4O7GA

Crystal structure of ascorbate-bound cytochrome b561, crystal soaked in 1 m l-ascorbate for 40 minutes
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
211
structure length
211
Chain Sequence
PIFMVVRVLGFIIAALVLTWTVHYRGGLALSSDNKDHIFNVHPVMMVIGLILFNGEAMLAYKSVQGTKNLKKLVHLTLQLTAFILSLIGVWAALKFHIDKGIENFYSLHSWLGLACLFLFAFQWAAGFVTYWYPGGSRNSRASLMPWHVFLGISIYALALVTATTGILEKVTFLQVNQVITRYSTEAMLVNTMGVLILILGGFVILGVVTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable transmembrane ascorbate ferrireductase 2
publication title Structure and mechanism of a eukaryotic transmembrane ascorbate-dependent oxidoreductase
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 90
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature ec 7.2.1.3: Ascorbate ferrireductase (transmembrane).
pdb deposition date 2013-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4o7gA00
4O79A 4O6YA 4O7GA
chains in the Genus database with same CATH superfamily
4U5CE 4U9DA 1MQVA 2IXMA 3QTHA 3SP1A 3O39A 1OCRC 3UGPA 2KJGA 2J9WA 3NKEA 1SZIA 1U0BB 4P6IC 4XLNF 2HS5A 2NUTA 3U0CA 3ABLC 1K05A 1Q0FA 1T9KA 2VH3A 3DE8A 3HLZA 3MYIA 4MVOA 4OINF 1E85A 4CSAC 2P6VA 4CS7A 1OW8A 1FTSA 1QZXA 2PX0A 3C8ZA 4JEAA 4WGZA 5CIVA 3AQCA 2P1AA 3OWTA 2A1DD 3C8GA 2ZPAA 2KGOA 1H6GA 3GM3A 3EFOA 4CS9A 1H9TA 1G4US 2V3CC 2OOCA 2CW0F 4BG0A 2KW3C 4O6YA 2NSFA 3TJ5A 4E18A 3QW1A 2R9RB 2X0CA 3RKOF 3G4ZA 1NBBA 4MVRA 2XLEA 1VLTA 4U5GA 4NTAA 4JTCB 5BQIA 3IEEA 4Q5SF 2V26A 3T6JA 2CDQA 2EPLX 3IQTA 4CS9C 3AG2C 1OCCC 1Q0DA 1D0XA 5L0HA 1LIHA 4I44A 2J9BA 2EILC 3GANA 2LFDA 4G78A 1GS9A 1Z7Qc 3VYWA 3EG9A 1EA8A 3WODF 1H9GA 2C03A 1BR4A 4BJ5A 4YN0B 2ZXPA 3LS1A 4BJ1A 2YHSA 4P9FA 3G50A 3EJNA 4Z9IA 2JPUA 1HMDA 5L0CA 3U8VA 2UUHA 5B1AC 4ULVA 1YYXA 1GGQA 1O3UA 1ZW2A 3EGXA 4WABA 3S9OA 3NMJA 3L8IA 2R03A 4HEAJ 1Z6AA 1VYIA 3B71A 3U5SA 5L3VA 4JTAB 3K7DA 4YT5A 3LNRA 3BRJA 1NLXA 2EIJC 2Q3TA 4AX2A 1O5HA 1ZHXA 3T6BA 4BJ6C 3KYJA 2RD9A 3HNJA 2Y3BA 2CNWA 4PJMA 3N0TA 4JW1A 5F28E 4C3DA 1ORSC 3K1HA 1ZHZA 3O6XA 3Q7LA 3JTLO 4YL1A 4KI2A 1M57C 2H7BA 1T6UA 1VYKA 2MYSA 1S7ZA 3I5PA 4XPYA 2EPMX 2J7PD 3HJCA 4LDRA 3SXZA 3NYLA 5COGA 1PD0A 4EHPA 1UG7A 2XRHA 4P9TA 2G3KA 3UNGC 1JAFA 2BL2A 2A0UA 3SXKA 1FMWA 1K40A 1S05A 1Q0GA 3LLKA 1H7IA 4U5DE 1I4ZA 2HJMA 3GORA 1NSGB 1WASA 1ZVZA 2HSQA 2IM8A 3KYIA 4XEFA 2XM0A 3AG3C 2BC5A 3SXYA 4IWBA 4MTGA 2MHRA 4JE9A 1OR2A 4LERA 3L8JA 1GQAA 2L7AA 3DAGA 1E83A 1V74B 2A6HF 3FAPB 2XM4A 2R25A 3NKDA 4MVMA 3AG1C 3ZDLA 4XPXA 2XL6A 3BEHA 3NMIA 4L6RA 1D1BA 2QY9A 1D1CA 2YKZA 4PJNA 3GWNA 3JRMO 5FZTA 4EBBA 2Q9BA 5JS5A 4MTOA 3JSZA 4E17A 3EGDB 3L0IA 2G3VA 2YL7A 3GEIA 3T9OA 1ZHYA 4GQHA 4DVYP 5EGYA 3ABKC 3M1CB 5A6BD 3FXHA 4OIPF 3RQEA 2QLAA 3TOLA 3ASNC 4G0HA 4QI0A 3KMIA 3R7CA 3ZQVA 4DJ9A 3ECSA 1KNYA 2L9JA 2XSEA 4O6NA 4PJLA 5E33A 2HSBA 5CI8A 1FMVA 4MVUA 4O7GA 3F47A 2Y3DA 2Y69C 1C17M 4MQ9F 4R32A 2YWAA 4E7SA 5B3SC 5K0IA 2CGEA 1MMGA 4JZAA 3LS0A 1ZU5A 4E0IA 2J0WA 2KNHA 2LCHA 1QSPA 1ORJA 2D4UA 2I8BA 3C8GD 1TR2A 3F46A 3OA1A 4Q7CA 2LD6A 3C63A 1Z3IX 4MVQA 1CPQA 1BDJB 2LQGA 5AC5A 5L0GA 3U9MA 5BQHA 2DYSC 4IRUA 4JJGA 4WGYA 3JYYA 3CSKA 3ZSUA 3W2WA 4AK9A 4E0HA 5KYYA 1JOGA 4LLEA 3UGOA 4C3EA 1ZHTA 1O87A 2JX0A 1A41A 1TWGA 3UR3C 4AL0A 4YT4A 2OG2A 3EHNA 2VC9A 4N4WA 4U5BE 1TFKB 1BBHA 1Q0KA 1W2WA 2HMQA 2YQYA 5A6BA 2R7TA 3NG1A 2NSGA 2WZGA 1TQGA 1VK5A 3DE9A 4GEHA 4HFKB 5L0FA 5KYXA 3S90A 3CEXA 2R7VA 2W4MA 5L0JA 1YDIA 4A4AA 3AOUA 2GAQA 1VLSA 1SYQA 2HZ8A 2WB7A 4XQ1A 5T3WA 1EKYA 2DGJA 2R7UA 3IQ5A 3FDQA 3AG4C 1JPJA 2H8AA 3C7JA 3HKKA 4IARA 4Z9JA 1HMOA 3S27A 4ZLCA 4CIHA 2J46A 3IQCA 3U2LA 4YWQA 3I4UA 4NTFA 2LFFA 2A0BA 2LIGA 4EIYA 4EBJA 4XPWA 1YLMA 1WATA 3V5YA 1YZAA 4I1OB 5KYUA 5DQZA 2EINC 3X1OA 5HSWA 1I5NA 1JRAA 4MVSA 4JURI 1C02A 3O55A 4JVSA 3K66A 3TQOA 4AE4A 1KU2A 4C7OA 4CJGA 1YA7O 4A2NB 3US6A 1DOVA 1D0ZA 1FFTC 3DZAA 3S28A 4YJWA 3J06A 2L6GA 3ZWIA 2F22A 2WVOA 2CNWD 1E2XA 4KBLA 2PBEA 4M63A 3H65A 1JMWA 1NG1A 2XLOA 2LK4A 3G4XA 2XXAA 3FAJA 3LEVA 5COFA 1RKEA 3O10A 3U3FA 2KYHA 2W4BA 4DBQA 4CJOA 4H54A 5JSLA 4JTDB 1SR2A 2QUPA 2J45A 4MVZA 1F1MA 3TJ6A 2Y39A 4WJ0A 4CDAA 3ZTZA 5D92A 1AVOB 4KNVA 1CGNA 4D4XA 3N2ZB 2HUJA 3H2VA 3A9CA 3L34A 2R02A 3LJBA 1LM3B 4EKWA 1CGME 4BJ5C 1A7DA 2KQ9A 1VMAA 3IPMO 2DYRC 4JEBA 2GDCA 1APCA 2EPOA 4LACB 2YEVA 3R2PA 4KNWA 2TMVP 3ATPA 3V5ZA 3FOPA 5F5HA 4CDYA 4DVZA 4F4BA 4W8PA 1K04A 2YVKA 4IAOA 2YL1A 4DRIB 1MMNA 3OEOA 5D91A 1HE1A 4DOZA 3T4RA 1MNDA 3ABMC 3LLIA 1LS1A 3E9VA 5E2QA 2NPUA 1M2VA 4YT8A 3DKAA 4U5EE 3I5QA 1Q0MA 2YL3A 2NUPA 3DJUB 3B0PA 1G5ZA 2XLDA 4BEMJ 2GFHA 2Q7RA 4NC3A 2YZSA 5L3QA 2O9XA 1LVKA 3GM2A 1R5ID 3HNLA 3ZQYA 4NY3A 4EWCA 5HV9A 1RMVA 1E84A 1LI5A 3JRTA 1VOMA 2EPNA 3U2MA 2L81A 1MMDA 2NUTB 2WZFA 3JZ0A 1ZYRF 3QZCA 5A6KA 2G62A 1RJ9A 2J9UA 1AEPA 4J7YA 3NYJA 1TWCA 4CS8A 1C03A 2Y3HA 2FFHA 5COMA 1RKCA 2WL8A 5A69A 1OCZC 4OD4A 4O6MA 3IQ6A 3Q6NA 3PCVA 4YL0A 4OIRF 3RQGA 2KK1A 1OR3A 3C8GB 1SF8A 3N24A 3CAXA 4PR9A 2M4EA 3EFOB 3FVYA 3AGUA 4H4KC 4Z9HA 4KC9A 2Z15A 1IW7F 1OXKA 3QMKA 3B29A 1NZEA 4DBRA 4AE4B 1UFBA 2OEXA 3DJNB 4D4NA 3MX3A 4JCZA 3JSEO 3LAYA 4XEKA 4NTBA 2IXNA 2XLMA 4XEVA 1A0BA 3MFNA 3ZIBA 4CX9A 1ZU4A 1A7EA 2WVQA 3MLGA 4JKVA 1HE9A 3SEOA 3X2QC 5FCLA 4O79A 1JR8A 3TD7A 5JT4A 2A6EF 3VAYA 4W8KA 3WHNA 1U89A 1WOLA 2AWYA 1FNTc 1ST6A 1HW1A 3U9JA 1RKEB 2HV6A 3WG7C 1J8MF 4EBKA 3EG9B 3VRCA 1YJGA 4E7ZA 3RW0A 1Y6DA 3M15A 4N6HA 3KH2A 3W8IA 4LDQA 4U9EA 5JLIA 3V5XA 1G8XA 5DS6A 1VB5A 3E70C 1BR2A 2EPKX 2GA0A 2R7OA 2R05A 4DRHB 4JC7A 2Y3GA 3ASOC 1IZMA 2XLWA 3EGXB 3GODA 1LKXA 2PFDA 2AWCA 2VCCA 4K1OA 4U5HA 5AGFA 2P0NA 1QKRA 4PFPA 1PCXA 3SXMA 3NDBB 4LDKA 3GWLA 3Q6MA 1B68A 2OKUA 1XWJA 3CQZA 1DOWA 1WTYA 4QI2A 2DI3A 2XS8A 3LESA 2FAPB 3JT1A 4JRZA 3EH2A 3AGTA 3K6BA 3S0XA 3T6GB 1TWAA 1JPNA 2B0JA 4AL1A 3PDMP 4U5FE 1XZQA 5T1DB 1Z5ZA 4YL3A 1WN0A 4K0DA 3EH1A 4ER9A 2ZD9A 4PFOA 1ZHWA 2VCAA 3UMKA 3RQFA 3C18A 2Q4FA 2YLGA 2P7VA 4ANJA 4DXWA 1T6QA 3MBGA 3H2UA 3NMKA 3Q7GA 4FAPB 4MNDA 3S84A 3ITFA 1OKKA 1NFNA 1EI7A 1RXQA 2P61A 1PD1A 2UUIA 2YL0A 3EZIA 5TJ5E 4PACA 1BR1A 4XTKA 2IXOA 3U8PA 3CZ6A 2A68F 4CSAA 3B0UX 4JIOA 3M4CA 5DQTA 4J7TA 3NRHA 4N6CA 3RVZA 3ZG1A 5DLJA 4MTFA 4BPMA 2NG1A 2YRFA 4NQFA 2IXPA 3RIPA 2L6HA 4LLCA 4OIQF 3EZHA 3L1MA 4BEJA 2HFIA 3A11A 1LPEA 2D5RB 3KPHA 2ZXWC 2PF4E 3FHDA 2HMZA 1CGOA 3NYMA 4ONSA 3VF0A 3HNIA 5KYNA 2OCCC 1GM5A 3RVYA 2CYDA 4YT2A 3DXJF 3IHUA 1M56C 1YZCA 3UMIA 5JP7A 4Q4ZF 1N1CA 3FMSA 2B0HA 2PP4A 3C62A 3SYNA 1MMAA 1LI7A 1D1AA 2LP4A 4PJJA 4PK4A 3TK0A 2VASA 1CPRA 4J30B 1OW7A 2IYLD 5BUOA 2H7VC 2XL4A 2I15A 3DM9B 3GEEA 5EK0A 3QW0A 3EGDA 1VTMP 3LUTB 4CIPA 1I4YA 2HKVA 4RD9A 1YA9A 1V54C 1ORYA 1J8YF 2J9VA 2KC3A 1R4TA 3FOOA 3GEHA 3PHF2 1T01A 3K33A 4G7ZF 1Z23A 2FGYA 2EIMC 1QPUA 1YARO 2L6FA 1E86A 4OIOF 2RSEB 2X51A 3V7OA 5KYYB 3RYLA 4N06A 5KYWA 1Y4CA 2A69F 3MYFA 4BJ6A 1RCPA 4MW3A 1QQ3A 5DS5A 4OD5A 2KSFA 2IOQA 2BE5F 5L0DA 3JCUQ 4I1MA 5KYXB 3EPVA 1OQCA 2W45A 4MS2A 4B6IA 2R7QA 1FFHA 2OJED 2YLDA 3PMRA 2C04A 3QVYA 2AP3A 1LE2A 3M79A 2Q9AA 2XL8A 1YVIA 2YLIA 4RBNA 5GPGB 1NFOA 1NU7D 2ZXOA 4IJJA 3LEOA 5T3TA 3K1IA 4RDAA 3AQBA 4CBEA 2Q00A 1YYJA 2EIKC 1V55C 2XLHA 4IB4A 2MWQA 2GWWA 4HFFB 4X0RA 1Z63A 2HJ3A 3EQLF 5CI9A 3GM1A 3VM6A 3DI5A 2OQMA 4ZLDA 5KYUB 5L0IA 256BA 3TULA 2VCBA 1M2OA 3W2VA 1EQ1A 4C7OB 4JCHA 2PNOA 4IAQA 4CS8C 2ETSA 3K1IC 5A6JA 1M6TA 2ASRA 4G7HF 4I3MA 4G7OF 2QE9A 3B9QA 4J32B 1ZW3A 2W9YA 5BQGA 2H7OA 3DAFA 3W8HA 4YK5A 5B1BC 5IY5C 4XWJA 2CCYA 2QNLA 3WAQA 5JRAA 1WWPA 5F5FA 3TOMA 3AJMA 1OCOC 3UMHA 1OXBA 3DMDA 5AC4A 1NU9C 2XXAB 2Q9CA 3LNMB 4JJFA 4DRJB 1QLEC 4FWVA 1AUEA 3KL4A 5JVEA 3SZRA 1KTMA 2J0XA 2DB4A 3ZTMA 4CDVA 2R7WA 1L3PA 3DM5A 5DVWA 1LS4A 1U6HA 1TFOB 2IBFA 5KYWB 4EUKB 5E3CA 3ZC4A 1YAUO 3RF3A 4QDLA 1OKKD 2J7PA 1ZZPA 1LE4A 2OJQA 3HTKC 4C3BA 2ZXRA 2E87A 2OEVA 1XZPA 2J8WA 4MW8A 1SMYF 2OU6A 2QTVA 4HE8D 2XS1A 5EHHA 5JUAA 1FAPB 3W4YA 4XLPF 2R7SA 5DS4A 2M64A 1PV3A 2WVNA 1QVXA 1WGWA 3KKBA 1OW6A 4BJTA 1M2VB 1HY5A 2R7XA 1BZ4A 4GYTA 5B3IA 4NCQA 2NUPB 3DD7A 2JD3A 1T6IA 1TKNA 4K7BA 4UDVA 2AU5A 1G4WR 2ICWG 2VB6A 3DWWA 3HNKA 1TWHA 1FR0A 2HV7A 2XLVA 2R7RA 1T5OA 4ULWA 2LSEA 2PX3A 4IGGA 5E3AA 3S29A 3U3BA 3POVA 3RFYA 4FESA 3M4BA 3EHMA 3RH3A 3ZVRA 1HW2A 3QVZA 4FX5A 2WZLA 1MNEA 1RJ9B 3SNHA 3JYHA 3B0VC 2AVKA 1D0YA 1A7VA 1L7CA 1V4AA 5A6AA
chains in the Genus database with same CATH topology
4U5CE 2IXMA 3SP1A 3O39A 1OCRC 3UGPA 2KJGA 2J9WA 3NKEA 1SZIA 4P6IC 4XLNF 2NUTA 3ABLC 2VH3A 3HLZA 4OINF 4CSAC 2P6VA 4CS7A 1FTSA 1QZXA 2PX0A 3AQCA 3OWTA 2A1DD 2ZPAA 2KGOA 4CS9A 3EFOA 2V3CC 2CW0F 4BG0A 2KW3C 4O6YA 3RKOF 4U5GA 3IEEA 4Q5SF 2V26A 3T6JA 2CDQA 4CS9C 3AG2C 1OCCC 1D0XA 4I44A 2EILC 3GANA 3VYWA 3EG9A 3WODF 4BJ5A 2C03A 1BR4A 4YN0B 2ZXPA 3LS1A 4BJ1A 2YHSA 3EJNA 5B1AC 3EGXA 4HEAJ 1Z6AA 1VYIA 5L3VA 3K7DA 4YT5A 3LNRA 2EIJC 2Q3TA 4AX2A 1O5HA 1ZHXA 3T6BA 4BJ6C 2Y3BA 2CNWA 4PJMA 3N0TA 4JW1A 4C3DA 3K1HA 1ZHZA 3O6XA 3Q7LA 4KI2A 1M57C 2H7BA 1VYKA 2MYSA 1S7ZA 3I5PA 3HJCA 2J7PD 3NYLA 1PD0A 2XRHA 2G3KA 3UNGC 1FMWA 3LLKA 4U5DE 3AG3C 4IWBA 4LERA 3DAGA 2A6HF 3NKDA 3AG1C 1D1BA 2QY9A 1D1CA 4PJNA 4EBBA 2Q9BA 3JSZA 3EGDB 3L0IA 2G3VA 1ZHYA 4DVYP 5EGYA 3M1CB 3ABKC 4OIPF 3ASNC 4G0HA 4QI0A 3KMIA 3ECSA 2L9JA 4PJLA 2XSEA 4O6NA 5E33A 5CI8A 1FMVA 4O7GA 5B3SC 3F47A 2Y3DA 2Y69C 4E7SA 4MQ9F 5KYWB 2CGEA 1MMGA 4JZAA 3LS0A 1ZU5A 2J0WA 2KNHA 3OA1A 2I8BA 3F46A 1TR2A 4Q7CA 1Z3IX 2DYSC 4IRUA 4JJGA 3ZSUA 3CSKA 4AK9A 3W2WA 5KYYA 3UGOA 4LLEA 4C3EA 1ZHTA 1O87A 1TWGA 3UR3C 4YT4A 2OG2A 3EHNA 4U5BE 2R7TA 1W2WA 3NG1A 5KYXA 2WZGA 1VK5A 4GEHA 4HFKB 2R7VA 2W4MA 5T3WA 2WB7A 2DGJA 2R7UA 3FDQA 3AG4C 1JPJA 4ZLCA 4CIHA 3S27A 2J46A 4YWQA 3I4UA 4I1OB 5KYUA 5DQZA 2EINC 3X1OA 5HSWA 4C7OA 4JURI 4JVSA 4AE4A 3K66A 1KU2A 4A2NB 1D0ZA 1FFTC 3DZAA 3S28A 4YJWA 2WVOA 2CNWD 4KBLA 4M63A 3H65A 1NG1A 2XXAA 3FAJA 3LEVA 2W4BA 4DBQA 2J45A 2Y39A 4WJ0A 5D92A 4KNVA 3N2ZB 3L34A 3LJBA 4BJ5C 2KQ9A 1VMAA 4LACB 2DYRC 2YEVA 4KNWA 4DVZA 5F5HA 4F4BA 4IAOA 1MMNA 3OEOA 5D91A 4DOZA 3T4RA 1MNDA 3ABMC 3LLIA 1LS1A 3E9VA 5E2QA 4YT8A 1M2VA 4U5EE 3I5QA 2NUPA 3DJUB 3B0PA 2GFHA 2YZSA 5L3QA 2O9XA 1LVKA 4EWCA 4NY3A 3JRTA 1VOMA 2L81A 1MMDA 2WZFA 2NUTB 1ZYRF 3QZCA 2G62A 1RJ9A 2J9UA 3NYJA 1TWCA 4CS8A 2Y3HA 2FFHA 2WL8A 1OCZC 4OD4A 4O6MA 3Q6NA 4OIRF 3N24A 1SF8A 2M4EA 3EFOB 3FVYA 4H4KC 4KC9A 2Z15A 1IW7F 3QMKA 1NZEA 4DBRA 4AE4B 3DJNB 3MX3A 3LAYA 2IXNA 3ZIBA 1ZU4A 2WVQA 3MLGA 3SEOA 3X2QC 5FCLA 4O79A 3TD7A 2A6EF 3VAYA 4W8KA 1ST6A 2HV6A 3WG7C 1J8MF 3EG9B 4E7ZA 3KH2A 3W8IA 1G8XA 5DS6A 3E70C 1BR2A 2R7OA 2Y3GA 3ASOC 1IZMA 3EGXB 3GODA 4U5HA 1LKXA 2PFDA 4PFPA 1PCXA 3NDBB 3Q6MA 3CQZA 4QI2A 3LESA 3JT1A 3EH2A 3K6BA 3S0XA 1TWAA 1JPNA 2B0JA 4U5FE 5T1DB 1Z5ZA 4K0DA 3EH1A 4PFOA 1ZHWA 3UMKA 2P7VA 4ANJA 3Q7GA 4MNDA 3ITFA 1OKKA 1PD1A 3EZIA 1BR1A 4XTKA 2IXOA 3CZ6A 2A68F 4CSAA 3B0UX 5DQTA 3NRHA 3ZG1A 5DLJA 2NG1A 3RIPA 2IXPA 4LLCA 4OIQF 3EZHA 4BEJA 2D5RB 2ZXWC 2PF4E 3FHDA 3NYMA 5KYNA 2OCCC 4YT2A 3DXJF 1M56C 3UMIA 4Q4ZF 1N1CA 2PP4A 3SYNA 1MMAA 4PK4A 1D1AA 4PJJA 2VASA 4J30B 2IYLD 5BUOA 2H7VC 2XL4A 3DM9B 3EGDA 4RD9A 1V54C 1J8YF 2J9VA 4G7ZF 3PHF2 3K33A 1Z23A 2FGYA 2EIMC 4OIOF 3V7OA 2X51A 5KYYB 3RYLA 4N06A 5KYWA 2A69F 4BJ6A 5DS5A 4OD5A 2IOQA 2BE5F 3JCUQ 4I1MA 5KYXB 3EPVA 2W45A 4B6IA 2R7QA 1FFHA 3PMRA 2C04A 2Q9AA 4RBNA 1NU7D 2ZXOA 4IJJA 5T3TA 4RDAA 4CBEA 3AQBA 2EIKC 1V55C 2MWQA 4HFFB 1Z63A 4X0RA 3EQLF 5CI9A 4ZLDA 5KYUB 1M2OA 3W2VA 4C7OB 4JCHA 4CS8C 3K1IC 4G7HF 4I3MA 4G7OF 3B9QA 4J32B 2W9YA 2H7OA 3DAFA 3W8HA 5B1BC 5IY5C 4XWJA 5F5FA 1OCOC 3UMHA 3DMDA 1NU9C 2XXAB 2Q9CA 4JJFA 1QLEC 4FWVA 3KL4A 3SZRA 2J0XA 2R7WA 3DM5A 5DVWA 5E3CA 3ZC4A 4QDLA 1OKKD 2J7PA 4C3BA 3HTKC 2ZXRA 2E87A 1SMYF 2QTVA 4HE8D 5EHHA 4XLPF 2R7SA 5DS4A 2WVNA 1WGWA 3KKBA 4BJTA 2R7XA 1M2VB 4GYTA 2NUPB 3DD7A 2JD3A 1TKNA 4K7BA 2VB6A 1TWHA 2HV7A 2R7RA 4ULWA 2LSEA 2PX3A 5E3AA 3S29A 3POVA 3RFYA 4FESA 3EHMA 3RH3A 3ZVRA 4FX5A 2WZLA 1MNEA 1RJ9B 3SNHA 3JYHA 3B0VC 1D0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O79 A;  4O6Y A;  4O7G A; 
#chains in the Genus database with same CATH topology
 4U5C E;  4U9D A;  1MQV A;  2IXM A;  3QTH A;  3SP1 A;  3O39 A;  1OCR C;  3UGP A;  2KJG A;  2J9W A;  3NKE A;  1SZI A;  1U0B B;  4P6I C;  4XLN F;  2HS5 A;  2NUT A;  3U0C A;  3ABL C;  1K05 A;  1Q0F A;  1T9K A;  2VH3 A;  3DE8 A;  3HLZ A;  3MYI A;  4MVO A;  4OIN F;  1E85 A;  4CSA C;  2P6V A;  4CS7 A;  1OW8 A;  1FTS A;  1QZX A;  2PX0 A;  3C8Z A;  4JEA A;  4WGZ A;  5CIV A;  3AQC A;  2P1A A;  3OWT A;  2A1D D;  3C8G A;  2ZPA A;  2KGO A;  1H6G A;  3GM3 A;  3EFO A;  4CS9 A;  1H9T A;  1G4U S;  2V3C C;  2OOC A;  2CW0 F;  4BG0 A;  2KW3 C;  4O6Y A;  2NSF A;  3TJ5 A;  4E18 A;  3QW1 A;  2R9R B;  2X0C A;  3RKO F;  3G4Z A;  1NBB A;  4MVR A;  2XLE A;  1VLT A;  4U5G A;  4NTA A;  4JTC B;  5BQI A;  3IEE A;  4Q5S F;  2V26 A;  3T6J A;  2CDQ A;  2EPL X;  3IQT A;  4CS9 C;  3AG2 C;  1OCC C;  1Q0D A;  1D0X A;  5L0H A;  1LIH A;  4I44 A;  2J9B A;  2EIL C;  3GAN A;  2LFD A;  4G78 A;  1GS9 A;  1Z7Q c;  3VYW A;  3EG9 A;  1EA8 A;  3WOD F;  1H9G A;  2C03 A;  1BR4 A;  4BJ5 A;  4YN0 B;  2ZXP A;  3LS1 A;  4BJ1 A;  2YHS A;  4P9F A;  3G50 A;  3EJN A;  4Z9I A;  2JPU A;  1HMD A;  5L0C A;  3U8V A;  2UUH A;  5B1A C;  4ULV A;  1YYX A;  1GGQ A;  1O3U A;  1ZW2 A;  3EGX A;  4WAB A;  3S9O A;  3NMJ A;  3L8I A;  2R03 A;  4HEA J;  1Z6A A;  1VYI A;  3B71 A;  3U5S A;  5L3V A;  4JTA B;  3K7D A;  4YT5 A;  3LNR A;  3BRJ A;  1NLX A;  2EIJ C;  2Q3T A;  4AX2 A;  1O5H A;  1ZHX A;  3T6B A;  4BJ6 C;  3KYJ A;  2RD9 A;  3HNJ A;  2Y3B A;  2CNW A;  4PJM A;  3N0T A;  4JW1 A;  5F28 E;  4C3D A;  1ORS C;  3K1H A;  1ZHZ A;  3O6X A;  3Q7L A;  3JTL O;  4YL1 A;  4KI2 A;  1M57 C;  2H7B A;  1T6U A;  1VYK A;  2MYS A;  1S7Z A;  3I5P A;  4XPY A;  2EPM X;  2J7P D;  3HJC A;  4LDR A;  3SXZ A;  3NYL A;  5COG A;  1PD0 A;  4EHP A;  1UG7 A;  2XRH A;  4P9T A;  2G3K A;  3UNG C;  1JAF A;  2BL2 A;  2A0U A;  3SXK A;  1FMW A;  1K40 A;  1S05 A;  1Q0G A;  3LLK A;  1H7I A;  4U5D E;  1I4Z A;  2HJM A;  3GOR A;  1NSG B;  1WAS A;  1ZVZ A;  2HSQ A;  2IM8 A;  3KYI A;  4XEF A;  2XM0 A;  3AG3 C;  2BC5 A;  3SXY A;  4IWB A;  4MTG A;  2MHR A;  4JE9 A;  1OR2 A;  4LER A;  3L8J A;  1GQA A;  2L7A A;  3DAG A;  1E83 A;  1V74 B;  2A6H F;  3FAP B;  2XM4 A;  2R25 A;  3NKD A;  4MVM A;  3AG1 C;  3ZDL A;  4XPX A;  2XL6 A;  3BEH A;  3NMI A;  4L6R A;  1D1B A;  2QY9 A;  1D1C A;  2YKZ A;  4PJN A;  3GWN A;  3JRM O;  5FZT A;  4EBB A;  2Q9B A;  5JS5 A;  4MTO A;  3JSZ A;  4E17 A;  3EGD B;  3L0I A;  2G3V A;  2YL7 A;  3GEI A;  3T9O A;  1ZHY A;  4GQH A;  4DVY P;  5EGY A;  3ABK C;  3M1C B;  5A6B D;  3FXH A;  4OIP F;  3RQE A;  2QLA A;  3TOL A;  3ASN C;  4G0H A;  4QI0 A;  3KMI A;  3R7C A;  3ZQV A;  4DJ9 A;  3ECS A;  1KNY A;  2L9J A;  2XSE A;  4O6N A;  4PJL A;  5E33 A;  2HSB A;  5CI8 A;  1FMV A;  4MVU A;  4O7G A;  3F47 A;  2Y3D A;  2Y69 C;  1C17 M;  4MQ9 F;  4R32 A;  2YWA A;  4E7S A;  5B3S C;  5K0I A;  2CGE A;  1MMG A;  4JZA A;  3LS0 A;  1ZU5 A;  4E0I A;  2J0W A;  2KNH A;  2LCH A;  1QSP A;  1ORJ A;  2D4U A;  2I8B A;  3C8G D;  1TR2 A;  3F46 A;  3OA1 A;  4Q7C A;  2LD6 A;  3C63 A;  1Z3I X;  4MVQ A;  1CPQ A;  1BDJ B;  2LQG A;  5AC5 A;  5L0G A;  3U9M A;  5BQH A;  2DYS C;  4IRU A;  4JJG A;  4WGY A;  3JYY A;  3CSK A;  3ZSU A;  3W2W A;  4AK9 A;  4E0H A;  5KYY A;  1JOG A;  4LLE A;  3UGO A;  4C3E A;  1ZHT A;  1O87 A;  2JX0 A;  1A41 A;  1TWG A;  3UR3 C;  4AL0 A;  4YT4 A;  2OG2 A;  3EHN A;  2VC9 A;  4N4W A;  4U5B E;  1TFK B;  1BBH A;  1Q0K A;  1W2W A;  2HMQ A;  2YQY A;  5A6B A;  2R7T A;  3NG1 A;  2NSG A;  2WZG A;  1TQG A;  1VK5 A;  3DE9 A;  4GEH A;  4HFK B;  5L0F A;  5KYX A;  3S90 A;  3CEX A;  2R7V A;  2W4M A;  5L0J A;  1YDI A;  4A4A A;  3AOU A;  2GAQ A;  1VLS A;  1SYQ A;  2HZ8 A;  2WB7 A;  4XQ1 A;  5T3W A;  1EKY A;  2DGJ A;  2R7U A;  3IQ5 A;  3FDQ A;  3AG4 C;  1JPJ A;  2H8A A;  3C7J A;  3HKK A;  4IAR A;  4Z9J A;  1HMO A;  3S27 A;  4ZLC A;  4CIH A;  2J46 A;  3IQC A;  3U2L A;  4YWQ A;  3I4U A;  4NTF A;  2LFF A;  2A0B A;  2LIG A;  4EIY A;  4EBJ A;  4XPW A;  1YLM A;  1WAT A;  3V5Y A;  1YZA A;  4I1O B;  5KYU A;  5DQZ A;  2EIN C;  3X1O A;  5HSW A;  1I5N A;  1JRA A;  4MVS A;  4JUR I;  1C02 A;  3O55 A;  4JVS A;  3K66 A;  3TQO A;  4AE4 A;  1KU2 A;  4C7O A;  4CJG A;  1YA7 O;  4A2N B;  3US6 A;  1DOV A;  1D0Z A;  1FFT C;  3DZA A;  3S28 A;  4YJW A;  3J06 A;  2L6G A;  3ZWI A;  2F22 A;  2WVO A;  2CNW D;  1E2X A;  4KBL A;  2PBE A;  4M63 A;  3H65 A;  1JMW A;  1NG1 A;  2XLO A;  2LK4 A;  3G4X A;  2XXA A;  3FAJ A;  3LEV A;  5COF A;  1RKE A;  3O10 A;  3U3F A;  2KYH A;  2W4B A;  4DBQ A;  4CJO A;  4H54 A;  5JSL A;  4JTD B;  1SR2 A;  2QUP A;  2J45 A;  4MVZ A;  1F1M A;  3TJ6 A;  2Y39 A;  4WJ0 A;  4CDA A;  3ZTZ A;  5D92 A;  1AVO B;  4KNV A;  1CGN A;  4D4X A;  3N2Z B;  2HUJ A;  3H2V A;  3A9C A;  3L34 A;  2R02 A;  3LJB A;  1LM3 B;  4EKW A;  1CGM E;  4BJ5 C;  1A7D A;  2KQ9 A;  1VMA A;  3IPM O;  2DYR C;  4JEB A;  2GDC A;  1APC A;  2EPO A;  4LAC B;  2YEV A;  3R2P A;  4KNW A;  2TMV P;  3ATP A;  3V5Z A;  3FOP A;  5F5H A;  4CDY A;  4DVZ A;  4F4B A;  4W8P A;  1K04 A;  2YVK A;  4IAO A;  2YL1 A;  4DRI B;  1MMN A;  3OEO A;  5D91 A;  1HE1 A;  4DOZ A;  3T4R A;  1MND A;  3ABM C;  3LLI A;  1LS1 A;  3E9V A;  5E2Q A;  2NPU A;  1M2V A;  4YT8 A;  3DKA A;  4U5E E;  3I5Q A;  1Q0M A;  2YL3 A;  2NUP A;  3DJU B;  3B0P A;  1G5Z A;  2XLD A;  4BEM J;  2GFH A;  2Q7R A;  4NC3 A;  2YZS A;  5L3Q A;  2O9X A;  1LVK A;  3GM2 A;  1R5I D;  3HNL A;  3ZQY A;  4NY3 A;  4EWC A;  5HV9 A;  1RMV A;  1E84 A;  1LI5 A;  3JRT A;  1VOM A;  2EPN A;  3U2M A;  2L81 A;  1MMD A;  2NUT B;  2WZF A;  3JZ0 A;  1ZYR F;  3QZC A;  5A6K A;  2G62 A;  1RJ9 A;  2J9U A;  1AEP A;  4J7Y A;  3NYJ A;  1TWC A;  4CS8 A;  1C03 A;  2Y3H A;  2FFH A;  5COM A;  1RKC A;  2WL8 A;  5A69 A;  1OCZ C;  4OD4 A;  4O6M A;  3IQ6 A;  3Q6N A;  3PCV A;  4YL0 A;  4OIR F;  3RQG A;  2KK1 A;  1OR3 A;  3C8G B;  1SF8 A;  3N24 A;  3CAX A;  4PR9 A;  2M4E A;  3EFO B;  3FVY A;  3AGU A;  4H4K C;  4Z9H A;  4KC9 A;  2Z15 A;  1IW7 F;  1OXK A;  3QMK A;  3B29 A;  1NZE A;  4DBR A;  4AE4 B;  1UFB A;  2OEX A;  3DJN B;  4D4N A;  3MX3 A;  4JCZ A;  3JSE O;  3LAY A;  4XEK A;  4NTB A;  2IXN A;  2XLM A;  4XEV A;  1A0B A;  3MFN A;  3ZIB A;  4CX9 A;  1ZU4 A;  1A7E A;  2WVQ A;  3MLG A;  4JKV A;  1HE9 A;  3SEO A;  3X2Q C;  5FCL A;  4O79 A;  1JR8 A;  3TD7 A;  5JT4 A;  2A6E F;  3VAY A;  4W8K A;  3WHN A;  1U89 A;  1WOL A;  2AWY A;  1FNT c;  1ST6 A;  1HW1 A;  3U9J A;  1RKE B;  2HV6 A;  3WG7 C;  1J8M F;  4EBK A;  3EG9 B;  3VRC A;  1YJG A;  4E7Z A;  3RW0 A;  1Y6D A;  3M15 A;  4N6H A;  3KH2 A;  3W8I A;  4LDQ A;  4U9E A;  5JLI A;  3V5X A;  1G8X A;  5DS6 A;  1VB5 A;  3E70 C;  1BR2 A;  2EPK X;  2GA0 A;  2R7O A;  2R05 A;  4DRH B;  4JC7 A;  2Y3G A;  3ASO C;  1IZM A;  2XLW A;  3EGX B;  3GOD A;  1LKX A;  2PFD A;  2AWC A;  2VCC A;  4K1O A;  4U5H A;  5AGF A;  2P0N A;  1QKR A;  4PFP A;  1PCX A;  3SXM A;  3NDB B;  4LDK A;  3GWL A;  3Q6M A;  1B68 A;  2OKU A;  1XWJ A;  3CQZ A;  1DOW A;  1WTY A;  4QI2 A;  2DI3 A;  2XS8 A;  3LES A;  2FAP B;  3JT1 A;  4JRZ A;  3EH2 A;  3AGT A;  3K6B A;  3S0X A;  3T6G B;  1TWA A;  1JPN A;  2B0J A;  4AL1 A;  3PDM P;  4U5F E;  1XZQ A;  5T1D B;  1Z5Z A;  4YL3 A;  1WN0 A;  4K0D A;  3EH1 A;  4ER9 A;  2ZD9 A;  4PFO A;  1ZHW A;  2VCA A;  3UMK A;  3RQF A;  3C18 A;  2Q4F A;  2YLG A;  2P7V A;  4ANJ A;  4DXW A;  1T6Q A;  3MBG A;  3H2U A;  3NMK A;  3Q7G A;  4FAP B;  4MND A;  3S84 A;  3ITF A;  1OKK A;  1NFN A;  1EI7 A;  1RXQ A;  2P61 A;  1PD1 A;  2UUI A;  2YL0 A;  3EZI A;  5TJ5 E;  4PAC A;  1BR1 A;  4XTK A;  2IXO A;  3U8P A;  3CZ6 A;  2A68 F;  4CSA A;  3B0U X;  4JIO A;  3M4C A;  5DQT A;  4J7T A;  3NRH A;  4N6C A;  3RVZ A;  3ZG1 A;  5DLJ A;  4MTF A;  4BPM A;  2NG1 A;  2YRF A;  4NQF A;  2IXP A;  3RIP A;  2L6H A;  4LLC A;  4OIQ F;  3EZH A;  3L1M A;  4BEJ A;  2HFI A;  3A11 A;  1LPE A;  2D5R B;  3KPH A;  2ZXW C;  2PF4 E;  3FHD A;  2HMZ A;  1CGO A;  3NYM A;  4ONS A;  3VF0 A;  3HNI A;  5KYN A;  2OCC C;  1GM5 A;  3RVY A;  2CYD A;  4YT2 A;  3DXJ F;  3IHU A;  1M56 C;  1YZC A;  3UMI A;  5JP7 A;  4Q4Z F;  1N1C A;  3FMS A;  2B0H A;  2PP4 A;  3C62 A;  3SYN A;  1MMA A;  1LI7 A;  1D1A A;  2LP4 A;  4PJJ A;  4PK4 A;  3TK0 A;  2VAS A;  1CPR A;  4J30 B;  1OW7 A;  2IYL D;  5BUO A;  2H7V C;  2XL4 A;  2I15 A;  3DM9 B;  3GEE A;  5EK0 A;  3QW0 A;  3EGD A;  1VTM P;  3LUT B;  4CIP A;  1I4Y A;  2HKV A;  4RD9 A;  1YA9 A;  1V54 C;  1ORY A;  1J8Y F;  2J9V A;  2KC3 A;  1R4T A;  3FOO A;  3GEH A;  3PHF 2;  1T01 A;  3K33 A;  4G7Z F;  1Z23 A;  2FGY A;  2EIM C;  1QPU A;  1YAR O;  2L6F A;  1E86 A;  4OIO F;  2RSE B;  2X51 A;  3V7O A;  5KYY B;  3RYL A;  4N06 A;  5KYW A;  1Y4C A;  2A69 F;  3MYF A;  4BJ6 A;  1RCP A;  4MW3 A;  1QQ3 A;  5DS5 A;  4OD5 A;  2KSF A;  2IOQ A;  2BE5 F;  5L0D A;  3JCU Q;  4I1M A;  5KYX B;  3EPV A;  1OQC A;  2W45 A;  4MS2 A;  4B6I A;  2R7Q A;  1FFH A;  2OJE D;  2YLD A;  3PMR A;  2C04 A;  3QVY A;  2AP3 A;  1LE2 A;  3M79 A;  2Q9A A;  2XL8 A;  1YVI A;  2YLI A;  4RBN A;  5GPG B;  1NFO A;  1NU7 D;  2ZXO A;  4IJJ A;  3LEO A;  5T3T A;  3K1I A;  4RDA A;  3AQB A;  4CBE A;  2Q00 A;  1YYJ A;  2EIK C;  1V55 C;  2XLH A;  4IB4 A;  2MWQ A;  2GWW A;  4HFF B;  4X0R A;  1Z63 A;  2HJ3 A;  3EQL F;  5CI9 A;  3GM1 A;  3VM6 A;  3DI5 A;  2OQM A;  4ZLD A;  5KYU B;  5L0I A;  256B A;  3TUL A;  2VCB A;  1M2O A;  3W2V A;  1EQ1 A;  4C7O B;  4JCH A;  2PNO A;  4IAQ A;  4CS8 C;  2ETS A;  3K1I C;  5A6J A;  1M6T A;  2ASR A;  4G7H F;  4I3M A;  4G7O F;  2QE9 A;  3B9Q A;  4J32 B;  1ZW3 A;  2W9Y A;  5BQG A;  2H7O A;  3DAF A;  3W8H A;  4YK5 A;  5B1B C;  5IY5 C;  4XWJ A;  2CCY A;  2QNL A;  3WAQ A;  5JRA A;  1WWP A;  5F5F A;  3TOM A;  3AJM A;  1OCO C;  3UMH A;  1OXB A;  3DMD A;  5AC4 A;  1NU9 C;  2XXA B;  2Q9C A;  3LNM B;  4JJF A;  4DRJ B;  1QLE C;  4FWV A;  1AUE A;  3KL4 A;  5JVE A;  3SZR A;  1KTM A;  2J0X A;  2DB4 A;  3ZTM A;  4CDV A;  2R7W A;  1L3P A;  3DM5 A;  5DVW A;  1LS4 A;  1U6H A;  1TFO B;  2IBF A;  5KYW B;  4EUK B;  5E3C A;  3ZC4 A;  1YAU O;  3RF3 A;  4QDL A;  1OKK D;  2J7P A;  1ZZP A;  1LE4 A;  2OJQ A;  3HTK C;  4C3B A;  2ZXR A;  2E87 A;  2OEV A;  1XZP A;  2J8W A;  4MW8 A;  1SMY F;  2OU6 A;  2QTV A;  4HE8 D;  2XS1 A;  5EHH A;  5JUA A;  1FAP B;  3W4Y A;  4XLP F;  2R7S A;  5DS4 A;  2M64 A;  1PV3 A;  2WVN A;  1QVX A;  1WGW A;  3KKB A;  1OW6 A;  4BJT A;  1M2V B;  1HY5 A;  2R7X A;  1BZ4 A;  4GYT A;  5B3I A;  4NCQ A;  2NUP B;  3DD7 A;  2JD3 A;  1T6I A;  1TKN A;  4K7B A;  4UDV A;  2AU5 A;  1G4W R;  2ICW G;  2VB6 A;  3DWW A;  3HNK A;  1TWH A;  1FR0 A;  2HV7 A;  2XLV A;  2R7R A;  1T5O A;  4ULW A;  2LSE A;  2PX3 A;  4IGG A;  5E3A A;  3S29 A;  3U3B A;  3POV A;  3RFY A;  4FES A;  3M4B A;  3EHM A;  3RH3 A;  3ZVR A;  1HW2 A;  3QVZ A;  4FX5 A;  2WZL A;  1MNE A;  1RJ9 B;  3SNH A;  3JYH A;  3B0V C;  2AVK A;  1D0Y A;  1A7V A;  1L7C A;  1V4A A;  5A6A A; 
#chains in the Genus database with same CATH homology
 4U5C E;  2IXM A;  3SP1 A;  3O39 A;  1OCR C;  3UGP A;  2KJG A;  2J9W A;  3NKE A;  1SZI A;  4P6I C;  4XLN F;  2NUT A;  3ABL C;  2VH3 A;  3HLZ A;  4OIN F;  4CSA C;  2P6V A;  4CS7 A;  1FTS A;  1QZX A;  2PX0 A;  3AQC A;  3OWT A;  2A1D D;  2ZPA A;  2KGO A;  4CS9 A;  3EFO A;  2V3C C;  2CW0 F;  4BG0 A;  2KW3 C;  4O6Y A;  3RKO F;  4U5G A;  3IEE A;  4Q5S F;  2V26 A;  3T6J A;  2CDQ A;  4CS9 C;  3AG2 C;  1OCC C;  1D0X A;  4I44 A;  2EIL C;  3GAN A;  3VYW A;  3EG9 A;  3WOD F;  4BJ5 A;  2C03 A;  1BR4 A;  4YN0 B;  2ZXP A;  3LS1 A;  4BJ1 A;  2YHS A;  3EJN A;  5B1A C;  3EGX A;  4HEA J;  1Z6A A;  1VYI A;  5L3V A;  3K7D A;  4YT5 A;  3LNR A;  2EIJ C;  2Q3T A;  4AX2 A;  1O5H A;  1ZHX A;  3T6B A;  4BJ6 C;  2Y3B A;  2CNW A;  4PJM A;  3N0T A;  4JW1 A;  4C3D A;  3K1H A;  1ZHZ A;  3O6X A;  3Q7L A;  4KI2 A;  1M57 C;  2H7B A;  1VYK A;  2MYS A;  1S7Z A;  3I5P A;  3HJC A;  2J7P D;  3NYL A;  1PD0 A;  2XRH A;  2G3K A;  3UNG C;  1FMW A;  3LLK A;  4U5D E;  3AG3 C;  4IWB A;  4LER A;  3DAG A;  2A6H F;  3NKD A;  3AG1 C;  1D1B A;  2QY9 A;  1D1C A;  4PJN A;  4EBB A;  2Q9B A;  3JSZ A;  3EGD B;  3L0I A;  2G3V A;  1ZHY A;  4DVY P;  5EGY A;  3M1C B;  3ABK C;  4OIP F;  3ASN C;  4G0H A;  4QI0 A;  3KMI A;  3ECS A;  2L9J A;  4PJL A;  2XSE A;  4O6N A;  5E33 A;  5CI8 A;  1FMV A;  4O7G A;  5B3S C;  3F47 A;  2Y3D A;  2Y69 C;  4E7S A;  4MQ9 F;  5KYW B;  2CGE A;  1MMG A;  4JZA A;  3LS0 A;  1ZU5 A;  2J0W A;  2KNH A;  3OA1 A;  2I8B A;  3F46 A;  1TR2 A;  4Q7C A;  1Z3I X;  2DYS C;  4IRU A;  4JJG A;  3ZSU A;  3CSK A;  4AK9 A;  3W2W A;  5KYY A;  3UGO A;  4LLE A;  4C3E A;  1ZHT A;  1O87 A;  1TWG A;  3UR3 C;  4YT4 A;  2OG2 A;  3EHN A;  4U5B E;  2R7T A;  1W2W A;  3NG1 A;  5KYX A;  2WZG A;  1VK5 A;  4GEH A;  4HFK B;  2R7V A;  2W4M A;  5T3W A;  2WB7 A;  2DGJ A;  2R7U A;  3FDQ A;  3AG4 C;  1JPJ A;  4ZLC A;  4CIH A;  3S27 A;  2J46 A;  4YWQ A;  3I4U A;  4I1O B;  5KYU A;  5DQZ A;  2EIN C;  3X1O A;  5HSW A;  4C7O A;  4JUR I;  4JVS A;  4AE4 A;  3K66 A;  1KU2 A;  4A2N B;  1D0Z A;  1FFT C;  3DZA A;  3S28 A;  4YJW A;  2WVO A;  2CNW D;  4KBL A;  4M63 A;  3H65 A;  1NG1 A;  2XXA A;  3FAJ A;  3LEV A;  2W4B A;  4DBQ A;  2J45 A;  2Y39 A;  4WJ0 A;  5D92 A;  4KNV A;  3N2Z B;  3L34 A;  3LJB A;  4BJ5 C;  2KQ9 A;  1VMA A;  4LAC B;  2DYR C;  2YEV A;  4KNW A;  4DVZ A;  5F5H A;  4F4B A;  4IAO A;  1MMN A;  3OEO A;  5D91 A;  4DOZ A;  3T4R A;  1MND A;  3ABM C;  3LLI A;  1LS1 A;  3E9V A;  5E2Q A;  4YT8 A;  1M2V A;  4U5E E;  3I5Q A;  2NUP A;  3DJU B;  3B0P A;  2GFH A;  2YZS A;  5L3Q A;  2O9X A;  1LVK A;  4EWC A;  4NY3 A;  3JRT A;  1VOM A;  2L81 A;  1MMD A;  2WZF A;  2NUT B;  1ZYR F;  3QZC A;  2G62 A;  1RJ9 A;  2J9U A;  3NYJ A;  1TWC A;  4CS8 A;  2Y3H A;  2FFH A;  2WL8 A;  1OCZ C;  4OD4 A;  4O6M A;  3Q6N A;  4OIR F;  3N24 A;  1SF8 A;  2M4E A;  3EFO B;  3FVY A;  4H4K C;  4KC9 A;  2Z15 A;  1IW7 F;  3QMK A;  1NZE A;  4DBR A;  4AE4 B;  3DJN B;  3MX3 A;  3LAY A;  2IXN A;  3ZIB A;  1ZU4 A;  2WVQ A;  3MLG A;  3SEO A;  3X2Q C;  5FCL A;  4O79 A;  3TD7 A;  2A6E F;  3VAY A;  4W8K A;  1ST6 A;  2HV6 A;  3WG7 C;  1J8M F;  3EG9 B;  4E7Z A;  3KH2 A;  3W8I A;  1G8X A;  5DS6 A;  3E70 C;  1BR2 A;  2R7O A;  2Y3G A;  3ASO C;  1IZM A;  3EGX B;  3GOD A;  4U5H A;  1LKX A;  2PFD A;  4PFP A;  1PCX A;  3NDB B;  3Q6M A;  3CQZ A;  4QI2 A;  3LES A;  3JT1 A;  3EH2 A;  3K6B A;  3S0X A;  1TWA A;  1JPN A;  2B0J A;  4U5F E;  5T1D B;  1Z5Z A;  4K0D A;  3EH1 A;  4PFO A;  1ZHW A;  3UMK A;  2P7V A;  4ANJ A;  3Q7G A;  4MND A;  3ITF A;  1OKK A;  1PD1 A;  3EZI A;  1BR1 A;  4XTK A;  2IXO A;  3CZ6 A;  2A68 F;  4CSA A;  3B0U X;  5DQT A;  3NRH A;  3ZG1 A;  5DLJ A;  2NG1 A;  3RIP A;  2IXP A;  4LLC A;  4OIQ F;  3EZH A;  4BEJ A;  2D5R B;  2ZXW C;  2PF4 E;  3FHD A;  3NYM A;  5KYN A;  2OCC C;  4YT2 A;  3DXJ F;  1M56 C;  3UMI A;  4Q4Z F;  1N1C A;  2PP4 A;  3SYN A;  1MMA A;  4PK4 A;  1D1A A;  4PJJ A;  2VAS A;  4J30 B;  2IYL D;  5BUO A;  2H7V C;  2XL4 A;  3DM9 B;  3EGD A;  4RD9 A;  1V54 C;  1J8Y F;  2J9V A;  4G7Z F;  3PHF 2;  3K33 A;  1Z23 A;  2FGY A;  2EIM C;  4OIO F;  3V7O A;  2X51 A;  5KYY B;  3RYL A;  4N06 A;  5KYW A;  2A69 F;  4BJ6 A;  5DS5 A;  4OD5 A;  2IOQ A;  2BE5 F;  3JCU Q;  4I1M A;  5KYX B;  3EPV A;  2W45 A;  4B6I A;  2R7Q A;  1FFH A;  3PMR A;  2C04 A;  2Q9A A;  4RBN A;  1NU7 D;  2ZXO A;  4IJJ A;  5T3T A;  4RDA A;  4CBE A;  3AQB A;  2EIK C;  1V55 C;  2MWQ A;  4HFF B;  1Z63 A;  4X0R A;  3EQL F;  5CI9 A;  4ZLD A;  5KYU B;  1M2O A;  3W2V A;  4C7O B;  4JCH A;  4CS8 C;  3K1I C;  4G7H F;  4I3M A;  4G7O F;  3B9Q A;  4J32 B;  2W9Y A;  2H7O A;  3DAF A;  3W8H A;  5B1B C;  5IY5 C;  4XWJ A;  5F5F A;  1OCO C;  3UMH A;  3DMD A;  1NU9 C;  2XXA B;  2Q9C A;  4JJF A;  1QLE C;  4FWV A;  3KL4 A;  3SZR A;  2J0X A;  2R7W A;  3DM5 A;  5DVW A;  5E3C A;  3ZC4 A;  4QDL A;  1OKK D;  2J7P A;  4C3B A;  3HTK C;  2ZXR A;  2E87 A;  1SMY F;  2QTV A;  4HE8 D;  5EHH A;  4XLP F;  2R7S A;  5DS4 A;  2WVN A;  1WGW A;  3KKB A;  4BJT A;  2R7X A;  1M2V B;  4GYT A;  2NUP B;  3DD7 A;  2JD3 A;  1TKN A;  4K7B A;  2VB6 A;  1TWH A;  2HV7 A;  2R7R A;  4ULW A;  2LSE A;  2PX3 A;  5E3A A;  3S29 A;  3POV A;  3RFY A;  4FES A;  3EHM A;  3RH3 A;  3ZVR A;  4FX5 A;  2WZL A;  1MNE A;  1RJ9 B;  3SNH A;  3JYH A;  3B0V C;  1D0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...