4I1OB

Crystal structure of the legionella pneumophila gap domain of lepb in complex with rab1b bound to gdp and bef3
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
291
structure length
280
Chain Sequence
PLTLLMTSSTSFSETINQWADILKTMEKFDSNPINLLELVKQFNLYVDELAITCEANNVWASTPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCAAHADSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSFAEPNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of Rab1b deactivation by the Legionella pneumophila GAP LepB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/hydrolase
molecule keywords Ras-related protein Rab-1B
total genus 101
structure length 280
sequence length 291
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
B PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4i1oB01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i1oB02
4JW1A 4I1MA 4I1OB 4IRUA 4JVSA
chains in the Genus database with same CATH superfamily
2H6FA 2LAHA 2QNLA 3G2WA 2L9JA 3AG3E 4R32A 4WWPA 1OCRE 3NG1A 1MMGA 4OD5A 4HFKB 3S28A 2R7XA 4XPXA 4H7YA 4U5EE 5IY5E 4M3OA 2KCVA 1N52A 5JJ6A 4PFOA 1TN6A 2V4HC 4BT9A 4NCQA 1D8EA 2Y3AA 3NMJA 3K9IA 3O55A 2BE5F 2I1JA 1NA3A 5KNGA 4P9TA 3UPVA 3PZDA 3C8GA 2P9PG 2L9BA 3HG0D 4AJWA 4CDVA 4OIOF 3RQFA 4XPYA 4H54A 3KMIA 1BI8B 1HO8A 5KYUB 5JP7A 3ESLA 3FXHA 3U64A 5KJMA 3H2UA 4XLNF 4YT8A 1E8WA 2PP4A 2PX0A 3PZ1A 4UWLA 4IAQA 2WXJA 1ZU4A 2VSXE 4GYTA 4WAFA 4OIPF 3F47A 3TJ6A 4YVOA 5A6CA 2XM0A 3NMKA 3EU5A 4LG6A 2Y4UA 4K5CA 5BW8C 4C7OA 5BV0A 5FQ4A 5C2YA 4BPMA 1YYXA 2WXLA 1Z63A 3LS8A 2PNNA 1UOHA 3BG1B 1SMYF 3CSKA 1A41A 2KC7A 3S29A 3L9TA 4XI9A 2XXAA 4MVUA 3U9MA 1WY6A 3U9JA 2R59A 4HBDA 4JZAA 3L17A 1U3CA 3ASNE 2IFUA 3WXXA 1OWMA 1YZCA 4N4WA 3BEHA 3KH2A 1DNPA 3LNRA 5JJTA 3HXEA 2CNWA 3DEOA 1YA9A 5FTPA 4A1SA 1SA4A 1BU9A 1FFHA 1L5JA 3UT7A 5ITZF 3Q4AB 1NU9C 1ZU2A 4WNGA 4CDMA 3TGOA 4JJFA 3FUIA 3HXDA 1RJ9B 2P9KG 2LK4A 3Q7GA 2XPZA 4WUYA 4JC8A 4M7CA 5G04J 3WG7C 3NB2A 4N3CA 3UGOA 2R7VA 2YHCA 4CT0A 3ZXPA 5TJ5E 1MZCA 3NF1A 4TXRA 3VLDA 2PX3A 4HOTA 2EIJC 3SZ7A 3ENEA 1ELKA 5T8IA 4WJ0A 5L0FA 1WASA 2R7UA 3SY2A 4RD9A 2L0TB 2OVBA 4OINF 3MBGA 4CDAA 1IHGA 4O1OA 1H2UA 3NYLA 5EIDA 1J8YF 2R7WA 2XLHA 2QUPA 1ZHTA 4CS8C 2Y0BG 1VYIA 1G4WR 3EG9B 3S7BA 2R25A 3DE9A 5DQTA 1NBBA 1AVOB 2EPLX 5DBKA 4MVOA 4FC8A 2XM4A 3FDQA 4CDRA 4HOUA 3C18A 1LTXA 2H8AA 3M4BA 2XLMA 2WXGA 1WOLA 3AGUA 2DCPA 2JLBA 1T9KA 3L08A 3TOLA 2YLDA 4K1OA 4NACA 3LNMB 5COFA 4IARA 2FI7A 3UIPC 1WAO1 4AP2A 3KSQA 2EIKC 4IGGA 2ZPAA 5L0IA 3FULA 4R7LA 3W2VA 4ANJA 1PCXA 5L0JA 2XCCA 2H6GA 1YCSB 5EDSA 2GROB 2KSFA 3TWVA 3RVZA 2X6IA 3ASDA 3S7DA 3RRNB 3PNLB 3JYYA 5JSLA 4YJWA 3HXBA 1KNYA 2RG8A 3LAYA 4LRZA 1GM5A 3WHNA 1LS1A 4DVZA 4BEPA 1WM5A 2KZTA 1LPEA 2YNQA 2IXOA 4O6NA 3CV0A 4BTBA 1YAUO 2R7SA 5JA4D 1KZOA 2ILRA 1T6QA 3TG5A 4Z68A 3X1OA 3T9KA 1H6KA 4YL1A 3CHSA 2Q3TA 3UI2A 3EFOA 5EHHA 1O5MA 4LDRA 3HVEB 1OWPA 4RG9A 1SA5A 2P1AA 3ZTZA 1S0PA 2EILE 4I43A 3IQ6A 1LM3B 2GGFA 2MOWA 3FTZA 5JHAA 2CHZA 3Q6MA 2HMZA 5J08A 3ONLA 4U0ZA 3V5XA 2ASRA 2YQYA 3DXKG 4GZ5A 1Q2ZA 3EGXA 2GFHA 4GA2A 4CEMA 3ZYQA 4AIFA 4Y6CA 1HW1A 1H9TA 1T6IA 2ONDA 3SFXA 1AEPA 1MX2A 3C3RA 3DRAA 2IO2C 4F7AA 2B6CA 4GPKA 4CCAA 4MW3A 4Z9JA 3FTSA 3OAWA 4O60A 3GEIA 3AJMA 4CS8A 4F3VA 1JMWA 3R7QA 2VGXB 3HDXA 3P2BA 1AUEA 4AXHA 2FBNA 1DCEA 3B9QA 4IULA 4U5FE 2V4LA 2P2CP 1FMWA 2OEWA 1S05A 1JPLA 3I4GA 1OR2A 3R2PA 1NG1A 2I6HA 1EF1C 1TFOB 5CIVA 3HRAA 4AX2A 4XIFA 3T6JA 3T8KA 1EKYA 2WMOA 3KSLA 3O39A 4BJTA 2XCBA 5FQ6A 3Q9UC 3ECSA 5CHEE 5ARFA 1UW4B 5CERB 3QW0A 4I44A 3UXGA 3K1IC 3QMKA 4UI9K 2HO1A 3MZLB 4DXWA 3DJUB 3NOCD 1RKEA 4L2YA 3FUDA 2EIJE 3B7RL 2XQ0A 4EBAA 4JRZA 4AV7A 1NL4A 5J90A 1W2WA 2XGOA 4W8PA 2J7PA 2JABA 1H2TC 2A0UA 4GZCA 3VTXA 2L6FA 2YL3A 2DYSC 1GW6A 3LS0A 2KW3C 2P58C 3EJNA 4JE9A 4WNDA 4YT4A 4J7TA 3MGBA 4XEKA 4NTAA 1G8XA 3PZ4A 4NQFA 3CGHA 5F5HA 2QYJA 4QI2A 3UIOC 3CVWA 3C5RA 2AXUA 3FTVA 2W9YA 4HS2A 4DI4A 5B3SC 3CHRA 1CPQA 1RCPA 4APFA 4EPZA 3KYIA 5LP0A 5L0HA 4Q96A 4U7EB 5KNHD 2G3KA 1HE8A 1TNZA 3UMIA 3LVQE 3AU5A 1K1AA 4X8QA 5FZTA 3QWPA 4U07A 2R17C 1UN8A 1TR4A 2L81A 1XZPA 2JEKA 4CRWA 5EX3A 2H6IA 5EIBE 2QTVA 3LESA 1QKRA 1D0YA 3RIPA 1C17M 2YKZA 1PAQA 2ZISA 4ILGA 3SF4A 2P9LG 4GTTA 4ILHB 1OY3D 1G4US 3ZRHA 1OKKD 5IY5C 3NKEA 1W3BA 1KZPA 2ETSA 3D9LA 1NSGB 5BNWA 3KYJA 4J8DA 4PJJA 3QB2A 2ICWG 4LCTA 3Q7FA 4HORA 1V54E 4DX5D 4DJAA 1E86A 3TWQA 4FLBA 3FAJA 1ZHYA 5DIZA 4E85A 2NUPB 4HI8A 4BY6A 5CECB 4GEHA 3NDBB 3H2VA 2LQGA 4C0EA 2UY1A 2UWJG 3ZUVB 4CS9C 1H2VC 1ZW2A 3K6BA 1EA8A 1N95A 5G2NA 4E0HA 4U8VD 5BPPA 3W9GA 3E9VA 4Z9HA 5HQ8A 4F1SA 1FT1A 3QWVA 2VGYA 3JSEO 5T3WA 2WB2A 3PDNA 3NKDA 3TXMA 2DIWA 1TQGA 1SZIA 3OTNA 5LCWJ 3EHMA 3CVLA 2V5QC 2V0PA 3MA5A 2C0LA 1IZMA 1MQVA 1UG7A 5KYUA 3TG4A 1Q0DA 4MNDA 1MX4A 4XTKA 5EILA 4LEUA 1R4TA 4BX9A 4Y6WA 2QC9A 2UUHA 5KBAA 3DZAA 4UWGA 4HFGA 2CHXA 2HV7A 2KGOA 1A17A 3CEXA 1N1CA 3G2UA 5BQGA 3ABLC 3KEAA 2L6GA 4LLCA 4GZ3A 4MVQA 4DX6D 3Q78A 3LJBA 4JHRA 1O1TA 4BFRA 3FH7A 1PD0A 3NRHA 3T9OA 4GTSA 3GZ1A 1Z6AA 4BJ6C 4ATZD 4MVZA 3QAQA 1VB5A 4IB4A 5E3CA 5DLJA 3PNTB 2XPIA 4I3MA 1WN0A 4PH4B 1RW2A 2CNWD 5BQHA 4CJGA 2OJED 5L3VA 2XZDG 3AOUA 2YWAA 5D0QD 2GRRB 4DBRA 3CSTA 3SP1A 2X6FA 1YVIA 2IY0C 4U96D 4GA0A 5E3AA 4TUMA 1Q0GA 4DRXE 2GDCA 1N54A 4WGZA 5E75A 3V2OA 5HV9A 5K0IA 3HNLA 3RK6A 3EZHA 2WZGA 3LEOA 4KBQA 2LFDA 3TXNA 5HS0A 2R7OA 3AS5A 4FULA 3ASOC 3CVNA 5E76A 1JWGA 1TN7A 4HRMB 5AQAA 2EPNA 4ILIA 4MQ9F 4RBNA 5EKQD 3QTHA 4L6RA 5CEAA 4UWKA 1OCRC 3CHMA 3IHVA 4LNGA 5FZRA 5JHBA 4OD4A 3TWSA 4UI9C 4AE4A 1ST6A 2QE9A 1BR2A 1N0RA 3J06A 3K33A 4K0DA 1PV3A 3M15A 2WXOA 1LS4A 2R9RB 3ZU7B 1A7DA 3V31A 3TWUA 4GYWA 5DVWA 1SR2A 2I15A 3MJWA 3D9KA 1FFTC 2H7BA 3IBEA 1T6UA 3FMSA 2F22A 2BL2A 1ORJA 3UR3C 5KJLA 3FY4A 1R5ID 4KYOB 2LUHA 3GYZA 3K66A 3WG7E 4BETA 4JA7A 4GTPA 4PJNA 1HE1A 4KBLA 4A2NB 1TEZA 1BBHA 1OUVA 1HY5A 1A7VA 2Y3HA 3DSXA 4JXTA 2DYRE 5F28E 2BEDA 2VB6A 4J8EA 2IYLD 3JXJA 1HG5A 1E96B 1S64A 4J7YA 2JX0A 4N6HA 3FH5A 3L82A 2VTBA 4PR9A 3B29A 3UUXA 1WTYA 2J08A 3Q6NA 2B0JA 4KNWA 3Q7LA 3HJCA 4YN0B 3ZVVA 2WQ6A 4DRJB 4C48B 5F5FA 3HNJA 2M63A 1OW6A 3B71A 2AU5A 3FU5A 4OVUA 3OXGA 3U8PA 5HRYA 5CEDB 4G11A 4I9EA 2QZAA 3UKRG 3MCXA 4WWNA 2LNIA 5CCMA 2A0BA 5EN5D 3JYHA 3TD7A 2Y4TA 3O48A 2EQXA 4EZKA 5FZQA 4YDWA 2DZNA 4B6IA 1QZ2A 4FWVA 3NOGD 1VMAA 3J5QB 4MLPA 1H6OA 1C03A 2EIME 5AJDA 1MJ0A 4BEJA 4K7BA 3FUFA 4MRUA 5B3IA 1BPOA 2WVIA 3GEHA 1YARO 3BEEA 4KC9A 2EINC 3CAXA 5ENRD 5KJKA 1X81A 2WVNA 1FAPB 2WXPA 2EPMX 1Q0MA 1O3UA 3RKOF 2WXMA 3Q49B 3IQCA 3FUMA 1MMAA 4ER9A 1OQCA 2YEVA 1WDYA 2X51A 1LD8A 3TAXA 4ZLDA 4E6HA 5JUAA 4BSXA 4YDOA 3V7OA 2EIKE 2VGEA 3ZXSA 2A6HF 2CG2A 3QWWA 4PK4A 3U66A 3PREA 3G4XA 2Y3DA 4Q5SF 3FAPB 2DYSE 1WGWA 1D9SA 3DSSA 4DI3A 3EG9A 4JW1A 3L34A 1FMVA 1KT0A 4U5CE 3N2ZB 2NXPA 2AP3A 1Q0KA 2WZLA 3GWLA 4CIPA 1NFNA 3RW0A 2ZGGA 3MX3A 1HFAA 1RKEB 3FHEA 3I3NA 4HQDA 4U95D 4CJOA 3IQ5A 3IV0A 1P5QA 5CMWA 4NY3A 3L8JA 4JD2G 1Z3IX 3ZQVA 3NZSA 2NUPA 4N2QA 2ZU6B 2J7PD 5M72A 1CGOA 3S90A 3R9AB 3C98A 3FTWA 1K3ZD 1YA7O 1UN9A 3B7BA 3D9IA 4CS7A 5AC5A 1DOWA 2R5SA 4A1GA 2HSBA 3SXYA 3ABLE 3L13A 2M64A 3RFYA 3OWTA 4GTRA 4M63A 2DB4A 3PZ2A 4UQXA 1Y6DA 2IXMA 1I4ZA 5BXOA 3U4TA 1IKND 1SW6A 2HS5A 3VLFA 2Y3BA 2J49A 2WXRA 3ITFA 1ZYRF 4XEVA 5A6AA 3ABME 3DD7A 3ZYMA 3PUKA 1K05A 1QSPA 3PS6A 2KZTB 2Q7FA 2DZOA 2X6JA 1INZA 2CGEA 3EGDB 3AJIA 4QQIA 3DSUA 3D9PA 3RU0A 2KCLA 4I1MA 4HXIA 3S7FA 4QFVA 4EBBA 3RO3A 1EDUA 2ZXWE 2AXZA 2EPKX 4P9FA 3MEKA 3AG2C 3ABKE 4ANWA 3S27A 3SNHA 3MYVA 3CR3A 4URKA 2FEZA 4H4KC 3EPVA 4HOQA 5EYPF 5FQ8A 1XZQA 2C03A 4H7XA 1D0XA 2LXMA 1B89A 3KD7A 3DE8A 3UINC 4EBAG 2KK1A 1Z3YA 4B8AA 4UWFA 2J07A 3QARA 3DSWA 1HXIA 5COGA 2Y69E 2YLIA 4L2LA 3V79K 1ZW3A 3LY7A 4HB5A 3VLEA 4KI2A 3A11A 4CSAC 1BD8A 1TKNA 5DS6A 2X3MA 5B1BE 1QPUA 2OEXA 2F8YA 1A0BA 5L0CA 3ZW3A 3FUKA 1WWPA 3D9OA 3OA1A 2UY1B 5G05C 4JEHA 3MYIA 2CYDA 2H7VC 1N0QA 1BDJB 3QZCA 5ARGA 4KMOA 5COMA 3RRUA 3HXCA 2L0IA 3NQPA 2HFIA 1HG2A 2XLEA 3LS1A 4JURI 4F53A 1FPPA 3GANA 1H7IA 4J8YA 2NSFA 2CDQA 4NIKA 4BWRA 2MWQA 4FAPB 4Q69A 3EZIA 3PE3A 2VCBA 5AQ7A 3NAWA 2V26A 3MYFA 4U8YD 2KBXA 3D9JA 3US6A 4EIYA 4K03A 5CMYA 1KTMA 3TL5A 2JD3A 5L3QA 4X0RA 3N71A 3DMDA 4RG6A 1N11A 4C9BB 2KNHA 4U0UA 3WODF 4AL1A 4AE4B 4EHPA 1MQSA 3JT1A 1KPSB 3HNIA 3LEWA 2XPYA 3LUTB 3HVEA 1TR2A 3QDNA 4EECA 1QVXA 1OT8A 3FOOA 3APDA 3RQGA 3B95A 3CHQA 3TWTA 3ASGA 2J9UA 3CHPA 1JUQA 1LD7A 1VK5A 3QVZA 2BUGA 5E2QA 4FADA 2GAQA 4G7HF 2J0XA 3IQTA 4G2VA 5JLIA 4DX1A 4LSZE 3EGXB 1H6GA 3PZ3A 2WXNA 3OXFA 3SEOA 1XWJA 4GTMA 3UM2A 4JEBA 2OJQA 2WQHA 4JPSA 4ACLA 1OXJA 3E37A 4N3AA 2UUIA 4PDXA 2GW1A 1HW2A 3ZPJA 1KLXA 1IQUA 3ASNC 3R7RA 1BZ4A 4L23A 3CVPA 2XRZA 2LFFA 3S9OA 2GRNB 3B0PA 1MX6A 3HXFA 1D1CA 1H9GA 2Q7RA 3CK9A 4BJ6A 2OEVA 3CQGB 1H0AA 3I5PA 3JUIA 1Y6IA 3SBSA 3L1MA 4JTAB 5CI9A 3FP3A 4CBEA 4E18A 4FJZA 2VTBB 2PF4E 4FJYA 1GQAA 3PDMP 2R7QA 3PCVA 1V4AA 1E7UA 2J9WA 4B0ZA 4J0UA 4JCZA 3LEVA 3Q73A 3CSFA 2AWYA 1IHBA 3ZC4A 4EZJA 4F4BA 3SI5A 2W4BA 1C02A 5CI8A 5ANRA 2OQMA 3ZYLA 4NTFA 3I4UA 4KVMA 1M6TA 1PC2A 4YT5A 2X6KA 2VCAA 5T4YA 3QNKA 3O10A 4G25A 2F0YA 2HE0A 1N4PA 4J32B 1I5NA 5T3TA 5H7PA 1OXBA 1GGQA 1U89A 4GYYA 3CZ6A 4ULWA 4BEMJ 3PRZA 3VYWA 2BF0X 1BR4A 2IO3C 2VH3A 2GA0A 4L7TA 4HFFB 4HRNA 2IOQA 4YNDA 3K7DA 2HKVA 3ZQYA 4O6FA 3T5XA 1KT1A 3DPDA 3RAUA 3FU3A 1F1MA 3MV2B 2F37A 2IJGX 4EHMA 4C3DA 2NG1A 4WGYA 4JL0A 3L22A 2I2OA 3S7JA 3RIBA 3B0VC 3FTYA 3FUJA 3VM6A 4NC3A 4XE0A 5JMND 3SFYA 1YMPA 256BA 3JUEA 4XPWA 2KJGA 4QI0A 3IEGA 1T5OA 4DLOA 3LVRE 3G2VA 5A6KA 2ZXRA 1QQEA 3QK0A 2LIGA 4JB8P 3CVUA 1E2XA 2R05A 5DS4A 4TUUA 5AC4A 3PUJA 2I8BA 4N2SA 2WZFA 1N4QA 2IXPA 3BQOA 3RYLA 3KL4A 4TXQA 1OCOC 3RQEA 3UM1A 2RSEB 1XNFA 2CHWA 3S84A 3E4BA 4RLYA 5DQZA 3U3BA 4EBJA 1V74B 3G2TA 3DM9B 2NYJA 4FLHA 4YL0A 4W9RA 4AM9A 3M79A 1TWAA 4DJ9A 2L6BA 2XZTG 2XS8A 3LKUA 4O7GA 4EBKA 3AAAC 4DRIB 3R9MA 1ZHZA 4ABNA 4LNBA 4GZ6A 4G7ZF 1XGWA 2XHEA 4AL0A 4O6MA 1G5ZA 3CVQA 2FF4A 3JYSA 3PEUB 4PS3A 3C8GD 4E17A 1H19A 1QZXA 2J0WA 1MNEA 3DM5A 4GZDA 4FA6A 3UNGC 4K0RA 3B7UX 3CIAA 1EYHA 3QKYA 5ENOD 1M2VA 4FX5A 5AQ9A 1NU7D 4O1PA 5G55A 2C0MA 3SZRA 2KCKA 4G0HA 2XEHA 3V2XA 1UFBA 1M2OA 2YZSA 5C1DA 1Y4CA 1JCQA 3ASHA 1RZ4A 1QBQA 3DXJF 4LACB 3ESKA 3QVYA 5G05J 4CDNA 3ZDLA 3G50A 2H6HA 1SZ9A 2F8XK 5JVEA 4IRUA 1V54C 1N94A 3Q75A 4A63B 2RD9A 1Z6TA 2AWIA 4Q7CA 2A6EF 2NUTA 2LSUA 3KKBA 4NURA 2HUJA 2BKGA 4BERA 2HM8A 3X2QC 2CW0F 2WMNA 3I5QA 3ATPA 1IXVA 2NSGA 4K5AB 4TV3A 2Q9BA 4U63A 2YVKA 1OWLA 4CYMD 3L0IA 2WPVA 2ZGDA 4I6GA 2P7VA 1B68A 4LERA 4IYPA 4LDKA 4XWJA 3ZG1A 3SO8A 5EX0A 3ISMC 4MW8A 2V5FA 1CGME 4GMRA 1NA0A 2DWZA 3LLIA 4U0SA 4MTGA 5FQ7A 4MVSA 1VTMP 1LI7A 3RVYA 4NTBA 2X38A 2IBFA 5D92A 3T4RA 3ML9A 4AY5A 2KATA 1K04A 3C62A 3U3WA 1RMVA 3ABKC 3AG2E 3IXEA 3ULYA 3IEEA 2E0IA 1APCA 2KC3A 1OKKA 4CX9A 1Z23A 1OCCC 1OW7A 4I9CA 1S63A 3ZNGA 3UQ3A 2MHRA 3E34A 2P0NA 1E8XA 3POVA 3ZKJA 5G04C 2Q9CA 2W4MA 5ENNA 4I17A 3ZHEA 2WXFA 3GODA 2YLGA 5E33A 1NFIE 4XX5A 2NC9A 1G3NB 3EDTB 3ZSUA 5B1AC 1KU2A 3AQCA 1VDYA 2A68F 3FU6A 3UGPA 4GMJA 3UX4A 4ANXA 3V5ZA 5AAOA 2HJ3A 5A6JA 2C04A 5ENPD 4ACKA 3VF0A 1WATA 4YT2A 2AVPA 1QNFA 1TNUA 3PMRA 5BUOA 3K1HA 3SFZA 5EGYA 2WVOA 4PFPA 3IHUA 1N4SA 4J7WA 1U3DA 4DX2A 3C7JA 1TWHA 5B1AE 4FP7A 1S7ZA 3AS8A 2YQ8A 1U0BB 5EYLA 4CZ2D 1ZBPA 4OYSA 5FJYA 3EIJA 3CEQA 3W8HA 3SXZA 1OR3A 3Q5MA 3GZSA 1JRAA 4DPRA 5AIJA 4RSYA 2VJ8A 4ANVA 4D4NA 2PFDA 3TOMA 3UM3A 4BJ5C 4KXKB 3AS4A 2RFMA 3JRTA 2V3CC 4B93B 1U2VG 2W45A 3PHF2 4JHJA 1QYMA 4U04A 4DBQA 1OCZC 2HV6A 3QOUA 5BQIA 4HEAJ 4C3EA 2QY9A 4GMLA 1SYQA 3MV3B 3C3QA 4PJLA 4XEIG 3WAQA 1JWFA 2A4ZA 4XZ4A 3C63A 3LY8A 3RH3A 1JR8A 1YYHA 4ANUA 3LCAA 2NSZA 3DI5A 3W4YA 2QYUA 3URZA 4O79A 2OG2A 3I4RB 2DGJA 5BT1A 3FWVA 3X2QE 4HOSA 5GPGB 2HYZA 3JTLO 3R7CA 4U8HA 4EWCA 2OCCC 4JZYA 3Q7AA 4ZLCA 2ZD9A 1MHQA 2D4UA 3Q47B 1HX8A 2QLAA 2HJMA 3Q79A 4J8SA 1BLXB 2PZIA 2YL7A 3CVYA 3E32A 2AXVA 3CVVA 4O6YA 4CDYA 1TN8A 1TJCA 2RD0A 2LSVA 5A23A 4N06A 4NRHB 2XEVA 4Z9IA 1FT2A 1JOGA 5AARA 3FUEA 4MVMA 5KYNA 2VASA 4U5HA 4YK5A 2LO6A 1CPRA 4FESA 2XLOA 2DI3A 1V55C 4CSAA 1TWGA 1LVKA 3O6XA 2J46A 2OKUA 5B1BC 1ORSC 3Q9NC 3HIZA 3V30A 4BX8A 3AG4C 3CKCA 4L1BA 1ELWA 3APCA 2A1DD 3FU0A 4IJJA 3PH0C 3ASFA 2P9IG 5KYXB 1Q0FA 4JCHA 1IYGA 4GTVA 4I1AA 4ZFHA 4ULVA 1EQ1A 3RJVA 4BT8A 2PM7A 2R7TA 1OCCE 4LDQA 1LI5A 4OVVA 2DYRC 1VYKA 2OOCA 3K1IA 1LKXA 4G78A 1YA0A 4D10C 5BUZA 2I9CA 4JVSA 5A6BD 3ZEFA 1JPJA 4TXPA 2WXHA 4JJGA 1DC2A 1HH8A 2J9VA 2X0CA 1RXQA 1LIHA 4GA1A 4V3IA 3JCUQ 4IWBA 4HVBA 1FR0A 2XXAB 3SYNA 1Z3XA 2J8WA 4Q94A 4YDYA 3LLKA 1LE2A 5FZSA 4E0IA 1D8DA 3AG1E 3FTXA 2YL1A 3AG3C 3EHQA 1EI7A 1E7VA 2YHSA 3KEZA 4ME2A 4XKCA 2Q9AA 2IU1A 4ONSA 4MS6A 1HMOA 3TWXA 3DJNB 3ONKA 4E7SA 2FO1E 3D9HA 2GRQB 3DEPA 4KNVA 5CRVA 1PD1A 3LJ3A 1CGNA 5KJNA 4U5BE 2FULA 3UMKA 2J45A 1M2VB 3TWRA 4DUIA 3BG0B 4OAVB 2CCYA 3DAFA 5A69A 2R03A 2XLVA 2GRMA 3VTYA 4JEAA 4RVBA 5JJ7A 2PM6A 4XEFA 2YL0A 1O5HA 3FUNA 2KM4A 4YDEA 3RF3A 3BRJA 4UDVA 3U5SA 2Y39A 2E2EA 3EGDA 3U3FA 3CQCB 1NP7A 2Y3GA 4GYOA 1TNBA 2P9NG 3TWWA 1E90A 2WB7A 4JC7A 2WXIA 3D9NA 2NUTB 2XRYA 3U8VA 1BR1A 3E30A 1ZZPA 2ZXOA 3QW1A 3DBSA 2YRFA 4HI9A 1M57C 3L6AA 1SVXA 4I1OB 4IAOA 2TMVP 3MKRA 3HYMB 3SBTB 4BESA 5AGFA 5LX8A 3TQOA 5AQBA 3ULEG 3KS2A 3HLZA 3JXIA 4B89A 2XL4A 3JCKC 2HZ8A 1E83A 1FVHA 2ETCA 3MKQB 4OAUC 1L7CA 2CG3A 2J4DA 3B13A 3AU4A 3S0XA 3KAEA 4KZCA 5KYYB 3GEEA 3DKAA 3U9WA 5L0DA 2AWCA 5AYWD 2XSEA 4APOA 3LJNA 3DWLG 2P9UG 3GM2A 2R7RA 1TFKB 2QFCA 2YINA 1RJ9A 2GWWA 4G8LA 4DLQA 3DXMG 1TYQG 2AVKA 3EIQC 3VAYA 2KQ9A 4F1PA 3Q15A 2XL6A 1V55E 3DSVA 2ZIRA 2XLDA 2Z15A 3N0TA 2PL2A 5T3RA 4U5GA 1JCSA 3NBNB 3UM0A 4BJ5A 3C3OA 4BSZB 4U9EA 1FCHA 1FNTc 1HE9A 3MFNA 1FTSA 4MVRA 2ZXWC 4E7ZA 4A4AA 3FDHA 2EINE 4N39A 3C8ZA 2OV8A 3N24A 3IPMO 1JAFA 3M4CA 1TNOA 1O87A 1OCOE 2AW6A 4N3BA 3ZN3A 4YVQC 4EKWA 5AENA 1UJJA 2WVQA 3HTKC 1K40A 3AG4E 2HMQA 5D91A 1NZNA 1HS6A 4GB9A 4HLEA 1D0ZA 1ELRA 1MNDA 2JPUA 2MRIA 2LCHA 1YLMA 3QC1A 3UT8A 2IF4A 4DVYP 3NMIA 4OIQF 1OWOA 1FVFA 4WNFA 3FH8A 3DAGA 2D5RB 5DS5A 3G2SA 4B8CB 4ZHBA 1Z5SC 4LNUD 3AGTA 3FVYA 2J09A 3SXMA 3B7TA 3OEOA 2L6JA 3RRMB 2PQRA 4CS9A 4AVXA 1A7EA 3UTMA 3PVLA 1WG0A 3C8GB 1H6PA 4FHKA 3SNXA 1A5EA 2R02A 2X6HA 3RSEG 1TNYA 4HNAD 3B0UX 4A55A 2J8SD 1GS9A 4DOZA 4J6IA 1Y8MA 5KWDA 3SD5A 5LOZA 1QQ3A 3D9MA 4UQYA 2LXLA 2XL8A 3G4ZA 1JCRA 4RQIA 2M4EA 5LCWC 1HF8A 1J8MF 4PUCA 5FT9A 3W9FA 3ZFWA 4WABA 1T01A 4JTDB 2VYIA 2DBAA 1AP7A 3H65A 4PS7A 1M56C 2G62A 3TK0A 4HLLA 5EK0A 2XRHA 4WWOA 2FAPB 4C7OB 3DPYA 3L54A 1TWCA 3OXLA 3LDZA 1AWCB 3KPHA 5KYWB 4JA9A 3ASOE 2XLWA 4I2ZA 3VRCA 3GORA 2PNOA 2VCCA 3ZTMA 4KVOA 1HMDA 2QY7A 2LD6A 2OU6A 4DX7D 2RFAA 4XQ1A 3SGHA 3GWNA 1HU3A 4HRLA 3LY9A 2PQNA 4FHJA 3GZ2A 2Q00A 1SZAA 3NZUA 5FCLA 5HI7A 2IM8A 5LFAA 4G8KA 2DVWA 2IEJA 4GTOA 3TJ5A 4CT4A 2A5EA 3FTUA 1N4RA 3O4ZA 3J5PA 4UUCA 4C3BA 4GPMA 1DCQA 4EQFA 1YDIA 1E84A 4J30B 3SQVA 2ZXPA 5L0GA 2IOSA 4AEZC 3P1UA 3T6BA 2ETBA 4AK9A 3ZIBA 1IQRA 2LAIA 2G3VA 2VC9A 3A9CA 3M1CB 4N5QA 4RDAA 4D4XA 4Q4ZF 5ENTD 3SHFA 3MLGA 3QJZA 5FINA 2XGMA 3TJPA 1YZAA 1N9AA 3IKOB 3PE4A 1NLXA 4GCOA 3BU8A 3AQBA 2GRLA 1E8YA 3CHOA 4BJ1A 4FU3A 5BXUA 2EILC 3DWWA 3CKBA 4JTCB 5FIOA 1L3PA 1PY1A 1D1BA 1ZHWA 3ML8A 2E87A 3TULA 4P29A 2BTDA 2A69F 4AY6A 5CBOA 4MTOA 4K5BA 2EPOA 4IN3B 1MMNA 2RKKA 4CGWA 2KXPC 3HNKA 4KZ0A 3GM1A 4UWHA 2CFUA 4N6CA 2B0OE 3GM3A 4G1TA 1DVPA 2NPUA 1NFOA 4PJMA 4OIRF 1UJKA 4WNEA 4BG0A 3U2MA 2OVFA 2Q4FA 2IXNA 3JZ0A 4NQ0A 1Z7Qc 3EHRA 3SXKA 3CK7A 3EQLF 4P6IC 1TJFA 3FEXA 1OW8A 4G26A 5A7DB 2O9XA 4U9DA 2WXQA 1MYOA 1K1BA 3PEVB 3HKKA 3ZYKA 4I6EA 1OWNA 3ZHEB 2MYSA 1ZB1A 1BI7B 2FGYA 5AJLA 3CQZA 4EUKB 4GQHA 1S70B 5KYXA 3JRMO 5D2MC 2Y69C 3EHNA 3EH2A 5B3SE 3LPZA 4G7OF 1OXKA 2V8SE 3L8IA 3UT4A 4PACA 4U5DE 3T6GB 5JRAA 2PBEA 3ZVRA 5JT4A 5A6BA 3ZIMA 1JPNA 4MS2A 3UMHA 2WXKA 2XGSA 2R2LA 5D66A 2WQ7A 2GRPB 1X5BA 2BKKB 2Y1LE 4CGVA 4YL3A 2KYHA 3E70C 4EZLA 2P9SG 3GW4A 2A5UA 3T8MA 1U6HA 4GU5A 3JQ0A 2WL8A 5KYYA 1E8ZA 4MKTA 4N5CA 3CK8A 2VGXA 2OOEA 5ENSD 2J4BA 3F46A 4JHKA 5T1DB 3C72A 3JQ1A 4L9PA 1ZHXA 5HSWA 2MHKA 3CLJA 3E33A 4W8KA 4UI9J 4GCNA 4KT6B 3V5YA 1SQMA 4UQZA 3HHMA 4JKVA 1UG3A 3UKUG 2AJAA 5BV1A 2XS1A 3EU9A 4J8FA 2BC5A 2HR2A 4CIHA 3ULQA 2OCCE 4A3VA 4XKBA 4JIOA 3ZWIA 4AOFA 1VLSA 1QLEC 1LE4A 4HE8D 1I4YA 1OCZE 2XEEA 3UMVA 3FHDA 2VQ2A 2LSEA 4TRQA 2C2LA 3APFA 1NI1A 2P61A 4LLEA 4I6JA 1ORYA 5CRUA 4GTQA 5ENQD 1YJGA 5AN8A 1VOMA 3EFOB 1O1SA 2LP4A 2J9QA 3EUVA 3LYAA 5CCLA 5ANLA 4JEUA 2WM9A 2B0HA 3FEYA 4MTFA 3IHYA 4DK5A 3T5VA 4BTAA 3RO2A 1IW7F 2VSOE 2I1KA 2IONA 3LXUX 2HSQA 3ABMC 5FWQA 2J9BA 5D0OD 2ETAA 3BUAA 3CVXA 3ZGQA 2P6VA 4I2WA 2IQCA 3L16A 3MKQA 4MBGA 1NZEA 3D3MA 2FFHA 1EPUA 4F6RD 5CBNA 4XI0A 5KCMA 1YYJA 4PS8A 3FOPA 3FFLA 4GAAA 3U0CA 1HZ4A 1ZU5A 1ZVZA 2MYOA 2YHEA 2L7AA 3AG1C 3NYMA 2VSYA 1D1AA 3NYJA 3DSTA 2IOLA 3B7SA 3EH1A 1RKCA 2L6HA 4QDLA 2CFZA 3JSZA 1DOVA 4G24A 4B94A 1Z5ZA 1O1RA 3W2WA 5JS5A 4LUNU 4G23A 1VLTA 3U2LA 3FUHA 3S2AA 1K8KG 5HKPA 2VSNA 3F6QA 4C0MA 2XENA 4YWQA 1SF8A 4ATGA 1MMDA 3W8IA 5KYWA 3RKVA 4A3TA 1E85A 4XLPF 1LF8A 2H7OA 2FO7A 4DRHB 2EIMC
chains in the Genus database with same CATH topology
2LAHA 3G2WA 2L9JA 4WWPA 3NG1A 1MMGA 4OD5A 4HFKB 3S28A 2R7XA 4H7YA 4U5EE 4M3OA 2KCVA 1N52A 5JJ6A 4PFOA 4BT9A 2Y3AA 3K9IA 2BE5F 2I1JA 1NA3A 3UPVA 3PZDA 2L9BA 4AJWA 4OIOF 3KMIA 1HO8A 5KYUB 3ESLA 3U64A 5KJMA 4XLNF 4YT8A 1E8WA 2PP4A 2PX0A 4UWLA 2WXJA 1ZU4A 2VSXE 4GYTA 4WAFA 4OIPF 3F47A 4YVOA 5A6CA 2Y4UA 5BW8C 4C7OA 5BV0A 5FQ4A 5C2YA 2WXLA 1Z63A 3LS8A 3BG1B 1SMYF 3CSKA 2KC7A 3S29A 4XI9A 2XXAA 1WY6A 2R59A 4JZAA 3L17A 1U3CA 2IFUA 3WXXA 1OWMA 3KH2A 1DNPA 3LNRA 5JJTA 2CNWA 5FTPA 4A1SA 1FFHA 1L5JA 3UT7A 3Q4AB 1NU9C 1ZU2A 4WNGA 4CDMA 3TGOA 4JJFA 3FUIA 1RJ9B 2XPZA 4WUYA 3Q7GA 4JC8A 5G04J 3WG7C 4N3CA 3UGOA 2R7VA 2YHCA 4CT0A 3VLDA 3NF1A 2PX3A 4HOTA 2EIJC 3SZ7A 3ENEA 1ELKA 5T8IA 4WJ0A 2R7UA 4RD9A 2L0TB 2OVBA 4OINF 1IHGA 1H2UA 3NYLA 1J8YF 2R7WA 1ZHTA 4CS8C 1VYIA 3EG9B 3S7BA 5DQTA 5DBKA 4FC8A 3FDQA 4CDRA 4HOUA 2WXGA 2DCPA 2JLBA 3L08A 4NACA 2FI7A 1WAO1 4AP2A 2EIKC 2ZPAA 3FULA 4R7LA 3W2VA 4ANJA 1PCXA 2XCCA 5EDSA 2X6IA 3ASDA 3S7DA 3RRNB 3PNLB 4YJWA 2RG8A 3LAYA 4LRZA 1LS1A 4DVZA 1WM5A 2KZTA 2YNQA 2IXOA 4O6NA 3CV0A 4BTBA 2R7SA 2ILRA 3TG5A 3X1OA 1H6KA 3CHSA 2Q3TA 3EFOA 5EHHA 3HVEB 1OWPA 4RG9A 1S0PA 4I43A 2MOWA 2GGFA 3FTZA 5JHAA 2CHZA 3Q6MA 5J08A 3ONLA 4U0ZA 4GZ5A 3EGXA 2GFHA 4GA2A 4CEMA 4AIFA 3ZYQA 4Y6CA 2ONDA 4F7AA 4GPKA 4CCAA 3OAWA 3FTSA 4CS8A 4F3VA 3R7QA 2VGXB 3HDXA 3P2BA 4AXHA 2FBNA 3B9QA 4IULA 4U5FE 2V4LA 1FMWA 1JPLA 3I4GA 1NG1A 2I6HA 1EF1C 4AX2A 4XIFA 3T6JA 2WMOA 3O39A 4BJTA 2XCBA 5FQ6A 3ECSA 5CHEE 5ARFA 1UW4B 4I44A 3K1IC 3QMKA 4UI9K 2HO1A 3MZLB 3DJUB 4L2YA 3FUDA 3B7RL 2XQ0A 4EBAA 5J90A 4AV7A 1W2WA 2XGOA 2J7PA 1H2TC 4GZCA 3VTXA 2DYSC 1GW6A 3LS0A 2KW3C 2P58C 3EJNA 4WNDA 4YT4A 3MGBA 1G8XA 3CGHA 5F5HA 4QI2A 3CVWA 2AXUA 3FTVA 2W9YA 4HS2A 4DI4A 5B3SC 3CHRA 4EPZA 4APFA 5LP0A 4Q96A 2G3KA 1HE8A 3UMIA 3LVQE 3AU5A 3QWPA 4U07A 2R17C 1UN8A 2L81A 2JEKA 4CRWA 5EX3A 2QTVA 3LESA 3RIPA 1D0YA 4ILGA 1PAQA 3SF4A 4ILHB 3ZRHA 1OKKD 5IY5C 3NKEA 1W3BA 3D9LA 5BNWA 4J8DA 4PJJA 3QB2A 4LCTA 4HORA 4DJAA 4FLBA 3FAJA 1ZHYA 5DIZA 4E85A 2NUPB 4BY6A 4GEHA 3NDBB 4C0EA 2UY1A 2UWJG 4CS9C 1H2VC 3K6BA 5G2NA 5BPPA 3E9VA 5HQ8A 4F1SA 3QWVA 2VGYA 5T3WA 2WB2A 3PDNA 3NKDA 3TXMA 2DIWA 1SZIA 3OTNA 5LCWJ 3EHMA 3CVLA 2V0PA 3MA5A 2C0LA 1IZMA 5KYUA 3TG4A 4MNDA 4XTKA 4LEUA 4BX9A 4Y6WA 3DZAA 4UWGA 4HFGA 2CHXA 2HV7A 2KGOA 1A17A 1N1CA 3G2UA 3ABLC 4LLCA 4GZ3A 3LJBA 4JHRA 4BFRA 3FH7A 1PD0A 3NRHA 3GZ1A 1Z6AA 4BJ6C 3QAQA 5E3CA 5DLJA 3PNTB 2XPIA 4I3MA 4PH4B 2CNWD 5L3VA 5D0QD 4DBRA 3CSTA 3SP1A 2X6FA 4GA0A 5E3AA 1N54A 5E75A 3RK6A 3EZHA 2WZGA 4KBQA 3TXNA 2R7OA 3AS5A 4FULA 3ASOC 3CVNA 5E76A 1JWGA 4ILIA 4MQ9F 4RBNA 5EKQD 4UWKA 1OCRC 3CHMA 3IHVA 5FZRA 5JHBA 4OD4A 4UI9C 4AE4A 1ST6A 1BR2A 3K33A 4K0DA 2WXOA 4GYWA 5DVWA 3MJWA 3D9KA 1FFTC 2H7BA 3IBEA 3UR3C 5KJLA 3FY4A 4KYOB 3GYZA 3K66A 4JA7A 4PJNA 4KBLA 4A2NB 1TEZA 1OUVA 2Y3HA 4JXTA 2VB6A 4J8EA 2IYLD 1HG5A 1E96B 3FH5A 2VTBA 3UUXA 2J08A 3Q6NA 2B0JA 4KNWA 3Q7LA 3HJCA 4YN0B 3ZVVA 2WQ6A 5F5FA 2M63A 3FU5A 4OVUA 3OXGA 4G11A 4I9EA 3MCXA 4WWNA 2LNIA 5CCMA 3JYHA 3TD7A 2Y4TA 3O48A 2EQXA 4EZKA 5FZQA 4B6IA 1QZ2A 4FWVA 1VMAA 4MLPA 5AJDA 4BEJA 4K7BA 3FUFA 4MRUA 1BPOA 2WVIA 3BEEA 4KC9A 2EINC 5KJKA 2WVNA 2WXPA 3RKOF 2WXMA 3Q49B 3FUMA 1MMAA 2YEVA 2X51A 3TAXA 4ZLDA 4E6HA 4BSXA 3V7OA 3ZXSA 2A6HF 2CG2A 3QWWA 4PK4A 3U66A 3PREA 2Y3DA 4Q5SF 1WGWA 4DI3A 3EG9A 4JW1A 3L34A 1FMVA 1KT0A 4U5CE 3N2ZB 2NXPA 2WZLA 3MX3A 1HFAA 3FHEA 3I3NA 3IV0A 1P5QA 5CMWA 4NY3A 1Z3IX 3NZSA 2NUPA 4N2QA 2ZU6B 2J7PD 5M72A 3R9AB 3C98A 3FTWA 1UN9A 3D9IA 4CS7A 2R5SA 4A1GA 3L13A 3RFYA 3OWTA 4M63A 4UQXA 2IXMA 3U4TA 3VLFA 2Y3BA 2J49A 2WXRA 3ITFA 1ZYRF 3DD7A 3ZYMA 3PUKA 3PS6A 2KZTB 2Q7FA 2X6JA 1INZA 2CGEA 3EGDB 3D9PA 3RU0A 3S7FA 2KCLA 4I1MA 4HXIA 4QFVA 4EBBA 3RO3A 1EDUA 2AXZA 4ANWA 3MEKA 3AG2C 3S27A 3SNHA 3MYVA 3CR3A 4URKA 2FEZA 4H4KC 3EPVA 4HOQA 5FQ8A 2C03A 4H7XA 1D0XA 1B89A 3KD7A 4EBAG 1Z3YA 4B8AA 4UWFA 2J07A 3QARA 1HXIA 4L2LA 3LY7A 3VLEA 4KI2A 4CSAC 1TKNA 5DS6A 2X3MA 3ZW3A 3FUKA 3D9OA 3OA1A 2UY1B 5G05C 4JEHA 2H7VC 3QZCA 5ARGA 4KMOA 3RRUA 2L0IA 3NQPA 1HG2A 3LS1A 4JURI 4F53A 3GANA 2CDQA 4BWRA 2MWQA 4Q69A 3EZIA 3PE3A 2V26A 3D9JA 4K03A 5CMYA 3TL5A 2JD3A 5L3QA 4X0RA 3N71A 3DMDA 4RG6A 4C9BB 2KNHA 4U0UA 3WODF 4AE4B 1MQSA 3JT1A 3LEWA 2XPYA 3HVEA 3QDNA 1TR2A 4EECA 3APDA 3CHQA 3ASGA 2J9UA 3CHPA 1JUQA 1VK5A 2BUGA 5E2QA 4FADA 4G7HF 2J0XA 4G2VA 3EGXB 2WXNA 3OXFA 3SEOA 4ACLA 2WQHA 4JPSA 4N3AA 4PDXA 2GW1A 3ZPJA 1KLXA 1IQUA 3ASNC 3R7RA 4L23A 3CVPA 2XRZA 3B0PA 1D1CA 3CK9A 4BJ6A 3CQGB 1H0AA 3I5PA 3JUIA 1Y6IA 3SBSA 5CI9A 3FP3A 4CBEA 4FJZA 2VTBB 2PF4E 4FJYA 2R7QA 1E7UA 2J9WA 4B0ZA 4J0UA 3LEVA 3CSFA 3ZC4A 4EZJA 4F4BA 3SI5A 2W4BA 5CI8A 5ANRA 3ZYLA 3I4UA 4KVMA 1PC2A 4YT5A 2X6KA 5T4YA 3QNKA 4G25A 4J32B 5T3TA 4GYYA 3CZ6A 4ULWA 3PRZA 3VYWA 2BF0X 1BR4A 2VH3A 4L7TA 4HFFB 4YNDA 2IOQA 3K7DA 4O6FA 3T5XA 1KT1A 3DPDA 3FU3A 3MV2B 2IJGX 4C3DA 2NG1A 4JL0A 3L22A 2I2OA 3S7JA 3RIBA 3B0VC 3FTYA 3FUJA 4XE0A 2KJGA 4QI0A 3IEGA 4DLOA 3LVRE 3G2VA 2ZXRA 1QQEA 3QK0A 3CVUA 5DS4A 4TUUA 3PUJA 2I8BA 4N2SA 2WZFA 2IXPA 3RYLA 3KL4A 1OCOC 1XNFA 2CHWA 3E4BA 5DQZA 3G2TA 3DM9B 4FLHA 4W9RA 4AM9A 1TWAA 3LKUA 4O7GA 1ZHZA 4ABNA 4GZ6A 4G7ZF 1XGWA 2XHEA 4O6MA 3CVQA 2FF4A 3JYSA 3PEUB 4PS3A 1H19A 1QZXA 2J0WA 1MNEA 3DM5A 4GZDA 4FA6A 3UNGC 4K0RA 3B7UX 3CIAA 1EYHA 3QKYA 1M2VA 4FX5A 1NU7D 5G55A 2C0MA 3SZRA 2KCKA 4G0HA 1M2OA 2YZSA 5C1DA 3ASHA 3DXJF 4LACB 3ESKA 5G05J 4CDNA 1SZ9A 4IRUA 1V54C 1Z6TA 2AWIA 4Q7CA 2A6EF 2NUTA 2LSUA 3KKBA 4NURA 2HM8A 3X2QC 2CW0F 2WMNA 3I5QA 4TV3A 2Q9BA 4U63A 1OWLA 3L0IA 2WPVA 4I6GA 2P7VA 4LERA 4IYPA 3ZG1A 4XWJA 5EX0A 2V5FA 1NA0A 3LLIA 4U0SA 5FQ7A 2X38A 5D92A 3T4RA 3ML9A 4AY5A 2KATA 3U3WA 3ABKC 3IEEA 2E0IA 1OKKA 1Z23A 1OCCC 4I9CA 3UQ3A 3POVA 1E8XA 5G04C 2Q9CA 2W4MA 5ENNA 4I17A 3ZHEA 2WXFA 3GODA 5E33A 4XX5A 2NC9A 3EDTB 3ZSUA 5B1AC 1KU2A 3AQCA 1VDYA 2A68F 3FU6A 3UGPA 4GMJA 3UX4A 4ANXA 2C04A 4ACKA 4YT2A 2AVPA 1QNFA 3PMRA 5BUOA 3K1HA 3SFZA 5EGYA 2WVOA 4PFPA 1U3DA 1TWHA 4FP7A 1S7ZA 3AS8A 2YQ8A 1ZBPA 4OYSA 5FJYA 3EIJA 3CEQA 3W8HA 3Q5MA 3GZSA 4DPRA 5AIJA 4RSYA 2VJ8A 4ANVA 2PFDA 4BJ5C 4KXKB 3AS4A 3JRTA 2V3CC 2W45A 3PHF2 4JHJA 4U04A 4DBQA 1OCZC 2HV6A 3QOUA 4HEAJ 4C3EA 2QY9A 4GMLA 3MV3B 4PJLA 1JWFA 2A4ZA 4XZ4A 3LY8A 3RH3A 4ANUA 3LCAA 2NSZA 3URZA 4O79A 2OG2A 3I4RB 2DGJA 5BT1A 3FWVA 4HOSA 2HYZA 4U8HA 4EWCA 2OCCC 4JZYA 4ZLCA 1MHQA 3Q47B 1HX8A 4J8SA 2PZIA 3CVYA 2AXVA 3CVVA 4O6YA 1TJCA 2RD0A 2LSVA 5A23A 4N06A 4NRHB 2XEVA 3FUEA 5KYNA 2VASA 4U5HA 2LO6A 4FESA 1V55C 4CSAA 1TWGA 1LVKA 3O6XA 2J46A 5B1BC 3HIZA 4BX8A 3AG4C 3CKCA 4L1BA 1ELWA 3APCA 2A1DD 3FU0A 4IJJA 3PH0C 3ASFA 5KYXB 4JCHA 1IYGA 4I1AA 3RJVA 4BT8A 2PM7A 2R7TA 4OVVA 2DYRC 1VYKA 1LKXA 1YA0A 4D10C 5BUZA 2I9CA 4JVSA 3ZEFA 1JPJA 2WXHA 4JJGA 1HH8A 2J9VA 4GA1A 4V3IA 3JCUQ 4IWBA 4HVBA 2XXAB 4Q94A 3SYNA 1Z3XA 3LLKA 5FZSA 3FTXA 3AG3C 1E7VA 2YHSA 3KEZA 4ME2A 4XKCA 2Q9AA 2IU1A 4MS6A 3DJNB 3ONKA 4E7SA 4KNVA 1PD1A 3LJ3A 5KJNA 4U5BE 2FULA 3UMKA 2J45A 1M2VB 3BG0B 3DAFA 5JJ7A 2GRMA 3VTYA 4RVBA 2PM6A 1O5HA 3FUNA 2KM4A 2Y39A 2E2EA 3EGDA 3CQCB 1NP7A 2Y3GA 4GYOA 1E90A 2WB7A 2WXIA 3D9NA 2NUTB 2XRYA 1BR1A 2ZXOA 3DBSA 1M57C 3L6AA 4I1OB 4IAOA 3MKRA 3HYMB 3SBTB 5LX8A 3KS2A 3HLZA 4B89A 2XL4A 3JCKC 1FVHA 3MKQB 2CG3A 2J4DA 3B13A 3AU4A 3S0XA 3KAEA 4KZCA 5KYYB 3U9WA 5AYWD 2XSEA 4APOA 2QFCA 2YINA 2R7RA 1RJ9A 4DLQA 3EIQC 3VAYA 2KQ9A 3Q15A 2Z15A 3N0TA 2PL2A 5T3RA 4U5GA 4BJ5A 1FCHA 1FTSA 2ZXWC 4E7ZA 3FDHA 4N39A 2OV8A 3N24A 3ZN3A 2AW6A 1O87A 4N3BA 4YVQC 5AENA 1UJJA 2WVQA 3HTKC 5D91A 1NZNA 4GB9A 1HS6A 4HLEA 1D0ZA 1ELRA 1MNDA 2MRIA 3UT8A 3QC1A 2IF4A 4DVYP 4OIQF 1OWOA 1FVFA 4WNFA 3FH8A 3DAGA 2D5RB 5DS5A 3G2SA 4B8CB 3FVYA 2J09A 3B7TA 3OEOA 2L6JA 3RRMB 2PQRA 4CS9A 4AVXA 3PVLA 4FHKA 3SNXA 2X6HA 3B0UX 4A55A 4DOZA 4J6IA 1Y8MA 3SD5A 5LOZA 3D9MA 4UQYA 2M4EA 5LCWC 1HF8A 1J8MF 4PUCA 5FT9A 3ZFWA 2VYIA 2DBAA 3H65A 4PS7A 1M56C 2G62A 2XRHA 4WWOA 3L54A 4C7OB 1TWCA 3OXLA 3LDZA 5KYWB 4JA9A 4I2ZA 4KVOA 2QY7A 3SGHA 1HU3A 3LY9A 2PQNA 4FHJA 3GZ2A 1SZAA 3NZUA 5FCLA 5HI7A 5LFAA 4CT4A 3FTUA 3O4ZA 4C3BA 4EQFA 4J30B 2ZXPA 2IOSA 4AEZC 3P1UA 3T6BA 4AK9A 3ZIBA 1IQRA 2LAIA 2G3VA 3M1CB 4RDAA 4Q4ZF 3SHFA 3MLGA 3QJZA 2XGMA 3TJPA 3IKOB 3PE4A 4GCOA 3AQBA 2GRLA 1E8YA 3CHOA 4BJ1A 4FU3A 2EILC 3CKBA 1PY1A 1D1BA 1ZHWA 3ML8A 2E87A 4P29A 2BTDA 2A69F 4AY6A 4IN3B 1MMNA 4CGWA 4KZ0A 4UWHA 2CFUA 4G1TA 1DVPA 4PJMA 4OIRF 1UJKA 4WNEA 4BG0A 2OVFA 2IXNA 4NQ0A 3CK7A 3EQLF 4P6IC 1TJFA 3FEXA 4G26A 5A7DB 2O9XA 2WXQA 3PEVB 3ZYKA 4I6EA 1OWNA 3ZHEB 2MYSA 5AJLA 2FGYA 3CQZA 5KYXA 2Y69C 3EHNA 3EH2A 3LPZA 4G7OF 2V8SE 3UT4A 4U5DE 3ZVRA 3ZIMA 1JPNA 3UMHA 2WXKA 2XGSA 2WQ7A 1X5BA 4CGVA 3E70C 4EZLA 3GW4A 2A5UA 3T8MA 4GU5A 3JQ0A 2WL8A 5KYYA 1E8ZA 4MKTA 4N5CA 3CK8A 2VGXA 2OOEA 2J4BA 3F46A 4JHKA 5T1DB 3JQ1A 1ZHXA 5HSWA 2MHKA 3CLJA 4W8KA 4UI9J 4GCNA 4KT6B 1SQMA 4UQZA 3HHMA 1UG3A 5BV1A 4J8FA 2HR2A 4CIHA 3ULQA 4A3VA 4XKBA 4AOFA 1QLEC 4HE8D 3UMVA 3FHDA 2VQ2A 2LSEA 4TRQA 2C2LA 3APFA 4I6JA 4LLEA 1VOMA 3EFOB 2J9QA 3LYAA 5CCLA 5ANLA 4JEUA 2WM9A 3FEYA 4DK5A 3IHYA 3T5VA 4BTAA 3RO2A 1IW7F 2VSOE 2I1KA 2IONA 3LXUX 3ABMC 5FWQA 5D0OD 3CVXA 3ZGQA 2P6VA 4I2WA 2IQCA 3L16A 3MKQA 1NZEA 3D3MA 2FFHA 1EPUA 4XI0A 5KCMA 4PS8A 4GAAA 3FFLA 1HZ4A 1ZU5A 2YHEA 3AG1C 3NYMA 2VSYA 1D1AA 3NYJA 2IOLA 3B7SA 3EH1A 4QDLA 2CFZA 3JSZA 4G24A 4B94A 1Z5ZA 3W2WA 4LUNU 4G23A 3FUHA 3S2AA 2VSNA 4C0MA 4YWQA 1SF8A 4ATGA 1MMDA 3W8IA 5KYWA 3RKVA 4A3TA 4XLPF 1LF8A 2H7OA 2FO7A 2EIMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JW1 A;  4I1M A;  4I1O B;  4IRU A;  4JVS A; 
#chains in the Genus database with same CATH topology
 2H6F A;  2LAH A;  2QNL A;  3G2W A;  2L9J A;  3AG3 E;  4R32 A;  4WWP A;  1OCR E;  3NG1 A;  1MMG A;  4OD5 A;  4HFK B;  3S28 A;  2R7X A;  4XPX A;  4H7Y A;  4U5E E;  5IY5 E;  4M3O A;  2KCV A;  1N52 A;  5JJ6 A;  4PFO A;  1TN6 A;  2V4H C;  4BT9 A;  4NCQ A;  1D8E A;  2Y3A A;  3NMJ A;  3K9I A;  3O55 A;  2BE5 F;  2I1J A;  1NA3 A;  5KNG A;  4P9T A;  3UPV A;  3PZD A;  3C8G A;  2P9P G;  2L9B A;  3HG0 D;  4AJW A;  4CDV A;  4OIO F;  3RQF A;  4XPY A;  4H54 A;  3KMI A;  1BI8 B;  1HO8 A;  5KYU B;  5JP7 A;  3ESL A;  3FXH A;  3U64 A;  5KJM A;  3H2U A;  4XLN F;  4YT8 A;  1E8W A;  2PP4 A;  2PX0 A;  3PZ1 A;  4UWL A;  4IAQ A;  2WXJ A;  1ZU4 A;  2VSX E;  4GYT A;  4WAF A;  4OIP F;  3F47 A;  3TJ6 A;  4YVO A;  5A6C A;  2XM0 A;  3NMK A;  3EU5 A;  4LG6 A;  2Y4U A;  4K5C A;  5BW8 C;  4C7O A;  5BV0 A;  5FQ4 A;  5C2Y A;  4BPM A;  1YYX A;  2WXL A;  1Z63 A;  3LS8 A;  2PNN A;  1UOH A;  3BG1 B;  1SMY F;  3CSK A;  1A41 A;  2KC7 A;  3S29 A;  3L9T A;  4XI9 A;  2XXA A;  4MVU A;  3U9M A;  1WY6 A;  3U9J A;  2R59 A;  4HBD A;  4JZA A;  3L17 A;  1U3C A;  3ASN E;  2IFU A;  3WXX A;  1OWM A;  1YZC A;  4N4W A;  3BEH A;  3KH2 A;  1DNP A;  3LNR A;  5JJT A;  3HXE A;  2CNW A;  3DEO A;  1YA9 A;  5FTP A;  4A1S A;  1SA4 A;  1BU9 A;  1FFH A;  1L5J A;  3UT7 A;  5ITZ F;  3Q4A B;  1NU9 C;  1ZU2 A;  4WNG A;  4CDM A;  3TGO A;  4JJF A;  3FUI A;  3HXD A;  1RJ9 B;  2P9K G;  2LK4 A;  3Q7G A;  2XPZ A;  4WUY A;  4JC8 A;  4M7C A;  5G04 J;  3WG7 C;  3NB2 A;  4N3C A;  3UGO A;  2R7V A;  2YHC A;  4CT0 A;  3ZXP A;  5TJ5 E;  1MZC A;  3NF1 A;  4TXR A;  3VLD A;  2PX3 A;  4HOT A;  2EIJ C;  3SZ7 A;  3ENE A;  1ELK A;  5T8I A;  4WJ0 A;  5L0F A;  1WAS A;  2R7U A;  3SY2 A;  4RD9 A;  2L0T B;  2OVB A;  4OIN F;  3MBG A;  4CDA A;  1IHG A;  4O1O A;  1H2U A;  3NYL A;  5EID A;  1J8Y F;  2R7W A;  2XLH A;  2QUP A;  1ZHT A;  4CS8 C;  2Y0B G;  1VYI A;  1G4W R;  3EG9 B;  3S7B A;  2R25 A;  3DE9 A;  5DQT A;  1NBB A;  1AVO B;  2EPL X;  5DBK A;  4MVO A;  4FC8 A;  2XM4 A;  3FDQ A;  4CDR A;  4HOU A;  3C18 A;  1LTX A;  2H8A A;  3M4B A;  2XLM A;  2WXG A;  1WOL A;  3AGU A;  2DCP A;  2JLB A;  1T9K A;  3L08 A;  3TOL A;  2YLD A;  4K1O A;  4NAC A;  3LNM B;  5COF A;  4IAR A;  2FI7 A;  3UIP C;  1WAO 1;  4AP2 A;  3KSQ A;  2EIK C;  4IGG A;  2ZPA A;  5L0I A;  3FUL A;  4R7L A;  3W2V A;  4ANJ A;  1PCX A;  5L0J A;  2XCC A;  2H6G A;  1YCS B;  5EDS A;  2GRO B;  2KSF A;  3TWV A;  3RVZ A;  2X6I A;  3ASD A;  3S7D A;  3RRN B;  3PNL B;  3JYY A;  5JSL A;  4YJW A;  3HXB A;  1KNY A;  2RG8 A;  3LAY A;  4LRZ A;  1GM5 A;  3WHN A;  1LS1 A;  4DVZ A;  4BEP A;  1WM5 A;  2KZT A;  1LPE A;  2YNQ A;  2IXO A;  4O6N A;  3CV0 A;  4BTB A;  1YAU O;  2R7S A;  5JA4 D;  1KZO A;  2ILR A;  1T6Q A;  3TG5 A;  4Z68 A;  3X1O A;  3T9K A;  1H6K A;  4YL1 A;  3CHS A;  2Q3T A;  3UI2 A;  3EFO A;  5EHH A;  1O5M A;  4LDR A;  3HVE B;  1OWP A;  4RG9 A;  1SA5 A;  2P1A A;  3ZTZ A;  1S0P A;  2EIL E;  4I43 A;  3IQ6 A;  1LM3 B;  2GGF A;  2MOW A;  3FTZ A;  5JHA A;  2CHZ A;  3Q6M A;  2HMZ A;  5J08 A;  3ONL A;  4U0Z A;  3V5X A;  2ASR A;  2YQY A;  3DXK G;  4GZ5 A;  1Q2Z A;  3EGX A;  2GFH A;  4GA2 A;  4CEM A;  3ZYQ A;  4AIF A;  4Y6C A;  1HW1 A;  1H9T A;  1T6I A;  2OND A;  3SFX A;  1AEP A;  1MX2 A;  3C3R A;  3DRA A;  2IO2 C;  4F7A A;  2B6C A;  4GPK A;  4CCA A;  4MW3 A;  4Z9J A;  3FTS A;  3OAW A;  4O60 A;  3GEI A;  3AJM A;  4CS8 A;  4F3V A;  1JMW A;  3R7Q A;  2VGX B;  3HDX A;  3P2B A;  1AUE A;  4AXH A;  2FBN A;  1DCE A;  3B9Q A;  4IUL A;  4U5F E;  2V4L A;  2P2C P;  1FMW A;  2OEW A;  1S05 A;  1JPL A;  3I4G A;  1OR2 A;  3R2P A;  1NG1 A;  2I6H A;  1EF1 C;  1TFO B;  5CIV A;  3HRA A;  4AX2 A;  4XIF A;  3T6J A;  3T8K A;  1EKY A;  2WMO A;  3KSL A;  3O39 A;  4BJT A;  2XCB A;  5FQ6 A;  3Q9U C;  3ECS A;  5CHE E;  5ARF A;  1UW4 B;  5CER B;  3QW0 A;  4I44 A;  3UXG A;  3K1I C;  3QMK A;  4UI9 K;  2HO1 A;  3MZL B;  4DXW A;  3DJU B;  3NOC D;  1RKE A;  4L2Y A;  3FUD A;  2EIJ E;  3B7R L;  2XQ0 A;  4EBA A;  4JRZ A;  4AV7 A;  1NL4 A;  5J90 A;  1W2W A;  2XGO A;  4W8P A;  2J7P A;  2JAB A;  1H2T C;  2A0U A;  4GZC A;  3VTX A;  2L6F A;  2YL3 A;  2DYS C;  1GW6 A;  3LS0 A;  2KW3 C;  2P58 C;  3EJN A;  4JE9 A;  4WND A;  4YT4 A;  4J7T A;  3MGB A;  4XEK A;  4NTA A;  1G8X A;  3PZ4 A;  4NQF A;  3CGH A;  5F5H A;  2QYJ A;  4QI2 A;  3UIO C;  3CVW A;  3C5R A;  2AXU A;  3FTV A;  2W9Y A;  4HS2 A;  4DI4 A;  5B3S C;  3CHR A;  1CPQ A;  1RCP A;  4APF A;  4EPZ A;  3KYI A;  5LP0 A;  5L0H A;  4Q96 A;  4U7E B;  5KNH D;  2G3K A;  1HE8 A;  1TNZ A;  3UMI A;  3LVQ E;  3AU5 A;  1K1A A;  4X8Q A;  5FZT A;  3QWP A;  4U07 A;  2R17 C;  1UN8 A;  1TR4 A;  2L81 A;  1XZP A;  2JEK A;  4CRW A;  5EX3 A;  2H6I A;  5EIB E;  2QTV A;  3LES A;  1QKR A;  1D0Y A;  3RIP A;  1C17 M;  2YKZ A;  1PAQ A;  2ZIS A;  4ILG A;  3SF4 A;  2P9L G;  4GTT A;  4ILH B;  1OY3 D;  1G4U S;  3ZRH A;  1OKK D;  5IY5 C;  3NKE A;  1W3B A;  1KZP A;  2ETS A;  3D9L A;  1NSG B;  5BNW A;  3KYJ A;  4J8D A;  4PJJ A;  3QB2 A;  2ICW G;  4LCT A;  3Q7F A;  4HOR A;  1V54 E;  4DX5 D;  4DJA A;  1E86 A;  3TWQ A;  4FLB A;  3FAJ A;  1ZHY A;  5DIZ A;  4E85 A;  2NUP B;  4HI8 A;  4BY6 A;  5CEC B;  4GEH A;  3NDB B;  3H2V A;  2LQG A;  4C0E A;  2UY1 A;  2UWJ G;  3ZUV B;  4CS9 C;  1H2V C;  1ZW2 A;  3K6B A;  1EA8 A;  1N95 A;  5G2N A;  4E0H A;  4U8V D;  5BPP A;  3W9G A;  3E9V A;  4Z9H A;  5HQ8 A;  4F1S A;  1FT1 A;  3QWV A;  2VGY A;  3JSE O;  5T3W A;  2WB2 A;  3PDN A;  3NKD A;  3TXM A;  2DIW A;  1TQG A;  1SZI A;  3OTN A;  5LCW J;  3EHM A;  3CVL A;  2V5Q C;  2V0P A;  3MA5 A;  2C0L A;  1IZM A;  1MQV A;  1UG7 A;  5KYU A;  3TG4 A;  1Q0D A;  4MND A;  1MX4 A;  4XTK A;  5EIL A;  4LEU A;  1R4T A;  4BX9 A;  4Y6W A;  2QC9 A;  2UUH A;  5KBA A;  3DZA A;  4UWG A;  4HFG A;  2CHX A;  2HV7 A;  2KGO A;  1A17 A;  3CEX A;  1N1C A;  3G2U A;  5BQG A;  3ABL C;  3KEA A;  2L6G A;  4LLC A;  4GZ3 A;  4MVQ A;  4DX6 D;  3Q78 A;  3LJB A;  4JHR A;  1O1T A;  4BFR A;  3FH7 A;  1PD0 A;  3NRH A;  3T9O A;  4GTS A;  3GZ1 A;  1Z6A A;  4BJ6 C;  4ATZ D;  4MVZ A;  3QAQ A;  1VB5 A;  4IB4 A;  5E3C A;  5DLJ A;  3PNT B;  2XPI A;  4I3M A;  1WN0 A;  4PH4 B;  1RW2 A;  2CNW D;  5BQH A;  4CJG A;  2OJE D;  5L3V A;  2XZD G;  3AOU A;  2YWA A;  5D0Q D;  2GRR B;  4DBR A;  3CST A;  3SP1 A;  2X6F A;  1YVI A;  2IY0 C;  4U96 D;  4GA0 A;  5E3A A;  4TUM A;  1Q0G A;  4DRX E;  2GDC A;  1N54 A;  4WGZ A;  5E75 A;  3V2O A;  5HV9 A;  5K0I A;  3HNL A;  3RK6 A;  3EZH A;  2WZG A;  3LEO A;  4KBQ A;  2LFD A;  3TXN A;  5HS0 A;  2R7O A;  3AS5 A;  4FUL A;  3ASO C;  3CVN A;  5E76 A;  1JWG A;  1TN7 A;  4HRM B;  5AQA A;  2EPN A;  4ILI A;  4MQ9 F;  4RBN A;  5EKQ D;  3QTH A;  4L6R A;  5CEA A;  4UWK A;  1OCR C;  3CHM A;  3IHV A;  4LNG A;  5FZR A;  5JHB A;  4OD4 A;  3TWS A;  4UI9 C;  4AE4 A;  1ST6 A;  2QE9 A;  1BR2 A;  1N0R A;  3J06 A;  3K33 A;  4K0D A;  1PV3 A;  3M15 A;  2WXO A;  1LS4 A;  2R9R B;  3ZU7 B;  1A7D A;  3V31 A;  3TWU A;  4GYW A;  5DVW A;  1SR2 A;  2I15 A;  3MJW A;  3D9K A;  1FFT C;  2H7B A;  3IBE A;  1T6U A;  3FMS A;  2F22 A;  2BL2 A;  1ORJ A;  3UR3 C;  5KJL A;  3FY4 A;  1R5I D;  4KYO B;  2LUH A;  3GYZ A;  3K66 A;  3WG7 E;  4BET A;  4JA7 A;  4GTP A;  4PJN A;  1HE1 A;  4KBL A;  4A2N B;  1TEZ A;  1BBH A;  1OUV A;  1HY5 A;  1A7V A;  2Y3H A;  3DSX A;  4JXT A;  2DYR E;  5F28 E;  2BED A;  2VB6 A;  4J8E A;  2IYL D;  3JXJ A;  1HG5 A;  1E96 B;  1S64 A;  4J7Y A;  2JX0 A;  4N6H A;  3FH5 A;  3L82 A;  2VTB A;  4PR9 A;  3B29 A;  3UUX A;  1WTY A;  2J08 A;  3Q6N A;  2B0J A;  4KNW A;  3Q7L A;  3HJC A;  4YN0 B;  3ZVV A;  2WQ6 A;  4DRJ B;  4C48 B;  5F5F A;  3HNJ A;  2M63 A;  1OW6 A;  3B71 A;  2AU5 A;  3FU5 A;  4OVU A;  3OXG A;  3U8P A;  5HRY A;  5CED B;  4G11 A;  4I9E A;  2QZA A;  3UKR G;  3MCX A;  4WWN A;  2LNI A;  5CCM A;  2A0B A;  5EN5 D;  3JYH A;  3TD7 A;  2Y4T A;  3O48 A;  2EQX A;  4EZK A;  5FZQ A;  4YDW A;  2DZN A;  4B6I A;  1QZ2 A;  4FWV A;  3NOG D;  1VMA A;  3J5Q B;  4MLP A;  1H6O A;  1C03 A;  2EIM E;  5AJD A;  1MJ0 A;  4BEJ A;  4K7B A;  3FUF A;  4MRU A;  5B3I A;  1BPO A;  2WVI A;  3GEH A;  1YAR O;  3BEE A;  4KC9 A;  2EIN C;  3CAX A;  5ENR D;  5KJK A;  1X81 A;  2WVN A;  1FAP B;  2WXP A;  2EPM X;  1Q0M A;  1O3U A;  3RKO F;  2WXM A;  3Q49 B;  3IQC A;  3FUM A;  1MMA A;  4ER9 A;  1OQC A;  2YEV A;  1WDY A;  2X51 A;  1LD8 A;  3TAX A;  4ZLD A;  4E6H A;  5JUA A;  4BSX A;  4YDO A;  3V7O A;  2EIK E;  2VGE A;  3ZXS A;  2A6H F;  2CG2 A;  3QWW A;  4PK4 A;  3U66 A;  3PRE A;  3G4X A;  2Y3D A;  4Q5S F;  3FAP B;  2DYS E;  1WGW A;  1D9S A;  3DSS A;  4DI3 A;  3EG9 A;  4JW1 A;  3L34 A;  1FMV A;  1KT0 A;  4U5C E;  3N2Z B;  2NXP A;  2AP3 A;  1Q0K A;  2WZL A;  3GWL A;  4CIP A;  1NFN A;  3RW0 A;  2ZGG A;  3MX3 A;  1HFA A;  1RKE B;  3FHE A;  3I3N A;  4HQD A;  4U95 D;  4CJO A;  3IQ5 A;  3IV0 A;  1P5Q A;  5CMW A;  4NY3 A;  3L8J A;  4JD2 G;  1Z3I X;  3ZQV A;  3NZS A;  2NUP A;  4N2Q A;  2ZU6 B;  2J7P D;  5M72 A;  1CGO A;  3S90 A;  3R9A B;  3C98 A;  3FTW A;  1K3Z D;  1YA7 O;  1UN9 A;  3B7B A;  3D9I A;  4CS7 A;  5AC5 A;  1DOW A;  2R5S A;  4A1G A;  2HSB A;  3SXY A;  3ABL E;  3L13 A;  2M64 A;  3RFY A;  3OWT A;  4GTR A;  4M63 A;  2DB4 A;  3PZ2 A;  4UQX A;  1Y6D A;  2IXM A;  1I4Z A;  5BXO A;  3U4T A;  1IKN D;  1SW6 A;  2HS5 A;  3VLF A;  2Y3B A;  2J49 A;  2WXR A;  3ITF A;  1ZYR F;  4XEV A;  5A6A A;  3ABM E;  3DD7 A;  3ZYM A;  3PUK A;  1K05 A;  1QSP A;  3PS6 A;  2KZT B;  2Q7F A;  2DZO A;  2X6J A;  1INZ A;  2CGE A;  3EGD B;  3AJI A;  4QQI A;  3DSU A;  3D9P A;  3RU0 A;  2KCL A;  4I1M A;  4HXI A;  3S7F A;  4QFV A;  4EBB A;  3RO3 A;  1EDU A;  2ZXW E;  2AXZ A;  2EPK X;  4P9F A;  3MEK A;  3AG2 C;  3ABK E;  4ANW A;  3S27 A;  3SNH A;  3MYV A;  3CR3 A;  4URK A;  2FEZ A;  4H4K C;  3EPV A;  4HOQ A;  5EYP F;  5FQ8 A;  1XZQ A;  2C03 A;  4H7X A;  1D0X A;  2LXM A;  1B89 A;  3KD7 A;  3DE8 A;  3UIN C;  4EBA G;  2KK1 A;  1Z3Y A;  4B8A A;  4UWF A;  2J07 A;  3QAR A;  3DSW A;  1HXI A;  5COG A;  2Y69 E;  2YLI A;  4L2L A;  3V79 K;  1ZW3 A;  3LY7 A;  4HB5 A;  3VLE A;  4KI2 A;  3A11 A;  4CSA C;  1BD8 A;  1TKN A;  5DS6 A;  2X3M A;  5B1B E;  1QPU A;  2OEX A;  2F8Y A;  1A0B A;  5L0C A;  3ZW3 A;  3FUK A;  1WWP A;  3D9O A;  3OA1 A;  2UY1 B;  5G05 C;  4JEH A;  3MYI A;  2CYD A;  2H7V C;  1N0Q A;  1BDJ B;  3QZC A;  5ARG A;  4KMO A;  5COM A;  3RRU A;  3HXC A;  2L0I A;  3NQP A;  2HFI A;  1HG2 A;  2XLE A;  3LS1 A;  4JUR I;  4F53 A;  1FPP A;  3GAN A;  1H7I A;  4J8Y A;  2NSF A;  2CDQ A;  4NIK A;  4BWR A;  2MWQ A;  4FAP B;  4Q69 A;  3EZI A;  3PE3 A;  2VCB A;  5AQ7 A;  3NAW A;  2V26 A;  3MYF A;  4U8Y D;  2KBX A;  3D9J A;  3US6 A;  4EIY A;  4K03 A;  5CMY A;  1KTM A;  3TL5 A;  2JD3 A;  5L3Q A;  4X0R A;  3N71 A;  3DMD A;  4RG6 A;  1N11 A;  4C9B B;  2KNH A;  4U0U A;  3WOD F;  4AL1 A;  4AE4 B;  4EHP A;  1MQS A;  3JT1 A;  1KPS B;  3HNI A;  3LEW A;  2XPY A;  3LUT B;  3HVE A;  1TR2 A;  3QDN A;  4EEC A;  1QVX A;  1OT8 A;  3FOO A;  3APD A;  3RQG A;  3B95 A;  3CHQ A;  3TWT A;  3ASG A;  2J9U A;  3CHP A;  1JUQ A;  1LD7 A;  1VK5 A;  3QVZ A;  2BUG A;  5E2Q A;  4FAD A;  2GAQ A;  4G7H F;  2J0X A;  3IQT A;  4G2V A;  5JLI A;  4DX1 A;  4LSZ E;  3EGX B;  1H6G A;  3PZ3 A;  2WXN A;  3OXF A;  3SEO A;  1XWJ A;  4GTM A;  3UM2 A;  4JEB A;  2OJQ A;  2WQH A;  4JPS A;  4ACL A;  1OXJ A;  3E37 A;  4N3A A;  2UUI A;  4PDX A;  2GW1 A;  1HW2 A;  3ZPJ A;  1KLX A;  1IQU A;  3ASN C;  3R7R A;  1BZ4 A;  4L23 A;  3CVP A;  2XRZ A;  2LFF A;  3S9O A;  2GRN B;  3B0P A;  1MX6 A;  3HXF A;  1D1C A;  1H9G A;  2Q7R A;  3CK9 A;  4BJ6 A;  2OEV A;  3CQG B;  1H0A A;  3I5P A;  3JUI A;  1Y6I A;  3SBS A;  3L1M A;  4JTA B;  5CI9 A;  3FP3 A;  4CBE A;  4E18 A;  4FJZ A;  2VTB B;  2PF4 E;  4FJY A;  1GQA A;  3PDM P;  2R7Q A;  3PCV A;  1V4A A;  1E7U A;  2J9W A;  4B0Z A;  4J0U A;  4JCZ A;  3LEV A;  3Q73 A;  3CSF A;  2AWY A;  1IHB A;  3ZC4 A;  4EZJ A;  4F4B A;  3SI5 A;  2W4B A;  1C02 A;  5CI8 A;  5ANR A;  2OQM A;  3ZYL A;  4NTF A;  3I4U A;  4KVM A;  1M6T A;  1PC2 A;  4YT5 A;  2X6K A;  2VCA A;  5T4Y A;  3QNK A;  3O10 A;  4G25 A;  2F0Y A;  2HE0 A;  1N4P A;  4J32 B;  1I5N A;  5T3T A;  5H7P A;  1OXB A;  1GGQ A;  1U89 A;  4GYY A;  3CZ6 A;  4ULW A;  4BEM J;  3PRZ A;  3VYW A;  2BF0 X;  1BR4 A;  2IO3 C;  2VH3 A;  2GA0 A;  4L7T A;  4HFF B;  4HRN A;  2IOQ A;  4YND A;  3K7D A;  2HKV A;  3ZQY A;  4O6F A;  3T5X A;  1KT1 A;  3DPD A;  3RAU A;  3FU3 A;  1F1M A;  3MV2 B;  2F37 A;  2IJG X;  4EHM A;  4C3D A;  2NG1 A;  4WGY A;  4JL0 A;  3L22 A;  2I2O A;  3S7J A;  3RIB A;  3B0V C;  3FTY A;  3FUJ A;  3VM6 A;  4NC3 A;  4XE0 A;  5JMN D;  3SFY A;  1YMP A;  256B A;  3JUE A;  4XPW A;  2KJG A;  4QI0 A;  3IEG A;  1T5O A;  4DLO A;  3LVR E;  3G2V A;  5A6K A;  2ZXR A;  1QQE A;  3QK0 A;  2LIG A;  4JB8 P;  3CVU A;  1E2X A;  2R05 A;  5DS4 A;  4TUU A;  5AC4 A;  3PUJ A;  2I8B A;  4N2S A;  2WZF A;  1N4Q A;  2IXP A;  3BQO A;  3RYL A;  3KL4 A;  4TXQ A;  1OCO C;  3RQE A;  3UM1 A;  2RSE B;  1XNF A;  2CHW A;  3S84 A;  3E4B A;  4RLY A;  5DQZ A;  3U3B A;  4EBJ A;  1V74 B;  3G2T A;  3DM9 B;  2NYJ A;  4FLH A;  4YL0 A;  4W9R A;  4AM9 A;  3M79 A;  1TWA A;  4DJ9 A;  2L6B A;  2XZT G;  2XS8 A;  3LKU A;  4O7G A;  4EBK A;  3AAA C;  4DRI B;  3R9M A;  1ZHZ A;  4ABN A;  4LNB A;  4GZ6 A;  4G7Z F;  1XGW A;  2XHE A;  4AL0 A;  4O6M A;  1G5Z A;  3CVQ A;  2FF4 A;  3JYS A;  3PEU B;  4PS3 A;  3C8G D;  4E17 A;  1H19 A;  1QZX A;  2J0W A;  1MNE A;  3DM5 A;  4GZD A;  4FA6 A;  3UNG C;  4K0R A;  3B7U X;  3CIA A;  1EYH A;  3QKY A;  5ENO D;  1M2V A;  4FX5 A;  5AQ9 A;  1NU7 D;  4O1P A;  5G55 A;  2C0M A;  3SZR A;  2KCK A;  4G0H A;  2XEH A;  3V2X A;  1UFB A;  1M2O A;  2YZS A;  5C1D A;  1Y4C A;  1JCQ A;  3ASH A;  1RZ4 A;  1QBQ A;  3DXJ F;  4LAC B;  3ESK A;  3QVY A;  5G05 J;  4CDN A;  3ZDL A;  3G50 A;  2H6H A;  1SZ9 A;  2F8X K;  5JVE A;  4IRU A;  1V54 C;  1N94 A;  3Q75 A;  4A63 B;  2RD9 A;  1Z6T A;  2AWI A;  4Q7C A;  2A6E F;  2NUT A;  2LSU A;  3KKB A;  4NUR A;  2HUJ A;  2BKG A;  4BER A;  2HM8 A;  3X2Q C;  2CW0 F;  2WMN A;  3I5Q A;  3ATP A;  1IXV A;  2NSG A;  4K5A B;  4TV3 A;  2Q9B A;  4U63 A;  2YVK A;  1OWL A;  4CYM D;  3L0I A;  2WPV A;  2ZGD A;  4I6G A;  2P7V A;  1B68 A;  4LER A;  4IYP A;  4LDK A;  4XWJ A;  3ZG1 A;  3SO8 A;  5EX0 A;  3ISM C;  4MW8 A;  2V5F A;  1CGM E;  4GMR A;  1NA0 A;  2DWZ A;  3LLI A;  4U0S A;  4MTG A;  5FQ7 A;  4MVS A;  1VTM P;  1LI7 A;  3RVY A;  4NTB A;  2X38 A;  2IBF A;  5D92 A;  3T4R A;  3ML9 A;  4AY5 A;  2KAT A;  1K04 A;  3C62 A;  3U3W A;  1RMV A;  3ABK C;  3AG2 E;  3IXE A;  3ULY A;  3IEE A;  2E0I A;  1APC A;  2KC3 A;  1OKK A;  4CX9 A;  1Z23 A;  1OCC C;  1OW7 A;  4I9C A;  1S63 A;  3ZNG A;  3UQ3 A;  2MHR A;  3E34 A;  2P0N A;  1E8X A;  3POV A;  3ZKJ A;  5G04 C;  2Q9C A;  2W4M A;  5ENN A;  4I17 A;  3ZHE A;  2WXF A;  3GOD A;  2YLG A;  5E33 A;  1NFI E;  4XX5 A;  2NC9 A;  1G3N B;  3EDT B;  3ZSU A;  5B1A C;  1KU2 A;  3AQC A;  1VDY A;  2A68 F;  3FU6 A;  3UGP A;  4GMJ A;  3UX4 A;  4ANX A;  3V5Z A;  5AAO A;  2HJ3 A;  5A6J A;  2C04 A;  5ENP D;  4ACK A;  3VF0 A;  1WAT A;  4YT2 A;  2AVP A;  1QNF A;  1TNU A;  3PMR A;  5BUO A;  3K1H A;  3SFZ A;  5EGY A;  2WVO A;  4PFP A;  3IHU A;  1N4S A;  4J7W A;  1U3D A;  4DX2 A;  3C7J A;  1TWH A;  5B1A E;  4FP7 A;  1S7Z A;  3AS8 A;  2YQ8 A;  1U0B B;  5EYL A;  4CZ2 D;  1ZBP A;  4OYS A;  5FJY A;  3EIJ A;  3CEQ A;  3W8H A;  3SXZ A;  1OR3 A;  3Q5M A;  3GZS A;  1JRA A;  4DPR A;  5AIJ A;  4RSY A;  2VJ8 A;  4ANV A;  4D4N A;  2PFD A;  3TOM A;  3UM3 A;  4BJ5 C;  4KXK B;  3AS4 A;  2RFM A;  3JRT A;  2V3C C;  4B93 B;  1U2V G;  2W45 A;  3PHF 2;  4JHJ A;  1QYM A;  4U04 A;  4DBQ A;  1OCZ C;  2HV6 A;  3QOU A;  5BQI A;  4HEA J;  4C3E A;  2QY9 A;  4GML A;  1SYQ A;  3MV3 B;  3C3Q A;  4PJL A;  4XEI G;  3WAQ A;  1JWF A;  2A4Z A;  4XZ4 A;  3C63 A;  3LY8 A;  3RH3 A;  1JR8 A;  1YYH A;  4ANU A;  3LCA A;  2NSZ A;  3DI5 A;  3W4Y A;  2QYU A;  3URZ A;  4O79 A;  2OG2 A;  3I4R B;  2DGJ A;  5BT1 A;  3FWV A;  3X2Q E;  4HOS A;  5GPG B;  2HYZ A;  3JTL O;  3R7C A;  4U8H A;  4EWC A;  2OCC C;  4JZY A;  3Q7A A;  4ZLC A;  2ZD9 A;  1MHQ A;  2D4U A;  3Q47 B;  1HX8 A;  2QLA A;  2HJM A;  3Q79 A;  4J8S A;  1BLX B;  2PZI A;  2YL7 A;  3CVY A;  3E32 A;  2AXV A;  3CVV A;  4O6Y A;  4CDY A;  1TN8 A;  1TJC A;  2RD0 A;  2LSV A;  5A23 A;  4N06 A;  4NRH B;  2XEV A;  4Z9I A;  1FT2 A;  1JOG A;  5AAR A;  3FUE A;  4MVM A;  5KYN A;  2VAS A;  4U5H A;  4YK5 A;  2LO6 A;  1CPR A;  4FES A;  2XLO A;  2DI3 A;  1V55 C;  4CSA A;  1TWG A;  1LVK A;  3O6X A;  2J46 A;  2OKU A;  5B1B C;  1ORS C;  3Q9N C;  3HIZ A;  3V30 A;  4BX8 A;  3AG4 C;  3CKC A;  4L1B A;  1ELW A;  3APC A;  2A1D D;  3FU0 A;  4IJJ A;  3PH0 C;  3ASF A;  2P9I G;  5KYX B;  1Q0F A;  4JCH A;  1IYG A;  4GTV A;  4I1A A;  4ZFH A;  4ULV A;  1EQ1 A;  3RJV A;  4BT8 A;  2PM7 A;  2R7T A;  1OCC E;  4LDQ A;  1LI5 A;  4OVV A;  2DYR C;  1VYK A;  2OOC A;  3K1I A;  1LKX A;  4G78 A;  1YA0 A;  4D10 C;  5BUZ A;  2I9C A;  4JVS A;  5A6B D;  3ZEF A;  1JPJ A;  4TXP A;  2WXH A;  4JJG A;  1DC2 A;  1HH8 A;  2J9V A;  2X0C A;  1RXQ A;  1LIH A;  4GA1 A;  4V3I A;  3JCU Q;  4IWB A;  4HVB A;  1FR0 A;  2XXA B;  3SYN A;  1Z3X A;  2J8W A;  4Q94 A;  4YDY A;  3LLK A;  1LE2 A;  5FZS A;  4E0I A;  1D8D A;  3AG1 E;  3FTX A;  2YL1 A;  3AG3 C;  3EHQ A;  1EI7 A;  1E7V A;  2YHS A;  3KEZ A;  4ME2 A;  4XKC A;  2Q9A A;  2IU1 A;  4ONS A;  4MS6 A;  1HMO A;  3TWX A;  3DJN B;  3ONK A;  4E7S A;  2FO1 E;  3D9H A;  2GRQ B;  3DEP A;  4KNV A;  5CRV A;  1PD1 A;  3LJ3 A;  1CGN A;  5KJN A;  4U5B E;  2FUL A;  3UMK A;  2J45 A;  1M2V B;  3TWR A;  4DUI A;  3BG0 B;  4OAV B;  2CCY A;  3DAF A;  5A69 A;  2R03 A;  2XLV A;  2GRM A;  3VTY A;  4JEA A;  4RVB A;  5JJ7 A;  2PM6 A;  4XEF A;  2YL0 A;  1O5H A;  3FUN A;  2KM4 A;  4YDE A;  3RF3 A;  3BRJ A;  4UDV A;  3U5S A;  2Y39 A;  2E2E A;  3EGD A;  3U3F A;  3CQC B;  1NP7 A;  2Y3G A;  4GYO A;  1TNB A;  2P9N G;  3TWW A;  1E90 A;  2WB7 A;  4JC7 A;  2WXI A;  3D9N A;  2NUT B;  2XRY A;  3U8V A;  1BR1 A;  3E30 A;  1ZZP A;  2ZXO A;  3QW1 A;  3DBS A;  2YRF A;  4HI9 A;  1M57 C;  3L6A A;  1SVX A;  4I1O B;  4IAO A;  2TMV P;  3MKR A;  3HYM B;  3SBT B;  4BES A;  5AGF A;  5LX8 A;  3TQO A;  5AQB A;  3ULE G;  3KS2 A;  3HLZ A;  3JXI A;  4B89 A;  2XL4 A;  3JCK C;  2HZ8 A;  1E83 A;  1FVH A;  2ETC A;  3MKQ B;  4OAU C;  1L7C A;  2CG3 A;  2J4D A;  3B13 A;  3AU4 A;  3S0X A;  3KAE A;  4KZC A;  5KYY B;  3GEE A;  3DKA A;  3U9W A;  5L0D A;  2AWC A;  5AYW D;  2XSE A;  4APO A;  3LJN A;  3DWL G;  2P9U G;  3GM2 A;  2R7R A;  1TFK B;  2QFC A;  2YIN A;  1RJ9 A;  2GWW A;  4G8L A;  4DLQ A;  3DXM G;  1TYQ G;  2AVK A;  3EIQ C;  3VAY A;  2KQ9 A;  4F1P A;  3Q15 A;  2XL6 A;  1V55 E;  3DSV A;  2ZIR A;  2XLD A;  2Z15 A;  3N0T A;  2PL2 A;  5T3R A;  4U5G A;  1JCS A;  3NBN B;  3UM0 A;  4BJ5 A;  3C3O A;  4BSZ B;  4U9E A;  1FCH A;  1FNT c;  1HE9 A;  3MFN A;  1FTS A;  4MVR A;  2ZXW C;  4E7Z A;  4A4A A;  3FDH A;  2EIN E;  4N39 A;  3C8Z A;  2OV8 A;  3N24 A;  3IPM O;  1JAF A;  3M4C A;  1TNO A;  1O87 A;  1OCO E;  2AW6 A;  4N3B A;  3ZN3 A;  4YVQ C;  4EKW A;  5AEN A;  1UJJ A;  2WVQ A;  3HTK C;  1K40 A;  3AG4 E;  2HMQ A;  5D91 A;  1NZN A;  1HS6 A;  4GB9 A;  4HLE A;  1D0Z A;  1ELR A;  1MND A;  2JPU A;  2MRI A;  2LCH A;  1YLM A;  3QC1 A;  3UT8 A;  2IF4 A;  4DVY P;  3NMI A;  4OIQ F;  1OWO A;  1FVF A;  4WNF A;  3FH8 A;  3DAG A;  2D5R B;  5DS5 A;  3G2S A;  4B8C B;  4ZHB A;  1Z5S C;  4LNU D;  3AGT A;  3FVY A;  2J09 A;  3SXM A;  3B7T A;  3OEO A;  2L6J A;  3RRM B;  2PQR A;  4CS9 A;  4AVX A;  1A7E A;  3UTM A;  3PVL A;  1WG0 A;  3C8G B;  1H6P A;  4FHK A;  3SNX A;  1A5E A;  2R02 A;  2X6H A;  3RSE G;  1TNY A;  4HNA D;  3B0U X;  4A55 A;  2J8S D;  1GS9 A;  4DOZ A;  4J6I A;  1Y8M A;  5KWD A;  3SD5 A;  5LOZ A;  1QQ3 A;  3D9M A;  4UQY A;  2LXL A;  2XL8 A;  3G4Z A;  1JCR A;  4RQI A;  2M4E A;  5LCW C;  1HF8 A;  1J8M F;  4PUC A;  5FT9 A;  3W9F A;  3ZFW A;  4WAB A;  1T01 A;  4JTD B;  2VYI A;  2DBA A;  1AP7 A;  3H65 A;  4PS7 A;  1M56 C;  2G62 A;  3TK0 A;  4HLL A;  5EK0 A;  2XRH A;  4WWO A;  2FAP B;  4C7O B;  3DPY A;  3L54 A;  1TWC A;  3OXL A;  3LDZ A;  1AWC B;  3KPH A;  5KYW B;  4JA9 A;  3ASO E;  2XLW A;  4I2Z A;  3VRC A;  3GOR A;  2PNO A;  2VCC A;  3ZTM A;  4KVO A;  1HMD A;  2QY7 A;  2LD6 A;  2OU6 A;  4DX7 D;  2RFA A;  4XQ1 A;  3SGH A;  3GWN A;  1HU3 A;  4HRL A;  3LY9 A;  2PQN A;  4FHJ A;  3GZ2 A;  2Q00 A;  1SZA A;  3NZU A;  5FCL A;  5HI7 A;  2IM8 A;  5LFA A;  4G8K A;  2DVW A;  2IEJ A;  4GTO A;  3TJ5 A;  4CT4 A;  2A5E A;  3FTU A;  1N4R A;  3O4Z A;  3J5P A;  4UUC A;  4C3B A;  4GPM A;  1DCQ A;  4EQF A;  1YDI A;  1E84 A;  4J30 B;  3SQV A;  2ZXP A;  5L0G A;  2IOS A;  4AEZ C;  3P1U A;  3T6B A;  2ETB A;  4AK9 A;  3ZIB A;  1IQR A;  2LAI A;  2G3V A;  2VC9 A;  3A9C A;  3M1C B;  4N5Q A;  4RDA A;  4D4X A;  4Q4Z F;  5ENT D;  3SHF A;  3MLG A;  3QJZ A;  5FIN A;  2XGM A;  3TJP A;  1YZA A;  1N9A A;  3IKO B;  3PE4 A;  1NLX A;  4GCO A;  3BU8 A;  3AQB A;  2GRL A;  1E8Y A;  3CHO A;  4BJ1 A;  4FU3 A;  5BXU A;  2EIL C;  3DWW A;  3CKB A;  4JTC B;  5FIO A;  1L3P A;  1PY1 A;  1D1B A;  1ZHW A;  3ML8 A;  2E87 A;  3TUL A;  4P29 A;  2BTD A;  2A69 F;  4AY6 A;  5CBO A;  4MTO A;  4K5B A;  2EPO A;  4IN3 B;  1MMN A;  2RKK A;  4CGW A;  2KXP C;  3HNK A;  4KZ0 A;  3GM1 A;  4UWH A;  2CFU A;  4N6C A;  2B0O E;  3GM3 A;  4G1T A;  1DVP A;  2NPU A;  1NFO A;  4PJM A;  4OIR F;  1UJK A;  4WNE A;  4BG0 A;  3U2M A;  2OVF A;  2Q4F A;  2IXN A;  3JZ0 A;  4NQ0 A;  1Z7Q c;  3EHR A;  3SXK A;  3CK7 A;  3EQL F;  4P6I C;  1TJF A;  3FEX A;  1OW8 A;  4G26 A;  5A7D B;  2O9X A;  4U9D A;  2WXQ A;  1MYO A;  1K1B A;  3PEV B;  3HKK A;  3ZYK A;  4I6E A;  1OWN A;  3ZHE B;  2MYS A;  1ZB1 A;  1BI7 B;  2FGY A;  5AJL A;  3CQZ A;  4EUK B;  4GQH A;  1S70 B;  5KYX A;  3JRM O;  5D2M C;  2Y69 C;  3EHN A;  3EH2 A;  5B3S E;  3LPZ A;  4G7O F;  1OXK A;  2V8S E;  3L8I A;  3UT4 A;  4PAC A;  4U5D E;  3T6G B;  5JRA A;  2PBE A;  3ZVR A;  5JT4 A;  5A6B A;  3ZIM A;  1JPN A;  4MS2 A;  3UMH A;  2WXK A;  2XGS A;  2R2L A;  5D66 A;  2WQ7 A;  2GRP B;  1X5B A;  2BKK B;  2Y1L E;  4CGV A;  4YL3 A;  2KYH A;  3E70 C;  4EZL A;  2P9S G;  3GW4 A;  2A5U A;  3T8M A;  1U6H A;  4GU5 A;  3JQ0 A;  2WL8 A;  5KYY A;  1E8Z A;  4MKT A;  4N5C A;  3CK8 A;  2VGX A;  2OOE A;  5ENS D;  2J4B A;  3F46 A;  4JHK A;  5T1D B;  3C72 A;  3JQ1 A;  4L9P A;  1ZHX A;  5HSW A;  2MHK A;  3CLJ A;  3E33 A;  4W8K A;  4UI9 J;  4GCN A;  4KT6 B;  3V5Y A;  1SQM A;  4UQZ A;  3HHM A;  4JKV A;  1UG3 A;  3UKU G;  2AJA A;  5BV1 A;  2XS1 A;  3EU9 A;  4J8F A;  2BC5 A;  2HR2 A;  4CIH A;  3ULQ A;  2OCC E;  4A3V A;  4XKB A;  4JIO A;  3ZWI A;  4AOF A;  1VLS A;  1QLE C;  1LE4 A;  4HE8 D;  1I4Y A;  1OCZ E;  2XEE A;  3UMV A;  3FHD A;  2VQ2 A;  2LSE A;  4TRQ A;  2C2L A;  3APF A;  1NI1 A;  2P61 A;  4LLE A;  4I6J A;  1ORY A;  5CRU A;  4GTQ A;  5ENQ D;  1YJG A;  5AN8 A;  1VOM A;  3EFO B;  1O1S A;  2LP4 A;  2J9Q A;  3EUV A;  3LYA A;  5CCL A;  5ANL A;  4JEU A;  2WM9 A;  2B0H A;  3FEY A;  4MTF A;  3IHY A;  4DK5 A;  3T5V A;  4BTA A;  3RO2 A;  1IW7 F;  2VSO E;  2I1K A;  2ION A;  3LXU X;  2HSQ A;  3ABM C;  5FWQ A;  2J9B A;  5D0O D;  2ETA A;  3BUA A;  3CVX A;  3ZGQ A;  2P6V A;  4I2W A;  2IQC A;  3L16 A;  3MKQ A;  4MBG A;  1NZE A;  3D3M A;  2FFH A;  1EPU A;  4F6R D;  5CBN A;  4XI0 A;  5KCM A;  1YYJ A;  4PS8 A;  3FOP A;  3FFL A;  4GAA A;  3U0C A;  1HZ4 A;  1ZU5 A;  1ZVZ A;  2MYO A;  2YHE A;  2L7A A;  3AG1 C;  3NYM A;  2VSY A;  1D1A A;  3NYJ A;  3DST A;  2IOL A;  3B7S A;  3EH1 A;  1RKC A;  2L6H A;  4QDL A;  2CFZ A;  3JSZ A;  1DOV A;  4G24 A;  4B94 A;  1Z5Z A;  1O1R A;  3W2W A;  5JS5 A;  4LUN U;  4G23 A;  1VLT A;  3U2L A;  3FUH A;  3S2A A;  1K8K G;  5HKP A;  2VSN A;  3F6Q A;  4C0M A;  2XEN A;  4YWQ A;  1SF8 A;  4ATG A;  1MMD A;  3W8I A;  5KYW A;  3RKV A;  4A3T A;  1E85 A;  4XLP F;  1LF8 A;  2H7O A;  2FO7 A;  4DRH B;  2EIM C; 
#chains in the Genus database with same CATH homology
 2LAH A;  3G2W A;  2L9J A;  4WWP A;  3NG1 A;  1MMG A;  4OD5 A;  4HFK B;  3S28 A;  2R7X A;  4H7Y A;  4U5E E;  4M3O A;  2KCV A;  1N52 A;  5JJ6 A;  4PFO A;  4BT9 A;  2Y3A A;  3K9I A;  2BE5 F;  2I1J A;  1NA3 A;  3UPV A;  3PZD A;  2L9B A;  4AJW A;  4OIO F;  3KMI A;  1HO8 A;  5KYU B;  3ESL A;  3U64 A;  5KJM A;  4XLN F;  4YT8 A;  1E8W A;  2PP4 A;  2PX0 A;  4UWL A;  2WXJ A;  1ZU4 A;  2VSX E;  4GYT A;  4WAF A;  4OIP F;  3F47 A;  4YVO A;  5A6C A;  2Y4U A;  5BW8 C;  4C7O A;  5BV0 A;  5FQ4 A;  5C2Y A;  2WXL A;  1Z63 A;  3LS8 A;  3BG1 B;  1SMY F;  3CSK A;  2KC7 A;  3S29 A;  4XI9 A;  2XXA A;  1WY6 A;  2R59 A;  4JZA A;  3L17 A;  1U3C A;  2IFU A;  3WXX A;  1OWM A;  3KH2 A;  1DNP A;  3LNR A;  5JJT A;  2CNW A;  5FTP A;  4A1S A;  1FFH A;  1L5J A;  3UT7 A;  3Q4A B;  1NU9 C;  1ZU2 A;  4WNG A;  4CDM A;  3TGO A;  4JJF A;  3FUI A;  1RJ9 B;  2XPZ A;  4WUY A;  3Q7G A;  4JC8 A;  5G04 J;  3WG7 C;  4N3C A;  3UGO A;  2R7V A;  2YHC A;  4CT0 A;  3VLD A;  3NF1 A;  2PX3 A;  4HOT A;  2EIJ C;  3SZ7 A;  3ENE A;  1ELK A;  5T8I A;  4WJ0 A;  2R7U A;  4RD9 A;  2L0T B;  2OVB A;  4OIN F;  1IHG A;  1H2U A;  3NYL A;  1J8Y F;  2R7W A;  1ZHT A;  4CS8 C;  1VYI A;  3EG9 B;  3S7B A;  5DQT A;  5DBK A;  4FC8 A;  3FDQ A;  4CDR A;  4HOU A;  2WXG A;  2DCP A;  2JLB A;  3L08 A;  4NAC A;  2FI7 A;  1WAO 1;  4AP2 A;  2EIK C;  2ZPA A;  3FUL A;  4R7L A;  3W2V A;  4ANJ A;  1PCX A;  2XCC A;  5EDS A;  2X6I A;  3ASD A;  3S7D A;  3RRN B;  3PNL B;  4YJW A;  2RG8 A;  3LAY A;  4LRZ A;  1LS1 A;  4DVZ A;  1WM5 A;  2KZT A;  2YNQ A;  2IXO A;  4O6N A;  3CV0 A;  4BTB A;  2R7S A;  2ILR A;  3TG5 A;  3X1O A;  1H6K A;  3CHS A;  2Q3T A;  3EFO A;  5EHH A;  3HVE B;  1OWP A;  4RG9 A;  1S0P A;  4I43 A;  2MOW A;  2GGF A;  3FTZ A;  5JHA A;  2CHZ A;  3Q6M A;  5J08 A;  3ONL A;  4U0Z A;  4GZ5 A;  3EGX A;  2GFH A;  4GA2 A;  4CEM A;  4AIF A;  3ZYQ A;  4Y6C A;  2OND A;  4F7A A;  4GPK A;  4CCA A;  3OAW A;  3FTS A;  4CS8 A;  4F3V A;  3R7Q A;  2VGX B;  3HDX A;  3P2B A;  4AXH A;  2FBN A;  3B9Q A;  4IUL A;  4U5F E;  2V4L A;  1FMW A;  1JPL A;  3I4G A;  1NG1 A;  2I6H A;  1EF1 C;  4AX2 A;  4XIF A;  3T6J A;  2WMO A;  3O39 A;  4BJT A;  2XCB A;  5FQ6 A;  3ECS A;  5CHE E;  5ARF A;  1UW4 B;  4I44 A;  3K1I C;  3QMK A;  4UI9 K;  2HO1 A;  3MZL B;  3DJU B;  4L2Y A;  3FUD A;  3B7R L;  2XQ0 A;  4EBA A;  5J90 A;  4AV7 A;  1W2W A;  2XGO A;  2J7P A;  1H2T C;  4GZC A;  3VTX A;  2DYS C;  1GW6 A;  3LS0 A;  2KW3 C;  2P58 C;  3EJN A;  4WND A;  4YT4 A;  3MGB A;  1G8X A;  3CGH A;  5F5H A;  4QI2 A;  3CVW A;  2AXU A;  3FTV A;  2W9Y A;  4HS2 A;  4DI4 A;  5B3S C;  3CHR A;  4EPZ A;  4APF A;  5LP0 A;  4Q96 A;  2G3K A;  1HE8 A;  3UMI A;  3LVQ E;  3AU5 A;  3QWP A;  4U07 A;  2R17 C;  1UN8 A;  2L81 A;  2JEK A;  4CRW A;  5EX3 A;  2QTV A;  3LES A;  3RIP A;  1D0Y A;  4ILG A;  1PAQ A;  3SF4 A;  4ILH B;  3ZRH A;  1OKK D;  5IY5 C;  3NKE A;  1W3B A;  3D9L A;  5BNW A;  4J8D A;  4PJJ A;  3QB2 A;  4LCT A;  4HOR A;  4DJA A;  4FLB A;  3FAJ A;  1ZHY A;  5DIZ A;  4E85 A;  2NUP B;  4BY6 A;  4GEH A;  3NDB B;  4C0E A;  2UY1 A;  2UWJ G;  4CS9 C;  1H2V C;  3K6B A;  5G2N A;  5BPP A;  3E9V A;  5HQ8 A;  4F1S A;  3QWV A;  2VGY A;  5T3W A;  2WB2 A;  3PDN A;  3NKD A;  3TXM A;  2DIW A;  1SZI A;  3OTN A;  5LCW J;  3EHM A;  3CVL A;  2V0P A;  3MA5 A;  2C0L A;  1IZM A;  5KYU A;  3TG4 A;  4MND A;  4XTK A;  4LEU A;  4BX9 A;  4Y6W A;  3DZA A;  4UWG A;  4HFG A;  2CHX A;  2HV7 A;  2KGO A;  1A17 A;  1N1C A;  3G2U A;  3ABL C;  4LLC A;  4GZ3 A;  3LJB A;  4JHR A;  4BFR A;  3FH7 A;  1PD0 A;  3NRH A;  3GZ1 A;  1Z6A A;  4BJ6 C;  3QAQ A;  5E3C A;  5DLJ A;  3PNT B;  2XPI A;  4I3M A;  4PH4 B;  2CNW D;  5L3V A;  5D0Q D;  4DBR A;  3CST A;  3SP1 A;  2X6F A;  4GA0 A;  5E3A A;  1N54 A;  5E75 A;  3RK6 A;  3EZH A;  2WZG A;  4KBQ A;  3TXN A;  2R7O A;  3AS5 A;  4FUL A;  3ASO C;  3CVN A;  5E76 A;  1JWG A;  4ILI A;  4MQ9 F;  4RBN A;  5EKQ D;  4UWK A;  1OCR C;  3CHM A;  3IHV A;  5FZR A;  5JHB A;  4OD4 A;  4UI9 C;  4AE4 A;  1ST6 A;  1BR2 A;  3K33 A;  4K0D A;  2WXO A;  4GYW A;  5DVW A;  3MJW A;  3D9K A;  1FFT C;  2H7B A;  3IBE A;  3UR3 C;  5KJL A;  3FY4 A;  4KYO B;  3GYZ A;  3K66 A;  4JA7 A;  4PJN A;  4KBL A;  4A2N B;  1TEZ A;  1OUV A;  2Y3H A;  4JXT A;  2VB6 A;  4J8E A;  2IYL D;  1HG5 A;  1E96 B;  3FH5 A;  2VTB A;  3UUX A;  2J08 A;  3Q6N A;  2B0J A;  4KNW A;  3Q7L A;  3HJC A;  4YN0 B;  3ZVV A;  2WQ6 A;  5F5F A;  2M63 A;  3FU5 A;  4OVU A;  3OXG A;  4G11 A;  4I9E A;  3MCX A;  4WWN A;  2LNI A;  5CCM A;  3JYH A;  3TD7 A;  2Y4T A;  3O48 A;  2EQX A;  4EZK A;  5FZQ A;  4B6I A;  1QZ2 A;  4FWV A;  1VMA A;  4MLP A;  5AJD A;  4BEJ A;  4K7B A;  3FUF A;  4MRU A;  1BPO A;  2WVI A;  3BEE A;  4KC9 A;  2EIN C;  5KJK A;  2WVN A;  2WXP A;  3RKO F;  2WXM A;  3Q49 B;  3FUM A;  1MMA A;  2YEV A;  2X51 A;  3TAX A;  4ZLD A;  4E6H A;  4BSX A;  3V7O A;  3ZXS A;  2A6H F;  2CG2 A;  3QWW A;  4PK4 A;  3U66 A;  3PRE A;  2Y3D A;  4Q5S F;  1WGW A;  4DI3 A;  3EG9 A;  4JW1 A;  3L34 A;  1FMV A;  1KT0 A;  4U5C E;  3N2Z B;  2NXP A;  2WZL A;  3MX3 A;  1HFA A;  3FHE A;  3I3N A;  3IV0 A;  1P5Q A;  5CMW A;  4NY3 A;  1Z3I X;  3NZS A;  2NUP A;  4N2Q A;  2ZU6 B;  2J7P D;  5M72 A;  3R9A B;  3C98 A;  3FTW A;  1UN9 A;  3D9I A;  4CS7 A;  2R5S A;  4A1G A;  3L13 A;  3RFY A;  3OWT A;  4M63 A;  4UQX A;  2IXM A;  3U4T A;  3VLF A;  2Y3B A;  2J49 A;  2WXR A;  3ITF A;  1ZYR F;  3DD7 A;  3ZYM A;  3PUK A;  3PS6 A;  2KZT B;  2Q7F A;  2X6J A;  1INZ A;  2CGE A;  3EGD B;  3D9P A;  3RU0 A;  3S7F A;  2KCL A;  4I1M A;  4HXI A;  4QFV A;  4EBB A;  3RO3 A;  1EDU A;  2AXZ A;  4ANW A;  3MEK A;  3AG2 C;  3S27 A;  3SNH A;  3MYV A;  3CR3 A;  4URK A;  2FEZ A;  4H4K C;  3EPV A;  4HOQ A;  5FQ8 A;  2C03 A;  4H7X A;  1D0X A;  1B89 A;  3KD7 A;  4EBA G;  1Z3Y A;  4B8A A;  4UWF A;  2J07 A;  3QAR A;  1HXI A;  4L2L A;  3LY7 A;  3VLE A;  4KI2 A;  4CSA C;  1TKN A;  5DS6 A;  2X3M A;  3ZW3 A;  3FUK A;  3D9O A;  3OA1 A;  2UY1 B;  5G05 C;  4JEH A;  2H7V C;  3QZC A;  5ARG A;  4KMO A;  3RRU A;  2L0I A;  3NQP A;  1HG2 A;  3LS1 A;  4JUR I;  4F53 A;  3GAN A;  2CDQ A;  4BWR A;  2MWQ A;  4Q69 A;  3EZI A;  3PE3 A;  2V26 A;  3D9J A;  4K03 A;  5CMY A;  3TL5 A;  2JD3 A;  5L3Q A;  4X0R A;  3N71 A;  3DMD A;  4RG6 A;  4C9B B;  2KNH A;  4U0U A;  3WOD F;  4AE4 B;  1MQS A;  3JT1 A;  3LEW A;  2XPY A;  3HVE A;  3QDN A;  1TR2 A;  4EEC A;  3APD A;  3CHQ A;  3ASG A;  2J9U A;  3CHP A;  1JUQ A;  1VK5 A;  2BUG A;  5E2Q A;  4FAD A;  4G7H F;  2J0X A;  4G2V A;  3EGX B;  2WXN A;  3OXF A;  3SEO A;  4ACL A;  2WQH A;  4JPS A;  4N3A A;  4PDX A;  2GW1 A;  3ZPJ A;  1KLX A;  1IQU A;  3ASN C;  3R7R A;  4L23 A;  3CVP A;  2XRZ A;  3B0P A;  1D1C A;  3CK9 A;  4BJ6 A;  3CQG B;  1H0A A;  3I5P A;  3JUI A;  1Y6I A;  3SBS A;  5CI9 A;  3FP3 A;  4CBE A;  4FJZ A;  2VTB B;  2PF4 E;  4FJY A;  2R7Q A;  1E7U A;  2J9W A;  4B0Z A;  4J0U A;  3LEV A;  3CSF A;  3ZC4 A;  4EZJ A;  4F4B A;  3SI5 A;  2W4B A;  5CI8 A;  5ANR A;  3ZYL A;  3I4U A;  4KVM A;  1PC2 A;  4YT5 A;  2X6K A;  5T4Y A;  3QNK A;  4G25 A;  4J32 B;  5T3T A;  4GYY A;  3CZ6 A;  4ULW A;  3PRZ A;  3VYW A;  2BF0 X;  1BR4 A;  2VH3 A;  4L7T A;  4HFF B;  4YND A;  2IOQ A;  3K7D A;  4O6F A;  3T5X A;  1KT1 A;  3DPD A;  3FU3 A;  3MV2 B;  2IJG X;  4C3D A;  2NG1 A;  4JL0 A;  3L22 A;  2I2O A;  3S7J A;  3RIB A;  3B0V C;  3FTY A;  3FUJ A;  4XE0 A;  2KJG A;  4QI0 A;  3IEG A;  4DLO A;  3LVR E;  3G2V A;  2ZXR A;  1QQE A;  3QK0 A;  3CVU A;  5DS4 A;  4TUU A;  3PUJ A;  2I8B A;  4N2S A;  2WZF A;  2IXP A;  3RYL A;  3KL4 A;  1OCO C;  1XNF A;  2CHW A;  3E4B A;  5DQZ A;  3G2T A;  3DM9 B;  4FLH A;  4W9R A;  4AM9 A;  1TWA A;  3LKU A;  4O7G A;  1ZHZ A;  4ABN A;  4GZ6 A;  4G7Z F;  1XGW A;  2XHE A;  4O6M A;  3CVQ A;  2FF4 A;  3JYS A;  3PEU B;  4PS3 A;  1H19 A;  1QZX A;  2J0W A;  1MNE A;  3DM5 A;  4GZD A;  4FA6 A;  3UNG C;  4K0R A;  3B7U X;  3CIA A;  1EYH A;  3QKY A;  1M2V A;  4FX5 A;  1NU7 D;  5G55 A;  2C0M A;  3SZR A;  2KCK A;  4G0H A;  1M2O A;  2YZS A;  5C1D A;  3ASH A;  3DXJ F;  4LAC B;  3ESK A;  5G05 J;  4CDN A;  1SZ9 A;  4IRU A;  1V54 C;  1Z6T A;  2AWI A;  4Q7C A;  2A6E F;  2NUT A;  2LSU A;  3KKB A;  4NUR A;  2HM8 A;  3X2Q C;  2CW0 F;  2WMN A;  3I5Q A;  4TV3 A;  2Q9B A;  4U63 A;  1OWL A;  3L0I A;  2WPV A;  4I6G A;  2P7V A;  4LER A;  4IYP A;  3ZG1 A;  4XWJ A;  5EX0 A;  2V5F A;  1NA0 A;  3LLI A;  4U0S A;  5FQ7 A;  2X38 A;  5D92 A;  3T4R A;  3ML9 A;  4AY5 A;  2KAT A;  3U3W A;  3ABK C;  3IEE A;  2E0I A;  1OKK A;  1Z23 A;  1OCC C;  4I9C A;  3UQ3 A;  3POV A;  1E8X A;  5G04 C;  2Q9C A;  2W4M A;  5ENN A;  4I17 A;  3ZHE A;  2WXF A;  3GOD A;  5E33 A;  4XX5 A;  2NC9 A;  3EDT B;  3ZSU A;  5B1A C;  1KU2 A;  3AQC A;  1VDY A;  2A68 F;  3FU6 A;  3UGP A;  4GMJ A;  3UX4 A;  4ANX A;  2C04 A;  4ACK A;  4YT2 A;  2AVP A;  1QNF A;  3PMR A;  5BUO A;  3K1H A;  3SFZ A;  5EGY A;  2WVO A;  4PFP A;  1U3D A;  1TWH A;  4FP7 A;  1S7Z A;  3AS8 A;  2YQ8 A;  1ZBP A;  4OYS A;  5FJY A;  3EIJ A;  3CEQ A;  3W8H A;  3Q5M A;  3GZS A;  4DPR A;  5AIJ A;  4RSY A;  2VJ8 A;  4ANV A;  2PFD A;  4BJ5 C;  4KXK B;  3AS4 A;  3JRT A;  2V3C C;  2W45 A;  3PHF 2;  4JHJ A;  4U04 A;  4DBQ A;  1OCZ C;  2HV6 A;  3QOU A;  4HEA J;  4C3E A;  2QY9 A;  4GML A;  3MV3 B;  4PJL A;  1JWF A;  2A4Z A;  4XZ4 A;  3LY8 A;  3RH3 A;  4ANU A;  3LCA A;  2NSZ A;  3URZ A;  4O79 A;  2OG2 A;  3I4R B;  2DGJ A;  5BT1 A;  3FWV A;  4HOS A;  2HYZ A;  4U8H A;  4EWC A;  2OCC C;  4JZY A;  4ZLC A;  1MHQ A;  3Q47 B;  1HX8 A;  4J8S A;  2PZI A;  3CVY A;  2AXV A;  3CVV A;  4O6Y A;  1TJC A;  2RD0 A;  2LSV A;  5A23 A;  4N06 A;  4NRH B;  2XEV A;  3FUE A;  5KYN A;  2VAS A;  4U5H A;  2LO6 A;  4FES A;  1V55 C;  4CSA A;  1TWG A;  1LVK A;  3O6X A;  2J46 A;  5B1B C;  3HIZ A;  4BX8 A;  3AG4 C;  3CKC A;  4L1B A;  1ELW A;  3APC A;  2A1D D;  3FU0 A;  4IJJ A;  3PH0 C;  3ASF A;  5KYX B;  4JCH A;  1IYG A;  4I1A A;  3RJV A;  4BT8 A;  2PM7 A;  2R7T A;  4OVV A;  2DYR C;  1VYK A;  1LKX A;  1YA0 A;  4D10 C;  5BUZ A;  2I9C A;  4JVS A;  3ZEF A;  1JPJ A;  2WXH A;  4JJG A;  1HH8 A;  2J9V A;  4GA1 A;  4V3I A;  3JCU Q;  4IWB A;  4HVB A;  2XXA B;  4Q94 A;  3SYN A;  1Z3X A;  3LLK A;  5FZS A;  3FTX A;  3AG3 C;  1E7V A;  2YHS A;  3KEZ A;  4ME2 A;  4XKC A;  2Q9A A;  2IU1 A;  4MS6 A;  3DJN B;  3ONK A;  4E7S A;  4KNV A;  1PD1 A;  3LJ3 A;  5KJN A;  4U5B E;  2FUL A;  3UMK A;  2J45 A;  1M2V B;  3BG0 B;  3DAF A;  5JJ7 A;  2GRM A;  3VTY A;  4RVB A;  2PM6 A;  1O5H A;  3FUN A;  2KM4 A;  2Y39 A;  2E2E A;  3EGD A;  3CQC B;  1NP7 A;  2Y3G A;  4GYO A;  1E90 A;  2WB7 A;  2WXI A;  3D9N A;  2NUT B;  2XRY A;  1BR1 A;  2ZXO A;  3DBS A;  1M57 C;  3L6A A;  4I1O B;  4IAO A;  3MKR A;  3HYM B;  3SBT B;  5LX8 A;  3KS2 A;  3HLZ A;  4B89 A;  2XL4 A;  3JCK C;  1FVH A;  3MKQ B;  2CG3 A;  2J4D A;  3B13 A;  3AU4 A;  3S0X A;  3KAE A;  4KZC A;  5KYY B;  3U9W A;  5AYW D;  2XSE A;  4APO A;  2QFC A;  2YIN A;  2R7R A;  1RJ9 A;  4DLQ A;  3EIQ C;  3VAY A;  2KQ9 A;  3Q15 A;  2Z15 A;  3N0T A;  2PL2 A;  5T3R A;  4U5G A;  4BJ5 A;  1FCH A;  1FTS A;  2ZXW C;  4E7Z A;  3FDH A;  4N39 A;  2OV8 A;  3N24 A;  3ZN3 A;  2AW6 A;  1O87 A;  4N3B A;  4YVQ C;  5AEN A;  1UJJ A;  2WVQ A;  3HTK C;  5D91 A;  1NZN A;  4GB9 A;  1HS6 A;  4HLE A;  1D0Z A;  1ELR A;  1MND A;  2MRI A;  3UT8 A;  3QC1 A;  2IF4 A;  4DVY P;  4OIQ F;  1OWO A;  1FVF A;  4WNF A;  3FH8 A;  3DAG A;  2D5R B;  5DS5 A;  3G2S A;  4B8C B;  3FVY A;  2J09 A;  3B7T A;  3OEO A;  2L6J A;  3RRM B;  2PQR A;  4CS9 A;  4AVX A;  3PVL A;  4FHK A;  3SNX A;  2X6H A;  3B0U X;  4A55 A;  4DOZ A;  4J6I A;  1Y8M A;  3SD5 A;  5LOZ A;  3D9M A;  4UQY A;  2M4E A;  5LCW C;  1HF8 A;  1J8M F;  4PUC A;  5FT9 A;  3ZFW A;  2VYI A;  2DBA A;  3H65 A;  4PS7 A;  1M56 C;  2G62 A;  2XRH A;  4WWO A;  3L54 A;  4C7O B;  1TWC A;  3OXL A;  3LDZ A;  5KYW B;  4JA9 A;  4I2Z A;  4KVO A;  2QY7 A;  3SGH A;  1HU3 A;  3LY9 A;  2PQN A;  4FHJ A;  3GZ2 A;  1SZA A;  3NZU A;  5FCL A;  5HI7 A;  5LFA A;  4CT4 A;  3FTU A;  3O4Z A;  4C3B A;  4EQF A;  4J30 B;  2ZXP A;  2IOS A;  4AEZ C;  3P1U A;  3T6B A;  4AK9 A;  3ZIB A;  1IQR A;  2LAI A;  2G3V A;  3M1C B;  4RDA A;  4Q4Z F;  3SHF A;  3MLG A;  3QJZ A;  2XGM A;  3TJP A;  3IKO B;  3PE4 A;  4GCO A;  3AQB A;  2GRL A;  1E8Y A;  3CHO A;  4BJ1 A;  4FU3 A;  2EIL C;  3CKB A;  1PY1 A;  1D1B A;  1ZHW A;  3ML8 A;  2E87 A;  4P29 A;  2BTD A;  2A69 F;  4AY6 A;  4IN3 B;  1MMN A;  4CGW A;  4KZ0 A;  4UWH A;  2CFU A;  4G1T A;  1DVP A;  4PJM A;  4OIR F;  1UJK A;  4WNE A;  4BG0 A;  2OVF A;  2IXN A;  4NQ0 A;  3CK7 A;  3EQL F;  4P6I C;  1TJF A;  3FEX A;  4G26 A;  5A7D B;  2O9X A;  2WXQ A;  3PEV B;  3ZYK A;  4I6E A;  1OWN A;  3ZHE B;  2MYS A;  5AJL A;  2FGY A;  3CQZ A;  5KYX A;  2Y69 C;  3EHN A;  3EH2 A;  3LPZ A;  4G7O F;  2V8S E;  3UT4 A;  4U5D E;  3ZVR A;  3ZIM A;  1JPN A;  3UMH A;  2WXK A;  2XGS A;  2WQ7 A;  1X5B A;  4CGV A;  3E70 C;  4EZL A;  3GW4 A;  2A5U A;  3T8M A;  4GU5 A;  3JQ0 A;  2WL8 A;  5KYY A;  1E8Z A;  4MKT A;  4N5C A;  3CK8 A;  2VGX A;  2OOE A;  2J4B A;  3F46 A;  4JHK A;  5T1D B;  3JQ1 A;  1ZHX A;  5HSW A;  2MHK A;  3CLJ A;  4W8K A;  4UI9 J;  4GCN A;  4KT6 B;  1SQM A;  4UQZ A;  3HHM A;  1UG3 A;  5BV1 A;  4J8F A;  2HR2 A;  4CIH A;  3ULQ A;  4A3V A;  4XKB A;  4AOF A;  1QLE C;  4HE8 D;  3UMV A;  3FHD A;  2VQ2 A;  2LSE A;  4TRQ A;  2C2L A;  3APF A;  4I6J A;  4LLE A;  1VOM A;  3EFO B;  2J9Q A;  3LYA A;  5CCL A;  5ANL A;  4JEU A;  2WM9 A;  3FEY A;  4DK5 A;  3IHY A;  3T5V A;  4BTA A;  3RO2 A;  1IW7 F;  2VSO E;  2I1K A;  2ION A;  3LXU X;  3ABM C;  5FWQ A;  5D0O D;  3CVX A;  3ZGQ A;  2P6V A;  4I2W A;  2IQC A;  3L16 A;  3MKQ A;  1NZE A;  3D3M A;  2FFH A;  1EPU A;  4XI0 A;  5KCM A;  4PS8 A;  4GAA A;  3FFL A;  1HZ4 A;  1ZU5 A;  2YHE A;  3AG1 C;  3NYM A;  2VSY A;  1D1A A;  3NYJ A;  2IOL A;  3B7S A;  3EH1 A;  4QDL A;  2CFZ A;  3JSZ A;  4G24 A;  4B94 A;  1Z5Z A;  3W2W A;  4LUN U;  4G23 A;  3FUH A;  3S2A A;  2VSN A;  4C0M A;  4YWQ A;  1SF8 A;  4ATG A;  1MMD A;  3W8I A;  5KYW A;  3RKV A;  4A3T A;  4XLP F;  1LF8 A;  2H7O A;  2FO7 A;  2EIM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...