4I1OB

Crystal structure of the legionella pneumophila gap domain of lepb in complex with rab1b bound to gdp and bef3
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
291
structure length
280
Chain Sequence
PLTLLMTSSTSFSETINQWADILKTMEKFDSNPINLLELVKQFNLYVDELAITCEANNVWASTPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCAAHADSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSFAEPNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport/hydrolase
molecule keywords Ras-related protein Rab-1B
publication title Mechanism of Rab1b deactivation by the Legionella pneumophila GAP LepB.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 280
sequence length 291
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
B PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4i1oB01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i1oB02
4I1MA 4IRUA 4I1OB 4JW1A 4JVSA
chains in the Genus database with same CATH superfamily
3JCKC 2LO6A 4YDEA 2L6JA 2YKZA 4E0IA 5A69A 2XCCA 3PZ4A 3CQCB 3B71A 3CEQA 3LKUA 5A7DB 3FY4A 2VH3A 1JWFA 4LCTA 1AEPA 2OEVA 4FC8A 4A63B 2G3VA 2WVNA 5COFA 1A7EA 1TQGA 3V2OA 3J5QB 4KNVA 4HORA 4LDRA 4DBQA 1M6TA 2DBAA 1OWLA 2Q9BA 4FJYA 3Q78A 3UXGA 2J08A 2R7VA 4DRXE 2WVQA 3U2MA 4JHJA 5KYWA 1OCRC 1I4YA 3LEOA 3Q7GA 3LEVA 5D91A 2Q9AA 1OXKA 4YL1A 2J4BA 2XS8A 3TULA 1L3PA 3RJVA 2XL8A 3CV0A 4G2VA 2OU6A 3NAWA 4JZAA 4F53A 4A1SA 3LUTB 5T3WA 3NOCD 4GYWA 1ZYRF 1VTMP 1P5QA 2LAIA 4N2QA 4AOFA 2LIGA 1TN8A 4AY6A 4BETA 3UMHA 5JLIA 3AG3C 4WWNA 3AU4A 3JYYA 4YT2A 5FZQA 1HX8A 3MCXA 5KJMA 4GTVA 4MVUA 1N4PA 2IEJA 2BUGA 1R5ID 2OQMA 4MW3A 2P9NG 4BERA 3C63A 4FX5A 4EZJA 3E32A 5HV9A 5JUAA 1OY3D 4HLEA 4I44A 2H8AA 2Y1LE 4TXRA 4JEAA 5ENQD 1INZA 3NDBB 2XENA 3ONLA 1BR4A 3EZHA 5B3IA 1MHQA 2GRLA 4M7CA 4TXPA 3ESKA 2ZXPA 4HEAJ 2CDQA 3UGPA 1EF1C 3OXLA 3BUAA 3UINC 4CBEA 1A7DA 3DZAA 2MYSA 3GZ1A 5EKQD 4DI4A 2PL2A 5JVEA 2XCBA 1OXJA 2DZNA 3TOLA 1CGOA 1E96B 2VB6A 2ZXOA 3RQEA 2YVKA 4AL1A 1XGWA 2XLOA 3KMIA 4LUNU 3R7RA 1A17A 3DAGA 4U5BE 1ZHZA 1KZPA 1TWGA 4E7SA 5KYUA 4AP2A 3UM0A 5BXOA 2PZIA 2I1KA 4J7TA 3CVQA 2XEHA 3EFOB 4OD4A 3EUVA 4C48B 1IYGA 3ML8A 2FEZA 4GEHA 4QDLA 3KD7A 4J32B 2P7VA 2DYRC 1ZU2A 3EHQA 4L9PA 1M2VA 1H7IA 3DJUB 4WAFA 1HE8A 1JAFA 1TN6A 5KYXB 2P9SG 3UMKA 3RK6A 1E8YA 1S05A 4DJ9A 5E3CA 3TD7A 2DVWA 1UG7A 4JJGA 4W8KA 4U7EB 2KM4A 4YK5A 4CYMD 3L1MA 3CK7A 1NI1A 2D5RB 4NTBA 3ZYMA 3RVZA 3SFZA 5EDSA 3ASGA 1ZW2A 1K04A 3ABMC 2XLDA 2QE9A 3EG9A 2G3KA 2R03A 2CYDA 1MMNA 4UWKA 1BR2A 3N71A 2DB4A 3AGTA 2X6HA 2NSFA 3HRAA 1M2VB 5DS4A 1AP7A 4YJWA 3NMKA 2V8SE 3S90A 2LXLA 5EHHA 1BI7B 3S84A 3DSVA 2WQ7A 4JA9A 5KJLA 5F28E 4GMJA 2DI3A 5FQ6A 1VB5A 4UDVA 1LS4A 4JEHA 1TWHA 4WWPA 4HOSA 2UUHA 1QLEC 1HS6A 4F1SA 3L8JA 1QZXA 4U5GA 4WGZA 4DBRA 4Q4ZF 1IW7F 1OCRE 3ZUVB 5EN5D 1EDUA 4O1OA 4I3MA 1GM5A 3N0TA 2A1DD 3EU9A 1Z23A 3IQ6A 3MYFA 3CVNA 1Z3IX 3HLZA 4ONSA 2F8XK 1FR0A 1JCSA 1Q0GA 2P2CP 3ASFA 4RBNA 2KATA 4BTBA 3I4RB 2CFUA 2QC9A 3ML9A 2QY7A 2VJ8A 5JJ6A 4AXHA 3UUXA 4R32A 4MVOA 4YT8A 2V3CC 1E7UA 2F22A 2Q7RA 3DEOA 1GW6A 1OKKA 2HMZA 2YHCA 4ZHBA 5BUOA 2XL4A 3B9QA 3ZIBA 2H7BA 2AXVA 3LPZA 3GODA 1NSGB 3S7BA 3LCAA 3ATPA 4FESA 4YL3A 3C5RA 3FTXA 4KBLA 1UFBA 2NUTB 4CJGA 3G50A 1TFKB 2XZDG 3M79A 3H65A 4L23A 3EDTB 1FFHA 2RD9A 1N4QA 2J0WA 3DI5A 2WVIA 1N52A 4C3EA 4DX7D 1V54C 2IXNA 1RJ9B 2R25A 1IKND 1NBBA 1ORSC 2LQGA 4J0UA 1QBQA 4XQ1A 4CS8A 5KYYB 3SXYA 3SXMA 2YLGA 3MKQB 3BRJA 3PZ3A 3L9TA 3W9FA 3CSFA 3FH8A 3C98A 2M64A 1MMAA 3E4BA 1TNOA 3S0XA 4LRZA 3K6BA 4MVMA 4PK4A 5B3SC 4I6GA 3T6JA 5AIJA 1E84A 1WGWA 4ME2A 1CGNA 2GRRB 3CQGB 3SXKA 2VTBB 2BKGA 2F37A 4CS9A 3LNMB 1LD7A 4WUYA 1KZOA 2A4ZA 2CG2A 5JJ7A 4EKWA 1O3UA 1CGME 1FNTc 2JABA 3L0IA 3O39A 4UWHA 2EQXA 3FUKA 3BU8A 2RG8A 3ZXSA 3FTUA 1TR4A 1U3CA 4HB5A 4J7WA 2Z15A 3C72A 4P9FA 2ZIRA 1EYHA 4JHRA 5ANRA 3K1HA 2OCCE 4UI9K 3PVLA 3PE3A 3C8GB 1Y6DA 4ER9A 1ELRA 4ACKA 4ZFHA 3A9CA 1RZ4A 3AS5A 2EIJC 3BEEA 3X1OA 3J06A 4B8CB 3RW0A 2GRNB 4JRZA 4BEPA 3HTKC 4GZDA 5B1AC 1XWJA 1T5OA 2IF4A 2A68F 2L9BA 3DRAA 1E2XA 3MGBA 4G0HA 3RO3A 1T01A 4NTAA 2WXFA 4RG6A 4ANJA 2H6IA 3PUKA 3QK0A 3U9WA 4CS7A 4XTKA 3JCUQ 2XPZA 1D0YA 5AQAA 1VMAA 1OWPA 2ZXWC 4CS8C 2P9KG 4GCNA 5ENOD 4MVQA 4ATZD 3TWVA 1NFNA 5IY5E 3QNKA 3T8MA 1Z5ZA 4DVZA 4G1TA 5FINA 1D8EA 3MBGA 4XI9A 3CHMA 3QKYA 4NTFA 3JYHA 2Y0BG 4BWRA 4Z9JA 4AIFA 4OAVB 1TKNA 2HKVA 2WXHA 2CCYA 1OCZC 1QKRA 3AG2C 3T9OA 4CS9C 1JOGA 3FUIA 2IXPA 3W2WA 3K7DA 4G7OF 1NA3A 2HJ3A 2P61A 3FUHA 3LY8A 2J9VA 4U8YD 2D4UA 3LS8A 2X6KA 2WMOA 5ANLA 3RAUA 4XKCA 2LK4A 4DX6D 4PH4B 3FOOA 2MHKA 4UI9J 4GYYA 2WXRA 4B8AA 4I43A 2J9UA 3AGUA 1NFOA 1YARO 3NKDA 4GZ6A 1SW6A 1YZCA 2R05A 4Q7CA 3CKBA 2R7UA 4L6RA 2L0TB 2ICWG 3DM5A 2I15A 1O1RA 5T1DB 4BJ6A 2IXOA 3ENEA 1VLSA 1FFTC 3SBSA 2WZFA 2H6GA 3PE4A 2A0UA 4ABNA 2R9RB 3DSSA 1TEZA 4LLEA 3B7UX 3ASOE 1MMDA 4MS6A 1ELWA 2XLEA 1HE1A 5COGA 3U9MA 4HLLA 1TFOB 3HVEA 3TWWA 2ETSA 4YT5A 1IXVA 3D9JA 1ZU5A 2ASRA 3OAWA 1TJFA 4APOA 2FO1E 3EPVA 4E17A 3E9VA 2Q00A 3DXJF 5A6CA 3WXXA 4PJNA 2XXAB 3G2TA 4C0MA 1HXIA 4DI3A 2ETAA 2H6HA 1MX2A 2XPIA 1DCQA 2I1JA 3LVRE 4FHKA 2GA0A 2B6CA 1IQRA 3CVVA 1KLXA 3E34A 2L0IA 2G62A 3IHVA 3EGDA 4K5AB 5DQZA 2Y3AA 3DM9B 2XM4A 1YMPA 4G8LA 3HVEB 5ENTD 3F46A 3EJNA 3APDA 4BSZB 2IOLA 5EX0A 3HXFA 2CNWD 4LNUD 1WTYA 4L2YA 5AN8A 4HI9A 2O9XA 4IAQA 3H2VA 1GQAA 1Y4CA 2JPUA 3UPVA 2PM6A 1YLMA 2W4MA 5D92A 2FULA 1G4WR 3I4GA 4C7OA 2NYJA 1FMWA 5B1AE 4G11A 4CDYA 3TJ6A 3S7FA 1Z6AA 1U0BB 3PMRA 4I6EA 4DK5A 2FF4A 5FQ8A 4GAAA 4I1AA 2BEDA 2KZTA 4N4WA 1Z3YA 2VGXB 2YNQA 3B7TA 3RSEG 4AM9A 2H7OA 4APFA 3L82A 4JTCB 2EILE 4BJ6C 1E85A 5AJDA 2HV6A 4P6IC 5CMWA 4OINF 1M2OA 4E0HA 3QWVA 5L0CA 3FTZA 4M63A 2FI7A 3TGOA 2AVPA 2OJED 3FAJA 3UX4A 3G4XA 2IBFA 3CHPA 4NURA 1ORYA 1ZHWA 2J7PA 3JQ0A 3T6GB 4C7OB 1GS9A 2XRYA 5ENSD 5FZSA 5EYLA 3DJNB 4CGWA 3WG7E 4IRUA 5ENNA 3ZSUA 1OCZE 3R9AB 1LE2A 2OEWA 3AG2E 3OA1A 3FUNA 5KJNA 2PBEA 1T6QA 1TN7A 2CHWA 4I9EA 5ARGA 2R7XA 2YL7A 1TJCA 4HOUA 1Z7Qc 3SYNA 3NYMA 2A5EA 2WM9A 2RFMA 4F7AA 4IARA 4HOQA 2WXNA 2IO3C 3DMDA 3CHQA 4G7ZF 3KYIA 2CNWA 4G25A 5H7PA 1MJ0A 2YQYA 3G4ZA 3LS0A 3V30A 4Q94A 2KBXA 1HMDA 2Y69C 2YL1A 3AQBA 4H7XA 5LCWC 3Q9NC 4HRNA 1NZEA 4L2LA 4WNDA 1BU9A 4YVOA 3QJZA 2OOEA 1LE4A 3B29A 3W4YA 3BG0B 2C0MA 1NG1A 4ILHB 4KMOA 3FVYA 3D9IA 2J8SD 1Q0FA 5AC5A 5DVWA 5AJLA 4G7HF 2MWQA 3DWWA 4FA6A 3PEVB 3V5XA 3D3MA 4J8EA 3EU5A 2IFUA 3LJ3A 3CIAA 4TV3A 3LYAA 2ZXRA 2KK1A 4U0SA 2W4BA 2GDCA 3AAAC 4WNGA 1MNDA 4EECA 3GM2A 3ISMC 1OW6A 5FJYA 4UWLA 3J5PA 1RW2A 5LFAA 4EIYA 1OR2A 3T8KA 2E0IA 4CT4A 4IJJA 3M1CB 2WXOA 1TNYA 3D9KA 2UWJG 2XGMA 3E70C 5L0DA 1LPEA 4U04A 2L81A 4RQIA 2X6JA 4RG9A 3WODF 4HI8A 4JL0A 1BDJB 3AOUA 4BX9A 3TL5A 5EGYA 1SQMA 2QZAA 2AW6A 2XPYA 2LNIA 1OWNA 1BBHA 4JTDB 3EGXA 5ENPD 2AXZA 3LVQE 3ZHEA 3FWVA 2AP3A 3CK8A 4RDAA 1RMVA 3BEHA 4WNEA 4MTFA 1L7CA 4JEUA 2GROB 4U0ZA 5KYWB 1U89A 5LP0A 1PD0A 3D9LA 4JVSA 3DEPA 3UIPC 1HO8A 3SGHA 4GZ3A 2EPMX 3ZQVA 3FFLA 5JMND 2FGYA 4O6NA 4ACLA 2NC9A 2C0LA 5JJTA 4BJTA 1W3BA 3NF1A 5AARA 4YL0A 3H2UA 1Z3XA 3FEYA 4ILGA 1EA8A 1E83A 4O79A 3CKCA 3AG1E 5ENRD 4J8SA 4K5CA 5AQ9A 3V7OA 3TXMA 3DXMG 2I8BA 2WZLA 2AXUA 5FT9A 1F1MA 1QPUA 2Y39A 4U96D 4EBKA 4K03A 5A23A 1G3NB 2J0XA 4JEBA 3HXDA 3LY7A 3APCA 3IQTA 5M72A 4LG6A 4WGYA 1N9AA 4C9BB 4A1GA 2J45A 3GWLA 3ASNE 4U07A 4BPMA 2OEXA 1YA0A 3JSZA 2FAPB 3SZ7A 4EPZA 1H9TA 1K3ZD 3R7QA 3O48A 5JS5A 1U6HA 3AJIA 2Y69E 4AJWA 3JUIA 1DOWA 3TG5A 3L6AA 3NG1A 2DCPA 4GTTA 4LACB 3UGOA 2LSEA 2OCCC 1PD1A 3ZVRA 1HW2A 3SHFA 4HRLA 4J30B 2HJMA 2I6HA 5KYUB 4BG0A 1G4US 1RKCA 4DUIA 3PH0C 4OVUA 3ZTMA 4U5EE 3KKBA 5HI7A 2NXPA 4JA7A 4BY6A 4JC8A 5E75A 5EIBE 3UMIA 1N4RA 5TJ5E 4UWGA 5FZTA 1LM3B 4DX5D 3ZIMA 2NUPA 1UG3A 4QI0A 3QW0A 1OR3A 4H7YA 5CRUA 3VF0A 1SZIA 2WL8A 3CHSA 2P9UG 4FULA 4G24A 3U8VA 1KNYA 3V2XA 4CRWA 1ZHYA 5IY5C 1TNBA 1MQVA 1AVOB 3IHUA 3U3FA 3EG9B 3U4TA 4MRUA 5BV0A 4YVQC 3L34A 4O1PA 3PREA 4J6IA 4LDKA 4I2WA 3FUMA 3LAYA 4N3BA 4IULA 4URKA 4CIHA 5AGFA 2R5SA 2EPNA 3O6XA 4U5FE 4XEFA 4PS8A 3O10A 3EIQC 3RO2A 2NG1A 3HNJA 1Q0MA 3QARA 1C03A 4JJFA 2BTDA 3SQVA 1YJGA 2NUPB 2L6GA 3PDNA 4HE8D 1NU7D 2YLIA 3TWQA 4A2NB 4QFVA 2HE0A 4CDVA 3P1UA 5B1BC 4AX2A 3DSXA 4YWQA 3CVPA 5ITZF 3JZ0A 2LAHA 2WXKA 3FU3A 1IZMA 2IONA 3PUJA 3TG4A 1RXQA 4KC9A 3C62A 4PJLA 2CW0F 4GCOA 4EBAA 4AL0A 1H9GA 4GMLA 4GTPA 4BEMJ 1AWCB 2R02A 2XGOA 4CSAC 4TXQA 3SNXA 5A6BD 2VCCA 1ELKA 3FUJA 4G26A 3I4UA 2XZTG 4MVSA 3OTNA 2M4EA 1V4AA 1UN9A 5D2MC 2LP4A 3VTYA 2E87A 3AG4C 1MYOA 2QFCA 4TUUA 4XIFA 3SP1A 4NQFA 2CHZA 4MVRA 1IHGA 5T3RA 2KNHA 3PDMP 1NP7A 3ASOC 1EQ1A 2WXMA 3RRUA 4KBQA 3KS2A 1QVXA 5F5HA 4OIOF 3HXBA 3S2AA 3CSTA 3EHNA 2ZD9A 3GORA 3RF3A 4UQZA 3U66A 3L8IA 1QYMA 2XRHA 3SBTB 1NU9C 3QVZA 3UMVA 1T9KA 3KEAA 1NLXA 3EH2A 3PCVA 3CQZA 1VLTA 3ZU7B 5C2YA 2YHEA 5AAOA 4CGVA 4W8PA 5DS6A 1D8DA 4YDWA 4FWVA 3DE9A 4NQ0A 4EBAG 4GQHA 1H2UA 3U0CA 2DYSC 3SNHA 5LX8A 1S70B 3MA5A 4D4XA 2PP4A 1TYQG 4GYOA 3GANA 3DAFA 2UY1A 2IQCA 1DVPA 3JT1A 1MZCA 4TUMA 5HSWA 3HXEA 4LERA 2AWIA 3R7CA 3Q5MA 3S7JA 5D0QD 3G2VA 3U3BA 5L0HA 1DNPA 3U5SA 4PUCA 2DWZA 4A3VA 3L54A 2JEKA 2QNLA 4KYOB 1JPLA 2XRZA 2CHXA 3IEEA 2EILC 4FP7A 5L3VA 1XZPA 4KNWA 4TRQA 1I5NA 4GPMA 3DWLG 2PM7A 3CZ6A 5JHAA 2CFZA 3NRHA 2ZPAA 2ZGGA 3I5PA 5F5FA 5G04C 2AWYA 4G78A 1WASA 1E90A 1DC2A 4MTOA 3N24A 3B95A 3X2QC 3RVYA 1RCPA 4JB8P 4RVBA 4EHPA 4E18A 2R7TA 1G5ZA 1TNZA 3WG7C 2CGEA 5A6KA 4DPRA 5FWQA 3RIBA 4Q69A 1FT1A 4K7BA 4EZKA 3LEWA 1BI8B 2PX3A 2BC5A 1HZ4A 4HFKB 2V4HC 2VQ2A 5BPPA 1HH8A 3U2LA 4JZYA 2PQRA 4DJAA 1EI7A 2XS1A 2J4DA 2NSGA 3DPYA 4RSYA 3HG0D 5B1BE 3LNRA 2Y3GA 2MRIA 2R7OA 4N6HA 4CDRA 4FAPB 3ULYA 3SF4A 4E7ZA 3S9OA 1D1AA 5CCMA 3KSQA 2VSNA 3UNGC 2EPOA 4AY5A 4CDNA 5EILA 1FPPA 4UWFA 1SZAA 4LNBA 3A11A 1FMVA 3TQOA 3D9HA 1LKXA 3UT4A 2ZGDA 2KC3A 3CR3A 3FTWA 3HHMA 5CHEE 2Y3HA 4KZ0A 3EIJA 4J8YA 2RSEB 5HRYA 4IGGA 3AG4E 1BPOA 4PACA 1J8MF 1YA9A 1JUQA 5G04J 5JP7A 3NBNB 5D66A 2HO1A 4EHMA 2LSVA 1NL4A 3MYVA 3NZUA 2VCBA 3FH7A 3QAQA 1YZAA 3GEEA 4R7LA 1G8XA 3E30A 1GGQA 1PV3A 3K33A 1VDYA 2EPKX 1A41A 3DSUA 2WMNA 1VOMA 5KBAA 3R2PA 2V26A 5AC4A 1OXBA 2OOCA 5EYPF 1YYHA 3T5XA 2PNOA 4E85A 3MLGA 1C17M 2P0NA 3TAXA 4AEZC 1HY5A 4O60A 5KWDA 5KJKA 2F8YA 3V5ZA 3ONKA 3ABLE 2KW3C 2OKUA 4MW8A 4IN3B 1ST6A 2DYSE 1V55E 2RD0A 3NOGD 4B89A 1N0QA 4EBJA 4AK9A 4N5CA 4QQIA 3B7RL 4ILIA 4XLPF 3GM1A 2J07A 1WG0A 2KGOA 2L9JA 4FHJA 1HE9A 1B89A 3Q6NA 4G23A 4P29A 3CK9A 4XKBA 3VLDA 2B0HA 2V4LA 1YYXA 3DSTA 3TWRA 1AUEA 5BT1A 3T5VA 2HMQA 3R9MA 4BFRA 3FU6A 4I1OB 4U8HA 3EGDB 3T4RA 4DRIB 1LI7A 2YEVA 5AQ7A 2R7RA 1N1CA 4K0DA 1OW8A 1A0BA 4X0RA 4JC7A 2Q3TA 3ZFWA 3AU5A 2YLDA 3DE8A 3B7SA 1EKYA 3P2BA 2PX0A 2LUHA 1OCOC 1N0RA 3AS4A 3QTHA 3JYSA 2I2OA 3UT7A 4EQFA 4HFGA 3X2QE 4O6FA 3ZC4A 2M63A 4YN0B 2LCHA 1QQ3A 2IOQA 1N94A 3AG1C 1XNFA 4ULWA 3I3NA 4MKTA 3K66A 1DOVA 2HM8A 3PZ1A 4K0RA 2KZTB 3ZPJA 2J9QA 3HNIA 3VM6A 2LFDA 4HNAD 1U3DA 4U5DE 1H6KA 3U3WA 5CIVA 5CEDB 4XEIG 2KJGA 1FVHA 2A6HF 3V5YA 5K0IA 3MV3B 2AJAA 5DIZA 3W2VA 2L7AA 2LFFA 1APCA 3G2SA 4KVOA 3GEIA 3CVLA 2ZISA 2WZGA 3SFYA 4XX5A 3ZRHA 2A5UA 1T6IA 3B0VC 3JUEA 4CDAA 3KEZA 3ASNC 3MZLB 2V5QC 4GTSA 1Q0KA 2X6FA 3QDNA 2KXPC 3LJNA 4N39A 1ZZPA 1WDYA 3POVA 1KT1A 2OV8A 1NZNA 2EIKC 4XI0A 2IYLD 3RIPA 4DX1A 4YDOA 3HKKA 2YQ8A 3PRZA 3F47A 1MNEA 3LESA 2WQHA 2VYIA 4DLQA 3KSLA 4OYSA 5BW8C 4MBGA 4C0EA 4Q5SF 1LI5A 1E86A 3FEXA 4B6IA 3W8IA 1H0AA 5BUZA 1ZBPA 3ZQYA 3ASHA 4KZCA 1ZU4A 2H6FA 4UUCA 3AQCA 5EK0A 2WXPA 4XEVA 1MQSA 2QLAA 2X6IA 4I9CA 5A6JA 4B0ZA 1OQCA 4UQYA 3MYIA 1BR1A 3B7BA 1H2VC 3TWXA 2WXLA 5EIDA 5G05C 2KSFA 3CSKA 3M15A 1A7VA 1QSPA 256BA 3UM2A 2JD3A 4G8KA 4U95D 3IHYA 3D9PA 3K1IC 5FQ4A 5CMYA 5COMA 3DKAA 5HKPA 2GAQA 4FLBA 5C1DA 3RQFA 2KYHA 2AVKA 1SMYF 5CBNA 2R7WA 3IBEA 3NKEA 4C3DA 3KH2A 2YL0A 4JIOA 2EIME 2OVBA 2HS5A 1FCHA 3FHEA 5CBOA 4DRJB 2H7VC 2WPVA 4LSZE 1TR2A 2BKKB 3DBSA 3JRTA 3B0UX 2R59A 2VGEA 1YA7O 2YRFA 3PNTB 4M3OA 4YDYA 5G2NA 3FXHA 3FU0A 2GRPB 2P58C 3QB2A 4HQDA 5LCWJ 4EWCA 3M4BA 1S7ZA 4DOZA 1SA4A 4I17A 3ZYKA 2J8WA 2X0CA 4BJ1A 3JXJA 5G55A 1YDIA 4JTAB 4GU5A 2IO2C 2MHRA 3ABKC 4E6HA 3S28A 5L0GA 4Z9HA 4OD5A 4HOTA 3NB2A 3MX3A 2GW1A 2HYZA 3RRMB 4DRHB 2XQ0A 2XM0A 5LOZA 5L0FA 3ITFA 3T6BA 2QYUA 3EHRA 1LS1A 4ANXA 4AE4A 4CJOA 2EPLX 3FTYA 5JHBA 2R7QA 4JXTA 5JSLA 2L6BA 1M56C 1OCOE 3PS6A 3SI5A 3KPHA 5DS5A 3U64A 3UKUG 2FBNA 2XLVA 1JPNA 2ILRA 5G05J 3MKRA 1JMWA 3AS8A 3LDZA 2AU5A 2QYJA 2XEEA 3EGXB 4MNDA 3GZSA 2HV7A 1FT2A 3RRNB 3K9IA 4PFPA 4N5QA 3TJ5A 4NRHB 3ZHEB 5A6AA 2MOWA 4GA0A 2ETBA 3PNLB 2I9CA 3IEGA 1H6GA 4XPXA 3URZA 4BSXA 5GPGB 3HDXA 4JD2G 1WOLA 4HRMB 3EFOA 4PDXA 4AE4B 1SZ9A 1U2VG 3ZDLA 4ATGA 3ZXPA 2YL3A 4KT6B 2OG2A 5KNHD 1SF8A 2BE5F 3O55A 3RYLA 1O1TA 3Q6MA 4O6YA 5T8IA 5KYXA 3MV2B 1C02A 3LS1A 3T9KA 3VLFA 2ZU6B 2WXGA 1FVFA 4XEKA 2J9WA 1OT8A 2PNNA 3ZEFA 4LDQA 5BNWA 4GZCA 2EIKE 1QZ2A 3MEKA 2DGJA 2KCVA 3NMIA 5J08A 2P6VA 2V0PA 2NSZA 3KL4A 4BT9A 2W45A 3Q7LA 3V31A 2HFIA 2C2LA 3US6A 4CSAA 1LTXA 4GYTA 4GA1A 4OVVA 4EZLA 1JPJA 3QOUA 3ZYLA 2J49A 1SVXA 3UQ3A 1O87A 2WXQA 4OAUC 1OKKD 2DIWA 4ULVA 3D9NA 4DXWA 3L22A 2YINA 3AJMA 4K1OA 2LSUA 3PZ2A 3FUFA 2Y3DA 3L17A 1LF8A 4F4BA 4BJ5A 4H54A 1KU2A 3KYJA 4U8VD 4IWBA 1JCQA 4GTRA 3ZYQA 4PFOA 4ZLDA 3QC1A 5JT4A 1ZW3A 2GFHA 1K8KG 3IV0A 2P9LG 1LIHA 3B13A 2WB2A 1TWCA 3ZTZA 5CCLA 4F3VA 1X5BA 4GTOA 4GTQA 2B0OE 1YCSB 2KQ9A 5CI9A 3G2UA 3S29A 1D9SA 2Q9CA 4BX8A 2OVFA 5CECB 1V74B 1HW1A 2J09A 3DSWA 1TWAA 2XHEA 3OXFA 3ZKJA 1E8WA 3ESLA 3VTXA 1Q2ZA 1ZB1A 3C7JA 4F1PA 2CG3A 3SD5A 5E76A 4Y6WA 3DPDA 3EHMA 2DZOA 4PJMA 2BL2A 4DLOA 1N95A 2R17C 4DX2A 3EQLF 4WWOA 3C8ZA 3C8GD 4PS7A 5J90A 3Q9UC 1VK5A 1X81A 2LXMA 4CCAA 4IAOA 1YYJA 4O6MA 5FQ7A 3ABKE 1HMOA 2NUTA 3RH3A 5T3TA 5BQIA 3I5QA 2OJQA 3CVYA 1D1CA 2XLMA 2GGFA 1ZVZA 3ASDA 3Q7AA 4ANWA 3TJPA 2VSXE 2XGSA 2KCKA 3C3OA 3LJBA 3Q7FA 1RJ9A 3Q73A 3ULQA 2VSYA 3Q49B 3OWTA 5EX3A 3TK0A 4BEJA 3F6QA 4CT0A 3L16A 1WM5A 2B0JA 3S7DA 1RKEA 3AG3E 2Y3BA 5E33A 5KYYA 2IJGX 2X51A 3MKQA 2RFAA 3IXEA 3N2ZB 4CEMA 1OWMA 4JKVA 4I2ZA 5BXUA 4GA2A 1ORJA 4JHKA 2XSEA 4BJ5C 2IXMA 4QI2A 4FU3A 4NC3A 4L7TA 3VYWA 1H6PA 5KCMA 2V5FA 1JWGA 2VTBA 4N3CA 4H4KC 3C3QA 4L1BA 4CDMA 1QNFA 3Q4AB 2R2LA 4Q96A 1N54A 2WXJA 1RKEB 4JW1A 1IHBA 3QWPA 3LLKA 3JQ1A 2Q4FA 2P9IG 3VRCA 1CPQA 4D10C 4U5CE 3QZCA 2WQ6A 5DLJA 3QW1A 2Q7FA 1MX4A 3ABLC 1JCRA 1K05A 1V55C 3SEOA 3HXCA 3GM3A 3OXGA 4BT8A 3FDHA 3C8GA 2HR2A 2WVOA 4U9DA 3HNKA 1FTSA 1K1BA 4CX9A 3D9MA 3TOMA 1WATA 1JR8A 1LVKA 3UR3C 3VAYA 4A55A 1IQUA 2DYRE 3UM3A 1OW7A 5DBKA 5BQGA 1XZQA 2GRQB 1T6UA 3U9JA 1K1AA 2XEVA 3CEXA 5A6BA 3OEOA 3PZDA 4GZ5A 2J46A 5D0OD 4IYPA 5FZRA 4N2SA 1VYKA 2YWAA 4EBBA 4YNDA 3NYJA 3BQOA 2AWCA 2PF4E 4U9EA 4WABA 2VGYA 5L0IA 3UT8A 3EH1A 3Q79A 3ABME 1WAO1 1BD8A 2UY1B 2ETCA 4UI9C 2Y4UA 1ZHXA 1YVIA 4HBDA 3CVXA 3ZGQA 2QY9A 3TWTA 4OIQF 1B68A 3U8PA 4U0UA 3MJWA 4A3TA 4XPYA 5AQBA 4XLNF 3FOPA 4X8QA 1OWOA 3SY2A 4Z9IA 5L0JA 3APFA 2WB7A 2A69F 4GB9A 2VSOE 2LD6A 1M57C 4WNFA 1MX6A 2E2EA 3QWWA 3IQ5A 1D0ZA 4MQ9F 3CHOA 4O7GA 3GZ2A 4Y6CA 2WXIA 3PHF2 3JSEO 1KPSB 4C3BA 5AYWD 4ANUA 4XWJA 2IM8A 3ZWIA 3GW4A 5KYNA 3UI2A 2TMVP 3RQGA 4YT4A 4XE0A 4XZ4A 3UTMA 3ECSA 5DQTA 3IQCA 4LEUA 4OIRF 3CAXA 1Z6TA 3ZN3A 1NA0A 1BZ4A 2A6EF 3WAQA 1UJKA 4HFFB 3MFNA 3CLJA 3LLIA 1S63A 3NQPA 3FH5A 4RLYA 4NIKA 2PFDA 4K5BA 4DVYP 3W9GA 1VYIA 2EINC 3FAPB 2XLWA 3SZRA 1E7VA 2QTVA 3HIZA 3NZSA 2HSQA 1LD8A 3HJCA 3CGHA 2W9YA 4D4NA 2JX0A 3JXIA 1HF8A 4GTMA 3Q47B 3WHNA 3DD7A 2HUJA 1N4SA 4HS2A 2XXAA 5FIOA 1V54E 4JCHA 1ZHTA 5BQHA 4KXKB 1QQEA 4B93B 4N6CA 3FTVA 1UOHA 1E8XA 2VCAA 2NPUA 3HNLA 2YHSA 1SA5A 3IKOB 1OCCC 1HU3A 5ARFA 3DXKG 2P9PG 1PCXA 2A0BA 1UN8A 3FDQA 2RKKA 3KAEA 4NACA 1O1SA 1N11A 2J7PD 1KTMA 5AENA 5B3SE 2JLBA 2KCLA 1DCEA 1FAPB 4FJZA 2EIMC 1KT0A 5HQ8A 4I1MA 3HYMB 2HSBA 1YAUO 4PJJA 1W2WA 3L13A 1A5EA 4FADA 1K40A 1H2TC 2C04A 4UQXA 1HG5A 4P9TA 4LLCA 5E2QA 3LY9A 4I6JA 3D9OA 3M4CA 2GWWA 3UKRG 1J8YF 2VC9A 1NFIE 2VGXA 5CI8A 4KVMA 4N3AA 3RU0A 2GRMA 2IY0C 3NYLA 2Y4TA 4GPKA 3CHRA 1SYQA 3G2WA 1OUVA 5CEAA 2BF0X 1PC2A 4AVXA 5CERB 1HG2A 4MVZA 3L08A 4PS3A 3JRMO 2HZ8A 4FLHA 4F6RD 2XL6A 3SXZA 2EIJE 3V79K 4HXIA 4AV7A 1MMGA 3IPMO 1D0XA 4WJ0A 3C18A 3E37A 3O4ZA 1E8ZA 2VASA 4KI2A 4ZLCA 3Q15A 1D1BA 4RD9A 1WN0A 3C3RA 5JA4D 3W8HA 2KC7A 2FO7A 5FTPA 5FCLA 1PAQA 3UIOC 3K1IA 1S0PA 4J8FA 3RFYA 2F0YA 4MS2A 1WY6A 2ZXWE 4Z68A 4BTAA 4ANVA 5KNGA 4HVBA 1JRAA 4OIPF 1Y8MA 4CIPA 2C03A 2X3MA 3GYZA 1SR2A 3FU5A 2YZSA 3LXUX 2J9BA 5HS0A 5L3QA 3UM1A 1I4ZA 4PR9A 4U5HA 5BV1A 3SO8A 3QMKA 1Z5SC 3NMJA 4JURI 2IU1A 4B94A 3PEUB 1L5JA 3JTLO 5JRAA 3GWNA 3FMSA 3FTSA 3ULEG 4A4AA 3SFXA 3ZVVA 3FHDA 1Z63A 1HFAA 3FP3A 4U63A 1S64A 2PQNA 2XLHA 3FUDA 1PY1A 1UJJA 2ONDA 3E33A 1Y6IA 3RKVA 2X38A 4CZ2D 2L6HA 2EINE 5CRVA 3TXNA 3GEHA 1TNUA 3BG1B 4LNGA 3S27A 4N06A 3QVYA 4MLPA 5E3AA 2L6FA 1WWPA 4EUKB 1R4TA 1Q0DA 2UUIA 1UW4B 4MTGA 1O5MA 3EZIA 2MYOA 3ZNGA 5T4YA 2FFHA 4J7YA 3RKOF 3VLEA 3FUEA 4NY3A 4IB4A 1CPRA 2R7SA 3CVUA 3Q75A 4GMRA 3TWUA 3TWSA 1BLXB 3ZW3A 4W9RA 2QUPA 4V3IA 4NCQA 1H19A 3FULA 3CVWA 4XPWA 1O5HA 1OCCE 4JE9A 2P1AA 3B0PA 4BESA 2IOSA 4JPSA 1EPUA 3ZG1A 1H6OA 4JCZA 4J8DA
chains in the Genus database with same CATH topology
3JCKC 2LO6A 2L6JA 2XCCA 3CQCB 3CEQA 3LKUA 5A7DB 3FY4A 2VH3A 1JWFA 4LCTA 4FC8A 2G3VA 2WVNA 4HORA 4KNVA 4DBQA 2DBAA 1OWLA 2Q9BA 4FJYA 2J08A 2R7VA 2WVQA 4JHJA 5KYWA 1OCRC 3Q7GA 3LEVA 5D91A 2Q9AA 2J4BA 3RJVA 3CV0A 4G2VA 4JZAA 4F53A 4A1SA 5T3WA 4GYWA 1ZYRF 1P5QA 2LAIA 4N2QA 4AOFA 4AY6A 3UMHA 3AG3C 4WWNA 3AU4A 4YT2A 5FZQA 1HX8A 3MCXA 5KJMA 2BUGA 4FX5A 4EZJA 4HLEA 4I44A 1INZA 3NDBB 3ONLA 1BR4A 3EZHA 1MHQA 2GRLA 3ESKA 2ZXPA 4HEAJ 2CDQA 3UGPA 1EF1C 3OXLA 4CBEA 3DZAA 2MYSA 3GZ1A 5EKQD 4DI4A 2PL2A 2XCBA 1E96B 2VB6A 2ZXOA 1XGWA 3KMIA 4LUNU 3R7RA 1A17A 3DAGA 4U5BE 1ZHZA 1TWGA 4E7SA 5KYUA 4AP2A 2PZIA 2I1KA 3CVQA 3EFOB 4OD4A 1IYGA 3ML8A 2FEZA 4GEHA 4QDLA 3KD7A 4J32B 2P7VA 2DYRC 1ZU2A 1M2VA 4WAFA 3DJUB 1HE8A 5KYXB 3UMKA 3RK6A 1E8YA 5E3CA 3TD7A 4JJGA 4W8KA 2KM4A 3CK7A 2D5RB 3ZYMA 3SFZA 5EDSA 3ASGA 3ABMC 3EG9A 2G3KA 4UWKA 1MMNA 1BR2A 3N71A 2X6HA 1M2VB 5DS4A 4YJWA 2V8SE 5EHHA 2WQ7A 4JA9A 5KJLA 4GMJA 5FQ6A 4JEHA 1TWHA 4WWPA 4HOSA 1QLEC 1HS6A 4F1SA 1QZXA 4U5GA 4DBRA 4Q4ZF 1IW7F 1EDUA 4I3MA 3N0TA 2A1DD 1Z23A 3CVNA 1Z3IX 3HLZA 3ASFA 4RBNA 2KATA 4BTBA 3I4RB 2CFUA 3ML9A 2QY7A 2VJ8A 5JJ6A 4AXHA 3UUXA 4YT8A 2V3CC 1E7UA 1GW6A 1OKKA 2YHCA 5BUOA 2XL4A 3B9QA 3ZIBA 2H7BA 2AXVA 3LPZA 3GODA 3S7BA 3LCAA 4FESA 3FTXA 4KBLA 2NUTB 3H65A 4L23A 3EDTB 1FFHA 2J0WA 2WVIA 1N52A 4C3EA 1V54C 2IXNA 1RJ9B 4J0UA 4CS8A 5KYYB 3MKQB 3CSFA 3FH8A 3C98A 1MMAA 3E4BA 3S0XA 4LRZA 3K6BA 4PK4A 5B3SC 4I6GA 3T6JA 5AIJA 1WGWA 4ME2A 3CQGB 2VTBB 4CS9A 4WUYA 2A4ZA 2CG2A 5JJ7A 3L0IA 3O39A 4UWHA 2EQXA 3FUKA 3ZXSA 2RG8A 3FTUA 1U3CA 2Z15A 1EYHA 4JHRA 5ANRA 3K1HA 4UI9K 3PVLA 3PE3A 1ELRA 4ACKA 3AS5A 2EIJC 3BEEA 3X1OA 4B8CB 3HTKC 4GZDA 5B1AC 2IF4A 2A68F 2L9BA 3MGBA 4G0HA 3RO3A 2WXFA 4RG6A 4ANJA 3PUKA 3QK0A 3U9WA 4CS7A 4XTKA 3JCUQ 2XPZA 1D0YA 1VMAA 1OWPA 2ZXWC 4CS8C 4GCNA 3QNKA 3T8MA 1Z5ZA 4DVZA 4G1TA 4XI9A 3CHMA 3QKYA 3JYHA 4BWRA 4AIFA 1TKNA 2WXHA 1OCZC 3AG2C 3FUIA 4CS9C 2IXPA 3W2WA 3K7DA 4G7OF 1NA3A 3FUHA 3LY8A 2J9VA 3LS8A 2X6KA 2WMOA 5ANLA 4XKCA 4PH4B 2MHKA 4UI9J 4GYYA 2WXRA 4B8AA 4I43A 2J9UA 3NKDA 4GZ6A 4Q7CA 3CKBA 2R7UA 2L0TB 3DM5A 5T1DB 4BJ6A 2IXOA 3ENEA 1FFTC 3SBSA 2WZFA 3PE4A 4ABNA 1TEZA 4LLEA 3B7UX 1MMDA 4MS6A 1ELWA 3HVEA 4YT5A 3D9JA 1ZU5A 3OAWA 1TJFA 4APOA 3EPVA 3E9VA 3DXJF 5A6CA 3WXXA 4PJNA 2XXAB 3G2TA 4C0MA 1HXIA 4DI3A 2XPIA 2I1JA 3LVRE 4FHKA 1IQRA 3CVVA 1KLXA 2L0IA 2G62A 3IHVA 3EGDA 5DQZA 2Y3AA 3DM9B 3HVEB 3F46A 3EJNA 3APDA 2IOLA 5EX0A 2CNWD 4L2YA 2O9XA 3UPVA 2PM6A 2W4MA 5D92A 2FULA 3I4GA 4C7OA 1FMWA 4G11A 3S7FA 1Z6AA 3PMRA 4I6EA 4DK5A 2FF4A 5FQ8A 4GAAA 4I1AA 2KZTA 2VGXB 1Z3YA 4AM9A 2YNQA 3B7TA 2H7OA 4APFA 4BJ6C 5AJDA 2HV6A 4P6IC 5CMWA 4OINF 1M2OA 3QWVA 3FTZA 4M63A 2FI7A 3TGOA 2AVPA 3FAJA 3UX4A 3CHPA 4NURA 1ZHWA 2J7PA 3JQ0A 4C7OB 2XRYA 5FZSA 3DJNB 4CGWA 4IRUA 5ENNA 3ZSUA 3R9AB 3OA1A 3FUNA 5KJNA 2CHWA 4I9EA 5ARGA 2R7XA 1TJCA 4HOUA 3SYNA 3NYMA 2WM9A 4F7AA 4HOQA 2WXNA 3DMDA 3CHQA 4G7ZF 2CNWA 4G25A 3LS0A 4Q94A 2Y69C 3AQBA 4H7XA 5LCWC 4L2LA 1NZEA 4WNDA 4YVOA 3QJZA 2OOEA 3BG0B 2C0MA 1NG1A 4ILHB 4KMOA 3FVYA 3D9IA 5DVWA 5AJLA 4G7HF 2MWQA 4FA6A 3PEVB 3D3MA 4J8EA 2IFUA 3LJ3A 3CIAA 4TV3A 3LYAA 2ZXRA 4U0SA 2W4BA 4WNGA 1MNDA 4EECA 5FJYA 4UWLA 5LFAA 2E0IA 4CT4A 4IJJA 3M1CB 2WXOA 3D9KA 2UWJG 2XGMA 3E70C 4U04A 2L81A 2X6JA 4RG9A 3WODF 4JL0A 4BX9A 3TL5A 5EGYA 1SQMA 2XPYA 2AW6A 2LNIA 1OWNA 3EGXA 2AXZA 3LVQE 3ZHEA 3FWVA 3CK8A 4RDAA 4WNEA 4JEUA 4U0ZA 5KYWB 5LP0A 3D9LA 1PD0A 4JVSA 1HO8A 3SGHA 4GZ3A 3FFLA 4ACLA 2FGYA 4O6NA 2NC9A 2C0LA 5JJTA 4BJTA 1W3BA 3NF1A 1Z3XA 3FEYA 4ILGA 4O79A 3CKCA 4J8SA 3V7OA 3TXMA 2I8BA 2WZLA 2AXUA 5FT9A 2Y39A 4K03A 5A23A 2J0XA 3LY7A 3APCA 5M72A 4C9BB 4A1GA 2J45A 4U07A 1YA0A 3JSZA 3SZ7A 4EPZA 3R7QA 3O48A 4AJWA 3JUIA 3TG5A 3L6AA 3NG1A 2DCPA 4LACB 3UGOA 2LSEA 2OCCC 1PD1A 3ZVRA 3SHFA 4J30B 2I6HA 5KYUB 4BG0A 3PH0C 4OVUA 4U5EE 3KKBA 5HI7A 2NXPA 4JA7A 4BY6A 4JC8A 5E75A 3UMIA 4UWGA 3ZIMA 2NUPA 1UG3A 4QI0A 4H7YA 1SZIA 2WL8A 3CHSA 4FULA 4G24A 4CRWA 1ZHYA 5IY5C 3EG9B 3U4TA 4MRUA 5BV0A 4YVQC 3L34A 3PREA 4J6IA 4I2WA 3FUMA 3LAYA 4N3BA 4IULA 4URKA 4CIHA 2R5SA 3O6XA 4U5FE 4PS8A 3EIQC 3RO2A 2NG1A 3QARA 4JJFA 2BTDA 2NUPB 3PDNA 4HE8D 1NU7D 4A2NB 4QFVA 3P1UA 5B1BC 4AX2A 4YWQA 3CVPA 2LAHA 2WXKA 3FU3A 1IZMA 2IONA 3PUJA 3TG4A 4KC9A 4PJLA 4GCOA 2CW0F 4EBAA 4GMLA 2XGOA 4CSAC 3SNXA 1ELKA 3FUJA 4G26A 3I4UA 3OTNA 2M4EA 1UN9A 3VTYA 2E87A 3AG4C 2QFCA 4TUUA 4XIFA 3SP1A 2CHZA 1IHGA 5T3RA 2KNHA 1NP7A 3ASOC 2WXMA 3RRUA 4KBQA 3KS2A 5F5HA 4OIOF 3S2AA 3CSTA 3EHNA 3U66A 4UQZA 2XRHA 3SBTB 1NU9C 3UMVA 3EH2A 3CQZA 5C2YA 2YHEA 4CGVA 5DS6A 4FWVA 4NQ0A 4EBAG 1H2UA 2DYSC 3SNHA 5LX8A 3MA5A 2PP4A 4GYOA 3GANA 3DAFA 2UY1A 2IQCA 1DVPA 3JT1A 5HSWA 4LERA 2AWIA 3Q5MA 3S7JA 5D0QD 3G2VA 1DNPA 4PUCA 4A3VA 3L54A 2JEKA 4KYOB 1JPLA 2XRZA 2CHXA 3IEEA 2EILC 4FP7A 5L3VA 4KNWA 4TRQA 5JHAA 2PM7A 3CZ6A 2CFZA 3NRHA 2ZPAA 3I5PA 5F5FA 5G04C 1E90A 3N24A 3X2QC 4RVBA 2R7TA 3WG7C 2CGEA 4DPRA 5FWQA 3RIBA 4Q69A 4K7BA 4EZKA 3LEWA 2PX3A 1HZ4A 4HFKB 2VQ2A 5BPPA 1HH8A 4JZYA 2PQRA 4DJAA 2J4DA 4RSYA 3LNRA 2Y3GA 2MRIA 2R7OA 4CDRA 3SF4A 4E7ZA 1D1AA 5CCMA 2VSNA 3UNGC 4AY5A 4CDNA 4UWFA 1SZAA 1FMVA 1LKXA 3UT4A 3CR3A 3HHMA 3FTWA 5CHEE 2Y3HA 4KZ0A 3EIJA 1BPOA 1J8MF 1JUQA 5G04J 2HO1A 2LSVA 3MYVA 3NZUA 3FH7A 3QAQA 4R7LA 1G8XA 3K33A 1VDYA 2WMNA 1VOMA 2V26A 3T5XA 4E85A 3MLGA 3TAXA 4AEZC 5KJKA 3ONKA 2KW3C 4IN3B 1ST6A 2RD0A 4B89A 4AK9A 4N5CA 3B7RL 4ILIA 4XLPF 2J07A 2KGOA 2L9JA 4FHJA 1B89A 3Q6NA 4G23A 4P29A 3CK9A 4XKBA 3VLDA 2V4LA 5BT1A 3T5VA 4BFRA 3FU6A 4I1OB 4U8HA 3EGDB 3T4RA 2YEVA 2R7RA 1N1CA 4K0DA 4X0RA 3ZFWA 2Q3TA 3AU5A 3B7SA 3P2BA 2PX0A 1OCOC 3AS4A 3JYSA 2I2OA 3UT7A 4EQFA 4HFGA 4O6FA 3ZC4A 2M63A 4YN0B 2IOQA 3AG1C 1XNFA 4ULWA 3I3NA 4MKTA 3K66A 2HM8A 4K0RA 2KZTB 3ZPJA 2J9QA 1U3DA 4U5DE 1H6KA 3U3WA 2KJGA 1FVHA 2A6HF 3MV3B 5DIZA 3W2VA 3G2SA 4KVOA 3CVLA 2WZGA 4XX5A 3ZRHA 2A5UA 3B0VC 3KEZA 3ASNC 3MZLB 2X6FA 3QDNA 4N39A 3POVA 1KT1A 2OV8A 1NZNA 2EIKC 4XI0A 2IYLD 3RIPA 2YQ8A 3PRZA 3F47A 1MNEA 3LESA 2WQHA 2VYIA 4DLQA 4OYSA 5BW8C 4C0EA 4Q5SF 3FEXA 4B6IA 3W8IA 1H0AA 5BUZA 1ZBPA 3ASHA 4KZCA 1ZU4A 3AQCA 2WXPA 1MQSA 2X6IA 4I9CA 4B0ZA 4UQYA 1BR1A 1H2VC 2WXLA 5G05C 3CSKA 2JD3A 3IHYA 3D9PA 3K1IC 5FQ4A 5CMYA 4FLBA 5C1DA 1SMYF 2R7WA 3IBEA 3NKEA 4C3DA 3KH2A 2OVBA 1FCHA 3FHEA 2H7VC 2WPVA 1TR2A 3DBSA 3JRTA 3B0UX 2R59A 3PNTB 4M3OA 5G2NA 3FU0A 5LCWJ 2P58C 3QB2A 4EWCA 1S7ZA 4DOZA 4I17A 3ZYKA 4BJ1A 5G55A 4GU5A 4E6HA 3ABKC 3S28A 4OD5A 4HOTA 3MX3A 2GW1A 2HYZA 3RRMB 2XQ0A 5LOZA 3ITFA 3T6BA 1LS1A 4ANXA 4AE4A 3FTYA 5JHBA 2R7QA 4JXTA 1M56C 3PS6A 3SI5A 5DS5A 3U64A 2FBNA 1JPNA 2ILRA 5G05J 3MKRA 3AS8A 3LDZA 3EGXB 4MNDA 3GZSA 2HV7A 3RRNB 3K9IA 4PFPA 4NRHB 3ZHEB 2MOWA 4GA0A 3PNLB 2I9CA 3IEGA 3URZA 4BSXA 3HDXA 3EFOA 4PDXA 4AE4B 1SZ9A 4ATGA 4KT6B 2OG2A 1SF8A 2BE5F 3RYLA 3Q6MA 4O6YA 5T8IA 5KYXA 3MV2B 3LS1A 3VLFA 2ZU6B 2WXGA 1FVFA 2J9WA 3ZEFA 5BNWA 4GZCA 1QZ2A 3MEKA 2DGJA 2KCVA 5J08A 2P6VA 2V0PA 2NSZA 3KL4A 4BT9A 2W45A 3Q7LA 2C2LA 4CSAA 4GYTA 4GA1A 4OVVA 4EZLA 1JPJA 3QOUA 3ZYLA 2J49A 3UQ3A 1O87A 2WXQA 1OKKD 2DIWA 3D9NA 3L22A 2YINA 2LSUA 3FUFA 2Y3DA 3L17A 1LF8A 4F4BA 4BJ5A 1KU2A 4IWBA 3ZYQA 4PFOA 4ZLDA 3QC1A 2GFHA 3IV0A 3B13A 2WB2A 1TWCA 5CCLA 4F3VA 1X5BA 2KQ9A 5CI9A 3G2UA 3S29A 2Q9CA 4BX8A 2OVFA 2J09A 1TWAA 2XHEA 3OXFA 1E8WA 3ESLA 3VTXA 2CG3A 3SD5A 5E76A 4Y6WA 3DPDA 3EHMA 4PJMA 4DLOA 2R17C 3EQLF 4WWOA 4PS7A 5J90A 1VK5A 4CCAA 4IAOA 4O6MA 5FQ7A 2NUTA 3RH3A 5T3TA 3I5QA 3CVYA 1D1CA 2GGFA 3ASDA 4ANWA 3TJPA 2VSXE 2XGSA 2KCKA 3LJBA 1RJ9A 3ULQA 2VSYA 3Q49B 3OWTA 5EX3A 4BEJA 4CT0A 3L16A 1WM5A 2B0JA 3S7DA 2Y3BA 5E33A 5KYYA 2IJGX 2X51A 3MKQA 3N2ZB 4CEMA 1OWMA 4I2ZA 4GA2A 4JHKA 2XSEA 4BJ5C 2IXMA 4QI2A 4FU3A 4L7TA 3VYWA 5KCMA 2V5FA 1JWGA 2VTBA 4N3CA 4H4KC 4L1BA 4CDMA 1QNFA 3Q4AB 4Q96A 1N54A 2WXJA 4JW1A 3QWPA 3LLKA 3JQ1A 4D10C 4U5CE 3QZCA 2WQ6A 5DLJA 2Q7FA 3ABLC 1V55C 3SEOA 4BT8A 3OXGA 3FDHA 2HR2A 2WVOA 1FTSA 3D9MA 1LVKA 3UR3C 3VAYA 4A55A 1IQUA 5DBKA 2XEVA 3PZDA 4GZ5A 3OEOA 2J46A 5D0OD 4IYPA 5FZRA 4N2SA 1VYKA 4YNDA 4EBBA 3NYJA 2PF4E 2VGYA 3UT8A 3EH1A 1WAO1 2UY1B 4UI9C 2Y4UA 1ZHXA 3CVXA 3ZGQA 2QY9A 4OIQF 4U0UA 3MJWA 4A3TA 4XLNF 1OWOA 3APFA 2WB7A 2A69F 4GB9A 2VSOE 1M57C 4WNFA 2E2EA 3QWWA 1D0ZA 4MQ9F 3CHOA 4Y6CA 4O7GA 3GZ2A 2WXIA 3PHF2 4C3BA 5AYWD 4ANUA 4XWJA 3GW4A 5KYNA 4YT4A 4XE0A 4XZ4A 3ECSA 5DQTA 4LEUA 4OIRF 3ZN3A 1Z6TA 1NA0A 2A6EF 1UJKA 4HFFB 3CLJA 3LLIA 3NQPA 3FH5A 2PFDA 4DVYP 1VYIA 2EINC 1E7VA 3SZRA 2QTVA 3HIZA 3NZSA 3HJCA 3CGHA 2W9YA 1HF8A 3Q47B 3DD7A 4HS2A 2XXAA 4JCHA 1ZHTA 4KXKB 1QQEA 3FTVA 1E8XA 2YHSA 3IKOB 1OCCC 1HU3A 5ARFA 1PCXA 1UN8A 3FDQA 3KAEA 4NACA 2J7PD 5AENA 2JLBA 2KCLA 4FJZA 2EIMC 1KT0A 5HQ8A 4I1MA 3HYMB 4PJJA 1W2WA 3L13A 4FADA 1H2TC 2C04A 4UQXA 1HG5A 4LLCA 5E2QA 3LY9A 4I6JA 3D9OA 1J8YF 2VGXA 5CI8A 4KVMA 4N3AA 3RU0A 2GRMA 3NYLA 2Y4TA 4GPKA 3CHRA 3G2WA 1OUVA 2BF0X 1PC2A 4AVXA 1HG2A 3L08A 4PS3A 4FLHA 4HXIA 4AV7A 1MMGA 1D0XA 4WJ0A 3O4ZA 1E8ZA 2VASA 4KI2A 4ZLCA 3Q15A 1D1BA 4RD9A 3W8HA 2KC7A 2FO7A 5FTPA 5FCLA 1PAQA 1S0PA 4J8FA 3RFYA 1WY6A 4BTAA 4ANVA 4HVBA 4OIPF 1Y8MA 2C03A 3GYZA 2X3MA 3FU5A 2YZSA 3LXUX 5L3QA 4U5HA 5BV1A 3QMKA 4JURI 2IU1A 4B94A 3PEUB 1L5JA 3FTSA 3ZVVA 3FHDA 1Z63A 1HFAA 3FP3A 4U63A 2PQNA 3FUDA 1PY1A 1UJJA 2ONDA 1Y6IA 3RKVA 2X38A 3TXNA 3BG1B 4MLPA 3S27A 4N06A 5E3AA 1UW4B 3EZIA 5T4YA 2FFHA 3RKOF 3VLEA 3FUEA 4NY3A 2R7SA 3CVUA 3ZW3A 4W9RA 4V3IA 1H19A 3FULA 3CVWA 1O5HA 3B0PA 2IOSA 4JPSA 1EPUA 3ZG1A 4J8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1M A;  4IRU A;  4I1O B;  4JW1 A;  4JVS A; 
#chains in the Genus database with same CATH topology
 3JCK C;  2LO6 A;  4YDE A;  2L6J A;  2YKZ A;  4E0I A;  5A69 A;  2XCC A;  3PZ4 A;  3CQC B;  3B71 A;  3CEQ A;  3LKU A;  5A7D B;  3FY4 A;  2VH3 A;  1JWF A;  4LCT A;  1AEP A;  2OEV A;  4FC8 A;  4A63 B;  2G3V A;  2WVN A;  5COF A;  1A7E A;  1TQG A;  3V2O A;  3J5Q B;  4KNV A;  4HOR A;  4LDR A;  4DBQ A;  1M6T A;  2DBA A;  1OWL A;  2Q9B A;  4FJY A;  3Q78 A;  3UXG A;  2J08 A;  2R7V A;  4DRX E;  2WVQ A;  3U2M A;  4JHJ A;  5KYW A;  1OCR C;  1I4Y A;  3LEO A;  3Q7G A;  3LEV A;  5D91 A;  2Q9A A;  1OXK A;  4YL1 A;  2J4B A;  2XS8 A;  3TUL A;  1L3P A;  3RJV A;  2XL8 A;  3CV0 A;  4G2V A;  2OU6 A;  3NAW A;  4JZA A;  4F53 A;  4A1S A;  3LUT B;  5T3W A;  3NOC D;  4GYW A;  1ZYR F;  1VTM P;  1P5Q A;  2LAI A;  4N2Q A;  4AOF A;  2LIG A;  1TN8 A;  4AY6 A;  4BET A;  3UMH A;  5JLI A;  3AG3 C;  4WWN A;  3AU4 A;  3JYY A;  4YT2 A;  5FZQ A;  1HX8 A;  3MCX A;  5KJM A;  4GTV A;  4MVU A;  1N4P A;  2IEJ A;  2BUG A;  1R5I D;  2OQM A;  4MW3 A;  2P9N G;  4BER A;  3C63 A;  4FX5 A;  4EZJ A;  3E32 A;  5HV9 A;  5JUA A;  1OY3 D;  4HLE A;  4I44 A;  2H8A A;  2Y1L E;  4TXR A;  4JEA A;  5ENQ D;  1INZ A;  3NDB B;  2XEN A;  3ONL A;  1BR4 A;  3EZH A;  5B3I A;  1MHQ A;  2GRL A;  4M7C A;  4TXP A;  3ESK A;  2ZXP A;  4HEA J;  2CDQ A;  3UGP A;  1EF1 C;  3OXL A;  3BUA A;  3UIN C;  4CBE A;  1A7D A;  3DZA A;  2MYS A;  3GZ1 A;  5EKQ D;  4DI4 A;  2PL2 A;  5JVE A;  2XCB A;  1OXJ A;  2DZN A;  3TOL A;  1CGO A;  1E96 B;  2VB6 A;  2ZXO A;  3RQE A;  2YVK A;  4AL1 A;  1XGW A;  2XLO A;  3KMI A;  4LUN U;  3R7R A;  1A17 A;  3DAG A;  4U5B E;  1ZHZ A;  1KZP A;  1TWG A;  4E7S A;  5KYU A;  4AP2 A;  3UM0 A;  5BXO A;  2PZI A;  2I1K A;  4J7T A;  3CVQ A;  2XEH A;  3EFO B;  4OD4 A;  3EUV A;  4C48 B;  1IYG A;  3ML8 A;  2FEZ A;  4GEH A;  4QDL A;  3KD7 A;  4J32 B;  2P7V A;  2DYR C;  1ZU2 A;  3EHQ A;  4L9P A;  1M2V A;  1H7I A;  3DJU B;  4WAF A;  1HE8 A;  1JAF A;  1TN6 A;  5KYX B;  2P9S G;  3UMK A;  3RK6 A;  1E8Y A;  1S05 A;  4DJ9 A;  5E3C A;  3TD7 A;  2DVW A;  1UG7 A;  4JJG A;  4W8K A;  4U7E B;  2KM4 A;  4YK5 A;  4CYM D;  3L1M A;  3CK7 A;  1NI1 A;  2D5R B;  4NTB A;  3ZYM A;  3RVZ A;  3SFZ A;  5EDS A;  3ASG A;  1ZW2 A;  1K04 A;  3ABM C;  2XLD A;  2QE9 A;  3EG9 A;  2G3K A;  2R03 A;  2CYD A;  1MMN A;  4UWK A;  1BR2 A;  3N71 A;  2DB4 A;  3AGT A;  2X6H A;  2NSF A;  3HRA A;  1M2V B;  5DS4 A;  1AP7 A;  4YJW A;  3NMK A;  2V8S E;  3S90 A;  2LXL A;  5EHH A;  1BI7 B;  3S84 A;  3DSV A;  2WQ7 A;  4JA9 A;  5KJL A;  5F28 E;  4GMJ A;  2DI3 A;  5FQ6 A;  1VB5 A;  4UDV A;  1LS4 A;  4JEH A;  1TWH A;  4WWP A;  4HOS A;  2UUH A;  1QLE C;  1HS6 A;  4F1S A;  3L8J A;  1QZX A;  4U5G A;  4WGZ A;  4DBR A;  4Q4Z F;  1IW7 F;  1OCR E;  3ZUV B;  5EN5 D;  1EDU A;  4O1O A;  4I3M A;  1GM5 A;  3N0T A;  2A1D D;  3EU9 A;  1Z23 A;  3IQ6 A;  3MYF A;  3CVN A;  1Z3I X;  3HLZ A;  4ONS A;  2F8X K;  1FR0 A;  1JCS A;  1Q0G A;  2P2C P;  3ASF A;  4RBN A;  2KAT A;  4BTB A;  3I4R B;  2CFU A;  2QC9 A;  3ML9 A;  2QY7 A;  2VJ8 A;  5JJ6 A;  4AXH A;  3UUX A;  4R32 A;  4MVO A;  4YT8 A;  2V3C C;  1E7U A;  2F22 A;  2Q7R A;  3DEO A;  1GW6 A;  1OKK A;  2HMZ A;  2YHC A;  4ZHB A;  5BUO A;  2XL4 A;  3B9Q A;  3ZIB A;  2H7B A;  2AXV A;  3LPZ A;  3GOD A;  1NSG B;  3S7B A;  3LCA A;  3ATP A;  4FES A;  4YL3 A;  3C5R A;  3FTX A;  4KBL A;  1UFB A;  2NUT B;  4CJG A;  3G50 A;  1TFK B;  2XZD G;  3M79 A;  3H65 A;  4L23 A;  3EDT B;  1FFH A;  2RD9 A;  1N4Q A;  2J0W A;  3DI5 A;  2WVI A;  1N52 A;  4C3E A;  4DX7 D;  1V54 C;  2IXN A;  1RJ9 B;  2R25 A;  1IKN D;  1NBB A;  1ORS C;  2LQG A;  4J0U A;  1QBQ A;  4XQ1 A;  4CS8 A;  5KYY B;  3SXY A;  3SXM A;  2YLG A;  3MKQ B;  3BRJ A;  3PZ3 A;  3L9T A;  3W9F A;  3CSF A;  3FH8 A;  3C98 A;  2M64 A;  1MMA A;  3E4B A;  1TNO A;  3S0X A;  4LRZ A;  3K6B A;  4MVM A;  4PK4 A;  5B3S C;  4I6G A;  3T6J A;  5AIJ A;  1E84 A;  1WGW A;  4ME2 A;  1CGN A;  2GRR B;  3CQG B;  3SXK A;  2VTB B;  2BKG A;  2F37 A;  4CS9 A;  3LNM B;  1LD7 A;  4WUY A;  1KZO A;  2A4Z A;  2CG2 A;  5JJ7 A;  4EKW A;  1O3U A;  1CGM E;  1FNT c;  2JAB A;  3L0I A;  3O39 A;  4UWH A;  2EQX A;  3FUK A;  3BU8 A;  2RG8 A;  3ZXS A;  3FTU A;  1TR4 A;  1U3C A;  4HB5 A;  4J7W A;  2Z15 A;  3C72 A;  4P9F A;  2ZIR A;  1EYH A;  4JHR A;  5ANR A;  3K1H A;  2OCC E;  4UI9 K;  3PVL A;  3PE3 A;  3C8G B;  1Y6D A;  4ER9 A;  1ELR A;  4ACK A;  4ZFH A;  3A9C A;  1RZ4 A;  3AS5 A;  2EIJ C;  3BEE A;  3X1O A;  3J06 A;  4B8C B;  3RW0 A;  2GRN B;  4JRZ A;  4BEP A;  3HTK C;  4GZD A;  5B1A C;  1XWJ A;  1T5O A;  2IF4 A;  2A68 F;  2L9B A;  3DRA A;  1E2X A;  3MGB A;  4G0H A;  3RO3 A;  1T01 A;  4NTA A;  2WXF A;  4RG6 A;  4ANJ A;  2H6I A;  3PUK A;  3QK0 A;  3U9W A;  4CS7 A;  4XTK A;  3JCU Q;  2XPZ A;  1D0Y A;  5AQA A;  1VMA A;  1OWP A;  2ZXW C;  4CS8 C;  2P9K G;  4GCN A;  5ENO D;  4MVQ A;  4ATZ D;  3TWV A;  1NFN A;  5IY5 E;  3QNK A;  3T8M A;  1Z5Z A;  4DVZ A;  4G1T A;  5FIN A;  1D8E A;  3MBG A;  4XI9 A;  3CHM A;  3QKY A;  4NTF A;  3JYH A;  2Y0B G;  4BWR A;  4Z9J A;  4AIF A;  4OAV B;  1TKN A;  2HKV A;  2WXH A;  2CCY A;  1OCZ C;  1QKR A;  3AG2 C;  3T9O A;  4CS9 C;  1JOG A;  3FUI A;  2IXP A;  3W2W A;  3K7D A;  4G7O F;  1NA3 A;  2HJ3 A;  2P61 A;  3FUH A;  3LY8 A;  2J9V A;  4U8Y D;  2D4U A;  3LS8 A;  2X6K A;  2WMO A;  5ANL A;  3RAU A;  4XKC A;  2LK4 A;  4DX6 D;  4PH4 B;  3FOO A;  2MHK A;  4UI9 J;  4GYY A;  2WXR A;  4B8A A;  4I43 A;  2J9U A;  3AGU A;  1NFO A;  1YAR O;  3NKD A;  4GZ6 A;  1SW6 A;  1YZC A;  2R05 A;  4Q7C A;  3CKB A;  2R7U A;  4L6R A;  2L0T B;  2ICW G;  3DM5 A;  2I15 A;  1O1R A;  5T1D B;  4BJ6 A;  2IXO A;  3ENE A;  1VLS A;  1FFT C;  3SBS A;  2WZF A;  2H6G A;  3PE4 A;  2A0U A;  4ABN A;  2R9R B;  3DSS A;  1TEZ A;  4LLE A;  3B7U X;  3ASO E;  1MMD A;  4MS6 A;  1ELW A;  2XLE A;  1HE1 A;  5COG A;  3U9M A;  4HLL A;  1TFO B;  3HVE A;  3TWW A;  2ETS A;  4YT5 A;  1IXV A;  3D9J A;  1ZU5 A;  2ASR A;  3OAW A;  1TJF A;  4APO A;  2FO1 E;  3EPV A;  4E17 A;  3E9V A;  2Q00 A;  3DXJ F;  5A6C A;  3WXX A;  4PJN A;  2XXA B;  3G2T A;  4C0M A;  1HXI A;  4DI3 A;  2ETA A;  2H6H A;  1MX2 A;  2XPI A;  1DCQ A;  2I1J A;  3LVR E;  4FHK A;  2GA0 A;  2B6C A;  1IQR A;  3CVV A;  1KLX A;  3E34 A;  2L0I A;  2G62 A;  3IHV A;  3EGD A;  4K5A B;  5DQZ A;  2Y3A A;  3DM9 B;  2XM4 A;  1YMP A;  4G8L A;  3HVE B;  5ENT D;  3F46 A;  3EJN A;  3APD A;  4BSZ B;  2IOL A;  5EX0 A;  3HXF A;  2CNW D;  4LNU D;  1WTY A;  4L2Y A;  5AN8 A;  4HI9 A;  2O9X A;  4IAQ A;  3H2V A;  1GQA A;  1Y4C A;  2JPU A;  3UPV A;  2PM6 A;  1YLM A;  2W4M A;  5D92 A;  2FUL A;  1G4W R;  3I4G A;  4C7O A;  2NYJ A;  1FMW A;  5B1A E;  4G11 A;  4CDY A;  3TJ6 A;  3S7F A;  1Z6A A;  1U0B B;  3PMR A;  4I6E A;  4DK5 A;  2FF4 A;  5FQ8 A;  4GAA A;  4I1A A;  2BED A;  2KZT A;  4N4W A;  1Z3Y A;  2VGX B;  2YNQ A;  3B7T A;  3RSE G;  4AM9 A;  2H7O A;  4APF A;  3L82 A;  4JTC B;  2EIL E;  4BJ6 C;  1E85 A;  5AJD A;  2HV6 A;  4P6I C;  5CMW A;  4OIN F;  1M2O A;  4E0H A;  3QWV A;  5L0C A;  3FTZ A;  4M63 A;  2FI7 A;  3TGO A;  2AVP A;  2OJE D;  3FAJ A;  3UX4 A;  3G4X A;  2IBF A;  3CHP A;  4NUR A;  1ORY A;  1ZHW A;  2J7P A;  3JQ0 A;  3T6G B;  4C7O B;  1GS9 A;  2XRY A;  5ENS D;  5FZS A;  5EYL A;  3DJN B;  4CGW A;  3WG7 E;  4IRU A;  5ENN A;  3ZSU A;  1OCZ E;  3R9A B;  1LE2 A;  2OEW A;  3AG2 E;  3OA1 A;  3FUN A;  5KJN A;  2PBE A;  1T6Q A;  1TN7 A;  2CHW A;  4I9E A;  5ARG A;  2R7X A;  2YL7 A;  1TJC A;  4HOU A;  1Z7Q c;  3SYN A;  3NYM A;  2A5E A;  2WM9 A;  2RFM A;  4F7A A;  4IAR A;  4HOQ A;  2WXN A;  2IO3 C;  3DMD A;  3CHQ A;  4G7Z F;  3KYI A;  2CNW A;  4G25 A;  5H7P A;  1MJ0 A;  2YQY A;  3G4Z A;  3LS0 A;  3V30 A;  4Q94 A;  2KBX A;  1HMD A;  2Y69 C;  2YL1 A;  3AQB A;  4H7X A;  5LCW C;  3Q9N C;  4HRN A;  1NZE A;  4L2L A;  4WND A;  1BU9 A;  4YVO A;  3QJZ A;  2OOE A;  1LE4 A;  3B29 A;  3W4Y A;  3BG0 B;  2C0M A;  1NG1 A;  4ILH B;  4KMO A;  3FVY A;  3D9I A;  2J8S D;  1Q0F A;  5AC5 A;  5DVW A;  5AJL A;  4G7H F;  2MWQ A;  3DWW A;  4FA6 A;  3PEV B;  3V5X A;  3D3M A;  4J8E A;  3EU5 A;  2IFU A;  3LJ3 A;  3CIA A;  4TV3 A;  3LYA A;  2ZXR A;  2KK1 A;  4U0S A;  2W4B A;  2GDC A;  3AAA C;  4WNG A;  1MND A;  4EEC A;  3GM2 A;  3ISM C;  1OW6 A;  5FJY A;  4UWL A;  3J5P A;  1RW2 A;  5LFA A;  4EIY A;  1OR2 A;  3T8K A;  2E0I A;  4CT4 A;  4IJJ A;  3M1C B;  2WXO A;  1TNY A;  3D9K A;  2UWJ G;  2XGM A;  3E70 C;  5L0D A;  1LPE A;  4U04 A;  2L81 A;  4RQI A;  2X6J A;  4RG9 A;  3WOD F;  4HI8 A;  4JL0 A;  1BDJ B;  3AOU A;  4BX9 A;  3TL5 A;  5EGY A;  1SQM A;  2QZA A;  2AW6 A;  2XPY A;  2LNI A;  1OWN A;  1BBH A;  4JTD B;  3EGX A;  5ENP D;  2AXZ A;  3LVQ E;  3ZHE A;  3FWV A;  2AP3 A;  3CK8 A;  4RDA A;  1RMV A;  3BEH A;  4WNE A;  4MTF A;  1L7C A;  4JEU A;  2GRO B;  4U0Z A;  5KYW B;  1U89 A;  5LP0 A;  1PD0 A;  3D9L A;  4JVS A;  3DEP A;  3UIP C;  1HO8 A;  3SGH A;  4GZ3 A;  2EPM X;  3ZQV A;  3FFL A;  5JMN D;  2FGY A;  4O6N A;  4ACL A;  2NC9 A;  2C0L A;  5JJT A;  4BJT A;  1W3B A;  3NF1 A;  5AAR A;  4YL0 A;  3H2U A;  1Z3X A;  3FEY A;  4ILG A;  1EA8 A;  1E83 A;  4O79 A;  3CKC A;  3AG1 E;  5ENR D;  4J8S A;  4K5C A;  5AQ9 A;  3V7O A;  3TXM A;  3DXM G;  2I8B A;  2WZL A;  2AXU A;  5FT9 A;  1F1M A;  1QPU A;  2Y39 A;  4U96 D;  4EBK A;  4K03 A;  5A23 A;  1G3N B;  2J0X A;  4JEB A;  3HXD A;  3LY7 A;  3APC A;  3IQT A;  5M72 A;  4LG6 A;  4WGY A;  1N9A A;  4C9B B;  4A1G A;  2J45 A;  3GWL A;  3ASN E;  4U07 A;  4BPM A;  2OEX A;  1YA0 A;  3JSZ A;  2FAP B;  3SZ7 A;  4EPZ A;  1H9T A;  1K3Z D;  3R7Q A;  3O48 A;  5JS5 A;  1U6H A;  3AJI A;  2Y69 E;  4AJW A;  3JUI A;  1DOW A;  3TG5 A;  3L6A A;  3NG1 A;  2DCP A;  4GTT A;  4LAC B;  3UGO A;  2LSE A;  2OCC C;  1PD1 A;  3ZVR A;  1HW2 A;  3SHF A;  4HRL A;  4J30 B;  2HJM A;  2I6H A;  5KYU B;  4BG0 A;  1G4U S;  1RKC A;  4DUI A;  3PH0 C;  4OVU A;  3ZTM A;  4U5E E;  3KKB A;  5HI7 A;  2NXP A;  4JA7 A;  4BY6 A;  4JC8 A;  5E75 A;  5EIB E;  3UMI A;  1N4R A;  5TJ5 E;  4UWG A;  5FZT A;  1LM3 B;  4DX5 D;  3ZIM A;  2NUP A;  1UG3 A;  4QI0 A;  3QW0 A;  1OR3 A;  4H7Y A;  5CRU A;  3VF0 A;  1SZI A;  2WL8 A;  3CHS A;  2P9U G;  4FUL A;  4G24 A;  3U8V A;  1KNY A;  3V2X A;  4CRW A;  1ZHY A;  5IY5 C;  1TNB A;  1MQV A;  1AVO B;  3IHU A;  3U3F A;  3EG9 B;  3U4T A;  4MRU A;  5BV0 A;  4YVQ C;  3L34 A;  4O1P A;  3PRE A;  4J6I A;  4LDK A;  4I2W A;  3FUM A;  3LAY A;  4N3B A;  4IUL A;  4URK A;  4CIH A;  5AGF A;  2R5S A;  2EPN A;  3O6X A;  4U5F E;  4XEF A;  4PS8 A;  3O10 A;  3EIQ C;  3RO2 A;  2NG1 A;  3HNJ A;  1Q0M A;  3QAR A;  1C03 A;  4JJF A;  2BTD A;  3SQV A;  1YJG A;  2NUP B;  2L6G A;  3PDN A;  4HE8 D;  1NU7 D;  2YLI A;  3TWQ A;  4A2N B;  4QFV A;  2HE0 A;  4CDV A;  3P1U A;  5B1B C;  4AX2 A;  3DSX A;  4YWQ A;  3CVP A;  5ITZ F;  3JZ0 A;  2LAH A;  2WXK A;  3FU3 A;  1IZM A;  2ION A;  3PUJ A;  3TG4 A;  1RXQ A;  4KC9 A;  3C62 A;  4PJL A;  2CW0 F;  4GCO A;  4EBA A;  4AL0 A;  1H9G A;  4GML A;  4GTP A;  4BEM J;  1AWC B;  2R02 A;  2XGO A;  4CSA C;  4TXQ A;  3SNX A;  5A6B D;  2VCC A;  1ELK A;  3FUJ A;  4G26 A;  3I4U A;  2XZT G;  4MVS A;  3OTN A;  2M4E A;  1V4A A;  1UN9 A;  5D2M C;  2LP4 A;  3VTY A;  2E87 A;  3AG4 C;  1MYO A;  2QFC A;  4TUU A;  4XIF A;  3SP1 A;  4NQF A;  2CHZ A;  4MVR A;  1IHG A;  5T3R A;  2KNH A;  3PDM P;  1NP7 A;  3ASO C;  1EQ1 A;  2WXM A;  3RRU A;  4KBQ A;  3KS2 A;  1QVX A;  5F5H A;  4OIO F;  3HXB A;  3S2A A;  3CST A;  3EHN A;  2ZD9 A;  3GOR A;  3RF3 A;  4UQZ A;  3U66 A;  3L8I A;  1QYM A;  2XRH A;  3SBT B;  1NU9 C;  3QVZ A;  3UMV A;  1T9K A;  3KEA A;  1NLX A;  3EH2 A;  3PCV A;  3CQZ A;  1VLT A;  3ZU7 B;  5C2Y A;  2YHE A;  5AAO A;  4CGV A;  4W8P A;  5DS6 A;  1D8D A;  4YDW A;  4FWV A;  3DE9 A;  4NQ0 A;  4EBA G;  4GQH A;  1H2U A;  3U0C A;  2DYS C;  3SNH A;  5LX8 A;  1S70 B;  3MA5 A;  4D4X A;  2PP4 A;  1TYQ G;  4GYO A;  3GAN A;  3DAF A;  2UY1 A;  2IQC A;  1DVP A;  3JT1 A;  1MZC A;  4TUM A;  5HSW A;  3HXE A;  4LER A;  2AWI A;  3R7C A;  3Q5M A;  3S7J A;  5D0Q D;  3G2V A;  3U3B A;  5L0H A;  1DNP A;  3U5S A;  4PUC A;  2DWZ A;  4A3V A;  3L54 A;  2JEK A;  2QNL A;  4KYO B;  1JPL A;  2XRZ A;  2CHX A;  3IEE A;  2EIL C;  4FP7 A;  5L3V A;  1XZP A;  4KNW A;  4TRQ A;  1I5N A;  4GPM A;  3DWL G;  2PM7 A;  3CZ6 A;  5JHA A;  2CFZ A;  3NRH A;  2ZPA A;  2ZGG A;  3I5P A;  5F5F A;  5G04 C;  2AWY A;  4G78 A;  1WAS A;  1E90 A;  1DC2 A;  4MTO A;  3N24 A;  3B95 A;  3X2Q C;  3RVY A;  1RCP A;  4JB8 P;  4RVB A;  4EHP A;  4E18 A;  2R7T A;  1G5Z A;  1TNZ A;  3WG7 C;  2CGE A;  5A6K A;  4DPR A;  5FWQ A;  3RIB A;  4Q69 A;  1FT1 A;  4K7B A;  4EZK A;  3LEW A;  1BI8 B;  2PX3 A;  2BC5 A;  1HZ4 A;  4HFK B;  2V4H C;  2VQ2 A;  5BPP A;  1HH8 A;  3U2L A;  4JZY A;  2PQR A;  4DJA A;  1EI7 A;  2XS1 A;  2J4D A;  2NSG A;  3DPY A;  4RSY A;  3HG0 D;  5B1B E;  3LNR A;  2Y3G A;  2MRI A;  2R7O A;  4N6H A;  4CDR A;  4FAP B;  3ULY A;  3SF4 A;  4E7Z A;  3S9O A;  1D1A A;  5CCM A;  3KSQ A;  2VSN A;  3UNG C;  2EPO A;  4AY5 A;  4CDN A;  5EIL A;  1FPP A;  4UWF A;  1SZA A;  4LNB A;  3A11 A;  1FMV A;  3TQO A;  3D9H A;  1LKX A;  3UT4 A;  2ZGD A;  2KC3 A;  3CR3 A;  3FTW A;  3HHM A;  5CHE E;  2Y3H A;  4KZ0 A;  3EIJ A;  4J8Y A;  2RSE B;  5HRY A;  4IGG A;  3AG4 E;  1BPO A;  4PAC A;  1J8M F;  1YA9 A;  1JUQ A;  5G04 J;  5JP7 A;  3NBN B;  5D66 A;  2HO1 A;  4EHM A;  2LSV A;  1NL4 A;  3MYV A;  3NZU A;  2VCB A;  3FH7 A;  3QAQ A;  1YZA A;  3GEE A;  4R7L A;  1G8X A;  3E30 A;  1GGQ A;  1PV3 A;  3K33 A;  1VDY A;  2EPK X;  1A41 A;  3DSU A;  2WMN A;  1VOM A;  5KBA A;  3R2P A;  2V26 A;  5AC4 A;  1OXB A;  2OOC A;  5EYP F;  1YYH A;  3T5X A;  2PNO A;  4E85 A;  3MLG A;  1C17 M;  2P0N A;  3TAX A;  4AEZ C;  1HY5 A;  4O60 A;  5KWD A;  5KJK A;  2F8Y A;  3V5Z A;  3ONK A;  3ABL E;  2KW3 C;  2OKU A;  4MW8 A;  4IN3 B;  1ST6 A;  2DYS E;  1V55 E;  2RD0 A;  3NOG D;  4B89 A;  1N0Q A;  4EBJ A;  4AK9 A;  4N5C A;  4QQI A;  3B7R L;  4ILI A;  4XLP F;  3GM1 A;  2J07 A;  1WG0 A;  2KGO A;  2L9J A;  4FHJ A;  1HE9 A;  1B89 A;  3Q6N A;  4G23 A;  4P29 A;  3CK9 A;  4XKB A;  3VLD A;  2B0H A;  2V4L A;  1YYX A;  3DST A;  3TWR A;  1AUE A;  5BT1 A;  3T5V A;  2HMQ A;  3R9M A;  4BFR A;  3FU6 A;  4I1O B;  4U8H A;  3EGD B;  3T4R A;  4DRI B;  1LI7 A;  2YEV A;  5AQ7 A;  2R7R A;  1N1C A;  4K0D A;  1OW8 A;  1A0B A;  4X0R A;  4JC7 A;  2Q3T A;  3ZFW A;  3AU5 A;  2YLD A;  3DE8 A;  3B7S A;  1EKY A;  3P2B A;  2PX0 A;  2LUH A;  1OCO C;  1N0R A;  3AS4 A;  3QTH A;  3JYS A;  2I2O A;  3UT7 A;  4EQF A;  4HFG A;  3X2Q E;  4O6F A;  3ZC4 A;  2M63 A;  4YN0 B;  2LCH A;  1QQ3 A;  2IOQ A;  1N94 A;  3AG1 C;  1XNF A;  4ULW A;  3I3N A;  4MKT A;  3K66 A;  1DOV A;  2HM8 A;  3PZ1 A;  4K0R A;  2KZT B;  3ZPJ A;  2J9Q A;  3HNI A;  3VM6 A;  2LFD A;  4HNA D;  1U3D A;  4U5D E;  1H6K A;  3U3W A;  5CIV A;  5CED B;  4XEI G;  2KJG A;  1FVH A;  2A6H F;  3V5Y A;  5K0I A;  3MV3 B;  2AJA A;  5DIZ A;  3W2V A;  2L7A A;  2LFF A;  1APC A;  3G2S A;  4KVO A;  3GEI A;  3CVL A;  2ZIS A;  2WZG A;  3SFY A;  4XX5 A;  3ZRH A;  2A5U A;  1T6I A;  3B0V C;  3JUE A;  4CDA A;  3KEZ A;  3ASN C;  3MZL B;  2V5Q C;  4GTS A;  1Q0K A;  2X6F A;  3QDN A;  2KXP C;  3LJN A;  4N39 A;  1ZZP A;  1WDY A;  3POV A;  1KT1 A;  2OV8 A;  1NZN A;  2EIK C;  4XI0 A;  2IYL D;  3RIP A;  4DX1 A;  4YDO A;  3HKK A;  2YQ8 A;  3PRZ A;  3F47 A;  1MNE A;  3LES A;  2WQH A;  2VYI A;  4DLQ A;  3KSL A;  4OYS A;  5BW8 C;  4MBG A;  4C0E A;  4Q5S F;  1LI5 A;  1E86 A;  3FEX A;  4B6I A;  3W8I A;  1H0A A;  5BUZ A;  1ZBP A;  3ZQY A;  3ASH A;  4KZC A;  1ZU4 A;  2H6F A;  4UUC A;  3AQC A;  5EK0 A;  2WXP A;  4XEV A;  1MQS A;  2QLA A;  2X6I A;  4I9C A;  5A6J A;  4B0Z A;  1OQC A;  4UQY A;  3MYI A;  1BR1 A;  3B7B A;  1H2V C;  3TWX A;  2WXL A;  5EID A;  5G05 C;  2KSF A;  3CSK A;  3M15 A;  1A7V A;  1QSP A;  256B A;  3UM2 A;  2JD3 A;  4G8K A;  4U95 D;  3IHY A;  3D9P A;  3K1I C;  5FQ4 A;  5CMY A;  5COM A;  3DKA A;  5HKP A;  2GAQ A;  4FLB A;  5C1D A;  3RQF A;  2KYH A;  2AVK A;  1SMY F;  5CBN A;  2R7W A;  3IBE A;  3NKE A;  4C3D A;  3KH2 A;  2YL0 A;  4JIO A;  2EIM E;  2OVB A;  2HS5 A;  1FCH A;  3FHE A;  5CBO A;  4DRJ B;  2H7V C;  2WPV A;  4LSZ E;  1TR2 A;  2BKK B;  3DBS A;  3JRT A;  3B0U X;  2R59 A;  2VGE A;  1YA7 O;  2YRF A;  3PNT B;  4M3O A;  4YDY A;  5G2N A;  3FXH A;  3FU0 A;  2GRP B;  2P58 C;  3QB2 A;  4HQD A;  5LCW J;  4EWC A;  3M4B A;  1S7Z A;  4DOZ A;  1SA4 A;  4I17 A;  3ZYK A;  2J8W A;  2X0C A;  4BJ1 A;  3JXJ A;  5G55 A;  1YDI A;  4JTA B;  4GU5 A;  2IO2 C;  2MHR A;  3ABK C;  4E6H A;  3S28 A;  5L0G A;  4Z9H A;  4OD5 A;  4HOT A;  3NB2 A;  3MX3 A;  2GW1 A;  2HYZ A;  3RRM B;  4DRH B;  2XQ0 A;  2XM0 A;  5LOZ A;  5L0F A;  3ITF A;  3T6B A;  2QYU A;  3EHR A;  1LS1 A;  4ANX A;  4AE4 A;  4CJO A;  2EPL X;  3FTY A;  5JHB A;  2R7Q A;  4JXT A;  5JSL A;  2L6B A;  1M56 C;  1OCO E;  3PS6 A;  3SI5 A;  3KPH A;  5DS5 A;  3U64 A;  3UKU G;  2FBN A;  2XLV A;  1JPN A;  2ILR A;  5G05 J;  3MKR A;  1JMW A;  3AS8 A;  3LDZ A;  2AU5 A;  2QYJ A;  2XEE A;  3EGX B;  4MND A;  3GZS A;  2HV7 A;  1FT2 A;  3RRN B;  3K9I A;  4PFP A;  4N5Q A;  3TJ5 A;  4NRH B;  3ZHE B;  5A6A A;  2MOW A;  4GA0 A;  2ETB A;  3PNL B;  2I9C A;  3IEG A;  1H6G A;  4XPX A;  3URZ A;  4BSX A;  5GPG B;  3HDX A;  4JD2 G;  1WOL A;  4HRM B;  3EFO A;  4PDX A;  4AE4 B;  1SZ9 A;  1U2V G;  3ZDL A;  4ATG A;  3ZXP A;  2YL3 A;  4KT6 B;  2OG2 A;  5KNH D;  1SF8 A;  2BE5 F;  3O55 A;  3RYL A;  1O1T A;  3Q6M A;  4O6Y A;  5T8I A;  5KYX A;  3MV2 B;  1C02 A;  3LS1 A;  3T9K A;  3VLF A;  2ZU6 B;  2WXG A;  1FVF A;  4XEK A;  2J9W A;  1OT8 A;  2PNN A;  3ZEF A;  4LDQ A;  5BNW A;  4GZC A;  2EIK E;  1QZ2 A;  3MEK A;  2DGJ A;  2KCV A;  3NMI A;  5J08 A;  2P6V A;  2V0P A;  2NSZ A;  3KL4 A;  4BT9 A;  2W45 A;  3Q7L A;  3V31 A;  2HFI A;  2C2L A;  3US6 A;  4CSA A;  1LTX A;  4GYT A;  4GA1 A;  4OVV A;  4EZL A;  1JPJ A;  3QOU A;  3ZYL A;  2J49 A;  1SVX A;  3UQ3 A;  1O87 A;  2WXQ A;  4OAU C;  1OKK D;  2DIW A;  4ULV A;  3D9N A;  4DXW A;  3L22 A;  2YIN A;  3AJM A;  4K1O A;  2LSU A;  3PZ2 A;  3FUF A;  2Y3D A;  3L17 A;  1LF8 A;  4F4B A;  4BJ5 A;  4H54 A;  1KU2 A;  3KYJ A;  4U8V D;  4IWB A;  1JCQ A;  4GTR A;  3ZYQ A;  4PFO A;  4ZLD A;  3QC1 A;  5JT4 A;  1ZW3 A;  2GFH A;  1K8K G;  3IV0 A;  2P9L G;  1LIH A;  3B13 A;  2WB2 A;  1TWC A;  3ZTZ A;  5CCL A;  4F3V A;  1X5B A;  4GTO A;  4GTQ A;  2B0O E;  1YCS B;  2KQ9 A;  5CI9 A;  3G2U A;  3S29 A;  1D9S A;  2Q9C A;  4BX8 A;  2OVF A;  5CEC B;  1V74 B;  1HW1 A;  2J09 A;  3DSW A;  1TWA A;  2XHE A;  3OXF A;  3ZKJ A;  1E8W A;  3ESL A;  3VTX A;  1Q2Z A;  1ZB1 A;  3C7J A;  4F1P A;  2CG3 A;  3SD5 A;  5E76 A;  4Y6W A;  3DPD A;  3EHM A;  2DZO A;  4PJM A;  2BL2 A;  4DLO A;  1N95 A;  2R17 C;  4DX2 A;  3EQL F;  4WWO A;  3C8Z A;  3C8G D;  4PS7 A;  5J90 A;  3Q9U C;  1VK5 A;  1X81 A;  2LXM A;  4CCA A;  4IAO A;  1YYJ A;  4O6M A;  5FQ7 A;  3ABK E;  1HMO A;  2NUT A;  3RH3 A;  5T3T A;  5BQI A;  3I5Q A;  2OJQ A;  3CVY A;  1D1C A;  2XLM A;  2GGF A;  1ZVZ A;  3ASD A;  3Q7A A;  4ANW A;  3TJP A;  2VSX E;  2XGS A;  2KCK A;  3C3O A;  3LJB A;  3Q7F A;  1RJ9 A;  3Q73 A;  3ULQ A;  2VSY A;  3Q49 B;  3OWT A;  5EX3 A;  3TK0 A;  4BEJ A;  3F6Q A;  4CT0 A;  3L16 A;  1WM5 A;  2B0J A;  3S7D A;  1RKE A;  3AG3 E;  2Y3B A;  5E33 A;  5KYY A;  2IJG X;  2X51 A;  3MKQ A;  2RFA A;  3IXE A;  3N2Z B;  4CEM A;  1OWM A;  4JKV A;  4I2Z A;  5BXU A;  4GA2 A;  1ORJ A;  4JHK A;  2XSE A;  4BJ5 C;  2IXM A;  4QI2 A;  4FU3 A;  4NC3 A;  4L7T A;  3VYW A;  1H6P A;  5KCM A;  2V5F A;  1JWG A;  2VTB A;  4N3C A;  4H4K C;  3C3Q A;  4L1B A;  4CDM A;  1QNF A;  3Q4A B;  2R2L A;  4Q96 A;  1N54 A;  2WXJ A;  1RKE B;  4JW1 A;  1IHB A;  3QWP A;  3LLK A;  3JQ1 A;  2Q4F A;  2P9I G;  3VRC A;  1CPQ A;  4D10 C;  4U5C E;  3QZC A;  2WQ6 A;  5DLJ A;  3QW1 A;  2Q7F A;  1MX4 A;  3ABL C;  1JCR A;  1K05 A;  1V55 C;  3SEO A;  3HXC A;  3GM3 A;  3OXG A;  4BT8 A;  3FDH A;  3C8G A;  2HR2 A;  2WVO A;  4U9D A;  3HNK A;  1FTS A;  1K1B A;  4CX9 A;  3D9M A;  3TOM A;  1WAT A;  1JR8 A;  1LVK A;  3UR3 C;  3VAY A;  4A55 A;  1IQU A;  2DYR E;  3UM3 A;  1OW7 A;  5DBK A;  5BQG A;  1XZQ A;  2GRQ B;  1T6U A;  3U9J A;  1K1A A;  2XEV A;  3CEX A;  5A6B A;  3OEO A;  3PZD A;  4GZ5 A;  2J46 A;  5D0O D;  4IYP A;  5FZR A;  4N2S A;  1VYK A;  2YWA A;  4EBB A;  4YND A;  3NYJ A;  3BQO A;  2AWC A;  2PF4 E;  4U9E A;  4WAB A;  2VGY A;  5L0I A;  3UT8 A;  3EH1 A;  3Q79 A;  3ABM E;  1WAO 1;  1BD8 A;  2UY1 B;  2ETC A;  4UI9 C;  2Y4U A;  1ZHX A;  1YVI A;  4HBD A;  3CVX A;  3ZGQ A;  2QY9 A;  3TWT A;  4OIQ F;  1B68 A;  3U8P A;  4U0U A;  3MJW A;  4A3T A;  4XPY A;  5AQB A;  4XLN F;  3FOP A;  4X8Q A;  1OWO A;  3SY2 A;  4Z9I A;  5L0J A;  3APF A;  2WB7 A;  2A69 F;  4GB9 A;  2VSO E;  2LD6 A;  1M57 C;  4WNF A;  1MX6 A;  2E2E A;  3QWW A;  3IQ5 A;  1D0Z A;  4MQ9 F;  3CHO A;  4O7G A;  3GZ2 A;  4Y6C A;  2WXI A;  3PHF 2;  3JSE O;  1KPS B;  4C3B A;  5AYW D;  4ANU A;  4XWJ A;  2IM8 A;  3ZWI A;  3GW4 A;  5KYN A;  3UI2 A;  2TMV P;  3RQG A;  4YT4 A;  4XE0 A;  4XZ4 A;  3UTM A;  3ECS A;  5DQT A;  3IQC A;  4LEU A;  4OIR F;  3CAX A;  1Z6T A;  3ZN3 A;  1NA0 A;  1BZ4 A;  2A6E F;  3WAQ A;  1UJK A;  4HFF B;  3MFN A;  3CLJ A;  3LLI A;  1S63 A;  3NQP A;  3FH5 A;  4RLY A;  4NIK A;  2PFD A;  4K5B A;  4DVY P;  3W9G A;  1VYI A;  2EIN C;  3FAP B;  2XLW A;  3SZR A;  1E7V A;  2QTV A;  3HIZ A;  3NZS A;  2HSQ A;  1LD8 A;  3HJC A;  3CGH A;  2W9Y A;  4D4N A;  2JX0 A;  3JXI A;  1HF8 A;  4GTM A;  3Q47 B;  3WHN A;  3DD7 A;  2HUJ A;  1N4S A;  4HS2 A;  2XXA A;  5FIO A;  1V54 E;  4JCH A;  1ZHT A;  5BQH A;  4KXK B;  1QQE A;  4B93 B;  4N6C A;  3FTV A;  1UOH A;  1E8X A;  2VCA A;  2NPU A;  3HNL A;  2YHS A;  1SA5 A;  3IKO B;  1OCC C;  1HU3 A;  5ARF A;  3DXK G;  2P9P G;  1PCX A;  2A0B A;  1UN8 A;  3FDQ A;  2RKK A;  3KAE A;  4NAC A;  1O1S A;  1N11 A;  2J7P D;  1KTM A;  5AEN A;  5B3S E;  2JLB A;  2KCL A;  1DCE A;  1FAP B;  4FJZ A;  2EIM C;  1KT0 A;  5HQ8 A;  4I1M A;  3HYM B;  2HSB A;  1YAU O;  4PJJ A;  1W2W A;  3L13 A;  1A5E A;  4FAD A;  1K40 A;  1H2T C;  2C04 A;  4UQX A;  1HG5 A;  4P9T A;  4LLC A;  5E2Q A;  3LY9 A;  4I6J A;  3D9O A;  3M4C A;  2GWW A;  3UKR G;  1J8Y F;  2VC9 A;  1NFI E;  2VGX A;  5CI8 A;  4KVM A;  4N3A A;  3RU0 A;  2GRM A;  2IY0 C;  3NYL A;  2Y4T A;  4GPK A;  3CHR A;  1SYQ A;  3G2W A;  1OUV A;  5CEA A;  2BF0 X;  1PC2 A;  4AVX A;  5CER B;  1HG2 A;  4MVZ A;  3L08 A;  4PS3 A;  3JRM O;  2HZ8 A;  4FLH A;  4F6R D;  2XL6 A;  3SXZ A;  2EIJ E;  3V79 K;  4HXI A;  4AV7 A;  1MMG A;  3IPM O;  1D0X A;  4WJ0 A;  3C18 A;  3E37 A;  3O4Z A;  1E8Z A;  2VAS A;  4KI2 A;  4ZLC A;  3Q15 A;  1D1B A;  4RD9 A;  1WN0 A;  3C3R A;  5JA4 D;  3W8H A;  2KC7 A;  2FO7 A;  5FTP A;  5FCL A;  1PAQ A;  3UIO C;  3K1I A;  1S0P A;  4J8F A;  3RFY A;  2F0Y A;  4MS2 A;  1WY6 A;  2ZXW E;  4Z68 A;  4BTA A;  4ANV A;  5KNG A;  4HVB A;  1JRA A;  4OIP F;  1Y8M A;  4CIP A;  2C03 A;  2X3M A;  3GYZ A;  1SR2 A;  3FU5 A;  2YZS A;  3LXU X;  2J9B A;  5HS0 A;  5L3Q A;  3UM1 A;  1I4Z A;  4PR9 A;  4U5H A;  5BV1 A;  3SO8 A;  3QMK A;  1Z5S C;  3NMJ A;  4JUR I;  2IU1 A;  4B94 A;  3PEU B;  1L5J A;  3JTL O;  5JRA A;  3GWN A;  3FMS A;  3FTS A;  3ULE G;  4A4A A;  3SFX A;  3ZVV A;  3FHD A;  1Z63 A;  1HFA A;  3FP3 A;  4U63 A;  1S64 A;  2PQN A;  2XLH A;  3FUD A;  1PY1 A;  1UJJ A;  2OND A;  3E33 A;  1Y6I A;  3RKV A;  2X38 A;  4CZ2 D;  2L6H A;  2EIN E;  5CRV A;  3TXN A;  3GEH A;  1TNU A;  3BG1 B;  4LNG A;  3S27 A;  4N06 A;  3QVY A;  4MLP A;  5E3A A;  2L6F A;  1WWP A;  4EUK B;  1R4T A;  1Q0D A;  2UUI A;  1UW4 B;  4MTG A;  1O5M A;  3EZI A;  2MYO A;  3ZNG A;  5T4Y A;  2FFH A;  4J7Y A;  3RKO F;  3VLE A;  3FUE A;  4NY3 A;  4IB4 A;  1CPR A;  2R7S A;  3CVU A;  3Q75 A;  4GMR A;  3TWU A;  3TWS A;  1BLX B;  3ZW3 A;  4W9R A;  2QUP A;  4V3I A;  4NCQ A;  1H19 A;  3FUL A;  3CVW A;  4XPW A;  1O5H A;  1OCC E;  4JE9 A;  2P1A A;  3B0P A;  4BES A;  2IOS A;  4JPS A;  1EPU A;  3ZG1 A;  1H6O A;  4JCZ A;  4J8D A; 
#chains in the Genus database with same CATH homology
 3JCK C;  2LO6 A;  2L6J A;  2XCC A;  3CQC B;  3CEQ A;  3LKU A;  5A7D B;  3FY4 A;  2VH3 A;  1JWF A;  4LCT A;  4FC8 A;  2G3V A;  2WVN A;  4HOR A;  4KNV A;  4DBQ A;  2DBA A;  1OWL A;  2Q9B A;  4FJY A;  2J08 A;  2R7V A;  2WVQ A;  4JHJ A;  5KYW A;  1OCR C;  3Q7G A;  3LEV A;  5D91 A;  2Q9A A;  2J4B A;  3RJV A;  3CV0 A;  4G2V A;  4JZA A;  4F53 A;  4A1S A;  5T3W A;  4GYW A;  1ZYR F;  1P5Q A;  2LAI A;  4N2Q A;  4AOF A;  4AY6 A;  3UMH A;  3AG3 C;  4WWN A;  3AU4 A;  4YT2 A;  5FZQ A;  1HX8 A;  3MCX A;  5KJM A;  2BUG A;  4FX5 A;  4EZJ A;  4HLE A;  4I44 A;  1INZ A;  3NDB B;  3ONL A;  1BR4 A;  3EZH A;  1MHQ A;  2GRL A;  3ESK A;  2ZXP A;  4HEA J;  2CDQ A;  3UGP A;  1EF1 C;  3OXL A;  4CBE A;  3DZA A;  2MYS A;  3GZ1 A;  5EKQ D;  4DI4 A;  2PL2 A;  2XCB A;  1E96 B;  2VB6 A;  2ZXO A;  1XGW A;  3KMI A;  4LUN U;  3R7R A;  1A17 A;  3DAG A;  4U5B E;  1ZHZ A;  1TWG A;  4E7S A;  5KYU A;  4AP2 A;  2PZI A;  2I1K A;  3CVQ A;  3EFO B;  4OD4 A;  1IYG A;  3ML8 A;  2FEZ A;  4GEH A;  4QDL A;  3KD7 A;  4J32 B;  2P7V A;  2DYR C;  1ZU2 A;  1M2V A;  4WAF A;  3DJU B;  1HE8 A;  5KYX B;  3UMK A;  3RK6 A;  1E8Y A;  5E3C A;  3TD7 A;  4JJG A;  4W8K A;  2KM4 A;  3CK7 A;  2D5R B;  3ZYM A;  3SFZ A;  5EDS A;  3ASG A;  3ABM C;  3EG9 A;  2G3K A;  4UWK A;  1MMN A;  1BR2 A;  3N71 A;  2X6H A;  1M2V B;  5DS4 A;  4YJW A;  2V8S E;  5EHH A;  2WQ7 A;  4JA9 A;  5KJL A;  4GMJ A;  5FQ6 A;  4JEH A;  1TWH A;  4WWP A;  4HOS A;  1QLE C;  1HS6 A;  4F1S A;  1QZX A;  4U5G A;  4DBR A;  4Q4Z F;  1IW7 F;  1EDU A;  4I3M A;  3N0T A;  2A1D D;  1Z23 A;  3CVN A;  1Z3I X;  3HLZ A;  3ASF A;  4RBN A;  2KAT A;  4BTB A;  3I4R B;  2CFU A;  3ML9 A;  2QY7 A;  2VJ8 A;  5JJ6 A;  4AXH A;  3UUX A;  4YT8 A;  2V3C C;  1E7U A;  1GW6 A;  1OKK A;  2YHC A;  5BUO A;  2XL4 A;  3B9Q A;  3ZIB A;  2H7B A;  2AXV A;  3LPZ A;  3GOD A;  3S7B A;  3LCA A;  4FES A;  3FTX A;  4KBL A;  2NUT B;  3H65 A;  4L23 A;  3EDT B;  1FFH A;  2J0W A;  2WVI A;  1N52 A;  4C3E A;  1V54 C;  2IXN A;  1RJ9 B;  4J0U A;  4CS8 A;  5KYY B;  3MKQ B;  3CSF A;  3FH8 A;  3C98 A;  1MMA A;  3E4B A;  3S0X A;  4LRZ A;  3K6B A;  4PK4 A;  5B3S C;  4I6G A;  3T6J A;  5AIJ A;  1WGW A;  4ME2 A;  3CQG B;  2VTB B;  4CS9 A;  4WUY A;  2A4Z A;  2CG2 A;  5JJ7 A;  3L0I A;  3O39 A;  4UWH A;  2EQX A;  3FUK A;  3ZXS A;  2RG8 A;  3FTU A;  1U3C A;  2Z15 A;  1EYH A;  4JHR A;  5ANR A;  3K1H A;  4UI9 K;  3PVL A;  3PE3 A;  1ELR A;  4ACK A;  3AS5 A;  2EIJ C;  3BEE A;  3X1O A;  4B8C B;  3HTK C;  4GZD A;  5B1A C;  2IF4 A;  2A68 F;  2L9B A;  3MGB A;  4G0H A;  3RO3 A;  2WXF A;  4RG6 A;  4ANJ A;  3PUK A;  3QK0 A;  3U9W A;  4CS7 A;  4XTK A;  3JCU Q;  2XPZ A;  1D0Y A;  1VMA A;  1OWP A;  2ZXW C;  4CS8 C;  4GCN A;  3QNK A;  3T8M A;  1Z5Z A;  4DVZ A;  4G1T A;  4XI9 A;  3CHM A;  3QKY A;  3JYH A;  4BWR A;  4AIF A;  1TKN A;  2WXH A;  1OCZ C;  3AG2 C;  3FUI A;  4CS9 C;  2IXP A;  3W2W A;  3K7D A;  4G7O F;  1NA3 A;  3FUH A;  3LY8 A;  2J9V A;  3LS8 A;  2X6K A;  2WMO A;  5ANL A;  4XKC A;  4PH4 B;  2MHK A;  4UI9 J;  4GYY A;  2WXR A;  4B8A A;  4I43 A;  2J9U A;  3NKD A;  4GZ6 A;  4Q7C A;  3CKB A;  2R7U A;  2L0T B;  3DM5 A;  5T1D B;  4BJ6 A;  2IXO A;  3ENE A;  1FFT C;  3SBS A;  2WZF A;  3PE4 A;  4ABN A;  1TEZ A;  4LLE A;  3B7U X;  1MMD A;  4MS6 A;  1ELW A;  3HVE A;  4YT5 A;  3D9J A;  1ZU5 A;  3OAW A;  1TJF A;  4APO A;  3EPV A;  3E9V A;  3DXJ F;  5A6C A;  3WXX A;  4PJN A;  2XXA B;  3G2T A;  4C0M A;  1HXI A;  4DI3 A;  2XPI A;  2I1J A;  3LVR E;  4FHK A;  1IQR A;  3CVV A;  1KLX A;  2L0I A;  2G62 A;  3IHV A;  3EGD A;  5DQZ A;  2Y3A A;  3DM9 B;  3HVE B;  3F46 A;  3EJN A;  3APD A;  2IOL A;  5EX0 A;  2CNW D;  4L2Y A;  2O9X A;  3UPV A;  2PM6 A;  2W4M A;  5D92 A;  2FUL A;  3I4G A;  4C7O A;  1FMW A;  4G11 A;  3S7F A;  1Z6A A;  3PMR A;  4I6E A;  4DK5 A;  2FF4 A;  5FQ8 A;  4GAA A;  4I1A A;  2KZT A;  2VGX B;  1Z3Y A;  4AM9 A;  2YNQ A;  3B7T A;  2H7O A;  4APF A;  4BJ6 C;  5AJD A;  2HV6 A;  4P6I C;  5CMW A;  4OIN F;  1M2O A;  3QWV A;  3FTZ A;  4M63 A;  2FI7 A;  3TGO A;  2AVP A;  3FAJ A;  3UX4 A;  3CHP A;  4NUR A;  1ZHW A;  2J7P A;  3JQ0 A;  4C7O B;  2XRY A;  5FZS A;  3DJN B;  4CGW A;  4IRU A;  5ENN A;  3ZSU A;  3R9A B;  3OA1 A;  3FUN A;  5KJN A;  2CHW A;  4I9E A;  5ARG A;  2R7X A;  1TJC A;  4HOU A;  3SYN A;  3NYM A;  2WM9 A;  4F7A A;  4HOQ A;  2WXN A;  3DMD A;  3CHQ A;  4G7Z F;  2CNW A;  4G25 A;  3LS0 A;  4Q94 A;  2Y69 C;  3AQB A;  4H7X A;  5LCW C;  4L2L A;  1NZE A;  4WND A;  4YVO A;  3QJZ A;  2OOE A;  3BG0 B;  2C0M A;  1NG1 A;  4ILH B;  4KMO A;  3FVY A;  3D9I A;  5DVW A;  5AJL A;  4G7H F;  2MWQ A;  4FA6 A;  3PEV B;  3D3M A;  4J8E A;  2IFU A;  3LJ3 A;  3CIA A;  4TV3 A;  3LYA A;  2ZXR A;  4U0S A;  2W4B A;  4WNG A;  1MND A;  4EEC A;  5FJY A;  4UWL A;  5LFA A;  2E0I A;  4CT4 A;  4IJJ A;  3M1C B;  2WXO A;  3D9K A;  2UWJ G;  2XGM A;  3E70 C;  4U04 A;  2L81 A;  2X6J A;  4RG9 A;  3WOD F;  4JL0 A;  4BX9 A;  3TL5 A;  5EGY A;  1SQM A;  2XPY A;  2AW6 A;  2LNI A;  1OWN A;  3EGX A;  2AXZ A;  3LVQ E;  3ZHE A;  3FWV A;  3CK8 A;  4RDA A;  4WNE A;  4JEU A;  4U0Z A;  5KYW B;  5LP0 A;  3D9L A;  1PD0 A;  4JVS A;  1HO8 A;  3SGH A;  4GZ3 A;  3FFL A;  4ACL A;  2FGY A;  4O6N A;  2NC9 A;  2C0L A;  5JJT A;  4BJT A;  1W3B A;  3NF1 A;  1Z3X A;  3FEY A;  4ILG A;  4O79 A;  3CKC A;  4J8S A;  3V7O A;  3TXM A;  2I8B A;  2WZL A;  2AXU A;  5FT9 A;  2Y39 A;  4K03 A;  5A23 A;  2J0X A;  3LY7 A;  3APC A;  5M72 A;  4C9B B;  4A1G A;  2J45 A;  4U07 A;  1YA0 A;  3JSZ A;  3SZ7 A;  4EPZ A;  3R7Q A;  3O48 A;  4AJW A;  3JUI A;  3TG5 A;  3L6A A;  3NG1 A;  2DCP A;  4LAC B;  3UGO A;  2LSE A;  2OCC C;  1PD1 A;  3ZVR A;  3SHF A;  4J30 B;  2I6H A;  5KYU B;  4BG0 A;  3PH0 C;  4OVU A;  4U5E E;  3KKB A;  5HI7 A;  2NXP A;  4JA7 A;  4BY6 A;  4JC8 A;  5E75 A;  3UMI A;  4UWG A;  3ZIM A;  2NUP A;  1UG3 A;  4QI0 A;  4H7Y A;  1SZI A;  2WL8 A;  3CHS A;  4FUL A;  4G24 A;  4CRW A;  1ZHY A;  5IY5 C;  3EG9 B;  3U4T A;  4MRU A;  5BV0 A;  4YVQ C;  3L34 A;  3PRE A;  4J6I A;  4I2W A;  3FUM A;  3LAY A;  4N3B A;  4IUL A;  4URK A;  4CIH A;  2R5S A;  3O6X A;  4U5F E;  4PS8 A;  3EIQ C;  3RO2 A;  2NG1 A;  3QAR A;  4JJF A;  2BTD A;  2NUP B;  3PDN A;  4HE8 D;  1NU7 D;  4A2N B;  4QFV A;  3P1U A;  5B1B C;  4AX2 A;  4YWQ A;  3CVP A;  2LAH A;  2WXK A;  3FU3 A;  1IZM A;  2ION A;  3PUJ A;  3TG4 A;  4KC9 A;  4PJL A;  4GCO A;  2CW0 F;  4EBA A;  4GML A;  2XGO A;  4CSA C;  3SNX A;  1ELK A;  3FUJ A;  4G26 A;  3I4U A;  3OTN A;  2M4E A;  1UN9 A;  3VTY A;  2E87 A;  3AG4 C;  2QFC A;  4TUU A;  4XIF A;  3SP1 A;  2CHZ A;  1IHG A;  5T3R A;  2KNH A;  1NP7 A;  3ASO C;  2WXM A;  3RRU A;  4KBQ A;  3KS2 A;  5F5H A;  4OIO F;  3S2A A;  3CST A;  3EHN A;  3U66 A;  4UQZ A;  2XRH A;  3SBT B;  1NU9 C;  3UMV A;  3EH2 A;  3CQZ A;  5C2Y A;  2YHE A;  4CGV A;  5DS6 A;  4FWV A;  4NQ0 A;  4EBA G;  1H2U A;  2DYS C;  3SNH A;  5LX8 A;  3MA5 A;  2PP4 A;  4GYO A;  3GAN A;  3DAF A;  2UY1 A;  2IQC A;  1DVP A;  3JT1 A;  5HSW A;  4LER A;  2AWI A;  3Q5M A;  3S7J A;  5D0Q D;  3G2V A;  1DNP A;  4PUC A;  4A3V A;  3L54 A;  2JEK A;  4KYO B;  1JPL A;  2XRZ A;  2CHX A;  3IEE A;  2EIL C;  4FP7 A;  5L3V A;  4KNW A;  4TRQ A;  5JHA A;  2PM7 A;  3CZ6 A;  2CFZ A;  3NRH A;  2ZPA A;  3I5P A;  5F5F A;  5G04 C;  1E90 A;  3N24 A;  3X2Q C;  4RVB A;  2R7T A;  3WG7 C;  2CGE A;  4DPR A;  5FWQ A;  3RIB A;  4Q69 A;  4K7B A;  4EZK A;  3LEW A;  2PX3 A;  1HZ4 A;  4HFK B;  2VQ2 A;  5BPP A;  1HH8 A;  4JZY A;  2PQR A;  4DJA A;  2J4D A;  4RSY A;  3LNR A;  2Y3G A;  2MRI A;  2R7O A;  4CDR A;  3SF4 A;  4E7Z A;  1D1A A;  5CCM A;  2VSN A;  3UNG C;  4AY5 A;  4CDN A;  4UWF A;  1SZA A;  1FMV A;  1LKX A;  3UT4 A;  3CR3 A;  3HHM A;  3FTW A;  5CHE E;  2Y3H A;  4KZ0 A;  3EIJ A;  1BPO A;  1J8M F;  1JUQ A;  5G04 J;  2HO1 A;  2LSV A;  3MYV A;  3NZU A;  3FH7 A;  3QAQ A;  4R7L A;  1G8X A;  3K33 A;  1VDY A;  2WMN A;  1VOM A;  2V26 A;  3T5X A;  4E85 A;  3MLG A;  3TAX A;  4AEZ C;  5KJK A;  3ONK A;  2KW3 C;  4IN3 B;  1ST6 A;  2RD0 A;  4B89 A;  4AK9 A;  4N5C A;  3B7R L;  4ILI A;  4XLP F;  2J07 A;  2KGO A;  2L9J A;  4FHJ A;  1B89 A;  3Q6N A;  4G23 A;  4P29 A;  3CK9 A;  4XKB A;  3VLD A;  2V4L A;  5BT1 A;  3T5V A;  4BFR A;  3FU6 A;  4I1O B;  4U8H A;  3EGD B;  3T4R A;  2YEV A;  2R7R A;  1N1C A;  4K0D A;  4X0R A;  3ZFW A;  2Q3T A;  3AU5 A;  3B7S A;  3P2B A;  2PX0 A;  1OCO C;  3AS4 A;  3JYS A;  2I2O A;  3UT7 A;  4EQF A;  4HFG A;  4O6F A;  3ZC4 A;  2M63 A;  4YN0 B;  2IOQ A;  3AG1 C;  1XNF A;  4ULW A;  3I3N A;  4MKT A;  3K66 A;  2HM8 A;  4K0R A;  2KZT B;  3ZPJ A;  2J9Q A;  1U3D A;  4U5D E;  1H6K A;  3U3W A;  2KJG A;  1FVH A;  2A6H F;  3MV3 B;  5DIZ A;  3W2V A;  3G2S A;  4KVO A;  3CVL A;  2WZG A;  4XX5 A;  3ZRH A;  2A5U A;  3B0V C;  3KEZ A;  3ASN C;  3MZL B;  2X6F A;  3QDN A;  4N39 A;  3POV A;  1KT1 A;  2OV8 A;  1NZN A;  2EIK C;  4XI0 A;  2IYL D;  3RIP A;  2YQ8 A;  3PRZ A;  3F47 A;  1MNE A;  3LES A;  2WQH A;  2VYI A;  4DLQ A;  4OYS A;  5BW8 C;  4C0E A;  4Q5S F;  3FEX A;  4B6I A;  3W8I A;  1H0A A;  5BUZ A;  1ZBP A;  3ASH A;  4KZC A;  1ZU4 A;  3AQC A;  2WXP A;  1MQS A;  2X6I A;  4I9C A;  4B0Z A;  4UQY A;  1BR1 A;  1H2V C;  2WXL A;  5G05 C;  3CSK A;  2JD3 A;  3IHY A;  3D9P A;  3K1I C;  5FQ4 A;  5CMY A;  4FLB A;  5C1D A;  1SMY F;  2R7W A;  3IBE A;  3NKE A;  4C3D A;  3KH2 A;  2OVB A;  1FCH A;  3FHE A;  2H7V C;  2WPV A;  1TR2 A;  3DBS A;  3JRT A;  3B0U X;  2R59 A;  3PNT B;  4M3O A;  5G2N A;  3FU0 A;  5LCW J;  2P58 C;  3QB2 A;  4EWC A;  1S7Z A;  4DOZ A;  4I17 A;  3ZYK A;  4BJ1 A;  5G55 A;  4GU5 A;  4E6H A;  3ABK C;  3S28 A;  4OD5 A;  4HOT A;  3MX3 A;  2GW1 A;  2HYZ A;  3RRM B;  2XQ0 A;  5LOZ A;  3ITF A;  3T6B A;  1LS1 A;  4ANX A;  4AE4 A;  3FTY A;  5JHB A;  2R7Q A;  4JXT A;  1M56 C;  3PS6 A;  3SI5 A;  5DS5 A;  3U64 A;  2FBN A;  1JPN A;  2ILR A;  5G05 J;  3MKR A;  3AS8 A;  3LDZ A;  3EGX B;  4MND A;  3GZS A;  2HV7 A;  3RRN B;  3K9I A;  4PFP A;  4NRH B;  3ZHE B;  2MOW A;  4GA0 A;  3PNL B;  2I9C A;  3IEG A;  3URZ A;  4BSX A;  3HDX A;  3EFO A;  4PDX A;  4AE4 B;  1SZ9 A;  4ATG A;  4KT6 B;  2OG2 A;  1SF8 A;  2BE5 F;  3RYL A;  3Q6M A;  4O6Y A;  5T8I A;  5KYX A;  3MV2 B;  3LS1 A;  3VLF A;  2ZU6 B;  2WXG A;  1FVF A;  2J9W A;  3ZEF A;  5BNW A;  4GZC A;  1QZ2 A;  3MEK A;  2DGJ A;  2KCV A;  5J08 A;  2P6V A;  2V0P A;  2NSZ A;  3KL4 A;  4BT9 A;  2W45 A;  3Q7L A;  2C2L A;  4CSA A;  4GYT A;  4GA1 A;  4OVV A;  4EZL A;  1JPJ A;  3QOU A;  3ZYL A;  2J49 A;  3UQ3 A;  1O87 A;  2WXQ A;  1OKK D;  2DIW A;  3D9N A;  3L22 A;  2YIN A;  2LSU A;  3FUF A;  2Y3D A;  3L17 A;  1LF8 A;  4F4B A;  4BJ5 A;  1KU2 A;  4IWB A;  3ZYQ A;  4PFO A;  4ZLD A;  3QC1 A;  2GFH A;  3IV0 A;  3B13 A;  2WB2 A;  1TWC A;  5CCL A;  4F3V A;  1X5B A;  2KQ9 A;  5CI9 A;  3G2U A;  3S29 A;  2Q9C A;  4BX8 A;  2OVF A;  2J09 A;  1TWA A;  2XHE A;  3OXF A;  1E8W A;  3ESL A;  3VTX A;  2CG3 A;  3SD5 A;  5E76 A;  4Y6W A;  3DPD A;  3EHM A;  4PJM A;  4DLO A;  2R17 C;  3EQL F;  4WWO A;  4PS7 A;  5J90 A;  1VK5 A;  4CCA A;  4IAO A;  4O6M A;  5FQ7 A;  2NUT A;  3RH3 A;  5T3T A;  3I5Q A;  3CVY A;  1D1C A;  2GGF A;  3ASD A;  4ANW A;  3TJP A;  2VSX E;  2XGS A;  2KCK A;  3LJB A;  1RJ9 A;  3ULQ A;  2VSY A;  3Q49 B;  3OWT A;  5EX3 A;  4BEJ A;  4CT0 A;  3L16 A;  1WM5 A;  2B0J A;  3S7D A;  2Y3B A;  5E33 A;  5KYY A;  2IJG X;  2X51 A;  3MKQ A;  3N2Z B;  4CEM A;  1OWM A;  4I2Z A;  4GA2 A;  4JHK A;  2XSE A;  4BJ5 C;  2IXM A;  4QI2 A;  4FU3 A;  4L7T A;  3VYW A;  5KCM A;  2V5F A;  1JWG A;  2VTB A;  4N3C A;  4H4K C;  4L1B A;  4CDM A;  1QNF A;  3Q4A B;  4Q96 A;  1N54 A;  2WXJ A;  4JW1 A;  3QWP A;  3LLK A;  3JQ1 A;  4D10 C;  4U5C E;  3QZC A;  2WQ6 A;  5DLJ A;  2Q7F A;  3ABL C;  1V55 C;  3SEO A;  4BT8 A;  3OXG A;  3FDH A;  2HR2 A;  2WVO A;  1FTS A;  3D9M A;  1LVK A;  3UR3 C;  3VAY A;  4A55 A;  1IQU A;  5DBK A;  2XEV A;  3PZD A;  4GZ5 A;  3OEO A;  2J46 A;  5D0O D;  4IYP A;  5FZR A;  4N2S A;  1VYK A;  4YND A;  4EBB A;  3NYJ A;  2PF4 E;  2VGY A;  3UT8 A;  3EH1 A;  1WAO 1;  2UY1 B;  4UI9 C;  2Y4U A;  1ZHX A;  3CVX A;  3ZGQ A;  2QY9 A;  4OIQ F;  4U0U A;  3MJW A;  4A3T A;  4XLN F;  1OWO A;  3APF A;  2WB7 A;  2A69 F;  4GB9 A;  2VSO E;  1M57 C;  4WNF A;  2E2E A;  3QWW A;  1D0Z A;  4MQ9 F;  3CHO A;  4Y6C A;  4O7G A;  3GZ2 A;  2WXI A;  3PHF 2;  4C3B A;  5AYW D;  4ANU A;  4XWJ A;  3GW4 A;  5KYN A;  4YT4 A;  4XE0 A;  4XZ4 A;  3ECS A;  5DQT A;  4LEU A;  4OIR F;  3ZN3 A;  1Z6T A;  1NA0 A;  2A6E F;  1UJK A;  4HFF B;  3CLJ A;  3LLI A;  3NQP A;  3FH5 A;  2PFD A;  4DVY P;  1VYI A;  2EIN C;  1E7V A;  3SZR A;  2QTV A;  3HIZ A;  3NZS A;  3HJC A;  3CGH A;  2W9Y A;  1HF8 A;  3Q47 B;  3DD7 A;  4HS2 A;  2XXA A;  4JCH A;  1ZHT A;  4KXK B;  1QQE A;  3FTV A;  1E8X A;  2YHS A;  3IKO B;  1OCC C;  1HU3 A;  5ARF A;  1PCX A;  1UN8 A;  3FDQ A;  3KAE A;  4NAC A;  2J7P D;  5AEN A;  2JLB A;  2KCL A;  4FJZ A;  2EIM C;  1KT0 A;  5HQ8 A;  4I1M A;  3HYM B;  4PJJ A;  1W2W A;  3L13 A;  4FAD A;  1H2T C;  2C04 A;  4UQX A;  1HG5 A;  4LLC A;  5E2Q A;  3LY9 A;  4I6J A;  3D9O A;  1J8Y F;  2VGX A;  5CI8 A;  4KVM A;  4N3A A;  3RU0 A;  2GRM A;  3NYL A;  2Y4T A;  4GPK A;  3CHR A;  3G2W A;  1OUV A;  2BF0 X;  1PC2 A;  4AVX A;  1HG2 A;  3L08 A;  4PS3 A;  4FLH A;  4HXI A;  4AV7 A;  1MMG A;  1D0X A;  4WJ0 A;  3O4Z A;  1E8Z A;  2VAS A;  4KI2 A;  4ZLC A;  3Q15 A;  1D1B A;  4RD9 A;  3W8H A;  2KC7 A;  2FO7 A;  5FTP A;  5FCL A;  1PAQ A;  1S0P A;  4J8F A;  3RFY A;  1WY6 A;  4BTA A;  4ANV A;  4HVB A;  4OIP F;  1Y8M A;  2C03 A;  3GYZ A;  2X3M A;  3FU5 A;  2YZS A;  3LXU X;  5L3Q A;  4U5H A;  5BV1 A;  3QMK A;  4JUR I;  2IU1 A;  4B94 A;  3PEU B;  1L5J A;  3FTS A;  3ZVV A;  3FHD A;  1Z63 A;  1HFA A;  3FP3 A;  4U63 A;  2PQN A;  3FUD A;  1PY1 A;  1UJJ A;  2OND A;  1Y6I A;  3RKV A;  2X38 A;  3TXN A;  3BG1 B;  4MLP A;  3S27 A;  4N06 A;  5E3A A;  1UW4 B;  3EZI A;  5T4Y A;  2FFH A;  3RKO F;  3VLE A;  3FUE A;  4NY3 A;  2R7S A;  3CVU A;  3ZW3 A;  4W9R A;  4V3I A;  1H19 A;  3FUL A;  3CVW A;  1O5H A;  3B0P A;  2IOS A;  4JPS A;  1EPU A;  3ZG1 A;  4J8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...