JTAB 2R25A 3B0VC 2D5RB 3JT1A 3MYIA 4P6IC 3OEOA 1YDIA 3GM2A 2XL8A 1YA7O 3X2QC 1RKEA 1L3PA 3O55A 1TFOB 3H2VA 2P1AA 1D1AA 1TWHA 2NPUA 4JE9A 3RF3A 1HY5A 1OQCA 4CIHA 2YLDA 3QW1A 2BL2A 3U8VA 3ZC4A 4EHPA 2NSFA 1OKKD 4MVRA 3KH2A 3L8IA 1ORJA 4XPYA 3V5XA 4AL1A 2MWQA 3EGDB 2ETSA 3QW0A 5K0IA 1M57C 2HMQA 5BQIA 5B1AC 1HE1A 4P9FA 1FMWA 4IAQA 4KBLA 1O3UA 2Q3TA 3V5YA 2Q00A 1MMDA 1BBHA 1LE2A 2NSGA 4CJOA 2J9WA 5JUAA 3NMKA 1ZVZA 1ZW2A 2O9XA 2GWWA 5L0HA 4RBNA 1H9TA 1Y4CA 3Q6MA 1C03A 3QMKA 1SZIA 2LFDA 2X51A 3MBGA 5BQGA 3SXZA 3TOLA 4CS8A 3MYFA 3B0PA 1JR8A 1JPNA 2FAPB 2L81A 4CSAA 3WODF 2QY9A 5JLIA 3BRJA 4EKWA 2WL8A 3S27A 1L7CA 3U9MA 2QNLA 2YKZA 1DOVA 1PD0A 1KNYA 1TWAA 4LDRA 3G4ZA 4FWVA 3MX3A 2JPUA 1YYJA 4LDQA 5F5FA 4MVOA 2R7XA 4ONSA 4NY3A 3QTHA 3Q7GA 4X0RA 2CGEA 4HEAJ 3PHF2 1I4YA 2G3KA 4XWJA 5KYYA 4U5CE 5DS4A 3NRHA 4OIQF 2HFIA 1QPUA 3W8IA 1WN0A 2WVNA 3C8GA 3M4CA 3GORA 2M64A 2ICWG 3TOMA 3M1CB 2PX0A 5L0CA 1LKXA 3Q6NA 2B0JA 3K6BA 1HMDA 1VMAA 3K66A 1LS4A 1BR4A 1ZHTA 2J9VA 3G50A 2PF4E 1YZCA 2HJMA 4ULVA 4O7GA 4AK9A 4EBKA 3TQOA 3AG4C 2HMZA 3T9OA 1HMOA 2AP3A 3T4RA 1C02A 3UMIA 1M2OA 1YYXA 4IWBA 4U5BE 1YAUO 2NUTB 3L8JA 3JSZA 1RKCA 5T1DB 4I44A 3WHNA 3F46A 5A6BA 2WZLA 2Q9AA 2H7VC 3U2MA 3B0UX 5KYUA 1GS9A 2XRHA 2Y39A 4JTDB 2KNHA 3JYHA 5DS6A 4MS2A 1M6TA 3WAQA 4ZLDA 2JX0A 5D92A 4MTGA 3ABLC 2FFHA 3K7DA 4CS9C 2J45A 3RYLA 1M56C 1NFNA 2LK4A 1ZHWA 2OJED 1I4ZA 1LI7A 2Q4FA 4F4BA 1VTMP 1DOWA 3NMJA 3EFOB 3HKKA 3LLKA 4HFFB 3S28A 1IZMA 3C7JA 4JKVA 5CIVA 2XXAB 2J9UA 5A6KA 4CSAC 1NZEA 5KYXB 2IXOA 3C62A 3IQ5A 4Z9HA 3IQ6A 2R7SA 2LP4A 3AGTA 2EPMX 2VASA 4LLCA 4C3DA 2CDQA 3HNLA 4YN0B 5DLJA 3EH2A 2YLGA 1EI7A 2EPOA 2L6FA 1VOMA 3ASNC 3NYMA 1OKKA 1LS1A 4JEAA 4WGYA 4WJ0A 3VM6A 3EQLF 4MVSA 3AQBA 1HE9A 3S84A 1MNEA 2YQYA 3ZSUA 1TKNA 2WZGA 2QUPA 3FOPA 1K40A 3VAYA 1OW6A 4GEHA 1T01A 2CNWD 5E33A 2OEVA 4IJJA 4DBQA 2YL0A 1B68A 3N0TA 2JD3A 5JRAA 1QLEC 3HNKA 4DRHB 2XLHA 3DD7A 1CPRA 3IQTA 1AUEA 4KC9A 4NTBA 1T6UA 5B3SC 1WOLA 1JMWA 2IBFA 3N2ZB 4J7TA 2L7AA 4JJGA 4XQ1A 3ZG1A 1GM5A 1U6HA 2R7QA 3SZRA 2EILC 1KU2A 1RKEB 2HV6A 1TR2A 2J7PA 3OA1A 3DWWA 4G7ZF 4NC3A 3RQEA 1LE4A 2LFFA 3JZ0A 2W4BA 3SXMA 3W4YA 2I8BA 1GGQA 2KC3A 5JSLA 2IXNA 1FFTC 1OR3A 3T6GB 2EPKX 5AGFA 4Z9JA 3U8PA 3AG3C 3HLZA 3KMIA 4AE4A 2KJGA 2A69F 3LUTB 1Z5ZA 2ZPAA 4N6CA 4YT4A 1Y6DA 3NMIA 4MVUA 3CAXA 2KSFA 5HSWA 3FAJA 2ZXPA 1MQVA 1WGWA 1WTYA 2NUPA 4H4KC 3GWLA 2GAQA 3NG1A 3ATPA 4XLNF 3SEOA 3ZDLA 3ZQYA 4DRIB 1FAPB 2OEXA 3H2UA 3QZCA 2LSEA 1VLTA 2X0CA 1OXBA 1H7IA 2OJQA 3L34A 1V54C 4OINF 3SYNA 3TD7A 4U5FE 4CS9A 3TULA 4BJ6C 4XLPF 3DM5A 1FNTc 2OG2A 1NU9C 2Y3DA 4PJLA 3TJ6A 4IARA 4G7OF 5FCLA 1G4US 2YVKA 3ZQVA 3L0IA 1KTMA 1ORSC 5JVEA 3I5PA 3SNHA 1LIHA 3LEOA 1XZPA 3U0CA 1FMVA 2IM8A 4Q7CA 1OR2A 3UGPA 3LNMB 4DOZA 4D4XA 3K1IA 4MW8A 4MVMA 3WG7C 4CBEA 4CX9A 3I5QA 4ANJA 4G7HF 3FOOA 1JOGA 3IEEA 5COFA 5KYYB 4JW1A 1NSGB 3VYWA 4I1MA 5L3QA 3C8GB 2PNOA 4YL0A 1G4WR 2YRFA 3C63A 2WVQA 2WVOA 2A0BA 1ZW3A 3LLIA 2R7RA 3ITFA 4I3MA 3AG1C 1TWGA 1T6IA 1V55C 3I4UA 1VYKA 5B1BC 2V3CC 3UNGC 3A11A 4KI2A 2J0WA 2XM4A 5IY5C 2J0XA 4OIPF 1BDJB 2HKVA 2HS5A 2P61A 3PMRA 4E0IA 2Q9CA 3GODA 1QVXA 2NG1A 2R7VA 5KYWA 4JTCB 5L0IA 4K1OA 2BC5A 1S7ZA 3B9QA 3EGXA 1V74B 4FX5A 1OW7A 2A6EF 4PR9A 4YK5A 3LNRA 3N24A 4KNVA 5L3VA 4CIPA 3W2VA
chains in the Genus database with same CATH topology
3V5XA 3V5ZA 3U9MA 3U9JA 2P0NA 3CAXA 3V5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5X A;  3V5Z A;  3U9M A;  3U9J A;  2P0N A;  3CAX A;  3V5Y A; 
#chains in the Genus database with same CATH topology
 3TK0 A;  3GEE A;  3U3B A;  4XEK A;  3ZIB A;  2UUI A;  3QVZ A;  5A6J A;  2L6G A;  2OOC A;  2CNW A;  1LI5 A;  2KGO A;  3RVZ A;  3ZTZ A;  5EK0 A;  5E2Q A;  2KK1 A;  2V26 A;  1CGM E;  5DQT A;  1OCZ C;  1A0B A;  2OCC C;  4EUK B;  4JCH A;  3DE9 A;  5BUO A;  1RXQ A;  3J06 A;  3O39 A;  2XM0 A;  4I1O B;  4BJ1 A;  3K33 A;  4ULW A;  2OKU A;  4K0D A;  4NCQ A;  3LAY A;  3R7C A;  1JPJ A;  5B3I A;  2GDC A;  2DYR C;  2KW3 C;  5E3A A;  1YA9 A;  3R2P A;  1UFB A;  1V4A A;  1I5N A;  3DKA A;  1EA8 A;  3H65 A;  3DMD A;  4BJ6 A;  5TJ5 E;  4E7S A;  2A68 F;  3RIP A;  4GQH A;  2B0H A;  2P7V A;  4O79 A;  1CGO A;  4MVQ A;  2YL7 A;  2XS1 A;  3CZ6 A;  3POV A;  1R4T A;  1OW8 A;  1D0Y A;  1VK5 A;  4NQF A;  2ZXW C;  3HTK C;  1F1M A;  2HSB A;  4MW3 A;  3NDB B;  4N06 A;  4XPX A;  4QDL A;  1ZZP A;  4E0H A;  2R7W A;  2L9J A;  1ST6 A;  4EWC A;  1FTS A;  4C3B A;  2CYD A;  4RDA A;  3GWN A;  4R32 A;  3K1I C;  2KYH A;  4QI2 A;  3X1O A;  4U5D E;  5COG A;  1BR2 A;  3M15 A;  2VCA A;  1HW2 A;  3EPV A;  2E87 A;  1W2W A;  3C8Z A;  4OD5 A;  2EPN A;  1Q0K A;  4U9E A;  1ZHX A;  3ZVR A;  3EG9 A;  3V5Z A;  3RH3 A;  5BQH A;  3HJC A;  4BPM A;  2EIK C;  3TJ5 A;  2C03 A;  4AE4 B;  1Z3I X;  3MLG A;  256B A;  2Y69 C;  2ZXR A;  3T6B A;  4YT8 A;  4PFO A;  2XLD A;  4XEV A;  2HUJ A;  3UMK A;  2NUP B;  2LIG A;  3B29 A;  3QVY A;  2YLI A;  4JZA A;  2GFH A;  4DBR A;  3S90 A;  1RMV A;  5CI8 A;  4YT5 A;  3AGU A;  2HSQ A;  3SP1 A;  4RD9 A;  5T3T A;  4WGZ A;  4J32 B;  5JT4 A;  4JIO A;  1OCC C;  1VYI A;  2FGY A;  4MTF A;  3W2W A;  4A2N B;  2VB6 A;  2WZF A;  2EIJ C;  2IYL D;  1A7D A;  5KYN A;  3DJN B;  2W4M A;  1PV3 A;  4PJN A;  2IXM A;  4JEB A;  4BJ5 C;  3U2L A;  1C17 M;  1NG1 A;  3CEX A;  3IHU A;  1H6G A;  5D91 A;  2R03 A;  1M2V A;  2PFD A;  4EBJ A;  2G3V A;  1XWJ A;  1ZU5 A;  1CGN A;  1UG7 A;  4FES A;  3RVY A;  3V7O A;  1NFO A;  1ORY A;  4IGG A;  1Z23 A;  2MHR A;  1Q0M A;  1WAS A;  4WAB A;  3G4X A;  3KYI A;  3GEI A;  1WWP A;  2EPL X;  3EHM A;  4LDK A;  1JAF A;  1SF8 A;  1RCP A;  4CS7 A;  4DXW A;  3BEH A;  3U5S A;  3C18 A;  4OIO F;  1U89 A;  2AWY A;  3S0X A;  2XS8 A;  5COM A;  4B6I A;  1FFH A;  3MFN A;  1D0X A;  5DS5 A;  3U3F A;  1APC A;  2YZS A;  1MMG A;  3GAN A;  4YJW A;  2RSE B;  3FHD A;  3DAF A;  3CSK A;  3LEV A;  4U9D A;  4PK4 A;  1FR0 A;  2C04 A;  3F47 A;  3NYJ A;  5L0J A;  1Z7Q c;  1J8M F;  4ZLC A;  3RQF A;  4N4W A;  4GYT A;  5KYW B;  1RJ9 A;  3FXH A;  1OXK A;  1QSP A;  3UR3 C;  3FMS A;  3JCU Q;  2QE9 A;  2MYS A;  2YHS A;  3EGX B;  3JRT A;  3LJB A;  2DB4 A;  2VH3 A;  1NBB A;  4HFK B;  1O87 A;  3SXK A;  3W8H A;  4FAP B;  1YVI A;  2XLE A;  1OCR C;  2WB7 A;  2ASR A;  3DAG A;  4DJ9 A;  4PJJ A;  3DI5 A;  2EIM C;  4OIR F;  3HNJ A;  5JS5 A;  2R02 A;  2RD9 A;  4G0H A;  2LQG A;  4BEJ A;  2D4U A;  3M4B A;  4O6N A;  1VLS A;  2ZXO A;  3AQC A;  4KNW A;  3S29 A;  4CDV A;  4O6Y A;  3U9J A;  5AC5 A;  2P0N A;  3O10 A;  5FZT A;  1QQ3 A;  4N6H A;  4JUR I;  1NLX A;  2XL4 A;  1MMA A;  3FVY A;  3IQC A;  4NTF A;  4J30 B;  1Q0D A;  3A9C A;  4MTO A;  4JC7 A;  3US6 A;  3AOU A;  3DM9 B;  1XZQ A;  1Q0F A;  2J7P D;  5A6A A;  3EGD A;  1E86 A;  3UMH A;  5F5H A;  5L0D A;  3ABM C;  3JTL O;  4O6M A;  4YT2 A;  1MMN A;  4BJT A;  1YZA A;  1A41 A;  3RW0 A;  2XLW A;  3AG2 C;  3KKB A;  3LS0 A;  2DYS C;  4MVZ A;  1G5Z A;  4C3E A;  2AWC A;  3NKD A;  2Y3B A;  1T6Q A;  1D0Z A;  4K7B A;  1SR2 A;  2CCY A;  2L6H A;  1Z6A A;  2CW0 F;  3CQZ A;  4XPW A;  3SXY A;  5L0G A;  4BJ5 A;  1SYQ A;  2A6H F;  3KPH A;  1QZX A;  1VB5 A;  2ZD9 A;  4IB4 A;  1E83 A;  3LS1 A;  1E85 A;  1Z63 A;  1TFK B;  1Q0G A;  4DRJ B;  2W9Y A;  2YL1 A;  4Q4Z F;  2HV7 A;  2F22 A;  2I15 A;  1JRA A;  2XL6 A;  4E17 A;  5GPG B;  5AC4 A;  3HNI A;  4M63 A;  4C7O A;  4UDV A;  4U5H A;  2HJ3 A;  1H9G A;  1QKR A;  2DGJ A;  3EH1 A;  3GM1 A;  1PD1 A;  3RKO F;  4EIY A;  2IXP A;  1SMY F;  1A7V A;  2J8W A;  4U5G A;  3M79 A;  4E18 A;  2AU5 A;  3E9V A;  2TMV P;  2OQM A;  2YWA A;  3DZA A;  4C7O B;  3JYY A;  3FDQ A;  5EGY A;  4A4A A;  1T9K A;  2XLV A;  3ABK C;  2PBE A;  3EG9 B;  3S9O A;  1D1B A;  3KYJ A;  4DVZ A;  4EBB A;  3DE8 A;  2LD6 A;  1O5H A;  4PAC A;  4CJG A;  3OWT A;  2G62 A;  2PX3 A;  2VC9 A;  4PJM A;  4W8P A;  3ASO C;  3JRM O;  4OD4 A;  4Q5S F;  1NU7 D;  3DJU B;  2IOQ A;  2Y3H A;  4AL0 A;  4D4N A;  4J7Y A;  3NKE A;  4BG0 A;  5KYU B;  1ZYR F;  1YAR O;  4XTK A;  1E2X A;  4YL1 A;  5JP7 A;  4CDY A;  3EZI A;  3DXJ F;  2H7B A;  4YWQ A;  2A0U A;  1AEP A;  1HW1 A;  2GA0 A;  3ZTM A;  1D1C A;  1LM3 B;  2BE5 F;  2J46 A;  2OU6 A;  4BEM J;  1YLM A;  4XEF A;  2P6V A;  4PFP A;  3RQG A;  1N1C A;  2Y3G A;  2NUT A;  3IPM O;  2Q9B A;  4JJF A;  3Q7L A;  5F28 E;  4CDA A;  1ZU4 A;  3RFY A;  4U5E E;  4ER9 A;  1LPE A;  1A7E A;  3ECS A;  2XLO A;  3FAP B;  4LER A;  4W8K A;  1ZHZ A;  3O6X A;  1K04 A;  1M2V B;  1T5O A;  3ZWI A;  4CS8 C;  3JSE O;  2QTV A;  3C8G D;  2AVK A;  2LCH A;  2KQ9 A;  2QLA A;  1YJG A;  4QI0 A;  5DVW A;  3PDM P;  2XSE A;  2M4E A;  1EKY A;  3EFO A;  5DQZ A;  3UGO A;  1E84 A;  1U0B B;  5CI9 A;  2XXA A;  3GM3 A;  2H7O A;  4L6R A;  4AX2 A;  2XLM A;  3VF0 A;  1OCO C;  5A69 A;  2PP4 A;  4NTA A;  1TQG A;  3EHN A;  4MND A;  5KYX A;  2R05 A;  2Q7R A;  1ZHY A;  3L1M A;  4E7Z A;  1PCX A;  4LAC B;  5HV9 A;  2YL3 A;  1LVK A;  4JCZ A;  4P9T A;  2J9B A;  4JRZ A;  2H8A A;  4LLE A;  1BZ4 A;  3B71 A;  3T6J A;  2HZ8 A;  2R7U A;  1TWC A;  3NYL A;  3LES A;  2DI3 A;  1R5I D;  4G78 A;  4H54 A;  4IAO A;  3EZH A;  1GQA A;  4JVS A;  5A6B D;  1EQ1 A;  2EIN C;  2Z15 A;  1K05 A;  2VCB A;  3AJM A;  1MND A;  3EJN A;  3K1H A;  4HE8 D;  4YL3 A;  3E70 C;  1S05 A;  1CPQ A;  1G8X A;  1RJ9 B;  3PCV A;  4MQ9 F;  5L0F A;  2R7T A;  2YEV A;  2R9R B;  3GEH A;  4Z9I A;  5E3C A;  1BR1 A;  2R7O A;  1J8Y F;  5EHH A;  2W45 A;  5T3W A;  3VRC A;  2VCC A;  4DVY P;  4IRU A;  3KL4 A;  2A1D D;  1AVO B;  1IW7 F;  1WAT A;  2UUH A;  4JTA B;  2R25 A;  3B0V C;  2D5R B;  3JT1 A;  3MYI A;  4P6I C;  3OEO A;  1YDI A;  3GM2 A;  2XL8 A;  1YA7 O;  3X2Q C;  1RKE A;  1L3P A;  3O55 A;  1TFO B;  3H2V A;  2P1A A;  1D1A A;  1TWH A;  2NPU A;  4JE9 A;  3RF3 A;  1HY5 A;  1OQC A;  4CIH A;  2YLD A;  3QW1 A;  2BL2 A;  3U8V A;  3ZC4 A;  4EHP A;  2NSF A;  1OKK D;  4MVR A;  3KH2 A;  3L8I A;  1ORJ A;  4XPY A;  3V5X A;  4AL1 A;  2MWQ A;  3EGD B;  2ETS A;  3QW0 A;  5K0I A;  1M57 C;  2HMQ A;  5BQI A;  5B1A C;  1HE1 A;  4P9F A;  1FMW A;  4IAQ A;  4KBL A;  1O3U A;  2Q3T A;  3V5Y A;  2Q00 A;  1MMD A;  1BBH A;  1LE2 A;  2NSG A;  4CJO A;  2J9W A;  5JUA A;  3NMK A;  1ZVZ A;  1ZW2 A;  2O9X A;  2GWW A;  5L0H A;  4RBN A;  1H9T A;  1Y4C A;  3Q6M A;  1C03 A;  3QMK A;  1SZI A;  2LFD A;  2X51 A;  3MBG A;  5BQG A;  3SXZ A;  3TOL A;  4CS8 A;  3MYF A;  3B0P A;  1JR8 A;  1JPN A;  2FAP B;  2L81 A;  4CSA A;  3WOD F;  2QY9 A;  5JLI A;  3BRJ A;  4EKW A;  2WL8 A;  3S27 A;  1L7C A;  3U9M A;  2QNL A;  2YKZ A;  1DOV A;  1PD0 A;  1KNY A;  1TWA A;  4LDR A;  3G4Z A;  4FWV A;  3MX3 A;  2JPU A;  1YYJ A;  4LDQ A;  5F5F A;  4MVO A;  2R7X A;  4ONS A;  4NY3 A;  3QTH A;  3Q7G A;  4X0R A;  2CGE A;  4HEA J;  3PHF 2;  1I4Y A;  2G3K A;  4XWJ A;  5KYY A;  4U5C E;  5DS4 A;  3NRH A;  4OIQ F;  2HFI A;  1QPU A;  3W8I A;  1WN0 A;  2WVN A;  3C8G A;  3M4C A;  3GOR A;  2M64 A;  2ICW G;  3TOM A;  3M1C B;  2PX0 A;  5L0C A;  1LKX A;  3Q6N A;  2B0J A;  3K6B A;  1HMD A;  1VMA A;  3K66 A;  1LS4 A;  1BR4 A;  1ZHT A;  2J9V A;  3G50 A;  2PF4 E;  1YZC A;  2HJM A;  4ULV A;  4O7G A;  4AK9 A;  4EBK A;  3TQO A;  3AG4 C;  2HMZ A;  3T9O A;  1HMO A;  2AP3 A;  3T4R A;  1C02 A;  3UMI A;  1M2O A;  1YYX A;  4IWB A;  4U5B E;  1YAU O;  2NUT B;  3L8J A;  3JSZ A;  1RKC A;  5T1D B;  4I44 A;  3WHN A;  3F46 A;  5A6B A;  2WZL A;  2Q9A A;  2H7V C;  3U2M A;  3B0U X;  5KYU A;  1GS9 A;  2XRH A;  2Y39 A;  4JTD B;  2KNH A;  3JYH A;  5DS6 A;  4MS2 A;  1M6T A;  3WAQ A;  4ZLD A;  2JX0 A;  5D92 A;  4MTG A;  3ABL C;  2FFH A;  3K7D A;  4CS9 C;  2J45 A;  3RYL A;  1M56 C;  1NFN A;  2LK4 A;  1ZHW A;  2OJE D;  1I4Z A;  1LI7 A;  2Q4F A;  4F4B A;  1VTM P;  1DOW A;  3NMJ A;  3EFO B;  3HKK A;  3LLK A;  4HFF B;  3S28 A;  1IZM A;  3C7J A;  4JKV A;  5CIV A;  2XXA B;  2J9U A;  5A6K A;  4CSA C;  1NZE A;  5KYX B;  2IXO A;  3C62 A;  3IQ5 A;  4Z9H A;  3IQ6 A;  2R7S A;  2LP4 A;  3AGT A;  2EPM X;  2VAS A;  4LLC A;  4C3D A;  2CDQ A;  3HNL A;  4YN0 B;  5DLJ A;  3EH2 A;  2YLG A;  1EI7 A;  2EPO A;  2L6F A;  1VOM A;  3ASN C;  3NYM A;  1OKK A;  1LS1 A;  4JEA A;  4WGY A;  4WJ0 A;  3VM6 A;  3EQL F;  4MVS A;  3AQB A;  1HE9 A;  3S84 A;  1MNE A;  2YQY A;  3ZSU A;  1TKN A;  2WZG A;  2QUP A;  3FOP A;  1K40 A;  3VAY A;  1OW6 A;  4GEH A;  1T01 A;  2CNW D;  5E33 A;  2OEV A;  4IJJ A;  4DBQ A;  2YL0 A;  1B68 A;  3N0T A;  2JD3 A;  5JRA A;  1QLE C;  3HNK A;  4DRH B;  2XLH A;  3DD7 A;  1CPR A;  3IQT A;  1AUE A;  4KC9 A;  4NTB A;  1T6U A;  5B3S C;  1WOL A;  1JMW A;  2IBF A;  3N2Z B;  4J7T A;  2L7A A;  4JJG A;  4XQ1 A;  3ZG1 A;  1GM5 A;  1U6H A;  2R7Q A;  3SZR A;  2EIL C;  1KU2 A;  1RKE B;  2HV6 A;  1TR2 A;  2J7P A;  3OA1 A;  3DWW A;  4G7Z F;  4NC3 A;  3RQE A;  1LE4 A;  2LFF A;  3JZ0 A;  2W4B A;  3SXM A;  3W4Y A;  2I8B A;  1GGQ A;  2KC3 A;  5JSL A;  2IXN A;  1FFT C;  1OR3 A;  3T6G B;  2EPK X;  5AGF A;  4Z9J A;  3U8P A;  3AG3 C;  3HLZ A;  3KMI A;  4AE4 A;  2KJG A;  2A69 F;  3LUT B;  1Z5Z A;  2ZPA A;  4N6C A;  4YT4 A;  1Y6D A;  3NMI A;  4MVU A;  3CAX A;  2KSF A;  5HSW A;  3FAJ A;  2ZXP A;  1MQV A;  1WGW A;  1WTY A;  2NUP A;  4H4K C;  3GWL A;  2GAQ A;  3NG1 A;  3ATP A;  4XLN F;  3SEO A;  3ZDL A;  3ZQY A;  4DRI B;  1FAP B;  2OEX A;  3H2U A;  3QZC A;  2LSE A;  1VLT A;  2X0C A;  1OXB A;  1H7I A;  2OJQ A;  3L34 A;  1V54 C;  4OIN F;  3SYN A;  3TD7 A;  4U5F E;  4CS9 A;  3TUL A;  4BJ6 C;  4XLP F;  3DM5 A;  1FNT c;  2OG2 A;  1NU9 C;  2Y3D A;  4PJL A;  3TJ6 A;  4IAR A;  4G7O F;  5FCL A;  1G4U S;  2YVK A;  3ZQV A;  3L0I A;  1KTM A;  1ORS C;  5JVE A;  3I5P A;  3SNH A;  1LIH A;  3LEO A;  1XZP A;  3U0C A;  1FMV A;  2IM8 A;  4Q7C A;  1OR2 A;  3UGP A;  3LNM B;  4DOZ A;  4D4X A;  3K1I A;  4MW8 A;  4MVM A;  3WG7 C;  4CBE A;  4CX9 A;  3I5Q A;  4ANJ A;  4G7H F;  3FOO A;  1JOG A;  3IEE A;  5COF A;  5KYY B;  4JW1 A;  1NSG B;  3VYW A;  4I1M A;  5L3Q A;  3C8G B;  2PNO A;  4YL0 A;  1G4W R;  2YRF A;  3C63 A;  2WVQ A;  2WVO A;  2A0B A;  1ZW3 A;  3LLI A;  2R7R A;  3ITF A;  4I3M A;  3AG1 C;  1TWG A;  1T6I A;  1V55 C;  3I4U A;  1VYK A;  5B1B C;  2V3C C;  3UNG C;  3A11 A;  4KI2 A;  2J0W A;  2XM4 A;  5IY5 C;  2J0X A;  4OIP F;  1BDJ B;  2HKV A;  2HS5 A;  2P61 A;  3PMR A;  4E0I A;  2Q9C A;  3GOD A;  1QVX A;  2NG1 A;  2R7V A;  5KYW A;  4JTC B;  5L0I A;  4K1O A;  2BC5 A;  1S7Z A;  3B9Q A;  3EGX A;  1V74 B;  4FX5 A;  1OW7 A;  2A6E F;  4PR9 A;  4YK5 A;  3LNR A;  3N24 A;  4KNV A;  5L3V A;  4CIP A;  3W2V A; 
#chains in the Genus database with same CATH homology
 3V5X A;  3V5Z A;  3U9M A;  3U9J A;  2P0N A;  3CAX A;  3V5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...