4I1OB

Crystal structure of the legionella pneumophila gap domain of lepb in complex with rab1b bound to gdp and bef3
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
291
structure length
280
Chain Sequence
PLTLLMTSSTSFSETINQWADILKTMEKFDSNPINLLELVKQFNLYVDELAITCEANNVWASTPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCAAHADSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSFAEPNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of Rab1b deactivation by the Legionella pneumophila GAP LepB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/hydrolase
molecule keywords Ras-related protein Rab-1B
total genus 101
structure length 280
sequence length 291
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
B PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4i1oB01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i1oB02
4I1MA 4I1OB 4JW1A 4IRUA 4JVSA
chains in the Genus database with same CATH superfamily
3W2VA 4O60A 3QWPA 3ASHA 3HRAA 1GGQA 4TUMA 1Y4CA 4GB9A 2EIJE 2GRMA 4E0IA 3RKOF 2W4BA 3ZGQA 2W4MA 1EKYA 2XQ0A 3T9KA 2VCBA 2WVQA 4MKTA 4DX5D 2AVKA 2YKZA 3QOUA 2VGEA 5AC4A 1E96B 3DXMG 3ONLA 3QW1A 3QKYA 3EHNA 1ST6A 4FESA 4J8YA 5CRUA 4ILHB 4AX2A 4UQXA 3V5ZA 5CCLA 4FADA 2XLOA 4I6JA 5ARGA 1MX4A 3ZXPA 4BT8A 2KM4A 3B0VC 4YDWA 3ZTZA 3J06A 2BKKB 2YWAA 1Z3XA 2YQYA 3Q7GA 3U3WA 3HLZA 1J8YF 1HW1A 2YHSA 2LK4A 3G4ZA 2AP3A 1O87A 3SO8A 4HEAJ 2ZU6B 2DZOA 3KD7A 3RK6A 2IO2C 3ULEG 4HFKB 3WG7C 3FU3A 5KNHD 5LCWC 3HXDA 2HV6A 1K1AA 2AWIA 4KXKB 4Y6WA 3MEKA 4EZKA 1ZVZA 1OW8A 4XI9A 2ZXWE 1WATA 3NB2A 1FVFA 1RJ9A 3FEYA 5CCMA 4CCAA 4EHPA 1PC2A 2B0HA 4NTBA 2QZAA 3AS8A 3U2LA 3LXUX 5ITZF 2IO3C 3HG0D 4JL0A 4CSAA 4ANWA 3GORA 4AE4B 2P9KG 3IHVA 5CBNA 4ZLDA 2XLVA 1JWGA 5CMYA 4HRMB 1HY5A 2I9CA 2XGSA 1TN7A 1S7ZA 4PDXA 3IHUA 2XEHA 4YN0B 5CIVA 5KYNA 2VGXA 2P2CP 1E83A 4BFRA 4HI8A 3LPZA 4LUNU 4UQYA 3DI5A 2PZIA 2P9LG 3L13A 4H7YA 4AV7A 3AQBA 1FCHA 1O5HA 2P9IG 4GTMA 1KTMA 4MVRA 3JXJA 2L9BA 3VLEA 3ZEFA 4WNFA 1HW2A 3FUKA 3IQ6A 3PUKA 4U96D 4AOFA 1VLSA 2XL8A 2YL7A 1OCOC 2ETCA 3L8IA 4K5BA 1H6KA 4PS8A 3UR3C 2OCCC 5D91A 2WXIA 1JRAA 4ILGA 3BUAA 4RLYA 3CHMA 5CMWA 3D9OA 1TN6A 1S70B 1NSGB 4DXWA 4K5CA 4GZDA 3LVRE 2KQ9A 3QVZA 1N94A 3JYSA 4U5CE 3PZ2A 2WZFA 3FTWA 3GODA 4GU5A 1OWNA 4DX2A 1FFTC 2KZTB 4I6EA 3N71A 1N4PA 3CLJA 1A0BA 5E33A 3SBSA 3FVYA 2IOSA 1U89A 3ZN3A 4U9DA 1YYXA 3P2BA 1G5ZA 4GYOA 1OCRE 1XZPA 2NUTB 2YLIA 4PJMA 3MA5A 1C03A 5L3QA 3N24A 1QNFA 3PNLB 5H7PA 1VOMA 4E18A 3RYLA 3SFYA 1YJGA 1AVOB 5G04J 1LI7A 3JYYA 5COGA 5BQHA 2WXNA 1JUQA 3ZVRA 2PP4A 3CKCA 4O6FA 1W3BA 2R7UA 1UG3A 4YWQA 2A6HF 2I6HA 3T6GB 3VYWA 4JIOA 4KNVA 4E85A 2VB6A 4JHRA 5E75A 2YNQA 5KYUA 3QDNA 5DBKA 3G2UA 4F3VA 4YT5A 1X5BA 3S7BA 4PR9A 1O1RA 3DEPA 4BJ1A 1BLXB 1H19A 5B3IA 3D9LA 1N4QA 2A68F 4CJGA 1IZMA 3DKAA 3FAJA 1TJFA 4XZ4A 4LDKA 2BF0X 1S0PA 3S2AA 3HVEA 2J07A 2J9QA 3PZ4A 2DGJA 3UPVA 3ASGA 2J7PD 2Q00A 3K1HA 4JURI 2L0IA 4Q5SF 1TR2A 4C3BA 4JA9A 3GM2A 2R7SA 4ONSA 3S90A 5EK0A 1GW6A 4OIPF 3CEXA 2KXPC 2KC7A 3UT4A 3PHF2 4RG9A 5T8IA 3H2UA 1H0AA 4LEUA 3CHOA 3ZIMA 4MVZA 2W9YA 5KYWA 5FZSA 1H2VC 2DVWA 1QZXA 2XLMA 3ZHEB 4G2VA 4J32B 4OINF 5E2QA 4WAFA 4HRNA 1N1CA 5CI8A 4XLNF 2P7VA 1OUVA 2Y3GA 3AG2C 4LNGA 3HTKC 5A6JA 2YHCA 2WVNA 4U0ZA 1LI5A 2QLAA 4BJ6C 2FFHA 3LAYA 4LDQA 3LJNA 3IBEA 4A1SA 1KZPA 1JPLA 1BR2A 1QYMA 2D5RB 2EPNA 1VYKA 2XM4A 2R7TA 4L1BA 3KPHA 4J0UA 3UM3A 3AG3C 4FHKA 1M2VB 2QFCA 4P9FA 3G4XA 1I5NA 2L0TB 2VGYA 3PCVA 4HB5A 2D4UA 1BZ4A 5AJDA 4BTAA 4C0EA 4DBRA 3ZFWA 5DQZA 1ZHTA 4MS2A 2KC3A 3UT8A 4U07A 3GZ2A 1E8WA 4IAOA 2WB7A 4YJWA 3B71A 2ZGGA 4EPZA 2V26A 3TWWA 2IXPA 3FUNA 3EGXA 4I43A 2A5UA 3MBGA 2CDQA 4HFGA 5ENTD 3L34A 5B1BE 2PF4E 4GCOA 5HS0A 1D1CA 2YVKA 3CSKA 2ZIRA 4JHKA 2Y3BA 2HMZA 4Q4ZF 4M7CA 4UI9C 3L16A 2CHWA 3C8GA 5A6BA 3QW0A 5T3RA 4K1OA 4ABNA 3G2WA 3SY2A 2C0MA 5ENNA 5T3WA 3R7RA 4N4WA 1KT0A 2GRQB 3C62A 2WXQA 4HNAD 1SYQA 3D9PA 4CZ2D 4NURA 3ULYA 3WG7E 2JD3A 3U5SA 2IF4A 4CDMA 3FOPA 3ESLA 3G2VA 5FCLA 1O5MA 2V5FA 1WWPA 3DBSA 1WOLA 4KVMA 1Q2ZA 3SXKA 1B68A 1VYIA 2IXMA 5DS5A 3NAWA 3VAYA 3DD7A 2HKVA 3L17A 4BERA 5J90A 3RO2A 4XEIG 1XGWA 5BUZA 1YZAA 4CGVA 1NA3A 5A7DB 2J7PA 2R02A 3K66A 2HSQA 4AL0A 1DOWA 4U95D 2PNNA 3W2WA 4KBLA 4FULA 3M4BA 3KYIA 1D0YA 3D9HA 3CVYA 2HZ8A 4UWFA 1QLEC 3EHQA 4ACLA 4XWJA 3S28A 3FTVA 3RIBA 4I2WA 4HOTA 4CJOA 3Q4AB 1HE8A 1BR1A 4OIRF 4E17A 2M64A 3CAXA 3DSXA 1OKKA 4XLPF 4LLEA 4NACA 5ANRA 2Z15A 1MMNA 1NBBA 1SZAA 5L0CA 2CW0F 4M63A 4O6NA 3SNXA 4NQFA 1H6PA 4MW8A 5AARA 3UX4A 4L7TA 5ENQD 3FUMA 1HE9A 4AM9A 4NRHB 1YYJA 3AAAC 2VC9A 2Q3TA 1E7VA 5JSLA 4G24A 1RXQA 3FFLA 2R7VA 1YLMA 2Y3DA 4G7HF 1Z3IX 2LD6A 3ML9A 2J0WA 3Q79A 2JX0A 3O55A 3R2PA 3V79K 4CDYA 4UDVA 1KPSB 4IB4A 5EYLA 3R9MA 3N2ZB 4GA0A 4HLLA 4UI9K 1YA9A 4IN3B 3JSEO 4F6RD 1N52A 2XRHA 3DXKG 3EZHA 3F6QA 4P29A 4JPSA 2X38A 1UG7A 4CDRA 2LP4A 1Z23A 4U5DE 2ZGDA 4JE9A 1IW7F 1YDIA 5F5FA 1MJ0A 3DPYA 4OYSA 4J7TA 2V4HC 4BX9A 4B0ZA 3ZWIA 2G62A 2AW6A 4PFPA 4KZCA 3Q15A 2VASA 1G3NB 1LPEA 4IGGA 2F37A 5FZRA 4DVYP 3ESKA 1LIHA 4HE8D 4KVOA 2I15A 3HNLA 5FJYA 3KEZA 2AXUA 5DLJA 3L1MA 3RW0A 2UUHA 4PS7A 3U9MA 2B0OE 3I5PA 2J9WA 1MNEA 2R9RB 2PBEA 2GDCA 3ABME 2CFZA 4BSXA 1YA7O 3FOOA 5CRVA 1UW4B 3ZKJA 3SD5A 2OV8A 4J8FA 2X6JA 4GTOA 3E33A 4KI2A 4J30B 4GYTA 1UN8A 3PZ3A 3S27A 2VCAA 3JUIA 3IHYA 4DPRA 2ZXPA 5CERB 3MGBA 1E86A 3Q7FA 3CK9A 3FUDA 3NMJA 3LEOA 4G25A 2FAPB 3UUXA 2R03A 5EGYA 2XENA 1EDUA 2EPOA 3GW4A 3PUJA 2PX3A 4YL1A 5A23A 4FU3A 2VSXE 4ANVA 3ASOE 1OXKA 2WZLA 3RF3A 2GGFA 1K3ZD 3EDTB 1FPPA 1OQCA 5EDSA 1NP7A 1XWJA 3GWNA 1N95A 1SA4A 5FIOA 2V0PA 1JMWA 3G2SA 3BQOA 3O48A 1NU9C 1GS9A 3CVNA 3LY8A 5BW8C 3TWTA 2Q7RA 1QQEA 3GYZA 4O6MA 1GM5A 1XZQA 4MQ9F 2OOEA 4DLOA 3PMRA 3I3NA 1OW7A 5BQGA 3DEOA 4U0SA 2DYRE 3TAXA 5FT9A 4G23A 3C5RA 2JEKA 3EPVA 3QTHA 1D1AA 1N4SA 5LX8A 3B7UX 3ZNGA 3VLFA 1AEPA 2BKGA 4BY6A 1FAPB 1F1MA 5BUOA 1MZCA 1V4AA 3ZUVB 1ZHYA 2ONDA 2M63A 3IQTA 1BDJB 3I4UA 4J7WA 1V54C 1JR8A 2AJAA 4XI0A 2NXPA 3KSLA 3L22A 1M56C 5KYYA 4JEAA 2XGOA 2LSVA 4O7GA 4M3OA 1EI7A 3T9OA 3TJPA 4BEMJ 1VMAA 3DJUB 4HRLA 2DB4A 2R5SA 2XL6A 4CBEA 4GAAA 4EBBA 2R7XA 4HBDA 4DX6D 2OVFA 2E87A 3GM1A 3SYNA 2W45A 1O1TA 4GYWA 1OWMA 2KZTA 3JSZA 2R7WA 2A69F 5A69A 2GFHA 3C8GB 1E8XA 3U9JA 2PM6A 3FP3A 3HXFA 4PJJA 4UQZA 5AJLA 4MTOA 3KAEA 1T01A 2HMQA 3NKEA 4N6HA 3VLDA 4A63B 4MLPA 1ZZPA 2DWZA 3P1UA 4L23A 1ZW3A 3OXFA 3EGXB 4N06A 5D92A 1NL4A 3LEWA 4RG6A 2QY7A 4JXTA 1PCXA 1NU7D 2I1KA 4K5AB 2IONA 4FWVA 2V8SE 3PS6A 4JZAA 1BR4A 3IKOB 2XXAA 3T8KA 3UQ3A 3IQCA 1OCCE 3LLIA 3IEEA 2KNHA 4GMRA 2XLWA 4GMJA 2WXRA 1UJJA 3GANA 4YL3A 4ME2A 1KZOA 5HRYA 4DLQA 1BD8A 1FT2A 1XNFA 3QVYA 3C98A 1LS4A 5TJ5E 1TNYA 5L0IA 4UWKA 3S0XA 1LD8A 1NFIE 3PEVB 4MS6A 2J09A 5JA4D 4U5FE 2PQNA 2LQGA 3DSWA 3NYLA 3C7JA 4JCZA 4LNUD 2IY0C 4ZLCA 3FHEA 4MW3A 4D4NA 2MYOA 3LESA 1SQMA 2J0XA 3EGDB 5ENOD 5ENSD 2KJGA 2HO1A 3L82A 3TXMA 4MTFA 2LSEA 3RJVA 4DOZA 3FH8A 5EX3A 1WAO1 2DBAA 2ZISA 1TKNA 3Q9UC 4BT9A 2WXKA 2WXHA 4BETA 4N39A 2YRFA 1HS6A 5A6AA 3DSUA 2LAHA 1K04A 3CEQA 4K0DA 4JEHA 3EFOB 1D1BA 3FHDA 3HXEA 4N5QA 2PQRA 4TXRA 1HG2A 4U0UA 1FTSA 4LNBA 4YVOA 3QC1A 1KLXA 2OG2A 4GZ3A 3V7OA 4ULVA 2NUPA 3TGOA 4I9EA 3ZG1A 4JB8P 2OOCA 3E30A 1WTYA 1ELWA 3NF1A 2WQ6A 2QTVA 3K6BA 3ZPJA 4O1OA 4JA7A 2BE5F 4IWBA 3FU6A 2J4BA 2QUPA 4MNDA 1OXJA 1WY6A 4FJYA 5CEDB 2WVIA 1U2VG 4Y6CA 3S7JA 2XM0A 3FEXA 4JTDB 2EIJC 1IHGA 2NG1A 1OW6A 5DS4A 4RQIA 5G2NA 4CSAC 4NQ0A 4LRZA 1QPUA 3UGPA 3ISMC 1EPUA 1TFOB 4EZJA 4LLCA 4QFVA 1YMPA 4O79A 2RSEB 1PD1A 1CGME 3UMHA 4HOQA 3AQCA 3CHRA 4UWGA 3W9GA 3FULA 5AYWD 3URZA 3T5XA 1EQ1A 3MZLB 3H65A 2UY1A 1H6OA 3QB2A 4GTRA 2WMNA 2KSFA 4DJAA 3DM5A 2ZXRA 1EYHA 1N11A 3B7TA 1CPQA 1HU3A 1SR2A 2CNWA 1RW2A 3OWTA 4W8KA 4EWCA 4FAPB 4B93B 1QVXA 2BC5A 4C3EA 4E7ZA 1E2XA 3M4CA 4HORA 4BWRA 3LS0A 5KYUB 2PM7A 2JLBA 5AN8A 2FI7A 3Q6MA 4U04A 5G05J 5L3VA 4U8VD 2XPIA 4BJ5A 1YCSB 3DPDA 4AJWA 3ZIBA 2QYJA 4AXHA 2QC9A 4JRZA 2IFUA 4IULA 4I6GA 3DSVA 3TD7A 2DI3A 4U5GA 3V31A 2F0YA 5HI7A 4XTKA 4DK5A 2J8SD 3U8VA 3LJ3A 4AE4A 1TYQG 4URKA 1D9SA 2V5QC 4APFA 2Y39A 4OIOF 1N0RA 1T6IA 3RSEG 2L81A 2E0IA 3SQVA 5A6KA 3IQ5A 4WNEA 4CS7A 2XEEA 3FU5A 2VTBB 2G3VA 3L9TA 5D66A 4B89A 1NZNA 3HVEB 4I3MA 1QZ2A 4EBAA 4GQHA 2GA0A 3CR3A 2WB2A 3RAUA 3W4YA 3VRCA 3HDXA 3I5QA 2PNOA 3DM9B 3FDQA 5JVEA 3Q7AA 5AQ9A 2NC9A 3RIPA 4CRWA 4WNDA 1N9AA 4HS2A 1SW6A 2V4LA 2RD9A 1VDYA 3CKBA 3SGHA 4UWLA 2X6IA 3NMIA 3MV2B 1H9GA 4DI4A 2BTDA 1ZU2A 3JQ0A 3LDZA 2AXVA 4H7XA 4L2YA 1TWAA 4I1AA 1NZEA 3EFOA 2XRYA 3CVQA 3CQZA 2FO1E 3EH2A 2YEVA 5L0FA 2L6JA 3IEGA 1MYOA 3U9WA 3OEOA 3BRJA 2P61A 1INZA 3FXHA 3O6XA 2ZPAA 2X6HA 4R7LA 2LO6A 3ZXSA 2FF4A 4WNGA 4GTSA 5BPPA 4CIHA 3GZ1A 5GPGB 4HXIA 3CHSA 4YT2A 5D0OD 2VH3A 3T6JA 3TJ6A 4F7AA 4ZHBA 3M15A 2WXLA 3TULA 3T6BA 3CHPA 2OEXA 2Y4UA 2E2EA 4JTCB 1DC2A 2FGYA 3D9KA 2XZDG 2IXNA 4G8LA 1RJ9B 3EH1A 1OXBA 4B8AA 3ASOC 3DWLG 3D9MA 4HOUA 1E90A 4V3IA 3RRUA 1UJKA 4BJ5C 3LVQE 3O4ZA 2P0NA 3I4GA 2DCPA 3SFZA 3TL5A 3GZSA 5AC5A 2AXZA 5KJMA 4EIYA 1H7IA 2F22A 4PFOA 1WM5A 2OEVA 2BUGA 2TMVP 1K8KG 4FC8A 3SEOA 1RCPA 2RFMA 3AJMA 3MYVA 1E8ZA 5D2MC 2NYJA 4RBNA 3TWUA 2XZTG 4BEPA 3RFYA 2OU6A 4Q96A 4GZCA 3MV3B 3B29A 3US6A 4XKCA 4ATGA 2P9PG 4J7YA 5CECB 2VQ2A 4LERA 2R59A 4GYYA 1BI8B 1MMAA 3A9CA 4OVUA 1T6UA 2GRNB 2Q9CA 3EJNA 4LG6A 4MRUA 5KBAA 3LJBA 1FR0A 5BXUA 3NG1A 1H6GA 2OCCE 2BL2A 3MX3A 4GZ6A 3KL4A 4CS8A 4BJ6A 3DE8A 1WASA 5FTPA 4JD2G 1D0ZA 3LYAA 4BX8A 3GEEA 3U64A 1JCSA 1U3DA 3WODF 2H7BA 3CQCB 5BNWA 1X81A 3V2XA 1IKND 4WGZA 4YVQC 2EINE 4N3AA 5ANLA 1SA5A 4BESA 4B8CB 1LKXA 1NG1A 3ABKC 4PACA 2L6GA 2EIKC 2EIMC 3OA1A 2P6VA 3JCUQ 4CDAA 2C04A 2EPMX 3DRAA 3BU8A 5KCMA 3ECSA 3ASNE 1G4US 3PEUB 4OVVA 4CIPA 3JRTA 3ML8A 4BEJA 3UINC 4P9TA 1BPOA 4X8QA 3PREA 4WUYA 3RH3A 4E7SA 1TN8A 4ZFHA 4PH4B 4ACKA 3F46A 4RSYA 3C8ZA 3AGUA 5T4YA 2KCVA 4WWNA 4PUCA 5FQ7A 4KZ0A 5DS6A 5AENA 1PV3A 1L3PA 4KBQA 4I2ZA 2X6FA 5B3SE 2LNIA 3B9QA 4EQFA 3PE3A 1T6QA 3EUVA 3VF0A 2ZXOA 4Z9IA 5A6CA 2MWQA 2DIWA 4K0RA 2CG3A 2CCYA 5JP7A 2P9SG 3UI2A 2Y69C 2H6HA 4FLHA 1E84A 3QK0A 4YDOA 3C18A 3C63A 5AQBA 1FMWA 1NLXA 3ZSUA 2H6GA 1MQSA 2NUPB 5JUAA 5FINA 2GRLA 3L08A 4IARA 3NOCD 3FU0A 4GPKA 1OR3A 4EKWA 4ER9A 2HJ3A 3GEIA 2XCCA 3M1CB 3L8JA 3PRZA 1IQUA 4A4AA 1D8DA 1YYHA 4BG0A 5T1DB 3PE4A 3ZVVA 4Z9JA 5ENRD 5B1AE 5FWQA 2YLDA 4CDNA 3CSFA 1NFNA 3TWQA 5KJNA 4IYPA 4K03A 4OAUC 2R25A 4HQDA 3KEAA 2H6IA 2OJED 3V5XA 2GW1A 4YDYA 3PDNA 1NA0A 2X6KA 2HUJA 4A1GA 4U5HA 4QDLA 3PVLA 3EG9A 3CV0A 1D0XA 3EQLF 3U4TA 5IY5C 5J08A 3KKBA 1T9KA 3QWVA 2CGEA 2RKKA 4AY5A 3X2QE 4N3BA 3NRHA 4CEMA 4LCTA 1M2OA 3IV0A 3LEVA 3ZC4A 2PL2A 3CQGB 4GTPA 1KNYA 4RVBA 1RZ4A 4TUUA 3ZRHA 1OKKD 4NTFA 3Q73A 1AWCB 1E85A 2J45A 4UUCA 1TWGA 4JKVA 3S84A 1JOGA 3SBTB 5L0JA 3UIPC 3ZW3A 4GTVA 2KYHA 4ANUA 4JTAB 3S29A 4J6IA 4I1MA 2R2LA 5DVWA 2KBXA 4LDRA 3R9AB 4MVOA 3JRMO 1GQAA 4N3CA 1R4TA 4W8PA 3NBNB 4D4XA 1Y6DA 3KS2A 2IYLD 3ZTMA 4U7EB 3SZRA 3FMSA 3L6AA 1SZIA 5KYYB 1ZU4A 4L6RA 2FO7A 1ZHXA 3LNRA 3CZ6A 5JS5A 4G7ZF 5G05C 3PDMP 1OCCC 2GRRB 3B7RL 5A6BD 3FTZA 1AP7A 3B13A 2QY9A 3Q9NC 5L0HA 3CVXA 3EIQC 3AG4C 2EPKX 3MLGA 4Z9HA 5KYXA 1TQGA 2IM8A 4CDVA 3ASDA 2X51A 2VSOE 1FFHA 3UNGC 2MOWA 2QNLA 4FHJA 3K1IC 4K7BA 2LFDA 2L6BA 2A0UA 2HFIA 2HYZA 5E76A 3HNJA 5KJLA 4LSZE 5COMA 3FH7A 3TWRA 4C0MA 5B1AC 4P6IC 3HNIA 2MHRA 4JEBA 2A4ZA 4ANXA 4MTGA 3C8GD 4NC3A 3CHQA 1H2UA 3UM0A 2VCCA 1ZBPA 2Q9AA 3N0TA 1HXIA 1QBQA 2Q4FA 1TNBA 4LACB 2WPVA 3FTXA 2A5EA 3WXXA 5EILA 3JTLO 1PY1A 4TXPA 3ABMC 1OY3D 1LD7A 1SF8A 1RMVA 3HIZA 4L9PA 1CPRA 1EF1C 2FBNA 2XLDA 3TG4A 2YZSA 3B0UX 4UI9J 4A3TA 4AVXA 1Y6IA 2J4DA 4W9RA 3MJWA 1RKCA 1MMDA 3HJCA 4ANJA 1I4ZA 3O39A 2DYRC 5F5HA 1OCZE 4Z68A 3AS4A 3KH2A 4PS3A 2CFUA 3FUHA 3X2QC 1U6HA 1JPNA 2X0CA 3CVVA 4O6YA 2WL8A 3JXIA 2MYSA 4EHMA 5E3AA 5IY5E 1YAUO 3MKRA 3CVWA 3ASNC 3IXEA 1KT1A 3AJIA 3F47A 3T8MA 4E0HA 4A3VA 5AGFA 3M79A 1E8YA 3CVLA 3OXGA 2XRZA 3SFXA 1ZW2A 3D9NA 3OXLA 3UT7A 4X0RA 5KWDA 2KATA 5EYPF 4G0HA 4FJZA 4CT0A 4I17A 3HKKA 5M72A 5EHHA 1TR4A 2I1JA 3K9IA 4MVUA 2KCLA 3EIJA 2A0BA 3DMDA 4G11A 4QI0A 3ZYMA 5JLIA 1Z5ZA 2KK1A 4KT6B 2L7AA 3K33A 1MX2A 3SHFA 3NOGD 4UWHA 2XLEA 1S64A 2CG2A 4AEZC 3UGOA 4OD5A 3C3RA 4AK9A 4QI2A 3AOUA 2QYUA 3JT1A 2FEZA 2L6FA 5DIZA 2J08A 1LM3B 3DE9A 5JJ6A 4GA2A 4HI9A 3NMKA 3ATPA 2C03A 3ZDLA 3W8HA 4DX7D 2VJ8A 3UM2A 1JPJA 1YZCA 4KMOA 1KU2A 5C2YA 1PD0A 2P1AA 3GWLA 2R05A 4G7OF 2Y3HA 3L54A 3MYIA 2R17C 2WXMA 3HHMA 2CHZA 1HG5A 2LUHA 1YARO 2KCKA 2ZXWC 2HM8A 2X3MA 1TJCA 1ZB1A 4DX1A 2XPYA 2LIGA 4NCQA 1G4WR 1HMDA 1MX6A 3OAWA 4NIKA 3LS1A 1YA0A 4A55A 2R7RA 2YINA 2XLHA 3NQPA 3LLKA 3JCKC 2HE0A 4DBQA 1TNUA 4N2QA 3K1IA 1DOVA 5G55A 2QE9A 2WQ7A 4YK5A 4OIQF 4JC8A 4XEFA 3FUJA 4XX5A 2LXLA 1ZU5A 5D0QD 4DRXE 3VTXA 2XS8A 3FY4A 1LTXA 4XPXA 2HSBA 1AUEA 3WAQA 2CNWD 3HYMB 1HH8A 1N54A 4J8EA 2OJQA 2IEJA 3AG1E 3RVZA 3K7DA 4C7OB 4U8HA 4AP2A 3DWWA 5FZQA 2WXGA 3Q5MA 4GTTA 1OR2A 4JCHA 1C17M 2XGMA 2NSGA 5JT4A 3DAFA 1B89A 2LXMA 3FTSA 1UFBA 2H7VC 3E32A 4DRHB 2R7QA 4YT4A 1NI1A 5KNGA 4E6HA 4L2LA 4YL0A 4XE0A 3NZUA 3LNMB 3RRNB 3S7FA 2VSNA 3R7CA 1D8EA 1YVIA 2BEDA 4TRQA 3DSSA 1L7CA 4DI3A 4G26A 2CHXA 4GMLA 2HR2A 3VTYA 3CVUA 1T5OA 4JEUA 4GZ5A 2HJMA 3HXCA 2NPUA 3EU9A 4YT8A 4B6IA 3JZ0A 2GAQA 1A7VA 4G8KA 2OEWA 3RKVA 4TXQA 2Y3AA 1JAFA 5BV0A 1IHBA 1Z6AA 1HX8A 1ORSC 1BU9A 3SZ7A 2EPLX 3O10A 2RG8A 3SXYA 5BQIA 2L9JA 1LE2A 1HO8A 4TV3A 1U0BB 5CBOA 3ULQA 1MHQA 5AQ7A 3CK8A 2AVPA 3DAGA 2J8WA 3U8PA 3AU4A 2ETSA 1JCQA 3SF4A 4GPMA 2Q7FA 2LAIA 2WM9A 1IYGA 4C3DA 2IU1A 1MMGA 4AL1A 2F8YA 4PK4A 5KYXB 5EN5D 4A2NB 3AG4E 2MRIA 4F1PA 3B95A 2LCHA 3FUIA 3FAPB 3ZYLA 4IAQA 3RQEA 1Q0KA 3UMIA 3LY9A 4F4BA 4G1TA 3TWXA 5JHAA 2JPUA 4RD9A 1N4RA 4IRUA 1BBHA 2F8XK 2O9XA 5ARFA 3TK0A 3BEEA 3A11A 3T5VA 2DYSE 5COFA 3UKRG 3V30A 1FVHA 4FA6A 1LS1A 5HQ8A 3TQOA 4WJ0A 3QARA 1I4YA 4BPMA 3UKUG 3EHRA 2J9UA 3RU0A 3EHMA 4NY3A 1Y8MA 4F53A 4O1PA 3ZHEA 4OAVB 4EECA 4OD4A 3HNKA 3B0PA 1UOHA 4Q69A 3L0IA 2P58C 3AG3E 1V55C 1ZYRF 4CX9A 3UMVA 5FQ6A 5EIBE 3AG2E 1EA8A 2VGXB 1QQ3A 1A7DA 1OCRC 3EZIA 4C48B 2XEVA 2XSEA 3QAQA 3ITFA 3U66A 3G50A 4JC7A 2Y0BG 2IOQA 5JJTA 5JMND 5FQ4A 5ENPD 4HVBA 4HLEA 1SZ9A 2A6EF 3FDHA 1TWHA 3D9IA 5BV1A 1PAQA 4F1SA 3RO3A 4JHJA 1SVXA 3IPMO 2NUTA 1ZHZA 4G78A 3Q6NA 2H7OA 2NSFA 256BA 4QQIA 3FTUA 5EIDA 3ZQVA 5BT1A 1K1BA 1TFKB 4PJLA 1Q0MA 4RDAA 1FMVA 3DXJF 3ABLC 1MQVA 4EBJA 4R32A 2XL4A 2A1DD 2ILRA 1OCOE 3B7SA 4GEHA 1J8MF 3APCA 2I8BA 3RVYA 1M6TA 1M2VA 1ELKA 5LCWJ 2WVOA 2YL0A 2WXPA 1WGWA 2IQCA 4MVSA 3BEHA 2RFAA 4U5BE 5E3CA 2WXJA 4H4KC 4U5EE 2Y1LE 4I9CA 2WXOA 1DCEA 2HV7A 2H6FA 2M4EA 4EUKB 2IOLA 1Z7Qc 2DYSC 3MFNA 1LE4A 2Q9BA 4FP7A 5EKQD 4MBGA 2Y69E 3PZDA 1WDYA 1R5ID 3FUEA 1HFAA 3NYJA 2MHKA 1V74B 1K40A 2FULA 2YL1A 4DUIA 3FH5A 4JZYA 1A7EA 2R7OA 3C3OA 2CYDA 3UIOC 3KYJA 3R7QA 2LSUA 4KNWA 5B3SC 1VK5A 3CSTA 1OWPA 4ULWA 4XPYA 3ZYKA 3SNHA 2J46A 3GEHA 3RQFA 2V3CC 4KYOB 3JYHA 3AG1C 5K0IA 2NSZA 1TNZA 1C02A 2EIKE 2EIME 4EBAG 3ZYQA 4EZLA 5AQAA 2XS1A 2AU5A 1DNPA 3DZAA 2WZGA 2EINC 2L6HA 1H9TA 1RKEB 1JCRA 5LFAA 1CGNA 3FUFA 5AAOA 1WN0A 1DCQA 3LKUA 3ABKE 3Q78A 5CEAA 3Q75A 3V2OA 2RD0A 4I44A 3NYMA 3J5PA 1M57C 4C7OA 2J49A 4IJJA 3LY7A 3SI5A 1MNDA 2YLGA 2Y4TA 2WXFA 5HV9A 1IQRA 3RQGA 4XQ1A 4EBKA 3ENEA 3APDA 2HS5A 5EX0A 4BTBA 2WQHA 3QMKA 2XHEA 1O1SA 3U3BA 2P9NG 4XKBA 4BSZB 2EQXA 1IXVA 4DRIB 3NZSA 3H2VA 2GRPB 4MVQA 1S63A 4JJFA 3EGDA 3RRMB 3CIAA 4APOA 4N6CA 3T4RA 4CS9A 3FWVA 3E70C 4JW1A 5HSWA 2JABA 2J9VA 5FZTA 5DQTA 4U9EA 3E9VA 5G04C 4WWOA 3QNKA 3W8IA 1ORJA 1A5EA 2C2LA 3G2TA 5HKPA 3U2MA 3TWVA 1QSPA 1Z6TA 5LP0A 4HOSA 1HMOA 4DJ9A 3QJZA 2ETBA 3ZU7B 4J8SA 2YHEA 3TOMA 1V55E 3E4BA 2ETAA 2XCBA 3LS8A 1HE1A 4ILIA 3LCAA 1S05A 2G3KA 2AWCA 4KC9A 4N2SA 1O3UA 3OTNA 1OWOA 1UN9A 4CYMD 3ZQYA 2B6CA 3NKDA 3TG5A 3Q47B 4D10C 4BJTA 2LFFA 3S7DA 3APFA 3CGHA 1BI7B 2IBFA 3MKQB 2AWYA 3VM6A 3CVPA 3U0CA 4Q94A 4U8YD 3W9FA 1P5QA 2UWJG 5CI9A 1VTMP 2B0JA 4JVSA 2ZD9A 3UMKA 1FNTc 3WHNA 4Q7CA 3FTYA 4CS8C 3E37A 4J8DA 5B1BC 2EILE 3GM3A 3ABLE 1H2TC 3MCXA 1ZHWA 1CGOA 3EU5A 2OQMA 4JJGA 1LF8A 2J9BA 4CT4A 3DJNB 1NFOA 3TOLA 1Q0FA 1W2WA 3NDBB 4WGYA 2GROB 4GA1A 4N5CA 3BG1B 3PZ1A 1OT8A 2DZNA 2OVBA 3AU5A 1SMYF 4YNDA 1G8XA 1N0QA 5L0DA 4ATZD 2KGOA 4PJNA 3ONKA 3SP1A 3LUTB 3PH0C 2OKUA 3CK7A 2WMOA 3UTMA 3JUEA 3Q7LA 1E7UA 3MKQA 1Z3YA 3BG0B 4AY6A 4WWPA 2PFDA 3SXMA 4GCNA 2IXOA 5C1DA 1K05A 1ORYA 3KSQA 1OWLA 3B7BA 3SXZA 5JHBA 3D3MA 3DSTA 3Q49B 2YL3A 3HXBA 3KMIA 3TXNA 3C3QA 1TEZA 1L5JA 2C0LA 1V54E 2KW3C 4XEKA 5BXOA 4GTQA 2GWWA 5FQ8A 3QWWA 3E34A 4HFFB 1VB5A 3PNTB 2IJGX 2UY1B 1ELRA 5L0GA 3MYFA 4DVZA 3S9OA 2VTBA 2EILC 4DRJB 1Q0DA 4WABA 3D9JA 3AGTA 5LOZA 1Q0GA 4YDEA 1HF8A 4NTAA 5KYWB 1OCZC 4U63A 1A17A 1A41A 3J5QB 2PX0A 4H54A 3EG9B 2YQ8A 4B94A 4XPWA 1APCA 4CGWA 2UUIA 1FT1A 3V5YA 1TNOA 3X1OA 1QKRA 1U3CA 1WG0A 5AIJA 2XPZA 2P9UG 4XEVA 4MVMA 1DVPA 5CHEE 3UXGA 1VLTA 2ASRA 1Z5SC 3UM1A 3AS5A 3JQ1A 4AIFA 5JRAA 2XXAB 3I4RB 1LVKA 5KJKA 4C9BB 3TWSA 1RKEA 4I1OB 3POVA 5T3TA 2ICWG 4FLBA 3QZCA 5F28E 3U3FA 2VYIA 1Z63A 3ASFA 1TWCA 2VSYA 3C72A 5JJ7A 4FX5A 2I2OA 1HZ4A 4CS9C 2H8AA 3TJ5A 4XIFA 1JWFA
chains in the Genus database with same CATH topology
3W2VA 3QWPA 3ASHA 4GB9A 2GRMA 3RKOF 2W4BA 3ZGQA 2W4MA 2XQ0A 2WVQA 4MKTA 3QOUA 1E96B 3ONLA 3QKYA 3EHNA 1ST6A 4FESA 4ILHB 4AX2A 4UQXA 5CCLA 4FADA 4I6JA 5ARGA 4BT8A 2KM4A 3B0VC 1Z3XA 3Q7GA 3U3WA 3HLZA 1J8YF 2YHSA 1O87A 4HEAJ 2ZU6B 3KD7A 3RK6A 4HFKB 3WG7C 3FU3A 5LCWC 2HV6A 2AWIA 4KXKB 4Y6WA 3MEKA 4EZKA 4XI9A 1FVFA 1RJ9A 3FEYA 5CCMA 4CCAA 1PC2A 3AS8A 3LXUX 4JL0A 4CSAA 4ANWA 4AE4B 3IHVA 4ZLDA 1JWGA 5CMYA 2I9CA 2XGSA 1S7ZA 4PDXA 4YN0B 5KYNA 2VGXA 4BFRA 3LPZA 4LUNU 4UQYA 2PZIA 3L13A 4H7YA 4AV7A 3AQBA 1FCHA 1O5HA 3VLEA 2L9BA 3ZEFA 4WNFA 3FUKA 3PUKA 4AOFA 1OCOC 1H6KA 4PS8A 3UR3C 2OCCC 5D91A 2WXIA 4ILGA 3CHMA 5CMWA 3D9OA 4GZDA 3LVRE 2KQ9A 3JYSA 4U5CE 2WZFA 3FTWA 3GODA 4GU5A 1OWNA 1FFTC 2KZTB 4I6EA 3N71A 3CLJA 5E33A 3SBSA 3FVYA 2IOSA 3ZN3A 3P2BA 4GYOA 2NUTB 4PJMA 3MA5A 5L3QA 3N24A 1QNFA 3PNLB 1VOMA 3RYLA 5G04J 2WXNA 1JUQA 3ZVRA 2PP4A 3CKCA 4O6FA 1W3BA 2R7UA 1UG3A 4YWQA 2A6HF 2I6HA 3VYWA 4E85A 4KNVA 2VB6A 4JHRA 5E75A 2YNQA 5KYUA 3QDNA 5DBKA 3G2UA 4F3VA 4YT5A 1X5BA 3S7BA 4BJ1A 1H19A 3D9LA 2A68F 1IZMA 3FAJA 1TJFA 4XZ4A 2BF0X 1S0PA 3S2AA 3HVEA 2J07A 2J9QA 3UPVA 2DGJA 3ASGA 2J7PD 3K1HA 4JURI 2L0IA 4Q5SF 1TR2A 4C3BA 4JA9A 2R7SA 1GW6A 4OIPF 2KC7A 3UT4A 3PHF2 4RG9A 5T8IA 1H0AA 4LEUA 3CHOA 3ZIMA 2W9YA 5KYWA 5FZSA 1H2VC 1QZXA 3ZHEB 4G2VA 4J32B 4OINF 5E2QA 4WAFA 1N1CA 5CI8A 4XLNF 2P7VA 1OUVA 2Y3GA 3AG2C 3HTKC 2YHCA 2WVNA 4U0ZA 4BJ6C 2FFHA 3LAYA 3IBEA 4A1SA 1JPLA 1BR2A 2D5RB 1VYKA 2R7TA 4L1BA 4J0UA 3AG3C 4FHKA 1M2VB 2QFCA 2VGYA 2L0TB 4BTAA 5AJDA 4C0EA 4DBRA 3ZFWA 5DQZA 1ZHTA 3UT8A 4U07A 3GZ2A 1E8WA 4IAOA 2WB7A 4YJWA 4EPZA 2V26A 2IXPA 3FUNA 3EGXA 4I43A 2A5UA 2CDQA 4HFGA 3L34A 2PF4E 4GCOA 1D1CA 3CSKA 4JHKA 2Y3BA 4Q4ZF 4UI9C 3L16A 2CHWA 5T3RA 4ABNA 3G2WA 2C0MA 5ENNA 5T3WA 3R7RA 1KT0A 2WXQA 3D9PA 4NURA 2JD3A 4CDMA 2IF4A 3ESLA 3G2VA 5FCLA 2V5FA 3DBSA 4KVMA 1VYIA 2IXMA 5DS5A 3VAYA 3DD7A 5J90A 3L17A 3RO2A 1XGWA 5BUZA 4CGVA 1NA3A 5A7DB 2J7PA 3K66A 3W2WA 4KBLA 4FULA 1D0YA 3CVYA 4UWFA 1QLEC 4ACLA 4XWJA 3S28A 3FTVA 3RIBA 4I2WA 4HOTA 3Q4AB 1HE8A 1BR1A 4OIRF 1OKKA 4XLPF 4LLEA 4NACA 5ANRA 2Z15A 1MMNA 1SZAA 2CW0F 4M63A 4O6NA 3SNXA 3UX4A 4L7TA 3FUMA 4AM9A 4NRHB 2Q3TA 1E7VA 4G24A 3FFLA 2R7VA 2Y3DA 4G7HF 1Z3IX 3ML9A 2J0WA 3N2ZB 4GA0A 4UI9K 4IN3B 2XRHA 1N52A 3EZHA 4P29A 4JPSA 2X38A 4CDRA 1Z23A 4U5DE 1IW7F 5F5FA 4OYSA 4BX9A 4B0ZA 2G62A 2AW6A 4PFPA 4KZCA 3Q15A 2VASA 5FZRA 4DVYP 3ESKA 4HE8D 4KVOA 5FJYA 3KEZA 2AXUA 5DLJA 4PS7A 3I5PA 2J9WA 1MNEA 2CFZA 4BSXA 1UW4B 3SD5A 2OV8A 4J8FA 2X6JA 4KI2A 4J30B 4GYTA 1UN8A 3S27A 3JUIA 3IHYA 4DPRA 2ZXPA 3MGBA 3CK9A 3FUDA 4G25A 3UUXA 5EGYA 1EDUA 3GW4A 3PUJA 2PX3A 5A23A 4FU3A 2VSXE 4ANVA 2WZLA 2GGFA 3EDTB 5EDSA 1NP7A 2V0PA 3G2SA 3O48A 1NU9C 3CVNA 3LY8A 5BW8C 1QQEA 3GYZA 4O6MA 2OOEA 4MQ9F 4DLOA 3PMRA 3I3NA 4U0SA 3TAXA 5FT9A 4G23A 2JEKA 3EPVA 1D1AA 5LX8A 3B7UX 3VLFA 4BY6A 5BUOA 1ZHYA 2ONDA 2M63A 3I4UA 1V54C 4XI0A 2NXPA 3L22A 1M56C 5KYYA 2XGOA 2LSVA 4O7GA 4M3OA 3TJPA 1VMAA 3DJUB 2R5SA 4CBEA 4GAAA 4EBBA 2R7XA 2OVFA 2E87A 3SYNA 2W45A 4GYWA 1OWMA 2KZTA 3JSZA 2R7WA 2A69F 1E8XA 2GFHA 5AJLA 2PM6A 4UQZA 3FP3A 4AVXA 4PJJA 3KAEA 3NKEA 3VLDA 4MLPA 3P1UA 4L23A 3OXFA 3EGXB 4N06A 5D92A 3LEWA 4RG6A 2QY7A 4JXTA 1PCXA 1NU7D 2I1KA 2IONA 4FWVA 2V8SE 3PS6A 4JZAA 1BR4A 3IKOB 2XXAA 3UQ3A 3LLIA 3IEEA 2KNHA 4GMJA 2WXRA 1UJJA 3GANA 4ME2A 4DLQA 1XNFA 3C98A 4UWKA 3S0XA 3PEVB 4MS6A 2J09A 4U5FE 2PQNA 3NYLA 4ZLCA 3FHEA 3LESA 1SQMA 2J0XA 3EGDB 2KJGA 2HO1A 3TXMA 3RJVA 2LSEA 4DOZA 3FH8A 5EX3A 1WAO1 2DBAA 1TKNA 4BT9A 2WXKA 2WXHA 4N39A 1HS6A 2LAHA 3CEQA 4K0DA 4JEHA 3EFOB 1D1BA 3FHDA 2PQRA 1HG2A 4U0UA 1FTSA 4YVOA 3QC1A 1KLXA 2OG2A 4GZ3A 3V7OA 2NUPA 3TGOA 4I9EA 3ZG1A 1ELWA 3NF1A 2WQ6A 2QTVA 3K6BA 3ZPJA 4JA7A 2BE5F 4IWBA 3FU6A 2J4BA 4MNDA 1WY6A 4FJYA 2WVIA 4Y6CA 3S7JA 3FEXA 2EIJC 2NG1A 1IHGA 5DS4A 5G2NA 4CSAC 4NQ0A 4LRZA 3UGPA 1EPUA 4EZJA 4LLCA 4QFVA 4O79A 1PD1A 3UMHA 4HOQA 3AQCA 3CHRA 4UWGA 3FULA 5AYWD 3URZA 3T5XA 3MZLB 3H65A 2UY1A 3QB2A 2WMNA 4DJAA 3DM5A 2ZXRA 1EYHA 3B7TA 1HU3A 2CNWA 3OWTA 4W8KA 4EWCA 4C3EA 4E7ZA 4HORA 4BWRA 3LS0A 5KYUB 2PM7A 2JLBA 2FI7A 3Q6MA 4U04A 5G05J 5L3VA 2XPIA 4BJ5A 3DPDA 4AJWA 3ZIBA 4AXHA 2IFUA 4IULA 4I6GA 3TD7A 4U5GA 5HI7A 4XTKA 4DK5A 3LJ3A 4AE4A 4URKA 4APFA 2Y39A 4OIOF 2L81A 2E0IA 4WNEA 4CS7A 3FU5A 2VTBB 2G3VA 4B89A 1NZNA 3HVEB 4I3MA 1QZ2A 4EBAA 3CR3A 2WB2A 3HDXA 3I5QA 3DM9B 3FDQA 2NC9A 3RIPA 4CRWA 4WNDA 4HS2A 2V4LA 1VDYA 3SGHA 3CKBA 4UWLA 2X6IA 3MV2B 4DI4A 2BTDA 1ZU2A 3JQ0A 3LDZA 2AXVA 4H7XA 4L2YA 1TWAA 4I1AA 1NZEA 3EFOA 2XRYA 3CVQA 3CQZA 3EH2A 2YEVA 2L6JA 3IEGA 3U9WA 3OEOA 1INZA 3O6XA 2ZPAA 2X6HA 4R7LA 2LO6A 3ZXSA 2FF4A 4WNGA 5BPPA 4CIHA 3GZ1A 4HXIA 3CHSA 4YT2A 5D0OD 2VH3A 3T6JA 4F7AA 2WXLA 3T6BA 3CHPA 2Y4UA 2E2EA 2FGYA 3D9KA 2IXNA 1RJ9B 3EH1A 4B8AA 3ASOC 3D9MA 4HOUA 1E90A 4V3IA 3RRUA 1UJKA 4BJ5C 3O4ZA 3TL5A 3I4GA 3LVQE 2DCPA 3SFZA 3GZSA 2AXZA 5KJMA 4PFOA 1WM5A 2BUGA 4FC8A 3SEOA 3MYVA 1E8ZA 4RBNA 3RFYA 4Q96A 4GZCA 3MV3B 4XKCA 4ATGA 2VQ2A 4LERA 2R59A 4GYYA 1MMAA 4OVUA 2Q9CA 3EJNA 4MRUA 3LJBA 3NG1A 3MX3A 4GZ6A 3KL4A 4CS8A 4BJ6A 5FTPA 1D0ZA 3LYAA 4BX8A 3U64A 1U3DA 3WODF 2H7BA 3CQCB 5BNWA 4YVQC 4N3AA 5ANLA 4B8CB 1LKXA 1NG1A 3ABKC 3OA1A 2EIMC 2EIKC 2P6VA 3JCUQ 2C04A 5KCMA 3ECSA 4OVVA 3PEUB 3JRTA 3ML8A 4BEJA 1BPOA 3PREA 4WUYA 3RH3A 4E7SA 4PH4B 4ACKA 3F46A 4RSYA 5T4YA 2KCVA 4WWNA 4PUCA 5FQ7A 4KZ0A 5DS6A 5AENA 4KBQA 4I2ZA 2X6FA 2LNIA 3B9QA 4EQFA 3PE3A 2ZXOA 5A6CA 2MWQA 2DIWA 4K0RA 2CG3A 2Y69C 4FLHA 3QK0A 1FMWA 3ZSUA 1MQSA 2NUPB 2GRLA 3L08A 3FU0A 4GPKA 2XCCA 3M1CB 3PRZA 1IQUA 4BG0A 5T1DB 3PE4A 3ZVVA 5FWQA 4CDNA 3CSFA 5KJNA 4IYPA 4K03A 2GW1A 3PDNA 1NA0A 2X6KA 4A1GA 4U5HA 4QDLA 3PVLA 3EG9A 3CV0A 1D0XA 3EQLF 3U4TA 5IY5C 5J08A 3KKBA 3QWVA 2CGEA 4AY5A 4N3BA 3NRHA 4CEMA 4LCTA 1M2OA 3IV0A 3LEVA 3ZC4A 2PL2A 3CQGB 4RVBA 3ZRHA 4TUUA 1OKKD 2J45A 1TWGA 3SBTB 3ZW3A 4ANUA 3S29A 4J6IA 4I1MA 5DVWA 3R9AB 4N3CA 3KS2A 2IYLD 3SZRA 3L6AA 1SZIA 5KYYB 1ZU4A 2FO7A 1ZHXA 3LNRA 3CZ6A 4G7ZF 5G05C 1OCCC 3B7RL 3FTZA 3B13A 2QY9A 3CVXA 3EIQC 3AG4C 3MLGA 5KYXA 3ASDA 2X51A 2VSOE 1FFHA 3UNGC 2MOWA 4FHJA 3K1IC 4K7BA 2HYZA 5E76A 5KJLA 3FH7A 4C0MA 5B1AC 4P6IC 2A4ZA 4ANXA 3CHQA 1H2UA 1ZBPA 2Q9AA 3N0TA 1HXIA 4LACB 2WPVA 3FTXA 3WXXA 1PY1A 3ABMC 1SF8A 3HIZA 1EF1C 2FBNA 3TG4A 2YZSA 3B0UX 4UI9J 4A3TA 1Y6IA 2J4DA 4W9RA 3MJWA 1MMDA 3HJCA 4ANJA 3O39A 2DYRC 5F5HA 3AS4A 3KH2A 4PS3A 2CFUA 3FUHA 3X2QC 1JPNA 3CVVA 4O6YA 2WL8A 2MYSA 5E3AA 3MKRA 3CVWA 3ASNC 1KT1A 3F47A 3T8MA 4A3VA 1E8YA 3CVLA 3OXGA 2XRZA 3D9NA 3OXLA 3UT7A 4X0RA 2KATA 4G0HA 4FJZA 4CT0A 4I17A 5M72A 5EHHA 2I1JA 3K9IA 2KCLA 3EIJA 3DMDA 4G11A 4QI0A 3ZYMA 1Z5ZA 4KT6B 3K33A 3SHFA 4UWHA 2CG2A 4AEZC 3UGOA 4OD5A 4AK9A 4QI2A 3JT1A 2FEZA 5DIZA 2J08A 5JJ6A 4GA2A 2C03A 3W8HA 2VJ8A 1JPJA 4KMOA 1KU2A 5C2YA 1PD0A 4G7OF 2Y3HA 3L54A 2R17C 2WXMA 3HHMA 2CHZA 1HG5A 2KCKA 2ZXWC 2HM8A 2X3MA 1TJCA 2XPYA 3OAWA 3LS1A 1YA0A 4A55A 2R7RA 2YINA 3NQPA 3LLKA 3JCKC 4DBQA 4N2QA 5G55A 2WQ7A 4OIQF 4JC8A 3FUJA 4XX5A 5D0QD 1ZU5A 3VTXA 3FY4A 2CNWD 3HYMB 1HH8A 1N54A 4J8EA 3K7DA 4C7OB 4U8HA 4AP2A 5FZQA 2WXGA 3Q5MA 4JCHA 2XGMA 1B89A 3DAFA 3FTSA 2H7VC 4E6HA 2R7QA 4YT4A 4L2LA 4XE0A 3NZUA 3RRNB 3S7FA 2VSNA 4TRQA 4DI3A 4G26A 2CHXA 4GMLA 2HR2A 3VTYA 3CVUA 4JEUA 4GZ5A 4YT8A 4B6IA 3RKVA 2Y3AA 5BV0A 1Z6AA 1HX8A 3SZ7A 2RG8A 2L9JA 1HO8A 4TV3A 3ULQA 1MHQA 3CK8A 2AVPA 3DAGA 3AU4A 3SF4A 2Q7FA 2LAIA 2WM9A 1IYGA 4C3DA 2IU1A 1MMGA 4PK4A 5KYXB 4A2NB 2MRIA 3FUIA 3ZYLA 3UMIA 3LY9A 4F4BA 4G1TA 5JHAA 4RD9A 4IRUA 2O9XA 5ARFA 3BEEA 3T5VA 1FVHA 4FA6A 1LS1A 5HQ8A 4WJ0A 3QARA 2J9UA 3RU0A 3EHMA 4NY3A 1Y8MA 4F53A 3ZHEA 4EECA 4OD4A 3B0PA 4Q69A 3L0IA 2P58C 1V55C 1ZYRF 3UMVA 5FQ6A 2VGXB 1OCRC 3EZIA 2XEVA 2XSEA 3QAQA 3ITFA 3U66A 5JJTA 2IOQA 5FQ4A 4HVBA 4HLEA 1SZ9A 2A6EF 3FDHA 1TWHA 3D9IA 5BV1A 1PAQA 4F1SA 3RO3A 4JHJA 2NUTA 1ZHZA 3Q6NA 2H7OA 3FTUA 5BT1A 4PJLA 4RDAA 1FMVA 3DXJF 3ABLC 2XL4A 2A1DD 2ILRA 3B7SA 4GEHA 1J8MF 3APCA 2I8BA 1M2VA 1ELKA 5LCWJ 2WVOA 2WXPA 1WGWA 2IQCA 4U5BE 5E3CA 2WXJA 4H4KC 4U5EE 4I9CA 2WXOA 2HV7A 2M4EA 2IOLA 2DYSC 2Q9BA 4FP7A 5EKQD 3PZDA 3FUEA 1HFAA 3NYJA 2MHKA 2FULA 3FH5A 4JZYA 2R7OA 3R7QA 2LSUA 4KNWA 5B3SC 1VK5A 3CSTA 1OWPA 4ULWA 3ZYKA 3SNHA 2J46A 2V3CC 4KYOB 3JYHA 3AG1C 2NSZA 4EBAG 4EZLA 3ZYQA 1DNPA 3DZAA 2WZGA 2EINC 5LFAA 3FUFA 3LKUA 2RD0A 4I44A 3NYMA 1M57C 4C7OA 2J49A 4IJJA 3LY7A 3SI5A 1MNDA 2Y4TA 2WXFA 1IQRA 3ENEA 3APDA 5EX0A 4BTBA 2WQHA 3QMKA 2XHEA 4XKBA 2EQXA 3NZSA 4APOA 4JJFA 3EGDA 3RRMB 3CIAA 3T4RA 4CS9A 3FWVA 3E70C 4JW1A 5HSWA 2J9VA 5DQTA 3E9VA 5G04C 4WWOA 3QNKA 3W8IA 2C2LA 3G2TA 1Z6TA 5LP0A 4HOSA 3QJZA 4J8SA 2YHEA 3E4BA 2XCBA 3LS8A 4ILIA 3LCAA 2G3KA 4KC9A 4N2SA 3OTNA 1OWOA 1UN9A 3NKDA 3TG5A 3Q47B 4D10C 4BJTA 3S7DA 3APFA 3CGHA 3MKQB 3CVPA 4Q94A 1P5QA 2UWJG 5CI9A 2B0JA 4JVSA 3UMKA 4Q7CA 3FTYA 4CS8C 4J8DA 5B1BC 1H2TC 3MCXA 1ZHWA 4JJGA 1LF8A 4CT4A 3DJNB 1W2WA 3NDBB 4GA1A 4N5CA 3BG1B 2OVBA 3AU5A 1SMYF 4YNDA 1G8XA 2KGOA 4PJNA 3ONKA 3SP1A 3PH0C 3CK7A 2WMOA 3Q7LA 1E7UA 3MKQA 1Z3YA 3BG0B 4AY6A 4WWPA 2PFDA 4GCNA 2IXOA 5C1DA 1OWLA 5JHBA 3D3MA 3Q49B 3KMIA 3TXNA 1TEZA 1L5JA 2C0LA 2KW3C 5FQ8A 3QWWA 4HFFB 3PNTB 2IJGX 2UY1B 1ELRA 4DVZA 2VTBA 2EILC 3D9JA 5LOZA 1HF8A 5KYWB 1OCZC 4U63A 1A17A 2PX0A 2YQ8A 3EG9B 4B94A 4CGWA 3X1OA 1U3CA 5AIJA 2XPZA 1DVPA 5CHEE 3AS5A 3JQ1A 4AIFA 2XXAB 3I4RB 1LVKA 5KJKA 4C9BB 4I1OB 3POVA 5T3TA 4FLBA 3QZCA 2VYIA 1Z63A 3ASFA 1TWCA 2VSYA 5JJ7A 4FX5A 2I2OA 4CS9C 1HZ4A 4XIFA 1JWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1M A;  4I1O B;  4JW1 A;  4IRU A;  4JVS A; 
#chains in the Genus database with same CATH topology
 3W2V A;  4O60 A;  3QWP A;  3ASH A;  3HRA A;  1GGQ A;  4TUM A;  1Y4C A;  4GB9 A;  2EIJ E;  2GRM A;  4E0I A;  3RKO F;  2W4B A;  3ZGQ A;  2W4M A;  1EKY A;  2XQ0 A;  3T9K A;  2VCB A;  2WVQ A;  4MKT A;  4DX5 D;  2AVK A;  2YKZ A;  3QOU A;  2VGE A;  5AC4 A;  1E96 B;  3DXM G;  3ONL A;  3QW1 A;  3QKY A;  3EHN A;  1ST6 A;  4FES A;  4J8Y A;  5CRU A;  4ILH B;  4AX2 A;  4UQX A;  3V5Z A;  5CCL A;  4FAD A;  2XLO A;  4I6J A;  5ARG A;  1MX4 A;  3ZXP A;  4BT8 A;  2KM4 A;  3B0V C;  4YDW A;  3ZTZ A;  3J06 A;  2BKK B;  2YWA A;  1Z3X A;  2YQY A;  3Q7G A;  3U3W A;  3HLZ A;  1J8Y F;  1HW1 A;  2YHS A;  2LK4 A;  3G4Z A;  2AP3 A;  1O87 A;  3SO8 A;  4HEA J;  2ZU6 B;  2DZO A;  3KD7 A;  3RK6 A;  2IO2 C;  3ULE G;  4HFK B;  3WG7 C;  3FU3 A;  5KNH D;  5LCW C;  3HXD A;  2HV6 A;  1K1A A;  2AWI A;  4KXK B;  4Y6W A;  3MEK A;  4EZK A;  1ZVZ A;  1OW8 A;  4XI9 A;  2ZXW E;  1WAT A;  3NB2 A;  1FVF A;  1RJ9 A;  3FEY A;  5CCM A;  4CCA A;  4EHP A;  1PC2 A;  2B0H A;  4NTB A;  2QZA A;  3AS8 A;  3U2L A;  3LXU X;  5ITZ F;  2IO3 C;  3HG0 D;  4JL0 A;  4CSA A;  4ANW A;  3GOR A;  4AE4 B;  2P9K G;  3IHV A;  5CBN A;  4ZLD A;  2XLV A;  1JWG A;  5CMY A;  4HRM B;  1HY5 A;  2I9C A;  2XGS A;  1TN7 A;  1S7Z A;  4PDX A;  3IHU A;  2XEH A;  4YN0 B;  5CIV A;  5KYN A;  2VGX A;  2P2C P;  1E83 A;  4BFR A;  4HI8 A;  3LPZ A;  4LUN U;  4UQY A;  3DI5 A;  2PZI A;  2P9L G;  3L13 A;  4H7Y A;  4AV7 A;  3AQB A;  1FCH A;  1O5H A;  2P9I G;  4GTM A;  1KTM A;  4MVR A;  3JXJ A;  2L9B A;  3VLE A;  3ZEF A;  4WNF A;  1HW2 A;  3FUK A;  3IQ6 A;  3PUK A;  4U96 D;  4AOF A;  1VLS A;  2XL8 A;  2YL7 A;  1OCO C;  2ETC A;  3L8I A;  4K5B A;  1H6K A;  4PS8 A;  3UR3 C;  2OCC C;  5D91 A;  2WXI A;  1JRA A;  4ILG A;  3BUA A;  4RLY A;  3CHM A;  5CMW A;  3D9O A;  1TN6 A;  1S70 B;  1NSG B;  4DXW A;  4K5C A;  4GZD A;  3LVR E;  2KQ9 A;  3QVZ A;  1N94 A;  3JYS A;  4U5C E;  3PZ2 A;  2WZF A;  3FTW A;  3GOD A;  4GU5 A;  1OWN A;  4DX2 A;  1FFT C;  2KZT B;  4I6E A;  3N71 A;  1N4P A;  3CLJ A;  1A0B A;  5E33 A;  3SBS A;  3FVY A;  2IOS A;  1U89 A;  3ZN3 A;  4U9D A;  1YYX A;  3P2B A;  1G5Z A;  4GYO A;  1OCR E;  1XZP A;  2NUT B;  2YLI A;  4PJM A;  3MA5 A;  1C03 A;  5L3Q A;  3N24 A;  1QNF A;  3PNL B;  5H7P A;  1VOM A;  4E18 A;  3RYL A;  3SFY A;  1YJG A;  1AVO B;  5G04 J;  1LI7 A;  3JYY A;  5COG A;  5BQH A;  2WXN A;  1JUQ A;  3ZVR A;  2PP4 A;  3CKC A;  4O6F A;  1W3B A;  2R7U A;  1UG3 A;  4YWQ A;  2A6H F;  2I6H A;  3T6G B;  3VYW A;  4JIO A;  4KNV A;  4E85 A;  2VB6 A;  4JHR A;  5E75 A;  2YNQ A;  5KYU A;  3QDN A;  5DBK A;  3G2U A;  4F3V A;  4YT5 A;  1X5B A;  3S7B A;  4PR9 A;  1O1R A;  3DEP A;  4BJ1 A;  1BLX B;  1H19 A;  5B3I A;  3D9L A;  1N4Q A;  2A68 F;  4CJG A;  1IZM A;  3DKA A;  3FAJ A;  1TJF A;  4XZ4 A;  4LDK A;  2BF0 X;  1S0P A;  3S2A A;  3HVE A;  2J07 A;  2J9Q A;  3PZ4 A;  2DGJ A;  3UPV A;  3ASG A;  2J7P D;  2Q00 A;  3K1H A;  4JUR I;  2L0I A;  4Q5S F;  1TR2 A;  4C3B A;  4JA9 A;  3GM2 A;  2R7S A;  4ONS A;  3S90 A;  5EK0 A;  1GW6 A;  4OIP F;  3CEX A;  2KXP C;  2KC7 A;  3UT4 A;  3PHF 2;  4RG9 A;  5T8I A;  3H2U A;  1H0A A;  4LEU A;  3CHO A;  3ZIM A;  4MVZ A;  2W9Y A;  5KYW A;  5FZS A;  1H2V C;  2DVW A;  1QZX A;  2XLM A;  3ZHE B;  4G2V A;  4J32 B;  4OIN F;  5E2Q A;  4WAF A;  4HRN A;  1N1C A;  5CI8 A;  4XLN F;  2P7V A;  1OUV A;  2Y3G A;  3AG2 C;  4LNG A;  3HTK C;  5A6J A;  2YHC A;  2WVN A;  4U0Z A;  1LI5 A;  2QLA A;  4BJ6 C;  2FFH A;  3LAY A;  4LDQ A;  3LJN A;  3IBE A;  4A1S A;  1KZP A;  1JPL A;  1BR2 A;  1QYM A;  2D5R B;  2EPN A;  1VYK A;  2XM4 A;  2R7T A;  4L1B A;  3KPH A;  4J0U A;  3UM3 A;  3AG3 C;  4FHK A;  1M2V B;  2QFC A;  4P9F A;  3G4X A;  1I5N A;  2L0T B;  2VGY A;  3PCV A;  4HB5 A;  2D4U A;  1BZ4 A;  5AJD A;  4BTA A;  4C0E A;  4DBR A;  3ZFW A;  5DQZ A;  1ZHT A;  4MS2 A;  2KC3 A;  3UT8 A;  4U07 A;  3GZ2 A;  1E8W A;  4IAO A;  2WB7 A;  4YJW A;  3B71 A;  2ZGG A;  4EPZ A;  2V26 A;  3TWW A;  2IXP A;  3FUN A;  3EGX A;  4I43 A;  2A5U A;  3MBG A;  2CDQ A;  4HFG A;  5ENT D;  3L34 A;  5B1B E;  2PF4 E;  4GCO A;  5HS0 A;  1D1C A;  2YVK A;  3CSK A;  2ZIR A;  4JHK A;  2Y3B A;  2HMZ A;  4Q4Z F;  4M7C A;  4UI9 C;  3L16 A;  2CHW A;  3C8G A;  5A6B A;  3QW0 A;  5T3R A;  4K1O A;  4ABN A;  3G2W A;  3SY2 A;  2C0M A;  5ENN A;  5T3W A;  3R7R A;  4N4W A;  1KT0 A;  2GRQ B;  3C62 A;  2WXQ A;  4HNA D;  1SYQ A;  3D9P A;  4CZ2 D;  4NUR A;  3ULY A;  3WG7 E;  2JD3 A;  3U5S A;  2IF4 A;  4CDM A;  3FOP A;  3ESL A;  3G2V A;  5FCL A;  1O5M A;  2V5F A;  1WWP A;  3DBS A;  1WOL A;  4KVM A;  1Q2Z A;  3SXK A;  1B68 A;  1VYI A;  2IXM A;  5DS5 A;  3NAW A;  3VAY A;  3DD7 A;  2HKV A;  3L17 A;  4BER A;  5J90 A;  3RO2 A;  4XEI G;  1XGW A;  5BUZ A;  1YZA A;  4CGV A;  1NA3 A;  5A7D B;  2J7P A;  2R02 A;  3K66 A;  2HSQ A;  4AL0 A;  1DOW A;  4U95 D;  2PNN A;  3W2W A;  4KBL A;  4FUL A;  3M4B A;  3KYI A;  1D0Y A;  3D9H A;  3CVY A;  2HZ8 A;  4UWF A;  1QLE C;  3EHQ A;  4ACL A;  4XWJ A;  3S28 A;  3FTV A;  3RIB A;  4I2W A;  4HOT A;  4CJO A;  3Q4A B;  1HE8 A;  1BR1 A;  4OIR F;  4E17 A;  2M64 A;  3CAX A;  3DSX A;  1OKK A;  4XLP F;  4LLE A;  4NAC A;  5ANR A;  2Z15 A;  1MMN A;  1NBB A;  1SZA A;  5L0C A;  2CW0 F;  4M63 A;  4O6N A;  3SNX A;  4NQF A;  1H6P A;  4MW8 A;  5AAR A;  3UX4 A;  4L7T A;  5ENQ D;  3FUM A;  1HE9 A;  4AM9 A;  4NRH B;  1YYJ A;  3AAA C;  2VC9 A;  2Q3T A;  1E7V A;  5JSL A;  4G24 A;  1RXQ A;  3FFL A;  2R7V A;  1YLM A;  2Y3D A;  4G7H F;  1Z3I X;  2LD6 A;  3ML9 A;  2J0W A;  3Q79 A;  2JX0 A;  3O55 A;  3R2P A;  3V79 K;  4CDY A;  4UDV A;  1KPS B;  4IB4 A;  5EYL A;  3R9M A;  3N2Z B;  4GA0 A;  4HLL A;  4UI9 K;  1YA9 A;  4IN3 B;  3JSE O;  4F6R D;  1N52 A;  2XRH A;  3DXK G;  3EZH A;  3F6Q A;  4P29 A;  4JPS A;  2X38 A;  1UG7 A;  4CDR A;  2LP4 A;  1Z23 A;  4U5D E;  2ZGD A;  4JE9 A;  1IW7 F;  1YDI A;  5F5F A;  1MJ0 A;  3DPY A;  4OYS A;  4J7T A;  2V4H C;  4BX9 A;  4B0Z A;  3ZWI A;  2G62 A;  2AW6 A;  4PFP A;  4KZC A;  3Q15 A;  2VAS A;  1G3N B;  1LPE A;  4IGG A;  2F37 A;  5FZR A;  4DVY P;  3ESK A;  1LIH A;  4HE8 D;  4KVO A;  2I15 A;  3HNL A;  5FJY A;  3KEZ A;  2AXU A;  5DLJ A;  3L1M A;  3RW0 A;  2UUH A;  4PS7 A;  3U9M A;  2B0O E;  3I5P A;  2J9W A;  1MNE A;  2R9R B;  2PBE A;  2GDC A;  3ABM E;  2CFZ A;  4BSX A;  1YA7 O;  3FOO A;  5CRV A;  1UW4 B;  3ZKJ A;  3SD5 A;  2OV8 A;  4J8F A;  2X6J A;  4GTO A;  3E33 A;  4KI2 A;  4J30 B;  4GYT A;  1UN8 A;  3PZ3 A;  3S27 A;  2VCA A;  3JUI A;  3IHY A;  4DPR A;  2ZXP A;  5CER B;  3MGB A;  1E86 A;  3Q7F A;  3CK9 A;  3FUD A;  3NMJ A;  3LEO A;  4G25 A;  2FAP B;  3UUX A;  2R03 A;  5EGY A;  2XEN A;  1EDU A;  2EPO A;  3GW4 A;  3PUJ A;  2PX3 A;  4YL1 A;  5A23 A;  4FU3 A;  2VSX E;  4ANV A;  3ASO E;  1OXK A;  2WZL A;  3RF3 A;  2GGF A;  1K3Z D;  3EDT B;  1FPP A;  1OQC A;  5EDS A;  1NP7 A;  1XWJ A;  3GWN A;  1N95 A;  1SA4 A;  5FIO A;  2V0P A;  1JMW A;  3G2S A;  3BQO A;  3O48 A;  1NU9 C;  1GS9 A;  3CVN A;  3LY8 A;  5BW8 C;  3TWT A;  2Q7R A;  1QQE A;  3GYZ A;  4O6M A;  1GM5 A;  1XZQ A;  4MQ9 F;  2OOE A;  4DLO A;  3PMR A;  3I3N A;  1OW7 A;  5BQG A;  3DEO A;  4U0S A;  2DYR E;  3TAX A;  5FT9 A;  4G23 A;  3C5R A;  2JEK A;  3EPV A;  3QTH A;  1D1A A;  1N4S A;  5LX8 A;  3B7U X;  3ZNG A;  3VLF A;  1AEP A;  2BKG A;  4BY6 A;  1FAP B;  1F1M A;  5BUO A;  1MZC A;  1V4A A;  3ZUV B;  1ZHY A;  2OND A;  2M63 A;  3IQT A;  1BDJ B;  3I4U A;  4J7W A;  1V54 C;  1JR8 A;  2AJA A;  4XI0 A;  2NXP A;  3KSL A;  3L22 A;  1M56 C;  5KYY A;  4JEA A;  2XGO A;  2LSV A;  4O7G A;  4M3O A;  1EI7 A;  3T9O A;  3TJP A;  4BEM J;  1VMA A;  3DJU B;  4HRL A;  2DB4 A;  2R5S A;  2XL6 A;  4CBE A;  4GAA A;  4EBB A;  2R7X A;  4HBD A;  4DX6 D;  2OVF A;  2E87 A;  3GM1 A;  3SYN A;  2W45 A;  1O1T A;  4GYW A;  1OWM A;  2KZT A;  3JSZ A;  2R7W A;  2A69 F;  5A69 A;  2GFH A;  3C8G B;  1E8X A;  3U9J A;  2PM6 A;  3FP3 A;  3HXF A;  4PJJ A;  4UQZ A;  5AJL A;  4MTO A;  3KAE A;  1T01 A;  2HMQ A;  3NKE A;  4N6H A;  3VLD A;  4A63 B;  4MLP A;  1ZZP A;  2DWZ A;  3P1U A;  4L23 A;  1ZW3 A;  3OXF A;  3EGX B;  4N06 A;  5D92 A;  1NL4 A;  3LEW A;  4RG6 A;  2QY7 A;  4JXT A;  1PCX A;  1NU7 D;  2I1K A;  4K5A B;  2ION A;  4FWV A;  2V8S E;  3PS6 A;  4JZA A;  1BR4 A;  3IKO B;  2XXA A;  3T8K A;  3UQ3 A;  3IQC A;  1OCC E;  3LLI A;  3IEE A;  2KNH A;  4GMR A;  2XLW A;  4GMJ A;  2WXR A;  1UJJ A;  3GAN A;  4YL3 A;  4ME2 A;  1KZO A;  5HRY A;  4DLQ A;  1BD8 A;  1FT2 A;  1XNF A;  3QVY A;  3C98 A;  1LS4 A;  5TJ5 E;  1TNY A;  5L0I A;  4UWK A;  3S0X A;  1LD8 A;  1NFI E;  3PEV B;  4MS6 A;  2J09 A;  5JA4 D;  4U5F E;  2PQN A;  2LQG A;  3DSW A;  3NYL A;  3C7J A;  4JCZ A;  4LNU D;  2IY0 C;  4ZLC A;  3FHE A;  4MW3 A;  4D4N A;  2MYO A;  3LES A;  1SQM A;  2J0X A;  3EGD B;  5ENO D;  5ENS D;  2KJG A;  2HO1 A;  3L82 A;  3TXM A;  4MTF A;  2LSE A;  3RJV A;  4DOZ A;  3FH8 A;  5EX3 A;  1WAO 1;  2DBA A;  2ZIS A;  1TKN A;  3Q9U C;  4BT9 A;  2WXK A;  2WXH A;  4BET A;  4N39 A;  2YRF A;  1HS6 A;  5A6A A;  3DSU A;  2LAH A;  1K04 A;  3CEQ A;  4K0D A;  4JEH A;  3EFO B;  1D1B A;  3FHD A;  3HXE A;  4N5Q A;  2PQR A;  4TXR A;  1HG2 A;  4U0U A;  1FTS A;  4LNB A;  4YVO A;  3QC1 A;  1KLX A;  2OG2 A;  4GZ3 A;  3V7O A;  4ULV A;  2NUP A;  3TGO A;  4I9E A;  3ZG1 A;  4JB8 P;  2OOC A;  3E30 A;  1WTY A;  1ELW A;  3NF1 A;  2WQ6 A;  2QTV A;  3K6B A;  3ZPJ A;  4O1O A;  4JA7 A;  2BE5 F;  4IWB A;  3FU6 A;  2J4B A;  2QUP A;  4MND A;  1OXJ A;  1WY6 A;  4FJY A;  5CED B;  2WVI A;  1U2V G;  4Y6C A;  3S7J A;  2XM0 A;  3FEX A;  4JTD B;  2EIJ C;  1IHG A;  2NG1 A;  1OW6 A;  5DS4 A;  4RQI A;  5G2N A;  4CSA C;  4NQ0 A;  4LRZ A;  1QPU A;  3UGP A;  3ISM C;  1EPU A;  1TFO B;  4EZJ A;  4LLC A;  4QFV A;  1YMP A;  4O79 A;  2RSE B;  1PD1 A;  1CGM E;  3UMH A;  4HOQ A;  3AQC A;  3CHR A;  4UWG A;  3W9G A;  3FUL A;  5AYW D;  3URZ A;  3T5X A;  1EQ1 A;  3MZL B;  3H65 A;  2UY1 A;  1H6O A;  3QB2 A;  4GTR A;  2WMN A;  2KSF A;  4DJA A;  3DM5 A;  2ZXR A;  1EYH A;  1N11 A;  3B7T A;  1CPQ A;  1HU3 A;  1SR2 A;  2CNW A;  1RW2 A;  3OWT A;  4W8K A;  4EWC A;  4FAP B;  4B93 B;  1QVX A;  2BC5 A;  4C3E A;  4E7Z A;  1E2X A;  3M4C A;  4HOR A;  4BWR A;  3LS0 A;  5KYU B;  2PM7 A;  2JLB A;  5AN8 A;  2FI7 A;  3Q6M A;  4U04 A;  5G05 J;  5L3V A;  4U8V D;  2XPI A;  4BJ5 A;  1YCS B;  3DPD A;  4AJW A;  3ZIB A;  2QYJ A;  4AXH A;  2QC9 A;  4JRZ A;  2IFU A;  4IUL A;  4I6G A;  3DSV A;  3TD7 A;  2DI3 A;  4U5G A;  3V31 A;  2F0Y A;  5HI7 A;  4XTK A;  4DK5 A;  2J8S D;  3U8V A;  3LJ3 A;  4AE4 A;  1TYQ G;  4URK A;  1D9S A;  2V5Q C;  4APF A;  2Y39 A;  4OIO F;  1N0R A;  1T6I A;  3RSE G;  2L81 A;  2E0I A;  3SQV A;  5A6K A;  3IQ5 A;  4WNE A;  4CS7 A;  2XEE A;  3FU5 A;  2VTB B;  2G3V A;  3L9T A;  5D66 A;  4B89 A;  1NZN A;  3HVE B;  4I3M A;  1QZ2 A;  4EBA A;  4GQH A;  2GA0 A;  3CR3 A;  2WB2 A;  3RAU A;  3W4Y A;  3VRC A;  3HDX A;  3I5Q A;  2PNO A;  3DM9 B;  3FDQ A;  5JVE A;  3Q7A A;  5AQ9 A;  2NC9 A;  3RIP A;  4CRW A;  4WND A;  1N9A A;  4HS2 A;  1SW6 A;  2V4L A;  2RD9 A;  1VDY A;  3CKB A;  3SGH A;  4UWL A;  2X6I A;  3NMI A;  3MV2 B;  1H9G A;  4DI4 A;  2BTD A;  1ZU2 A;  3JQ0 A;  3LDZ A;  2AXV A;  4H7X A;  4L2Y A;  1TWA A;  4I1A A;  1NZE A;  3EFO A;  2XRY A;  3CVQ A;  3CQZ A;  2FO1 E;  3EH2 A;  2YEV A;  5L0F A;  2L6J A;  3IEG A;  1MYO A;  3U9W A;  3OEO A;  3BRJ A;  2P61 A;  1INZ A;  3FXH A;  3O6X A;  2ZPA A;  2X6H A;  4R7L A;  2LO6 A;  3ZXS A;  2FF4 A;  4WNG A;  4GTS A;  5BPP A;  4CIH A;  3GZ1 A;  5GPG B;  4HXI A;  3CHS A;  4YT2 A;  5D0O D;  2VH3 A;  3T6J A;  3TJ6 A;  4F7A A;  4ZHB A;  3M15 A;  2WXL A;  3TUL A;  3T6B A;  3CHP A;  2OEX A;  2Y4U A;  2E2E A;  4JTC B;  1DC2 A;  2FGY A;  3D9K A;  2XZD G;  2IXN A;  4G8L A;  1RJ9 B;  3EH1 A;  1OXB A;  4B8A A;  3ASO C;  3DWL G;  3D9M A;  4HOU A;  1E90 A;  4V3I A;  3RRU A;  1UJK A;  4BJ5 C;  3LVQ E;  3O4Z A;  2P0N A;  3I4G A;  2DCP A;  3SFZ A;  3TL5 A;  3GZS A;  5AC5 A;  2AXZ A;  5KJM A;  4EIY A;  1H7I A;  2F22 A;  4PFO A;  1WM5 A;  2OEV A;  2BUG A;  2TMV P;  1K8K G;  4FC8 A;  3SEO A;  1RCP A;  2RFM A;  3AJM A;  3MYV A;  1E8Z A;  5D2M C;  2NYJ A;  4RBN A;  3TWU A;  2XZT G;  4BEP A;  3RFY A;  2OU6 A;  4Q96 A;  4GZC A;  3MV3 B;  3B29 A;  3US6 A;  4XKC A;  4ATG A;  2P9P G;  4J7Y A;  5CEC B;  2VQ2 A;  4LER A;  2R59 A;  4GYY A;  1BI8 B;  1MMA A;  3A9C A;  4OVU A;  1T6U A;  2GRN B;  2Q9C A;  3EJN A;  4LG6 A;  4MRU A;  5KBA A;  3LJB A;  1FR0 A;  5BXU A;  3NG1 A;  1H6G A;  2OCC E;  2BL2 A;  3MX3 A;  4GZ6 A;  3KL4 A;  4CS8 A;  4BJ6 A;  3DE8 A;  1WAS A;  5FTP A;  4JD2 G;  1D0Z A;  3LYA A;  4BX8 A;  3GEE A;  3U64 A;  1JCS A;  1U3D A;  3WOD F;  2H7B A;  3CQC B;  5BNW A;  1X81 A;  3V2X A;  1IKN D;  4WGZ A;  4YVQ C;  2EIN E;  4N3A A;  5ANL A;  1SA5 A;  4BES A;  4B8C B;  1LKX A;  1NG1 A;  3ABK C;  4PAC A;  2L6G A;  2EIK C;  2EIM C;  3OA1 A;  2P6V A;  3JCU Q;  4CDA A;  2C04 A;  2EPM X;  3DRA A;  3BU8 A;  5KCM A;  3ECS A;  3ASN E;  1G4U S;  3PEU B;  4OVV A;  4CIP A;  3JRT A;  3ML8 A;  4BEJ A;  3UIN C;  4P9T A;  1BPO A;  4X8Q A;  3PRE A;  4WUY A;  3RH3 A;  4E7S A;  1TN8 A;  4ZFH A;  4PH4 B;  4ACK A;  3F46 A;  4RSY A;  3C8Z A;  3AGU A;  5T4Y A;  2KCV A;  4WWN A;  4PUC A;  5FQ7 A;  4KZ0 A;  5DS6 A;  5AEN A;  1PV3 A;  1L3P A;  4KBQ A;  4I2Z A;  2X6F A;  5B3S E;  2LNI A;  3B9Q A;  4EQF A;  3PE3 A;  1T6Q A;  3EUV A;  3VF0 A;  2ZXO A;  4Z9I A;  5A6C A;  2MWQ A;  2DIW A;  4K0R A;  2CG3 A;  2CCY A;  5JP7 A;  2P9S G;  3UI2 A;  2Y69 C;  2H6H A;  4FLH A;  1E84 A;  3QK0 A;  4YDO A;  3C18 A;  3C63 A;  5AQB A;  1FMW A;  1NLX A;  3ZSU A;  2H6G A;  1MQS A;  2NUP B;  5JUA A;  5FIN A;  2GRL A;  3L08 A;  4IAR A;  3NOC D;  3FU0 A;  4GPK A;  1OR3 A;  4EKW A;  4ER9 A;  2HJ3 A;  3GEI A;  2XCC A;  3M1C B;  3L8J A;  3PRZ A;  1IQU A;  4A4A A;  1D8D A;  1YYH A;  4BG0 A;  5T1D B;  3PE4 A;  3ZVV A;  4Z9J A;  5ENR D;  5B1A E;  5FWQ A;  2YLD A;  4CDN A;  3CSF A;  1NFN A;  3TWQ A;  5KJN A;  4IYP A;  4K03 A;  4OAU C;  2R25 A;  4HQD A;  3KEA A;  2H6I A;  2OJE D;  3V5X A;  2GW1 A;  4YDY A;  3PDN A;  1NA0 A;  2X6K A;  2HUJ A;  4A1G A;  4U5H A;  4QDL A;  3PVL A;  3EG9 A;  3CV0 A;  1D0X A;  3EQL F;  3U4T A;  5IY5 C;  5J08 A;  3KKB A;  1T9K A;  3QWV A;  2CGE A;  2RKK A;  4AY5 A;  3X2Q E;  4N3B A;  3NRH A;  4CEM A;  4LCT A;  1M2O A;  3IV0 A;  3LEV A;  3ZC4 A;  2PL2 A;  3CQG B;  4GTP A;  1KNY A;  4RVB A;  1RZ4 A;  4TUU A;  3ZRH A;  1OKK D;  4NTF A;  3Q73 A;  1AWC B;  1E85 A;  2J45 A;  4UUC A;  1TWG A;  4JKV A;  3S84 A;  1JOG A;  3SBT B;  5L0J A;  3UIP C;  3ZW3 A;  4GTV A;  2KYH A;  4ANU A;  4JTA B;  3S29 A;  4J6I A;  4I1M A;  2R2L A;  5DVW A;  2KBX A;  4LDR A;  3R9A B;  4MVO A;  3JRM O;  1GQA A;  4N3C A;  1R4T A;  4W8P A;  3NBN B;  4D4X A;  1Y6D A;  3KS2 A;  2IYL D;  3ZTM A;  4U7E B;  3SZR A;  3FMS A;  3L6A A;  1SZI A;  5KYY B;  1ZU4 A;  4L6R A;  2FO7 A;  1ZHX A;  3LNR A;  3CZ6 A;  5JS5 A;  4G7Z F;  5G05 C;  3PDM P;  1OCC C;  2GRR B;  3B7R L;  5A6B D;  3FTZ A;  1AP7 A;  3B13 A;  2QY9 A;  3Q9N C;  5L0H A;  3CVX A;  3EIQ C;  3AG4 C;  2EPK X;  3MLG A;  4Z9H A;  5KYX A;  1TQG A;  2IM8 A;  4CDV A;  3ASD A;  2X51 A;  2VSO E;  1FFH A;  3UNG C;  2MOW A;  2QNL A;  4FHJ A;  3K1I C;  4K7B A;  2LFD A;  2L6B A;  2A0U A;  2HFI A;  2HYZ A;  5E76 A;  3HNJ A;  5KJL A;  4LSZ E;  5COM A;  3FH7 A;  3TWR A;  4C0M A;  5B1A C;  4P6I C;  3HNI A;  2MHR A;  4JEB A;  2A4Z A;  4ANX A;  4MTG A;  3C8G D;  4NC3 A;  3CHQ A;  1H2U A;  3UM0 A;  2VCC A;  1ZBP A;  2Q9A A;  3N0T A;  1HXI A;  1QBQ A;  2Q4F A;  1TNB A;  4LAC B;  2WPV A;  3FTX A;  2A5E A;  3WXX A;  5EIL A;  3JTL O;  1PY1 A;  4TXP A;  3ABM C;  1OY3 D;  1LD7 A;  1SF8 A;  1RMV A;  3HIZ A;  4L9P A;  1CPR A;  1EF1 C;  2FBN A;  2XLD A;  3TG4 A;  2YZS A;  3B0U X;  4UI9 J;  4A3T A;  4AVX A;  1Y6I A;  2J4D A;  4W9R A;  3MJW A;  1RKC A;  1MMD A;  3HJC A;  4ANJ A;  1I4Z A;  3O39 A;  2DYR C;  5F5H A;  1OCZ E;  4Z68 A;  3AS4 A;  3KH2 A;  4PS3 A;  2CFU A;  3FUH A;  3X2Q C;  1U6H A;  1JPN A;  2X0C A;  3CVV A;  4O6Y A;  2WL8 A;  3JXI A;  2MYS A;  4EHM A;  5E3A A;  5IY5 E;  1YAU O;  3MKR A;  3CVW A;  3ASN C;  3IXE A;  1KT1 A;  3AJI A;  3F47 A;  3T8M A;  4E0H A;  4A3V A;  5AGF A;  3M79 A;  1E8Y A;  3CVL A;  3OXG A;  2XRZ A;  3SFX A;  1ZW2 A;  3D9N A;  3OXL A;  3UT7 A;  4X0R A;  5KWD A;  2KAT A;  5EYP F;  4G0H A;  4FJZ A;  4CT0 A;  4I17 A;  3HKK A;  5M72 A;  5EHH A;  1TR4 A;  2I1J A;  3K9I A;  4MVU A;  2KCL A;  3EIJ A;  2A0B A;  3DMD A;  4G11 A;  4QI0 A;  3ZYM A;  5JLI A;  1Z5Z A;  2KK1 A;  4KT6 B;  2L7A A;  3K33 A;  1MX2 A;  3SHF A;  3NOG D;  4UWH A;  2XLE A;  1S64 A;  2CG2 A;  4AEZ C;  3UGO A;  4OD5 A;  3C3R A;  4AK9 A;  4QI2 A;  3AOU A;  2QYU A;  3JT1 A;  2FEZ A;  2L6F A;  5DIZ A;  2J08 A;  1LM3 B;  3DE9 A;  5JJ6 A;  4GA2 A;  4HI9 A;  3NMK A;  3ATP A;  2C03 A;  3ZDL A;  3W8H A;  4DX7 D;  2VJ8 A;  3UM2 A;  1JPJ A;  1YZC A;  4KMO A;  1KU2 A;  5C2Y A;  1PD0 A;  2P1A A;  3GWL A;  2R05 A;  4G7O F;  2Y3H A;  3L54 A;  3MYI A;  2R17 C;  2WXM A;  3HHM A;  2CHZ A;  1HG5 A;  2LUH A;  1YAR O;  2KCK A;  2ZXW C;  2HM8 A;  2X3M A;  1TJC A;  1ZB1 A;  4DX1 A;  2XPY A;  2LIG A;  4NCQ A;  1G4W R;  1HMD A;  1MX6 A;  3OAW A;  4NIK A;  3LS1 A;  1YA0 A;  4A55 A;  2R7R A;  2YIN A;  2XLH A;  3NQP A;  3LLK A;  3JCK C;  2HE0 A;  4DBQ A;  1TNU A;  4N2Q A;  3K1I A;  1DOV A;  5G55 A;  2QE9 A;  2WQ7 A;  4YK5 A;  4OIQ F;  4JC8 A;  4XEF A;  3FUJ A;  4XX5 A;  2LXL A;  1ZU5 A;  5D0Q D;  4DRX E;  3VTX A;  2XS8 A;  3FY4 A;  1LTX A;  4XPX A;  2HSB A;  1AUE A;  3WAQ A;  2CNW D;  3HYM B;  1HH8 A;  1N54 A;  4J8E A;  2OJQ A;  2IEJ A;  3AG1 E;  3RVZ A;  3K7D A;  4C7O B;  4U8H A;  4AP2 A;  3DWW A;  5FZQ A;  2WXG A;  3Q5M A;  4GTT A;  1OR2 A;  4JCH A;  1C17 M;  2XGM A;  2NSG A;  5JT4 A;  3DAF A;  1B89 A;  2LXM A;  3FTS A;  1UFB A;  2H7V C;  3E32 A;  4DRH B;  2R7Q A;  4YT4 A;  1NI1 A;  5KNG A;  4E6H A;  4L2L A;  4YL0 A;  4XE0 A;  3NZU A;  3LNM B;  3RRN B;  3S7F A;  2VSN A;  3R7C A;  1D8E A;  1YVI A;  2BED A;  4TRQ A;  3DSS A;  1L7C A;  4DI3 A;  4G26 A;  2CHX A;  4GML A;  2HR2 A;  3VTY A;  3CVU A;  1T5O A;  4JEU A;  4GZ5 A;  2HJM A;  3HXC A;  2NPU A;  3EU9 A;  4YT8 A;  4B6I A;  3JZ0 A;  2GAQ A;  1A7V A;  4G8K A;  2OEW A;  3RKV A;  4TXQ A;  2Y3A A;  1JAF A;  5BV0 A;  1IHB A;  1Z6A A;  1HX8 A;  1ORS C;  1BU9 A;  3SZ7 A;  2EPL X;  3O10 A;  2RG8 A;  3SXY A;  5BQI A;  2L9J A;  1LE2 A;  1HO8 A;  4TV3 A;  1U0B B;  5CBO A;  3ULQ A;  1MHQ A;  5AQ7 A;  3CK8 A;  2AVP A;  3DAG A;  2J8W A;  3U8P A;  3AU4 A;  2ETS A;  1JCQ A;  3SF4 A;  4GPM A;  2Q7F A;  2LAI A;  2WM9 A;  1IYG A;  4C3D A;  2IU1 A;  1MMG A;  4AL1 A;  2F8Y A;  4PK4 A;  5KYX B;  5EN5 D;  4A2N B;  3AG4 E;  2MRI A;  4F1P A;  3B95 A;  2LCH A;  3FUI A;  3FAP B;  3ZYL A;  4IAQ A;  3RQE A;  1Q0K A;  3UMI A;  3LY9 A;  4F4B A;  4G1T A;  3TWX A;  5JHA A;  2JPU A;  4RD9 A;  1N4R A;  4IRU A;  1BBH A;  2F8X K;  2O9X A;  5ARF A;  3TK0 A;  3BEE A;  3A11 A;  3T5V A;  2DYS E;  5COF A;  3UKR G;  3V30 A;  1FVH A;  4FA6 A;  1LS1 A;  5HQ8 A;  3TQO A;  4WJ0 A;  3QAR A;  1I4Y A;  4BPM A;  3UKU G;  3EHR A;  2J9U A;  3RU0 A;  3EHM A;  4NY3 A;  1Y8M A;  4F53 A;  4O1P A;  3ZHE A;  4OAV B;  4EEC A;  4OD4 A;  3HNK A;  3B0P A;  1UOH A;  4Q69 A;  3L0I A;  2P58 C;  3AG3 E;  1V55 C;  1ZYR F;  4CX9 A;  3UMV A;  5FQ6 A;  5EIB E;  3AG2 E;  1EA8 A;  2VGX B;  1QQ3 A;  1A7D A;  1OCR C;  3EZI A;  4C48 B;  2XEV A;  2XSE A;  3QAQ A;  3ITF A;  3U66 A;  3G50 A;  4JC7 A;  2Y0B G;  2IOQ A;  5JJT A;  5JMN D;  5FQ4 A;  5ENP D;  4HVB A;  4HLE A;  1SZ9 A;  2A6E F;  3FDH A;  1TWH A;  3D9I A;  5BV1 A;  1PAQ A;  4F1S A;  3RO3 A;  4JHJ A;  1SVX A;  3IPM O;  2NUT A;  1ZHZ A;  4G78 A;  3Q6N A;  2H7O A;  2NSF A;  256B A;  4QQI A;  3FTU A;  5EID A;  3ZQV A;  5BT1 A;  1K1B A;  1TFK B;  4PJL A;  1Q0M A;  4RDA A;  1FMV A;  3DXJ F;  3ABL C;  1MQV A;  4EBJ A;  4R32 A;  2XL4 A;  2A1D D;  2ILR A;  1OCO E;  3B7S A;  4GEH A;  1J8M F;  3APC A;  2I8B A;  3RVY A;  1M6T A;  1M2V A;  1ELK A;  5LCW J;  2WVO A;  2YL0 A;  2WXP A;  1WGW A;  2IQC A;  4MVS A;  3BEH A;  2RFA A;  4U5B E;  5E3C A;  2WXJ A;  4H4K C;  4U5E E;  2Y1L E;  4I9C A;  2WXO A;  1DCE A;  2HV7 A;  2H6F A;  2M4E A;  4EUK B;  2IOL A;  1Z7Q c;  2DYS C;  3MFN A;  1LE4 A;  2Q9B A;  4FP7 A;  5EKQ D;  4MBG A;  2Y69 E;  3PZD A;  1WDY A;  1R5I D;  3FUE A;  1HFA A;  3NYJ A;  2MHK A;  1V74 B;  1K40 A;  2FUL A;  2YL1 A;  4DUI A;  3FH5 A;  4JZY A;  1A7E A;  2R7O A;  3C3O A;  2CYD A;  3UIO C;  3KYJ A;  3R7Q A;  2LSU A;  4KNW A;  5B3S C;  1VK5 A;  3CST A;  1OWP A;  4ULW A;  4XPY A;  3ZYK A;  3SNH A;  2J46 A;  3GEH A;  3RQF A;  2V3C C;  4KYO B;  3JYH A;  3AG1 C;  5K0I A;  2NSZ A;  1TNZ A;  1C02 A;  2EIK E;  2EIM E;  4EBA G;  3ZYQ A;  4EZL A;  5AQA A;  2XS1 A;  2AU5 A;  1DNP A;  3DZA A;  2WZG A;  2EIN C;  2L6H A;  1H9T A;  1RKE B;  1JCR A;  5LFA A;  1CGN A;  3FUF A;  5AAO A;  1WN0 A;  1DCQ A;  3LKU A;  3ABK E;  3Q78 A;  5CEA A;  3Q75 A;  3V2O A;  2RD0 A;  4I44 A;  3NYM A;  3J5P A;  1M57 C;  4C7O A;  2J49 A;  4IJJ A;  3LY7 A;  3SI5 A;  1MND A;  2YLG A;  2Y4T A;  2WXF A;  5HV9 A;  1IQR A;  3RQG A;  4XQ1 A;  4EBK A;  3ENE A;  3APD A;  2HS5 A;  5EX0 A;  4BTB A;  2WQH A;  3QMK A;  2XHE A;  1O1S A;  3U3B A;  2P9N G;  4XKB A;  4BSZ B;  2EQX A;  1IXV A;  4DRI B;  3NZS A;  3H2V A;  2GRP B;  4MVQ A;  1S63 A;  4JJF A;  3EGD A;  3RRM B;  3CIA A;  4APO A;  4N6C A;  3T4R A;  4CS9 A;  3FWV A;  3E70 C;  4JW1 A;  5HSW A;  2JAB A;  2J9V A;  5FZT A;  5DQT A;  4U9E A;  3E9V A;  5G04 C;  4WWO A;  3QNK A;  3W8I A;  1ORJ A;  1A5E A;  2C2L A;  3G2T A;  5HKP A;  3U2M A;  3TWV A;  1QSP A;  1Z6T A;  5LP0 A;  4HOS A;  1HMO A;  4DJ9 A;  3QJZ A;  2ETB A;  3ZU7 B;  4J8S A;  2YHE A;  3TOM A;  1V55 E;  3E4B A;  2ETA A;  2XCB A;  3LS8 A;  1HE1 A;  4ILI A;  3LCA A;  1S05 A;  2G3K A;  2AWC A;  4KC9 A;  4N2S A;  1O3U A;  3OTN A;  1OWO A;  1UN9 A;  4CYM D;  3ZQY A;  2B6C A;  3NKD A;  3TG5 A;  3Q47 B;  4D10 C;  4BJT A;  2LFF A;  3S7D A;  3APF A;  3CGH A;  1BI7 B;  2IBF A;  3MKQ B;  2AWY A;  3VM6 A;  3CVP A;  3U0C A;  4Q94 A;  4U8Y D;  3W9F A;  1P5Q A;  2UWJ G;  5CI9 A;  1VTM P;  2B0J A;  4JVS A;  2ZD9 A;  3UMK A;  1FNT c;  3WHN A;  4Q7C A;  3FTY A;  4CS8 C;  3E37 A;  4J8D A;  5B1B C;  2EIL E;  3GM3 A;  3ABL E;  1H2T C;  3MCX A;  1ZHW A;  1CGO A;  3EU5 A;  2OQM A;  4JJG A;  1LF8 A;  2J9B A;  4CT4 A;  3DJN B;  1NFO A;  3TOL A;  1Q0F A;  1W2W A;  3NDB B;  4WGY A;  2GRO B;  4GA1 A;  4N5C A;  3BG1 B;  3PZ1 A;  1OT8 A;  2DZN A;  2OVB A;  3AU5 A;  1SMY F;  4YND A;  1G8X A;  1N0Q A;  5L0D A;  4ATZ D;  2KGO A;  4PJN A;  3ONK A;  3SP1 A;  3LUT B;  3PH0 C;  2OKU A;  3CK7 A;  2WMO A;  3UTM A;  3JUE A;  3Q7L A;  1E7U A;  3MKQ A;  1Z3Y A;  3BG0 B;  4AY6 A;  4WWP A;  2PFD A;  3SXM A;  4GCN A;  2IXO A;  5C1D A;  1K05 A;  1ORY A;  3KSQ A;  1OWL A;  3B7B A;  3SXZ A;  5JHB A;  3D3M A;  3DST A;  3Q49 B;  2YL3 A;  3HXB A;  3KMI A;  3TXN A;  3C3Q A;  1TEZ A;  1L5J A;  2C0L A;  1V54 E;  2KW3 C;  4XEK A;  5BXO A;  4GTQ A;  2GWW A;  5FQ8 A;  3QWW A;  3E34 A;  4HFF B;  1VB5 A;  3PNT B;  2IJG X;  2UY1 B;  1ELR A;  5L0G A;  3MYF A;  4DVZ A;  3S9O A;  2VTB A;  2EIL C;  4DRJ B;  1Q0D A;  4WAB A;  3D9J A;  3AGT A;  5LOZ A;  1Q0G A;  4YDE A;  1HF8 A;  4NTA A;  5KYW B;  1OCZ C;  4U63 A;  1A17 A;  1A41 A;  3J5Q B;  2PX0 A;  4H54 A;  3EG9 B;  2YQ8 A;  4B94 A;  4XPW A;  1APC A;  4CGW A;  2UUI A;  1FT1 A;  3V5Y A;  1TNO A;  3X1O A;  1QKR A;  1U3C A;  1WG0 A;  5AIJ A;  2XPZ A;  2P9U G;  4XEV A;  4MVM A;  1DVP A;  5CHE E;  3UXG A;  1VLT A;  2ASR A;  1Z5S C;  3UM1 A;  3AS5 A;  3JQ1 A;  4AIF A;  5JRA A;  2XXA B;  3I4R B;  1LVK A;  5KJK A;  4C9B B;  3TWS A;  1RKE A;  4I1O B;  3POV A;  5T3T A;  2ICW G;  4FLB A;  3QZC A;  5F28 E;  3U3F A;  2VYI A;  1Z63 A;  3ASF A;  1TWC A;  2VSY A;  3C72 A;  5JJ7 A;  4FX5 A;  2I2O A;  1HZ4 A;  4CS9 C;  2H8A A;  3TJ5 A;  4XIF A;  1JWF A; 
#chains in the Genus database with same CATH homology
 3W2V A;  3QWP A;  3ASH A;  4GB9 A;  2GRM A;  3RKO F;  2W4B A;  3ZGQ A;  2W4M A;  2XQ0 A;  2WVQ A;  4MKT A;  3QOU A;  1E96 B;  3ONL A;  3QKY A;  3EHN A;  1ST6 A;  4FES A;  4ILH B;  4AX2 A;  4UQX A;  5CCL A;  4FAD A;  4I6J A;  5ARG A;  4BT8 A;  2KM4 A;  3B0V C;  1Z3X A;  3Q7G A;  3U3W A;  3HLZ A;  1J8Y F;  2YHS A;  1O87 A;  4HEA J;  2ZU6 B;  3KD7 A;  3RK6 A;  4HFK B;  3WG7 C;  3FU3 A;  5LCW C;  2HV6 A;  2AWI A;  4KXK B;  4Y6W A;  3MEK A;  4EZK A;  4XI9 A;  1FVF A;  1RJ9 A;  3FEY A;  5CCM A;  4CCA A;  1PC2 A;  3AS8 A;  3LXU X;  4JL0 A;  4CSA A;  4ANW A;  4AE4 B;  3IHV A;  4ZLD A;  1JWG A;  5CMY A;  2I9C A;  2XGS A;  1S7Z A;  4PDX A;  4YN0 B;  5KYN A;  2VGX A;  4BFR A;  3LPZ A;  4LUN U;  4UQY A;  2PZI A;  3L13 A;  4H7Y A;  4AV7 A;  3AQB A;  1FCH A;  1O5H A;  3VLE A;  2L9B A;  3ZEF A;  4WNF A;  3FUK A;  3PUK A;  4AOF A;  1OCO C;  1H6K A;  4PS8 A;  3UR3 C;  2OCC C;  5D91 A;  2WXI A;  4ILG A;  3CHM A;  5CMW A;  3D9O A;  4GZD A;  3LVR E;  2KQ9 A;  3JYS A;  4U5C E;  2WZF A;  3FTW A;  3GOD A;  4GU5 A;  1OWN A;  1FFT C;  2KZT B;  4I6E A;  3N71 A;  3CLJ A;  5E33 A;  3SBS A;  3FVY A;  2IOS A;  3ZN3 A;  3P2B A;  4GYO A;  2NUT B;  4PJM A;  3MA5 A;  5L3Q A;  3N24 A;  1QNF A;  3PNL B;  1VOM A;  3RYL A;  5G04 J;  2WXN A;  1JUQ A;  3ZVR A;  2PP4 A;  3CKC A;  4O6F A;  1W3B A;  2R7U A;  1UG3 A;  4YWQ A;  2A6H F;  2I6H A;  3VYW A;  4E85 A;  4KNV A;  2VB6 A;  4JHR A;  5E75 A;  2YNQ A;  5KYU A;  3QDN A;  5DBK A;  3G2U A;  4F3V A;  4YT5 A;  1X5B A;  3S7B A;  4BJ1 A;  1H19 A;  3D9L A;  2A68 F;  1IZM A;  3FAJ A;  1TJF A;  4XZ4 A;  2BF0 X;  1S0P A;  3S2A A;  3HVE A;  2J07 A;  2J9Q A;  3UPV A;  2DGJ A;  3ASG A;  2J7P D;  3K1H A;  4JUR I;  2L0I A;  4Q5S F;  1TR2 A;  4C3B A;  4JA9 A;  2R7S A;  1GW6 A;  4OIP F;  2KC7 A;  3UT4 A;  3PHF 2;  4RG9 A;  5T8I A;  1H0A A;  4LEU A;  3CHO A;  3ZIM A;  2W9Y A;  5KYW A;  5FZS A;  1H2V C;  1QZX A;  3ZHE B;  4G2V A;  4J32 B;  4OIN F;  5E2Q A;  4WAF A;  1N1C A;  5CI8 A;  4XLN F;  2P7V A;  1OUV A;  2Y3G A;  3AG2 C;  3HTK C;  2YHC A;  2WVN A;  4U0Z A;  4BJ6 C;  2FFH A;  3LAY A;  3IBE A;  4A1S A;  1JPL A;  1BR2 A;  2D5R B;  1VYK A;  2R7T A;  4L1B A;  4J0U A;  3AG3 C;  4FHK A;  1M2V B;  2QFC A;  2VGY A;  2L0T B;  4BTA A;  5AJD A;  4C0E A;  4DBR A;  3ZFW A;  5DQZ A;  1ZHT A;  3UT8 A;  4U07 A;  3GZ2 A;  1E8W A;  4IAO A;  2WB7 A;  4YJW A;  4EPZ A;  2V26 A;  2IXP A;  3FUN A;  3EGX A;  4I43 A;  2A5U A;  2CDQ A;  4HFG A;  3L34 A;  2PF4 E;  4GCO A;  1D1C A;  3CSK A;  4JHK A;  2Y3B A;  4Q4Z F;  4UI9 C;  3L16 A;  2CHW A;  5T3R A;  4ABN A;  3G2W A;  2C0M A;  5ENN A;  5T3W A;  3R7R A;  1KT0 A;  2WXQ A;  3D9P A;  4NUR A;  2JD3 A;  4CDM A;  2IF4 A;  3ESL A;  3G2V A;  5FCL A;  2V5F A;  3DBS A;  4KVM A;  1VYI A;  2IXM A;  5DS5 A;  3VAY A;  3DD7 A;  5J90 A;  3L17 A;  3RO2 A;  1XGW A;  5BUZ A;  4CGV A;  1NA3 A;  5A7D B;  2J7P A;  3K66 A;  3W2W A;  4KBL A;  4FUL A;  1D0Y A;  3CVY A;  4UWF A;  1QLE C;  4ACL A;  4XWJ A;  3S28 A;  3FTV A;  3RIB A;  4I2W A;  4HOT A;  3Q4A B;  1HE8 A;  1BR1 A;  4OIR F;  1OKK A;  4XLP F;  4LLE A;  4NAC A;  5ANR A;  2Z15 A;  1MMN A;  1SZA A;  2CW0 F;  4M63 A;  4O6N A;  3SNX A;  3UX4 A;  4L7T A;  3FUM A;  4AM9 A;  4NRH B;  2Q3T A;  1E7V A;  4G24 A;  3FFL A;  2R7V A;  2Y3D A;  4G7H F;  1Z3I X;  3ML9 A;  2J0W A;  3N2Z B;  4GA0 A;  4UI9 K;  4IN3 B;  2XRH A;  1N52 A;  3EZH A;  4P29 A;  4JPS A;  2X38 A;  4CDR A;  1Z23 A;  4U5D E;  1IW7 F;  5F5F A;  4OYS A;  4BX9 A;  4B0Z A;  2G62 A;  2AW6 A;  4PFP A;  4KZC A;  3Q15 A;  2VAS A;  5FZR A;  4DVY P;  3ESK A;  4HE8 D;  4KVO A;  5FJY A;  3KEZ A;  2AXU A;  5DLJ A;  4PS7 A;  3I5P A;  2J9W A;  1MNE A;  2CFZ A;  4BSX A;  1UW4 B;  3SD5 A;  2OV8 A;  4J8F A;  2X6J A;  4KI2 A;  4J30 B;  4GYT A;  1UN8 A;  3S27 A;  3JUI A;  3IHY A;  4DPR A;  2ZXP A;  3MGB A;  3CK9 A;  3FUD A;  4G25 A;  3UUX A;  5EGY A;  1EDU A;  3GW4 A;  3PUJ A;  2PX3 A;  5A23 A;  4FU3 A;  2VSX E;  4ANV A;  2WZL A;  2GGF A;  3EDT B;  5EDS A;  1NP7 A;  2V0P A;  3G2S A;  3O48 A;  1NU9 C;  3CVN A;  3LY8 A;  5BW8 C;  1QQE A;  3GYZ A;  4O6M A;  2OOE A;  4MQ9 F;  4DLO A;  3PMR A;  3I3N A;  4U0S A;  3TAX A;  5FT9 A;  4G23 A;  2JEK A;  3EPV A;  1D1A A;  5LX8 A;  3B7U X;  3VLF A;  4BY6 A;  5BUO A;  1ZHY A;  2OND A;  2M63 A;  3I4U A;  1V54 C;  4XI0 A;  2NXP A;  3L22 A;  1M56 C;  5KYY A;  2XGO A;  2LSV A;  4O7G A;  4M3O A;  3TJP A;  1VMA A;  3DJU B;  2R5S A;  4CBE A;  4GAA A;  4EBB A;  2R7X A;  2OVF A;  2E87 A;  3SYN A;  2W45 A;  4GYW A;  1OWM A;  2KZT A;  3JSZ A;  2R7W A;  2A69 F;  1E8X A;  2GFH A;  5AJL A;  2PM6 A;  4UQZ A;  3FP3 A;  4AVX A;  4PJJ A;  3KAE A;  3NKE A;  3VLD A;  4MLP A;  3P1U A;  4L23 A;  3OXF A;  3EGX B;  4N06 A;  5D92 A;  3LEW A;  4RG6 A;  2QY7 A;  4JXT A;  1PCX A;  1NU7 D;  2I1K A;  2ION A;  4FWV A;  2V8S E;  3PS6 A;  4JZA A;  1BR4 A;  3IKO B;  2XXA A;  3UQ3 A;  3LLI A;  3IEE A;  2KNH A;  4GMJ A;  2WXR A;  1UJJ A;  3GAN A;  4ME2 A;  4DLQ A;  1XNF A;  3C98 A;  4UWK A;  3S0X A;  3PEV B;  4MS6 A;  2J09 A;  4U5F E;  2PQN A;  3NYL A;  4ZLC A;  3FHE A;  3LES A;  1SQM A;  2J0X A;  3EGD B;  2KJG A;  2HO1 A;  3TXM A;  3RJV A;  2LSE A;  4DOZ A;  3FH8 A;  5EX3 A;  1WAO 1;  2DBA A;  1TKN A;  4BT9 A;  2WXK A;  2WXH A;  4N39 A;  1HS6 A;  2LAH A;  3CEQ A;  4K0D A;  4JEH A;  3EFO B;  1D1B A;  3FHD A;  2PQR A;  1HG2 A;  4U0U A;  1FTS A;  4YVO A;  3QC1 A;  1KLX A;  2OG2 A;  4GZ3 A;  3V7O A;  2NUP A;  3TGO A;  4I9E A;  3ZG1 A;  1ELW A;  3NF1 A;  2WQ6 A;  2QTV A;  3K6B A;  3ZPJ A;  4JA7 A;  2BE5 F;  4IWB A;  3FU6 A;  2J4B A;  4MND A;  1WY6 A;  4FJY A;  2WVI A;  4Y6C A;  3S7J A;  3FEX A;  2EIJ C;  2NG1 A;  1IHG A;  5DS4 A;  5G2N A;  4CSA C;  4NQ0 A;  4LRZ A;  3UGP A;  1EPU A;  4EZJ A;  4LLC A;  4QFV A;  4O79 A;  1PD1 A;  3UMH A;  4HOQ A;  3AQC A;  3CHR A;  4UWG A;  3FUL A;  5AYW D;  3URZ A;  3T5X A;  3MZL B;  3H65 A;  2UY1 A;  3QB2 A;  2WMN A;  4DJA A;  3DM5 A;  2ZXR A;  1EYH A;  3B7T A;  1HU3 A;  2CNW A;  3OWT A;  4W8K A;  4EWC A;  4C3E A;  4E7Z A;  4HOR A;  4BWR A;  3LS0 A;  5KYU B;  2PM7 A;  2JLB A;  2FI7 A;  3Q6M A;  4U04 A;  5G05 J;  5L3V A;  2XPI A;  4BJ5 A;  3DPD A;  4AJW A;  3ZIB A;  4AXH A;  2IFU A;  4IUL A;  4I6G A;  3TD7 A;  4U5G A;  5HI7 A;  4XTK A;  4DK5 A;  3LJ3 A;  4AE4 A;  4URK A;  4APF A;  2Y39 A;  4OIO F;  2L81 A;  2E0I A;  4WNE A;  4CS7 A;  3FU5 A;  2VTB B;  2G3V A;  4B89 A;  1NZN A;  3HVE B;  4I3M A;  1QZ2 A;  4EBA A;  3CR3 A;  2WB2 A;  3HDX A;  3I5Q A;  3DM9 B;  3FDQ A;  2NC9 A;  3RIP A;  4CRW A;  4WND A;  4HS2 A;  2V4L A;  1VDY A;  3SGH A;  3CKB A;  4UWL A;  2X6I A;  3MV2 B;  4DI4 A;  2BTD A;  1ZU2 A;  3JQ0 A;  3LDZ A;  2AXV A;  4H7X A;  4L2Y A;  1TWA A;  4I1A A;  1NZE A;  3EFO A;  2XRY A;  3CVQ A;  3CQZ A;  3EH2 A;  2YEV A;  2L6J A;  3IEG A;  3U9W A;  3OEO A;  1INZ A;  3O6X A;  2ZPA A;  2X6H A;  4R7L A;  2LO6 A;  3ZXS A;  2FF4 A;  4WNG A;  5BPP A;  4CIH A;  3GZ1 A;  4HXI A;  3CHS A;  4YT2 A;  5D0O D;  2VH3 A;  3T6J A;  4F7A A;  2WXL A;  3T6B A;  3CHP A;  2Y4U A;  2E2E A;  2FGY A;  3D9K A;  2IXN A;  1RJ9 B;  3EH1 A;  4B8A A;  3ASO C;  3D9M A;  4HOU A;  1E90 A;  4V3I A;  3RRU A;  1UJK A;  4BJ5 C;  3O4Z A;  3TL5 A;  3I4G A;  3LVQ E;  2DCP A;  3SFZ A;  3GZS A;  2AXZ A;  5KJM A;  4PFO A;  1WM5 A;  2BUG A;  4FC8 A;  3SEO A;  3MYV A;  1E8Z A;  4RBN A;  3RFY A;  4Q96 A;  4GZC A;  3MV3 B;  4XKC A;  4ATG A;  2VQ2 A;  4LER A;  2R59 A;  4GYY A;  1MMA A;  4OVU A;  2Q9C A;  3EJN A;  4MRU A;  3LJB A;  3NG1 A;  3MX3 A;  4GZ6 A;  3KL4 A;  4CS8 A;  4BJ6 A;  5FTP A;  1D0Z A;  3LYA A;  4BX8 A;  3U64 A;  1U3D A;  3WOD F;  2H7B A;  3CQC B;  5BNW A;  4YVQ C;  4N3A A;  5ANL A;  4B8C B;  1LKX A;  1NG1 A;  3ABK C;  3OA1 A;  2EIM C;  2EIK C;  2P6V A;  3JCU Q;  2C04 A;  5KCM A;  3ECS A;  4OVV A;  3PEU B;  3JRT A;  3ML8 A;  4BEJ A;  1BPO A;  3PRE A;  4WUY A;  3RH3 A;  4E7S A;  4PH4 B;  4ACK A;  3F46 A;  4RSY A;  5T4Y A;  2KCV A;  4WWN A;  4PUC A;  5FQ7 A;  4KZ0 A;  5DS6 A;  5AEN A;  4KBQ A;  4I2Z A;  2X6F A;  2LNI A;  3B9Q A;  4EQF A;  3PE3 A;  2ZXO A;  5A6C A;  2MWQ A;  2DIW A;  4K0R A;  2CG3 A;  2Y69 C;  4FLH A;  3QK0 A;  1FMW A;  3ZSU A;  1MQS A;  2NUP B;  2GRL A;  3L08 A;  3FU0 A;  4GPK A;  2XCC A;  3M1C B;  3PRZ A;  1IQU A;  4BG0 A;  5T1D B;  3PE4 A;  3ZVV A;  5FWQ A;  4CDN A;  3CSF A;  5KJN A;  4IYP A;  4K03 A;  2GW1 A;  3PDN A;  1NA0 A;  2X6K A;  4A1G A;  4U5H A;  4QDL A;  3PVL A;  3EG9 A;  3CV0 A;  1D0X A;  3EQL F;  3U4T A;  5IY5 C;  5J08 A;  3KKB A;  3QWV A;  2CGE A;  4AY5 A;  4N3B A;  3NRH A;  4CEM A;  4LCT A;  1M2O A;  3IV0 A;  3LEV A;  3ZC4 A;  2PL2 A;  3CQG B;  4RVB A;  3ZRH A;  4TUU A;  1OKK D;  2J45 A;  1TWG A;  3SBT B;  3ZW3 A;  4ANU A;  3S29 A;  4J6I A;  4I1M A;  5DVW A;  3R9A B;  4N3C A;  3KS2 A;  2IYL D;  3SZR A;  3L6A A;  1SZI A;  5KYY B;  1ZU4 A;  2FO7 A;  1ZHX A;  3LNR A;  3CZ6 A;  4G7Z F;  5G05 C;  1OCC C;  3B7R L;  3FTZ A;  3B13 A;  2QY9 A;  3CVX A;  3EIQ C;  3AG4 C;  3MLG A;  5KYX A;  3ASD A;  2X51 A;  2VSO E;  1FFH A;  3UNG C;  2MOW A;  4FHJ A;  3K1I C;  4K7B A;  2HYZ A;  5E76 A;  5KJL A;  3FH7 A;  4C0M A;  5B1A C;  4P6I C;  2A4Z A;  4ANX A;  3CHQ A;  1H2U A;  1ZBP A;  2Q9A A;  3N0T A;  1HXI A;  4LAC B;  2WPV A;  3FTX A;  3WXX A;  1PY1 A;  3ABM C;  1SF8 A;  3HIZ A;  1EF1 C;  2FBN A;  3TG4 A;  2YZS A;  3B0U X;  4UI9 J;  4A3T A;  1Y6I A;  2J4D A;  4W9R A;  3MJW A;  1MMD A;  3HJC A;  4ANJ A;  3O39 A;  2DYR C;  5F5H A;  3AS4 A;  3KH2 A;  4PS3 A;  2CFU A;  3FUH A;  3X2Q C;  1JPN A;  3CVV A;  4O6Y A;  2WL8 A;  2MYS A;  5E3A A;  3MKR A;  3CVW A;  3ASN C;  1KT1 A;  3F47 A;  3T8M A;  4A3V A;  1E8Y A;  3CVL A;  3OXG A;  2XRZ A;  3D9N A;  3OXL A;  3UT7 A;  4X0R A;  2KAT A;  4G0H A;  4FJZ A;  4CT0 A;  4I17 A;  5M72 A;  5EHH A;  2I1J A;  3K9I A;  2KCL A;  3EIJ A;  3DMD A;  4G11 A;  4QI0 A;  3ZYM A;  1Z5Z A;  4KT6 B;  3K33 A;  3SHF A;  4UWH A;  2CG2 A;  4AEZ C;  3UGO A;  4OD5 A;  4AK9 A;  4QI2 A;  3JT1 A;  2FEZ A;  5DIZ A;  2J08 A;  5JJ6 A;  4GA2 A;  2C03 A;  3W8H A;  2VJ8 A;  1JPJ A;  4KMO A;  1KU2 A;  5C2Y A;  1PD0 A;  4G7O F;  2Y3H A;  3L54 A;  2R17 C;  2WXM A;  3HHM A;  2CHZ A;  1HG5 A;  2KCK A;  2ZXW C;  2HM8 A;  2X3M A;  1TJC A;  2XPY A;  3OAW A;  3LS1 A;  1YA0 A;  4A55 A;  2R7R A;  2YIN A;  3NQP A;  3LLK A;  3JCK C;  4DBQ A;  4N2Q A;  5G55 A;  2WQ7 A;  4OIQ F;  4JC8 A;  3FUJ A;  4XX5 A;  5D0Q D;  1ZU5 A;  3VTX A;  3FY4 A;  2CNW D;  3HYM B;  1HH8 A;  1N54 A;  4J8E A;  3K7D A;  4C7O B;  4U8H A;  4AP2 A;  5FZQ A;  2WXG A;  3Q5M A;  4JCH A;  2XGM A;  1B89 A;  3DAF A;  3FTS A;  2H7V C;  4E6H A;  2R7Q A;  4YT4 A;  4L2L A;  4XE0 A;  3NZU A;  3RRN B;  3S7F A;  2VSN A;  4TRQ A;  4DI3 A;  4G26 A;  2CHX A;  4GML A;  2HR2 A;  3VTY A;  3CVU A;  4JEU A;  4GZ5 A;  4YT8 A;  4B6I A;  3RKV A;  2Y3A A;  5BV0 A;  1Z6A A;  1HX8 A;  3SZ7 A;  2RG8 A;  2L9J A;  1HO8 A;  4TV3 A;  3ULQ A;  1MHQ A;  3CK8 A;  2AVP A;  3DAG A;  3AU4 A;  3SF4 A;  2Q7F A;  2LAI A;  2WM9 A;  1IYG A;  4C3D A;  2IU1 A;  1MMG A;  4PK4 A;  5KYX B;  4A2N B;  2MRI A;  3FUI A;  3ZYL A;  3UMI A;  3LY9 A;  4F4B A;  4G1T A;  5JHA A;  4RD9 A;  4IRU A;  2O9X A;  5ARF A;  3BEE A;  3T5V A;  1FVH A;  4FA6 A;  1LS1 A;  5HQ8 A;  4WJ0 A;  3QAR A;  2J9U A;  3RU0 A;  3EHM A;  4NY3 A;  1Y8M A;  4F53 A;  3ZHE A;  4EEC A;  4OD4 A;  3B0P A;  4Q69 A;  3L0I A;  2P58 C;  1V55 C;  1ZYR F;  3UMV A;  5FQ6 A;  2VGX B;  1OCR C;  3EZI A;  2XEV A;  2XSE A;  3QAQ A;  3ITF A;  3U66 A;  5JJT A;  2IOQ A;  5FQ4 A;  4HVB A;  4HLE A;  1SZ9 A;  2A6E F;  3FDH A;  1TWH A;  3D9I A;  5BV1 A;  1PAQ A;  4F1S A;  3RO3 A;  4JHJ A;  2NUT A;  1ZHZ A;  3Q6N A;  2H7O A;  3FTU A;  5BT1 A;  4PJL A;  4RDA A;  1FMV A;  3DXJ F;  3ABL C;  2XL4 A;  2A1D D;  2ILR A;  3B7S A;  4GEH A;  1J8M F;  3APC A;  2I8B A;  1M2V A;  1ELK A;  5LCW J;  2WVO A;  2WXP A;  1WGW A;  2IQC A;  4U5B E;  5E3C A;  2WXJ A;  4H4K C;  4U5E E;  4I9C A;  2WXO A;  2HV7 A;  2M4E A;  2IOL A;  2DYS C;  2Q9B A;  4FP7 A;  5EKQ D;  3PZD A;  3FUE A;  1HFA A;  3NYJ A;  2MHK A;  2FUL A;  3FH5 A;  4JZY A;  2R7O A;  3R7Q A;  2LSU A;  4KNW A;  5B3S C;  1VK5 A;  3CST A;  1OWP A;  4ULW A;  3ZYK A;  3SNH A;  2J46 A;  2V3C C;  4KYO B;  3JYH A;  3AG1 C;  2NSZ A;  4EBA G;  4EZL A;  3ZYQ A;  1DNP A;  3DZA A;  2WZG A;  2EIN C;  5LFA A;  3FUF A;  3LKU A;  2RD0 A;  4I44 A;  3NYM A;  1M57 C;  4C7O A;  2J49 A;  4IJJ A;  3LY7 A;  3SI5 A;  1MND A;  2Y4T A;  2WXF A;  1IQR A;  3ENE A;  3APD A;  5EX0 A;  4BTB A;  2WQH A;  3QMK A;  2XHE A;  4XKB A;  2EQX A;  3NZS A;  4APO A;  4JJF A;  3EGD A;  3RRM B;  3CIA A;  3T4R A;  4CS9 A;  3FWV A;  3E70 C;  4JW1 A;  5HSW A;  2J9V A;  5DQT A;  3E9V A;  5G04 C;  4WWO A;  3QNK A;  3W8I A;  2C2L A;  3G2T A;  1Z6T A;  5LP0 A;  4HOS A;  3QJZ A;  4J8S A;  2YHE A;  3E4B A;  2XCB A;  3LS8 A;  4ILI A;  3LCA A;  2G3K A;  4KC9 A;  4N2S A;  3OTN A;  1OWO A;  1UN9 A;  3NKD A;  3TG5 A;  3Q47 B;  4D10 C;  4BJT A;  3S7D A;  3APF A;  3CGH A;  3MKQ B;  3CVP A;  4Q94 A;  1P5Q A;  2UWJ G;  5CI9 A;  2B0J A;  4JVS A;  3UMK A;  4Q7C A;  3FTY A;  4CS8 C;  4J8D A;  5B1B C;  1H2T C;  3MCX A;  1ZHW A;  4JJG A;  1LF8 A;  4CT4 A;  3DJN B;  1W2W A;  3NDB B;  4GA1 A;  4N5C A;  3BG1 B;  2OVB A;  3AU5 A;  1SMY F;  4YND A;  1G8X A;  2KGO A;  4PJN A;  3ONK A;  3SP1 A;  3PH0 C;  3CK7 A;  2WMO A;  3Q7L A;  1E7U A;  3MKQ A;  1Z3Y A;  3BG0 B;  4AY6 A;  4WWP A;  2PFD A;  4GCN A;  2IXO A;  5C1D A;  1OWL A;  5JHB A;  3D3M A;  3Q49 B;  3KMI A;  3TXN A;  1TEZ A;  1L5J A;  2C0L A;  2KW3 C;  5FQ8 A;  3QWW A;  4HFF B;  3PNT B;  2IJG X;  2UY1 B;  1ELR A;  4DVZ A;  2VTB A;  2EIL C;  3D9J A;  5LOZ A;  1HF8 A;  5KYW B;  1OCZ C;  4U63 A;  1A17 A;  2PX0 A;  2YQ8 A;  3EG9 B;  4B94 A;  4CGW A;  3X1O A;  1U3C A;  5AIJ A;  2XPZ A;  1DVP A;  5CHE E;  3AS5 A;  3JQ1 A;  4AIF A;  2XXA B;  3I4R B;  1LVK A;  5KJK A;  4C9B B;  4I1O B;  3POV A;  5T3T A;  4FLB A;  3QZC A;  2VYI A;  1Z63 A;  3ASF A;  1TWC A;  2VSY A;  5JJ7 A;  4FX5 A;  2I2O A;  4CS9 C;  1HZ4 A;  4XIF A;  1JWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...