4I1OB

Crystal structure of the legionella pneumophila gap domain of lepb in complex with rab1b bound to gdp and bef3
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
291
structure length
280
Chain Sequence
PLTLLMTSSTSFSETINQWADILKTMEKFDSNPINLLELVKQFNLYVDELAITCEANNVWASTPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCAAHADSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSFAEPNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras-related protein Rab-1B
publication title Mechanism of Rab1b deactivation by the Legionella pneumophila GAP LepB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/hydrolase
total genus 101
structure length 280
sequence length 291
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
B PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4i1oB01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i1oB02
4I1MA 4JVSA 4I1OB 4IRUA 4JW1A
chains in the Genus database with same CATH superfamily
3E9VA 3UQ3A 3DBSA 4QQIA 1BDJB 3ZQVA 5E3AA 5B3SC 3MLGA 1HW2A 3NMKA 4E7SA 3C8ZA 3CKBA 4C48B 3RVYA 3OA1A 4ANUA 2P0NA 2WQ7A 4ZLCA 3ESKA 2ZD9A 3FUMA 4ACLA 1SW6A 2GWWA 2QZAA 3TQOA 3U3FA 3VLEA 1VTMP 2HFIA 3C98A 2J7PA 4FC8A 3CVQA 3NRHA 4AEZC 3GANA 2WVNA 2VGYA 3AGUA 3N24A 1VDYA 3NQPA 5DIZA 1O87A 1ST6A 3I4GA 3ZNGA 2P7VA 3FTYA 4GTOA 3CGHA 1TQGA 1OCRE 4ULVA 2WQHA 4A1GA 2HYZA 1CGNA 2OOCA 4AOFA 3WXXA 4XPYA 3NMJA 3ABLC 3ULQA 3I3NA 3TOMA 4Z68A 3D9JA 1RKEA 3GW4A 1EPUA 4GA0A 3E70C 2GRPB 2KATA 2ETAA 3W9GA 1TEZA 4Q4ZF 3JYSA 4YDYA 3TK0A 4FP7A 2Y69C 4CJGA 1YARO 4OD5A 2WXIA 3FDQA 3VLDA 5G05J 3KMIA 2UUIA 3QDNA 1E96B 3DXMG 2R03A 4B8CB 4G7OF 3OTNA 4MW8A 1M57C 1Z3XA 2EPNA 3JQ1A 4O6MA 2XLOA 4G7HF 4FHJA 2OOEA 3UMVA 4HI8A 4YJWA 1XZPA 1OCOE 3FXHA 2P9SG 1EDUA 4D4NA 1KLXA 3U66A 4BPMA 3RFYA 1N0QA 1D8EA 2HSBA 5CEAA 2VYIA 2JX0A 4P6IC 3FVYA 5HV9A 3L34A 3RKVA 2AVKA 3LY8A 3IHVA 3MA5A 4CCAA 2FO7A 3BEEA 4BT9A 1UOHA 2R2LA 2A0UA 2HSQA 3K1HA 1Q0MA 4BERA 4JW1A 1ZBPA 1LD7A 1A7DA 1ORYA 3JYHA 3N2ZB 3RH3A 3S28A 2YNQA 3MGBA 4KMOA 5JSLA 3G4XA 3QJZA 1HMOA 3TJPA 4DXWA 5EX0A 1SA4A 3QARA 2PNNA 2OEWA 2WZGA 1OQCA 4XKBA 5L0HA 2IBFA 4A1SA 1I4ZA 1RZ4A 3X2QE 2R05A 2AVPA 1OUVA 1U89A 2ETSA 2OV8A 4G8KA 2P58C 3RKOF 1VOMA 4JRZA 5TJ5E 4JD2G 1KNYA 2OKUA 4EECA 2CGEA 3HTKC 4AX2A 3QK0A 1NI1A 2NUTB 1D0ZA 2EIMC 1JCQA 2Y4UA 1Z23A 1NSGB 3EZIA 4NY3A 2IU1A 3CQCB 2CFZA 3WAQA 4ANVA 1LI7A 4MQ9F 2ETCA 4I6JA 2J9UA 3CEQA 3FUDA 3QOUA 2WMNA 4BFRA 4N6HA 3J5QB 3FTUA 2LIGA 5KYUA 1JWGA 2QFCA 3DEPA 3E32A 4E7ZA 4JHRA 4QFVA 2P1AA 2Y3HA 2J4DA 2CHXA 4P29A 5J90A 1N11A 5A6CA 2PM7A 2EILE 3ZIBA 1CGME 3F47A 4YK5A 4I6GA 3DI5A 3B95A 4JEHA 4BTBA 5EKQD 3V30A 4MKTA 5JVEA 3Q78A 3PUKA 2WXJA 4EWCA 1A5EA 1TWHA 3UT8A 1RW2A 1SVXA 3AGTA 3NZSA 1M6TA 3M15A 4DX7D 4CRWA 4P9TA 4DPRA 3RIBA 5E2QA 3GWNA 3HNJA 1Z5ZA 2XXAA 4KBQA 3HIZA 4Q94A 2IXNA 4ULWA 1JWFA 1H6OA 4XPWA 1JRAA 4HEAJ 1SA5A 2H6IA 1LPEA 3FY4A 5HKPA 2LFFA 1I4YA 5L0DA 2OU6A 4Q5SF 1NFOA 1YJGA 4DRXE 4JURI 3ZC4A 5IY5E 3NOGD 4K03A 3KPHA 4OAVB 3GZ2A 3ONKA 1YMPA 4RG9A 2DYRE 2I1JA 4E0IA 3KSLA 2FBNA 2XL8A 4GZ6A 3ZYQA 4V3IA 4N6CA 2ZPAA 5ARGA 3JUIA 2HJMA 1EF1C 3L54A 1LS1A 2KCVA 1MYOA 3MKQB 3DJUB 5AGFA 4PJJA 3ZG1A 3APDA 4C3DA 5BV0A 1GM5A 3V31A 2X51A 3APCA 4UQXA 2R7RA 1L7CA 4C7OA 5KCMA 3AG2E 4MTFA 4A55A 4ABNA 1MNDA 4HOTA 1N4QA 4HFKB 4MVUA 1FMVA 3DXKG 3LYAA 3EGDA 4U96D 3CSKA 4HFGA 3A11A 3SI5A 4R7LA 2I9CA 3HNLA 5AC5A 3ZYKA 4JE9A 1YZAA 4YN0B 2XQ0A 2VSOE 2XEEA 2WXOA 3NMIA 4TUUA 3V5ZA 2BKKB 4AM9A 2MYSA 3ATPA 5AJLA 3MCXA 3EFOB 3SFYA 3S29A 1JPNA 1SZAA 2ICWG 1D0XA 3ZIMA 2FAPB 5L0JA 3C63A 1WM5A 3NYLA 1M2VA 2AXUA 2VSXE 3HXBA 3NBNB 3LNMB 4RLYA 4NCQA 2WL8A 4BJ5C 5AJDA 2Y4TA 2HKVA 4YDOA 3SNHA 3JZ0A 3GZSA 5KYNA 4MBGA 1AEPA 2H7VC 1YYXA 3FUIA 4GYWA 3AJMA 3UUXA 2KZTA 2WZFA 3LJBA 2GA0A 1TNOA 4RD9A 2NUPA 3LS1A 1ZHWA 1U3CA 3R9AB 3S2AA 2HV7A 3TULA 4MVSA 4K5AB 5AIJA 1TJFA 3C72A 1JAFA 4UQZA 2J9VA 2YWAA 3B0PA 1E8ZA 1G3NB 2XLMA 1N54A 1VYIA 4I17A 1DCEA 5HSWA 3V2OA 2CG2A 5CMYA 5T4YA 5ENQD 1WASA 3MX3A 3NB2A 3TGOA 2HS5A 1QZ2A 2Y3GA 2X6KA 4U04A 3R7CA 2F0YA 3K33A 5EGYA 4KNVA 2BUGA 4XPXA 4PUCA 4XZ4A 1ZHYA 1ZW3A 2E0IA 3D9OA 1DC2A 1D1AA 3RU0A 3EHQA 4EPZA 4ANXA 3MYFA 2P9KG 3S0XA 1IXVA 1PD0A 1T6QA 4CS8C 1LM3B 4LDKA 3DWLG 3RRMB 4J8FA 4FAPB 4MS2A 2VSYA 3B9QA 1KZPA 4UWHA 3KAEA 2ZGDA 1OY3D 2HV6A 3ONLA 4U8VD 2NC9A 4FHKA 3FWVA 4MS6A 5CBOA 1PV3A 2XLDA 5KYWB 3U8VA 3GM3A 3FUNA 4XLNF 2XLWA 2HO1A 2PM6A 3SGHA 3Q9NC 4JC8A 4JC7A 3RK6A 4B6IA 2X6FA 3CQZA 2UY1B 4GMRA 1LF8A 4BX9A 2LSVA 2XLHA 1HMDA 4M3OA 5EIDA 2EILC 2DB4A 1FPPA 3U9MA 5ENPD 3HVEB 5EDSA 1BPOA 2QTVA 1O1RA 3JYYA 4HOSA 2AJAA 2OQMA 4UQYA 2W45A 3CK9A 1FFHA 4DX5D 2IY0C 2Y3BA 2LFDA 3HXEA 4U07A 3L6AA 1RJ9B 1LKXA 3HLZA 1K1BA 4M63A 4CBEA 2GDCA 1BR4A 2QY9A 4CSAA 4XKCA 1NA3A 2CNWD 2VGXB 1UFBA 2L9JA 2O9XA 3N71A 1ZHXA 3LPZA 2OCCC 2B6CA 4BWRA 3EG9B 3R2PA 4LERA 3R9MA 1SF8A 4XX5A 5JHBA 3D9LA 2ZXRA 4Y6CA 3UINC 2XENA 3D9NA 3JT1A 1QBQA 3Q6MA 4N4WA 4CGVA 5T3WA 5IY5C 3CSFA 3AS5A 5KYYB 4QI2A 4NURA 2DYRC 4CDAA 5KNGA 3FAPB 3TOLA 2XL4A 2R17C 4OD4A 3QW1A 1BI8B 3VM6A 1YVIA 4U5EE 2J09A 3QAQA 3NDBB 1TYQG 3ZYMA 5JP7A 3S7DA 4FU3A 4KT6B 3AG3E 3ML8A 2YZSA 2KGOA 4ZLDA 3AG2C 4N2SA 3U5SA 3PRZA 3C8GD 3Q6NA 1RKCA 3KEZA 5JA4D 2PQRA 3URZA 1G8XA 3IBEA 1ZU5A 3LNRA 3EU9A 4CS9A 3PH0C 3AU5A 3G2VA 3LXUX 5KJNA 1U0BB 3KYIA 2PZIA 4MTOA 4LLCA 3LVRE 4N39A 2KYHA 4GEHA 1O1SA 3GEEA 4U63A 2R59A 2XRYA 1MMAA 5A69A 3LS8A 3L08A 4DOZA 2EINE 2FI7A 2WB2A 5L0GA 2EPOA 3ZRHA 1HH8A 3DD7A 3KL4A 3E4BA 1OXBA 5A7DB 4GYOA 4YNDA 5BW8C 2XPZA 3FU5A 2JEKA 1LS4A 3PZ1A 1NG1A 4JPSA 4LNBA 3JSZA 4ZHBA 4CEMA 3Q4AB 4EZKA 2QYUA 1R5ID 3KEAA 5EYPF 2HJ3A 1TN8A 3JSEO 5CCLA 2XRZA 5BUZA 2HUJA 3RYLA 1TNYA 4RDAA 4EBAG 3FHDA 2AXZA 4FESA 1HXIA 2VGEA 2C0MA 1NZNA 2M4EA 4GU5A 1E86A 4XWJA 3VTXA 3DE9A 1K3ZD 2GRNB 5JJTA 2XZDG 2JLBA 5COFA 5E3CA 1HO8A 3ZW3A 4IYPA 4HS2A 3T8KA 3QWPA 2VTBA 4J8DA 1N4RA 4RSYA 5CIVA 1Y8MA 2XS8A 4NQ0A 3HG0D 4FADA 5LP0A 1WG0A 2NSGA 4LACB 1HX8A 4KYOB 2YHSA 5H7PA 2J4BA 2CYDA 4I9EA 2KSFA 4A4AA 3O48A 3G2TA 3EZHA 4CDMA 1UN9A 1HE8A 4GPKA 3SXYA 1SR2A 1DOWA 2R7XA 1LD8A 2L7AA 4AE4B 1YA0A 3IQ6A 3QTHA 5JHAA 1Z6TA 4G0HA 2D4UA 4G24A 3I5PA 3UKUG 4F4BA 4Q69A 2WXKA 5ENNA 1RCPA 4GMLA 3CLJA 2L9BA 4M7CA 2YRFA 2Q4FA 4YT8A 4EKWA 2KCLA 3E37A 4F7AA 4W8PA 2GGFA 4XEVA 1N4SA 3Q7LA 4HE8D 2BL2A 1Q2ZA 3PDMP 2KC3A 4GPMA 3QWWA 2I1KA 3EPVA 4LG6A 3I5QA 4O6YA 1H9GA 3RQEA 3HXFA 3MJWA 2C2LA 3R7RA 2DBAA 3UTMA 1Y6DA 4FA6A 2R9RB 2QY7A 3TG5A 4AV7A 1BLXB 4CSAC 4ANWA 1OWPA 4YL3A 3FEYA 3US6A 3POVA 2AWIA 4G78A 2C04A 4JJFA 1Z63A 2P9UG 2JPUA 3JXIA 5KYXB 4KXKB 1E83A 5FQ8A 5AARA 1FVFA 4CZ2D 3EDTB 1DCQA 3I4RB 1SZ9A 1MX2A 4UI9C 4DRJB 2ZGGA 4JHKA 1CGOA 2X0CA 5FZTA 4XIFA 4I1MA 1VLSA 3AG4E 2HM8A 2P9LG 3LEWA 2XCCA 5C1DA 3CVPA 1T9KA 3AG1C 2V8SE 4DBRA 3K9IA 4I6EA 5JRAA 2GFHA 3QB2A 2I15A 5JUAA 5FINA 3TWXA 4KVMA 4CS9C 2H8AA 2NSFA 2XL6A 2H6HA 3M79A 3DJNB 1GQAA 1NU9C 3U8PA 1SQMA 1OR3A 4NTBA 4WNGA 2XLEA 4XI0A 3SFXA 4BG0A 3O6XA 2P61A 4IRUA 4K5BA 3BQOA 2CHZA 2QLAA 3TWUA 3W8IA 3NOCD 2Q7RA 2FFHA 1CPRA 3AG3C 4G1TA 4MVZA 4OIPF 2NUTA 2G3VA 4BJTA 4BSZB 3ASNE 3CKCA 5M72A 4K1OA 4JIOA 1D1CA 2R7SA 3HXDA 2IXMA 3ASOC 5JJ7A 2FEZA 4GZ3A 3DM9B 3B0VC 2AWCA 3RSEG 5K0IA 3PCVA 1TJCA 1YZCA 2GRRB 3LESA 4O1PA 1B68A 2E87A 4JJGA 1QQ3A 2XHEA 3CVUA 1PAQA 2EINC 3N0TA 1QZXA 4G11A 1FMWA 2NXPA 5EIBE 2EIJC 1RKEB 4B8AA 4E17A 1OCCE 3TWVA 4OIQF 2YL3A 2IFUA 4GZDA 3JCKC 4I2ZA 2YL0A 2NSZA 2D5RB 3LDZA 1TWGA 2WB7A 3KYJA 1MHQA 1BU9A 2RSEB 4JHJA 4BSXA 5F28E 3DKAA 2BKGA 2FF4A 2XS1A 4MVQA 3PEUB 2J9QA 4KC9A 1X5BA 5B1AE 3DMDA 3SXMA 4EZLA 2GROB 5LCWJ 2A6EF 4XEFA 3Q7GA 4OYSA 3CVVA 2LNIA 1FNTc 1Z5SC 4NIKA 3Q5MA 1ZHZA 1E8WA 2L6BA 2F22A 4G26A 3K1IA 4J32B 3QKYA 3EGXA 1ZYRF 2VJ8A 4QDLA 4CIPA 3LY7A 3FUEA 4A63B 4ACKA 2V5FA 3JRTA 1QLEC 4BJ6C 4ILHB 3UI2A 1XZQA 2B0OE 5CEDB 4WNDA 1MMDA 3WG7C 1LTXA 1E8XA 5G04C 3FUKA 2J9WA 3MKQA 2PNOA 2IQCA 2LQGA 3IKOB 4TXQA 3S7FA 3PZ2A 3IQTA 2J9BA 2EPLX 3FTVA 2XPIA 1EKYA 1XWJA 2X6HA 3ASDA 2A1DD 4APOA 3D9KA 3Q75A 1U6HA 5CERB 1OKKD 4JEAA 3L1MA 2IO2C 5EX3A 2ZIRA 3Q73A 5FZQA 2OJED 1NL4A 1D1BA 2G62A 5ENSD 2Q7FA 4K5CA 4OVUA 3IHYA 3DPYA 4DX1A 1BR2A 3PZ4A 3L9TA 3HRAA 2ZXWE 3MFNA 4IARA 1GGQA 2GAQA 3SXZA 4YDWA 2RD9A 2KCKA 2DZNA 3S7JA 5KYUB 2IF4A 3L22A 4UI9K 3AAAC 3PE4A 1IW7F 1MMGA 3TWQA 4MTGA 4A3TA 2V3CC 1LIHA 5EYLA 3GM1A 2IXOA 4Q7CA 2CG3A 2YLDA 3ENEA 3HNKA 2EIKE 4JTAB 2QUPA 1MZCA 4MVRA 4HXIA 3CHRA 1QPUA 3PZDA 3DM5A 2A68F 3BG1B 4O79A 1TWAA 1OCRC 2H6FA 1C02A 4TV3A 4CIHA 1FT2A 3FDHA 2VQ2A 3AG4C 4YT5A 3FTWA 4JTDB 5F5FA 1MQSA 3EUVA 4JZAA 3ZXPA 3ML9A 3D9IA 2R7VA 2XXAB 5ENTD 3CR3A 1TKNA 2IYLD 4AL0A 4U9EA 5FWQA 3RO3A 2J8SD 2V5QC 2Q3TA 3CSTA 4GB9A 3ASFA 3B7RL 1OW7A 3D3MA 2IOQA 4G25A 4IULA 5D66A 1IHBA 3MYVA 3SF4A 4O7GA 4LLEA 5LOZA 4NC3A 1WWPA 3G2SA 4IAOA 2KBXA 3AS4A 5CBNA 3RJVA 5EK0A 2XGMA 5AENA 4PFPA 4GTPA 5D0QD 3DSXA 2X3MA 2CNWA 2IOLA 3MBGA 1EQ1A 1WAO1 2XSEA 1WY6A 1OCOC 3DAFA 4KVOA 1H2VC 3UMHA 3UGPA 4ILIA 4A3VA 3GEIA 4XQ1A 2J49A 2OVFA 4GMJA 2J8WA 4C7OB 4N3BA 1V54E 1QYMA 2WVOA 4B93B 1Z3IX 4EQFA 3ULYA 2WZLA 3EGDB 2ASRA 5L0IA 2A4ZA 2LD6A 2LK4A 1Y6IA 4IB4A 2PFDA 3U2MA 4HRLA 1ELKA 2WXFA 2Y0BG 5G55A 1DNPA 1I5NA 3IV0A 3S84A 2BTDA 5ANRA 1V55E 3Q47B 4FULA 1OCCC 1N95A 3CAXA 5T8IA 3TWSA 2QE9A 3X2QC 5E76A 3C8GA 3UPVA 3FP3A 3FTZA 2M63A 3VAYA 4IGGA 1JMWA 1L3PA 1IHGA 3E33A 3T6GB 1OWOA 1LE4A 3QZCA 2DVWA 2J0XA 2ONDA 1OWLA 4C0MA 4CS7A 3FAJA 5BXUA 3LKUA 5B1AC 2VH3A 3P2BA 3CIAA 3OAWA 3FOPA 3U2LA 1AVOB 2VGXA 1H6PA 3ZVVA 3UM3A 2GW1A 2YVKA 4GYTA 3NZUA 4LNUD 3ZPJA 1HE9A 3KH2A 4JB8P 4K0RA 4RVBA 5C2YA 5KJKA 1H0AA 4TUMA 3OXLA 1KPSB 3IPMO 4KI2A 3UT4A 5DS6A 4CT0A 4U9DA 2JABA 3ASHA 3QWVA 3ZN3A 4AL1A 4LEUA 4J8SA 3AOUA 3PS6A 4TXPA 2WXMA 1BR1A 1Z7Qc 4H54A 3V2XA 2Q00A 1G4US 4L1BA 3RVZA 5T1DB 2WMOA 5BQHA 4U5HA 3EH1A 3LLKA 3OEOA 1SZIA 4U5FE 4DLQA 5CCMA 3FHEA 3PDNA 5G05C 3DE8A 1VYKA 4GTTA 4I1AA 3SY2A 1FVHA 1V74B 3TWRA 3RQGA 3SXKA 3DXJF 3O4ZA 5BQGA 1GS9A 1HE1A 4WNFA 1A0BA 1ORJA 3FULA 1ELRA 2I8BA 4L23A 2CFUA 3ULEG 3ABKE 2MHKA 3S27A 4RBNA 1A17A 3AS8A 5A6KA 1JCRA 3HHMA 4N5CA 3SBSA 1E8YA 3EHRA 3CVNA 2C03A 4I1OB 1RMVA 3MYIA 5CRVA 5ARFA 5FQ6A 3ZHEA 4C0EA 4AY6A 3G4ZA 2XLVA 4U7EB 3B29A 3V5YA 1HZ4A 3BUAA 3RIPA 4YT4A 3FEXA 4K0DA 5B3IA 3DWWA 2YL7A 2H7OA 2ZXWC 4XLPF 2FGYA 4RG6A 4ILGA 4WWNA 2F37A 5DQZA 1ZU4A 3VTYA 5D91A 3MEKA 3EH2A 4J8YA 3IEEA 2WVIA 3QW0A 2OG2A 1O3UA 4PH4B 5A6BD 1DVPA 3SD5A 1YA9A 4FX5A 4BX8A 4L9PA 3UKRG 2EIKC 4YVOA 1LI5A 2L81A 3DSTA 1KTMA 4ATZD 1U2VG 4FLHA 4JCHA 1MX6A 2A0BA 2RD0A 4CJOA 4UWKA 1QQEA 3EU5A 1S63A 4CDRA 5D0OD 1TNZA 2A5UA 3IQCA 5JMND 2BC5A 3Q9UC 3CV0A 3V79K 1WOLA 1H6KA 1YCSB 3CHPA 3FH8A 3ZFWA 2CHWA 5COGA 3NF1A 1YAUO 1C03A 3B7SA 3UM1A 2PP4A 1FT1A 1JOGA 2A5EA 3A9CA 1S70B 3ZSUA 3RF3A 1ZZPA 4YDEA 3HDXA 5L0FA 4ME2A 3FTSA 1S64A 3EHMA 2EPMX 3CZ6A 3T5XA 2VASA 3B7UX 1T6IA 4UWFA 1T6UA 1Z3YA 3CVXA 3LVQE 3LJNA 4WGZA 1YDIA 3CVYA 3O55A 4U95D 2L6HA 3TWWA 3UM0A 3FUJA 4J30B 4UDVA 4PK4A 2R7QA 4HFFB 1V54C 3T9OA 1MX4A 3VYWA 2IOSA 3ECSA 3H2UA 3UT7A 3ZWIA 4JXTA 4J6IA 1TNUA 1A7VA 4OINF 3G2UA 3PEVB 2IEJA 2LCHA 4MW3A 2Y39A 2EPKX 4UWGA 1YLMA 3J5PA 4O1OA 3HNIA 4LRZA 1E85A 3B71A 5A6AA 5GPGB 4HB5A 5ENRD 4W9RA 3TD7A 2FO1E 1C17M 2M64A 2OEXA 1MQVA 3ASGA 3GYZA 3FU3A 3B13A 4AJWA 4HOQA 1H9TA 3GEHA 2YQ8A 4GAAA 2GRQB 2VCBA 3TXNA 4GCOA 3EQLF 3JQ0A 5AQAA 3MV2B 4Q96A 3C18A 2R7WA 4MLPA 3GODA 2KC7A 1HG5A 4UWLA 5BXOA 5KJMA 2WXHA 4GYYA 4U0SA 3FUHA 4BETA 3BG0B 3AQCA 1O1TA 3S90A 4AIFA 5CECB 1N94A 1TR4A 3GWLA 2FULA 5B1BE 4JTCB 3H65A 4HLEA 4NQFA 3JTLO 4AP2A 2V26A 2VTBB 1S05A 2AP3A 2YL1A 5HI7A 5AQ7A 4ATGA 4XEIG 3JRMO 4HRMB 1LE2A 3SZ7A 4PS3A 3DSVA 1PCXA 1ZB1A 2R5SA 5DS4A 2R7TA 2XRHA 3O10A 3CHQA 3T4RA 1HW1A 4U5GA 2XPYA 4OAUC 4HI9A 1YA7O 4APFA 4DI3A 3RQFA 3DSWA 1TFKB 1Q0GA 5CMWA 3ABKC 3FOOA 4J7TA 4D4XA 4IJJA 3L0IA 2I6HA 5A23A 5KJLA 1IZMA 1L5JA 4AK9A 1R4TA 2ZXOA 4ZFHA 3SBTB 4AY5A 3SNXA 3TXMA 3QVYA 4KBLA 3ZUVB 3L8IA 2WQ6A 1CPQA 1OCZE 3C7JA 3RRUA 3C3OA 3UMIA 4L2LA 1OT8A 2WVQA 4JZYA 1BZ4A 4BEJA 1E7UA 4AXHA 4LDQA 4J7WA 2HE0A 4IWBA 5AC4A 4BY6A 2J46A 2KNHA 2R7OA 5BNWA 1UW4B 5J08A 5FZSA 3DEOA 4JA9A 2XM0A 3VLFA 3RRNB 2L6FA 2OVBA 1HU3A 5ANLA 1OKKA 1SMYF 3EJNA 4H4KC 3GM2A 3CK7A 2XEVA 3ZTZA 5FQ7A 2WXNA 1FFTC 4O60A 1WTYA 3K6BA 3PREA 4XTKA 1WGWA 4DVYP 3L13A 1F1MA 2R7UA 3K7DA 2CDQA 2DCPA 2YINA 1XNFA 1NZEA 3NKDA 2VCCA 3LY9A 3NAWA 4E6HA 2VC9A 2WXRA 4PR9A 4DX2A 3CVLA 1H19A 3QMKA 4DLOA 3DPDA 1NFIE 3R7QA 1N0RA 4BJ5A 3OWTA 3TJ5A 2R02A 4DBQA 4CYMD 2Q9BA 4H7XA 3O39A 2W4MA 4Y6WA 1IQUA 2KW3C 2LAIA 2JD3A 4UUCA 3M4BA 3JUEA 3PUJA 3L17A 4XI9A 1YYHA 3LS0A 1S7ZA 3CK8A 2Q9AA 2PF4E 3EIQC 3PNTB 2RG8A 2F8YA 3KS2A 1U3DA 5JT4A 5CHEE 3CVWA 3OXGA 4JL0A 2J7PD 5L3VA 4GTRA 3U3BA 4N06A 4O6NA 3LLIA 4K7BA 3T6JA 1K05A 5E33A 3I4UA 4YT2A 3Q7FA 3FTXA 4CDYA 3PNLB 1Y4CA 4WNEA 3UX4A 4BT8A 1D9SA 3TL5A 4B94A 2H6GA 4GA1A 4WJ0A 3G50A 3FU0A 3JXJA 3ZQYA 3AJIA 2ZISA 4GTMA 3ZYLA 1E2XA 2YLIA 1YYJA 5COMA 3ABME 3BRJA 3F6QA 3U0CA 1Z6AA 2Z15A 3C5RA 1N4PA 5FIOA 5AQBA 4CS8A 3UIOC 2LUHA 1N9AA 1Q0KA 1TN7A 2DYSE 4I2WA 3ZEFA 2DI3A 3L82A 1BI7B 1JUQA 1HF8A 2A6HF 1S0PA 3C3QA 1B89A 4PJNA 3DRAA 4YVQC 5D92A 3U64A 4J0UA 2PL2A 4DI4A 3FFLA 4KZ0A 2VB6A 2X6IA 2PX0A 4GA2A 1QVXA 4F6RD 5BUOA 2MWQA 1W2WA 5D2MC 5LX8A 3U9JA 4URKA 2RKKA 2KXPC 2XGOA 2DWZA 4DVZA 2YEVA 5AYWD 3DAGA 1E90A 1VMAA 2XGSA 4PDXA 2X38A 1NU7D 2OCCE 4EZJA 1TWCA 3T8MA 3EFOA 3F46A 4X0RA 3VRCA 1UJJA 1FAPB 4TXRA 1J8YF 3PHF2 2QC9A 5B1BC 3W8HA 3LEOA 3M4CA 3EGXB 2IJGX 1JR8A 1PD1A 4PJLA 5BV1A 2KM4A 3TJ6A 4ONSA 3UXGA 4PFOA 3PMRA 1N1CA 4EHPA 2ZXPA 3NYJA 1INZA 1ORSC 3UNGC 5CI8A 4Z9IA 2W9YA 4I44A 1A41A 1OWNA 4PACA 3C62A 4WWPA 4F3VA 4HLLA 4CDVA 3VF0A 3Q79A 3ZKJA 1N52A 3C3RA 2YLGA 3D9MA 2V4LA 2YQYA 2PBEA 5EILA 1AP7A 3LJ3A 4BJ1A 4KNWA 3LCAA 2KQ9A 4EUKB 1SYQA 3FMSA 3KKBA 3LEVA 4EBJA 3BU8A 3KSQA 1AUEA 5DQTA 4PJMA 4PS8A 4C3EA 2V4HC 1WN0A 5CRUA 5JS5A 4U0ZA 4F1SA 1IYGA 3B0UX 1E7VA 3HYMB 3CEXA 1OCZC 1V4AA 4GZCA 1PC2A 4FJYA 2IO3C 1ZHTA 4DJAA 2L0TB 4B89A 2LXMA 2UWJG 2HMQA 3U3WA 4KZCA 3MV3B 1NBBA 4NTFA 5HRYA 2WM9A 2BEDA 4E85A 2IXPA 4EHMA 4OVVA 1QKRA 4WUYA 2H7BA 1O5MA 2AXVA 1G5ZA 1Q0DA 1UJKA 5LFAA 3DSSA 4UI9J 1NLXA 2LSUA 4GTQA 2J07A 3ASNC 2B0HA 5BT1A 2WXGA 3IQ5A 4WGYA 4EIYA 1JPJA 1M56C 4JEUA 5KYWA 2ZU6B 2XCBA 4F53A 3GORA 4HRNA 3QC1A 5FJYA 1G4WR 1VLTA 3ITFA 4G23A 3UMKA 3AU4A 1UG7A 5F5HA 3PVLA 4GTSA 2UY1A 2WPVA 3U4TA 1M2OA 3BEHA 3S7BA 3S9OA 1K40A 4OIOF 4FLBA 4J8EA 3HVEA 3K66A 1APCA 5A6BA 2GRLA 3E30A 5HS0A 3K1IC 2MOWA 2LP4A 5E75A 4WABA 1M2VB 2J45A 5JLIA 3PE3A 4E0HA 2NG1A 1UN8A 4GZ5A 1H6GA 1NFNA 4CDNA 5ENOD 4D10C 2WXPA 4CT4A 3LAYA 1RJ9A 4HQDA 3SHFA 3AQBA 2W4BA 1IKND 4DJ9A 1D8DA 2KZTB 3QNKA 4DK5A 2PQNA 2P9NG 3B7TA 2NUPB 4XE0A 2RFMA 4L7TA 3ZXSA 2DZOA 5AN8A 2ILRA 2CCYA 3L8JA 5HQ8A 1WDYA 1QSPA 1UG3A 2EQXA 3EG9A 3Q49B 4IN3B 1HFAA 1OXKA 2QNLA 3UGOA 3UIPC 2XEHA 4WWOA 2NYJA 2PX3A 4L6RA 3V7OA 2Y3AA 4OIRF 4MVOA 2LO6A 3APFA 1O5HA 5FQ4A 1D0YA 3T5VA 3IEGA 5KYYA 3D9PA 4B0ZA 3ABMC 2UUHA 3EHNA 1BD8A 1W3BA 5EHHA 2AU5A 3LUTB 2DIWA 2P9IG 5B3SE 4E18A 3RAUA 4EBKA 1ZVZA 5L0CA 3SO8A 4DRIB 2DYSC 1ZW2A 3DZAA 2KK1A 2KJGA 4W8KA 4N3CA 1T01A 2P9PG 3HXCA 4RQIA 4HBDA 5AAOA 1E84A 4DUIA 4BEMJ 3ZGQA 5T3RA 3SP1A 5T3TA 4EBAA 3ZU7B 2HZ8A 4TRQA 3C8GB 2XZTG 3MKRA 4X8QA 3WODF 1T5OA 1K04A 2YKZA 4LDRA 256BA 2AW6A 2Y1LE 3CHOA 1OW8A 5A6JA 4G2VA 1MJ0A 2MHRA 2NPUA 3M1CB 1OXJA 3D9HA 1X81A 1VK5A 4MRUA 5DVWA 2Q9CA 3ABLE 4GQHA 3QVZA 2J08A 1KT1A 2LXLA 4NTAA 2A69F 3ZTMA 3TWTA 5ITZF 3SZRA 3UM2A 2R25A 2YHEA 5DS5A 1HG2A 2Y69E 3AG1E 2HMZA 1JPLA 5G04J 4JEBA 1OWMA 3L16A 5KWDA 3T6BA 5AQ9A 3WHNA 3FH5A 1DOVA 4FWVA 4GTVA 2G3KA 2HR2A 4P9FA 2V0PA 1WATA 1AWCB 2C0LA 4JKVA 1FCHA 1ZU2A 1K1AA 3X1OA 4BEPA 4F1PA 4A2NB 3W2WA 2X6JA 4U5BE 5CI9A 2QYJA 4DRHB 4C3BA 5FZRA 4DX6D 2L6GA 3ZVRA 1KU2A 2BF0X 4XEKA 4ER9A 3V5XA 2LAHA 4Z9JA 3UR3C 2L0IA 4HOUA 1OW6A 3G2WA 4YWQA 2OJQA 1TN6A 3W9FA 4JVSA 3FUFA 2BE5F 5DBKA 5LCWC 3CHMA 4U5DE 1MNEA 5KBAA 4EBBA 1HS6A 1PY1A 4GCNA 2OEVA 3T9KA 1H2UA 4BESA 1Q0FA 3ZHEB 3ASOE 4O6FA 3E34A 2AWYA 3FU6A 5KNHD 3W2VA 2GRMA 3SYNA 3HJCA 4HNAD 4HVBA 3IHUA 2E2EA 4J7YA 3HKKA 4I3MA 4AVXA 4R32A 4AE4A 2LSEA 2EIJE 1KT0A 4NRHB 3SQVA 3J06A 1TNBA 3NG1A 1OR2A 3NKEA 2Y3DA 4LNGA 2MRIA 3IXEA 4U8HA 4QI0A 5FCLA 3W4YA 1H2TC 2ETBA 4JA7A 1J8MF 3ESLA 1A7EA 4IAQA 1RXQA 2IONA 2CW0F 2WXQA 3JCUQ 5DLJA 4WAFA 3TG4A 2EIME 4NACA 3SEOA 4N2QA 5G2NA 1NP7A 5BPPA 3H2VA 3CHSA 4I9CA 4G8LA 4LSZE 1JCSA 4U8YD 3DSUA 2F8XK 1TFOB 3GZ1A 5L3QA 3ISMC 3P1UA 4N5QA 4CGWA 4C9BB 4G7ZF 4ANJA 1FR0A 1K8KG 3SFZA 3NYMA 3OXFA 1GW6A 3B7BA 1TR2A 4LUNU 1V55C 4PS7A 1KZOA 4HORA 1QNFA 1HY5A 4BTAA 3KD7A 4FJZA 2RFAA 1EI7A 4H7YA 1BBHA 3WG7E 5KYXA 3FH7A 4JCZA 1NA0A 2I2OA 1VB5A 3U9WA 4YL1A 1XGWA 3PZ3A 4MNDA 3Q15A 1ELWA 3RO2A 3RW0A 5FTPA 2XM4A 1LVKA 4LCTA 3TAXA 1EYHA 3EIJA 2B0JA 2J0WA 1MMNA 4L2YA 5EN5D 2VCAA 4BJ6A 5BQIA 4YL0A 1P5QA 4MVMA 2P6VA 4U5CE 2VSNA 2WXLA 1H7IA 4Z9HA 2IM8A 4CX9A 4U0UA 2P2CP 2YHCA 1EA8A 2MYOA 3MZLB 4N3AA 1IQRA 2TMVP 3CQGB 5JJ6A 5FT9A 2L6JA 2DGJA 3ZDLA 1FTSA 4I43A 3Q7AA
chains in the Genus database with same CATH topology
3E9VA 3UQ3A 3DBSA 5E3AA 5B3SC 3MLGA 4E7SA 3CKBA 3OA1A 4ANUA 2WQ7A 4ZLCA 3ESKA 3FUMA 4ACLA 3VLEA 3C98A 2J7PA 4FC8A 3CVQA 3NRHA 4AEZC 3GANA 2WVNA 2VGYA 3N24A 1VDYA 3NQPA 5DIZA 1O87A 1ST6A 3I4GA 2P7VA 3FTYA 3CGHA 2WQHA 4A1GA 2HYZA 4AOFA 3WXXA 3ABLC 3ULQA 3I3NA 3D9JA 3GW4A 1EPUA 4GA0A 3E70C 2KATA 1TEZA 4Q4ZF 3JYSA 4FP7A 2Y69C 4OD5A 2WXIA 3FDQA 3VLDA 5G05J 3KMIA 3QDNA 1E96B 4B8CB 4G7OF 3OTNA 1M57C 1Z3XA 3JQ1A 4O6MA 4G7HF 4FHJA 2OOEA 3UMVA 4YJWA 1EDUA 1KLXA 3U66A 3RFYA 2VYIA 4P6IC 3FVYA 3L34A 3RKVA 3LY8A 3IHVA 3MA5A 4CCAA 2FO7A 3BEEA 4BT9A 3K1HA 4JW1A 1ZBPA 3JYHA 3N2ZB 3RH3A 3S28A 2YNQA 3MGBA 4KMOA 3QJZA 3TJPA 5EX0A 3QARA 2WZGA 4XKBA 4A1SA 2AVPA 1OUVA 2OV8A 2P58C 3RKOF 1VOMA 4EECA 2CGEA 3HTKC 4AX2A 3QK0A 2NUTB 1D0ZA 2EIMC 2Y4UA 1Z23A 3EZIA 4NY3A 2IU1A 3CQCB 2CFZA 4ANVA 4MQ9F 4I6JA 2J9UA 3CEQA 3FUDA 3QOUA 2WMNA 4BFRA 3FTUA 5KYUA 1JWGA 2QFCA 4E7ZA 4JHRA 4QFVA 2Y3HA 2J4DA 2CHXA 4P29A 5J90A 5A6CA 2PM7A 3ZIBA 3F47A 4I6GA 4JEHA 4BTBA 5EKQD 4MKTA 3PUKA 2WXJA 4EWCA 1TWHA 3UT8A 3NZSA 4CRWA 4DPRA 3RIBA 5E2QA 1Z5ZA 2XXAA 4KBQA 3HIZA 4Q94A 2IXNA 4ULWA 1JWFA 4HEAJ 3FY4A 4Q5SF 4JURI 3ZC4A 4K03A 3GZ2A 3ONKA 4RG9A 2I1JA 2FBNA 4GZ6A 3ZYQA 4V3IA 2ZPAA 5ARGA 3JUIA 3L54A 1EF1C 1LS1A 2KCVA 3MKQB 3DJUB 4PJJA 3ZG1A 3APDA 4C3DA 5BV0A 2X51A 3APCA 4UQXA 2R7RA 4C7OA 5KCMA 4A55A 4ABNA 1MNDA 4HOTA 4HFKB 1FMVA 3LYAA 3EGDA 3CSKA 4HFGA 3SI5A 4R7LA 2I9CA 3ZYKA 4YN0B 2XQ0A 2VSOE 2WXOA 4TUUA 4AM9A 2MYSA 5AJLA 3MCXA 3EFOB 3S29A 1JPNA 1SZAA 3ZIMA 1D0XA 1WM5A 3NYLA 1M2VA 2AXUA 2VSXE 5AJDA 4BJ5C 2WL8A 2Y4TA 3SNHA 3GZSA 5KYNA 2H7VC 3FUIA 4GYWA 3UUXA 2KZTA 2WZFA 3LJBA 4RD9A 2NUPA 3LS1A 1ZHWA 1U3CA 3R9AB 3S2AA 2HV7A 5AIJA 1TJFA 4UQZA 2J9VA 3B0PA 1E8ZA 1N54A 1VYIA 4I17A 5HSWA 2CG2A 5CMYA 5T4YA 3MX3A 3TGOA 1QZ2A 2Y3GA 2X6KA 4U04A 3K33A 5EGYA 4KNVA 2BUGA 4PUCA 4XZ4A 1ZHYA 2E0IA 3D9OA 1D1AA 3RU0A 4EPZA 4ANXA 3S0XA 1PD0A 4CS8C 3RRMB 4J8FA 2VSYA 3B9QA 4UWHA 3KAEA 2HV6A 3ONLA 2NC9A 4FHKA 3FWVA 4MS6A 5KYWB 3FUNA 4XLNF 2HO1A 2PM6A 3SGHA 4JC8A 3RK6A 4B6IA 2X6FA 3CQZA 2UY1B 1LF8A 4BX9A 2LSVA 4M3OA 2EILC 3HVEB 5EDSA 1BPOA 2QTVA 4HOSA 4UQYA 2W45A 3CK9A 1FFHA 2Y3BA 4U07A 3L6AA 1RJ9B 1LKXA 3HLZA 4M63A 4CBEA 1BR4A 2QY9A 4CSAA 4XKCA 1NA3A 2CNWD 2VGXB 2L9JA 2O9XA 3N71A 1ZHXA 3LPZA 2OCCC 4BWRA 3EG9B 4LERA 1SF8A 4XX5A 5JHBA 3D9LA 2ZXRA 4Y6CA 3D9NA 3JT1A 3Q6MA 4CGVA 5T3WA 5IY5C 3CSFA 3AS5A 5KYYB 4QI2A 4NURA 2DYRC 2XL4A 2R17C 4OD4A 4U5EE 2J09A 3QAQA 3NDBB 3ZYMA 3S7DA 4FU3A 4KT6B 3ML8A 2YZSA 2KGOA 4ZLDA 3AG2C 4N2SA 3PRZA 3Q6NA 3KEZA 2PQRA 3URZA 1G8XA 3IBEA 1ZU5A 3LNRA 4CS9A 3PH0C 3AU5A 3G2VA 3LXUX 5KJNA 2PZIA 4LLCA 3LVRE 4N39A 4GEHA 4U63A 2R59A 2XRYA 1MMAA 3LS8A 3L08A 4DOZA 2FI7A 2WB2A 3ZRHA 1HH8A 3DD7A 3KL4A 3E4BA 5A7DB 4GYOA 4YNDA 5BW8C 2XPZA 3FU5A 2JEKA 1NG1A 4JPSA 3JSZA 4CEMA 3Q4AB 4EZKA 5CCLA 2XRZA 5BUZA 3RYLA 4RDAA 4EBAG 3FHDA 2AXZA 4FESA 1HXIA 2C0MA 1NZNA 2M4EA 4GU5A 4XWJA 3VTXA 5JJTA 2JLBA 5E3CA 1HO8A 3ZW3A 4IYPA 4HS2A 3QWPA 2VTBA 4J8DA 4RSYA 1Y8MA 4NQ0A 4FADA 5LP0A 4LACB 1HX8A 4KYOB 2YHSA 2J4BA 4I9EA 3O48A 3G2TA 3EZHA 4CDMA 1UN9A 1HE8A 4GPKA 2R7XA 4AE4B 1YA0A 5JHAA 1Z6TA 4G0HA 4G24A 3I5PA 4F4BA 4Q69A 2WXKA 5ENNA 4GMLA 3CLJA 2L9BA 4YT8A 2KCLA 4F7AA 2GGFA 3Q7LA 4HE8D 3QWWA 2I1KA 3EPVA 3I5QA 4O6YA 3MJWA 3R7RA 2C2LA 2DBAA 4FA6A 2QY7A 3TG5A 4AV7A 4CSAC 4ANWA 1OWPA 3FEYA 3POVA 2AWIA 2C04A 4JJFA 1Z63A 5KYXB 4KXKB 5FQ8A 1FVFA 3EDTB 3I4RB 1SZ9A 4UI9C 4JHKA 4XIFA 4I1MA 2HM8A 3LEWA 2XCCA 5C1DA 3CVPA 3AG1C 2V8SE 4DBRA 3K9IA 4I6EA 2GFHA 3QB2A 4KVMA 4CS9C 3DJNB 1NU9C 1SQMA 4WNGA 4XI0A 4BG0A 3O6XA 4IRUA 2CHZA 3W8IA 2FFHA 3AG3C 4G1TA 4OIPF 2NUTA 2G3VA 4BJTA 3CKCA 5M72A 1D1CA 2R7SA 2IXMA 3ASOC 5JJ7A 2FEZA 4GZ3A 3DM9B 3B0VC 1TJCA 3LESA 2E87A 4JJGA 2XHEA 3CVUA 1PAQA 2EINC 3N0TA 1QZXA 4G11A 1FMWA 2NXPA 2EIJC 4B8AA 4OIQF 2IFUA 4GZDA 3JCKC 4I2ZA 2NSZA 2D5RB 3LDZA 1TWGA 2WB7A 1MHQA 4JHJA 4BSXA 2FF4A 3PEUB 2J9QA 4KC9A 1X5BA 3DMDA 4EZLA 5LCWJ 2A6EF 3Q7GA 4OYSA 3CVVA 2LNIA 3Q5MA 1ZHZA 1E8WA 4G26A 4J32B 3QKYA 3EGXA 1ZYRF 2VJ8A 4QDLA 3LY7A 3FUEA 4ACKA 2V5FA 3JRTA 1QLEC 4BJ6C 4ILHB 4WNDA 1MMDA 3WG7C 1E8XA 5G04C 3FUKA 2J9WA 3MKQA 2IQCA 3IKOB 3S7FA 3FTVA 2XPIA 2X6HA 3ASDA 2A1DD 4APOA 3D9KA 1OKKD 5EX3A 5FZQA 1D1BA 2G62A 2Q7FA 4OVUA 3IHYA 1BR2A 2KCKA 3S7JA 5KYUB 2IF4A 3L22A 4UI9K 3PE4A 1IW7F 1MMGA 4A3TA 2V3CC 2IXOA 4Q7CA 2CG3A 3ENEA 4HXIA 3CHRA 3PZDA 3DM5A 2A68F 3BG1B 4O79A 1TWAA 1OCRC 4TV3A 4CIHA 3FDHA 2VQ2A 3AG4C 4YT5A 3FTWA 5F5FA 1MQSA 4JZAA 3ML9A 3D9IA 2R7VA 2XXAB 3CR3A 1TKNA 2IYLD 5FWQA 3RO3A 2Q3TA 3CSTA 4GB9A 3ASFA 3B7RL 3D3MA 2IOQA 4G25A 4IULA 3MYVA 3SF4A 4O7GA 4LLEA 5LOZA 3G2SA 4IAOA 3AS4A 3RJVA 2XGMA 5AENA 4PFPA 5D0QD 2X3MA 2CNWA 2IOLA 1WAO1 2XSEA 1WY6A 1OCOC 3DAFA 4KVOA 1H2VC 3UMHA 3UGPA 4ILIA 4A3VA 2J49A 2OVFA 4GMJA 4C7OB 4N3BA 2WVOA 1Z3IX 4EQFA 2WZLA 3EGDB 2A4ZA 1Y6IA 2PFDA 1ELKA 2WXFA 5G55A 1DNPA 3IV0A 2BTDA 5ANRA 3Q47B 4FULA 1OCCC 5T8IA 3X2QC 5E76A 3UPVA 3FP3A 3FTZA 2M63A 3VAYA 1IHGA 1OWOA 3QZCA 2J0XA 2ONDA 1OWLA 4C0MA 4CS7A 3FAJA 3LKUA 5B1AC 2VH3A 3P2BA 3CIAA 3OAWA 2VGXA 3ZVVA 2GW1A 4GYTA 3NZUA 3ZPJA 3KH2A 4K0RA 4RVBA 5C2YA 5KJKA 1H0AA 3OXLA 4KI2A 3UT4A 5DS6A 4CT0A 3ASHA 3QWVA 3ZN3A 4LEUA 4J8SA 3PS6A 2WXMA 1BR1A 4L1BA 5T1DB 2WMOA 4U5HA 3EH1A 3LLKA 3OEOA 1SZIA 4U5FE 4DLQA 5CCMA 3FHEA 3PDNA 5G05C 1VYKA 4I1AA 1FVHA 3DXJF 3O4ZA 4WNFA 3FULA 1ELRA 2I8BA 4L23A 2CFUA 3AS8A 2MHKA 3S27A 4RBNA 1A17A 3HHMA 3SBSA 4N5CA 1E8YA 3CVNA 2C03A 4I1OB 5ARFA 5FQ6A 3ZHEA 4C0EA 4AY6A 1HZ4A 3RIPA 4YT4A 3FEXA 4K0DA 2H7OA 2ZXWC 4XLPF 2FGYA 4RG6A 4ILGA 4WWNA 5DQZA 1ZU4A 3VTYA 5D91A 3MEKA 3EH2A 3IEEA 2WVIA 2OG2A 4PH4B 1DVPA 3SD5A 4FX5A 4BX8A 2EIKC 4YVOA 2L81A 4FLHA 4JCHA 2RD0A 4UWKA 1QQEA 4CDRA 5D0OD 2A5UA 3CV0A 1H6KA 3CHPA 3FH8A 3ZFWA 2CHWA 3NF1A 3B7SA 2PP4A 3ZSUA 3HDXA 4ME2A 3FTSA 3EHMA 3CZ6A 3T5XA 2VASA 3B7UX 4UWFA 1Z3YA 3CVXA 3LVQE 3CVYA 3FUJA 4J30B 4PK4A 2R7QA 4HFFB 1V54C 3VYWA 2IOSA 3ECSA 3UT7A 4JXTA 4J6IA 4OINF 3G2UA 3PEVB 2Y39A 4UWGA 4LRZA 4W9RA 3TD7A 3ASGA 3GYZA 3FU3A 3B13A 4AJWA 4HOQA 2YQ8A 4GAAA 3TXNA 4GCOA 3EQLF 3JQ0A 3MV2B 4Q96A 2R7WA 4MLPA 3GODA 2KC7A 1HG5A 4UWLA 5KJMA 2WXHA 4GYYA 4U0SA 3FUHA 3BG0B 3AQCA 4AIFA 2FULA 3H65A 4HLEA 4AP2A 2V26A 2VTBB 5HI7A 4ATGA 3SZ7A 4PS3A 1PCXA 2R5SA 5DS4A 2R7TA 2XRHA 3CHQA 3T4RA 4U5GA 2XPYA 4APFA 4DI3A 5CMWA 3ABKC 4IJJA 3L0IA 2I6HA 5A23A 5KJLA 1IZMA 1L5JA 4AK9A 2ZXOA 3SBTB 4AY5A 3SNXA 3TXMA 4KBLA 2WQ6A 3RRUA 3UMIA 4L2LA 2WVQA 4JZYA 4BEJA 1E7UA 4AXHA 4IWBA 4BY6A 2J46A 2KNHA 2R7OA 5BNWA 1UW4B 5J08A 5FZSA 4JA9A 3VLFA 3RRNB 2OVBA 1HU3A 5ANLA 1OKKA 1SMYF 3EJNA 4H4KC 3CK7A 2XEVA 5FQ7A 2WXNA 1FFTC 3K6BA 3PREA 4XTKA 1WGWA 4DVYP 3L13A 2R7UA 3K7DA 2CDQA 2DCPA 2YINA 1XNFA 1NZEA 3NKDA 3LY9A 4E6HA 2WXRA 3CVLA 1H19A 3QMKA 4DLOA 3DPDA 3R7QA 4BJ5A 3OWTA 4DBQA 2Q9BA 4H7XA 3O39A 2W4MA 4Y6WA 1IQUA 2KW3C 2LAIA 2JD3A 3PUJA 3L17A 4XI9A 3LS0A 1S7ZA 3CK8A 2Q9AA 2PF4E 3EIQC 3PNTB 2RG8A 3KS2A 1U3DA 5CHEE 3CVWA 3OXGA 4JL0A 2J7PD 5L3VA 4N06A 4O6NA 3LLIA 4K7BA 3T6JA 5E33A 3I4UA 4YT2A 3FTXA 3PNLB 4WNEA 3UX4A 4BT8A 3TL5A 4B94A 4GA1A 4WJ0A 3FU0A 3ZYLA 1Z6AA 2Z15A 4CS8A 4I2WA 3ZEFA 1JUQA 1HF8A 2A6HF 1S0PA 1B89A 4PJNA 4YVQC 5D92A 3U64A 4J0UA 2PL2A 4DI4A 3FFLA 4KZ0A 2VB6A 2X6IA 2PX0A 4GA2A 5BUOA 2MWQA 1W2WA 5LX8A 4URKA 2XGOA 4DVZA 2YEVA 5AYWD 3DAGA 1E90A 1VMAA 2XGSA 4PDXA 2X38A 1NU7D 4EZJA 1TWCA 3T8MA 3EFOA 3F46A 4X0RA 1UJJA 1J8YF 3PHF2 5B1BC 3W8HA 3EGXB 2IJGX 4PJLA 1PD1A 5BV1A 2KM4A 4PFOA 3PMRA 1N1CA 2ZXPA 3NYJA 1INZA 3UNGC 5CI8A 2W9YA 4I44A 1OWNA 4WWPA 4F3VA 1N52A 3D9MA 2V4LA 3LJ3A 4BJ1A 4KNWA 3LCAA 2KQ9A 3KKBA 3LEVA 5DQTA 4PJMA 4PS8A 4C3EA 4U0ZA 4F1SA 1IYGA 3B0UX 1E7VA 3HYMB 1OCZC 4GZCA 1PC2A 4FJYA 1ZHTA 4DJAA 2L0TB 4B89A 2UWJG 3U3WA 4KZCA 3MV3B 2WM9A 4E85A 2IXPA 4OVVA 4WUYA 2H7BA 2AXVA 5LFAA 1UJKA 4UI9J 2LSUA 2J07A 3ASNC 5BT1A 2WXGA 1JPJA 1M56C 4JEUA 5KYWA 2ZU6B 2XCBA 4F53A 3QC1A 5FJYA 3ITFA 4G23A 3UMKA 3AU4A 5F5HA 3PVLA 2UY1A 2WPVA 3U4TA 1M2OA 3S7BA 4OIOF 4FLBA 4J8EA 3HVEA 3K66A 2GRLA 3K1IC 2MOWA 5E75A 1M2VB 2J45A 3PE3A 2NG1A 1UN8A 4GZ5A 4CDNA 4D10C 2WXPA 4CT4A 3LAYA 1RJ9A 3SHFA 3AQBA 2W4BA 2KZTB 3QNKA 4DK5A 2PQNA 3B7TA 2NUPB 4XE0A 4L7TA 3ZXSA 2ILRA 5HQ8A 1UG3A 2EQXA 3EG9A 3Q49B 4IN3B 1HFAA 3UGOA 4WWOA 2PX3A 3V7OA 2Y3AA 4OIRF 3APFA 2LO6A 1O5HA 5FQ4A 1D0YA 3T5VA 3IEGA 5KYYA 3D9PA 4B0ZA 3ABMC 3EHNA 1W3BA 5EHHA 2DIWA 2DYSC 3DZAA 2KJGA 4W8KA 4N3CA 3ZGQA 5T3RA 3SP1A 5T3TA 4EBAA 4TRQA 3MKRA 3WODF 2AW6A 3CHOA 4G2VA 3M1CB 1VK5A 4MRUA 5DVWA 2Q9CA 2J08A 1KT1A 2A69F 3SZRA 2YHEA 5DS5A 1HG2A 1JPLA 5G04J 1OWMA 3L16A 3T6BA 3FH5A 4FWVA 2G3KA 2HR2A 2V0PA 2C0LA 1ZU2A 1FCHA 3X1OA 4A2NB 3W2WA 2X6JA 4U5BE 5CI9A 5FZRA 4C3BA 3ZVRA 1KU2A 2BF0X 2LAHA 3UR3C 2L0IA 4HOUA 3G2WA 4YWQA 4JVSA 3FUFA 2BE5F 5DBKA 5LCWC 3CHMA 4U5DE 1MNEA 4EBBA 1HS6A 1PY1A 4GCNA 1H2UA 3ZHEB 4O6FA 3FU6A 3W2VA 2GRMA 3SYNA 3HJCA 4HVBA 2E2EA 4I3MA 4AVXA 4AE4A 2LSEA 1KT0A 4NRHB 3NG1A 3NKEA 2Y3DA 2MRIA 4U8HA 4QI0A 5FCLA 1H2TC 4JA7A 1J8MF 3ESLA 2IONA 2CW0F 2WXQA 3JCUQ 5DLJA 4WAFA 3TG4A 4NACA 3SEOA 4N2QA 5G2NA 1NP7A 5BPPA 3CHSA 4I9CA 3GZ1A 5L3QA 3P1UA 4CGWA 4C9BB 4G7ZF 4ANJA 3SFZA 3OXFA 3NYMA 1GW6A 1TR2A 4LUNU 1V55C 4PS7A 4HORA 1QNFA 4BTAA 3KD7A 4FJZA 4H7YA 5KYXA 3FH7A 1NA0A 2I2OA 3U9WA 1XGWA 4MNDA 3Q15A 1ELWA 3RO2A 5FTPA 1LVKA 4LCTA 3TAXA 1EYHA 3EIJA 2B0JA 2J0WA 1MMNA 4L2YA 4BJ6A 1P5QA 2P6VA 4U5CE 2VSNA 2WXLA 4U0UA 3MZLB 2YHCA 4N3AA 1IQRA 3CQGB 5JJ6A 5FT9A 2L6JA 2DGJA 1FTSA 4I43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1M A;  4JVS A;  4I1O B;  4IRU A;  4JW1 A; 
#chains in the Genus database with same CATH topology
 3E9V A;  3UQ3 A;  3DBS A;  4QQI A;  1BDJ B;  3ZQV A;  5E3A A;  5B3S C;  3MLG A;  1HW2 A;  3NMK A;  4E7S A;  3C8Z A;  3CKB A;  4C48 B;  3RVY A;  3OA1 A;  4ANU A;  2P0N A;  2WQ7 A;  4ZLC A;  3ESK A;  2ZD9 A;  3FUM A;  4ACL A;  1SW6 A;  2GWW A;  2QZA A;  3TQO A;  3U3F A;  3VLE A;  1VTM P;  2HFI A;  3C98 A;  2J7P A;  4FC8 A;  3CVQ A;  3NRH A;  4AEZ C;  3GAN A;  2WVN A;  2VGY A;  3AGU A;  3N24 A;  1VDY A;  3NQP A;  5DIZ A;  1O87 A;  1ST6 A;  3I4G A;  3ZNG A;  2P7V A;  3FTY A;  4GTO A;  3CGH A;  1TQG A;  1OCR E;  4ULV A;  2WQH A;  4A1G A;  2HYZ A;  1CGN A;  2OOC A;  4AOF A;  3WXX A;  4XPY A;  3NMJ A;  3ABL C;  3ULQ A;  3I3N A;  3TOM A;  4Z68 A;  3D9J A;  1RKE A;  3GW4 A;  1EPU A;  4GA0 A;  3E70 C;  2GRP B;  2KAT A;  2ETA A;  3W9G A;  1TEZ A;  4Q4Z F;  3JYS A;  4YDY A;  3TK0 A;  4FP7 A;  2Y69 C;  4CJG A;  1YAR O;  4OD5 A;  2WXI A;  3FDQ A;  3VLD A;  5G05 J;  3KMI A;  2UUI A;  3QDN A;  1E96 B;  3DXM G;  2R03 A;  4B8C B;  4G7O F;  3OTN A;  4MW8 A;  1M57 C;  1Z3X A;  2EPN A;  3JQ1 A;  4O6M A;  2XLO A;  4G7H F;  4FHJ A;  2OOE A;  3UMV A;  4HI8 A;  4YJW A;  1XZP A;  1OCO E;  3FXH A;  2P9S G;  1EDU A;  4D4N A;  1KLX A;  3U66 A;  4BPM A;  3RFY A;  1N0Q A;  1D8E A;  2HSB A;  5CEA A;  2VYI A;  2JX0 A;  4P6I C;  3FVY A;  5HV9 A;  3L34 A;  3RKV A;  2AVK A;  3LY8 A;  3IHV A;  3MA5 A;  4CCA A;  2FO7 A;  3BEE A;  4BT9 A;  1UOH A;  2R2L A;  2A0U A;  2HSQ A;  3K1H A;  1Q0M A;  4BER A;  4JW1 A;  1ZBP A;  1LD7 A;  1A7D A;  1ORY A;  3JYH A;  3N2Z B;  3RH3 A;  3S28 A;  2YNQ A;  3MGB A;  4KMO A;  5JSL A;  3G4X A;  3QJZ A;  1HMO A;  3TJP A;  4DXW A;  5EX0 A;  1SA4 A;  3QAR A;  2PNN A;  2OEW A;  2WZG A;  1OQC A;  4XKB A;  5L0H A;  2IBF A;  4A1S A;  1I4Z A;  1RZ4 A;  3X2Q E;  2R05 A;  2AVP A;  1OUV A;  1U89 A;  2ETS A;  2OV8 A;  4G8K A;  2P58 C;  3RKO F;  1VOM A;  4JRZ A;  5TJ5 E;  4JD2 G;  1KNY A;  2OKU A;  4EEC A;  2CGE A;  3HTK C;  4AX2 A;  3QK0 A;  1NI1 A;  2NUT B;  1D0Z A;  2EIM C;  1JCQ A;  2Y4U A;  1Z23 A;  1NSG B;  3EZI A;  4NY3 A;  2IU1 A;  3CQC B;  2CFZ A;  3WAQ A;  4ANV A;  1LI7 A;  4MQ9 F;  2ETC A;  4I6J A;  2J9U A;  3CEQ A;  3FUD A;  3QOU A;  2WMN A;  4BFR A;  4N6H A;  3J5Q B;  3FTU A;  2LIG A;  5KYU A;  1JWG A;  2QFC A;  3DEP A;  3E32 A;  4E7Z A;  4JHR A;  4QFV A;  2P1A A;  2Y3H A;  2J4D A;  2CHX A;  4P29 A;  5J90 A;  1N11 A;  5A6C A;  2PM7 A;  2EIL E;  3ZIB A;  1CGM E;  3F47 A;  4YK5 A;  4I6G A;  3DI5 A;  3B95 A;  4JEH A;  4BTB A;  5EKQ D;  3V30 A;  4MKT A;  5JVE A;  3Q78 A;  3PUK A;  2WXJ A;  4EWC A;  1A5E A;  1TWH A;  3UT8 A;  1RW2 A;  1SVX A;  3AGT A;  3NZS A;  1M6T A;  3M15 A;  4DX7 D;  4CRW A;  4P9T A;  4DPR A;  3RIB A;  5E2Q A;  3GWN A;  3HNJ A;  1Z5Z A;  2XXA A;  4KBQ A;  3HIZ A;  4Q94 A;  2IXN A;  4ULW A;  1JWF A;  1H6O A;  4XPW A;  1JRA A;  4HEA J;  1SA5 A;  2H6I A;  1LPE A;  3FY4 A;  5HKP A;  2LFF A;  1I4Y A;  5L0D A;  2OU6 A;  4Q5S F;  1NFO A;  1YJG A;  4DRX E;  4JUR I;  3ZC4 A;  5IY5 E;  3NOG D;  4K03 A;  3KPH A;  4OAV B;  3GZ2 A;  3ONK A;  1YMP A;  4RG9 A;  2DYR E;  2I1J A;  4E0I A;  3KSL A;  2FBN A;  2XL8 A;  4GZ6 A;  3ZYQ A;  4V3I A;  4N6C A;  2ZPA A;  5ARG A;  3JUI A;  2HJM A;  1EF1 C;  3L54 A;  1LS1 A;  2KCV A;  1MYO A;  3MKQ B;  3DJU B;  5AGF A;  4PJJ A;  3ZG1 A;  3APD A;  4C3D A;  5BV0 A;  1GM5 A;  3V31 A;  2X51 A;  3APC A;  4UQX A;  2R7R A;  1L7C A;  4C7O A;  5KCM A;  3AG2 E;  4MTF A;  4A55 A;  4ABN A;  1MND A;  4HOT A;  1N4Q A;  4HFK B;  4MVU A;  1FMV A;  3DXK G;  3LYA A;  3EGD A;  4U96 D;  3CSK A;  4HFG A;  3A11 A;  3SI5 A;  4R7L A;  2I9C A;  3HNL A;  5AC5 A;  3ZYK A;  4JE9 A;  1YZA A;  4YN0 B;  2XQ0 A;  2VSO E;  2XEE A;  2WXO A;  3NMI A;  4TUU A;  3V5Z A;  2BKK B;  4AM9 A;  2MYS A;  3ATP A;  5AJL A;  3MCX A;  3EFO B;  3SFY A;  3S29 A;  1JPN A;  1SZA A;  2ICW G;  1D0X A;  3ZIM A;  2FAP B;  5L0J A;  3C63 A;  1WM5 A;  3NYL A;  1M2V A;  2AXU A;  2VSX E;  3HXB A;  3NBN B;  3LNM B;  4RLY A;  4NCQ A;  2WL8 A;  4BJ5 C;  5AJD A;  2Y4T A;  2HKV A;  4YDO A;  3SNH A;  3JZ0 A;  3GZS A;  5KYN A;  4MBG A;  1AEP A;  2H7V C;  1YYX A;  3FUI A;  4GYW A;  3AJM A;  3UUX A;  2KZT A;  2WZF A;  3LJB A;  2GA0 A;  1TNO A;  4RD9 A;  2NUP A;  3LS1 A;  1ZHW A;  1U3C A;  3R9A B;  3S2A A;  2HV7 A;  3TUL A;  4MVS A;  4K5A B;  5AIJ A;  1TJF A;  3C72 A;  1JAF A;  4UQZ A;  2J9V A;  2YWA A;  3B0P A;  1E8Z A;  1G3N B;  2XLM A;  1N54 A;  1VYI A;  4I17 A;  1DCE A;  5HSW A;  3V2O A;  2CG2 A;  5CMY A;  5T4Y A;  5ENQ D;  1WAS A;  3MX3 A;  3NB2 A;  3TGO A;  2HS5 A;  1QZ2 A;  2Y3G A;  2X6K A;  4U04 A;  3R7C A;  2F0Y A;  3K33 A;  5EGY A;  4KNV A;  2BUG A;  4XPX A;  4PUC A;  4XZ4 A;  1ZHY A;  1ZW3 A;  2E0I A;  3D9O A;  1DC2 A;  1D1A A;  3RU0 A;  3EHQ A;  4EPZ A;  4ANX A;  3MYF A;  2P9K G;  3S0X A;  1IXV A;  1PD0 A;  1T6Q A;  4CS8 C;  1LM3 B;  4LDK A;  3DWL G;  3RRM B;  4J8F A;  4FAP B;  4MS2 A;  2VSY A;  3B9Q A;  1KZP A;  4UWH A;  3KAE A;  2ZGD A;  1OY3 D;  2HV6 A;  3ONL A;  4U8V D;  2NC9 A;  4FHK A;  3FWV A;  4MS6 A;  5CBO A;  1PV3 A;  2XLD A;  5KYW B;  3U8V A;  3GM3 A;  3FUN A;  4XLN F;  2XLW A;  2HO1 A;  2PM6 A;  3SGH A;  3Q9N C;  4JC8 A;  4JC7 A;  3RK6 A;  4B6I A;  2X6F A;  3CQZ A;  2UY1 B;  4GMR A;  1LF8 A;  4BX9 A;  2LSV A;  2XLH A;  1HMD A;  4M3O A;  5EID A;  2EIL C;  2DB4 A;  1FPP A;  3U9M A;  5ENP D;  3HVE B;  5EDS A;  1BPO A;  2QTV A;  1O1R A;  3JYY A;  4HOS A;  2AJA A;  2OQM A;  4UQY A;  2W45 A;  3CK9 A;  1FFH A;  4DX5 D;  2IY0 C;  2Y3B A;  2LFD A;  3HXE A;  4U07 A;  3L6A A;  1RJ9 B;  1LKX A;  3HLZ A;  1K1B A;  4M63 A;  4CBE A;  2GDC A;  1BR4 A;  2QY9 A;  4CSA A;  4XKC A;  1NA3 A;  2CNW D;  2VGX B;  1UFB A;  2L9J A;  2O9X A;  3N71 A;  1ZHX A;  3LPZ A;  2OCC C;  2B6C A;  4BWR A;  3EG9 B;  3R2P A;  4LER A;  3R9M A;  1SF8 A;  4XX5 A;  5JHB A;  3D9L A;  2ZXR A;  4Y6C A;  3UIN C;  2XEN A;  3D9N A;  3JT1 A;  1QBQ A;  3Q6M A;  4N4W A;  4CGV A;  5T3W A;  5IY5 C;  3CSF A;  3AS5 A;  5KYY B;  4QI2 A;  4NUR A;  2DYR C;  4CDA A;  5KNG A;  3FAP B;  3TOL A;  2XL4 A;  2R17 C;  4OD4 A;  3QW1 A;  1BI8 B;  3VM6 A;  1YVI A;  4U5E E;  2J09 A;  3QAQ A;  3NDB B;  1TYQ G;  3ZYM A;  5JP7 A;  3S7D A;  4FU3 A;  4KT6 B;  3AG3 E;  3ML8 A;  2YZS A;  2KGO A;  4ZLD A;  3AG2 C;  4N2S A;  3U5S A;  3PRZ A;  3C8G D;  3Q6N A;  1RKC A;  3KEZ A;  5JA4 D;  2PQR A;  3URZ A;  1G8X A;  3IBE A;  1ZU5 A;  3LNR A;  3EU9 A;  4CS9 A;  3PH0 C;  3AU5 A;  3G2V A;  3LXU X;  5KJN A;  1U0B B;  3KYI A;  2PZI A;  4MTO A;  4LLC A;  3LVR E;  4N39 A;  2KYH A;  4GEH A;  1O1S A;  3GEE A;  4U63 A;  2R59 A;  2XRY A;  1MMA A;  5A69 A;  3LS8 A;  3L08 A;  4DOZ A;  2EIN E;  2FI7 A;  2WB2 A;  5L0G A;  2EPO A;  3ZRH A;  1HH8 A;  3DD7 A;  3KL4 A;  3E4B A;  1OXB A;  5A7D B;  4GYO A;  4YND A;  5BW8 C;  2XPZ A;  3FU5 A;  2JEK A;  1LS4 A;  3PZ1 A;  1NG1 A;  4JPS A;  4LNB A;  3JSZ A;  4ZHB A;  4CEM A;  3Q4A B;  4EZK A;  2QYU A;  1R5I D;  3KEA A;  5EYP F;  2HJ3 A;  1TN8 A;  3JSE O;  5CCL A;  2XRZ A;  5BUZ A;  2HUJ A;  3RYL A;  1TNY A;  4RDA A;  4EBA G;  3FHD A;  2AXZ A;  4FES A;  1HXI A;  2VGE A;  2C0M A;  1NZN A;  2M4E A;  4GU5 A;  1E86 A;  4XWJ A;  3VTX A;  3DE9 A;  1K3Z D;  2GRN B;  5JJT A;  2XZD G;  2JLB A;  5COF A;  5E3C A;  1HO8 A;  3ZW3 A;  4IYP A;  4HS2 A;  3T8K A;  3QWP A;  2VTB A;  4J8D A;  1N4R A;  4RSY A;  5CIV A;  1Y8M A;  2XS8 A;  4NQ0 A;  3HG0 D;  4FAD A;  5LP0 A;  1WG0 A;  2NSG A;  4LAC B;  1HX8 A;  4KYO B;  2YHS A;  5H7P A;  2J4B A;  2CYD A;  4I9E A;  2KSF A;  4A4A A;  3O48 A;  3G2T A;  3EZH A;  4CDM A;  1UN9 A;  1HE8 A;  4GPK A;  3SXY A;  1SR2 A;  1DOW A;  2R7X A;  1LD8 A;  2L7A A;  4AE4 B;  1YA0 A;  3IQ6 A;  3QTH A;  5JHA A;  1Z6T A;  4G0H A;  2D4U A;  4G24 A;  3I5P A;  3UKU G;  4F4B A;  4Q69 A;  2WXK A;  5ENN A;  1RCP A;  4GML A;  3CLJ A;  2L9B A;  4M7C A;  2YRF A;  2Q4F A;  4YT8 A;  4EKW A;  2KCL A;  3E37 A;  4F7A A;  4W8P A;  2GGF A;  4XEV A;  1N4S A;  3Q7L A;  4HE8 D;  2BL2 A;  1Q2Z A;  3PDM P;  2KC3 A;  4GPM A;  3QWW A;  2I1K A;  3EPV A;  4LG6 A;  3I5Q A;  4O6Y A;  1H9G A;  3RQE A;  3HXF A;  3MJW A;  2C2L A;  3R7R A;  2DBA A;  3UTM A;  1Y6D A;  4FA6 A;  2R9R B;  2QY7 A;  3TG5 A;  4AV7 A;  1BLX B;  4CSA C;  4ANW A;  1OWP A;  4YL3 A;  3FEY A;  3US6 A;  3POV A;  2AWI A;  4G78 A;  2C04 A;  4JJF A;  1Z63 A;  2P9U G;  2JPU A;  3JXI A;  5KYX B;  4KXK B;  1E83 A;  5FQ8 A;  5AAR A;  1FVF A;  4CZ2 D;  3EDT B;  1DCQ A;  3I4R B;  1SZ9 A;  1MX2 A;  4UI9 C;  4DRJ B;  2ZGG A;  4JHK A;  1CGO A;  2X0C A;  5FZT A;  4XIF A;  4I1M A;  1VLS A;  3AG4 E;  2HM8 A;  2P9L G;  3LEW A;  2XCC A;  5C1D A;  3CVP A;  1T9K A;  3AG1 C;  2V8S E;  4DBR A;  3K9I A;  4I6E A;  5JRA A;  2GFH A;  3QB2 A;  2I15 A;  5JUA A;  5FIN A;  3TWX A;  4KVM A;  4CS9 C;  2H8A A;  2NSF A;  2XL6 A;  2H6H A;  3M79 A;  3DJN B;  1GQA A;  1NU9 C;  3U8P A;  1SQM A;  1OR3 A;  4NTB A;  4WNG A;  2XLE A;  4XI0 A;  3SFX A;  4BG0 A;  3O6X A;  2P61 A;  4IRU A;  4K5B A;  3BQO A;  2CHZ A;  2QLA A;  3TWU A;  3W8I A;  3NOC D;  2Q7R A;  2FFH A;  1CPR A;  3AG3 C;  4G1T A;  4MVZ A;  4OIP F;  2NUT A;  2G3V A;  4BJT A;  4BSZ B;  3ASN E;  3CKC A;  5M72 A;  4K1O A;  4JIO A;  1D1C A;  2R7S A;  3HXD A;  2IXM A;  3ASO C;  5JJ7 A;  2FEZ A;  4GZ3 A;  3DM9 B;  3B0V C;  2AWC A;  3RSE G;  5K0I A;  3PCV A;  1TJC A;  1YZC A;  2GRR B;  3LES A;  4O1P A;  1B68 A;  2E87 A;  4JJG A;  1QQ3 A;  2XHE A;  3CVU A;  1PAQ A;  2EIN C;  3N0T A;  1QZX A;  4G11 A;  1FMW A;  2NXP A;  5EIB E;  2EIJ C;  1RKE B;  4B8A A;  4E17 A;  1OCC E;  3TWV A;  4OIQ F;  2YL3 A;  2IFU A;  4GZD A;  3JCK C;  4I2Z A;  2YL0 A;  2NSZ A;  2D5R B;  3LDZ A;  1TWG A;  2WB7 A;  3KYJ A;  1MHQ A;  1BU9 A;  2RSE B;  4JHJ A;  4BSX A;  5F28 E;  3DKA A;  2BKG A;  2FF4 A;  2XS1 A;  4MVQ A;  3PEU B;  2J9Q A;  4KC9 A;  1X5B A;  5B1A E;  3DMD A;  3SXM A;  4EZL A;  2GRO B;  5LCW J;  2A6E F;  4XEF A;  3Q7G A;  4OYS A;  3CVV A;  2LNI A;  1FNT c;  1Z5S C;  4NIK A;  3Q5M A;  1ZHZ A;  1E8W A;  2L6B A;  2F22 A;  4G26 A;  3K1I A;  4J32 B;  3QKY A;  3EGX A;  1ZYR F;  2VJ8 A;  4QDL A;  4CIP A;  3LY7 A;  3FUE A;  4A63 B;  4ACK A;  2V5F A;  3JRT A;  1QLE C;  4BJ6 C;  4ILH B;  3UI2 A;  1XZQ A;  2B0O E;  5CED B;  4WND A;  1MMD A;  3WG7 C;  1LTX A;  1E8X A;  5G04 C;  3FUK A;  2J9W A;  3MKQ A;  2PNO A;  2IQC A;  2LQG A;  3IKO B;  4TXQ A;  3S7F A;  3PZ2 A;  3IQT A;  2J9B A;  2EPL X;  3FTV A;  2XPI A;  1EKY A;  1XWJ A;  2X6H A;  3ASD A;  2A1D D;  4APO A;  3D9K A;  3Q75 A;  1U6H A;  5CER B;  1OKK D;  4JEA A;  3L1M A;  2IO2 C;  5EX3 A;  2ZIR A;  3Q73 A;  5FZQ A;  2OJE D;  1NL4 A;  1D1B A;  2G62 A;  5ENS D;  2Q7F A;  4K5C A;  4OVU A;  3IHY A;  3DPY A;  4DX1 A;  1BR2 A;  3PZ4 A;  3L9T A;  3HRA A;  2ZXW E;  3MFN A;  4IAR A;  1GGQ A;  2GAQ A;  3SXZ A;  4YDW A;  2RD9 A;  2KCK A;  2DZN A;  3S7J A;  5KYU B;  2IF4 A;  3L22 A;  4UI9 K;  3AAA C;  3PE4 A;  1IW7 F;  1MMG A;  3TWQ A;  4MTG A;  4A3T A;  2V3C C;  1LIH A;  5EYL A;  3GM1 A;  2IXO A;  4Q7C A;  2CG3 A;  2YLD A;  3ENE A;  3HNK A;  2EIK E;  4JTA B;  2QUP A;  1MZC A;  4MVR A;  4HXI A;  3CHR A;  1QPU A;  3PZD A;  3DM5 A;  2A68 F;  3BG1 B;  4O79 A;  1TWA A;  1OCR C;  2H6F A;  1C02 A;  4TV3 A;  4CIH A;  1FT2 A;  3FDH A;  2VQ2 A;  3AG4 C;  4YT5 A;  3FTW A;  4JTD B;  5F5F A;  1MQS A;  3EUV A;  4JZA A;  3ZXP A;  3ML9 A;  3D9I A;  2R7V A;  2XXA B;  5ENT D;  3CR3 A;  1TKN A;  2IYL D;  4AL0 A;  4U9E A;  5FWQ A;  3RO3 A;  2J8S D;  2V5Q C;  2Q3T A;  3CST A;  4GB9 A;  3ASF A;  3B7R L;  1OW7 A;  3D3M A;  2IOQ A;  4G25 A;  4IUL A;  5D66 A;  1IHB A;  3MYV A;  3SF4 A;  4O7G A;  4LLE A;  5LOZ A;  4NC3 A;  1WWP A;  3G2S A;  4IAO A;  2KBX A;  3AS4 A;  5CBN A;  3RJV A;  5EK0 A;  2XGM A;  5AEN A;  4PFP A;  4GTP A;  5D0Q D;  3DSX A;  2X3M A;  2CNW A;  2IOL A;  3MBG A;  1EQ1 A;  1WAO 1;  2XSE A;  1WY6 A;  1OCO C;  3DAF A;  4KVO A;  1H2V C;  3UMH A;  3UGP A;  4ILI A;  4A3V A;  3GEI A;  4XQ1 A;  2J49 A;  2OVF A;  4GMJ A;  2J8W A;  4C7O B;  4N3B A;  1V54 E;  1QYM A;  2WVO A;  4B93 B;  1Z3I X;  4EQF A;  3ULY A;  2WZL A;  3EGD B;  2ASR A;  5L0I A;  2A4Z A;  2LD6 A;  2LK4 A;  1Y6I A;  4IB4 A;  2PFD A;  3U2M A;  4HRL A;  1ELK A;  2WXF A;  2Y0B G;  5G55 A;  1DNP A;  1I5N A;  3IV0 A;  3S84 A;  2BTD A;  5ANR A;  1V55 E;  3Q47 B;  4FUL A;  1OCC C;  1N95 A;  3CAX A;  5T8I A;  3TWS A;  2QE9 A;  3X2Q C;  5E76 A;  3C8G A;  3UPV A;  3FP3 A;  3FTZ A;  2M63 A;  3VAY A;  4IGG A;  1JMW A;  1L3P A;  1IHG A;  3E33 A;  3T6G B;  1OWO A;  1LE4 A;  3QZC A;  2DVW A;  2J0X A;  2OND A;  1OWL A;  4C0M A;  4CS7 A;  3FAJ A;  5BXU A;  3LKU A;  5B1A C;  2VH3 A;  3P2B A;  3CIA A;  3OAW A;  3FOP A;  3U2L A;  1AVO B;  2VGX A;  1H6P A;  3ZVV A;  3UM3 A;  2GW1 A;  2YVK A;  4GYT A;  3NZU A;  4LNU D;  3ZPJ A;  1HE9 A;  3KH2 A;  4JB8 P;  4K0R A;  4RVB A;  5C2Y A;  5KJK A;  1H0A A;  4TUM A;  3OXL A;  1KPS B;  3IPM O;  4KI2 A;  3UT4 A;  5DS6 A;  4CT0 A;  4U9D A;  2JAB A;  3ASH A;  3QWV A;  3ZN3 A;  4AL1 A;  4LEU A;  4J8S A;  3AOU A;  3PS6 A;  4TXP A;  2WXM A;  1BR1 A;  1Z7Q c;  4H54 A;  3V2X A;  2Q00 A;  1G4U S;  4L1B A;  3RVZ A;  5T1D B;  2WMO A;  5BQH A;  4U5H A;  3EH1 A;  3LLK A;  3OEO A;  1SZI A;  4U5F E;  4DLQ A;  5CCM A;  3FHE A;  3PDN A;  5G05 C;  3DE8 A;  1VYK A;  4GTT A;  4I1A A;  3SY2 A;  1FVH A;  1V74 B;  3TWR A;  3RQG A;  3SXK A;  3DXJ F;  3O4Z A;  5BQG A;  1GS9 A;  1HE1 A;  4WNF A;  1A0B A;  1ORJ A;  3FUL A;  1ELR A;  2I8B A;  4L23 A;  2CFU A;  3ULE G;  3ABK E;  2MHK A;  3S27 A;  4RBN A;  1A17 A;  3AS8 A;  5A6K A;  1JCR A;  3HHM A;  4N5C A;  3SBS A;  1E8Y A;  3EHR A;  3CVN A;  2C03 A;  4I1O B;  1RMV A;  3MYI A;  5CRV A;  5ARF A;  5FQ6 A;  3ZHE A;  4C0E A;  4AY6 A;  3G4Z A;  2XLV A;  4U7E B;  3B29 A;  3V5Y A;  1HZ4 A;  3BUA A;  3RIP A;  4YT4 A;  3FEX A;  4K0D A;  5B3I A;  3DWW A;  2YL7 A;  2H7O A;  2ZXW C;  4XLP F;  2FGY A;  4RG6 A;  4ILG A;  4WWN A;  2F37 A;  5DQZ A;  1ZU4 A;  3VTY A;  5D91 A;  3MEK A;  3EH2 A;  4J8Y A;  3IEE A;  2WVI A;  3QW0 A;  2OG2 A;  1O3U A;  4PH4 B;  5A6B D;  1DVP A;  3SD5 A;  1YA9 A;  4FX5 A;  4BX8 A;  4L9P A;  3UKR G;  2EIK C;  4YVO A;  1LI5 A;  2L81 A;  3DST A;  1KTM A;  4ATZ D;  1U2V G;  4FLH A;  4JCH A;  1MX6 A;  2A0B A;  2RD0 A;  4CJO A;  4UWK A;  1QQE A;  3EU5 A;  1S63 A;  4CDR A;  5D0O D;  1TNZ A;  2A5U A;  3IQC A;  5JMN D;  2BC5 A;  3Q9U C;  3CV0 A;  3V79 K;  1WOL A;  1H6K A;  1YCS B;  3CHP A;  3FH8 A;  3ZFW A;  2CHW A;  5COG A;  3NF1 A;  1YAU O;  1C03 A;  3B7S A;  3UM1 A;  2PP4 A;  1FT1 A;  1JOG A;  2A5E A;  3A9C A;  1S70 B;  3ZSU A;  3RF3 A;  1ZZP A;  4YDE A;  3HDX A;  5L0F A;  4ME2 A;  3FTS A;  1S64 A;  3EHM A;  2EPM X;  3CZ6 A;  3T5X A;  2VAS A;  3B7U X;  1T6I A;  4UWF A;  1T6U A;  1Z3Y A;  3CVX A;  3LVQ E;  3LJN A;  4WGZ A;  1YDI A;  3CVY A;  3O55 A;  4U95 D;  2L6H A;  3TWW A;  3UM0 A;  3FUJ A;  4J30 B;  4UDV A;  4PK4 A;  2R7Q A;  4HFF B;  1V54 C;  3T9O A;  1MX4 A;  3VYW A;  2IOS A;  3ECS A;  3H2U A;  3UT7 A;  3ZWI A;  4JXT A;  4J6I A;  1TNU A;  1A7V A;  4OIN F;  3G2U A;  3PEV B;  2IEJ A;  2LCH A;  4MW3 A;  2Y39 A;  2EPK X;  4UWG A;  1YLM A;  3J5P A;  4O1O A;  3HNI A;  4LRZ A;  1E85 A;  3B71 A;  5A6A A;  5GPG B;  4HB5 A;  5ENR D;  4W9R A;  3TD7 A;  2FO1 E;  1C17 M;  2M64 A;  2OEX A;  1MQV A;  3ASG A;  3GYZ A;  3FU3 A;  3B13 A;  4AJW A;  4HOQ A;  1H9T A;  3GEH A;  2YQ8 A;  4GAA A;  2GRQ B;  2VCB A;  3TXN A;  4GCO A;  3EQL F;  3JQ0 A;  5AQA A;  3MV2 B;  4Q96 A;  3C18 A;  2R7W A;  4MLP A;  3GOD A;  2KC7 A;  1HG5 A;  4UWL A;  5BXO A;  5KJM A;  2WXH A;  4GYY A;  4U0S A;  3FUH A;  4BET A;  3BG0 B;  3AQC A;  1O1T A;  3S90 A;  4AIF A;  5CEC B;  1N94 A;  1TR4 A;  3GWL A;  2FUL A;  5B1B E;  4JTC B;  3H65 A;  4HLE A;  4NQF A;  3JTL O;  4AP2 A;  2V26 A;  2VTB B;  1S05 A;  2AP3 A;  2YL1 A;  5HI7 A;  5AQ7 A;  4ATG A;  4XEI G;  3JRM O;  4HRM B;  1LE2 A;  3SZ7 A;  4PS3 A;  3DSV A;  1PCX A;  1ZB1 A;  2R5S A;  5DS4 A;  2R7T A;  2XRH A;  3O10 A;  3CHQ A;  3T4R A;  1HW1 A;  4U5G A;  2XPY A;  4OAU C;  4HI9 A;  1YA7 O;  4APF A;  4DI3 A;  3RQF A;  3DSW A;  1TFK B;  1Q0G A;  5CMW A;  3ABK C;  3FOO A;  4J7T A;  4D4X A;  4IJJ A;  3L0I A;  2I6H A;  5A23 A;  5KJL A;  1IZM A;  1L5J A;  4AK9 A;  1R4T A;  2ZXO A;  4ZFH A;  3SBT B;  4AY5 A;  3SNX A;  3TXM A;  3QVY A;  4KBL A;  3ZUV B;  3L8I A;  2WQ6 A;  1CPQ A;  1OCZ E;  3C7J A;  3RRU A;  3C3O A;  3UMI A;  4L2L A;  1OT8 A;  2WVQ A;  4JZY A;  1BZ4 A;  4BEJ A;  1E7U A;  4AXH A;  4LDQ A;  4J7W A;  2HE0 A;  4IWB A;  5AC4 A;  4BY6 A;  2J46 A;  2KNH A;  2R7O A;  5BNW A;  1UW4 B;  5J08 A;  5FZS A;  3DEO A;  4JA9 A;  2XM0 A;  3VLF A;  3RRN B;  2L6F A;  2OVB A;  1HU3 A;  5ANL A;  1OKK A;  1SMY F;  3EJN A;  4H4K C;  3GM2 A;  3CK7 A;  2XEV A;  3ZTZ A;  5FQ7 A;  2WXN A;  1FFT C;  4O60 A;  1WTY A;  3K6B A;  3PRE A;  4XTK A;  1WGW A;  4DVY P;  3L13 A;  1F1M A;  2R7U A;  3K7D A;  2CDQ A;  2DCP A;  2YIN A;  1XNF A;  1NZE A;  3NKD A;  2VCC A;  3LY9 A;  3NAW A;  4E6H A;  2VC9 A;  2WXR A;  4PR9 A;  4DX2 A;  3CVL A;  1H19 A;  3QMK A;  4DLO A;  3DPD A;  1NFI E;  3R7Q A;  1N0R A;  4BJ5 A;  3OWT A;  3TJ5 A;  2R02 A;  4DBQ A;  4CYM D;  2Q9B A;  4H7X A;  3O39 A;  2W4M A;  4Y6W A;  1IQU A;  2KW3 C;  2LAI A;  2JD3 A;  4UUC A;  3M4B A;  3JUE A;  3PUJ A;  3L17 A;  4XI9 A;  1YYH A;  3LS0 A;  1S7Z A;  3CK8 A;  2Q9A A;  2PF4 E;  3EIQ C;  3PNT B;  2RG8 A;  2F8Y A;  3KS2 A;  1U3D A;  5JT4 A;  5CHE E;  3CVW A;  3OXG A;  4JL0 A;  2J7P D;  5L3V A;  4GTR A;  3U3B A;  4N06 A;  4O6N A;  3LLI A;  4K7B A;  3T6J A;  1K05 A;  5E33 A;  3I4U A;  4YT2 A;  3Q7F A;  3FTX A;  4CDY A;  3PNL B;  1Y4C A;  4WNE A;  3UX4 A;  4BT8 A;  1D9S A;  3TL5 A;  4B94 A;  2H6G A;  4GA1 A;  4WJ0 A;  3G50 A;  3FU0 A;  3JXJ A;  3ZQY A;  3AJI A;  2ZIS A;  4GTM A;  3ZYL A;  1E2X A;  2YLI A;  1YYJ A;  5COM A;  3ABM E;  3BRJ A;  3F6Q A;  3U0C A;  1Z6A A;  2Z15 A;  3C5R A;  1N4P A;  5FIO A;  5AQB A;  4CS8 A;  3UIO C;  2LUH A;  1N9A A;  1Q0K A;  1TN7 A;  2DYS E;  4I2W A;  3ZEF A;  2DI3 A;  3L82 A;  1BI7 B;  1JUQ A;  1HF8 A;  2A6H F;  1S0P A;  3C3Q A;  1B89 A;  4PJN A;  3DRA A;  4YVQ C;  5D92 A;  3U64 A;  4J0U A;  2PL2 A;  4DI4 A;  3FFL A;  4KZ0 A;  2VB6 A;  2X6I A;  2PX0 A;  4GA2 A;  1QVX A;  4F6R D;  5BUO A;  2MWQ A;  1W2W A;  5D2M C;  5LX8 A;  3U9J A;  4URK A;  2RKK A;  2KXP C;  2XGO A;  2DWZ A;  4DVZ A;  2YEV A;  5AYW D;  3DAG A;  1E90 A;  1VMA A;  2XGS A;  4PDX A;  2X38 A;  1NU7 D;  2OCC E;  4EZJ A;  1TWC A;  3T8M A;  3EFO A;  3F46 A;  4X0R A;  3VRC A;  1UJJ A;  1FAP B;  4TXR A;  1J8Y F;  3PHF 2;  2QC9 A;  5B1B C;  3W8H A;  3LEO A;  3M4C A;  3EGX B;  2IJG X;  1JR8 A;  1PD1 A;  4PJL A;  5BV1 A;  2KM4 A;  3TJ6 A;  4ONS A;  3UXG A;  4PFO A;  3PMR A;  1N1C A;  4EHP A;  2ZXP A;  3NYJ A;  1INZ A;  1ORS C;  3UNG C;  5CI8 A;  4Z9I A;  2W9Y A;  4I44 A;  1A41 A;  1OWN A;  4PAC A;  3C62 A;  4WWP A;  4F3V A;  4HLL A;  4CDV A;  3VF0 A;  3Q79 A;  3ZKJ A;  1N52 A;  3C3R A;  2YLG A;  3D9M A;  2V4L A;  2YQY A;  2PBE A;  5EIL A;  1AP7 A;  3LJ3 A;  4BJ1 A;  4KNW A;  3LCA A;  2KQ9 A;  4EUK B;  1SYQ A;  3FMS A;  3KKB A;  3LEV A;  4EBJ A;  3BU8 A;  3KSQ A;  1AUE A;  5DQT A;  4PJM A;  4PS8 A;  4C3E A;  2V4H C;  1WN0 A;  5CRU A;  5JS5 A;  4U0Z A;  4F1S A;  1IYG A;  3B0U X;  1E7V A;  3HYM B;  3CEX A;  1OCZ C;  1V4A A;  4GZC A;  1PC2 A;  4FJY A;  2IO3 C;  1ZHT A;  4DJA A;  2L0T B;  4B89 A;  2LXM A;  2UWJ G;  2HMQ A;  3U3W A;  4KZC A;  3MV3 B;  1NBB A;  4NTF A;  5HRY A;  2WM9 A;  2BED A;  4E85 A;  2IXP A;  4EHM A;  4OVV A;  1QKR A;  4WUY A;  2H7B A;  1O5M A;  2AXV A;  1G5Z A;  1Q0D A;  1UJK A;  5LFA A;  3DSS A;  4UI9 J;  1NLX A;  2LSU A;  4GTQ A;  2J07 A;  3ASN C;  2B0H A;  5BT1 A;  2WXG A;  3IQ5 A;  4WGY A;  4EIY A;  1JPJ A;  1M56 C;  4JEU A;  5KYW A;  2ZU6 B;  2XCB A;  4F53 A;  3GOR A;  4HRN A;  3QC1 A;  5FJY A;  1G4W R;  1VLT A;  3ITF A;  4G23 A;  3UMK A;  3AU4 A;  1UG7 A;  5F5H A;  3PVL A;  4GTS A;  2UY1 A;  2WPV A;  3U4T A;  1M2O A;  3BEH A;  3S7B A;  3S9O A;  1K40 A;  4OIO F;  4FLB A;  4J8E A;  3HVE A;  3K66 A;  1APC A;  5A6B A;  2GRL A;  3E30 A;  5HS0 A;  3K1I C;  2MOW A;  2LP4 A;  5E75 A;  4WAB A;  1M2V B;  2J45 A;  5JLI A;  3PE3 A;  4E0H A;  2NG1 A;  1UN8 A;  4GZ5 A;  1H6G A;  1NFN A;  4CDN A;  5ENO D;  4D10 C;  2WXP A;  4CT4 A;  3LAY A;  1RJ9 A;  4HQD A;  3SHF A;  3AQB A;  2W4B A;  1IKN D;  4DJ9 A;  1D8D A;  2KZT B;  3QNK A;  4DK5 A;  2PQN A;  2P9N G;  3B7T A;  2NUP B;  4XE0 A;  2RFM A;  4L7T A;  3ZXS A;  2DZO A;  5AN8 A;  2ILR A;  2CCY A;  3L8J A;  5HQ8 A;  1WDY A;  1QSP A;  1UG3 A;  2EQX A;  3EG9 A;  3Q49 B;  4IN3 B;  1HFA A;  1OXK A;  2QNL A;  3UGO A;  3UIP C;  2XEH A;  4WWO A;  2NYJ A;  2PX3 A;  4L6R A;  3V7O A;  2Y3A A;  4OIR F;  4MVO A;  2LO6 A;  3APF A;  1O5H A;  5FQ4 A;  1D0Y A;  3T5V A;  3IEG A;  5KYY A;  3D9P A;  4B0Z A;  3ABM C;  2UUH A;  3EHN A;  1BD8 A;  1W3B A;  5EHH A;  2AU5 A;  3LUT B;  2DIW A;  2P9I G;  5B3S E;  4E18 A;  3RAU A;  4EBK A;  1ZVZ A;  5L0C A;  3SO8 A;  4DRI B;  2DYS C;  1ZW2 A;  3DZA A;  2KK1 A;  2KJG A;  4W8K A;  4N3C A;  1T01 A;  2P9P G;  3HXC A;  4RQI A;  4HBD A;  5AAO A;  1E84 A;  4DUI A;  4BEM J;  3ZGQ A;  5T3R A;  3SP1 A;  5T3T A;  4EBA A;  3ZU7 B;  2HZ8 A;  4TRQ A;  3C8G B;  2XZT G;  3MKR A;  4X8Q A;  3WOD F;  1T5O A;  1K04 A;  2YKZ A;  4LDR A;  256B A;  2AW6 A;  2Y1L E;  3CHO A;  1OW8 A;  5A6J A;  4G2V A;  1MJ0 A;  2MHR A;  2NPU A;  3M1C B;  1OXJ A;  3D9H A;  1X81 A;  1VK5 A;  4MRU A;  5DVW A;  2Q9C A;  3ABL E;  4GQH A;  3QVZ A;  2J08 A;  1KT1 A;  2LXL A;  4NTA A;  2A69 F;  3ZTM A;  3TWT A;  5ITZ F;  3SZR A;  3UM2 A;  2R25 A;  2YHE A;  5DS5 A;  1HG2 A;  2Y69 E;  3AG1 E;  2HMZ A;  1JPL A;  5G04 J;  4JEB A;  1OWM A;  3L16 A;  5KWD A;  3T6B A;  5AQ9 A;  3WHN A;  3FH5 A;  1DOV A;  4FWV A;  4GTV A;  2G3K A;  2HR2 A;  4P9F A;  2V0P A;  1WAT A;  1AWC B;  2C0L A;  4JKV A;  1FCH A;  1ZU2 A;  1K1A A;  3X1O A;  4BEP A;  4F1P A;  4A2N B;  3W2W A;  2X6J A;  4U5B E;  5CI9 A;  2QYJ A;  4DRH B;  4C3B A;  5FZR A;  4DX6 D;  2L6G A;  3ZVR A;  1KU2 A;  2BF0 X;  4XEK A;  4ER9 A;  3V5X A;  2LAH A;  4Z9J A;  3UR3 C;  2L0I A;  4HOU A;  1OW6 A;  3G2W A;  4YWQ A;  2OJQ A;  1TN6 A;  3W9F A;  4JVS A;  3FUF A;  2BE5 F;  5DBK A;  5LCW C;  3CHM A;  4U5D E;  1MNE A;  5KBA A;  4EBB A;  1HS6 A;  1PY1 A;  4GCN A;  2OEV A;  3T9K A;  1H2U A;  4BES A;  1Q0F A;  3ZHE B;  3ASO E;  4O6F A;  3E34 A;  2AWY A;  3FU6 A;  5KNH D;  3W2V A;  2GRM A;  3SYN A;  3HJC A;  4HNA D;  4HVB A;  3IHU A;  2E2E A;  4J7Y A;  3HKK A;  4I3M A;  4AVX A;  4R32 A;  4AE4 A;  2LSE A;  2EIJ E;  1KT0 A;  4NRH B;  3SQV A;  3J06 A;  1TNB A;  3NG1 A;  1OR2 A;  3NKE A;  2Y3D A;  4LNG A;  2MRI A;  3IXE A;  4U8H A;  4QI0 A;  5FCL A;  3W4Y A;  1H2T C;  2ETB A;  4JA7 A;  1J8M F;  3ESL A;  1A7E A;  4IAQ A;  1RXQ A;  2ION A;  2CW0 F;  2WXQ A;  3JCU Q;  5DLJ A;  4WAF A;  3TG4 A;  2EIM E;  4NAC A;  3SEO A;  4N2Q A;  5G2N A;  1NP7 A;  5BPP A;  3H2V A;  3CHS A;  4I9C A;  4G8L A;  4LSZ E;  1JCS A;  4U8Y D;  3DSU A;  2F8X K;  1TFO B;  3GZ1 A;  5L3Q A;  3ISM C;  3P1U A;  4N5Q A;  4CGW A;  4C9B B;  4G7Z F;  4ANJ A;  1FR0 A;  1K8K G;  3SFZ A;  3NYM A;  3OXF A;  1GW6 A;  3B7B A;  1TR2 A;  4LUN U;  1V55 C;  4PS7 A;  1KZO A;  4HOR A;  1QNF A;  1HY5 A;  4BTA A;  3KD7 A;  4FJZ A;  2RFA A;  1EI7 A;  4H7Y A;  1BBH A;  3WG7 E;  5KYX A;  3FH7 A;  4JCZ A;  1NA0 A;  2I2O A;  1VB5 A;  3U9W A;  4YL1 A;  1XGW A;  3PZ3 A;  4MND A;  3Q15 A;  1ELW A;  3RO2 A;  3RW0 A;  5FTP A;  2XM4 A;  1LVK A;  4LCT A;  3TAX A;  1EYH A;  3EIJ A;  2B0J A;  2J0W A;  1MMN A;  4L2Y A;  5EN5 D;  2VCA A;  4BJ6 A;  5BQI A;  4YL0 A;  1P5Q A;  4MVM A;  2P6V A;  4U5C E;  2VSN A;  2WXL A;  1H7I A;  4Z9H A;  2IM8 A;  4CX9 A;  4U0U A;  2P2C P;  2YHC A;  1EA8 A;  2MYO A;  3MZL B;  4N3A A;  1IQR A;  2TMV P;  3CQG B;  5JJ6 A;  5FT9 A;  2L6J A;  2DGJ A;  3ZDL A;  1FTS A;  4I43 A;  3Q7A A; 
#chains in the Genus database with same CATH homology
 3E9V A;  3UQ3 A;  3DBS A;  5E3A A;  5B3S C;  3MLG A;  4E7S A;  3CKB A;  3OA1 A;  4ANU A;  2WQ7 A;  4ZLC A;  3ESK A;  3FUM A;  4ACL A;  3VLE A;  3C98 A;  2J7P A;  4FC8 A;  3CVQ A;  3NRH A;  4AEZ C;  3GAN A;  2WVN A;  2VGY A;  3N24 A;  1VDY A;  3NQP A;  5DIZ A;  1O87 A;  1ST6 A;  3I4G A;  2P7V A;  3FTY A;  3CGH A;  2WQH A;  4A1G A;  2HYZ A;  4AOF A;  3WXX A;  3ABL C;  3ULQ A;  3I3N A;  3D9J A;  3GW4 A;  1EPU A;  4GA0 A;  3E70 C;  2KAT A;  1TEZ A;  4Q4Z F;  3JYS A;  4FP7 A;  2Y69 C;  4OD5 A;  2WXI A;  3FDQ A;  3VLD A;  5G05 J;  3KMI A;  3QDN A;  1E96 B;  4B8C B;  4G7O F;  3OTN A;  1M57 C;  1Z3X A;  3JQ1 A;  4O6M A;  4G7H F;  4FHJ A;  2OOE A;  3UMV A;  4YJW A;  1EDU A;  1KLX A;  3U66 A;  3RFY A;  2VYI A;  4P6I C;  3FVY A;  3L34 A;  3RKV A;  3LY8 A;  3IHV A;  3MA5 A;  4CCA A;  2FO7 A;  3BEE A;  4BT9 A;  3K1H A;  4JW1 A;  1ZBP A;  3JYH A;  3N2Z B;  3RH3 A;  3S28 A;  2YNQ A;  3MGB A;  4KMO A;  3QJZ A;  3TJP A;  5EX0 A;  3QAR A;  2WZG A;  4XKB A;  4A1S A;  2AVP A;  1OUV A;  2OV8 A;  2P58 C;  3RKO F;  1VOM A;  4EEC A;  2CGE A;  3HTK C;  4AX2 A;  3QK0 A;  2NUT B;  1D0Z A;  2EIM C;  2Y4U A;  1Z23 A;  3EZI A;  4NY3 A;  2IU1 A;  3CQC B;  2CFZ A;  4ANV A;  4MQ9 F;  4I6J A;  2J9U A;  3CEQ A;  3FUD A;  3QOU A;  2WMN A;  4BFR A;  3FTU A;  5KYU A;  1JWG A;  2QFC A;  4E7Z A;  4JHR A;  4QFV A;  2Y3H A;  2J4D A;  2CHX A;  4P29 A;  5J90 A;  5A6C A;  2PM7 A;  3ZIB A;  3F47 A;  4I6G A;  4JEH A;  4BTB A;  5EKQ D;  4MKT A;  3PUK A;  2WXJ A;  4EWC A;  1TWH A;  3UT8 A;  3NZS A;  4CRW A;  4DPR A;  3RIB A;  5E2Q A;  1Z5Z A;  2XXA A;  4KBQ A;  3HIZ A;  4Q94 A;  2IXN A;  4ULW A;  1JWF A;  4HEA J;  3FY4 A;  4Q5S F;  4JUR I;  3ZC4 A;  4K03 A;  3GZ2 A;  3ONK A;  4RG9 A;  2I1J A;  2FBN A;  4GZ6 A;  3ZYQ A;  4V3I A;  2ZPA A;  5ARG A;  3JUI A;  3L54 A;  1EF1 C;  1LS1 A;  2KCV A;  3MKQ B;  3DJU B;  4PJJ A;  3ZG1 A;  3APD A;  4C3D A;  5BV0 A;  2X51 A;  3APC A;  4UQX A;  2R7R A;  4C7O A;  5KCM A;  4A55 A;  4ABN A;  1MND A;  4HOT A;  4HFK B;  1FMV A;  3LYA A;  3EGD A;  3CSK A;  4HFG A;  3SI5 A;  4R7L A;  2I9C A;  3ZYK A;  4YN0 B;  2XQ0 A;  2VSO E;  2WXO A;  4TUU A;  4AM9 A;  2MYS A;  5AJL A;  3MCX A;  3EFO B;  3S29 A;  1JPN A;  1SZA A;  3ZIM A;  1D0X A;  1WM5 A;  3NYL A;  1M2V A;  2AXU A;  2VSX E;  5AJD A;  4BJ5 C;  2WL8 A;  2Y4T A;  3SNH A;  3GZS A;  5KYN A;  2H7V C;  3FUI A;  4GYW A;  3UUX A;  2KZT A;  2WZF A;  3LJB A;  4RD9 A;  2NUP A;  3LS1 A;  1ZHW A;  1U3C A;  3R9A B;  3S2A A;  2HV7 A;  5AIJ A;  1TJF A;  4UQZ A;  2J9V A;  3B0P A;  1E8Z A;  1N54 A;  1VYI A;  4I17 A;  5HSW A;  2CG2 A;  5CMY A;  5T4Y A;  3MX3 A;  3TGO A;  1QZ2 A;  2Y3G A;  2X6K A;  4U04 A;  3K33 A;  5EGY A;  4KNV A;  2BUG A;  4PUC A;  4XZ4 A;  1ZHY A;  2E0I A;  3D9O A;  1D1A A;  3RU0 A;  4EPZ A;  4ANX A;  3S0X A;  1PD0 A;  4CS8 C;  3RRM B;  4J8F A;  2VSY A;  3B9Q A;  4UWH A;  3KAE A;  2HV6 A;  3ONL A;  2NC9 A;  4FHK A;  3FWV A;  4MS6 A;  5KYW B;  3FUN A;  4XLN F;  2HO1 A;  2PM6 A;  3SGH A;  4JC8 A;  3RK6 A;  4B6I A;  2X6F A;  3CQZ A;  2UY1 B;  1LF8 A;  4BX9 A;  2LSV A;  4M3O A;  2EIL C;  3HVE B;  5EDS A;  1BPO A;  2QTV A;  4HOS A;  4UQY A;  2W45 A;  3CK9 A;  1FFH A;  2Y3B A;  4U07 A;  3L6A A;  1RJ9 B;  1LKX A;  3HLZ A;  4M63 A;  4CBE A;  1BR4 A;  2QY9 A;  4CSA A;  4XKC A;  1NA3 A;  2CNW D;  2VGX B;  2L9J A;  2O9X A;  3N71 A;  1ZHX A;  3LPZ A;  2OCC C;  4BWR A;  3EG9 B;  4LER A;  1SF8 A;  4XX5 A;  5JHB A;  3D9L A;  2ZXR A;  4Y6C A;  3D9N A;  3JT1 A;  3Q6M A;  4CGV A;  5T3W A;  5IY5 C;  3CSF A;  3AS5 A;  5KYY B;  4QI2 A;  4NUR A;  2DYR C;  2XL4 A;  2R17 C;  4OD4 A;  4U5E E;  2J09 A;  3QAQ A;  3NDB B;  3ZYM A;  3S7D A;  4FU3 A;  4KT6 B;  3ML8 A;  2YZS A;  2KGO A;  4ZLD A;  3AG2 C;  4N2S A;  3PRZ A;  3Q6N A;  3KEZ A;  2PQR A;  3URZ A;  1G8X A;  3IBE A;  1ZU5 A;  3LNR A;  4CS9 A;  3PH0 C;  3AU5 A;  3G2V A;  3LXU X;  5KJN A;  2PZI A;  4LLC A;  3LVR E;  4N39 A;  4GEH A;  4U63 A;  2R59 A;  2XRY A;  1MMA A;  3LS8 A;  3L08 A;  4DOZ A;  2FI7 A;  2WB2 A;  3ZRH A;  1HH8 A;  3DD7 A;  3KL4 A;  3E4B A;  5A7D B;  4GYO A;  4YND A;  5BW8 C;  2XPZ A;  3FU5 A;  2JEK A;  1NG1 A;  4JPS A;  3JSZ A;  4CEM A;  3Q4A B;  4EZK A;  5CCL A;  2XRZ A;  5BUZ A;  3RYL A;  4RDA A;  4EBA G;  3FHD A;  2AXZ A;  4FES A;  1HXI A;  2C0M A;  1NZN A;  2M4E A;  4GU5 A;  4XWJ A;  3VTX A;  5JJT A;  2JLB A;  5E3C A;  1HO8 A;  3ZW3 A;  4IYP A;  4HS2 A;  3QWP A;  2VTB A;  4J8D A;  4RSY A;  1Y8M A;  4NQ0 A;  4FAD A;  5LP0 A;  4LAC B;  1HX8 A;  4KYO B;  2YHS A;  2J4B A;  4I9E A;  3O48 A;  3G2T A;  3EZH A;  4CDM A;  1UN9 A;  1HE8 A;  4GPK A;  2R7X A;  4AE4 B;  1YA0 A;  5JHA A;  1Z6T A;  4G0H A;  4G24 A;  3I5P A;  4F4B A;  4Q69 A;  2WXK A;  5ENN A;  4GML A;  3CLJ A;  2L9B A;  4YT8 A;  2KCL A;  4F7A A;  2GGF A;  3Q7L A;  4HE8 D;  3QWW A;  2I1K A;  3EPV A;  3I5Q A;  4O6Y A;  3MJW A;  3R7R A;  2C2L A;  2DBA A;  4FA6 A;  2QY7 A;  3TG5 A;  4AV7 A;  4CSA C;  4ANW A;  1OWP A;  3FEY A;  3POV A;  2AWI A;  2C04 A;  4JJF A;  1Z63 A;  5KYX B;  4KXK B;  5FQ8 A;  1FVF A;  3EDT B;  3I4R B;  1SZ9 A;  4UI9 C;  4JHK A;  4XIF A;  4I1M A;  2HM8 A;  3LEW A;  2XCC A;  5C1D A;  3CVP A;  3AG1 C;  2V8S E;  4DBR A;  3K9I A;  4I6E A;  2GFH A;  3QB2 A;  4KVM A;  4CS9 C;  3DJN B;  1NU9 C;  1SQM A;  4WNG A;  4XI0 A;  4BG0 A;  3O6X A;  4IRU A;  2CHZ A;  3W8I A;  2FFH A;  3AG3 C;  4G1T A;  4OIP F;  2NUT A;  2G3V A;  4BJT A;  3CKC A;  5M72 A;  1D1C A;  2R7S A;  2IXM A;  3ASO C;  5JJ7 A;  2FEZ A;  4GZ3 A;  3DM9 B;  3B0V C;  1TJC A;  3LES A;  2E87 A;  4JJG A;  2XHE A;  3CVU A;  1PAQ A;  2EIN C;  3N0T A;  1QZX A;  4G11 A;  1FMW A;  2NXP A;  2EIJ C;  4B8A A;  4OIQ F;  2IFU A;  4GZD A;  3JCK C;  4I2Z A;  2NSZ A;  2D5R B;  3LDZ A;  1TWG A;  2WB7 A;  1MHQ A;  4JHJ A;  4BSX A;  2FF4 A;  3PEU B;  2J9Q A;  4KC9 A;  1X5B A;  3DMD A;  4EZL A;  5LCW J;  2A6E F;  3Q7G A;  4OYS A;  3CVV A;  2LNI A;  3Q5M A;  1ZHZ A;  1E8W A;  4G26 A;  4J32 B;  3QKY A;  3EGX A;  1ZYR F;  2VJ8 A;  4QDL A;  3LY7 A;  3FUE A;  4ACK A;  2V5F A;  3JRT A;  1QLE C;  4BJ6 C;  4ILH B;  4WND A;  1MMD A;  3WG7 C;  1E8X A;  5G04 C;  3FUK A;  2J9W A;  3MKQ A;  2IQC A;  3IKO B;  3S7F A;  3FTV A;  2XPI A;  2X6H A;  3ASD A;  2A1D D;  4APO A;  3D9K A;  1OKK D;  5EX3 A;  5FZQ A;  1D1B A;  2G62 A;  2Q7F A;  4OVU A;  3IHY A;  1BR2 A;  2KCK A;  3S7J A;  5KYU B;  2IF4 A;  3L22 A;  4UI9 K;  3PE4 A;  1IW7 F;  1MMG A;  4A3T A;  2V3C C;  2IXO A;  4Q7C A;  2CG3 A;  3ENE A;  4HXI A;  3CHR A;  3PZD A;  3DM5 A;  2A68 F;  3BG1 B;  4O79 A;  1TWA A;  1OCR C;  4TV3 A;  4CIH A;  3FDH A;  2VQ2 A;  3AG4 C;  4YT5 A;  3FTW A;  5F5F A;  1MQS A;  4JZA A;  3ML9 A;  3D9I A;  2R7V A;  2XXA B;  3CR3 A;  1TKN A;  2IYL D;  5FWQ A;  3RO3 A;  2Q3T A;  3CST A;  4GB9 A;  3ASF A;  3B7R L;  3D3M A;  2IOQ A;  4G25 A;  4IUL A;  3MYV A;  3SF4 A;  4O7G A;  4LLE A;  5LOZ A;  3G2S A;  4IAO A;  3AS4 A;  3RJV A;  2XGM A;  5AEN A;  4PFP A;  5D0Q D;  2X3M A;  2CNW A;  2IOL A;  1WAO 1;  2XSE A;  1WY6 A;  1OCO C;  3DAF A;  4KVO A;  1H2V C;  3UMH A;  3UGP A;  4ILI A;  4A3V A;  2J49 A;  2OVF A;  4GMJ A;  4C7O B;  4N3B A;  2WVO A;  1Z3I X;  4EQF A;  2WZL A;  3EGD B;  2A4Z A;  1Y6I A;  2PFD A;  1ELK A;  2WXF A;  5G55 A;  1DNP A;  3IV0 A;  2BTD A;  5ANR A;  3Q47 B;  4FUL A;  1OCC C;  5T8I A;  3X2Q C;  5E76 A;  3UPV A;  3FP3 A;  3FTZ A;  2M63 A;  3VAY A;  1IHG A;  1OWO A;  3QZC A;  2J0X A;  2OND A;  1OWL A;  4C0M A;  4CS7 A;  3FAJ A;  3LKU A;  5B1A C;  2VH3 A;  3P2B A;  3CIA A;  3OAW A;  2VGX A;  3ZVV A;  2GW1 A;  4GYT A;  3NZU A;  3ZPJ A;  3KH2 A;  4K0R A;  4RVB A;  5C2Y A;  5KJK A;  1H0A A;  3OXL A;  4KI2 A;  3UT4 A;  5DS6 A;  4CT0 A;  3ASH A;  3QWV A;  3ZN3 A;  4LEU A;  4J8S A;  3PS6 A;  2WXM A;  1BR1 A;  4L1B A;  5T1D B;  2WMO A;  4U5H A;  3EH1 A;  3LLK A;  3OEO A;  1SZI A;  4U5F E;  4DLQ A;  5CCM A;  3FHE A;  3PDN A;  5G05 C;  1VYK A;  4I1A A;  1FVH A;  3DXJ F;  3O4Z A;  4WNF A;  3FUL A;  1ELR A;  2I8B A;  4L23 A;  2CFU A;  3AS8 A;  2MHK A;  3S27 A;  4RBN A;  1A17 A;  3HHM A;  3SBS A;  4N5C A;  1E8Y A;  3CVN A;  2C03 A;  4I1O B;  5ARF A;  5FQ6 A;  3ZHE A;  4C0E A;  4AY6 A;  1HZ4 A;  3RIP A;  4YT4 A;  3FEX A;  4K0D A;  2H7O A;  2ZXW C;  4XLP F;  2FGY A;  4RG6 A;  4ILG A;  4WWN A;  5DQZ A;  1ZU4 A;  3VTY A;  5D91 A;  3MEK A;  3EH2 A;  3IEE A;  2WVI A;  2OG2 A;  4PH4 B;  1DVP A;  3SD5 A;  4FX5 A;  4BX8 A;  2EIK C;  4YVO A;  2L81 A;  4FLH A;  4JCH A;  2RD0 A;  4UWK A;  1QQE A;  4CDR A;  5D0O D;  2A5U A;  3CV0 A;  1H6K A;  3CHP A;  3FH8 A;  3ZFW A;  2CHW A;  3NF1 A;  3B7S A;  2PP4 A;  3ZSU A;  3HDX A;  4ME2 A;  3FTS A;  3EHM A;  3CZ6 A;  3T5X A;  2VAS A;  3B7U X;  4UWF A;  1Z3Y A;  3CVX A;  3LVQ E;  3CVY A;  3FUJ A;  4J30 B;  4PK4 A;  2R7Q A;  4HFF B;  1V54 C;  3VYW A;  2IOS A;  3ECS A;  3UT7 A;  4JXT A;  4J6I A;  4OIN F;  3G2U A;  3PEV B;  2Y39 A;  4UWG A;  4LRZ A;  4W9R A;  3TD7 A;  3ASG A;  3GYZ A;  3FU3 A;  3B13 A;  4AJW A;  4HOQ A;  2YQ8 A;  4GAA A;  3TXN A;  4GCO A;  3EQL F;  3JQ0 A;  3MV2 B;  4Q96 A;  2R7W A;  4MLP A;  3GOD A;  2KC7 A;  1HG5 A;  4UWL A;  5KJM A;  2WXH A;  4GYY A;  4U0S A;  3FUH A;  3BG0 B;  3AQC A;  4AIF A;  2FUL A;  3H65 A;  4HLE A;  4AP2 A;  2V26 A;  2VTB B;  5HI7 A;  4ATG A;  3SZ7 A;  4PS3 A;  1PCX A;  2R5S A;  5DS4 A;  2R7T A;  2XRH A;  3CHQ A;  3T4R A;  4U5G A;  2XPY A;  4APF A;  4DI3 A;  5CMW A;  3ABK C;  4IJJ A;  3L0I A;  2I6H A;  5A23 A;  5KJL A;  1IZM A;  1L5J A;  4AK9 A;  2ZXO A;  3SBT B;  4AY5 A;  3SNX A;  3TXM A;  4KBL A;  2WQ6 A;  3RRU A;  3UMI A;  4L2L A;  2WVQ A;  4JZY A;  4BEJ A;  1E7U A;  4AXH A;  4IWB A;  4BY6 A;  2J46 A;  2KNH A;  2R7O A;  5BNW A;  1UW4 B;  5J08 A;  5FZS A;  4JA9 A;  3VLF A;  3RRN B;  2OVB A;  1HU3 A;  5ANL A;  1OKK A;  1SMY F;  3EJN A;  4H4K C;  3CK7 A;  2XEV A;  5FQ7 A;  2WXN A;  1FFT C;  3K6B A;  3PRE A;  4XTK A;  1WGW A;  4DVY P;  3L13 A;  2R7U A;  3K7D A;  2CDQ A;  2DCP A;  2YIN A;  1XNF A;  1NZE A;  3NKD A;  3LY9 A;  4E6H A;  2WXR A;  3CVL A;  1H19 A;  3QMK A;  4DLO A;  3DPD A;  3R7Q A;  4BJ5 A;  3OWT A;  4DBQ A;  2Q9B A;  4H7X A;  3O39 A;  2W4M A;  4Y6W A;  1IQU A;  2KW3 C;  2LAI A;  2JD3 A;  3PUJ A;  3L17 A;  4XI9 A;  3LS0 A;  1S7Z A;  3CK8 A;  2Q9A A;  2PF4 E;  3EIQ C;  3PNT B;  2RG8 A;  3KS2 A;  1U3D A;  5CHE E;  3CVW A;  3OXG A;  4JL0 A;  2J7P D;  5L3V A;  4N06 A;  4O6N A;  3LLI A;  4K7B A;  3T6J A;  5E33 A;  3I4U A;  4YT2 A;  3FTX A;  3PNL B;  4WNE A;  3UX4 A;  4BT8 A;  3TL5 A;  4B94 A;  4GA1 A;  4WJ0 A;  3FU0 A;  3ZYL A;  1Z6A A;  2Z15 A;  4CS8 A;  4I2W A;  3ZEF A;  1JUQ A;  1HF8 A;  2A6H F;  1S0P A;  1B89 A;  4PJN A;  4YVQ C;  5D92 A;  3U64 A;  4J0U A;  2PL2 A;  4DI4 A;  3FFL A;  4KZ0 A;  2VB6 A;  2X6I A;  2PX0 A;  4GA2 A;  5BUO A;  2MWQ A;  1W2W A;  5LX8 A;  4URK A;  2XGO A;  4DVZ A;  2YEV A;  5AYW D;  3DAG A;  1E90 A;  1VMA A;  2XGS A;  4PDX A;  2X38 A;  1NU7 D;  4EZJ A;  1TWC A;  3T8M A;  3EFO A;  3F46 A;  4X0R A;  1UJJ A;  1J8Y F;  3PHF 2;  5B1B C;  3W8H A;  3EGX B;  2IJG X;  4PJL A;  1PD1 A;  5BV1 A;  2KM4 A;  4PFO A;  3PMR A;  1N1C A;  2ZXP A;  3NYJ A;  1INZ A;  3UNG C;  5CI8 A;  2W9Y A;  4I44 A;  1OWN A;  4WWP A;  4F3V A;  1N52 A;  3D9M A;  2V4L A;  3LJ3 A;  4BJ1 A;  4KNW A;  3LCA A;  2KQ9 A;  3KKB A;  3LEV A;  5DQT A;  4PJM A;  4PS8 A;  4C3E A;  4U0Z A;  4F1S A;  1IYG A;  3B0U X;  1E7V A;  3HYM B;  1OCZ C;  4GZC A;  1PC2 A;  4FJY A;  1ZHT A;  4DJA A;  2L0T B;  4B89 A;  2UWJ G;  3U3W A;  4KZC A;  3MV3 B;  2WM9 A;  4E85 A;  2IXP A;  4OVV A;  4WUY A;  2H7B A;  2AXV A;  5LFA A;  1UJK A;  4UI9 J;  2LSU A;  2J07 A;  3ASN C;  5BT1 A;  2WXG A;  1JPJ A;  1M56 C;  4JEU A;  5KYW A;  2ZU6 B;  2XCB A;  4F53 A;  3QC1 A;  5FJY A;  3ITF A;  4G23 A;  3UMK A;  3AU4 A;  5F5H A;  3PVL A;  2UY1 A;  2WPV A;  3U4T A;  1M2O A;  3S7B A;  4OIO F;  4FLB A;  4J8E A;  3HVE A;  3K66 A;  2GRL A;  3K1I C;  2MOW A;  5E75 A;  1M2V B;  2J45 A;  3PE3 A;  2NG1 A;  1UN8 A;  4GZ5 A;  4CDN A;  4D10 C;  2WXP A;  4CT4 A;  3LAY A;  1RJ9 A;  3SHF A;  3AQB A;  2W4B A;  2KZT B;  3QNK A;  4DK5 A;  2PQN A;  3B7T A;  2NUP B;  4XE0 A;  4L7T A;  3ZXS A;  2ILR A;  5HQ8 A;  1UG3 A;  2EQX A;  3EG9 A;  3Q49 B;  4IN3 B;  1HFA A;  3UGO A;  4WWO A;  2PX3 A;  3V7O A;  2Y3A A;  4OIR F;  3APF A;  2LO6 A;  1O5H A;  5FQ4 A;  1D0Y A;  3T5V A;  3IEG A;  5KYY A;  3D9P A;  4B0Z A;  3ABM C;  3EHN A;  1W3B A;  5EHH A;  2DIW A;  2DYS C;  3DZA A;  2KJG A;  4W8K A;  4N3C A;  3ZGQ A;  5T3R A;  3SP1 A;  5T3T A;  4EBA A;  4TRQ A;  3MKR A;  3WOD F;  2AW6 A;  3CHO A;  4G2V A;  3M1C B;  1VK5 A;  4MRU A;  5DVW A;  2Q9C A;  2J08 A;  1KT1 A;  2A69 F;  3SZR A;  2YHE A;  5DS5 A;  1HG2 A;  1JPL A;  5G04 J;  1OWM A;  3L16 A;  3T6B A;  3FH5 A;  4FWV A;  2G3K A;  2HR2 A;  2V0P A;  2C0L A;  1ZU2 A;  1FCH A;  3X1O A;  4A2N B;  3W2W A;  2X6J A;  4U5B E;  5CI9 A;  5FZR A;  4C3B A;  3ZVR A;  1KU2 A;  2BF0 X;  2LAH A;  3UR3 C;  2L0I A;  4HOU A;  3G2W A;  4YWQ A;  4JVS A;  3FUF A;  2BE5 F;  5DBK A;  5LCW C;  3CHM A;  4U5D E;  1MNE A;  4EBB A;  1HS6 A;  1PY1 A;  4GCN A;  1H2U A;  3ZHE B;  4O6F A;  3FU6 A;  3W2V A;  2GRM A;  3SYN A;  3HJC A;  4HVB A;  2E2E A;  4I3M A;  4AVX A;  4AE4 A;  2LSE A;  1KT0 A;  4NRH B;  3NG1 A;  3NKE A;  2Y3D A;  2MRI A;  4U8H A;  4QI0 A;  5FCL A;  1H2T C;  4JA7 A;  1J8M F;  3ESL A;  2ION A;  2CW0 F;  2WXQ A;  3JCU Q;  5DLJ A;  4WAF A;  3TG4 A;  4NAC A;  3SEO A;  4N2Q A;  5G2N A;  1NP7 A;  5BPP A;  3CHS A;  4I9C A;  3GZ1 A;  5L3Q A;  3P1U A;  4CGW A;  4C9B B;  4G7Z F;  4ANJ A;  3SFZ A;  3OXF A;  3NYM A;  1GW6 A;  1TR2 A;  4LUN U;  1V55 C;  4PS7 A;  4HOR A;  1QNF A;  4BTA A;  3KD7 A;  4FJZ A;  4H7Y A;  5KYX A;  3FH7 A;  1NA0 A;  2I2O A;  3U9W A;  1XGW A;  4MND A;  3Q15 A;  1ELW A;  3RO2 A;  5FTP A;  1LVK A;  4LCT A;  3TAX A;  1EYH A;  3EIJ A;  2B0J A;  2J0W A;  1MMN A;  4L2Y A;  4BJ6 A;  1P5Q A;  2P6V A;  4U5C E;  2VSN A;  2WXL A;  4U0U A;  3MZL B;  2YHC A;  4N3A A;  1IQR A;  3CQG B;  5JJ6 A;  5FT9 A;  2L6J A;  2DGJ A;  1FTS A;  4I43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...