4I1OB

Crystal structure of the legionella pneumophila gap domain of lepb in complex with rab1b bound to gdp and bef3
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
291
structure length
280
Chain Sequence
b'PLTLLMTSSTSFSETINQWADILKTMEKFDSNPINLLELVKQFNLYVDELAITCEANNVWASTPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCAAHADSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSFAEPNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras-related protein Rab-1B
molecule tags Protein transport/hydrolase
source organism Homo sapiens
publication title Mechanism of Rab1b deactivation by the Legionella pneumophila GAP LepB.
pubmed doi rcsb
total genus 101
structure length 280
sequence length 291
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
B PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4i1oB01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i1oB02
4JW1A 4JVSA 4I1OB 4IRUA 4I1MA
chains in the Genus database with same CATH superfamily
4B8AA 4EHPA 1N52A 4MW3A 5B1AC 4OINF 3CQCB 3F47A 4L23A 2IXOA 3SO8A 1OCOE 4GU5A 4I17A 1N4RA 3NZUA 3NRHA 4F1PA 1VLTA 2V8SE 3S0XA 3WHNA 4E7SA 5HSWA 4X8QA 3V5YA 3D9IA 3VTYA 4C48B 2HKVA 4BT9A 2OQMA 3FP3A 5L0FA 4ZFHA 2ETSA 5G04C 1ELWA 4O6MA 5D66A 1HH8A 4UQXA 4AEZC 4JEHA 1OW8A 4LUNU 3I4RB 5EDSA 4DLQA 3RVYA 2ZXWC 2XL6A 4C3EA 2EPKX 2J09A 4I9CA 5DLJA 2FF4A 1DOWA 3S7FA 3ZN3A 3UINC 3VRCA 1SR2A 3ITFA 3C7JA 5FTPA 2ILRA 3AGUA 4AXHA 4C7OA 1S0PA 3FTSA 2R7OA 3OTNA 1I4YA 2G62A 2CHZA 3HKKA 4M3OA 3CHOA 2CHWA 3CR3A 2DZOA 4U0UA 1FFHA 3L13A 2LUHA 2HZ8A 3JT1A 3ZVVA 1TEZA 1TWHA 4CDMA 3Q75A 1G4WR 2BTDA 4DX7D 2YL0A 5DIZA 4NTAA 3B7UX 5KYWA 4EZJA 2GRPB 3TGOA 2GROB 4BSZB 2XXAB 2LSVA 2FULA 3EDTB 5FINA 3QZCA 2DVWA 2P9NG 2PM6A 4U9EA 2XLOA 5BQGA 5T1DB 2ETBA 4K0RA 2C2LA 2JPUA 2V5FA 1OW7A 3W9FA 1EDUA 1SMYF 2GWWA 2NC9A 5FZQA 4RD9A 2WVQA 1GM5A 3ML9A 4N3AA 2X6KA 3R7QA 1NA0A 4YL0A 1GS9A 4YL1A 4N4WA 2P9KG 3X2QC 4QFVA 4OIQF 1TN6A 2BL2A 3EGXB 3BQOA 4TUMA 2LK4A 3C63A 4JC7A 2CNWD 2J45A 4DBQA 1T6QA 1V55C 1V54E 1V55E 1JAFA 2HV7A 2DWZA 1M57C 3D9PA 5FQ6A 1BLXB 4BERA 4GYTA 5IY5C 3V5XA 3PCVA 2WVIA 3HVEA 3PZ4A 3BRJA 4BX8A 3E32A 3TJPA 5AGFA 1I4ZA 1YAUO 2IOQA 4I6EA 1U0BB 1O3UA 1WGWA 3PDNA 4PH4B 4KBLA 3C3RA 1INZA 2PQRA 1OWPA 3OWTA 3SF4A 3L8IA 2XPYA 1MMAA 3CHSA 4LNUD 4CJOA 2MOWA 2Y1LE 4TXRA 2H6FA 3E33A 4CZ2D 5JS5A 3UIOC 4HVBA 2EIKC 4U0SA 2YWAA 2HSQA 3DSTA 1HG5A 2A5UA 3K6BA 3D9KA 2EIJE 1H2UA 5EX0A 3ZNGA 3ASNC 2WXLA 1NU9C 3UPVA 1OWOA 3EHMA 1VOMA 1H9TA 2OVBA 2QYUA 4EZLA 1K05A 4OVUA 3ZHEA 2XPZA 1HG2A 1M6TA 4O1PA 2B0HA 2IBFA 3SXYA 2NUTB 2EPLX 3MFNA 3MLGA 3SGHA 4AIFA 4YWQA 5JJ7A 4CDVA 1M2OA 4Z9IA 1HX8A 1TWCA 3DM5A 4FC8A 4DJAA 2UY1A 4I1OB 3KS2A 4UWGA 4UUCA 3R7CA 1V54C 3HIZA 4J8SA 3QTHA 3UT8A 4CYMD 4F6RD 1E7VA 3G50A 1IXVA 5D0OD 3BUAA 5JSLA 1D9SA 4L7TA 4UI9J 2H8AA 3IEEA 3QW1A 1QZ2A 3BEHA 2OV8A 4GQHA 2Q7RA 4B8CB 2AWIA 2YZSA 2G3KA 3HLZA 4FWVA 3M1CB 3AG3E 4BJ1A 3KSLA 4DRXE 2RD0A 1JWFA 3AU4A 3HNKA 1OQCA 3ZIBA 3NF1A 5AARA 2Q9AA 3C8GD 3SXKA 4CS8A 4DJ9A 4BWRA 4ATZD 2QE9A 5T3RA 3JRTA 3ZXSA 2VJ8A 3NYJA 4WNGA 3IQCA 1PD0A 1NI1A 4XI9A 4CS9A 1KPSB 3FTXA 2RFAA 1FT2A 4HRMB 3CEXA 4H7YA 5ENNA 4G8KA 2R7RA 1MYOA 2R2LA 3WG7C 1QKRA 2A69F 1K40A 3EGDA 2H6HA 1PCXA 1TN7A 3LEWA 1LIHA 2KCLA 1Z5SC 3TK0A 1S05A 4EUKB 5AIJA 3IHYA 3MEKA 4Z9JA 4GMLA 3RRNB 3AAAC 3ABLE 3A9CA 1UG7A 3GORA 4UWFA 2L81A 4EBBA 4WWPA 2I15A 4CSAC 5BV0A 2A0BA 4NTBA 2LIGA 1C02A 2ZXRA 2PNOA 1WN0A 2KQ9A 1FMVA 1WTYA 4BEMJ 4CX9A 1OCRE 1YZCA 4YL3A 4G7HF 2VGXA 3NYMA 2XRYA 5DQTA 4C7OB 4G1TA 4XQ1A 1UN8A 5C2YA 3TWQA 1K04A 2UUHA 3OXGA 2IONA 3KL4A 2HMZA 2X51A 4L1BA 5EN5D 4HLEA 2WM9A 3GM1A 4UQZA 3IHUA 3ZGQA 4ATGA 3H2VA 4MTFA 1ZU2A 2L9BA 3S27A 5FQ8A 3RU0A 1TFOB 3ML8A 4K1OA 5EKQD 3RFYA 2ETCA 4ANUA 1ZW2A 1G3NB 3UMIA 5ENRD 1Z6TA 2V4LA 4XPXA 5KYWB 4K03A 4P9TA 2FO7A 3S7DA 2AW6A 3FUNA 4KBQA 2XM4A 1ELRA 1BPOA 4Q4ZF 4I2WA 3U66A 3MKRA 4U8HA 1AWCB 2OVFA 4F3VA 5JP7A 4GA1A 3ZYKA 2XLHA 3NDBB 3KPHA 2J4BA 1KNYA 3RRMB 3SNHA 1A17A 1DNPA 5T3WA 3L9TA 3UXGA 3EU9A 2A4ZA 1KT0A 4HORA 4GZCA 2HYZA 2CFUA 3FUHA 2VSNA 3B71A 2C04A 2XRZA 3L1MA 3KEAA 4J8YA 2HSBA 2L0TB 2KGOA 3AJMA 2GW1A 5JHAA 1DCEA 3APFA 4A1SA 3N0TA 4JJGA 1J8MF 4IAOA 3U9JA 3EJNA 2X0CA 3FUKA 4L2LA 5F28E 3ASOC 1U89A 3SFXA 4GYWA 1LE2A 3HVEB 4Z9HA 4CDNA 2R7TA 4OIRF 3GW4A 4O6FA 2VCAA 1JR8A 3B7SA 3D9OA 4RSYA 4J32B 2FFHA 2J9WA 4DLOA 3CIAA 1A0BA 4TV3A 1H6PA 2WXHA 2F22A 3AS5A 3ULQA 1SZIA 3KH2A 1T9KA 1Y6DA 3V2OA 1GW6A 1E7UA 1N0QA 2V4HC 3S90A 3US6A 4ZLCA 4FJZA 4N6CA 2R7SA 2E2EA 2HS5A 4XEIG 3ZYMA 3NYLA 1BR4A 2WXKA 3Q9UC 1TNUA 3IEGA 4J30B 4YDYA 5HI7A 4B94A 3LS1A 4ILGA 3GZ1A 2NUTA 1ZBPA 4PUCA 2L7AA 1SF8A 1FTSA 5KYUA 4HOQA 1Q2ZA 1LTXA 1ZHYA 3DMDA 3D9JA 5G55A 3CQGB 1RXQA 4WJ0A 4HQDA 3LESA 1TYQG 3SNXA 2F37A 5E2QA 5A6AA 4KT6B 2CNWA 4MRUA 2CDQA 4U5EE 3LJ3A 1E8XA 2KSFA 1KT1A 3CVXA 4Q94A 1Z6AA 4EPZA 3OAWA 1H9GA 5L0GA 4MVQA 1ZHTA 3ZWIA 4DOZA 1A41A 2AXVA 3TWTA 2KJGA 5AN8A 1RKEB 4B0ZA 1H2VC 2L6HA 1ZB1A 4YJWA 3C8GA 5LOZA 4KNVA 3U2MA 1ST6A 2R25A 1HO8A 2PBEA 3NZSA 5KYXB 4DXWA 3PNLB 4ZLDA 3ASHA 4BJ6A 4C0EA 1T5OA 1EA8A 1NLXA 3RJVA 5A7DB 3T8MA 4N2QA 5L3QA 4UWHA 3EFOB 4GMRA 2WXGA 3ONLA 4JD2G 5BXUA 4U0ZA 4JCZA 5DS5A 1N4SA 2HJMA 2M4EA 4GZDA 3VLEA 5C1DA 3JUIA 3DM9B 4UI9K 2DYSC 5ENQD 3EHNA 4DRIB 2EIKE 3RSEG 1D0ZA 1GGQA 4JEBA 1YARO 1N4PA 3LY7A 4GPKA 3EZHA 4W8KA 1BI8B 5BNWA 1JCRA 2G3VA 2WPVA 5EYPF 1IZMA 1JCSA 4NQ0A 4BJ5C 5CRVA 4AVXA 2J8SD 3HHMA 3C5RA 3U3WA 1HS6A 5JHBA 4NCQA 2LAHA 3LDZA 5E3AA 3WXXA 4MBGA 2XZTG 5L3VA 3FUEA 4JHRA 4DX5D 5G2NA 4CS7A 1K8KG 4PR9A 4OYSA 3RK6A 5FZRA 1MZCA 2YQ8A 2X6FA 2KC7A 1P5QA 5HS0A 4X0RA 2DIWA 2QNLA 2PM7A 5JLIA 2HE0A 4YNDA 1YMPA 2JX0A 4BJTA 3UKRG 3PEVB 2NPUA 4Q7CA 2YL1A 1ORSC 3FUMA 5FQ4A 3TOMA 3EGDB 2XGMA 2LNIA 4U5BE 4U04A 1TNYA 4Y6WA 5AENA 2R5SA 4UWLA 3MYFA 4BJ5A 3D3MA 5EILA 4AX2A 4DX1A 1W2WA 1V4AA 4LEUA 3CK8A 2A5EA 4WAFA 4F4BA 3V79K 3JZ0A 4XLNF 3G4ZA 4IJJA 3IQ6A 2JEKA 3HNJA 4G26A 2OEXA 3Q7AA 3Q7FA 2GAQA 4ILHB 4MVZA 3FDHA 4WNEA 4CGVA 5DVWA 4U5CE 4DVZA 3EH2A 3C8ZA 2VGXB 1UJKA 1GQAA 4HRNA 2ZPAA 5BQHA 1H6KA 4GEHA 4KZCA 1FNTc 2J4DA 3HJCA 3W8IA 5FQ7A 1WASA 2ZGDA 1OKKD 3B29A 5G04J 2LCHA 5EYLA 1HMOA 1G8XA 3NBNB 4YVOA 2IJGX 1E8YA 2QUPA 1VYKA 4J7TA 3W2VA 3CVPA 4JHJA 4KVOA 4DK5A 2EIJC 3HNIA 4LERA 2AXUA 3IQTA 3ASOE 5KCMA 1W3BA 3KAEA 5H7PA 1AUEA 2ICWG 1MHQA 4JKVA 2IYLD 1MJ0A 2A1DD 4LDKA 3LYAA 3NAWA 3ASGA 3PRZA 3G2UA 5KBAA 1VB5A 3E30A 2W45A 4BSXA 1D8EA 2W9YA 3S9OA 2H7OA 1OUVA 1ZYRF 4ANXA 3NMIA 3ZC4A 3GEIA 4FHJA 4LRZA 1FT1A 4CEMA 2WQ7A 1QBQA 1NU7D 1Z63A 3EIQC 1T01A 4EKWA 4KC9A 1VTMP 3UMVA 2PFDA 2V26A 3DWWA 3RIPA 3BU8A 3PREA 2HFIA 3G2SA 2R7UA 4JCHA 3SD5A 4JL0A 2VH3A 3DE8A 3UX4A 2FBNA 2AJAA 4A1GA 4HOUA 2AP3A 3B7BA 4JURI 2IY0C 1QVXA 3E37A 5BW8C 1ZVZA 3ZIMA 3FUJA 2R05A 1LPEA 2P0NA 2WQHA 3BG0B 4JB8P 2RKKA 5ANRA 1N54A 2R59A 1C03A 2LXLA 5AYWD 3G4XA 5CMWA 1UOHA 4NIKA 4XEVA 1DC2A 1DCQA 4OIOF 1E8ZA 1N11A 3HXDA 2J9UA 2F0YA 3T8KA 4HNAD 5JJ6A 3PHF2 3QC1A 4PS7A 3ESKA 5A69A 3I4UA 5F5HA 5B1AE 4DRHB 2J0WA 2QY7A 3EHQA 3W2WA 3PMRA 3VM6A 4GCNA 3ZQVA 4U63A 5JA4D 4JA7A 4YDOA 2L9JA 3C3OA 5FIOA 3N24A 3HXBA 3P1UA 2DZNA 4YK5A 3L34A 3DRAA 3FAJA 1JPJA 2HMQA 1SQMA 4DPRA 4UQYA 3G2TA 2QTVA 4LDRA 2ZIRA 3NKDA 1U6HA 2RG8A 1IHGA 3LY8A 1YCSB 3UMKA 2HJ3A 2KNHA 4HS2A 1OT8A 1K1BA 1Z3IX 4G25A 2P9LG 5FT9A 1TNZA 4D4NA 3AG2E 3DKAA 3ABME 3APDA 4JHKA 1MNEA 2I1KA 3LAYA 4XTKA 4JZAA 5L0HA 1L5JA 4MS6A 5HQ8A 1FVFA 3UQ3A 2LSEA 3PNTB 3ZSUA 5B3SE 3EPVA 5KJKA 2P58C 4BETA 1RW2A 2WL8A 1CPRA 2CG3A 1A7EA 2PP4A 4GYYA 1EI7A 4FJYA 2I6HA 1M2VA 2LFDA 3GM2A 3IQ5A 1QNFA 4GCOA 4R7LA 2C03A 2ZD9A 2XL4A 3ULYA 4FP7A 3MCXA 5EHHA 2P61A 2NUPA 4AL1A 5E33A 4M63A 2Q00A 4LNGA 1YZAA 2VYIA 3FTVA 2CFZA 4A4AA 4N39A 1NSGB 1U3DA 3JSZA 3ATPA 3IKOB 3DEPA 3IXEA 1YYHA 5F5FA 3JCKC 5KJNA 4WABA 1H19A 3FTWA 4IARA 3POVA 3Q6NA 3DWLG 5AQAA 2KYHA 1MMNA 3K1IC 4DUIA 4GZ3A 3SZ7A 4HRLA 3UMHA 3CQZA 4EBAA 2QC9A 2IXMA 1KZPA 1WAO1 2XPIA 3ZKJA 4U95D 1O87A 3SI5A 2Q9BA 5DS4A 3PZ1A 4RLYA 4W9RA 2XZDG 2XCCA 4I1MA 3LXUX 3BG1B 5KNHD 1PV3A 2YKZA 3B9QA 4P9FA 4FLHA 4ABNA 3CEQA 2X6IA 1Z23A 3TJ6A 3OA1A 3IPMO 1O1TA 3GZSA 2X6HA 4AM9A 4YN0B 2MYSA 2OJQA 4W8PA 2XL8A 4GTVA 1Z3XA 4J7YA 1YYJA 1AVOB 4JXTA 4PACA 4GTMA 1S64A 2YL3A 5CI9A 4JTAB 1IW7F 4OD4A 2AXZA 2BC5A 4P29A 3JCUQ 2YL7A 3KYJA 4NACA 4XE0A 4I3MA 1ZU5A 3B0VC 1OWNA 1DOVA 3CVWA 4O6NA 4F53A 1WM5A 4BESA 3SXMA 1I5NA 2Q9CA 2BKKB 2IOLA 4L9PA 2AWYA 3H2UA 5D2MC 1UJJA 3SQVA 3MV3B 5HRYA 5LX8A 2A6HF 4NQFA 4G7OF 4EWCA 1FPPA 1OCZE 2KZTB 3ENEA 4N3BA 1D1AA 4YT5A 4ULVA 3KD7A 2BKGA 3EHRA 3Q47B 1TR4A 4TUUA 1FCHA 4U8YD 3UGOA 4XKCA 1HF8A 1N4QA 5D0QD 1G4US 3AG1C 2P9PG 3PUJA 3QB2A 3FHEA 4WNDA 4RQIA 3K66A 5CI8A 3MYIA 2KATA 4XEKA 2J9VA 4N5CA 3FTUA 3R9AB 1MX4A 2KW3C 3T5XA 1TN8A 4ONSA 2F8YA 1RZ4A 4IULA 3AU5A 3E34A 5JVEA 4CJGA 1XNFA 4K5BA 4Q69A 5LFAA 2YRFA 5BV1A 3CHQA 4BJ6C 2PX3A 1VMAA 3JRMO 3FUIA 5T3TA 3EUVA 3L54A 2B6CA 3CHPA 2JD3A 3MKQB 2PL2A 5HV9A 2J07A 1HE9A 2OEVA 3I5QA 4PJNA 4U07A 4GB9A 2XQ0A 1OY3D 3C18A 2LSUA 3HXFA 2B0JA 5EK0A 4D10C 3CVQA 3GZ2A 4N3CA 3ZUVB 2R7WA 5FCLA 4G2VA 5G05J 2EIME 3UI2A 5ENSD 2J7PA 4G24A 2LD6A 1IQRA 1OXKA 2CYDA 1N1CA 4HXIA 1OR2A 1APCA 3DJUB 2WVOA 1QZXA 4CDAA 4PK4A 3UR3C 4E0HA 4JIOA 2PNNA 4MVSA 3UGPA 2XENA 1YLMA 2RD9A 3ZQYA 5CEDB 4XPWA 3HYMB 1NZEA 1JRAA 3QAQA 3Q15A 1EYHA 2Y3GA 2OCCE 4C9BB 2M64A 3FMSA 1RCPA 4XKBA 4FA6A 1D1BA 2VSOE 2WXPA 5ARFA 3RW0A 1HE8A 1NP7A 4A63B 3FU6A 2ETAA 1S7ZA 4YDEA 2XS8A 3LLIA 3TWVA 3RKOF 2Y3AA 2H7BA 1VLSA 2CW0F 1V74B 3PZDA 3FULA 4K5CA 1E83A 1HMDA 4G7ZF 2A68F 2FEZA 3APCA 1ZZPA 3LS0A 3ABKE 1BR1A 2J46A 4GZ6A 4RG9A 3SFZA 1M2VB 3TWUA 3JYYA 1HXIA 3QARA 3ZU7B 5CCLA 3DXJF 3TWWA 3D9LA 4DX2A 1CGNA 2PZIA 5J08A 5A6JA 4EZKA 4HE8D 2IU1A 2EQXA 3FY4A 4N06A 4J7WA 4O6YA 4PFOA 1NG1A 5COGA 3TULA 2YNQA 4O60A 3EH1A 1HFAA 1O1RA 4AOFA 4G78A 4Y6CA 4U5HA 5KYYA 3CVLA 5FWQA 3T6BA 4FAPB 4APOA 5L0IA 3E4BA 3R2PA 4LLCA 2IM8A 3W8HA 3CSTA 1SZAA 3UT4A 4BTBA 3L17A 1MX2A 3U0CA 1JPLA 3RQGA 5CECB 3L08A 3UM2A 2GGFA 3SHFA 2IXPA 4U5DE 3CGHA 5E76A 1N9AA 5ENOD 2WMOA 5B3IA 4BEPA 1NA3A 1UG3A 5EIBE 2IQCA 2A0UA 3GWLA 3FUDA 3BEEA 3RQFA 1VYIA 3FEYA 2V0PA 3L8JA 5LCWC 2BF0X 4IWBA 2P9SG 3RKVA 4PJLA 3C98A 1AP7A 4JVSA 3FDQA 5LCWJ 3FU0A 3ECSA 1HW2A 3S2AA 4ILIA 2L6JA 3TQOA 4O7GA 4I2ZA 2KM4A 1Q0KA 3PDMP 2KXPC 5CERB 5A6BD 4I1AA 1WG0A 1NFOA 1OWMA 1QSPA 3S7BA 1NL4A 3RYLA 2O9XA 5EIDA 4AY6A 1YA9A 3GANA 2XLMA 2AU5A 4A55A 5CBNA 1BR2A 1SVXA 5E3CA 3LCAA 4JZYA 4E0IA 1H6GA 1EPUA 3SBSA 2PX0A 2Z15A 2XGSA 1Z3YA 3DPYA 4K7BA 2Y3BA 3Q49B 1RKCA 1S63A 4CSAA 2IEJA 3QWPA 5DS6A 1JPNA 3Q73A 4BX9A 5JT4A 3V31A 1ZHXA 1TNOA 1OCRC 3ESLA 1WATA 3FWVA 2WZLA 4EQFA 3RVZA 2GRQB 4U96D 4IRUA 3LVRE 3AG4E 1T6IA 5FJYA 2L0IA 1OWLA 3HNLA 3ABLC 2YQYA 3T9KA 2Y4TA 5CCMA 2QLAA 3K1IA 3UUXA 2EPMX 3WAQA 3ULEG 1Q0GA 2MYOA 5EX3A 2L6GA 3OXLA 4TRQA 2GRRB 1SA5A 1YVIA 3EG9A 1Z7Qc 5JRAA 3QJZA 4UI9C 1O1SA 1E8WA 3DSSA 2AVKA 1Y4CA 3L0IA 4WWNA 3GWNA 4HFGA 4AV7A 3AG1E 3U2LA 4CS8C 2R7XA 2R7QA 3W9GA 2WVNA 4JJFA 2FO1E 4I43A 3PZ3A 1MMGA 1UFBA 4WGZA 4CBEA 5L0JA 1TWAA 2IO2C 1OCZC 3RQEA 1AEPA 1TR2A 1XGWA 3S28A 3JQ1A 3RO3A 3W4YA 3FTYA 3ZVRA 3FH5A 3P2BA 3FXHA 4CDYA 3TAXA 4HFFB 3CKBA 2Y3DA 4JEUA 4BT8A 3HDXA 3SBTB 2R9RB 3DSWA 1TWGA 2XRHA 2YINA 2VTBB 3O39A 2DB4A 5E75A 3IHVA 4I6GA 5CRUA 3ABKC 4DRJB 3HXEA 3QVYA 1E90A 4GPMA 3LJNA 4LSZE 3MA5A 3O48A 1A7VA 4U8VD 3ZG1A 3DE9A 4MTGA 2J08A 2WZFA 5A6CA 2W4BA 4HOSA 3GYZA 4AY5A 3LJBA 4O1OA 4IGGA 3K1HA 4N2SA 4LDQA 1PC2A 3J06A 3M79A 3D9NA 2DCPA 4YT4A 5KYUB 2ZISA 4YVQC 5BQIA 2L6BA 1R4TA 1RJ9A 4CCAA 5KJLA 1FVHA 3C72A 3NOCD 3GM3A 1D8DA 1NZNA 4GTTA 4MVUA 4QQIA 2I9CA 2GRLA 1U2VG 3QKYA 1E86A 3MKQA 4GTQA 3LEVA 3QWVA 4QDLA 3O10A 5ANLA 1Q0FA 1R5ID 3KSQA 4H54A 4LLEA 2XLDA 2XLEA 4K5AB 4WGYA 4MQ9F 5D91A 3U3BA 3KYIA 3UT7A 3AG3C 2YHEA 1Y8MA 3Q4AB 2R02A 4I6JA 2IFUA 2C0MA 1J8YF 3PZ2A 3VTXA 2J9BA 1BD8A 4BPMA 5KYXA 1VDYA 3RO2A 3ISMC 2WB2A 3QWWA 4NTFA 3N2ZB 4IN3B 4ME2A 2Y3HA 2YLIA 4JRZA 3KKBA 2EPNA 4YT8A 2PQNA 2H6IA 3EFOA 5T4YA 3QVZA 4H7XA 3VLFA 5T8IA 5AQBA 4ZHBA 2WQ6A 1S70B 4NRHB 3UIPC 3X2QE 4CT0A 2UY1B 1MQSA 4A3TA 2NSZA 5ENPD 2XEVA 3T6GB 2Y69E 3C3QA 2MWQA 1LKXA 1ZW3A 3QNKA 2RSEB 3ZTMA 4DX6D 2XGOA 1FFTC 2BUGA 1YA7O 3OEOA 2WB7A 3FTZA 2D5RB 4OAUC 2KK1A 4HB5A 2AVPA 3DI5A 5CMYA 4TXPA 3RAUA 3FH7A 4DVYP 2Y39A 3ZXPA 2HUJA 2EPOA 3DSXA 4B93B 4YDWA 1YJGA 4F7AA 3LLKA 4C3DA 4MTOA 2WXIA 5CIVA 3Q7LA 2RFMA 3X1OA 4AP2A 3L82A 1MNDA 5AAOA 2X6JA 5B1BC 4XPYA 4LCTA 3M15A 4FLBA 1BU9A 1TNBA 5IY5E 3SY2A 1VK5A 3B95A 3TWSA 2XLWA 4FX5A 3CVVA 2GA0A 3NMJA 3GODA 4ER9A 3CAXA 5FZSA 1OW6A 3CSKA 1H2TC 1ORJA 3OXFA 1Q0MA 4OAVB 1X81A 2P9UG 3MV2B 3K7DA 2M63A 4GTOA 1K1AA 4I44A 1OXBA 4E18A 2DYSE 3H65A 2L6FA 5B3SC 4IYPA 4MNDA 3G2VA 3CHRA 4RDAA 4EHMA 2H7VC 5DBKA 4Q5SF 2NG1A 3QK0A 3LKUA 1BDJB 3FEXA 4K0DA 2NSFA 3NQPA 4XLPF 1H7IA 1SZ9A 4GTSA 4HLLA 4LG6A 2Q4FA 1WY6A 3I3NA 3EG9B 3QOUA 1JWGA 4ANVA 5LP0A 2EIMC 5KWDA 3QMKA 1OXJA 3AS4A 3FHDA 2E0IA 1OCOC 4PJJA 4BTAA 2LP4A 3O4ZA 1D0XA 2WXOA 1OCCC 2ZXOA 3B7RL 4AE4A 2NYJA 3MGBA 3EQLF 2YHCA 2ZXWE 3TXNA 5CBOA 3UM0A 2W4MA 4KYOB 4GAAA 4BG0A 1PY1A 3TWRA 5B1BE 2V5QC 1KU2A 5CHEE 3B0PA 1TQGA 5HKPA 4APFA 5CEAA 5AJLA 5AC5A 2GFHA 3I4GA 3DSUA 2XXAA 3LPZA 3ZPJA 5A6BA 4PDXA 3DXKG 4OIPF 4RVBA 3HG0D 5ENTD 2MRIA 3PE3A 4ANWA 3F6QA 4PS8A 3RF3A 3CK7A 3LNMB 4GTPA 4KI2A 4CS9C 3NG1A 4L2YA 1KTMA 1ORYA 2C0LA 4FHKA 2OCCC 1PAQA 3J5PA 2MHRA 4MLPA 3R9MA 1CPQA 3LY9A 4B89A 2LO6A 2KZTA 3TJ5A 1HU3A 3E70C 2Y69C 3CVYA 3AQBA 3K9IA 3EZIA 4N6HA 4E7ZA 1BZ4A 3ABMC 2GRMA 4DI4A 3ZYLA 1MQVA 3ONKA 1LF8A 2DBAA 1ZHZA 4E17A 3VLDA 1N95A 3B13A 3U8VA 2MHKA 3JYSA 1RJ9B 1LS4A 5L0DA 4GMJA 1QPUA 3LNRA 4YT2A 1TFKB 3WODF 2IO3C 1N94A 3C62A 2ZGGA 3SEOA 3Q79A 1JCQA 3L6AA 4C3BA 5K0IA 2QYJA 3ASFA 3PUKA 1B68A 4MS2A 3CKCA 5AQ7A 1TJCA 5BUZA 3T5VA 2YEVA 1QQ3A 2I8BA 4J8EA 1NFNA 1YDIA 1LI5A 3O55A 1LI7A 1YYXA 5COFA 2OG2A 2DGJA 4H4KC 1CGME 4EBKA 4AL0A 3HRAA 3TWXA 3MZLB 4F1SA 1F1MA 1LD7A 4E6HA 3DJNB 3ZTZA 3PH0C 2P1AA 3ASDA 2CGEA 3TOLA 4CGWA 1MMDA 3AGTA 1XZQA 2WXMA 3I5PA 5ARGA 1E2XA 2YHSA 1G5ZA 2PF4E 2R03A 2HO1A 3DSVA 1ZU4A 3TL5A 3MYVA 1B89A 3FH8A 2J49A 1PD1A 4JW1A 1RMVA 4RG6A 3FU3A 5KNGA 3NKEA 1DVPA 1YA0A 2JLBA 2V3CC 5A23A 2CG2A 4NURA 2A6EF 3LEOA 4XI0A 2OEWA 2OJED 3JYHA 1C17M 3D9MA 3RH3A 1LM3B 4EECA 3MX3A 4GZ5A 3AG4C 2J0XA 1N0RA 2QFCA 2EILC 3S7JA 2XM0A 2OOCA 3T6JA 3VYWA 1WOLA 3M4BA 2KC3A 4L6RA 3V2XA 3ZYQA 2JABA 2VQ2A 4FU3A 4HBDA 3S84A 2UUIA 2VSYA 2NUPB 2Q7FA 4CDRA 1RKEA 3FOPA 4MW8A 3URZA 4O79A 2YLGA 5GPGB 2ASRA 3DPDA 2IF4A 3JSEO 3C8GB 5COMA 3KEZA 3U64A 1O5HA 3AJIA 2J9QA 3Q78A 1TJFA 2B0OE 3SZRA 3SP1A 1O5MA 2OOEA 4QI0A 3NOGD 5JMND 2E87A 2XEHA 4QI2A 2WXFA 2EINE 2VC9A 2BEDA 2UWJG 4EBJA 2WXJA 4J8FA 2VCBA 1HY5A 4JPSA 2P2CP 1IHBA 3AG2C 4GA2A 1IKND 4AK9A 1LVKA 2ONDA 4NC3A 3U3FA 3Q5MA 4E85A 3FU5A 1L7CA 5JUAA 3WG7E 1X5BA 3PVLA 4BFRA 1KZOA 1QQEA 3CK9A 2FGYA 4D4XA 3HXCA 1MX6A 4IB4A 2WZGA 3Q7GA 4FADA 2X3MA 4XWJA 3U5SA 2XHEA 2H6GA 3DZAA 4DI3A 4EBAG 3PS6A 2QY9A 4JTCB 4JE9A 4R32A 4TXQA 4MVOA 3U4TA 2IXNA 4MVMA 5KJMA 1ELKA 4CT4A 4A3VA 4AE4B 5BPPA 5FZTA 5BT1A 4ACLA 2LAIA 3FOOA 4WWOA 3T4RA 4U5FE 1WWPA 1EF1C 2TMVP 4PFPA 3QDNA 3UM3A 3FFLA 4U5GA 4IAQA 1XWJA 2FAPB 1U3CA 4GTRA 2R17C 3SFYA 2HM8A 1JMWA 3TG5A 2KCVA 4XEFA 1H0AA 4Z68A 256BA 1T6UA 4LACB 3ZFWA 2F8XK 2D4UA 3UKUG 3GEEA 3CZ6A 3ZDLA 1OCCE 2XS1A 1ZHWA 2OU6A 4J8DA 1QYMA 1NFIE 3E9VA 3IBEA 5G05C 3M4CA 1D0YA 4CIHA 3FUFA 5L0CA 4J6IA 4OVVA 1E96B 3VAYA 1UW4B 2VSXE 3K33A 1IQUA 4J0UA 4I9EA 4EIYA 1XZPA 2R7VA 4GYOA 4PS3A 1KLXA 1SA4A 3AS8A 3Q6MA 2WMNA 4AJWA 1FR0A 1E84A 3FVYA 1HE1A 2VASA 1LS1A 1SW6A 4GA0A 2J8WA 4G0HA 1HW1A 3PEUB 2XLVA 4G23A 5AJDA 3VF0A 2HV6A 3G2WA 3JUEA 2CCYA 2I2OA 4M7CA 2NXPA 2FI7A 1LD8A 3TG4A 4HOTA 3CLJA 3L22A 3N71A 4KXKB 2QZAA 2KBXA 3JTLO 4FESA 4Q96A 4JEAA 4OD5A 3DXMG 3CVUA 3CSFA 2OKUA 3IV0A 3U9MA 2VTBA 1M56C 1NBBA 2HR2A 2Q3TA 4DBRA 3U9WA 4KZ0A 3UTMA 3CHMA 4LNBA 2J7PD 1CGOA 4C0MA 2ZU6B 1HZ4A 3DAFA 4P6IC 2X38A 3L16A 2P6VA 1Q0DA 2XEEA 3JQ0A 4KNWA 4V3IA 3JXIA 3EGXA 3PE4A 2DYRE 2P7VA 4U9DA 2Y0BG 3O6XA 4A2NB 4NY3A 4G11A 1BI7B 2NSGA 3B7TA 5AC4A 3NMKA 3LS8A 1QLEC 2I1JA 5KYNA 4KVMA 3UM1A 3JXJA 1EKYA 5AQ9A 4XX5A 3DD7A 1SYQA 3GEHA 2KCKA 3ASNE 3J5QB 3RIBA 3FAPB 4U7EB 3V30A 3V7OA 3AQCA 4MVRA 2DYRC 2ZXPA 3UNGC 4JA9A 1EQ1A 3NB2A 4JTDB 4ULWA 2LQGA 2Y4UA 3RRUA 4CIPA 1LE4A 2XSEA 3A11A 2LFFA 5ITZF 4FULA 4XZ4A 2BE5F 4ANJA 2VB6A 2WXNA 4HI8A 4RBNA 3ZRHA 2VGEA 3SXZA 1Y6IA 1JOGA 1IYGA 4WUYA 3F46A 4JC8A 3AOUA 4WNFA 4MKTA 5D92A 1K3ZD 3ZHEB 4G8LA 1E85A 5KYYB 4UDVA 1H6OA 3CV0A 3CVNA 3S29A 5J90A 1OR3A 3V5ZA 2XCBA 2YLDA 3MBGA 4N5QA 3ZW3A 3KMIA 4UWKA 3HTKC 3DBSA 4BEJA 1UN9A 2EINC 3DAGA 2VCCA 1FMWA 4BY6A 2WXQA 1D1CA 3LUTB 5EGYA 2GDCA 5BXOA 1FAPB 2AWCA 4HFKB 4HI9A 1WDYA 2VGYA 1BBHA 4PJMA 3U8PA 5JJTA 3DEOA 2CHXA 1A7DA 4ACKA 3QW0A 5BUOA 5A6KA 3T9OA 3R7RA 2YVKA 1A5EA 5M72A 4XIFA 3MJWA 4B6IA 2P9IG 4URKA 3EIJA 3LVQE 3ZEFA 4KMOA 2GRNB 3TXMA 2LXMA 5DQZA 3SYNA 2DI3A 3EU5A 1Z5ZA 5TJ5E 3B0UX 3D9HA 4HEAJ 1TKNA 1L3PA 2EILE 3Q9NC 2IOSA 4CRWA 3TD7A 2WXRA 1OKKA 1JUQA
chains in the Genus database with same CATH topology
4B8AA 1N52A 5B1AC 4OINF 3CQCB 3F47A 4L23A 2IXOA 4GU5A 4I17A 3NZUA 3NRHA 2V8SE 3S0XA 4E7SA 5HSWA 3D9IA 3VTYA 4BT9A 3FP3A 5G04C 1ELWA 4O6MA 1HH8A 4UQXA 4AEZC 4JEHA 4LUNU 3I4RB 5EDSA 4DLQA 2ZXWC 4C3EA 2J09A 4I9CA 5DLJA 2FF4A 3S7FA 3ZN3A 3ITFA 5FTPA 2ILRA 4AXHA 4C7OA 1S0PA 3FTSA 2R7OA 3OTNA 2G62A 2CHZA 4M3OA 3CHOA 2CHWA 3CR3A 4U0UA 1FFHA 3L13A 3JT1A 3ZVVA 1TEZA 1TWHA 4CDMA 2BTDA 5DIZA 3B7UX 5KYWA 4EZJA 3TGOA 2XXAB 2LSVA 2FULA 3EDTB 3QZCA 2PM6A 5T1DB 4K0RA 2C2LA 2V5FA 1EDUA 1SMYF 2NC9A 5FZQA 4RD9A 2WVQA 3ML9A 4N3AA 2X6KA 3R7QA 1NA0A 3X2QC 4QFVA 4OIQF 3EGXB 2J45A 2CNWD 4DBQA 1V55C 2HV7A 1M57C 3D9PA 5FQ6A 4GYTA 5IY5C 2WVIA 3HVEA 4BX8A 3TJPA 2IOQA 4I6EA 1WGWA 3PDNA 4PH4B 4KBLA 1INZA 2PQRA 1OWPA 3OWTA 3SF4A 2XPYA 3CHSA 1MMAA 2MOWA 4HVBA 2EIKC 4U0SA 1HG5A 2A5UA 3K6BA 3D9KA 1H2UA 5EX0A 3ASNC 2WXLA 1NU9C 3UPVA 1OWOA 3EHMA 1VOMA 2OVBA 4EZLA 4OVUA 3ZHEA 2XPZA 1HG2A 2NUTB 3MLGA 3SGHA 4AIFA 4YWQA 5JJ7A 1M2OA 1HX8A 1TWCA 3DM5A 4FC8A 4DJAA 2UY1A 4I1OB 3KS2A 4UWGA 1V54C 3HIZA 4J8SA 3UT8A 1E7VA 5D0OD 4L7TA 4UI9J 3IEEA 1QZ2A 2OV8A 4B8CB 2AWIA 2YZSA 2G3KA 3HLZA 4FWVA 3M1CB 4BJ1A 2RD0A 1JWFA 3AU4A 3ZIBA 3NF1A 2Q9AA 4CS8A 4BWRA 5T3RA 3JRTA 3ZXSA 2VJ8A 3NYJA 4WNGA 1PD0A 4XI9A 4CS9A 3FTXA 4H7YA 5ENNA 2R7RA 3WG7C 2A69F 3EGDA 3LEWA 1PCXA 2KCLA 5AIJA 3IHYA 3MEKA 4GMLA 3RRNB 4UWFA 2L81A 4EBBA 4WWPA 4CSAC 5BV0A 2ZXRA 2KQ9A 1FMVA 4G7HF 2VGXA 3NYMA 2XRYA 5DQTA 4C7OB 4G1TA 1UN8A 5C2YA 3OXGA 2IONA 3KL4A 2X51A 4L1BA 4HLEA 2WM9A 3ZGQA 4UQZA 4ATGA 1ZU2A 2L9BA 3S27A 5FQ8A 3RU0A 3ML8A 5EKQD 3RFYA 4ANUA 3UMIA 1Z6TA 2V4LA 5KYWB 4K03A 2FO7A 3S7DA 2AW6A 3FUNA 4KBQA 1ELRA 1BPOA 4Q4ZF 4I2WA 3U66A 3MKRA 4U8HA 2OVFA 4F3VA 4GA1A 3ZYKA 3NDBB 2J4BA 3RRMB 3SNHA 1A17A 1DNPA 5T3WA 2A4ZA 1KT0A 4HORA 4GZCA 2HYZA 2CFUA 3FUHA 2VSNA 2C04A 2XRZA 2L0TB 2KGOA 2GW1A 5JHAA 3APFA 4A1SA 3N0TA 4JJGA 1J8MF 4IAOA 3FUKA 3EJNA 4L2LA 3ASOC 4GYWA 3HVEB 4CDNA 2R7TA 4OIRF 3GW4A 4O6FA 3B7SA 3D9OA 4RSYA 4J32B 2FFHA 2J9WA 4DLOA 3CIAA 4TV3A 2WXHA 3AS5A 3ULQA 1SZIA 3KH2A 1GW6A 1E7UA 4ZLCA 4FJZA 2R7SA 2E2EA 3ZYMA 3NYLA 1BR4A 2WXKA 3IEGA 4J30B 5HI7A 4B94A 3LS1A 4ILGA 3GZ1A 2NUTA 1ZBPA 4PUCA 1SF8A 1FTSA 5KYUA 4HOQA 1ZHYA 3DMDA 3D9JA 5G55A 3CQGB 4WJ0A 3LESA 3SNXA 5E2QA 4KT6B 2CNWA 4MRUA 2CDQA 4U5EE 3LJ3A 1E8XA 1KT1A 3CVXA 4Q94A 1Z6AA 4EPZA 3OAWA 4DOZA 1ZHTA 2AXVA 2KJGA 4B0ZA 1H2VC 4YJWA 5LOZA 4KNVA 1ST6A 1HO8A 3NZSA 5KYXB 3PNLB 4ZLDA 3ASHA 4BJ6A 4C0EA 3RJVA 5A7DB 3T8MA 4N2QA 5L3QA 4UWHA 3EFOB 2WXGA 3ONLA 4U0ZA 5DS5A 2M4EA 4GZDA 3VLEA 5C1DA 3JUIA 3DM9B 4UI9K 2DYSC 3EHNA 1D0ZA 3LY7A 4GPKA 3EZHA 4W8KA 5BNWA 2G3VA 2WPVA 1IZMA 4NQ0A 4BJ5C 4AVXA 3HHMA 3U3WA 1HS6A 5JHBA 2LAHA 3LDZA 5E3AA 3WXXA 5L3VA 3FUEA 4JHRA 5G2NA 4CS7A 4OYSA 3RK6A 5FZRA 2YQ8A 2X6FA 2KC7A 1P5QA 4X0RA 2DIWA 2PM7A 4YNDA 4BJTA 3PEVB 4Q7CA 3FUMA 5FQ4A 3EGDB 2XGMA 2LNIA 4U5BE 4U04A 4Y6WA 5AENA 2R5SA 4UWLA 4BJ5A 3D3MA 4AX2A 1W2WA 4LEUA 3CK8A 4WAFA 4F4BA 4XLNF 4IJJA 2JEKA 4G26A 4ILHB 3FDHA 4WNEA 4CGVA 5DVWA 4U5CE 4DVZA 3EH2A 2VGXB 1UJKA 2ZPAA 1H6KA 4GEHA 4KZCA 2J4DA 3HJCA 3W8IA 5FQ7A 1OKKD 5G04J 1G8XA 4YVOA 2IJGX 1E8YA 3W2VA 1VYKA 3CVPA 4JHJA 4KVOA 4DK5A 2EIJC 4LERA 2AXUA 5KCMA 1W3BA 3KAEA 1MHQA 2IYLD 2A1DD 3LYAA 3ASGA 3PRZA 3G2UA 2W45A 4BSXA 2W9YA 2H7OA 1OUVA 1ZYRF 4ANXA 3ZC4A 4FHJA 4LRZA 4CEMA 2WQ7A 1NU7D 1Z63A 3EIQC 4KC9A 3UMVA 2PFDA 2V26A 3PREA 3RIPA 3G2SA 2R7UA 4JCHA 3SD5A 4JL0A 2VH3A 3UX4A 2FBNA 4A1GA 4HOUA 4JURI 5BW8C 3ZIMA 3FUJA 2WQHA 3BG0B 5ANRA 1N54A 2R59A 5AYWD 5CMWA 4OIOF 1E8ZA 2J9UA 5JJ6A 3PHF2 3QC1A 4PS7A 3ESKA 3I4UA 5F5HA 2J0WA 2QY7A 3W2WA 3PMRA 4GCNA 4U63A 4JA7A 2L9JA 3N24A 3P1UA 3L34A 3FAJA 1JPJA 1SQMA 4DPRA 4UQYA 3G2TA 2QTVA 3NKDA 2RG8A 1IHGA 3LY8A 3UMKA 2KNHA 4HS2A 1Z3IX 4G25A 5FT9A 3APDA 4JHKA 1MNEA 2I1KA 3LAYA 4XTKA 4JZAA 1L5JA 4MS6A 5HQ8A 1FVFA 3UQ3A 2LSEA 3PNTB 3ZSUA 5KJKA 3EPVA 2P58C 2WL8A 2CG3A 2PP4A 4GYYA 4FJYA 2I6HA 1M2VA 1QNFA 4GCOA 4R7LA 2C03A 2XL4A 4FP7A 3MCXA 5EHHA 2NUPA 5E33A 4M63A 2VYIA 3FTVA 2CFZA 4N39A 1U3DA 3JSZA 3IKOB 5F5FA 3JCKC 5KJNA 1H19A 3FTWA 3POVA 3Q6NA 1MMNA 3K1IC 3SZ7A 4GZ3A 3UMHA 3CQZA 4EBAA 2IXMA 1WAO1 2XPIA 1O87A 3SI5A 2Q9BA 5DS4A 4W9RA 2XCCA 4I1MA 3LXUX 3BG1B 3B9QA 4FLHA 4ABNA 3CEQA 2X6IA 1Z23A 3OA1A 3GZSA 2X6HA 4AM9A 4YN0B 2MYSA 1Z3XA 4JXTA 5CI9A 1IW7F 4OD4A 2AXZA 4P29A 3JCUQ 4NACA 4XE0A 4I3MA 1ZU5A 3B0VC 1OWNA 3CVWA 4O6NA 4F53A 1WM5A 2IOLA 2Q9CA 1UJJA 3MV3B 5LX8A 2A6HF 4G7OF 4EWCA 2KZTB 3ENEA 4N3BA 1D1AA 4YT5A 3KD7A 3Q47B 4TUUA 1FCHA 4XKCA 3UGOA 1HF8A 5D0QD 3AG1C 3PUJA 3QB2A 3FHEA 4WNDA 3K66A 5CI8A 2KATA 2J9VA 4N5CA 3FTUA 3R9AB 2KW3C 3T5XA 4IULA 3AU5A 5LFAA 1XNFA 4Q69A 5BV1A 3CHQA 4BJ6C 2PX3A 1VMAA 3FUIA 5T3TA 3L54A 3CHPA 2JD3A 3MKQB 2PL2A 2J07A 3I5QA 4PJNA 4U07A 4GB9A 2XQ0A 2LSUA 2B0JA 4D10C 3CVQA 3GZ2A 4N3CA 2R7WA 5FCLA 4G2VA 5G05J 2J7PA 4G24A 1IQRA 1N1CA 4HXIA 3DJUB 2WVOA 1QZXA 4PK4A 3UR3C 3UGPA 3HYMB 1NZEA 3QAQA 3Q15A 1EYHA 2Y3GA 4C9BB 4XKBA 4FA6A 1D1BA 2VSOE 2WXPA 5ARFA 1HE8A 1NP7A 3FU6A 1S7ZA 3LLIA 3RKOF 2Y3AA 2H7BA 2CW0F 3PZDA 3FULA 4G7ZF 2A68F 2FEZA 3APCA 3LS0A 1BR1A 2J46A 4GZ6A 3SFZA 4RG9A 1M2VB 1HXIA 3QARA 5CCLA 3DXJF 3D9LA 2PZIA 5J08A 4EZKA 4HE8D 2IU1A 2EQXA 3FY4A 4N06A 4O6YA 4PFOA 1NG1A 2YNQA 3EH1A 1HFAA 4AOFA 4Y6CA 4U5HA 5KYYA 3CVLA 5FWQA 3T6BA 4APOA 3E4BA 4LLCA 3W8HA 3CSTA 1SZAA 3UT4A 4BTBA 3L17A 1JPLA 3L08A 2GGFA 3SHFA 2IXPA 4U5DE 3CGHA 5E76A 2WMOA 1NA3A 1UG3A 2IQCA 3FUDA 3BEEA 1VYIA 3FEYA 2V0PA 5LCWC 2BF0X 4IWBA 3RKVA 4PJLA 3C98A 4JVSA 3FDQA 5LCWJ 3FU0A 3ECSA 3S2AA 4ILIA 2L6JA 4O7GA 4I2ZA 2KM4A 4I1AA 1OWMA 3S7BA 3RYLA 2O9XA 4AY6A 3GANA 4A55A 1BR2A 5E3CA 3LCAA 4JZYA 1EPUA 3SBSA 2PX0A 2Z15A 2XGSA 1Z3YA 4K7BA 2Y3BA 3Q49B 4CSAA 3QWPA 5DS6A 1JPNA 4BX9A 1ZHXA 1OCRC 3ESLA 3FWVA 2WZLA 4EQFA 4IRUA 3LVRE 5FJYA 2L0IA 1OWLA 3ABLC 2Y4TA 5CCMA 3UUXA 5EX3A 3OXLA 4TRQA 3EG9A 4UI9C 3QJZA 1E8WA 3L0IA 4WWNA 4HFGA 4AV7A 4CS8C 2R7XA 2R7QA 2WVNA 4JJFA 4I43A 1MMGA 4CBEA 1TWAA 1OCZC 1XGWA 1TR2A 3S28A 3JQ1A 3RO3A 3FTYA 3ZVRA 3FH5A 3P2BA 3TAXA 4JEUA 4HFFB 3CKBA 2Y3DA 4BT8A 3HDXA 3SBTB 1TWGA 2XRHA 2YINA 2VTBB 3O39A 5E75A 3IHVA 4I6GA 3ABKC 1E90A 3MA5A 3O48A 3ZG1A 2J08A 2WZFA 5A6CA 2W4BA 4HOSA 3GYZA 4AY5A 3LJBA 3K1HA 4N2SA 1PC2A 3D9NA 2DCPA 4YT4A 5KYUB 4YVQC 1RJ9A 4CCAA 5KJLA 1FVHA 1NZNA 2I9CA 2GRLA 3QKYA 3MKQA 3LEVA 3QWVA 4QDLA 5ANLA 4LLEA 4MQ9F 5D91A 3UT7A 3AG3C 2YHEA 1Y8MA 3Q4AB 4I6JA 2IFUA 2C0MA 1J8YF 3VTXA 5KYXA 1VDYA 3RO2A 2WB2A 3QWWA 3N2ZB 4IN3B 4ME2A 2Y3HA 3KKBA 4YT8A 2PQNA 3EFOA 5T4YA 4H7XA 3VLFA 5T8IA 2WQ6A 4NRHB 4CT0A 2UY1B 1MQSA 4A3TA 2NSZA 2XEVA 2MWQA 1LKXA 3QNKA 2XGOA 1FFTC 2BUGA 3OEOA 2WB7A 3FTZA 2D5RB 2AVPA 5CMYA 3FH7A 4DVYP 2Y39A 4F7AA 3LLKA 4C3DA 2WXIA 3Q7LA 3X1OA 4AP2A 1MNDA 2X6JA 5B1BC 4LCTA 4FLBA 1VK5A 4FX5A 3CVVA 3GODA 5FZSA 1H2TC 3CSKA 3OXFA 3MV2B 3K7DA 2M63A 4I44A 3H65A 5B3SC 4IYPA 4MNDA 3G2VA 3CHRA 4RDAA 2H7VC 5DBKA 4Q5SF 2NG1A 3QK0A 3LKUA 3FEXA 4K0DA 3NQPA 4XLPF 1SZ9A 3I3NA 1WY6A 3QOUA 3EG9B 1JWGA 4ANVA 5LP0A 2EIMC 3QMKA 3AS4A 3FHDA 2E0IA 1OCOC 4PJJA 4BTAA 3O4ZA 1D0XA 2WXOA 1OCCC 2ZXOA 3B7RL 4AE4A 3MGBA 3EQLF 2YHCA 3TXNA 2W4MA 4KYOB 4GAAA 4BG0A 1PY1A 5CHEE 1KU2A 3B0PA 4APFA 5AJLA 2GFHA 3I4GA 2XXAA 3LPZA 3ZPJA 4PDXA 4OIPF 4RVBA 2MRIA 3PE3A 4ANWA 4PS8A 3CK7A 4KI2A 4CS9C 3NG1A 4L2YA 2C0LA 4FHKA 2OCCC 1PAQA 4MLPA 3LY9A 4B89A 2LO6A 2KZTA 1HU3A 3E70C 2Y69C 3CVYA 3AQBA 3K9IA 3EZIA 4E7ZA 3ABMC 2GRMA 4DI4A 3ZYLA 3ONKA 1LF8A 2DBAA 1ZHZA 3VLDA 3B13A 2MHKA 3JYSA 1RJ9B 4GMJA 3LNRA 4YT2A 3WODF 3SEOA 3L6AA 4C3BA 3ASFA 3PUKA 3CKCA 1TJCA 5BUZA 3T5VA 2YEVA 2I8BA 4J8EA 2OG2A 2DGJA 4H4KC 3MZLB 4F1SA 4E6HA 3DJNB 3PH0C 3ASDA 2CGEA 4CGWA 1MMDA 2WXMA 3I5PA 5ARGA 2YHSA 2PF4E 2HO1A 1ZU4A 3TL5A 3MYVA 1B89A 3FH8A 2J49A 1PD1A 4JW1A 4RG6A 3FU3A 3NKEA 1DVPA 1YA0A 2JLBA 2V3CC 5A23A 2CG2A 4NURA 2A6EF 4XI0A 3JYHA 3D9MA 3RH3A 4EECA 3MX3A 4GZ5A 3AG4C 2J0XA 2QFCA 2EILC 3S7JA 3T6JA 3VYWA 3ZYQA 2VQ2A 4FU3A 2VSYA 2NUPB 2Q7FA 4CDRA 3URZA 4O79A 3DPDA 2IF4A 3KEZA 3U64A 1O5HA 2J9QA 1TJFA 3SZRA 3SP1A 2OOEA 4QI0A 2E87A 4QI2A 2WXFA 2UWJG 2WXJA 4J8FA 4JPSA 3AG2C 4GA2A 4AK9A 1LVKA 2ONDA 3Q5MA 4E85A 3FU5A 1X5BA 3PVLA 4BFRA 1QQEA 3CK9A 2FGYA 2WZGA 3Q7GA 4FADA 2X3MA 4XWJA 2XHEA 3DZAA 4DI3A 4EBAG 3PS6A 2QY9A 3U4TA 2IXNA 5KJMA 1ELKA 4CT4A 4A3VA 4AE4B 5BPPA 5BT1A 4ACLA 2LAIA 4WWOA 3T4RA 4U5FE 1EF1C 4PFPA 3QDNA 3FFLA 4U5GA 1U3CA 2R17C 2HM8A 3TG5A 2KCVA 1H0AA 4LACB 3ZFWA 3CZ6A 1ZHWA 4J8DA 3E9VA 3IBEA 5G05C 1D0YA 4CIHA 3FUFA 4J6IA 4OVVA 1E96B 3VAYA 1UW4B 2VSXE 3K33A 1IQUA 4J0UA 4I9EA 2R7VA 4GYOA 4PS3A 1KLXA 3AS8A 3Q6MA 2WMNA 4AJWA 3FVYA 2VASA 1LS1A 4GA0A 4G0HA 3PEUB 4G23A 5AJDA 3G2WA 2HV6A 2I2OA 2NXPA 2FI7A 3TG4A 4HOTA 3CLJA 3L22A 3N71A 4KXKB 4FESA 4Q96A 4OD5A 3CVUA 3CSFA 3IV0A 2VTBA 1M56C 2HR2A 2Q3TA 4DBRA 3U9WA 4KZ0A 3CHMA 2J7PD 4C0MA 2ZU6B 1HZ4A 3DAFA 4P6IC 2X38A 3L16A 2P6VA 3JQ0A 4KNWA 4V3IA 3EGXA 3PE4A 2P7VA 3O6XA 4A2NB 4NY3A 4G11A 3B7TA 3LS8A 1QLEC 2I1JA 5KYNA 4KVMA 4XX5A 3DD7A 2KCKA 3RIBA 3V7OA 3AQCA 2DYRC 2ZXPA 3UNGC 4JA9A 4ULWA 2Y4UA 3RRUA 2XSEA 4FULA 4XZ4A 2BE5F 4ANJA 2VB6A 2WXNA 4RBNA 3ZRHA 1Y6IA 1IYGA 4WUYA 3F46A 4JC8A 4WNFA 4MKTA 5D92A 3ZHEB 5KYYB 3CV0A 3CVNA 3S29A 5J90A 2XCBA 3ZW3A 3KMIA 4UWKA 3HTKC 3DBSA 4BEJA 1UN9A 2EINC 3DAGA 1FMWA 4BY6A 2WXQA 1D1CA 5EGYA 4HFKB 2VGYA 4PJMA 5JJTA 2CHXA 4ACKA 5BUOA 3R7RA 5M72A 4XIFA 3MJWA 4B6IA 4URKA 3EIJA 3ZEFA 3LVQE 4KMOA 3TXMA 5DQZA 3SYNA 1Z5ZA 3B0UX 4HEAJ 1TKNA 2IOSA 4CRWA 3TD7A 2WXRA 1OKKA 1JUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JW1 A;  4JVS A;  4I1O B;  4IRU A;  4I1M A; 
#chains in the Genus database with same CATH topology
 4B8A A;  4EHP A;  1N52 A;  4MW3 A;  5B1A C;  4OIN F;  3CQC B;  3F47 A;  4L23 A;  2IXO A;  3SO8 A;  1OCO E;  4GU5 A;  4I17 A;  1N4R A;  3NZU A;  3NRH A;  4F1P A;  1VLT A;  2V8S E;  3S0X A;  3WHN A;  4E7S A;  5HSW A;  4X8Q A;  3V5Y A;  3D9I A;  3VTY A;  4C48 B;  2HKV A;  4BT9 A;  2OQM A;  3FP3 A;  5L0F A;  4ZFH A;  2ETS A;  5G04 C;  1ELW A;  4O6M A;  5D66 A;  1HH8 A;  4UQX A;  4AEZ C;  4JEH A;  1OW8 A;  4LUN U;  3I4R B;  5EDS A;  4DLQ A;  3RVY A;  2ZXW C;  2XL6 A;  4C3E A;  2EPK X;  2J09 A;  4I9C A;  5DLJ A;  2FF4 A;  1DOW A;  3S7F A;  3ZN3 A;  3UIN C;  3VRC A;  1SR2 A;  3ITF A;  3C7J A;  5FTP A;  2ILR A;  3AGU A;  4AXH A;  4C7O A;  1S0P A;  3FTS A;  2R7O A;  3OTN A;  1I4Y A;  2G62 A;  2CHZ A;  3HKK A;  4M3O A;  3CHO A;  2CHW A;  3CR3 A;  2DZO A;  4U0U A;  1FFH A;  3L13 A;  2LUH A;  2HZ8 A;  3JT1 A;  3ZVV A;  1TEZ A;  1TWH A;  4CDM A;  3Q75 A;  1G4W R;  2BTD A;  4DX7 D;  2YL0 A;  5DIZ A;  4NTA A;  3B7U X;  5KYW A;  4EZJ A;  2GRP B;  3TGO A;  2GRO B;  4BSZ B;  2XXA B;  2LSV A;  2FUL A;  3EDT B;  5FIN A;  3QZC A;  2DVW A;  2P9N G;  2PM6 A;  4U9E A;  2XLO A;  5BQG A;  5T1D B;  2ETB A;  4K0R A;  2C2L A;  2JPU A;  2V5F A;  1OW7 A;  3W9F A;  1EDU A;  1SMY F;  2GWW A;  2NC9 A;  5FZQ A;  4RD9 A;  2WVQ A;  1GM5 A;  3ML9 A;  4N3A A;  2X6K A;  3R7Q A;  1NA0 A;  4YL0 A;  1GS9 A;  4YL1 A;  4N4W A;  2P9K G;  3X2Q C;  4QFV A;  4OIQ F;  1TN6 A;  2BL2 A;  3EGX B;  3BQO A;  4TUM A;  2LK4 A;  3C63 A;  4JC7 A;  2CNW D;  2J45 A;  4DBQ A;  1T6Q A;  1V55 C;  1V54 E;  1V55 E;  1JAF A;  2HV7 A;  2DWZ A;  1M57 C;  3D9P A;  5FQ6 A;  1BLX B;  4BER A;  4GYT A;  5IY5 C;  3V5X A;  3PCV A;  2WVI A;  3HVE A;  3PZ4 A;  3BRJ A;  4BX8 A;  3E32 A;  3TJP A;  5AGF A;  1I4Z A;  1YAU O;  2IOQ A;  4I6E A;  1U0B B;  1O3U A;  1WGW A;  3PDN A;  4PH4 B;  4KBL A;  3C3R A;  1INZ A;  2PQR A;  1OWP A;  3OWT A;  3SF4 A;  3L8I A;  2XPY A;  1MMA A;  3CHS A;  4LNU D;  4CJO A;  2MOW A;  2Y1L E;  4TXR A;  2H6F A;  3E33 A;  4CZ2 D;  5JS5 A;  3UIO C;  4HVB A;  2EIK C;  4U0S A;  2YWA A;  2HSQ A;  3DST A;  1HG5 A;  2A5U A;  3K6B A;  3D9K A;  2EIJ E;  1H2U A;  5EX0 A;  3ZNG A;  3ASN C;  2WXL A;  1NU9 C;  3UPV A;  1OWO A;  3EHM A;  1VOM A;  1H9T A;  2OVB A;  2QYU A;  4EZL A;  1K05 A;  4OVU A;  3ZHE A;  2XPZ A;  1HG2 A;  1M6T A;  4O1P A;  2B0H A;  2IBF A;  3SXY A;  2NUT B;  2EPL X;  3MFN A;  3MLG A;  3SGH A;  4AIF A;  4YWQ A;  5JJ7 A;  4CDV A;  1M2O A;  4Z9I A;  1HX8 A;  1TWC A;  3DM5 A;  4FC8 A;  4DJA A;  2UY1 A;  4I1O B;  3KS2 A;  4UWG A;  4UUC A;  3R7C A;  1V54 C;  3HIZ A;  4J8S A;  3QTH A;  3UT8 A;  4CYM D;  4F6R D;  1E7V A;  3G50 A;  1IXV A;  5D0O D;  3BUA A;  5JSL A;  1D9S A;  4L7T A;  4UI9 J;  2H8A A;  3IEE A;  3QW1 A;  1QZ2 A;  3BEH A;  2OV8 A;  4GQH A;  2Q7R A;  4B8C B;  2AWI A;  2YZS A;  2G3K A;  3HLZ A;  4FWV A;  3M1C B;  3AG3 E;  4BJ1 A;  3KSL A;  4DRX E;  2RD0 A;  1JWF A;  3AU4 A;  3HNK A;  1OQC A;  3ZIB A;  3NF1 A;  5AAR A;  2Q9A A;  3C8G D;  3SXK A;  4CS8 A;  4DJ9 A;  4BWR A;  4ATZ D;  2QE9 A;  5T3R A;  3JRT A;  3ZXS A;  2VJ8 A;  3NYJ A;  4WNG A;  3IQC A;  1PD0 A;  1NI1 A;  4XI9 A;  4CS9 A;  1KPS B;  3FTX A;  2RFA A;  1FT2 A;  4HRM B;  3CEX A;  4H7Y A;  5ENN A;  4G8K A;  2R7R A;  1MYO A;  2R2L A;  3WG7 C;  1QKR A;  2A69 F;  1K40 A;  3EGD A;  2H6H A;  1PCX A;  1TN7 A;  3LEW A;  1LIH A;  2KCL A;  1Z5S C;  3TK0 A;  1S05 A;  4EUK B;  5AIJ A;  3IHY A;  3MEK A;  4Z9J A;  4GML A;  3RRN B;  3AAA C;  3ABL E;  3A9C A;  1UG7 A;  3GOR A;  4UWF A;  2L81 A;  4EBB A;  4WWP A;  2I15 A;  4CSA C;  5BV0 A;  2A0B A;  4NTB A;  2LIG A;  1C02 A;  2ZXR A;  2PNO A;  1WN0 A;  2KQ9 A;  1FMV A;  1WTY A;  4BEM J;  4CX9 A;  1OCR E;  1YZC A;  4YL3 A;  4G7H F;  2VGX A;  3NYM A;  2XRY A;  5DQT A;  4C7O B;  4G1T A;  4XQ1 A;  1UN8 A;  5C2Y A;  3TWQ A;  1K04 A;  2UUH A;  3OXG A;  2ION A;  3KL4 A;  2HMZ A;  2X51 A;  4L1B A;  5EN5 D;  4HLE A;  2WM9 A;  3GM1 A;  4UQZ A;  3IHU A;  3ZGQ A;  4ATG A;  3H2V A;  4MTF A;  1ZU2 A;  2L9B A;  3S27 A;  5FQ8 A;  3RU0 A;  1TFO B;  3ML8 A;  4K1O A;  5EKQ D;  3RFY A;  2ETC A;  4ANU A;  1ZW2 A;  1G3N B;  3UMI A;  5ENR D;  1Z6T A;  2V4L A;  4XPX A;  5KYW B;  4K03 A;  4P9T A;  2FO7 A;  3S7D A;  2AW6 A;  3FUN A;  4KBQ A;  2XM4 A;  1ELR A;  1BPO A;  4Q4Z F;  4I2W A;  3U66 A;  3MKR A;  4U8H A;  1AWC B;  2OVF A;  4F3V A;  5JP7 A;  4GA1 A;  3ZYK A;  2XLH A;  3NDB B;  3KPH A;  2J4B A;  1KNY A;  3RRM B;  3SNH A;  1A17 A;  1DNP A;  5T3W A;  3L9T A;  3UXG A;  3EU9 A;  2A4Z A;  1KT0 A;  4HOR A;  4GZC A;  2HYZ A;  2CFU A;  3FUH A;  2VSN A;  3B71 A;  2C04 A;  2XRZ A;  3L1M A;  3KEA A;  4J8Y A;  2HSB A;  2L0T B;  2KGO A;  3AJM A;  2GW1 A;  5JHA A;  1DCE A;  3APF A;  4A1S A;  3N0T A;  4JJG A;  1J8M F;  4IAO A;  3U9J A;  3EJN A;  2X0C A;  3FUK A;  4L2L A;  5F28 E;  3ASO C;  1U89 A;  3SFX A;  4GYW A;  1LE2 A;  3HVE B;  4Z9H A;  4CDN A;  2R7T A;  4OIR F;  3GW4 A;  4O6F A;  2VCA A;  1JR8 A;  3B7S A;  3D9O A;  4RSY A;  4J32 B;  2FFH A;  2J9W A;  4DLO A;  3CIA A;  1A0B A;  4TV3 A;  1H6P A;  2WXH A;  2F22 A;  3AS5 A;  3ULQ A;  1SZI A;  3KH2 A;  1T9K A;  1Y6D A;  3V2O A;  1GW6 A;  1E7U A;  1N0Q A;  2V4H C;  3S90 A;  3US6 A;  4ZLC A;  4FJZ A;  4N6C A;  2R7S A;  2E2E A;  2HS5 A;  4XEI G;  3ZYM A;  3NYL A;  1BR4 A;  2WXK A;  3Q9U C;  1TNU A;  3IEG A;  4J30 B;  4YDY A;  5HI7 A;  4B94 A;  3LS1 A;  4ILG A;  3GZ1 A;  2NUT A;  1ZBP A;  4PUC A;  2L7A A;  1SF8 A;  1FTS A;  5KYU A;  4HOQ A;  1Q2Z A;  1LTX A;  1ZHY A;  3DMD A;  3D9J A;  5G55 A;  3CQG B;  1RXQ A;  4WJ0 A;  4HQD A;  3LES A;  1TYQ G;  3SNX A;  2F37 A;  5E2Q A;  5A6A A;  4KT6 B;  2CNW A;  4MRU A;  2CDQ A;  4U5E E;  3LJ3 A;  1E8X A;  2KSF A;  1KT1 A;  3CVX A;  4Q94 A;  1Z6A A;  4EPZ A;  3OAW A;  1H9G A;  5L0G A;  4MVQ A;  1ZHT A;  3ZWI A;  4DOZ A;  1A41 A;  2AXV A;  3TWT A;  2KJG A;  5AN8 A;  1RKE B;  4B0Z A;  1H2V C;  2L6H A;  1ZB1 A;  4YJW A;  3C8G A;  5LOZ A;  4KNV A;  3U2M A;  1ST6 A;  2R25 A;  1HO8 A;  2PBE A;  3NZS A;  5KYX B;  4DXW A;  3PNL B;  4ZLD A;  3ASH A;  4BJ6 A;  4C0E A;  1T5O A;  1EA8 A;  1NLX A;  3RJV A;  5A7D B;  3T8M A;  4N2Q A;  5L3Q A;  4UWH A;  3EFO B;  4GMR A;  2WXG A;  3ONL A;  4JD2 G;  5BXU A;  4U0Z A;  4JCZ A;  5DS5 A;  1N4S A;  2HJM A;  2M4E A;  4GZD A;  3VLE A;  5C1D A;  3JUI A;  3DM9 B;  4UI9 K;  2DYS C;  5ENQ D;  3EHN A;  4DRI B;  2EIK E;  3RSE G;  1D0Z A;  1GGQ A;  4JEB A;  1YAR O;  1N4P A;  3LY7 A;  4GPK A;  3EZH A;  4W8K A;  1BI8 B;  5BNW A;  1JCR A;  2G3V A;  2WPV A;  5EYP F;  1IZM A;  1JCS A;  4NQ0 A;  4BJ5 C;  5CRV A;  4AVX A;  2J8S D;  3HHM A;  3C5R A;  3U3W A;  1HS6 A;  5JHB A;  4NCQ A;  2LAH A;  3LDZ A;  5E3A A;  3WXX A;  4MBG A;  2XZT G;  5L3V A;  3FUE A;  4JHR A;  4DX5 D;  5G2N A;  4CS7 A;  1K8K G;  4PR9 A;  4OYS A;  3RK6 A;  5FZR A;  1MZC A;  2YQ8 A;  2X6F A;  2KC7 A;  1P5Q A;  5HS0 A;  4X0R A;  2DIW A;  2QNL A;  2PM7 A;  5JLI A;  2HE0 A;  4YND A;  1YMP A;  2JX0 A;  4BJT A;  3UKR G;  3PEV B;  2NPU A;  4Q7C A;  2YL1 A;  1ORS C;  3FUM A;  5FQ4 A;  3TOM A;  3EGD B;  2XGM A;  2LNI A;  4U5B E;  4U04 A;  1TNY A;  4Y6W A;  5AEN A;  2R5S A;  4UWL A;  3MYF A;  4BJ5 A;  3D3M A;  5EIL A;  4AX2 A;  4DX1 A;  1W2W A;  1V4A A;  4LEU A;  3CK8 A;  2A5E A;  4WAF A;  4F4B A;  3V79 K;  3JZ0 A;  4XLN F;  3G4Z A;  4IJJ A;  3IQ6 A;  2JEK A;  3HNJ A;  4G26 A;  2OEX A;  3Q7A A;  3Q7F A;  2GAQ A;  4ILH B;  4MVZ A;  3FDH A;  4WNE A;  4CGV A;  5DVW A;  4U5C E;  4DVZ A;  3EH2 A;  3C8Z A;  2VGX B;  1UJK A;  1GQA A;  4HRN A;  2ZPA A;  5BQH A;  1H6K A;  4GEH A;  4KZC A;  1FNT c;  2J4D A;  3HJC A;  3W8I A;  5FQ7 A;  1WAS A;  2ZGD A;  1OKK D;  3B29 A;  5G04 J;  2LCH A;  5EYL A;  1HMO A;  1G8X A;  3NBN B;  4YVO A;  2IJG X;  1E8Y A;  2QUP A;  1VYK A;  4J7T A;  3W2V A;  3CVP A;  4JHJ A;  4KVO A;  4DK5 A;  2EIJ C;  3HNI A;  4LER A;  2AXU A;  3IQT A;  3ASO E;  5KCM A;  1W3B A;  3KAE A;  5H7P A;  1AUE A;  2ICW G;  1MHQ A;  4JKV A;  2IYL D;  1MJ0 A;  2A1D D;  4LDK A;  3LYA A;  3NAW A;  3ASG A;  3PRZ A;  3G2U A;  5KBA A;  1VB5 A;  3E30 A;  2W45 A;  4BSX A;  1D8E A;  2W9Y A;  3S9O A;  2H7O A;  1OUV A;  1ZYR F;  4ANX A;  3NMI A;  3ZC4 A;  3GEI A;  4FHJ A;  4LRZ A;  1FT1 A;  4CEM A;  2WQ7 A;  1QBQ A;  1NU7 D;  1Z63 A;  3EIQ C;  1T01 A;  4EKW A;  4KC9 A;  1VTM P;  3UMV A;  2PFD A;  2V26 A;  3DWW A;  3RIP A;  3BU8 A;  3PRE A;  2HFI A;  3G2S A;  2R7U A;  4JCH A;  3SD5 A;  4JL0 A;  2VH3 A;  3DE8 A;  3UX4 A;  2FBN A;  2AJA A;  4A1G A;  4HOU A;  2AP3 A;  3B7B A;  4JUR I;  2IY0 C;  1QVX A;  3E37 A;  5BW8 C;  1ZVZ A;  3ZIM A;  3FUJ A;  2R05 A;  1LPE A;  2P0N A;  2WQH A;  3BG0 B;  4JB8 P;  2RKK A;  5ANR A;  1N54 A;  2R59 A;  1C03 A;  2LXL A;  5AYW D;  3G4X A;  5CMW A;  1UOH A;  4NIK A;  4XEV A;  1DC2 A;  1DCQ A;  4OIO F;  1E8Z A;  1N11 A;  3HXD A;  2J9U A;  2F0Y A;  3T8K A;  4HNA D;  5JJ6 A;  3PHF 2;  3QC1 A;  4PS7 A;  3ESK A;  5A69 A;  3I4U A;  5F5H A;  5B1A E;  4DRH B;  2J0W A;  2QY7 A;  3EHQ A;  3W2W A;  3PMR A;  3VM6 A;  4GCN A;  3ZQV A;  4U63 A;  5JA4 D;  4JA7 A;  4YDO A;  2L9J A;  3C3O A;  5FIO A;  3N24 A;  3HXB A;  3P1U A;  2DZN A;  4YK5 A;  3L34 A;  3DRA A;  3FAJ A;  1JPJ A;  2HMQ A;  1SQM A;  4DPR A;  4UQY A;  3G2T A;  2QTV A;  4LDR A;  2ZIR A;  3NKD A;  1U6H A;  2RG8 A;  1IHG A;  3LY8 A;  1YCS B;  3UMK A;  2HJ3 A;  2KNH A;  4HS2 A;  1OT8 A;  1K1B A;  1Z3I X;  4G25 A;  2P9L G;  5FT9 A;  1TNZ A;  4D4N A;  3AG2 E;  3DKA A;  3ABM E;  3APD A;  4JHK A;  1MNE A;  2I1K A;  3LAY A;  4XTK A;  4JZA A;  5L0H A;  1L5J A;  4MS6 A;  5HQ8 A;  1FVF A;  3UQ3 A;  2LSE A;  3PNT B;  3ZSU A;  5B3S E;  3EPV A;  5KJK A;  2P58 C;  4BET A;  1RW2 A;  2WL8 A;  1CPR A;  2CG3 A;  1A7E A;  2PP4 A;  4GYY A;  1EI7 A;  4FJY A;  2I6H A;  1M2V A;  2LFD A;  3GM2 A;  3IQ5 A;  1QNF A;  4GCO A;  4R7L A;  2C03 A;  2ZD9 A;  2XL4 A;  3ULY A;  4FP7 A;  3MCX A;  5EHH A;  2P61 A;  2NUP A;  4AL1 A;  5E33 A;  4M63 A;  2Q00 A;  4LNG A;  1YZA A;  2VYI A;  3FTV A;  2CFZ A;  4A4A A;  4N39 A;  1NSG B;  1U3D A;  3JSZ A;  3ATP A;  3IKO B;  3DEP A;  3IXE A;  1YYH A;  5F5F A;  3JCK C;  5KJN A;  4WAB A;  1H19 A;  3FTW A;  4IAR A;  3POV A;  3Q6N A;  3DWL G;  5AQA A;  2KYH A;  1MMN A;  3K1I C;  4DUI A;  4GZ3 A;  3SZ7 A;  4HRL A;  3UMH A;  3CQZ A;  4EBA A;  2QC9 A;  2IXM A;  1KZP A;  1WAO 1;  2XPI A;  3ZKJ A;  4U95 D;  1O87 A;  3SI5 A;  2Q9B A;  5DS4 A;  3PZ1 A;  4RLY A;  4W9R A;  2XZD G;  2XCC A;  4I1M A;  3LXU X;  3BG1 B;  5KNH D;  1PV3 A;  2YKZ A;  3B9Q A;  4P9F A;  4FLH A;  4ABN A;  3CEQ A;  2X6I A;  1Z23 A;  3TJ6 A;  3OA1 A;  3IPM O;  1O1T A;  3GZS A;  2X6H A;  4AM9 A;  4YN0 B;  2MYS A;  2OJQ A;  4W8P A;  2XL8 A;  4GTV A;  1Z3X A;  4J7Y A;  1YYJ A;  1AVO B;  4JXT A;  4PAC A;  4GTM A;  1S64 A;  2YL3 A;  5CI9 A;  4JTA B;  1IW7 F;  4OD4 A;  2AXZ A;  2BC5 A;  4P29 A;  3JCU Q;  2YL7 A;  3KYJ A;  4NAC A;  4XE0 A;  4I3M A;  1ZU5 A;  3B0V C;  1OWN A;  1DOV A;  3CVW A;  4O6N A;  4F53 A;  1WM5 A;  4BES A;  3SXM A;  1I5N A;  2Q9C A;  2BKK B;  2IOL A;  4L9P A;  2AWY A;  3H2U A;  5D2M C;  1UJJ A;  3SQV A;  3MV3 B;  5HRY A;  5LX8 A;  2A6H F;  4NQF A;  4G7O F;  4EWC A;  1FPP A;  1OCZ E;  2KZT B;  3ENE A;  4N3B A;  1D1A A;  4YT5 A;  4ULV A;  3KD7 A;  2BKG A;  3EHR A;  3Q47 B;  1TR4 A;  4TUU A;  1FCH A;  4U8Y D;  3UGO A;  4XKC A;  1HF8 A;  1N4Q A;  5D0Q D;  1G4U S;  3AG1 C;  2P9P G;  3PUJ A;  3QB2 A;  3FHE A;  4WND A;  4RQI A;  3K66 A;  5CI8 A;  3MYI A;  2KAT A;  4XEK A;  2J9V A;  4N5C A;  3FTU A;  3R9A B;  1MX4 A;  2KW3 C;  3T5X A;  1TN8 A;  4ONS A;  2F8Y A;  1RZ4 A;  4IUL A;  3AU5 A;  3E34 A;  5JVE A;  4CJG A;  1XNF A;  4K5B A;  4Q69 A;  5LFA A;  2YRF A;  5BV1 A;  3CHQ A;  4BJ6 C;  2PX3 A;  1VMA A;  3JRM O;  3FUI A;  5T3T A;  3EUV A;  3L54 A;  2B6C A;  3CHP A;  2JD3 A;  3MKQ B;  2PL2 A;  5HV9 A;  2J07 A;  1HE9 A;  2OEV A;  3I5Q A;  4PJN A;  4U07 A;  4GB9 A;  2XQ0 A;  1OY3 D;  3C18 A;  2LSU A;  3HXF A;  2B0J A;  5EK0 A;  4D10 C;  3CVQ A;  3GZ2 A;  4N3C A;  3ZUV B;  2R7W A;  5FCL A;  4G2V A;  5G05 J;  2EIM E;  3UI2 A;  5ENS D;  2J7P A;  4G24 A;  2LD6 A;  1IQR A;  1OXK A;  2CYD A;  1N1C A;  4HXI A;  1OR2 A;  1APC A;  3DJU B;  2WVO A;  1QZX A;  4CDA A;  4PK4 A;  3UR3 C;  4E0H A;  4JIO A;  2PNN A;  4MVS A;  3UGP A;  2XEN A;  1YLM A;  2RD9 A;  3ZQY A;  5CED B;  4XPW A;  3HYM B;  1NZE A;  1JRA A;  3QAQ A;  3Q15 A;  1EYH A;  2Y3G A;  2OCC E;  4C9B B;  2M64 A;  3FMS A;  1RCP A;  4XKB A;  4FA6 A;  1D1B A;  2VSO E;  2WXP A;  5ARF A;  3RW0 A;  1HE8 A;  1NP7 A;  4A63 B;  3FU6 A;  2ETA A;  1S7Z A;  4YDE A;  2XS8 A;  3LLI A;  3TWV A;  3RKO F;  2Y3A A;  2H7B A;  1VLS A;  2CW0 F;  1V74 B;  3PZD A;  3FUL A;  4K5C A;  1E83 A;  1HMD A;  4G7Z F;  2A68 F;  2FEZ A;  3APC A;  1ZZP A;  3LS0 A;  3ABK E;  1BR1 A;  2J46 A;  4GZ6 A;  4RG9 A;  3SFZ A;  1M2V B;  3TWU A;  3JYY A;  1HXI A;  3QAR A;  3ZU7 B;  5CCL A;  3DXJ F;  3TWW A;  3D9L A;  4DX2 A;  1CGN A;  2PZI A;  5J08 A;  5A6J A;  4EZK A;  4HE8 D;  2IU1 A;  2EQX A;  3FY4 A;  4N06 A;  4J7W A;  4O6Y A;  4PFO A;  1NG1 A;  5COG A;  3TUL A;  2YNQ A;  4O60 A;  3EH1 A;  1HFA A;  1O1R A;  4AOF A;  4G78 A;  4Y6C A;  4U5H A;  5KYY A;  3CVL A;  5FWQ A;  3T6B A;  4FAP B;  4APO A;  5L0I A;  3E4B A;  3R2P A;  4LLC A;  2IM8 A;  3W8H A;  3CST A;  1SZA A;  3UT4 A;  4BTB A;  3L17 A;  1MX2 A;  3U0C A;  1JPL A;  3RQG A;  5CEC B;  3L08 A;  3UM2 A;  2GGF A;  3SHF A;  2IXP A;  4U5D E;  3CGH A;  5E76 A;  1N9A A;  5ENO D;  2WMO A;  5B3I A;  4BEP A;  1NA3 A;  1UG3 A;  5EIB E;  2IQC A;  2A0U A;  3GWL A;  3FUD A;  3BEE A;  3RQF A;  1VYI A;  3FEY A;  2V0P A;  3L8J A;  5LCW C;  2BF0 X;  4IWB A;  2P9S G;  3RKV A;  4PJL A;  3C98 A;  1AP7 A;  4JVS A;  3FDQ A;  5LCW J;  3FU0 A;  3ECS A;  1HW2 A;  3S2A A;  4ILI A;  2L6J A;  3TQO A;  4O7G A;  4I2Z A;  2KM4 A;  1Q0K A;  3PDM P;  2KXP C;  5CER B;  5A6B D;  4I1A A;  1WG0 A;  1NFO A;  1OWM A;  1QSP A;  3S7B A;  1NL4 A;  3RYL A;  2O9X A;  5EID A;  4AY6 A;  1YA9 A;  3GAN A;  2XLM A;  2AU5 A;  4A55 A;  5CBN A;  1BR2 A;  1SVX A;  5E3C A;  3LCA A;  4JZY A;  4E0I A;  1H6G A;  1EPU A;  3SBS A;  2PX0 A;  2Z15 A;  2XGS A;  1Z3Y A;  3DPY A;  4K7B A;  2Y3B A;  3Q49 B;  1RKC A;  1S63 A;  4CSA A;  2IEJ A;  3QWP A;  5DS6 A;  1JPN A;  3Q73 A;  4BX9 A;  5JT4 A;  3V31 A;  1ZHX A;  1TNO A;  1OCR C;  3ESL A;  1WAT A;  3FWV A;  2WZL A;  4EQF A;  3RVZ A;  2GRQ B;  4U96 D;  4IRU A;  3LVR E;  3AG4 E;  1T6I A;  5FJY A;  2L0I A;  1OWL A;  3HNL A;  3ABL C;  2YQY A;  3T9K A;  2Y4T A;  5CCM A;  2QLA A;  3K1I A;  3UUX A;  2EPM X;  3WAQ A;  3ULE G;  1Q0G A;  2MYO A;  5EX3 A;  2L6G A;  3OXL A;  4TRQ A;  2GRR B;  1SA5 A;  1YVI A;  3EG9 A;  1Z7Q c;  5JRA A;  3QJZ A;  4UI9 C;  1O1S A;  1E8W A;  3DSS A;  2AVK A;  1Y4C A;  3L0I A;  4WWN A;  3GWN A;  4HFG A;  4AV7 A;  3AG1 E;  3U2L A;  4CS8 C;  2R7X A;  2R7Q A;  3W9G A;  2WVN A;  4JJF A;  2FO1 E;  4I43 A;  3PZ3 A;  1MMG A;  1UFB A;  4WGZ A;  4CBE A;  5L0J A;  1TWA A;  2IO2 C;  1OCZ C;  3RQE A;  1AEP A;  1TR2 A;  1XGW A;  3S28 A;  3JQ1 A;  3RO3 A;  3W4Y A;  3FTY A;  3ZVR A;  3FH5 A;  3P2B A;  3FXH A;  4CDY A;  3TAX A;  4HFF B;  3CKB A;  2Y3D A;  4JEU A;  4BT8 A;  3HDX A;  3SBT B;  2R9R B;  3DSW A;  1TWG A;  2XRH A;  2YIN A;  2VTB B;  3O39 A;  2DB4 A;  5E75 A;  3IHV A;  4I6G A;  5CRU A;  3ABK C;  4DRJ B;  3HXE A;  3QVY A;  1E90 A;  4GPM A;  3LJN A;  4LSZ E;  3MA5 A;  3O48 A;  1A7V A;  4U8V D;  3ZG1 A;  3DE9 A;  4MTG A;  2J08 A;  2WZF A;  5A6C A;  2W4B A;  4HOS A;  3GYZ A;  4AY5 A;  3LJB A;  4O1O A;  4IGG A;  3K1H A;  4N2S A;  4LDQ A;  1PC2 A;  3J06 A;  3M79 A;  3D9N A;  2DCP A;  4YT4 A;  5KYU B;  2ZIS A;  4YVQ C;  5BQI A;  2L6B A;  1R4T A;  1RJ9 A;  4CCA A;  5KJL A;  1FVH A;  3C72 A;  3NOC D;  3GM3 A;  1D8D A;  1NZN A;  4GTT A;  4MVU A;  4QQI A;  2I9C A;  2GRL A;  1U2V G;  3QKY A;  1E86 A;  3MKQ A;  4GTQ A;  3LEV A;  3QWV A;  4QDL A;  3O10 A;  5ANL A;  1Q0F A;  1R5I D;  3KSQ A;  4H54 A;  4LLE A;  2XLD A;  2XLE A;  4K5A B;  4WGY A;  4MQ9 F;  5D91 A;  3U3B A;  3KYI A;  3UT7 A;  3AG3 C;  2YHE A;  1Y8M A;  3Q4A B;  2R02 A;  4I6J A;  2IFU A;  2C0M A;  1J8Y F;  3PZ2 A;  3VTX A;  2J9B A;  1BD8 A;  4BPM A;  5KYX A;  1VDY A;  3RO2 A;  3ISM C;  2WB2 A;  3QWW A;  4NTF A;  3N2Z B;  4IN3 B;  4ME2 A;  2Y3H A;  2YLI A;  4JRZ A;  3KKB A;  2EPN A;  4YT8 A;  2PQN A;  2H6I A;  3EFO A;  5T4Y A;  3QVZ A;  4H7X A;  3VLF A;  5T8I A;  5AQB A;  4ZHB A;  2WQ6 A;  1S70 B;  4NRH B;  3UIP C;  3X2Q E;  4CT0 A;  2UY1 B;  1MQS A;  4A3T A;  2NSZ A;  5ENP D;  2XEV A;  3T6G B;  2Y69 E;  3C3Q A;  2MWQ A;  1LKX A;  1ZW3 A;  3QNK A;  2RSE B;  3ZTM A;  4DX6 D;  2XGO A;  1FFT C;  2BUG A;  1YA7 O;  3OEO A;  2WB7 A;  3FTZ A;  2D5R B;  4OAU C;  2KK1 A;  4HB5 A;  2AVP A;  3DI5 A;  5CMY A;  4TXP A;  3RAU A;  3FH7 A;  4DVY P;  2Y39 A;  3ZXP A;  2HUJ A;  2EPO A;  3DSX A;  4B93 B;  4YDW A;  1YJG A;  4F7A A;  3LLK A;  4C3D A;  4MTO A;  2WXI A;  5CIV A;  3Q7L A;  2RFM A;  3X1O A;  4AP2 A;  3L82 A;  1MND A;  5AAO A;  2X6J A;  5B1B C;  4XPY A;  4LCT A;  3M15 A;  4FLB A;  1BU9 A;  1TNB A;  5IY5 E;  3SY2 A;  1VK5 A;  3B95 A;  3TWS A;  2XLW A;  4FX5 A;  3CVV A;  2GA0 A;  3NMJ A;  3GOD A;  4ER9 A;  3CAX A;  5FZS A;  1OW6 A;  3CSK A;  1H2T C;  1ORJ A;  3OXF A;  1Q0M A;  4OAV B;  1X81 A;  2P9U G;  3MV2 B;  3K7D A;  2M63 A;  4GTO A;  1K1A A;  4I44 A;  1OXB A;  4E18 A;  2DYS E;  3H65 A;  2L6F A;  5B3S C;  4IYP A;  4MND A;  3G2V A;  3CHR A;  4RDA A;  4EHM A;  2H7V C;  5DBK A;  4Q5S F;  2NG1 A;  3QK0 A;  3LKU A;  1BDJ B;  3FEX A;  4K0D A;  2NSF A;  3NQP A;  4XLP F;  1H7I A;  1SZ9 A;  4GTS A;  4HLL A;  4LG6 A;  2Q4F A;  1WY6 A;  3I3N A;  3EG9 B;  3QOU A;  1JWG A;  4ANV A;  5LP0 A;  2EIM C;  5KWD A;  3QMK A;  1OXJ A;  3AS4 A;  3FHD A;  2E0I A;  1OCO C;  4PJJ A;  4BTA A;  2LP4 A;  3O4Z A;  1D0X A;  2WXO A;  1OCC C;  2ZXO A;  3B7R L;  4AE4 A;  2NYJ A;  3MGB A;  3EQL F;  2YHC A;  2ZXW E;  3TXN A;  5CBO A;  3UM0 A;  2W4M A;  4KYO B;  4GAA A;  4BG0 A;  1PY1 A;  3TWR A;  5B1B E;  2V5Q C;  1KU2 A;  5CHE E;  3B0P A;  1TQG A;  5HKP A;  4APF A;  5CEA A;  5AJL A;  5AC5 A;  2GFH A;  3I4G A;  3DSU A;  2XXA A;  3LPZ A;  3ZPJ A;  5A6B A;  4PDX A;  3DXK G;  4OIP F;  4RVB A;  3HG0 D;  5ENT D;  2MRI A;  3PE3 A;  4ANW A;  3F6Q A;  4PS8 A;  3RF3 A;  3CK7 A;  3LNM B;  4GTP A;  4KI2 A;  4CS9 C;  3NG1 A;  4L2Y A;  1KTM A;  1ORY A;  2C0L A;  4FHK A;  2OCC C;  1PAQ A;  3J5P A;  2MHR A;  4MLP A;  3R9M A;  1CPQ A;  3LY9 A;  4B89 A;  2LO6 A;  2KZT A;  3TJ5 A;  1HU3 A;  3E70 C;  2Y69 C;  3CVY A;  3AQB A;  3K9I A;  3EZI A;  4N6H A;  4E7Z A;  1BZ4 A;  3ABM C;  2GRM A;  4DI4 A;  3ZYL A;  1MQV A;  3ONK A;  1LF8 A;  2DBA A;  1ZHZ A;  4E17 A;  3VLD A;  1N95 A;  3B13 A;  3U8V A;  2MHK A;  3JYS A;  1RJ9 B;  1LS4 A;  5L0D A;  4GMJ A;  1QPU A;  3LNR A;  4YT2 A;  1TFK B;  3WOD F;  2IO3 C;  1N94 A;  3C62 A;  2ZGG A;  3SEO A;  3Q79 A;  1JCQ A;  3L6A A;  4C3B A;  5K0I A;  2QYJ A;  3ASF A;  3PUK A;  1B68 A;  4MS2 A;  3CKC A;  5AQ7 A;  1TJC A;  5BUZ A;  3T5V A;  2YEV A;  1QQ3 A;  2I8B A;  4J8E A;  1NFN A;  1YDI A;  1LI5 A;  3O55 A;  1LI7 A;  1YYX A;  5COF A;  2OG2 A;  2DGJ A;  4H4K C;  1CGM E;  4EBK A;  4AL0 A;  3HRA A;  3TWX A;  3MZL B;  4F1S A;  1F1M A;  1LD7 A;  4E6H A;  3DJN B;  3ZTZ A;  3PH0 C;  2P1A A;  3ASD A;  2CGE A;  3TOL A;  4CGW A;  1MMD A;  3AGT A;  1XZQ A;  2WXM A;  3I5P A;  5ARG A;  1E2X A;  2YHS A;  1G5Z A;  2PF4 E;  2R03 A;  2HO1 A;  3DSV A;  1ZU4 A;  3TL5 A;  3MYV A;  1B89 A;  3FH8 A;  2J49 A;  1PD1 A;  4JW1 A;  1RMV A;  4RG6 A;  3FU3 A;  5KNG A;  3NKE A;  1DVP A;  1YA0 A;  2JLB A;  2V3C C;  5A23 A;  2CG2 A;  4NUR A;  2A6E F;  3LEO A;  4XI0 A;  2OEW A;  2OJE D;  3JYH A;  1C17 M;  3D9M A;  3RH3 A;  1LM3 B;  4EEC A;  3MX3 A;  4GZ5 A;  3AG4 C;  2J0X A;  1N0R A;  2QFC A;  2EIL C;  3S7J A;  2XM0 A;  2OOC A;  3T6J A;  3VYW A;  1WOL A;  3M4B A;  2KC3 A;  4L6R A;  3V2X A;  3ZYQ A;  2JAB A;  2VQ2 A;  4FU3 A;  4HBD A;  3S84 A;  2UUI A;  2VSY A;  2NUP B;  2Q7F A;  4CDR A;  1RKE A;  3FOP A;  4MW8 A;  3URZ A;  4O79 A;  2YLG A;  5GPG B;  2ASR A;  3DPD A;  2IF4 A;  3JSE O;  3C8G B;  5COM A;  3KEZ A;  3U64 A;  1O5H A;  3AJI A;  2J9Q A;  3Q78 A;  1TJF A;  2B0O E;  3SZR A;  3SP1 A;  1O5M A;  2OOE A;  4QI0 A;  3NOG D;  5JMN D;  2E87 A;  2XEH A;  4QI2 A;  2WXF A;  2EIN E;  2VC9 A;  2BED A;  2UWJ G;  4EBJ A;  2WXJ A;  4J8F A;  2VCB A;  1HY5 A;  4JPS A;  2P2C P;  1IHB A;  3AG2 C;  4GA2 A;  1IKN D;  4AK9 A;  1LVK A;  2OND A;  4NC3 A;  3U3F A;  3Q5M A;  4E85 A;  3FU5 A;  1L7C A;  5JUA A;  3WG7 E;  1X5B A;  3PVL A;  4BFR A;  1KZO A;  1QQE A;  3CK9 A;  2FGY A;  4D4X A;  3HXC A;  1MX6 A;  4IB4 A;  2WZG A;  3Q7G A;  4FAD A;  2X3M A;  4XWJ A;  3U5S A;  2XHE A;  2H6G A;  3DZA A;  4DI3 A;  4EBA G;  3PS6 A;  2QY9 A;  4JTC B;  4JE9 A;  4R32 A;  4TXQ A;  4MVO A;  3U4T A;  2IXN A;  4MVM A;  5KJM A;  1ELK A;  4CT4 A;  4A3V A;  4AE4 B;  5BPP A;  5FZT A;  5BT1 A;  4ACL A;  2LAI A;  3FOO A;  4WWO A;  3T4R A;  4U5F E;  1WWP A;  1EF1 C;  2TMV P;  4PFP A;  3QDN A;  3UM3 A;  3FFL A;  4U5G A;  4IAQ A;  1XWJ A;  2FAP B;  1U3C A;  4GTR A;  2R17 C;  3SFY A;  2HM8 A;  1JMW A;  3TG5 A;  2KCV A;  4XEF A;  1H0A A;  4Z68 A;  256B A;  1T6U A;  4LAC B;  3ZFW A;  2F8X K;  2D4U A;  3UKU G;  3GEE A;  3CZ6 A;  3ZDL A;  1OCC E;  2XS1 A;  1ZHW A;  2OU6 A;  4J8D A;  1QYM A;  1NFI E;  3E9V A;  3IBE A;  5G05 C;  3M4C A;  1D0Y A;  4CIH A;  3FUF A;  5L0C A;  4J6I A;  4OVV A;  1E96 B;  3VAY A;  1UW4 B;  2VSX E;  3K33 A;  1IQU A;  4J0U A;  4I9E A;  4EIY A;  1XZP A;  2R7V A;  4GYO A;  4PS3 A;  1KLX A;  1SA4 A;  3AS8 A;  3Q6M A;  2WMN A;  4AJW A;  1FR0 A;  1E84 A;  3FVY A;  1HE1 A;  2VAS A;  1LS1 A;  1SW6 A;  4GA0 A;  2J8W A;  4G0H A;  1HW1 A;  3PEU B;  2XLV A;  4G23 A;  5AJD A;  3VF0 A;  2HV6 A;  3G2W A;  3JUE A;  2CCY A;  2I2O A;  4M7C A;  2NXP A;  2FI7 A;  1LD8 A;  3TG4 A;  4HOT A;  3CLJ A;  3L22 A;  3N71 A;  4KXK B;  2QZA A;  2KBX A;  3JTL O;  4FES A;  4Q96 A;  4JEA A;  4OD5 A;  3DXM G;  3CVU A;  3CSF A;  2OKU A;  3IV0 A;  3U9M A;  2VTB A;  1M56 C;  1NBB A;  2HR2 A;  2Q3T A;  4DBR A;  3U9W A;  4KZ0 A;  3UTM A;  3CHM A;  4LNB A;  2J7P D;  1CGO A;  4C0M A;  2ZU6 B;  1HZ4 A;  3DAF A;  4P6I C;  2X38 A;  3L16 A;  2P6V A;  1Q0D A;  2XEE A;  3JQ0 A;  4KNW A;  4V3I A;  3JXI A;  3EGX A;  3PE4 A;  2DYR E;  2P7V A;  4U9D A;  2Y0B G;  3O6X A;  4A2N B;  4NY3 A;  4G11 A;  1BI7 B;  2NSG A;  3B7T A;  5AC4 A;  3NMK A;  3LS8 A;  1QLE C;  2I1J A;  5KYN A;  4KVM A;  3UM1 A;  3JXJ A;  1EKY A;  5AQ9 A;  4XX5 A;  3DD7 A;  1SYQ A;  3GEH A;  2KCK A;  3ASN E;  3J5Q B;  3RIB A;  3FAP B;  4U7E B;  3V30 A;  3V7O A;  3AQC A;  4MVR A;  2DYR C;  2ZXP A;  3UNG C;  4JA9 A;  1EQ1 A;  3NB2 A;  4JTD B;  4ULW A;  2LQG A;  2Y4U A;  3RRU A;  4CIP A;  1LE4 A;  2XSE A;  3A11 A;  2LFF A;  5ITZ F;  4FUL A;  4XZ4 A;  2BE5 F;  4ANJ A;  2VB6 A;  2WXN A;  4HI8 A;  4RBN A;  3ZRH A;  2VGE A;  3SXZ A;  1Y6I A;  1JOG A;  1IYG A;  4WUY A;  3F46 A;  4JC8 A;  3AOU A;  4WNF A;  4MKT A;  5D92 A;  1K3Z D;  3ZHE B;  4G8L A;  1E85 A;  5KYY B;  4UDV A;  1H6O A;  3CV0 A;  3CVN A;  3S29 A;  5J90 A;  1OR3 A;  3V5Z A;  2XCB A;  2YLD A;  3MBG A;  4N5Q A;  3ZW3 A;  3KMI A;  4UWK A;  3HTK C;  3DBS A;  4BEJ A;  1UN9 A;  2EIN C;  3DAG A;  2VCC A;  1FMW A;  4BY6 A;  2WXQ A;  1D1C A;  3LUT B;  5EGY A;  2GDC A;  5BXO A;  1FAP B;  2AWC A;  4HFK B;  4HI9 A;  1WDY A;  2VGY A;  1BBH A;  4PJM A;  3U8P A;  5JJT A;  3DEO A;  2CHX A;  1A7D A;  4ACK A;  3QW0 A;  5BUO A;  5A6K A;  3T9O A;  3R7R A;  2YVK A;  1A5E A;  5M72 A;  4XIF A;  3MJW A;  4B6I A;  2P9I G;  4URK A;  3EIJ A;  3LVQ E;  3ZEF A;  4KMO A;  2GRN B;  3TXM A;  2LXM A;  5DQZ A;  3SYN A;  2DI3 A;  3EU5 A;  1Z5Z A;  5TJ5 E;  3B0U X;  3D9H A;  4HEA J;  1TKN A;  1L3P A;  2EIL E;  3Q9N C;  2IOS A;  4CRW A;  3TD7 A;  2WXR A;  1OKK A;  1JUQ A; 
#chains in the Genus database with same CATH homology
 4B8A A;  1N52 A;  5B1A C;  4OIN F;  3CQC B;  3F47 A;  4L23 A;  2IXO A;  4GU5 A;  4I17 A;  3NZU A;  3NRH A;  2V8S E;  3S0X A;  4E7S A;  5HSW A;  3D9I A;  3VTY A;  4BT9 A;  3FP3 A;  5G04 C;  1ELW A;  4O6M A;  1HH8 A;  4UQX A;  4AEZ C;  4JEH A;  4LUN U;  3I4R B;  5EDS A;  4DLQ A;  2ZXW C;  4C3E A;  2J09 A;  4I9C A;  5DLJ A;  2FF4 A;  3S7F A;  3ZN3 A;  3ITF A;  5FTP A;  2ILR A;  4AXH A;  4C7O A;  1S0P A;  3FTS A;  2R7O A;  3OTN A;  2G62 A;  2CHZ A;  4M3O A;  3CHO A;  2CHW A;  3CR3 A;  4U0U A;  1FFH A;  3L13 A;  3JT1 A;  3ZVV A;  1TEZ A;  1TWH A;  4CDM A;  2BTD A;  5DIZ A;  3B7U X;  5KYW A;  4EZJ A;  3TGO A;  2XXA B;  2LSV A;  2FUL A;  3EDT B;  3QZC A;  2PM6 A;  5T1D B;  4K0R A;  2C2L A;  2V5F A;  1EDU A;  1SMY F;  2NC9 A;  5FZQ A;  4RD9 A;  2WVQ A;  3ML9 A;  4N3A A;  2X6K A;  3R7Q A;  1NA0 A;  3X2Q C;  4QFV A;  4OIQ F;  3EGX B;  2J45 A;  2CNW D;  4DBQ A;  1V55 C;  2HV7 A;  1M57 C;  3D9P A;  5FQ6 A;  4GYT A;  5IY5 C;  2WVI A;  3HVE A;  4BX8 A;  3TJP A;  2IOQ A;  4I6E A;  1WGW A;  3PDN A;  4PH4 B;  4KBL A;  1INZ A;  2PQR A;  1OWP A;  3OWT A;  3SF4 A;  2XPY A;  3CHS A;  1MMA A;  2MOW A;  4HVB A;  2EIK C;  4U0S A;  1HG5 A;  2A5U A;  3K6B A;  3D9K A;  1H2U A;  5EX0 A;  3ASN C;  2WXL A;  1NU9 C;  3UPV A;  1OWO A;  3EHM A;  1VOM A;  2OVB A;  4EZL A;  4OVU A;  3ZHE A;  2XPZ A;  1HG2 A;  2NUT B;  3MLG A;  3SGH A;  4AIF A;  4YWQ A;  5JJ7 A;  1M2O A;  1HX8 A;  1TWC A;  3DM5 A;  4FC8 A;  4DJA A;  2UY1 A;  4I1O B;  3KS2 A;  4UWG A;  1V54 C;  3HIZ A;  4J8S A;  3UT8 A;  1E7V A;  5D0O D;  4L7T A;  4UI9 J;  3IEE A;  1QZ2 A;  2OV8 A;  4B8C B;  2AWI A;  2YZS A;  2G3K A;  3HLZ A;  4FWV A;  3M1C B;  4BJ1 A;  2RD0 A;  1JWF A;  3AU4 A;  3ZIB A;  3NF1 A;  2Q9A A;  4CS8 A;  4BWR A;  5T3R A;  3JRT A;  3ZXS A;  2VJ8 A;  3NYJ A;  4WNG A;  1PD0 A;  4XI9 A;  4CS9 A;  3FTX A;  4H7Y A;  5ENN A;  2R7R A;  3WG7 C;  2A69 F;  3EGD A;  3LEW A;  1PCX A;  2KCL A;  5AIJ A;  3IHY A;  3MEK A;  4GML A;  3RRN B;  4UWF A;  2L81 A;  4EBB A;  4WWP A;  4CSA C;  5BV0 A;  2ZXR A;  2KQ9 A;  1FMV A;  4G7H F;  2VGX A;  3NYM A;  2XRY A;  5DQT A;  4C7O B;  4G1T A;  1UN8 A;  5C2Y A;  3OXG A;  2ION A;  3KL4 A;  2X51 A;  4L1B A;  4HLE A;  2WM9 A;  3ZGQ A;  4UQZ A;  4ATG A;  1ZU2 A;  2L9B A;  3S27 A;  5FQ8 A;  3RU0 A;  3ML8 A;  5EKQ D;  3RFY A;  4ANU A;  3UMI A;  1Z6T A;  2V4L A;  5KYW B;  4K03 A;  2FO7 A;  3S7D A;  2AW6 A;  3FUN A;  4KBQ A;  1ELR A;  1BPO A;  4Q4Z F;  4I2W A;  3U66 A;  3MKR A;  4U8H A;  2OVF A;  4F3V A;  4GA1 A;  3ZYK A;  3NDB B;  2J4B A;  3RRM B;  3SNH A;  1A17 A;  1DNP A;  5T3W A;  2A4Z A;  1KT0 A;  4HOR A;  4GZC A;  2HYZ A;  2CFU A;  3FUH A;  2VSN A;  2C04 A;  2XRZ A;  2L0T B;  2KGO A;  2GW1 A;  5JHA A;  3APF A;  4A1S A;  3N0T A;  4JJG A;  1J8M F;  4IAO A;  3FUK A;  3EJN A;  4L2L A;  3ASO C;  4GYW A;  3HVE B;  4CDN A;  2R7T A;  4OIR F;  3GW4 A;  4O6F A;  3B7S A;  3D9O A;  4RSY A;  4J32 B;  2FFH A;  2J9W A;  4DLO A;  3CIA A;  4TV3 A;  2WXH A;  3AS5 A;  3ULQ A;  1SZI A;  3KH2 A;  1GW6 A;  1E7U A;  4ZLC A;  4FJZ A;  2R7S A;  2E2E A;  3ZYM A;  3NYL A;  1BR4 A;  2WXK A;  3IEG A;  4J30 B;  5HI7 A;  4B94 A;  3LS1 A;  4ILG A;  3GZ1 A;  2NUT A;  1ZBP A;  4PUC A;  1SF8 A;  1FTS A;  5KYU A;  4HOQ A;  1ZHY A;  3DMD A;  3D9J A;  5G55 A;  3CQG B;  4WJ0 A;  3LES A;  3SNX A;  5E2Q A;  4KT6 B;  2CNW A;  4MRU A;  2CDQ A;  4U5E E;  3LJ3 A;  1E8X A;  1KT1 A;  3CVX A;  4Q94 A;  1Z6A A;  4EPZ A;  3OAW A;  4DOZ A;  1ZHT A;  2AXV A;  2KJG A;  4B0Z A;  1H2V C;  4YJW A;  5LOZ A;  4KNV A;  1ST6 A;  1HO8 A;  3NZS A;  5KYX B;  3PNL B;  4ZLD A;  3ASH A;  4BJ6 A;  4C0E A;  3RJV A;  5A7D B;  3T8M A;  4N2Q A;  5L3Q A;  4UWH A;  3EFO B;  2WXG A;  3ONL A;  4U0Z A;  5DS5 A;  2M4E A;  4GZD A;  3VLE A;  5C1D A;  3JUI A;  3DM9 B;  4UI9 K;  2DYS C;  3EHN A;  1D0Z A;  3LY7 A;  4GPK A;  3EZH A;  4W8K A;  5BNW A;  2G3V A;  2WPV A;  1IZM A;  4NQ0 A;  4BJ5 C;  4AVX A;  3HHM A;  3U3W A;  1HS6 A;  5JHB A;  2LAH A;  3LDZ A;  5E3A A;  3WXX A;  5L3V A;  3FUE A;  4JHR A;  5G2N A;  4CS7 A;  4OYS A;  3RK6 A;  5FZR A;  2YQ8 A;  2X6F A;  2KC7 A;  1P5Q A;  4X0R A;  2DIW A;  2PM7 A;  4YND A;  4BJT A;  3PEV B;  4Q7C A;  3FUM A;  5FQ4 A;  3EGD B;  2XGM A;  2LNI A;  4U5B E;  4U04 A;  4Y6W A;  5AEN A;  2R5S A;  4UWL A;  4BJ5 A;  3D3M A;  4AX2 A;  1W2W A;  4LEU A;  3CK8 A;  4WAF A;  4F4B A;  4XLN F;  4IJJ A;  2JEK A;  4G26 A;  4ILH B;  3FDH A;  4WNE A;  4CGV A;  5DVW A;  4U5C E;  4DVZ A;  3EH2 A;  2VGX B;  1UJK A;  2ZPA A;  1H6K A;  4GEH A;  4KZC A;  2J4D A;  3HJC A;  3W8I A;  5FQ7 A;  1OKK D;  5G04 J;  1G8X A;  4YVO A;  2IJG X;  1E8Y A;  3W2V A;  1VYK A;  3CVP A;  4JHJ A;  4KVO A;  4DK5 A;  2EIJ C;  4LER A;  2AXU A;  5KCM A;  1W3B A;  3KAE A;  1MHQ A;  2IYL D;  2A1D D;  3LYA A;  3ASG A;  3PRZ A;  3G2U A;  2W45 A;  4BSX A;  2W9Y A;  2H7O A;  1OUV A;  1ZYR F;  4ANX A;  3ZC4 A;  4FHJ A;  4LRZ A;  4CEM A;  2WQ7 A;  1NU7 D;  1Z63 A;  3EIQ C;  4KC9 A;  3UMV A;  2PFD A;  2V26 A;  3PRE A;  3RIP A;  3G2S A;  2R7U A;  4JCH A;  3SD5 A;  4JL0 A;  2VH3 A;  3UX4 A;  2FBN A;  4A1G A;  4HOU A;  4JUR I;  5BW8 C;  3ZIM A;  3FUJ A;  2WQH A;  3BG0 B;  5ANR A;  1N54 A;  2R59 A;  5AYW D;  5CMW A;  4OIO F;  1E8Z A;  2J9U A;  5JJ6 A;  3PHF 2;  3QC1 A;  4PS7 A;  3ESK A;  3I4U A;  5F5H A;  2J0W A;  2QY7 A;  3W2W A;  3PMR A;  4GCN A;  4U63 A;  4JA7 A;  2L9J A;  3N24 A;  3P1U A;  3L34 A;  3FAJ A;  1JPJ A;  1SQM A;  4DPR A;  4UQY A;  3G2T A;  2QTV A;  3NKD A;  2RG8 A;  1IHG A;  3LY8 A;  3UMK A;  2KNH A;  4HS2 A;  1Z3I X;  4G25 A;  5FT9 A;  3APD A;  4JHK A;  1MNE A;  2I1K A;  3LAY A;  4XTK A;  4JZA A;  1L5J A;  4MS6 A;  5HQ8 A;  1FVF A;  3UQ3 A;  2LSE A;  3PNT B;  3ZSU A;  5KJK A;  3EPV A;  2P58 C;  2WL8 A;  2CG3 A;  2PP4 A;  4GYY A;  4FJY A;  2I6H A;  1M2V A;  1QNF A;  4GCO A;  4R7L A;  2C03 A;  2XL4 A;  4FP7 A;  3MCX A;  5EHH A;  2NUP A;  5E33 A;  4M63 A;  2VYI A;  3FTV A;  2CFZ A;  4N39 A;  1U3D A;  3JSZ A;  3IKO B;  5F5F A;  3JCK C;  5KJN A;  1H19 A;  3FTW A;  3POV A;  3Q6N A;  1MMN A;  3K1I C;  3SZ7 A;  4GZ3 A;  3UMH A;  3CQZ A;  4EBA A;  2IXM A;  1WAO 1;  2XPI A;  1O87 A;  3SI5 A;  2Q9B A;  5DS4 A;  4W9R A;  2XCC A;  4I1M A;  3LXU X;  3BG1 B;  3B9Q A;  4FLH A;  4ABN A;  3CEQ A;  2X6I A;  1Z23 A;  3OA1 A;  3GZS A;  2X6H A;  4AM9 A;  4YN0 B;  2MYS A;  1Z3X A;  4JXT A;  5CI9 A;  1IW7 F;  4OD4 A;  2AXZ A;  4P29 A;  3JCU Q;  4NAC A;  4XE0 A;  4I3M A;  1ZU5 A;  3B0V C;  1OWN A;  3CVW A;  4O6N A;  4F53 A;  1WM5 A;  2IOL A;  2Q9C A;  1UJJ A;  3MV3 B;  5LX8 A;  2A6H F;  4G7O F;  4EWC A;  2KZT B;  3ENE A;  4N3B A;  1D1A A;  4YT5 A;  3KD7 A;  3Q47 B;  4TUU A;  1FCH A;  4XKC A;  3UGO A;  1HF8 A;  5D0Q D;  3AG1 C;  3PUJ A;  3QB2 A;  3FHE A;  4WND A;  3K66 A;  5CI8 A;  2KAT A;  2J9V A;  4N5C A;  3FTU A;  3R9A B;  2KW3 C;  3T5X A;  4IUL A;  3AU5 A;  5LFA A;  1XNF A;  4Q69 A;  5BV1 A;  3CHQ A;  4BJ6 C;  2PX3 A;  1VMA A;  3FUI A;  5T3T A;  3L54 A;  3CHP A;  2JD3 A;  3MKQ B;  2PL2 A;  2J07 A;  3I5Q A;  4PJN A;  4U07 A;  4GB9 A;  2XQ0 A;  2LSU A;  2B0J A;  4D10 C;  3CVQ A;  3GZ2 A;  4N3C A;  2R7W A;  5FCL A;  4G2V A;  5G05 J;  2J7P A;  4G24 A;  1IQR A;  1N1C A;  4HXI A;  3DJU B;  2WVO A;  1QZX A;  4PK4 A;  3UR3 C;  3UGP A;  3HYM B;  1NZE A;  3QAQ A;  3Q15 A;  1EYH A;  2Y3G A;  4C9B B;  4XKB A;  4FA6 A;  1D1B A;  2VSO E;  2WXP A;  5ARF A;  1HE8 A;  1NP7 A;  3FU6 A;  1S7Z A;  3LLI A;  3RKO F;  2Y3A A;  2H7B A;  2CW0 F;  3PZD A;  3FUL A;  4G7Z F;  2A68 F;  2FEZ A;  3APC A;  3LS0 A;  1BR1 A;  2J46 A;  4GZ6 A;  3SFZ A;  4RG9 A;  1M2V B;  1HXI A;  3QAR A;  5CCL A;  3DXJ F;  3D9L A;  2PZI A;  5J08 A;  4EZK A;  4HE8 D;  2IU1 A;  2EQX A;  3FY4 A;  4N06 A;  4O6Y A;  4PFO A;  1NG1 A;  2YNQ A;  3EH1 A;  1HFA A;  4AOF A;  4Y6C A;  4U5H A;  5KYY A;  3CVL A;  5FWQ A;  3T6B A;  4APO A;  3E4B A;  4LLC A;  3W8H A;  3CST A;  1SZA A;  3UT4 A;  4BTB A;  3L17 A;  1JPL A;  3L08 A;  2GGF A;  3SHF A;  2IXP A;  4U5D E;  3CGH A;  5E76 A;  2WMO A;  1NA3 A;  1UG3 A;  2IQC A;  3FUD A;  3BEE A;  1VYI A;  3FEY A;  2V0P A;  5LCW C;  2BF0 X;  4IWB A;  3RKV A;  4PJL A;  3C98 A;  4JVS A;  3FDQ A;  5LCW J;  3FU0 A;  3ECS A;  3S2A A;  4ILI A;  2L6J A;  4O7G A;  4I2Z A;  2KM4 A;  4I1A A;  1OWM A;  3S7B A;  3RYL A;  2O9X A;  4AY6 A;  3GAN A;  4A55 A;  1BR2 A;  5E3C A;  3LCA A;  4JZY A;  1EPU A;  3SBS A;  2PX0 A;  2Z15 A;  2XGS A;  1Z3Y A;  4K7B A;  2Y3B A;  3Q49 B;  4CSA A;  3QWP A;  5DS6 A;  1JPN A;  4BX9 A;  1ZHX A;  1OCR C;  3ESL A;  3FWV A;  2WZL A;  4EQF A;  4IRU A;  3LVR E;  5FJY A;  2L0I A;  1OWL A;  3ABL C;  2Y4T A;  5CCM A;  3UUX A;  5EX3 A;  3OXL A;  4TRQ A;  3EG9 A;  4UI9 C;  3QJZ A;  1E8W A;  3L0I A;  4WWN A;  4HFG A;  4AV7 A;  4CS8 C;  2R7X A;  2R7Q A;  2WVN A;  4JJF A;  4I43 A;  1MMG A;  4CBE A;  1TWA A;  1OCZ C;  1XGW A;  1TR2 A;  3S28 A;  3JQ1 A;  3RO3 A;  3FTY A;  3ZVR A;  3FH5 A;  3P2B A;  3TAX A;  4JEU A;  4HFF B;  3CKB A;  2Y3D A;  4BT8 A;  3HDX A;  3SBT B;  1TWG A;  2XRH A;  2YIN A;  2VTB B;  3O39 A;  5E75 A;  3IHV A;  4I6G A;  3ABK C;  1E90 A;  3MA5 A;  3O48 A;  3ZG1 A;  2J08 A;  2WZF A;  5A6C A;  2W4B A;  4HOS A;  3GYZ A;  4AY5 A;  3LJB A;  3K1H A;  4N2S A;  1PC2 A;  3D9N A;  2DCP A;  4YT4 A;  5KYU B;  4YVQ C;  1RJ9 A;  4CCA A;  5KJL A;  1FVH A;  1NZN A;  2I9C A;  2GRL A;  3QKY A;  3MKQ A;  3LEV A;  3QWV A;  4QDL A;  5ANL A;  4LLE A;  4MQ9 F;  5D91 A;  3UT7 A;  3AG3 C;  2YHE A;  1Y8M A;  3Q4A B;  4I6J A;  2IFU A;  2C0M A;  1J8Y F;  3VTX A;  5KYX A;  1VDY A;  3RO2 A;  2WB2 A;  3QWW A;  3N2Z B;  4IN3 B;  4ME2 A;  2Y3H A;  3KKB A;  4YT8 A;  2PQN A;  3EFO A;  5T4Y A;  4H7X A;  3VLF A;  5T8I A;  2WQ6 A;  4NRH B;  4CT0 A;  2UY1 B;  1MQS A;  4A3T A;  2NSZ A;  2XEV A;  2MWQ A;  1LKX A;  3QNK A;  2XGO A;  1FFT C;  2BUG A;  3OEO A;  2WB7 A;  3FTZ A;  2D5R B;  2AVP A;  5CMY A;  3FH7 A;  4DVY P;  2Y39 A;  4F7A A;  3LLK A;  4C3D A;  2WXI A;  3Q7L A;  3X1O A;  4AP2 A;  1MND A;  2X6J A;  5B1B C;  4LCT A;  4FLB A;  1VK5 A;  4FX5 A;  3CVV A;  3GOD A;  5FZS A;  1H2T C;  3CSK A;  3OXF A;  3MV2 B;  3K7D A;  2M63 A;  4I44 A;  3H65 A;  5B3S C;  4IYP A;  4MND A;  3G2V A;  3CHR A;  4RDA A;  2H7V C;  5DBK A;  4Q5S F;  2NG1 A;  3QK0 A;  3LKU A;  3FEX A;  4K0D A;  3NQP A;  4XLP F;  1SZ9 A;  3I3N A;  1WY6 A;  3QOU A;  3EG9 B;  1JWG A;  4ANV A;  5LP0 A;  2EIM C;  3QMK A;  3AS4 A;  3FHD A;  2E0I A;  1OCO C;  4PJJ A;  4BTA A;  3O4Z A;  1D0X A;  2WXO A;  1OCC C;  2ZXO A;  3B7R L;  4AE4 A;  3MGB A;  3EQL F;  2YHC A;  3TXN A;  2W4M A;  4KYO B;  4GAA A;  4BG0 A;  1PY1 A;  5CHE E;  1KU2 A;  3B0P A;  4APF A;  5AJL A;  2GFH A;  3I4G A;  2XXA A;  3LPZ A;  3ZPJ A;  4PDX A;  4OIP F;  4RVB A;  2MRI A;  3PE3 A;  4ANW A;  4PS8 A;  3CK7 A;  4KI2 A;  4CS9 C;  3NG1 A;  4L2Y A;  2C0L A;  4FHK A;  2OCC C;  1PAQ A;  4MLP A;  3LY9 A;  4B89 A;  2LO6 A;  2KZT A;  1HU3 A;  3E70 C;  2Y69 C;  3CVY A;  3AQB A;  3K9I A;  3EZI A;  4E7Z A;  3ABM C;  2GRM A;  4DI4 A;  3ZYL A;  3ONK A;  1LF8 A;  2DBA A;  1ZHZ A;  3VLD A;  3B13 A;  2MHK A;  3JYS A;  1RJ9 B;  4GMJ A;  3LNR A;  4YT2 A;  3WOD F;  3SEO A;  3L6A A;  4C3B A;  3ASF A;  3PUK A;  3CKC A;  1TJC A;  5BUZ A;  3T5V A;  2YEV A;  2I8B A;  4J8E A;  2OG2 A;  2DGJ A;  4H4K C;  3MZL B;  4F1S A;  4E6H A;  3DJN B;  3PH0 C;  3ASD A;  2CGE A;  4CGW A;  1MMD A;  2WXM A;  3I5P A;  5ARG A;  2YHS A;  2PF4 E;  2HO1 A;  1ZU4 A;  3TL5 A;  3MYV A;  1B89 A;  3FH8 A;  2J49 A;  1PD1 A;  4JW1 A;  4RG6 A;  3FU3 A;  3NKE A;  1DVP A;  1YA0 A;  2JLB A;  2V3C C;  5A23 A;  2CG2 A;  4NUR A;  2A6E F;  4XI0 A;  3JYH A;  3D9M A;  3RH3 A;  4EEC A;  3MX3 A;  4GZ5 A;  3AG4 C;  2J0X A;  2QFC A;  2EIL C;  3S7J A;  3T6J A;  3VYW A;  3ZYQ A;  2VQ2 A;  4FU3 A;  2VSY A;  2NUP B;  2Q7F A;  4CDR A;  3URZ A;  4O79 A;  3DPD A;  2IF4 A;  3KEZ A;  3U64 A;  1O5H A;  2J9Q A;  1TJF A;  3SZR A;  3SP1 A;  2OOE A;  4QI0 A;  2E87 A;  4QI2 A;  2WXF A;  2UWJ G;  2WXJ A;  4J8F A;  4JPS A;  3AG2 C;  4GA2 A;  4AK9 A;  1LVK A;  2OND A;  3Q5M A;  4E85 A;  3FU5 A;  1X5B A;  3PVL A;  4BFR A;  1QQE A;  3CK9 A;  2FGY A;  2WZG A;  3Q7G A;  4FAD A;  2X3M A;  4XWJ A;  2XHE A;  3DZA A;  4DI3 A;  4EBA G;  3PS6 A;  2QY9 A;  3U4T A;  2IXN A;  5KJM A;  1ELK A;  4CT4 A;  4A3V A;  4AE4 B;  5BPP A;  5BT1 A;  4ACL A;  2LAI A;  4WWO A;  3T4R A;  4U5F E;  1EF1 C;  4PFP A;  3QDN A;  3FFL A;  4U5G A;  1U3C A;  2R17 C;  2HM8 A;  3TG5 A;  2KCV A;  1H0A A;  4LAC B;  3ZFW A;  3CZ6 A;  1ZHW A;  4J8D A;  3E9V A;  3IBE A;  5G05 C;  1D0Y A;  4CIH A;  3FUF A;  4J6I A;  4OVV A;  1E96 B;  3VAY A;  1UW4 B;  2VSX E;  3K33 A;  1IQU A;  4J0U A;  4I9E A;  2R7V A;  4GYO A;  4PS3 A;  1KLX A;  3AS8 A;  3Q6M A;  2WMN A;  4AJW A;  3FVY A;  2VAS A;  1LS1 A;  4GA0 A;  4G0H A;  3PEU B;  4G23 A;  5AJD A;  3G2W A;  2HV6 A;  2I2O A;  2NXP A;  2FI7 A;  3TG4 A;  4HOT A;  3CLJ A;  3L22 A;  3N71 A;  4KXK B;  4FES A;  4Q96 A;  4OD5 A;  3CVU A;  3CSF A;  3IV0 A;  2VTB A;  1M56 C;  2HR2 A;  2Q3T A;  4DBR A;  3U9W A;  4KZ0 A;  3CHM A;  2J7P D;  4C0M A;  2ZU6 B;  1HZ4 A;  3DAF A;  4P6I C;  2X38 A;  3L16 A;  2P6V A;  3JQ0 A;  4KNW A;  4V3I A;  3EGX A;  3PE4 A;  2P7V A;  3O6X A;  4A2N B;  4NY3 A;  4G11 A;  3B7T A;  3LS8 A;  1QLE C;  2I1J A;  5KYN A;  4KVM A;  4XX5 A;  3DD7 A;  2KCK A;  3RIB A;  3V7O A;  3AQC A;  2DYR C;  2ZXP A;  3UNG C;  4JA9 A;  4ULW A;  2Y4U A;  3RRU A;  2XSE A;  4FUL A;  4XZ4 A;  2BE5 F;  4ANJ A;  2VB6 A;  2WXN A;  4RBN A;  3ZRH A;  1Y6I A;  1IYG A;  4WUY A;  3F46 A;  4JC8 A;  4WNF A;  4MKT A;  5D92 A;  3ZHE B;  5KYY B;  3CV0 A;  3CVN A;  3S29 A;  5J90 A;  2XCB A;  3ZW3 A;  3KMI A;  4UWK A;  3HTK C;  3DBS A;  4BEJ A;  1UN9 A;  2EIN C;  3DAG A;  1FMW A;  4BY6 A;  2WXQ A;  1D1C A;  5EGY A;  4HFK B;  2VGY A;  4PJM A;  5JJT A;  2CHX A;  4ACK A;  5BUO A;  3R7R A;  5M72 A;  4XIF A;  3MJW A;  4B6I A;  4URK A;  3EIJ A;  3ZEF A;  3LVQ E;  4KMO A;  3TXM A;  5DQZ A;  3SYN A;  1Z5Z A;  3B0U X;  4HEA J;  1TKN A;  2IOS A;  4CRW A;  3TD7 A;  2WXR A;  1OKK A;  1JUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...