3U9JA

Crystal structure of oxidized human fbxl5 hemerythrin like domain
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
157
structure length
157
Chain Sequence
FPEEVDVFTAPHWRMKQLVGLYCDKLSKTNFSNNNDFRALLQSLYATFKEFKMHEQIENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKERLEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-box/LRR-repeat protein 5
publication title The Structural Basis of Iron Sensing by the Human F-box Protein FBXL5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 59
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01814 Hemerythrin Hemerythrin HHE cation binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.520 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) nmb1532 protein domain like 3u9jA00
3CAXA 3U9MA 3V5XA 3V5YA 2P0NA 3U9JA 3V5ZA
chains in the Genus database with same CATH superfamily
3T9OA 2MHRA 2WZLA 3L1MA 5KYWB 2P0NA 2HUJA 2MYSA 2Q9CA 2XM4A 3UR3C 2J0WA 2EPOA 1ORJA 3K1IC 3NYMA 1H9TA 3SEOA 1UG7A 2VCCA 3I4UA 4CS8C 1C03A 2YLIA 3IEEA 4NTBA 4G7HF 1PV3A 5COFA 1Y6DA 1RXQA 4QDLA 2YL7A 1MNDA 4JJFA 3C63A 1E86A 4XEVA 1RJ9A 1OKKA 1Q0MA 4YN0B 2VC9A 2D5RB 1Z6AA 4OIPF 4GYTA 3S90A 1NU9C 3EJNA 1HE1A 2PBEA 5F5FA 4DJ9A 5HV9A 1M56C 4NCQA 2EIJC 1TR2A 1TWAA 1Y4CA 3KYJA 4AL0A 4AE4B 2KYHA 1ZHYA 4PJMA 4CBEA 1Q0FA 1A7DA 2AWCA 4YJWA 2Z15A 3EZIA 2DYRC 3MLGA 4JW1A 3VAYA 4HFKB 4C7OB 4MVMA 256BA 2J46A 2HSQA 2HJMA 3EH2A 1FFHA 4XPWA 5KYXA 1GS9A 4JEAA 3CAXA 3LEOA 1OW8A 2B0HA 1LS1A 1OKKD 4I3MA 1ZYRF 4NTFA 1Z3IX 2LK4A 4ULWA 3SXKA 3SXZA 4BJ6A 5KYUB 1HW2A 1MMGA 1RKEA 1V74B 3AGUA 5AC4A 1ZHXA 2LFDA 1LE2A 5GPGB 3GANA 4C3DA 1K40A 4P6IC 1M2VA 1QQ3A 3MFNA 1VYKA 3EGDB 2UUHA 3M79A 1A0BA 1G8XA 3K1HA 4CSAA 1OR2A 1NSGB 4PK4A 3EFOB 1CPRA 1KTMA 1NLXA 4K1OA 3GM2A 3CSKA 2NUTB 4Q4ZF 1ZHZA 2HS5A 5CI9A 3WG7C 4WABA 3NYJA 2LP4A 4MVSA 1T6IA 1XZQA 5DS6A 1RMVA 3ZSUA 2ETSA 2YLDA 2OU6A 1MMNA 2Q4FA 3V7OA 1WASA 5JP7A 3W8IA 1J8MF 1PD1A 5AGFA 2OCCC 1LKXA 3RQEA 3N24A 1A7EA 3ZVRA 5COMA 3TJ6A 3DJNB 5L3QA 1SF8A 4KBLA 1Z7Qc 4C3EA 2L6GA 1ZW2A 3PHF2 3AG2C 4X0RA 4I1MA 3NKDA 3FVYA 4E18A 4Q7CA 2HZ8A 1TFOB 2J7PA 3O10A 4ULVA 3US6A 4BJ5C 5JSLA 3UMHA 3I5QA 3NRHA 1LPEA 1S7ZA 1YDIA 4MTOA 1SMYF 4CS8A 2YL0A 1OCCC 3RW0A 5JS5A 4E0IA 2A0UA 3ECSA 3KYIA 1LI7A 2HMQA 4JKVA 3GM1A 2YZSA 1W2WA 5B1BC 5AC5A 4M63A 5D92A 1Q0GA 1E2XA 1K05A 2YRFA 5E2QA 1FFTC 2EPKX 3DXJF 3G4ZA 3E9VA 3AG3C 1NFNA 1ZVZA 3MBGA 4D4NA 3E70C 2PF4E 3JRMO 1O3UA 2W4BA 3CZ6A 2DYSC 1G4WR 3SXMA 3DE9A 3JSZA 4ONSA 4KC9A 3RYLA 3HLZA 3G4XA 4LACB 2J7PD 2I15A 2YVKA 4CDAA 3B71A 4EWCA 5L0GA 3VYWA 1A41A 3JYYA 3UNGC 1OR3A 1Z23A 2ASRA 1V4AA 3GEEA 1U6HA 3DKAA 1OCRC 2ZXRA 3HNKA 3Q6MA 2H7VC 2YL3A 1H7IA 1AUEA 4DVYP 1TQGA 4YK5A 2VCBA 5A6BA 1EKYA 2BC5A 3U2LA 4MVRA 3U8VA 2R25A 4LDKA 2R7OA 3VM6A 1FMWA 1G5ZA 5EHHA 5A69A 3WAQA 1GGQA 3TOLA 4MNDA 1FAPB 1YZCA 1WATA 3Q6NA 4JZAA 3RKOF 3ZDLA 2W4MA 3ZIBA 2Y3GA 4BJ1A 2J9BA 2WVOA 1JAFA 1YLMA 4LDQA 1M2OA 3QTHA 4E7SA 1R4TA 4JRZA 1VLTA 2DGJA 2IXMA 1BR1A 4O7GA 4PFPA 3JTLO 5E3CA 2XRHA 1IW7F 5JVEA 3H65A 5HSWA 2VH3A 3I5PA 2JX0A 3DD7A 1T01A 2KJGA 1VB5A 3A11A 4IARA 4IJJA 4U5BE 5CI8A 4BPMA 5A6BD 2JD3A 3POVA 2NUPB 1RCPA 5JLIA 1G4US 3ZTZA 3QW1A 4Z9HA 3SYNA 1TWCA 3MX3A 4JURI 1V54C 4HFFB 2KK1A 3V5YA 2CW0F 3KH2A 4CIPA 4N6CA 1R5ID 3QW0A 4XQ1A 4U5HA 2B0JA 1WGWA 1OXBA 2QUPA 3X1OA 1BR2A 2C03A 2IOQA 3ASOC 1LIHA 3L8IA 4O6NA 2W45A 3IQTA 1LVKA 1YJGA 3GEHA 4HE8D 4AE4A 5T3WA 1NFOA 3NMKA 4BJ5A 3IQ5A 5DS5A 1Q0KA 2OJED 3GORA 4C7OA 1APCA 3EGXA 4MW3A 1QPUA 3DWWA 3RQGA 1AEPA 1SR2A 3C8GB 3GM3A 1YA7O 3CEXA 2FGYA 2HMZA 4D4XA 4MVUA 1YA9A 1I4ZA 4XTKA 2XS1A 1VTMP 3EHNA 3RVZA 3LLKA 2R7UA 4OD4A 3QVZA 1D1CA 1L3PA 3C8ZA 1MNEA 4JE9A 2FFHA 4NC3A 1QVXA 4XLPF 3UGOA 1QSPA 1WN0A 2AVKA 1I4YA 5L3VA 3CQZA 2AU5A 3TOMA 2HV7A 2J45A 4CS7A 1QZXA 3LEVA 1JR8A 3Q7GA 4N06A 3W2VA 3U0CA 4U5FE 3ABKC 5CIVA 2IM8A 1TWGA 3LUTB 4WJ0A 4DRIB 2XS8A 2XL8A 3QZCA 1KNYA 2YEVA 3LS0A 4G7ZF 3TQOA 4BEJA 2GA0A 1S05A 1Z63A 1U0BB 3T6GB 2XLWA 4HEAJ 5DQZA 2P7VA 3DM9B 3C7JA 3JZ0A 3RQFA 1OQCA 3M4BA 3OWTA 4OINF 4FESA 5BQHA 2ZXWC 4YT4A 1WTYA 1VMAA 1O87A 3ASNC 2IYLD 2H7OA 3H2UA 1GQAA 2EPNA 3M15A 4GQHA 4JVSA 2Y69C 3IHUA 4KI2A 3ZC4A 3FHDA 2P61A 2ZPAA 4G78A 2V3CC 1KU2A 4ZLDA 2J9VA 3SZRA 3NMIA 1RJ9B 1ZHTA 5F28E 3H2VA 4G0HA 2A69F 4LDRA 1QLEC 3FXHA 4R32A 3B29A 4YT2A 2R7VA 4XPXA 3S84A 4DVZA 4JCZA 4FX5A 5B3IA 3W4YA 4PACA 3LAYA 3C18A 3ZQVA 2FAPB 4DRHB 2XLVA 5A6JA 4MVQA 1FTSA 2EPLX 2YKZA 2PP4A 1BDJB 4C3BA 1LM3B 2QY9A 4IAOA 2D4UA 4N6HA 4JJGA 3V5ZA 1HMOA 1GM5A 3JRTA 1FR0A 2XXAA 5KYXB 1NZEA 1JMWA 2QTVA 3O6XA 1E85A 1WWPA 3EZHA 2YLGA 4PFOA 1OCOC 1PD0A 2QE9A 1RKEB 2QNLA 1ORYA 2GDCA 2P1AA 2PX3A 1C17M 3JCUQ 4GEHA 4KNWA 4MVOA 4A2NB 4CJGA 4E7ZA 2R03A 3ABLC 3S29A 4WGZA 1T5OA 3ATPA 1M2VB 4MS2A 4BG0A 3T6JA 2AWYA 3LLIA 3B0VC 2NG1A 3B0PA 3AQCA 2Q9BA 1K04A 3LESA 2GWWA 2M64A 2R05A 3N0TA 4FAPB 2Y39A 3F47A 3PCVA 2YHSA 2L6HA 2XLEA 3F46A 3GWNA 4JEBA 1HMDA 2HKVA 4EKWA 2LD6A 3EG9A 5COGA 2ZD9A 1DOVA 5TJ5E 3K7DA 4MTGA 1CPQA 2YQYA 2EILC 4NQFA 1TKNA 2G62A 4JTCB 1MMDA 3FAJA 3DJUB 3KL4A 5L0CA 5KYYB 2CYDA 1F1MA 2XLMA 3EQLF 4P9FA 2H7BA 1ZW3A 5JT4A 2P6VA 1BR4A 2CCYA 4DBQA 2XLDA 5IY5C 2EPMX 1YYXA 2AP3A 3NKEA 2YL1A 3FDQA 2A6EF 4YL1A 3EHMA 1YVIA 4Z9IA 3LNRA 4EUKB 4UDVA 4XLNF 1NU7D 3G50A 2L9JA 4YL3A 5F5HA 5DQTA 5B1AC 3VRCA 1XZPA 3Q7LA 5KYWA 2EIMC 3AGTA 2A1DD 4U5DE 2KQ9A 1D1AA 2LQGA 2XL4A 4I1OB 5DVWA 2VASA 4B6IA 3NDBB 3U3BA 5JRAA 1EI7A 5BQGA 3S27A 4AK9A 1A7VA 4O79A 1XWJA 1H6GA 1JPJA 2Q3TA 1JRAA 3GODA 1CGME 2R7TA 3NYLA 5L0FA 3ZG1A 4PJJA 4CJOA 2M4EA 4U5EE 4JTAB 3S0XA 4JCHA 2KNHA 4QI0A 4A4AA 2KSFA 4W8PA 2XLHA 4L6RA 3FMSA 3U8PA 3TJ5A 3HTKC 2KGOA 3HJCA 1V55C 3KPHA 1CGOA 3TULA 2LFFA 4G7OF 2OOCA 3BRJA 2PFDA 4DOZA 2R7XA 3U9MA 2MWQA 3V5XA 1HY5A 2J0XA 2L6FA 3HKKA 1VK5A 3WHNA 3AOUA 4OIOF 3MYFA 1LE4A 5KYUA 4CDVA 4U9DA 4NY3A 2KC3A 1M6TA 3N2ZB 5A6KA 2WZGA 4JIOA 5E33A 2WVQA 3DAGA 3B9QA 3IPMO 3VF0A 1FNTc 3LJBA 2R7RA 3WODF 4EBKA 4OIQF 2A0BA 3TK0A 4CS9C 1NBBA 3NMJA 3EGDA 1ORSC 3DZAA 2R9RB 3T4RA 5K0IA 4J32B 1E83A 1M57C 2VCAA 4IAQA 3J06A 3EFOA 3HNLA 2L81A 4XWJA 3T6BA 3K66A 1EA8A 1D0XA 2NUTA 2DB4A 2F22A 2Y3BA 1DOWA 4RDAA 5D91A 3QVYA 3ZTMA 5L0HA 2X51A 2DI3A 2HV6A 4PJNA 5DLJA 5A6AA 3RVYA 2J8WA 2HFIA 2ZXPA 3JSEO 1UFBA 2GFHA 3M1CB 3UMKA 3W2WA 2IXNA 1T9KA 4MW8A 2V26A 4JTDB 3X2QC 2EIKC 2OEXA 2BE5F 4IB4A 1YAUO 4J7TA 4PR9A 4XPYA 2O9XA 4YT5A 4MQ9F 4RBNA 3SXYA 4YT8A 5EGYA 5FCLA 3B0UX 5DS4A 4CDYA 3EGXB 4Q5SF 1B68A 1VYIA 1WOLA 2L7AA 3FOPA 3TD7A 4CIHA 3PDMP 3FOOA 4IWBA 1AVOB 1BBHA 3QMKA 2RSEB 5FZTA 2R02A 3W8HA 1JOGA 3L8JA 1E84A 1PCXA 2HSBA 1ZHWA 2IXOA 3IQCA 4FWVA 2H8AA 4K7BA 2OKUA 3C62A 4AX2A 5L0DA 5KYNA 4U5GA 5T1DB 1YZAA 2Y3HA 2LCHA 2XL6A 2I8BA 2OG2A 3AJMA 4IRUA 5JUAA 4U9EA 4AL1A 3L34A 1J8YF 2UUIA 3GEIA 1CGNA 4XEFA 3ABMC 1OW7A 4RD9A 2OQMA 3UMIA 4W8KA 4MVZA 1T6UA 3KMIA 4MTFA 3EPVA 4O6YA 4ANJA 1YYJA 2CGEA 3DM5A 3O39A 1RKCA 2CDQA 1YARO 4J30B 4LLCA 3JYHA 4DRJB 4EIYA 2CNWA 2IBFA 3DMDA 5KYYA 1OXKA 2EINC 3ZWIA 3AG4C 2R7WA 1HE9A 2NPUA 4JC7A 3HNIA 4XEKA 1OCZC 1OW6A 2Q9AA 2KW3C 2J9WA 1D0ZA 1VOMA 4BEMJ 4O6MA 4OD5A 2XM0A 3OEOA 2E87A 2NSFA 2W9YA 4CS9A 3S28A 1FMVA 2ZXOA 1MQVA 3DI5A 2HJ3A 1VLSA 2Y3DA 3K1IA 3K6BA 5T3TA 4DXWA 1MMAA 1HW1A 5EK0A 4N4WA 4H4KC 4WGYA 2XSEA 1T6QA 4BJTA 4QI2A 4H54A 2CNWD 1SZIA 4KNVA 3R2PA 2VB6A 1TFKB 2JPUA 1ZZPA 3R7CA 4I44A 1ST6A 3AG1C 4IGGA 4OIRF 1H9GA 1I5NA 2IXPA 1Q0DA 2NUPA 4J7YA 3RF3A 3DAFA 3EH1A 3HNJA 3U2MA 2LSEA 2YWAA 4CX9A 4ZLCA 3A9CA 5L0IA 3K33A 2XXAB 3O55A 3OA1A 3U5SA 3KKBA 3RH3A 3NG1A 4K0DA 4LLEA 2A68F 1D0YA 2XLOA 2G3KA 1LS4A 2NSGA 4U5CE 3U3FA 4EBJA 4YWQA 3DE8A 3RIPA 2WL8A 3LS1A 4EHPA 2GAQA 1D1BA 2QLAA 4YL0A 5B3SC 1C02A 3SNHA 4BJ6C 1SYQA 2PNOA 4F4BA 4EBBA 4LERA 2RD9A 2BL2A 4PJLA 3S9OA 1L7CA 1TWHA 3C8GA 2X0CA 2R7QA 3U9JA 2C04A 2J9UA 1N1CA 4DBRA 2Q00A 5E3AA 3ZQYA 4CSAC 3AQBA 4P9TA 2OJQA 3EG9B 3JT1A 2WZFA 2A6HF 1BZ4A 4NTAA 3IQ6A 3MYIA 3L0IA 1NG1A 2Q7RA 5BUOA 5L0JA 1QKRA 3BEHA 1EQ1A 2WB7A 1O5HA 2WVNA 5BQIA 1JPNA 1Z5ZA 3M4CA 4Z9JA 3LNMB 2R7SA 1ZU5A 3ITFA 2G3VA 2LIGA 3PMRA 4E17A 1U89A 2OEVA 3C8GD 3UGPA 4E0HA 3RFYA 1LI5A 2TMVP 2PX0A 3SP1A 3FAPB 3GWLA 1ZU4A 2ICWG 4ER9A 1IZMA
chains in the Genus database with same CATH topology
3CAXA 3U9MA 3V5XA 3V5YA 2P0NA 3U9JA 3V5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CAX A;  3U9M A;  3V5X A;  3V5Y A;  2P0N A;  3U9J A;  3V5Z A; 
#chains in the Genus database with same CATH topology
 3T9O A;  2MHR A;  2WZL A;  3L1M A;  5KYW B;  2P0N A;  2HUJ A;  2MYS A;  2Q9C A;  2XM4 A;  3UR3 C;  2J0W A;  2EPO A;  1ORJ A;  3K1I C;  3NYM A;  1H9T A;  3SEO A;  1UG7 A;  2VCC A;  3I4U A;  4CS8 C;  1C03 A;  2YLI A;  3IEE A;  4NTB A;  4G7H F;  1PV3 A;  5COF A;  1Y6D A;  1RXQ A;  4QDL A;  2YL7 A;  1MND A;  4JJF A;  3C63 A;  1E86 A;  4XEV A;  1RJ9 A;  1OKK A;  1Q0M A;  4YN0 B;  2VC9 A;  2D5R B;  1Z6A A;  4OIP F;  4GYT A;  3S90 A;  1NU9 C;  3EJN A;  1HE1 A;  2PBE A;  5F5F A;  4DJ9 A;  5HV9 A;  1M56 C;  4NCQ A;  2EIJ C;  1TR2 A;  1TWA A;  1Y4C A;  3KYJ A;  4AL0 A;  4AE4 B;  2KYH A;  1ZHY A;  4PJM A;  4CBE A;  1Q0F A;  1A7D A;  2AWC A;  4YJW A;  2Z15 A;  3EZI A;  2DYR C;  3MLG A;  4JW1 A;  3VAY A;  4HFK B;  4C7O B;  4MVM A;  256B A;  2J46 A;  2HSQ A;  2HJM A;  3EH2 A;  1FFH A;  4XPW A;  5KYX A;  1GS9 A;  4JEA A;  3CAX A;  3LEO A;  1OW8 A;  2B0H A;  1LS1 A;  1OKK D;  4I3M A;  1ZYR F;  4NTF A;  1Z3I X;  2LK4 A;  4ULW A;  3SXK A;  3SXZ A;  4BJ6 A;  5KYU B;  1HW2 A;  1MMG A;  1RKE A;  1V74 B;  3AGU A;  5AC4 A;  1ZHX A;  2LFD A;  1LE2 A;  5GPG B;  3GAN A;  4C3D A;  1K40 A;  4P6I C;  1M2V A;  1QQ3 A;  3MFN A;  1VYK A;  3EGD B;  2UUH A;  3M79 A;  1A0B A;  1G8X A;  3K1H A;  4CSA A;  1OR2 A;  1NSG B;  4PK4 A;  3EFO B;  1CPR A;  1KTM A;  1NLX A;  4K1O A;  3GM2 A;  3CSK A;  2NUT B;  4Q4Z F;  1ZHZ A;  2HS5 A;  5CI9 A;  3WG7 C;  4WAB A;  3NYJ A;  2LP4 A;  4MVS A;  1T6I A;  1XZQ A;  5DS6 A;  1RMV A;  3ZSU A;  2ETS A;  2YLD A;  2OU6 A;  1MMN A;  2Q4F A;  3V7O A;  1WAS A;  5JP7 A;  3W8I A;  1J8M F;  1PD1 A;  5AGF A;  2OCC C;  1LKX A;  3RQE A;  3N24 A;  1A7E A;  3ZVR A;  5COM A;  3TJ6 A;  3DJN B;  5L3Q A;  1SF8 A;  4KBL A;  1Z7Q c;  4C3E A;  2L6G A;  1ZW2 A;  3PHF 2;  3AG2 C;  4X0R A;  4I1M A;  3NKD A;  3FVY A;  4E18 A;  4Q7C A;  2HZ8 A;  1TFO B;  2J7P A;  3O10 A;  4ULV A;  3US6 A;  4BJ5 C;  5JSL A;  3UMH A;  3I5Q A;  3NRH A;  1LPE A;  1S7Z A;  1YDI A;  4MTO A;  1SMY F;  4CS8 A;  2YL0 A;  1OCC C;  3RW0 A;  5JS5 A;  4E0I A;  2A0U A;  3ECS A;  3KYI A;  1LI7 A;  2HMQ A;  4JKV A;  3GM1 A;  2YZS A;  1W2W A;  5B1B C;  5AC5 A;  4M63 A;  5D92 A;  1Q0G A;  1E2X A;  1K05 A;  2YRF A;  5E2Q A;  1FFT C;  2EPK X;  3DXJ F;  3G4Z A;  3E9V A;  3AG3 C;  1NFN A;  1ZVZ A;  3MBG A;  4D4N A;  3E70 C;  2PF4 E;  3JRM O;  1O3U A;  2W4B A;  3CZ6 A;  2DYS C;  1G4W R;  3SXM A;  3DE9 A;  3JSZ A;  4ONS A;  4KC9 A;  3RYL A;  3HLZ A;  3G4X A;  4LAC B;  2J7P D;  2I15 A;  2YVK A;  4CDA A;  3B71 A;  4EWC A;  5L0G A;  3VYW A;  1A41 A;  3JYY A;  3UNG C;  1OR3 A;  1Z23 A;  2ASR A;  1V4A A;  3GEE A;  1U6H A;  3DKA A;  1OCR C;  2ZXR A;  3HNK A;  3Q6M A;  2H7V C;  2YL3 A;  1H7I A;  1AUE A;  4DVY P;  1TQG A;  4YK5 A;  2VCB A;  5A6B A;  1EKY A;  2BC5 A;  3U2L A;  4MVR A;  3U8V A;  2R25 A;  4LDK A;  2R7O A;  3VM6 A;  1FMW A;  1G5Z A;  5EHH A;  5A69 A;  3WAQ A;  1GGQ A;  3TOL A;  4MND A;  1FAP B;  1YZC A;  1WAT A;  3Q6N A;  4JZA A;  3RKO F;  3ZDL A;  2W4M A;  3ZIB A;  2Y3G A;  4BJ1 A;  2J9B A;  2WVO A;  1JAF A;  1YLM A;  4LDQ A;  1M2O A;  3QTH A;  4E7S A;  1R4T A;  4JRZ A;  1VLT A;  2DGJ A;  2IXM A;  1BR1 A;  4O7G A;  4PFP A;  3JTL O;  5E3C A;  2XRH A;  1IW7 F;  5JVE A;  3H65 A;  5HSW A;  2VH3 A;  3I5P A;  2JX0 A;  3DD7 A;  1T01 A;  2KJG A;  1VB5 A;  3A11 A;  4IAR A;  4IJJ A;  4U5B E;  5CI8 A;  4BPM A;  5A6B D;  2JD3 A;  3POV A;  2NUP B;  1RCP A;  5JLI A;  1G4U S;  3ZTZ A;  3QW1 A;  4Z9H A;  3SYN A;  1TWC A;  3MX3 A;  4JUR I;  1V54 C;  4HFF B;  2KK1 A;  3V5Y A;  2CW0 F;  3KH2 A;  4CIP A;  4N6C A;  1R5I D;  3QW0 A;  4XQ1 A;  4U5H A;  2B0J A;  1WGW A;  1OXB A;  2QUP A;  3X1O A;  1BR2 A;  2C03 A;  2IOQ A;  3ASO C;  1LIH A;  3L8I A;  4O6N A;  2W45 A;  3IQT A;  1LVK A;  1YJG A;  3GEH A;  4HE8 D;  4AE4 A;  5T3W A;  1NFO A;  3NMK A;  4BJ5 A;  3IQ5 A;  5DS5 A;  1Q0K A;  2OJE D;  3GOR A;  4C7O A;  1APC A;  3EGX A;  4MW3 A;  1QPU A;  3DWW A;  3RQG A;  1AEP A;  1SR2 A;  3C8G B;  3GM3 A;  1YA7 O;  3CEX A;  2FGY A;  2HMZ A;  4D4X A;  4MVU A;  1YA9 A;  1I4Z A;  4XTK A;  2XS1 A;  1VTM P;  3EHN A;  3RVZ A;  3LLK A;  2R7U A;  4OD4 A;  3QVZ A;  1D1C A;  1L3P A;  3C8Z A;  1MNE A;  4JE9 A;  2FFH A;  4NC3 A;  1QVX A;  4XLP F;  3UGO A;  1QSP A;  1WN0 A;  2AVK A;  1I4Y A;  5L3V A;  3CQZ A;  2AU5 A;  3TOM A;  2HV7 A;  2J45 A;  4CS7 A;  1QZX A;  3LEV A;  1JR8 A;  3Q7G A;  4N06 A;  3W2V A;  3U0C A;  4U5F E;  3ABK C;  5CIV A;  2IM8 A;  1TWG A;  3LUT B;  4WJ0 A;  4DRI B;  2XS8 A;  2XL8 A;  3QZC A;  1KNY A;  2YEV A;  3LS0 A;  4G7Z F;  3TQO A;  4BEJ A;  2GA0 A;  1S05 A;  1Z63 A;  1U0B B;  3T6G B;  2XLW A;  4HEA J;  5DQZ A;  2P7V A;  3DM9 B;  3C7J A;  3JZ0 A;  3RQF A;  1OQC A;  3M4B A;  3OWT A;  4OIN F;  4FES A;  5BQH A;  2ZXW C;  4YT4 A;  1WTY A;  1VMA A;  1O87 A;  3ASN C;  2IYL D;  2H7O A;  3H2U A;  1GQA A;  2EPN A;  3M15 A;  4GQH A;  4JVS A;  2Y69 C;  3IHU A;  4KI2 A;  3ZC4 A;  3FHD A;  2P61 A;  2ZPA A;  4G78 A;  2V3C C;  1KU2 A;  4ZLD A;  2J9V A;  3SZR A;  3NMI A;  1RJ9 B;  1ZHT A;  5F28 E;  3H2V A;  4G0H A;  2A69 F;  4LDR A;  1QLE C;  3FXH A;  4R32 A;  3B29 A;  4YT2 A;  2R7V A;  4XPX A;  3S84 A;  4DVZ A;  4JCZ A;  4FX5 A;  5B3I A;  3W4Y A;  4PAC A;  3LAY A;  3C18 A;  3ZQV A;  2FAP B;  4DRH B;  2XLV A;  5A6J A;  4MVQ A;  1FTS A;  2EPL X;  2YKZ A;  2PP4 A;  1BDJ B;  4C3B A;  1LM3 B;  2QY9 A;  4IAO A;  2D4U A;  4N6H A;  4JJG A;  3V5Z A;  1HMO A;  1GM5 A;  3JRT A;  1FR0 A;  2XXA A;  5KYX B;  1NZE A;  1JMW A;  2QTV A;  3O6X A;  1E85 A;  1WWP A;  3EZH A;  2YLG A;  4PFO A;  1OCO C;  1PD0 A;  2QE9 A;  1RKE B;  2QNL A;  1ORY A;  2GDC A;  2P1A A;  2PX3 A;  1C17 M;  3JCU Q;  4GEH A;  4KNW A;  4MVO A;  4A2N B;  4CJG A;  4E7Z A;  2R03 A;  3ABL C;  3S29 A;  4WGZ A;  1T5O A;  3ATP A;  1M2V B;  4MS2 A;  4BG0 A;  3T6J A;  2AWY A;  3LLI A;  3B0V C;  2NG1 A;  3B0P A;  3AQC A;  2Q9B A;  1K04 A;  3LES A;  2GWW A;  2M64 A;  2R05 A;  3N0T A;  4FAP B;  2Y39 A;  3F47 A;  3PCV A;  2YHS A;  2L6H A;  2XLE A;  3F46 A;  3GWN A;  4JEB A;  1HMD A;  2HKV A;  4EKW A;  2LD6 A;  3EG9 A;  5COG A;  2ZD9 A;  1DOV A;  5TJ5 E;  3K7D A;  4MTG A;  1CPQ A;  2YQY A;  2EIL C;  4NQF A;  1TKN A;  2G62 A;  4JTC B;  1MMD A;  3FAJ A;  3DJU B;  3KL4 A;  5L0C A;  5KYY B;  2CYD A;  1F1M A;  2XLM A;  3EQL F;  4P9F A;  2H7B A;  1ZW3 A;  5JT4 A;  2P6V A;  1BR4 A;  2CCY A;  4DBQ A;  2XLD A;  5IY5 C;  2EPM X;  1YYX A;  2AP3 A;  3NKE A;  2YL1 A;  3FDQ A;  2A6E F;  4YL1 A;  3EHM A;  1YVI A;  4Z9I A;  3LNR A;  4EUK B;  4UDV A;  4XLN F;  1NU7 D;  3G50 A;  2L9J A;  4YL3 A;  5F5H A;  5DQT A;  5B1A C;  3VRC A;  1XZP A;  3Q7L A;  5KYW A;  2EIM C;  3AGT A;  2A1D D;  4U5D E;  2KQ9 A;  1D1A A;  2LQG A;  2XL4 A;  4I1O B;  5DVW A;  2VAS A;  4B6I A;  3NDB B;  3U3B A;  5JRA A;  1EI7 A;  5BQG A;  3S27 A;  4AK9 A;  1A7V A;  4O79 A;  1XWJ A;  1H6G A;  1JPJ A;  2Q3T A;  1JRA A;  3GOD A;  1CGM E;  2R7T A;  3NYL A;  5L0F A;  3ZG1 A;  4PJJ A;  4CJO A;  2M4E A;  4U5E E;  4JTA B;  3S0X A;  4JCH A;  2KNH A;  4QI0 A;  4A4A A;  2KSF A;  4W8P A;  2XLH A;  4L6R A;  3FMS A;  3U8P A;  3TJ5 A;  3HTK C;  2KGO A;  3HJC A;  1V55 C;  3KPH A;  1CGO A;  3TUL A;  2LFF A;  4G7O F;  2OOC A;  3BRJ A;  2PFD A;  4DOZ A;  2R7X A;  3U9M A;  2MWQ A;  3V5X A;  1HY5 A;  2J0X A;  2L6F A;  3HKK A;  1VK5 A;  3WHN A;  3AOU A;  4OIO F;  3MYF A;  1LE4 A;  5KYU A;  4CDV A;  4U9D A;  4NY3 A;  2KC3 A;  1M6T A;  3N2Z B;  5A6K A;  2WZG A;  4JIO A;  5E33 A;  2WVQ A;  3DAG A;  3B9Q A;  3IPM O;  3VF0 A;  1FNT c;  3LJB A;  2R7R A;  3WOD F;  4EBK A;  4OIQ F;  2A0B A;  3TK0 A;  4CS9 C;  1NBB A;  3NMJ A;  3EGD A;  1ORS C;  3DZA A;  2R9R B;  3T4R A;  5K0I A;  4J32 B;  1E83 A;  1M57 C;  2VCA A;  4IAQ A;  3J06 A;  3EFO A;  3HNL A;  2L81 A;  4XWJ A;  3T6B A;  3K66 A;  1EA8 A;  1D0X A;  2NUT A;  2DB4 A;  2F22 A;  2Y3B A;  1DOW A;  4RDA A;  5D91 A;  3QVY A;  3ZTM A;  5L0H A;  2X51 A;  2DI3 A;  2HV6 A;  4PJN A;  5DLJ A;  5A6A A;  3RVY A;  2J8W A;  2HFI A;  2ZXP A;  3JSE O;  1UFB A;  2GFH A;  3M1C B;  3UMK A;  3W2W A;  2IXN A;  1T9K A;  4MW8 A;  2V26 A;  4JTD B;  3X2Q C;  2EIK C;  2OEX A;  2BE5 F;  4IB4 A;  1YAU O;  4J7T A;  4PR9 A;  4XPY A;  2O9X A;  4YT5 A;  4MQ9 F;  4RBN A;  3SXY A;  4YT8 A;  5EGY A;  5FCL A;  3B0U X;  5DS4 A;  4CDY A;  3EGX B;  4Q5S F;  1B68 A;  1VYI A;  1WOL A;  2L7A A;  3FOP A;  3TD7 A;  4CIH A;  3PDM P;  3FOO A;  4IWB A;  1AVO B;  1BBH A;  3QMK A;  2RSE B;  5FZT A;  2R02 A;  3W8H A;  1JOG A;  3L8J A;  1E84 A;  1PCX A;  2HSB A;  1ZHW A;  2IXO A;  3IQC A;  4FWV A;  2H8A A;  4K7B A;  2OKU A;  3C62 A;  4AX2 A;  5L0D A;  5KYN A;  4U5G A;  5T1D B;  1YZA A;  2Y3H A;  2LCH A;  2XL6 A;  2I8B A;  2OG2 A;  3AJM A;  4IRU A;  5JUA A;  4U9E A;  4AL1 A;  3L34 A;  1J8Y F;  2UUI A;  3GEI A;  1CGN A;  4XEF A;  3ABM C;  1OW7 A;  4RD9 A;  2OQM A;  3UMI A;  4W8K A;  4MVZ A;  1T6U A;  3KMI A;  4MTF A;  3EPV A;  4O6Y A;  4ANJ A;  1YYJ A;  2CGE A;  3DM5 A;  3O39 A;  1RKC A;  2CDQ A;  1YAR O;  4J30 B;  4LLC A;  3JYH A;  4DRJ B;  4EIY A;  2CNW A;  2IBF A;  3DMD A;  5KYY A;  1OXK A;  2EIN C;  3ZWI A;  3AG4 C;  2R7W A;  1HE9 A;  2NPU A;  4JC7 A;  3HNI A;  4XEK A;  1OCZ C;  1OW6 A;  2Q9A A;  2KW3 C;  2J9W A;  1D0Z A;  1VOM A;  4BEM J;  4O6M A;  4OD5 A;  2XM0 A;  3OEO A;  2E87 A;  2NSF A;  2W9Y A;  4CS9 A;  3S28 A;  1FMV A;  2ZXO A;  1MQV A;  3DI5 A;  2HJ3 A;  1VLS A;  2Y3D A;  3K1I A;  3K6B A;  5T3T A;  4DXW A;  1MMA A;  1HW1 A;  5EK0 A;  4N4W A;  4H4K C;  4WGY A;  2XSE A;  1T6Q A;  4BJT A;  4QI2 A;  4H54 A;  2CNW D;  1SZI A;  4KNV A;  3R2P A;  2VB6 A;  1TFK B;  2JPU A;  1ZZP A;  3R7C A;  4I44 A;  1ST6 A;  3AG1 C;  4IGG A;  4OIR F;  1H9G A;  1I5N A;  2IXP A;  1Q0D A;  2NUP A;  4J7Y A;  3RF3 A;  3DAF A;  3EH1 A;  3HNJ A;  3U2M A;  2LSE A;  2YWA A;  4CX9 A;  4ZLC A;  3A9C A;  5L0I A;  3K33 A;  2XXA B;  3O55 A;  3OA1 A;  3U5S A;  3KKB A;  3RH3 A;  3NG1 A;  4K0D A;  4LLE A;  2A68 F;  1D0Y A;  2XLO A;  2G3K A;  1LS4 A;  2NSG A;  4U5C E;  3U3F A;  4EBJ A;  4YWQ A;  3DE8 A;  3RIP A;  2WL8 A;  3LS1 A;  4EHP A;  2GAQ A;  1D1B A;  2QLA A;  4YL0 A;  5B3S C;  1C02 A;  3SNH A;  4BJ6 C;  1SYQ A;  2PNO A;  4F4B A;  4EBB A;  4LER A;  2RD9 A;  2BL2 A;  4PJL A;  3S9O A;  1L7C A;  1TWH A;  3C8G A;  2X0C A;  2R7Q A;  3U9J A;  2C04 A;  2J9U A;  1N1C A;  4DBR A;  2Q00 A;  5E3A A;  3ZQY A;  4CSA C;  3AQB A;  4P9T A;  2OJQ A;  3EG9 B;  3JT1 A;  2WZF A;  2A6H F;  1BZ4 A;  4NTA A;  3IQ6 A;  3MYI A;  3L0I A;  1NG1 A;  2Q7R A;  5BUO A;  5L0J A;  1QKR A;  3BEH A;  1EQ1 A;  2WB7 A;  1O5H A;  2WVN A;  5BQI A;  1JPN A;  1Z5Z A;  3M4C A;  4Z9J A;  3LNM B;  2R7S A;  1ZU5 A;  3ITF A;  2G3V A;  2LIG A;  3PMR A;  4E17 A;  1U89 A;  2OEV A;  3C8G D;  3UGP A;  4E0H A;  3RFY A;  1LI5 A;  2TMV P;  2PX0 A;  3SP1 A;  3FAP B;  3GWL A;  1ZU4 A;  2ICW G;  4ER9 A;  1IZM A; 
#chains in the Genus database with same CATH homology
 3CAX A;  3U9M A;  3V5X A;  3V5Y A;  2P0N A;  3U9J A;  3V5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...