4I1OB

Crystal structure of the legionella pneumophila gap domain of lepb in complex with rab1b bound to gdp and bef3
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
291
structure length
280
Chain Sequence
b'PLTLLMTSSTSFSETINQWADILKTMEKFDSNPINLLELVKQFNLYVDELAITCEANNVWASTPNLFALYDNSGGEAIHGHAFVPYYKESIVLRRLFTVDPNTFNLSRFAAFEGPCQLYCAAHADSAWVKIQTLLTLGNGIINTLKIIKQAQAFGIDEAVTENLKALKEQFIAFQLAEADIKESLKAPSFAEPNKESEFFYPIDEKALAKMNGYQLATICLEELNSPKPSPLIERILSNKKFWKRINSAFESGVFKGRTDDPAGKIAKIREWHQLLQISG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras-related protein Rab-1B
publication title Mechanism of Rab1b deactivation by the Legionella pneumophila GAP LepB.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/hydrolase
total genus 101
structure length 280
sequence length 291
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18172 LepB_GAP_N LepB GAP domain N-terminal subdomain
B PF18227 LepB_GAP_C LepB GAP domain C-terminal subdomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1700 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4i1oB01
1.25.40.830 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4i1oB02
4IRUA 4JW1A 4I1OB 4JVSA 4I1MA
chains in the Genus database with same CATH superfamily
2I6HA 2EILE 3O39A 3AG1C 3U5SA 5DIZA 2WM9A 1U89A 1WWPA 5KWDA 2FO1E 1BI7B 2NYJA 4XIFA 3AGUA 5E76A 4FADA 3H65A 4LUNU 3RFYA 2LK4A 2DCPA 1Z5SC 4D4XA 1TR4A 2IOQA 3ASHA 2DYRC 2L9JA 4LRZA 4LACB 4GYWA 3L8IA 3TWUA 3LYAA 3FDQA 2WZGA 3MJWA 3OXLA 2RSEB 1Z23A 4FC8A 5EX3A 3G4ZA 2YL1A 3KAEA 4MW8A 3BRJA 3ASDA 3C3QA 3EGXA 5JHBA 2AXVA 3ASOC 1YYHA 4BX8A 3PEUB 4ULWA 4YL3A 4C7OA 1EI7A 5L3QA 1WDYA 3V31A 1UJJA 1FAPB 3UTMA 4CDRA 4I9CA 4U5EE 5BV1A 1ELKA 4ATZD 4WJ0A 4YJWA 4N4WA 2LAIA 2B6CA 3D9OA 2BE5F 1Z3YA 4LERA 3NF1A 2V0PA 1NSGB 2Q3TA 4FLBA 4W8KA 2RKKA 4K5CA 4C3DA 2P1AA 4K5BA 4F53A 4O6NA 4DVZA 2H6HA 4FULA 3EH1A 5K0IA 3EG9B 2FGYA 1Q2ZA 1N54A 1M57C 1ORSC 5B3IA 1MX2A 1W3BA 2CFZA 2NC9A 2MOWA 1MNEA 5A7DB 5ENPD 2J7PD 5KYWB 3C8GA 3AU4A 1JMWA 1TWGA 4RD9A 1H6KA 2NSZA 2FF4A 1WY6A 2IEJA 1E84A 5T3RA 2IO3C 4WGZA 3NMKA 3SXYA 4XE0A 1HH8A 2ZGGA 4JIOA 1T5OA 3K1IA 256BA 5ITZF 4J8FA 1ZHWA 4ZLDA 1YCSB 4HORA 3RO2A 3T6GB 1HG2A 4GTSA 1S7ZA 1AVOB 2A4ZA 4I6JA 3L08A 2M64A 2WXLA 3QARA 4NRHB 1JOGA 2OEWA 1N94A 1SMYF 2LD6A 3K1HA 2BKKB 1PC2A 3I4UA 1H2VC 3L13A 1T6IA 5AENA 3Q47B 3PS6A 4KVOA 3EJNA 4ER9A 3QDNA 2CGEA 5B3SE 2V26A 4HEAJ 3OXFA 3UINC 4I1OB 2EPOA 3AG4C 2R5SA 3K9IA 3D9NA 2J9VA 3BEHA 2BKGA 2W4BA 5B1BC 4ILGA 2PF4E 5CI8A 2F8XK 2OV8A 5LFAA 5T1DB 2R02A 2I1KA 4UWFA 4CCAA 5L0HA 1FMWA 1TNOA 4KBLA 3TULA 2XLDA 1SA4A 3DSWA 2YRFA 4BESA 5IY5E 3K1IC 1HS6A 3UI2A 2W45A 3PREA 5HS0A 4I2ZA 1VOMA 1H7IA 3E70C 2OOCA 3U2LA 3GWNA 2VYIA 2A0UA 1OCRE 3QC1A 3RKVA 3L34A 5BXOA 4F4BA 3RKOF 5B3SC 1XZPA 2FEZA 3U2MA 2VGXB 5CRUA 4C0EA 3NKDA 2JPUA 1J8MF 4Z9HA 2GW1A 3AGTA 3F6QA 1A7EA 3R9AB 1YYXA 1E96B 4DI3A 2QUPA 3I5QA 4OD4A 2V5FA 3CHRA 4N39A 1AEPA 4KMOA 2KCLA 4CYMD 3LEOA 4JC7A 5IY5C 3U3BA 3T4RA 4HOTA 5L0DA 5FJYA 3WODF 4MVMA 1TJFA 2OG2A 2UY1A 3PUJA 3SY2A 3FH8A 2R9RB 1NP7A 4BEJA 4OD5A 3K66A 4N5CA 1QPUA 3DM5A 1LD7A 3CLJA 1INZA 4AK9A 1FNTc 3TWTA 3FUFA 2J08A 4H4KC 1D1AA 1V55E 5JHAA 4JCZA 1K1BA 3SYNA 2NPUA 4FX5A 3U8VA 2VSOE 2XPIA 1SF8A 4FHJA 3OWTA 1V4AA 3MA5A 1TNYA 4B0ZA 3JZ0A 4YDEA 3T9OA 4TXPA 2WXKA 1EKYA 4IARA 4JTCB 3ZN3A 4EBBA 3LESA 1TWAA 2A68F 1NA3A 5KJMA 1MX4A 3VM6A 1NLXA 2HV6A 3U3FA 2R7OA 1Z3IX 3VTXA 3GORA 1NZNA 2ONDA 4U8HA 2Y1LE 3I4RB 4ZFHA 3NB2A 2PM7A 3W9FA 2WXOA 2B0JA 4JVSA 2C03A 1U6HA 5C1DA 2G3VA 4HLEA 3JUEA 3SXMA 4BJ5A 3WAQA 3FFLA 4YT5A 3D9KA 4U9DA 2ZD9A 2R59A 4LEUA 1U0BB 3ZEFA 5DQZA 2ICWG 3ABKE 4O1OA 1E8XA 1V74B 3QW0A 4YVQC 1ST6A 1ZBPA 3TWSA 2Q7RA 3TD7A 2FI7A 1TFKB 3B29A 4CJOA 3F46A 4WNDA 3TWRA 4APFA 1OXKA 4KC9A 3POVA 2MHRA 5BW8C 4AY6A 2H7OA 3ISMC 2HV7A 2IY0C 5BUOA 1QQ3A 4G8KA 4DPRA 4NTFA 2P9KG 1BLXB 4EECA 5KBAA 5A6KA 1KLXA 2HJMA 1OQCA 1L5JA 2UWJG 5HQ8A 1PV3A 4ANVA 5KJLA 1DCQA 1YA0A 1QSPA 1RW2A 3DE8A 3E9VA 1WAO1 5KYYA 2CW0F 4HQDA 3ABKC 3NMJA 1YA9A 3CHPA 1GQAA 4G78A 3QWPA 4BJ5C 1HFAA 5JLIA 3L82A 5L0CA 3RQGA 2WVOA 4Y6CA 1OKKA 3VTYA 3TOLA 1OWMA 2Q9CA 3NRHA 2KCVA 4Q7CA 2ZXRA 4U96D 3OXGA 3D3MA 3US6A 1ZHYA 2VH3A 2WXGA 1J8YF 3DRAA 1OCZE 2ETCA 3ZYKA 2ZIRA 1KPSB 4BFRA 5EN5D 4MQ9F 4E0IA 3FAPB 3SP1A 3GZ2A 2HSQA 3TG5A 4CDMA 5E33A 3QVYA 2Y4UA 1JPJA 3UQ3A 4CSAA 3NOCD 2Y3AA 2VCCA 2R7RA 3MCXA 2H6GA 5CERB 2W4MA 4OYSA 2AWCA 4YL0A 2CHZA 3AOUA 3LXUX 5CMWA 3QW1A 4EIYA 4U8YD 4DX2A 2Y39A 2A5UA 1XWJA 2OU6A 4LCTA 2DB4A 2KJGA 2DZNA 3IHUA 1ORJA 2WB7A 1OCZC 3IQTA 2C0LA 3AS8A 2M4EA 3D9HA 2LNIA 4EPZA 4YK5A 4QFVA 3ML9A 2WVIA 3SBTB 3WHNA 1L3PA 5HI7A 2X6IA 2VGYA 1N1CA 2XLOA 3HVEB 4PFPA 3DKAA 2KW3C 3ZIMA 3K33A 1T01A 1HW2A 4IYPA 2PNNA 4YDYA 3HXFA 2LXMA 5ANRA 1KT0A 3LS1A 1OWOA 2F22A 2H8AA 5ENTD 3U4TA 3E34A 4PFOA 4Z68A 1YLMA 1B89A 3IKOB 3DSSA 4GA1A 4G25A 1WASA 3RW0A 3WG7E 3MKQA 3RRNB 3TJ6A 1BD8A 3ZXPA 5CCMA 2EIMC 3JYYA 2MHKA 2GRMA 3FUMA 1APCA 3FTXA 1EDUA 4GAAA 1OT8A 4I43A 2GA0A 4DK5A 2M63A 3V30A 3ZU7B 4EBJA 1HG5A 1VK5A 3V2XA 4GMRA 4F7AA 3U9WA 2R7QA 3ITFA 5TJ5E 4GTOA 5DLJA 4EZKA 3E30A 4N6HA 3IQ5A 2A5EA 2KXPC 2J4BA 5LX8A 1QKRA 1JAFA 3PZ2A 1Q0GA 4JEUA 3WG7C 3NYJA 3OTNA 3FH7A 4UI9K 4PS8A 5JT4A 3FP3A 2HJ3A 3LY7A 3ASGA 3B95A 4CEMA 4J7TA 2X6KA 3A11A 3CVWA 1ZU4A 2FO7A 4Z9JA 5FTPA 3EZIA 1FTSA 2D5RB 1HX8A 2EPNA 1GM5A 2YQYA 3G2SA 4DJAA 4CS9A 5AIJA 2E0IA 2GWWA 2I9CA 4IJJA 1H19A 1UN8A 1QVXA 3NBNB 3EHNA 4C3EA 4B6IA 2GRRB 3C3OA 4J8YA 3TK0A 1E8WA 2OKUA 4LNUD 2KBXA 2EINC 2WB2A 1NA0A 4BJ1A 3FUJA 3ZTZA 5A6BD 1LS4A 1TN7A 4C3BA 4L23A 2CG3A 2P58C 1D1BA 3KH2A 4GTMA 4AM9A 3M79A 3C5RA 3UR3C 4N5QA 2AVPA 2NUTB 4OVVA 3FUNA 2DYSC 4JHRA 4DRXE 3HNIA 1JWGA 3SXZA 2IJGX 3MX3A 2WXNA 2YHCA 2HMQA 1C03A 5BQHA 2DIWA 3ZIBA 1BPOA 5BT1A 1LI7A 2YKZA 4X8QA 3S7FA 4CS9C 1MX6A 2ZXWE 4Z9IA 4XWJA 4KI2A 2CFUA 4DRHB 1YJGA 3JRMO 2HYZA 3Q4AB 4L2YA 2XENA 3U9MA 3AQBA 2R7UA 1ZVZA 2A69F 4JKVA 1NBBA 4NQ0A 1H6PA 3S84A 2QYUA 3GZ1A 1Q0DA 4C9BB 3TJ5A 2ETSA 1MMAA 3TWVA 4R32A 4I44A 3T5XA 1SZIA 3GM1A 3EFOB 3GWLA 2RFAA 1V54E 3R2PA 1IQUA 3NKEA 3IV0A 3D9MA 1TN8A 5JJTA 3B7RL 5AN8A 3MBGA 5BNWA 3UGOA 3U64A 3ABME 2ZXWC 3Q73A 3T6BA 3QK0A 3HTKC 3W2WA 4MVQA 4BJ6A 5FQ7A 5KYWA 5H7PA 3AG1E 1K1AA 3EHRA 1FVFA 1XGWA 3AG2C 2VQ2A 3RVZA 4YVOA 5LOZA 1Y6IA 2OEXA 4YWQA 2MRIA 3UM3A 3IQ6A 3TOMA 4JJGA 1IHBA 3HXCA 2HM8A 3P1UA 3EGDB 2XPYA 3FTZA 2DYRE 3FUEA 4JZYA 3PDMP 3W8HA 3E37A 1V54C 4FHKA 1AUEA 4WNGA 3TG4A 3UM2A 3T6JA 1O1SA 4UQZA 1PD1A 4GZCA 3RSEG 4MVZA 3QZCA 4YDOA 3TWXA 4BTBA 2C04A 3P2BA 3R9MA 3ASOE 5HRYA 1G3NB 2Y69C 2OVBA 2CG2A 3LJNA 3O4ZA 2F0YA 4E85A 4TUMA 4B8CB 4CIPA 2O9XA 4BJ6C 3B9QA 5L0FA 2W9YA 3B0UX 3CKCA 1OW7A 4Q5SF 1RXQA 4BX9A 4I17A 3U3WA 4A55A 3FTWA 3ULEG 3M4BA 3CEQA 2GRLA 4GYTA 2BEDA 4EZJA 2HZ8A 3BU8A 4DXWA 3DSTA 3EQLF 3RJVA 2R05A 3JQ1A 4U04A 5LP0A 4E7SA 4F3VA 2YNQA 4GA2A 4HOQA 3B0VC 1SVXA 4JPSA 3U66A 2F37A 4RG9A 3TWQA 4XLPF 1M6TA 4U5HA 3PZ3A 4A1GA 3T8KA 4GZ5A 3PZDA 5ENNA 2G62A 3SFXA 5ENQD 4DVYP 4GYYA 3B7SA 5G05C 2WQ7A 1PY1A 4QI2A 4A1SA 4J0UA 2IOLA 2D4UA 5D0QD 4ANXA 2VCAA 3MFNA 4GTRA 3CVVA 4XI0A 1EYHA 5FCLA 1TR2A 4EHMA 2R03A 1D0ZA 1ZYRF 3ZQYA 3DD7A 1K40A 3B13A 2R7SA 1YYJA 3G2WA 3ECSA 4YL1A 3AG4E 5B1BE 3DE9A 2CHXA 3UNGC 1HE9A 3EIJA 5A6CA 5D92A 1OWLA 3NG1A 5DS4A 1N4QA 1GS9A 2XL4A 2ZXOA 1D8DA 5FT9A 1SYQA 1WM5A 4ZHBA 4EKWA 3RAUA 5CEDB 1E85A 4JEBA 3SI5A 3ZC4A 2I15A 3W2VA 2YHEA 3PE4A 1TYQG 1UN9A 1G8XA 4GTTA 1QQEA 4Q69A 5E3AA 3CKBA 2KSFA 4K7BA 4PJMA 3MYFA 2XCCA 2X38A 2CNWD 3CK9A 2B0HA 4DRJB 3JXJA 5DQTA 4DBQA 3C98A 4H54A 4I9EA 5CCLA 3QOUA 3KS2A 3B71A 4XI9A 1U3CA 3M1CB 1N52A 2VB6A 4BSXA 4A3TA 4TV3A 5JMND 4FA6A 2JEKA 3CQGB 2Y3DA 4Q96A 3L54A 2ZGDA 3Q9UC 5AQ9A 4L1BA 3UX4A 3U0CA 2PL2A 3M15A 2QC9A 4O79A 3AS4A 2WMNA 4PH4B 1E7UA 1DNPA 5A69A 2GAQA 1XNFA 3RK6A 5G2NA 3NYMA 4NTBA 3DSUA 1A0BA 4PJNA 4RVBA 4ME2A 5DS5A 4MTOA 3I5PA 3IHVA 4ULVA 3CV0A 1BBHA 2ZU6B 4FJZA 4AY5A 3W9GA 2WXRA 4JZAA 4XEVA 4CS7A 4BY6A 2H7BA 3L1MA 4JEHA 1IHGA 5CBOA 4FP7A 2WVQA 4DUIA 4B8AA 1ZU5A 1RKCA 3R7CA 2X6FA 3FAJA 1N4PA 3U9JA 2J07A 3FOOA 2KC7A 3PZ1A 2DZOA 3LJBA 2KZTB 1E83A 2IOSA 3G4XA 3Q6MA 4H7XA 4J6IA 2VTBB 3O10A 1MZCA 5AJDA 4HRNA 1OXJA 3RRUA 2RD9A 4GB9A 3ABLC 3C8GD 4CIHA 4NIKA 3RF3A 3PMRA 2JLBA 4BT8A 3ZHEB 2PP4A 3RIBA 5JSLA 3CVYA 2V3CC 4I6EA 1JUQA 2YZSA 5GPGB 3RIPA 3FU6A 3PEVB 1SQMA 3SF4A 4MW3A 4FESA 1I4ZA 5L3VA 5CBNA 3EIQC 2Y3GA 3ZYLA 3MKRA 3AJMA 4W9RA 2L6HA 3UPVA 5LCWC 4JTAB 4UWGA 5AJLA 2H6FA 2R7VA 1JR8A 4GEHA 2LSUA 3ASNE 1YA7O 3IQCA 3PUKA 4YN0B 2J4DA 4DX6D 4MVSA 2LCHA 1FFTC 3PH0C 3Q75A 4RLYA 3FHEA 4DI4A 2XLWA 2WXFA 2P0NA 2Q7FA 4RBNA 2KQ9A 3DBSA 4EHPA 3HVEA 1N4SA 1K04A 2NG1A 3ZTMA 4IWBA 1TQGA 5AQAA 4K0RA 1K05A 3NQPA 1A5EA 3IHYA 4JURI 4A63B 2YWAA 3CVUA 3LEWA 5CECB 5CRVA 5D91A 3Q6NA 1CPQA 3JSEO 2KATA 4TRQA 3ZDLA 5EHHA 3CQCB 4HI8A 4L2LA 5AC5A 2PX0A 1D8EA 1Z5ZA 2QLAA 4GTQA 2XLVA 3GYZA 1JCSA 3ASNC 3SFZA 1X5BA 5KNHD 1AP7A 4CRWA 3HYMB 3MGBA 1TWCA 2DBAA 3FEYA 2R25A 4JHJA 4FJYA 5BUZA 4CJGA 4CGWA 2RFMA 3FXHA 4O6MA 4JC8A 4LNBA 4MTGA 4J8EA 3UT4A 4WGYA 3BUAA 1LTXA 3JQ0A 3H2UA 3Q15A 4GTPA 2A1DD 3OA1A 3VAYA 4C48B 3CEXA 1YARO 3FMSA 4JTDB 4YT8A 3KEZA 3AU5A 2XL6A 3SFYA 3BQOA 4EUKB 3UMIA 2WZFA 4GZ6A 4JL0A 1JRAA 1MJ0A 3OAWA 4N3BA 1JWFA 2RD0A 2XEVA 4U5BE 2R2LA 1JPNA 3FUHA 3N2ZB 4G7ZF 2YLGA 4E6HA 1GGQA 4J32B 4N2SA 4N6CA 1DVPA 2WXHA 3O6XA 2XRHA 2XL8A 4CS8A 3HJCA 4F1PA 3JT1A 1LVKA 3C18A 1OR2A 2IU1A 2P9UG 2NUPB 2BC5A 1JCRA 1T9KA 3S28A 2ASRA 3C8ZA 4G0HA 1KTMA 4PJLA 2P2CP 1C02A 1WG0A 1Y8MA 2X51A 5FQ4A 1R5ID 2YL3A 4AL0A 4IGGA 5D0OD 2EIME 4DX7D 3KSQA 4FLHA 4F1SA 4IB4A 1H2UA 1QZ2A 2IXMA 4N06A 4NACA 3HNJA 4GZ3A 1D9SA 4U5CE 3KEAA 2FAPB 2JABA 2OQMA 2RG8A 5T8IA 3DXMG 2XSEA 1FT2A 1HU3A 1A41A 1AWCB 2IO2C 4HVBA 4N2QA 2HR2A 3EU5A 3RO3A 3UIPC 4OIPF 2YHSA 3MV2B 1VYKA 4HI9A 1RKEB 4A2NB 4OAVB 2BL2A 3TXNA 4O1PA 4CSAC 4LG6A 1M2VB 2XPZA 2AVKA 4XPXA 4UDVA 3HLZA 1VTMP 2XHEA 3BG1B 4CDYA 3LY8A 4EBAG 2BTDA 5DBKA 4ANWA 4JEAA 4PR9A 2L6JA 2V5QC 3SQVA 4LDQA 2HE0A 5T3TA 1S05A 2HO1A 4J7WA 1H2TC 2HSBA 2PM6A 3IXEA 4Q94A 5G05J 4K03A 5CEAA 1D1CA 1DC2A 3FTVA 3U8PA 4O60A 1NI1A 3R7RA 5E75A 2L9BA 5JRAA 1W2WA 2NSGA 5DS6A 5T3WA 4KXKB 1QBQA 2QE9A 3ATPA 4G11A 3B7TA 2G3KA 4W8PA 4JE9A 3EFOA 3M4CA 3JCKC 4HS2A 4PDXA 3FWVA 4EBKA 2XXAB 1OKKD 3UMVA 3VLDA 2EINE 3G50A 4D4NA 5KYUB 3TL5A 3TAXA 2R7WA 1N0RA 3FUDA 1QYMA 4EWCA 3LLKA 5HKPA 4E18A 5AYWD 3RH3A 4BEMJ 3NDBB 4U5GA 4WAFA 2IF4A 2WQ6A 4ATGA 5FQ8A 3EHMA 4CDAA 2DYSE 3EGDA 1EF1C 1BZ4A 2GRQB 4YNDA 3LAYA 2VJ8A 2IXPA 4U7EB 5JVEA 2KC3A 2I2OA 4JJFA 1TNZA 4YT4A 5CHEE 4WUYA 3D9JA 1TWHA 1I5NA 3L8JA 2VSXE 3SNXA 4HOUA 4AE4B 1DOWA 1OCCC 4BT9A 1HMOA 1OR3A 3HRAA 2E2EA 2XGOA 3UM0A 3NMIA 1RJ9B 3DWLG 1FT1A 3PCVA 2JX0A 1QZXA 1UFBA 4OIOF 4QQIA 3EDTB 2AWIA 4PS7A 3S0XA 1U3DA 3DSXA 4JW1A 3BG0B 5EDSA 5L0IA 3L22A 4L7TA 4N3CA 5FZRA 1Q0MA 2AJAA 4P29A 3EPVA 1H6GA 3ESLA 1FMVA 2P6VA 1TFOB 2R7TA 1E86A 1S70B 1Z6TA 1OWNA 4I3MA 1O3UA 1OXBA 4OINF 1NU7D 4YT2A 1Z63A 3W4YA 3DPYA 3UT7A 4EQFA 4HE8D 4ANJA 3S7JA 4OIRF 4P9FA 4ACLA 4B93B 4TUUA 1MNDA 4IULA 3GZSA 2GRNB 3ZRHA 3ZWIA 1WGWA 3AG2E 3C3RA 4NCQA 3V5XA 4LNGA 3SXKA 1MQVA 4AVXA 4GMJA 1BR2A 3L9TA 1BU9A 5T4YA 4ILIA 4G1TA 2Z15A 5FIOA 3MKQB 4XEKA 1G5ZA 3S27A 1RCPA 3IEEA 2ZPAA 5COMA 5ANLA 5F28E 1ELWA 3QWWA 4MBGA 5FZSA 3EUVA 3L0IA 1IKND 2NXPA 4N3AA 5FINA 1O1RA 3GODA 3LY9A 3UM1A 3EG9A 3Q5MA 2UUHA 4CZ2D 2X3MA 3RQFA 2XS8A 2J9BA 2ETAA 3SZ7A 1N11A 3UKRG 3GEEA 2Y69E 4MLPA 2OOEA 3QJZA 1ZW3A 1LF8A 4BERA 4MS6A 3JYHA 2R7XA 4U0UA 4ACKA 3T5VA 2PBEA 4KYOB 5CIVA 3T8MA 4ILHB 3RU0A 2J7PA 3KL4A 2L0TB 3ZYQA 3B7BA 5LCWJ 1Y6DA 2J49A 4FU3A 2B0OE 2PQRA 4UQXA 4EZLA 3RYLA 1MMGA 1VMAA 2VC9A 2CYDA 2LFDA 3FY4A 1SZAA 3HHMA 4JRZA 4JD2G 3TJPA 2WMOA 3G2VA 1F1MA 1VLSA 2YEVA 3MLGA 3JSZA 1XZQA 2YL7A 2V4LA 2BF0X 3EU9A 4HOSA 3ENEA 4J8DA 4WWPA 5HV9A 2GGFA 2EPLX 3ULYA 2PX3A 2ZISA 2CHWA 3V2OA 3LS0A 2WXIA 4Y6WA 1Z7Qc 1H9TA 5KCMA 4OIQF 3HNKA 2DI3A 3ZGQA 2P9NG 4HFGA 4KBQA 2KK1A 2P9LG 2C2LA 3PNLB 1SR2A 4MS2A 5EIDA 1O5MA 3V79K 1YZAA 1KT1A 4XLNF 1GW6A 4G8LA 2Q00A 3K7DA 4BETA 2DVWA 4UI9C 1T6QA 1C17M 2X6JA 5ARFA 3JCUQ 2XQ0A 3MYIA 1CGME 3OEOA 2P9SG 1OW8A 3Q9NC 2XZDG 3CVLA 5M72A 4LDRA 3S29A 1YVIA 4HB5A 4U5FE 5ENOD 2PZIA 1WATA 2VGXA 4XEIG 2EIKC 3JUIA 5FZTA 3CR3A 3NOGD 2J9UA 2KM4A 3UXGA 3DM9B 3VLEA 2WL8A 1TEZA 3ML8A 2I8BA 4GCOA 1LIHA 4FWVA 1N9AA 4FAPB 3ZPJA 4MVRA 2VCBA 2XCBA 3ZQVA 2H6IA 3Q7AA 2EILC 5JS5A 2LSEA 2PNOA 5AQBA 2YQ8A 2QTVA 4HBDA 4LLEA 3KPHA 3FU3A 2KZTA 4BEPA 1NU9C 3KYIA 3N0TA 2ILRA 1WTYA 3E32A 4BTAA 2VTBA 5AARA 4IAOA 2Q4FA 1I4YA 2XLEA 4AJWA 3DWWA 3JTLO 3CHSA 2VASA 3B0PA 3CZ6A 5G04C 3ZHEA 5A23A 3GM3A 4LSZE 4MVOA 2XGSA 2KNHA 1PD0A 3FHDA 3SEOA 1HF8A 2X6HA 4GMLA 1YAUO 1NG1A 2XRYA 4IRUA 4DBRA 3MEKA 2XS1A 2XEEA 5A6JA 4UQYA 1ZHZA 4XPWA 4MTFA 3MV3B 3MYVA 4M3OA 1N95A 3B7UX 3D9PA 3QB2A 1UG3A 3LUTB 3CHOA 1TNBA 2IONA 4G2VA 2L81A 2YLDA 2V8SE 1G4US 1WN0A 3VLFA 4C0MA 4AXHA 1NL4A 1PAQA 5ENSD 3EHQA 2OCCE 3QWVA 1LS1A 2HUJA 3DPDA 5AGFA 4L9PA 4U5DE 1CGNA 2WPVA 4RG6A 2XM4A 2WXJA 1QLEC 4U95D 1HXIA 3J06A 2XZTG 4U0ZA 5KYXB 5FZQA 3VYWA 3V5ZA 1OCOE 3QAQA 1E2XA 4KNVA 2P9IG 5L0JA 2J0XA 4KVMA 3CVQA 1SA5A 3KYJA 4MVUA 4G7HF 2GRPB 3VRCA 3ONLA 3DJUB 2UUIA 3CSFA 4AEZC 5EGYA 5J90A 4XEFA 4WWOA 4JB8P 3ABLE 3F47A 3KD7A 3CVXA 2WXQA 3IBEA 2L6GA 2OCCC 4KZCA 2A6EF 1LPEA 2E87A 5FQ6A 4GA0A 1X81A 1RZ4A 3GW4A 3EGXB 4JA7A 1OY3D 4D10C 3SGHA 3HXBA 2IM8A 3DJNB 1CGOA 2IBFA 4CT0A 4C7OB 1OCOC 2IQCA 3UMHA 5F5HA 1EPUA 3C62A 5EYPF 3ZVVA 3FOPA 5EKQD 3CHQA 1A7VA 3APCA 3CHMA 5AC4A 2WXPA 3DEPA 2J8WA 5C2YA 3SO8A 4KZ0A 4LLCA 2AW6A 3UT8A 4V3IA 3H2VA 2A6HF 2Q9BA 4XTKA 3DI5A 3IEGA 1L7CA 1OCRC 1UG7A 2I1JA 3I3NA 4R7LA 3PZ4A 3ZSUA 3FH5A 5BV0A 3C8GB 5KYNA 3UMKA 5L0GA 4HFKB 3PNTB 1YMPA 1KZPA 2LAHA 2Y3BA 3LLIA 5JUAA 3APDA 5JA4D 2NUPA 2MWQA 2FULA 2OEVA 2L6BA 2QNLA 3UGPA 2PFDA 4RSYA 4KT6B 2C0MA 1N4RA 1D0XA 1MMDA 1DCEA 4WNEA 1KNYA 1FCHA 2QY7A 4DX5D 3Q7LA 2XM0A 4UWLA 2Y3HA 5AAOA 3RQEA 1HMDA 3CSTA 4BWRA 3C72A 4GCNA 4JHKA 3AQCA 4O7GA 1G4WR 4HXIA 4GTVA 1RKEA 4DRIB 3G2UA 3E4BA 1VB5A 4NY3A 4ONSA 1M2VA 4ABNA 3L6AA 1V55C 3X1OA 5J08A 5ARGA 4WABA 1IYGA 4O6YA 4HRMB 3IPMO 3URZA 1O5HA 2Q9AA 4JXTA 2XLMA 2CCYA 5JP7A 2HFIA 2J09A 1LD8A 4GQHA 5EILA 2QZAA 2Y0BG 3NZUA 4GZDA 2QYJA 3FEXA 4UWHA 3LEVA 1A17A 1LE4A 1IQRA 4ZLCA 1MYOA 4G24A 4PUCA 3JXIA 3JRTA 3FUIA 3TXMA 4E17A 3E33A 4QI0A 3CK8A 2YLIA 4CBEA 3DXJF 1VYIA 2NSFA 3LDZA 2P9PG 2LQGA 3SNHA 3T9KA 5COGA 4PACA 1Z3XA 4Q4ZF 1OW6A 5AQ7A 3FTSA 1M56C 3CSKA 1SW6A 2FBNA 1BR1A 1TN6A 3EH2A 2XXAA 5JJ6A 2DWZA 3V5YA 4CGVA 1KU2A 5KYUA 4U0SA 2EQXA 3CVNA 4AP2A 4H7YA 2XLHA 3D9LA 3FUKA 1H0AA 3CQZA 1QNFA 2GDCA 2IFUA 2UY1B 4IN3B 1MQSA 1UJKA 3MZLB 3DXKG 2AU5A 4B89A 4URKA 2A0BA 4NURA 3S90A 1E90A 2P61A 1PCXA 4O6FA 4XX5A 1OWPA 2MYOA 1MMNA 3KMIA 3KSLA 4UWKA 1N0QA 1ORYA 4NTAA 2TMVP 3CK7A 1NFIE 4K5AB 3CAXA 2HMZA 4JA9A 3GEIA 4AE4A 4LDKA 1S64A 1UW4B 3NAWA 1IZMA 4AX2A 4A4AA 1E7VA 4RDAA 4DLOA 1RJ9A 2PQNA 5EYLA 1CPRA 2LFFA 3S7DA 5KJNA 3DMDA 4EBAA 3GM2A 5F5FA 5COFA 2XEHA 3D9IA 4U63A 1SZ9A 1M2OA 4UI9J 4APOA 5A6BA 2YL0A 2FFHA 3DAGA 2NUTA 4IAQA 5BXUA 3PVLA 4XPYA 1HY5A 5BQIA 4CT4A 1FFHA 2L7AA 4I6GA 1EA8A 5EX0A 2BUGA 3LNMB 4CS8C 1ZHTA 1MHQA 2R17C 3PE3A 1LM3B 1BDJB 4E0HA 3UUXA 3HG0D 4M63A 3Q49B 4AOFA 4G26A 2HS5A 1ELRA 3J5QB 3APFA 3RRMB 4DOZA 3N71A 4DLQA 3GANA 2JD3A 1EQ1A 2OJQA 3ZXSA 4MRUA 3Q78A 3TGOA 3EZHA 1TKNA 3LNRA 1FR0A 1OUVA 1R4TA 4XZ4A 1Q0FA 4HLLA 1TNUA 5EIBE 1ZU2A 4U8VD 3FULA 3S7BA 4GPKA 1YZCA 3ZFWA 4CDVA 3FU5A 3UKUG 4J30B 4U07A 2J0WA 3AG3E 2CDQA 3SHFA 1OCCE 5KYYB 3GEHA 3ASFA 1O87A 3N24A 3L17A 2LO6A 2J8SD 5G04J 3ZVRA 2IYLD 2P7VA 4GYOA 1VLTA 5D2MC 2AXUA 2X0CA 3HIZA 2WXMA 3C63A 1S63A 3ZKJA 2ETBA 5DVWA 3ZUVB 3ZW3A 3LVRE 4HRLA 3VF0A 3QVZA 3CGHA 3CIAA 4BJTA 2ZXPA 3V7OA 4BSZB 4DJ9A 4XQ1A 3DAFA 3O48A 4L6RA 1D0YA 1JPLA 3LJ3A 3SZRA 3AG3C 2EPKX 3AAAC 2LXLA 4X0RA 4PS3A 1RMVA 4AIFA 4OVUA 4QDLA 3QNKA 3K6BA 4E7ZA 2WVNA 3FVYA 5A6AA 1HZ4A 3LCAA 2VSYA 3BEEA 3TQOA 4NQFA 1LKXA 1Q0KA 3SBSA 2V4HC 4NC3A 5D66A 4A3VA 4ANUA 4OAUC 2AXZA 1ZHXA 2QY9A 1E8ZA 5KNGA 3DZAA 3TWWA 3CVPA 2Y4TA 4CX9A 3ZYMA 2IXNA 3WXXA 4G23A 4HNAD 4P9TA 1UOHA 3ONKA 1Y4CA 2EIJE 2GFHA 1FVHA 4PJJA 3ZNGA 3KKBA 5ENRD 3S9OA 2XGMA 2YVKA 3ULQA 3FU0A 4F6RD 4J7YA 2EPMX 3Q7FA 5FWQA 2DGJA 4XKCA 3LKUA 4HFFB 4WNFA 3JYSA 2QFCA 5EK0A 1HO8A 1ZW2A 1A7DA 2LUHA 3LVQE 4YDWA 1LI5A 1WOLA 5CMYA 5BPPA 4BG0A 4MKTA 4U9EA 5E2QA 3J5PA 4CDNA 3FTUA 5HSWA 2WQHA 1ZB1A 3FTYA 4JCHA 1T6UA 2EIJC 1O1TA 3HXEA 2HKVA 2LSVA 2XRZA 1H6OA 2OVFA 2GROB 3A9CA 5KJKA 1P5QA 2MYSA 3UIOC 3X2QE 4XKBA 2IXOA 1KZOA 2VGEA 4B94A 1JCQA 2H7VC 3Q79A 5CI9A 3SD5A 5JJ7A 2WZLA 1VDYA 3QMKA 1HW1A 3HXDA 4TXQA 1HE8A 3DEOA 4M7CA 5G55A 1IXVA 1H9GA 3LPZA 1BR4A 5B1AE 4K1OA 2KYHA 4AV7A 4RQIA 4UUCA 1IW7F 2J45A 3FDHA 3AJIA 3QTHA 3AS5A 2KGOA 4I1AA 4AL1A 2J9WA 3G2TA 3ZG1A 3C7JA 3HKKA 3RVYA 4P6IC 3LS8A 2YINA 4I2WA 3S2AA 1HE1A 2OJED 1ZZPA 3NYLA 3X2QC 2LIGA 3Q7GA 1DOVA 1TJCA 2L0IA 2J9QA 1Z6AA 3PHF2 3ESKA 2KCKA 4BPMA 4TXRA 5BQGA 1B68A 3I4GA 4J8SA 2AWYA 2L6FA 2F8YA 4PK4A 1NFOA 1K3ZD 3O55A 4GU5A 1FPPA 4GPMA 2EIKE 2LP4A 3DSVA 1BI8B 1YDIA 5B1AC 4KNWA 3HDXA 2J46A 4K0DA 2VSNA 4DX1A 1LE2A 5E3CA 4G7OF 2CNWA 4MNDA 3NZSA 3QKYA 2AP3A 1U2VG 3R7QA 1E8YA 3PRZA 3ABMC 4I1MA 3W8IA 1S0PA 3HNLA 1K8KG 1NFNA 3L16A 4WWNA 1NZEA 3PDNA 5KYXA
chains in the Genus database with same CATH topology
2I6HA 3O39A 3AG1C 5DIZA 2WM9A 4XIFA 5E76A 4FADA 3H65A 4LUNU 3RFYA 2DCPA 2IOQA 3ASHA 2DYRC 2L9JA 4LRZA 4LACB 4GYWA 3LYAA 3FDQA 2WZGA 3MJWA 3OXLA 1Z23A 4FC8A 5EX3A 3KAEA 3ASDA 3EGXA 5JHBA 2AXVA 3ASOC 4BX8A 3PEUB 4ULWA 4C7OA 5L3QA 1UJJA 4CDRA 4I9CA 4U5EE 5BV1A 1ELKA 4WJ0A 4YJWA 2LAIA 3D9OA 2BE5F 1Z3YA 4LERA 3NF1A 2V0PA 4FLBA 2Q3TA 4W8KA 4C3DA 4F53A 4O6NA 4DVZA 4FULA 3EH1A 3EG9B 2FGYA 1N54A 1M57C 2CFZA 2NC9A 1W3BA 2MOWA 1MNEA 5A7DB 2J7PD 5KYWB 3AU4A 4RD9A 1TWGA 2NSZA 1H6KA 2FF4A 1WY6A 5T3RA 4XE0A 1HH8A 4J8FA 1ZHWA 4ZLDA 4HORA 3RO2A 1HG2A 1S7ZA 2A4ZA 4I6JA 3L08A 2WXLA 3QARA 4NRHB 1SMYF 3K1HA 1PC2A 3I4UA 1H2VC 3L13A 5AENA 3Q47B 3PS6A 4KVOA 3EJNA 3QDNA 2CGEA 2V26A 4HEAJ 3OXFA 4I1OB 3AG4C 2R5SA 3K9IA 3D9NA 2J9VA 2W4BA 5B1BC 4ILGA 2PF4E 5CI8A 2OV8A 5LFAA 5T1DB 2I1KA 4UWFA 4CCAA 1FMWA 4KBLA 3K1IC 1HS6A 2W45A 3PREA 4I2ZA 1VOMA 3E70C 2VYIA 3QC1A 3RKVA 3L34A 4F4BA 3RKOF 5B3SC 2FEZA 2VGXB 4C0EA 3NKDA 1J8MF 2GW1A 3R9AB 1E96B 4DI3A 3I5QA 4OD4A 2V5FA 3CHRA 4N39A 4KMOA 2KCLA 5IY5C 3T4RA 4HOTA 5FJYA 3WODF 1TJFA 2OG2A 2UY1A 3PUJA 3FH8A 1NP7A 4BEJA 4OD5A 3K66A 4N5CA 3DM5A 3CLJA 1INZA 4AK9A 3FUFA 2J08A 4H4KC 1D1AA 5JHAA 3SYNA 4FX5A 2VSOE 2XPIA 1SF8A 4FHJA 3OWTA 3MA5A 4B0ZA 2WXKA 3ZN3A 4EBBA 3LESA 1TWAA 2A68F 1NA3A 5KJMA 2HV6A 2R7OA 1Z3IX 3VTXA 1NZNA 2ONDA 4U8HA 3I4RB 2PM7A 2WXOA 2B0JA 4JVSA 2C03A 5C1DA 2G3VA 4HLEA 4BJ5A 3FFLA 4YT5A 3D9KA 4LEUA 2R59A 3ZEFA 5DQZA 1E8XA 4YVQC 1ST6A 1ZBPA 3TD7A 2FI7A 3F46A 4WNDA 4APFA 4KC9A 3POVA 4AY6A 5BW8C 2H7OA 2HV7A 5BUOA 4DPRA 4EECA 1KLXA 1L5JA 2UWJG 5HQ8A 4ANVA 5KJLA 1YA0A 3E9VA 1WAO1 5KYYA 2CW0F 3ABKC 3CHPA 3QWPA 4BJ5C 1HFAA 2WVOA 4Y6CA 1OKKA 3VTYA 1OWMA 2Q9CA 3NRHA 2KCVA 4Q7CA 2ZXRA 3OXGA 3D3MA 1ZHYA 2VH3A 2WXGA 1J8YF 3ZYKA 4BFRA 4MQ9F 3SP1A 3GZ2A 3TG5A 4CDMA 5E33A 2Y4UA 1JPJA 3UQ3A 4CSAA 2Y3AA 2R7RA 3MCXA 2W4MA 4OYSA 2CHZA 3LXUX 5CMWA 2Y39A 2A5UA 4LCTA 2KJGA 2WB7A 1OCZC 2C0LA 3AS8A 2M4EA 2LNIA 4EPZA 4QFVA 3ML9A 2WVIA 3SBTB 5HI7A 2X6IA 2VGYA 1N1CA 3HVEB 4PFPA 2KW3C 3ZIMA 3K33A 4IYPA 5ANRA 1KT0A 3LS1A 1OWOA 3U4TA 4PFOA 1B89A 3IKOB 4GA1A 4G25A 3MKQA 3RRNB 5CCMA 2EIMC 2MHKA 2GRMA 3FUMA 3FTXA 1EDUA 4GAAA 4I43A 4DK5A 2M63A 1HG5A 1VK5A 4F7AA 3U9WA 2R7QA 3ITFA 5DLJA 4EZKA 2J4BA 5LX8A 4JEUA 3WG7C 3NYJA 3OTNA 3FH7A 4UI9K 4PS8A 3FP3A 3LY7A 3ASGA 4CEMA 2X6KA 3CVWA 1ZU4A 2FO7A 5FTPA 3EZIA 1FTSA 2D5RB 1HX8A 3G2SA 4DJAA 4CS9A 5AIJA 2E0IA 2I9CA 4IJJA 1H19A 1UN8A 3EHNA 4C3EA 4B6IA 1E8WA 2EINC 2WB2A 1NA0A 4BJ1A 3FUJA 4C3BA 4L23A 2CG3A 2P58C 1D1BA 3KH2A 4AM9A 3UR3C 2AVPA 2NUTB 4OVVA 3FUNA 2DYSC 4JHRA 1JWGA 2IJGX 3MX3A 2WXNA 2YHCA 2DIWA 3ZIBA 1BPOA 5BT1A 3S7FA 4CS9C 4XWJA 4KI2A 2CFUA 2HYZA 3Q4AB 4L2YA 3AQBA 2R7UA 2A69F 4NQ0A 3GZ1A 4C9BB 1MMAA 4I44A 3T5XA 1SZIA 3EFOB 1IQUA 3NKEA 3IV0A 3D9MA 5JJTA 3B7RL 5BNWA 3UGOA 3U64A 2ZXWC 3T6BA 3QK0A 3HTKC 3W2WA 4BJ6A 5FQ7A 5KYWA 1FVFA 1XGWA 3AG2C 2VQ2A 4YVOA 5LOZA 1Y6IA 4YWQA 2MRIA 4JJGA 2HM8A 3P1UA 3EGDB 2XPYA 3FTZA 3FUEA 4JZYA 3W8HA 1V54C 4FHKA 4WNGA 3TG4A 3T6JA 4UQZA 1PD1A 4GZCA 3QZCA 4BTBA 2C04A 3P2BA 2Y69C 2OVBA 2CG2A 3O4ZA 4E85A 4B8CB 2O9XA 4BJ6C 3B9QA 2W9YA 3B0UX 3CKCA 4Q5SF 4BX9A 3U3WA 4I17A 4A55A 3FTWA 3CEQA 2GRLA 4GYTA 4EZJA 3EQLF 3RJVA 4U04A 3JQ1A 5LP0A 4E7SA 4F3VA 2YNQA 4GA2A 4HOQA 3B0VC 4JPSA 3U66A 4RG9A 4XLPF 4U5HA 4A1GA 4GZ5A 3PZDA 5ENNA 2G62A 4DVYP 4GYYA 3B7SA 5G05C 2WQ7A 1PY1A 4QI2A 4A1SA 4J0UA 2IOLA 5D0QD 4ANXA 3CVVA 4XI0A 1EYHA 5FCLA 1TR2A 1D0ZA 1ZYRF 3DD7A 3B13A 2R7SA 3G2WA 3ECSA 2CHXA 3UNGC 5A6CA 3EIJA 5D92A 1OWLA 3NG1A 5DS4A 2XL4A 2ZXOA 5FT9A 1WM5A 3SI5A 3ZC4A 3W2VA 2YHEA 3PE4A 1UN9A 1G8XA 1QQEA 4Q69A 5E3AA 3CKBA 4K7BA 4PJMA 2XCCA 3CK9A 2X38A 2CNWD 5DQTA 4DBQA 3C98A 4I9EA 5CCLA 3QOUA 3KS2A 4XI9A 1U3CA 3M1CB 1N52A 2VB6A 4BSXA 4A3TA 4TV3A 4FA6A 2JEKA 3CQGB 2Y3DA 4Q96A 3L54A 4L1BA 3UX4A 2PL2A 4O79A 3AS4A 2WMNA 4PH4B 1E7UA 1DNPA 1XNFA 3RK6A 5G2NA 3NYMA 4PJNA 4RVBA 4ME2A 5DS5A 3I5PA 3IHVA 3CV0A 2ZU6B 4FJZA 4AY5A 2WXRA 4JZAA 4CS7A 4BY6A 2H7BA 4JEHA 1IHGA 4FP7A 2WVQA 4B8AA 1ZU5A 2X6FA 3FAJA 2J07A 2KC7A 3LJBA 2KZTB 2IOSA 3Q6MA 4H7XA 4J6IA 2VTBB 5AJDA 3RRUA 4GB9A 3ABLC 4CIHA 3PMRA 2JLBA 4BT8A 3ZHEB 2PP4A 3RIBA 3CVYA 2V3CC 4I6EA 1JUQA 2YZSA 3RIPA 3FU6A 3PEVB 1SQMA 3SF4A 4FESA 5L3VA 3EIQC 2Y3GA 3ZYLA 3MKRA 4W9RA 3UPVA 5LCWC 4UWGA 5AJLA 4GEHA 2R7VA 2LSUA 3PUKA 4YN0B 2J4DA 1FFTC 3PH0C 3FHEA 4DI4A 2WXFA 2Q7FA 4RBNA 2KQ9A 3DBSA 3HVEA 2NG1A 4IWBA 4K0RA 3NQPA 3IHYA 4JURI 3CVUA 3LEWA 5D91A 3Q6NA 2KATA 4TRQA 5EHHA 3CQCB 4L2LA 2PX0A 1Z5ZA 3GYZA 3ASNC 3SFZA 1X5BA 4CRWA 3HYMB 3MGBA 1TWCA 2DBAA 3FEYA 4JHJA 4FJYA 5BUZA 4CGWA 4O6MA 4JC8A 4J8EA 3UT4A 3JQ0A 3Q15A 2A1DD 3OA1A 3VAYA 4YT8A 3KEZA 3AU5A 3UMIA 2WZFA 4GZ6A 4JL0A 3OAWA 4N3BA 1JWFA 2RD0A 2XEVA 4U5BE 1JPNA 3FUHA 3N2ZB 4G7ZF 4E6HA 4J32B 4N2SA 1DVPA 2WXHA 3O6XA 2XRHA 4CS8A 3HJCA 3JT1A 1LVKA 2IU1A 2NUPB 3S28A 4G0HA 4PJLA 1Y8MA 2X51A 5FQ4A 5D0OD 4FLHA 4F1SA 1H2UA 1QZ2A 2IXMA 4N06A 4NACA 4GZ3A 4U5CE 2RG8A 5T8IA 2XSEA 1HU3A 4HVBA 4N2QA 2HR2A 3RO3A 4OIPF 2YHSA 3MV2B 1VYKA 4A2NB 3TXNA 4CSAC 1M2VB 2XPZA 3HLZA 2XHEA 3BG1B 3LY8A 4EBAG 2BTDA 5DBKA 4ANWA 2L6JA 5T3TA 2HO1A 1H2TC 2PM6A 4Q94A 5G05J 4K03A 1D1CA 3FTVA 3R7RA 5E75A 2L9BA 1W2WA 5DS6A 5T3WA 4KXKB 4G11A 3B7TA 2G3KA 3EFOA 3JCKC 4HS2A 4PDXA 3FWVA 2XXAB 1OKKD 3UMVA 3VLDA 5KYUB 3TL5A 3TAXA 2R7WA 3FUDA 4EWCA 3LLKA 5AYWD 3RH3A 3NDBB 4U5GA 4WAFA 2IF4A 2WQ6A 4ATGA 5FQ8A 3EHMA 4YNDA 3EGDA 1EF1C 3LAYA 2VJ8A 2IXPA 2I2OA 4JJFA 4YT4A 5CHEE 4WUYA 3D9JA 1TWHA 3SNXA 2VSXE 4HOUA 4AE4B 1OCCC 4BT9A 2E2EA 2XGOA 1RJ9B 1QZXA 4OIOF 3EDTB 2AWIA 4PS7A 3S0XA 1U3DA 4JW1A 3BG0B 5EDSA 3L22A 4L7TA 4N3CA 5FZRA 4P29A 3EPVA 3ESLA 1FMVA 2P6VA 2R7TA 1Z6TA 1OWNA 4I3MA 4OINF 1NU7D 4YT2A 1Z63A 3UT7A 4EQFA 4HE8D 4ANJA 3S7JA 4OIRF 4ACLA 4TUUA 1MNDA 4IULA 3GZSA 3ZRHA 1WGWA 4AVXA 4GMJA 1BR2A 5T4YA 4ILIA 4G1TA 2Z15A 3MKQB 3S27A 3IEEA 2ZPAA 5ANLA 1ELWA 3QWWA 5FZSA 3L0IA 2NXPA 4N3AA 3GODA 3LY9A 3EG9A 3Q5MA 2X3MA 3SZ7A 4MLPA 2OOEA 3QJZA 1LF8A 4MS6A 3JYHA 2R7XA 4U0UA 4ACKA 3T5VA 4KYOB 3T8MA 4ILHB 3RU0A 2J7PA 3KL4A 2L0TB 3ZYQA 5LCWJ 2J49A 4FU3A 2PQRA 4UQXA 4EZLA 3RYLA 1MMGA 1VMAA 3HHMA 3FY4A 1SZAA 3TJPA 2WMOA 3G2VA 2YEVA 3MLGA 3JSZA 2V4LA 2BF0X 4HOSA 3ENEA 4J8DA 4WWPA 2GGFA 2PX3A 2CHWA 3LS0A 2WXIA 4Y6WA 5KCMA 4OIQF 3ZGQA 4HFGA 4KBQA 2C2LA 3PNLB 1KT1A 4XLNF 1GW6A 3K7DA 4UI9C 2X6JA 5ARFA 3JCUQ 2XQ0A 3OEOA 3CVLA 5M72A 3S29A 4U5FE 2PZIA 2VGXA 2EIKC 3JUIA 3CR3A 2J9UA 2KM4A 3DM9B 3VLEA 2WL8A 1TEZA 3ML8A 2I8BA 4GCOA 4FWVA 3ZPJA 2XCBA 2EILC 2LSEA 2YQ8A 2QTVA 4LLEA 3FU3A 2KZTA 1NU9C 3N0TA 2ILRA 2VTBA 4BTAA 4IAOA 4AJWA 3CHSA 2VASA 3B0PA 3CZ6A 5G04C 3ZHEA 5A23A 2XGSA 2KNHA 1PD0A 3FHDA 3SEOA 1HF8A 2X6HA 4GMLA 1NG1A 2XRYA 4IRUA 4DBRA 3MEKA 4UQYA 1ZHZA 3MYVA 3MV3B 4M3OA 3B7UX 3D9PA 3QB2A 1UG3A 3CHOA 2IONA 4G2VA 2L81A 2V8SE 3VLFA 4C0MA 4AXHA 1PAQA 3QWVA 1LS1A 3DPDA 4U5DE 2WPVA 4RG6A 2WXJA 1QLEC 1HXIA 4U0ZA 5KYXB 5FZQA 3VYWA 3QAQA 4KNVA 2J0XA 4KVMA 3CVQA 4G7HF 3ONLA 3DJUB 3CSFA 4AEZC 5EGYA 5J90A 4WWOA 3F47A 3KD7A 3CVXA 2WXQA 3IBEA 2OCCC 4KZCA 2A6EF 2E87A 5FQ6A 4GA0A 3GW4A 3EGXB 4JA7A 4D10C 3SGHA 4CT0A 3DJNB 4C7OB 1OCOC 2IQCA 3UMHA 5F5HA 1EPUA 3ZVVA 5EKQD 3CHQA 3APCA 3CHMA 2WXPA 5C2YA 4KZ0A 4LLCA 2AW6A 3UT8A 4V3IA 2A6HF 2Q9BA 4XTKA 3IEGA 1OCRC 2I1JA 3I3NA 4R7LA 3ZSUA 3FH5A 5BV0A 5KYNA 3UMKA 4HFKB 3PNTB 2LAHA 2Y3BA 3LLIA 3APDA 2NUPA 2MWQA 2FULA 3UGPA 2PFDA 4RSYA 4KT6B 2C0MA 1D0XA 1MMDA 4WNEA 1FCHA 2QY7A 3Q7LA 4UWLA 2Y3HA 3CSTA 4BWRA 4GCNA 4JHKA 3AQCA 4O7GA 4HXIA 3G2UA 3E4BA 4NY3A 1M2VA 4ABNA 3L6AA 1V55C 3X1OA 5J08A 5ARGA 1IYGA 4O6YA 3URZA 1O5HA 2Q9AA 4JXTA 2J09A 3NZUA 4GZDA 3FEXA 4UWHA 3LEVA 1A17A 1IQRA 4ZLCA 4PUCA 4G24A 3JRTA 3FUIA 3TXMA 4QI0A 3CK8A 4CBEA 3DXJF 1VYIA 3LDZA 3SNHA 1Z3XA 4Q4ZF 3FTSA 1M56C 3CSKA 2FBNA 1BR1A 3EH2A 2XXAA 5JJ6A 4CGVA 1KU2A 5KYUA 4U0SA 2EQXA 3CVNA 4AP2A 4H7YA 3D9LA 3FUKA 1H0AA 3CQZA 1QNFA 2IFUA 2UY1B 4IN3B 1MQSA 1UJKA 3MZLB 4B89A 4URKA 4NURA 1E90A 1PCXA 4O6FA 4XX5A 1OWPA 1MMNA 3KMIA 4UWKA 3CK7A 4JA9A 4AE4A 1UW4B 1IZMA 4AX2A 1E7VA 4RDAA 4DLOA 1RJ9A 2PQNA 3S7DA 5KJNA 3DMDA 4EBAA 5F5FA 3D9IA 4U63A 1SZ9A 1M2OA 4UI9J 4APOA 2FFHA 3DAGA 2NUTA 3PVLA 4CT4A 1FFHA 4I6GA 5EX0A 2BUGA 4CS8C 1MHQA 1ZHTA 2R17C 3PE3A 3UUXA 4M63A 3Q49B 4AOFA 4G26A 1ELRA 3RRMB 3APFA 4DOZA 3N71A 4DLQA 3GANA 2JD3A 3ZXSA 4MRUA 3TGOA 3EZHA 1TKNA 3LNRA 1OUVA 4XZ4A 1ZU2A 3FULA 3S7BA 4GPKA 3ZFWA 3FU5A 4J30B 4U07A 2J0WA 2CDQA 3SHFA 5KYYB 3ASFA 1O87A 3N24A 3L17A 2LO6A 5G04J 3ZVRA 2IYLD 2P7VA 4GYOA 2AXUA 3HIZA 2WXMA 5DVWA 3ZW3A 3LVRE 3CGHA 3CIAA 4BJTA 2ZXPA 3V7OA 3DAFA 3O48A 1D0YA 1JPLA 3LJ3A 3SZRA 3AG3C 4X0RA 4PS3A 4AIFA 4OVUA 4QDLA 3QNKA 3K6BA 4E7ZA 2WVNA 3FVYA 1HZ4A 3LCAA 2VSYA 3BEEA 1LKXA 3SBSA 4A3VA 4ANUA 2AXZA 1ZHXA 2QY9A 1E8ZA 3DZAA 3CVPA 2Y4TA 3ZYMA 2IXNA 3WXXA 4G23A 3ONKA 2GFHA 1FVHA 4PJJA 3KKBA 2XGMA 3ULQA 3FU0A 5FWQA 2DGJA 4XKCA 3LKUA 4HFFB 4WNFA 3JYSA 2QFCA 1HO8A 3LVQE 5CMYA 5BPPA 4BG0A 4MKTA 5E2QA 4CDNA 3FTUA 5HSWA 2WQHA 3FTYA 4JCHA 2EIJC 2LSVA 2XRZA 2OVFA 5KJKA 1P5QA 2MYSA 4XKBA 2IXOA 4B94A 2H7VC 5CI9A 3SD5A 5JJ7A 2WZLA 1VDYA 3QMKA 1HE8A 5G55A 3LPZA 1BR4A 4AV7A 1IW7F 2J45A 3FDHA 3AS5A 2KGOA 4I1AA 2J9WA 3G2TA 3ZG1A 3LS8A 4P6IC 2YINA 4I2WA 3S2AA 3NYLA 3X2QC 3Q7GA 1TJCA 2L0IA 2J9QA 1Z6AA 3PHF2 3ESKA 2KCKA 3I4GA 4J8SA 4PK4A 4GU5A 5B1AC 4KNWA 3HDXA 2J46A 4K0DA 2VSNA 5E3CA 4G7OF 2CNWA 4MNDA 3NZSA 3QKYA 3R7QA 1E8YA 3PRZA 3ABMC 4I1MA 3W8IA 1S0PA 3L16A 4WWNA 1NZEA 3PDNA 5KYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IRU A;  4JW1 A;  4I1O B;  4JVS A;  4I1M A; 
#chains in the Genus database with same CATH topology
 2I6H A;  2EIL E;  3O39 A;  3AG1 C;  3U5S A;  5DIZ A;  2WM9 A;  1U89 A;  1WWP A;  5KWD A;  2FO1 E;  1BI7 B;  2NYJ A;  4XIF A;  3AGU A;  5E76 A;  4FAD A;  3H65 A;  4LUN U;  3RFY A;  2LK4 A;  2DCP A;  1Z5S C;  4D4X A;  1TR4 A;  2IOQ A;  3ASH A;  2DYR C;  2L9J A;  4LRZ A;  4LAC B;  4GYW A;  3L8I A;  3TWU A;  3LYA A;  3FDQ A;  2WZG A;  3MJW A;  3OXL A;  2RSE B;  1Z23 A;  4FC8 A;  5EX3 A;  3G4Z A;  2YL1 A;  3KAE A;  4MW8 A;  3BRJ A;  3ASD A;  3C3Q A;  3EGX A;  5JHB A;  2AXV A;  3ASO C;  1YYH A;  4BX8 A;  3PEU B;  4ULW A;  4YL3 A;  4C7O A;  1EI7 A;  5L3Q A;  1WDY A;  3V31 A;  1UJJ A;  1FAP B;  3UTM A;  4CDR A;  4I9C A;  4U5E E;  5BV1 A;  1ELK A;  4ATZ D;  4WJ0 A;  4YJW A;  4N4W A;  2LAI A;  2B6C A;  3D9O A;  2BE5 F;  1Z3Y A;  4LER A;  3NF1 A;  2V0P A;  1NSG B;  2Q3T A;  4FLB A;  4W8K A;  2RKK A;  4K5C A;  4C3D A;  2P1A A;  4K5B A;  4F53 A;  4O6N A;  4DVZ A;  2H6H A;  4FUL A;  3EH1 A;  5K0I A;  3EG9 B;  2FGY A;  1Q2Z A;  1N54 A;  1M57 C;  1ORS C;  5B3I A;  1MX2 A;  1W3B A;  2CFZ A;  2NC9 A;  2MOW A;  1MNE A;  5A7D B;  5ENP D;  2J7P D;  5KYW B;  3C8G A;  3AU4 A;  1JMW A;  1TWG A;  4RD9 A;  1H6K A;  2NSZ A;  2FF4 A;  1WY6 A;  2IEJ A;  1E84 A;  5T3R A;  2IO3 C;  4WGZ A;  3NMK A;  3SXY A;  4XE0 A;  1HH8 A;  2ZGG A;  4JIO A;  1T5O A;  3K1I A;  256B A;  5ITZ F;  4J8F A;  1ZHW A;  4ZLD A;  1YCS B;  4HOR A;  3RO2 A;  3T6G B;  1HG2 A;  4GTS A;  1S7Z A;  1AVO B;  2A4Z A;  4I6J A;  3L08 A;  2M64 A;  2WXL A;  3QAR A;  4NRH B;  1JOG A;  2OEW A;  1N94 A;  1SMY F;  2LD6 A;  3K1H A;  2BKK B;  1PC2 A;  3I4U A;  1H2V C;  3L13 A;  1T6I A;  5AEN A;  3Q47 B;  3PS6 A;  4KVO A;  3EJN A;  4ER9 A;  3QDN A;  2CGE A;  5B3S E;  2V26 A;  4HEA J;  3OXF A;  3UIN C;  4I1O B;  2EPO A;  3AG4 C;  2R5S A;  3K9I A;  3D9N A;  2J9V A;  3BEH A;  2BKG A;  2W4B A;  5B1B C;  4ILG A;  2PF4 E;  5CI8 A;  2F8X K;  2OV8 A;  5LFA A;  5T1D B;  2R02 A;  2I1K A;  4UWF A;  4CCA A;  5L0H A;  1FMW A;  1TNO A;  4KBL A;  3TUL A;  2XLD A;  1SA4 A;  3DSW A;  2YRF A;  4BES A;  5IY5 E;  3K1I C;  1HS6 A;  3UI2 A;  2W45 A;  3PRE A;  5HS0 A;  4I2Z A;  1VOM A;  1H7I A;  3E70 C;  2OOC A;  3U2L A;  3GWN A;  2VYI A;  2A0U A;  1OCR E;  3QC1 A;  3RKV A;  3L34 A;  5BXO A;  4F4B A;  3RKO F;  5B3S C;  1XZP A;  2FEZ A;  3U2M A;  2VGX B;  5CRU A;  4C0E A;  3NKD A;  2JPU A;  1J8M F;  4Z9H A;  2GW1 A;  3AGT A;  3F6Q A;  1A7E A;  3R9A B;  1YYX A;  1E96 B;  4DI3 A;  2QUP A;  3I5Q A;  4OD4 A;  2V5F A;  3CHR A;  4N39 A;  1AEP A;  4KMO A;  2KCL A;  4CYM D;  3LEO A;  4JC7 A;  5IY5 C;  3U3B A;  3T4R A;  4HOT A;  5L0D A;  5FJY A;  3WOD F;  4MVM A;  1TJF A;  2OG2 A;  2UY1 A;  3PUJ A;  3SY2 A;  3FH8 A;  2R9R B;  1NP7 A;  4BEJ A;  4OD5 A;  3K66 A;  4N5C A;  1QPU A;  3DM5 A;  1LD7 A;  3CLJ A;  1INZ A;  4AK9 A;  1FNT c;  3TWT A;  3FUF A;  2J08 A;  4H4K C;  1D1A A;  1V55 E;  5JHA A;  4JCZ A;  1K1B A;  3SYN A;  2NPU A;  4FX5 A;  3U8V A;  2VSO E;  2XPI A;  1SF8 A;  4FHJ A;  3OWT A;  1V4A A;  3MA5 A;  1TNY A;  4B0Z A;  3JZ0 A;  4YDE A;  3T9O A;  4TXP A;  2WXK A;  1EKY A;  4IAR A;  4JTC B;  3ZN3 A;  4EBB A;  3LES A;  1TWA A;  2A68 F;  1NA3 A;  5KJM A;  1MX4 A;  3VM6 A;  1NLX A;  2HV6 A;  3U3F A;  2R7O A;  1Z3I X;  3VTX A;  3GOR A;  1NZN A;  2OND A;  4U8H A;  2Y1L E;  3I4R B;  4ZFH A;  3NB2 A;  2PM7 A;  3W9F A;  2WXO A;  2B0J A;  4JVS A;  2C03 A;  1U6H A;  5C1D A;  2G3V A;  4HLE A;  3JUE A;  3SXM A;  4BJ5 A;  3WAQ A;  3FFL A;  4YT5 A;  3D9K A;  4U9D A;  2ZD9 A;  2R59 A;  4LEU A;  1U0B B;  3ZEF A;  5DQZ A;  2ICW G;  3ABK E;  4O1O A;  1E8X A;  1V74 B;  3QW0 A;  4YVQ C;  1ST6 A;  1ZBP A;  3TWS A;  2Q7R A;  3TD7 A;  2FI7 A;  1TFK B;  3B29 A;  4CJO A;  3F46 A;  4WND A;  3TWR A;  4APF A;  1OXK A;  4KC9 A;  3POV A;  2MHR A;  5BW8 C;  4AY6 A;  2H7O A;  3ISM C;  2HV7 A;  2IY0 C;  5BUO A;  1QQ3 A;  4G8K A;  4DPR A;  4NTF A;  2P9K G;  1BLX B;  4EEC A;  5KBA A;  5A6K A;  1KLX A;  2HJM A;  1OQC A;  1L5J A;  2UWJ G;  5HQ8 A;  1PV3 A;  4ANV A;  5KJL A;  1DCQ A;  1YA0 A;  1QSP A;  1RW2 A;  3DE8 A;  3E9V A;  1WAO 1;  5KYY A;  2CW0 F;  4HQD A;  3ABK C;  3NMJ A;  1YA9 A;  3CHP A;  1GQA A;  4G78 A;  3QWP A;  4BJ5 C;  1HFA A;  5JLI A;  3L82 A;  5L0C A;  3RQG A;  2WVO A;  4Y6C A;  1OKK A;  3VTY A;  3TOL A;  1OWM A;  2Q9C A;  3NRH A;  2KCV A;  4Q7C A;  2ZXR A;  4U96 D;  3OXG A;  3D3M A;  3US6 A;  1ZHY A;  2VH3 A;  2WXG A;  1J8Y F;  3DRA A;  1OCZ E;  2ETC A;  3ZYK A;  2ZIR A;  1KPS B;  4BFR A;  5EN5 D;  4MQ9 F;  4E0I A;  3FAP B;  3SP1 A;  3GZ2 A;  2HSQ A;  3TG5 A;  4CDM A;  5E33 A;  3QVY A;  2Y4U A;  1JPJ A;  3UQ3 A;  4CSA A;  3NOC D;  2Y3A A;  2VCC A;  2R7R A;  3MCX A;  2H6G A;  5CER B;  2W4M A;  4OYS A;  2AWC A;  4YL0 A;  2CHZ A;  3AOU A;  3LXU X;  5CMW A;  3QW1 A;  4EIY A;  4U8Y D;  4DX2 A;  2Y39 A;  2A5U A;  1XWJ A;  2OU6 A;  4LCT A;  2DB4 A;  2KJG A;  2DZN A;  3IHU A;  1ORJ A;  2WB7 A;  1OCZ C;  3IQT A;  2C0L A;  3AS8 A;  2M4E A;  3D9H A;  2LNI A;  4EPZ A;  4YK5 A;  4QFV A;  3ML9 A;  2WVI A;  3SBT B;  3WHN A;  1L3P A;  5HI7 A;  2X6I A;  2VGY A;  1N1C A;  2XLO A;  3HVE B;  4PFP A;  3DKA A;  2KW3 C;  3ZIM A;  3K33 A;  1T01 A;  1HW2 A;  4IYP A;  2PNN A;  4YDY A;  3HXF A;  2LXM A;  5ANR A;  1KT0 A;  3LS1 A;  1OWO A;  2F22 A;  2H8A A;  5ENT D;  3U4T A;  3E34 A;  4PFO A;  4Z68 A;  1YLM A;  1B89 A;  3IKO B;  3DSS A;  4GA1 A;  4G25 A;  1WAS A;  3RW0 A;  3WG7 E;  3MKQ A;  3RRN B;  3TJ6 A;  1BD8 A;  3ZXP A;  5CCM A;  2EIM C;  3JYY A;  2MHK A;  2GRM A;  3FUM A;  1APC A;  3FTX A;  1EDU A;  4GAA A;  1OT8 A;  4I43 A;  2GA0 A;  4DK5 A;  2M63 A;  3V30 A;  3ZU7 B;  4EBJ A;  1HG5 A;  1VK5 A;  3V2X A;  4GMR A;  4F7A A;  3U9W A;  2R7Q A;  3ITF A;  5TJ5 E;  4GTO A;  5DLJ A;  4EZK A;  3E30 A;  4N6H A;  3IQ5 A;  2A5E A;  2KXP C;  2J4B A;  5LX8 A;  1QKR A;  1JAF A;  3PZ2 A;  1Q0G A;  4JEU A;  3WG7 C;  3NYJ A;  3OTN A;  3FH7 A;  4UI9 K;  4PS8 A;  5JT4 A;  3FP3 A;  2HJ3 A;  3LY7 A;  3ASG A;  3B95 A;  4CEM A;  4J7T A;  2X6K A;  3A11 A;  3CVW A;  1ZU4 A;  2FO7 A;  4Z9J A;  5FTP A;  3EZI A;  1FTS A;  2D5R B;  1HX8 A;  2EPN A;  1GM5 A;  2YQY A;  3G2S A;  4DJA A;  4CS9 A;  5AIJ A;  2E0I A;  2GWW A;  2I9C A;  4IJJ A;  1H19 A;  1UN8 A;  1QVX A;  3NBN B;  3EHN A;  4C3E A;  4B6I A;  2GRR B;  3C3O A;  4J8Y A;  3TK0 A;  1E8W A;  2OKU A;  4LNU D;  2KBX A;  2EIN C;  2WB2 A;  1NA0 A;  4BJ1 A;  3FUJ A;  3ZTZ A;  5A6B D;  1LS4 A;  1TN7 A;  4C3B A;  4L23 A;  2CG3 A;  2P58 C;  1D1B A;  3KH2 A;  4GTM A;  4AM9 A;  3M79 A;  3C5R A;  3UR3 C;  4N5Q A;  2AVP A;  2NUT B;  4OVV A;  3FUN A;  2DYS C;  4JHR A;  4DRX E;  3HNI A;  1JWG A;  3SXZ A;  2IJG X;  3MX3 A;  2WXN A;  2YHC A;  2HMQ A;  1C03 A;  5BQH A;  2DIW A;  3ZIB A;  1BPO A;  5BT1 A;  1LI7 A;  2YKZ A;  4X8Q A;  3S7F A;  4CS9 C;  1MX6 A;  2ZXW E;  4Z9I A;  4XWJ A;  4KI2 A;  2CFU A;  4DRH B;  1YJG A;  3JRM O;  2HYZ A;  3Q4A B;  4L2Y A;  2XEN A;  3U9M A;  3AQB A;  2R7U A;  1ZVZ A;  2A69 F;  4JKV A;  1NBB A;  4NQ0 A;  1H6P A;  3S84 A;  2QYU A;  3GZ1 A;  1Q0D A;  4C9B B;  3TJ5 A;  2ETS A;  1MMA A;  3TWV A;  4R32 A;  4I44 A;  3T5X A;  1SZI A;  3GM1 A;  3EFO B;  3GWL A;  2RFA A;  1V54 E;  3R2P A;  1IQU A;  3NKE A;  3IV0 A;  3D9M A;  1TN8 A;  5JJT A;  3B7R L;  5AN8 A;  3MBG A;  5BNW A;  3UGO A;  3U64 A;  3ABM E;  2ZXW C;  3Q73 A;  3T6B A;  3QK0 A;  3HTK C;  3W2W A;  4MVQ A;  4BJ6 A;  5FQ7 A;  5KYW A;  5H7P A;  3AG1 E;  1K1A A;  3EHR A;  1FVF A;  1XGW A;  3AG2 C;  2VQ2 A;  3RVZ A;  4YVO A;  5LOZ A;  1Y6I A;  2OEX A;  4YWQ A;  2MRI A;  3UM3 A;  3IQ6 A;  3TOM A;  4JJG A;  1IHB A;  3HXC A;  2HM8 A;  3P1U A;  3EGD B;  2XPY A;  3FTZ A;  2DYR E;  3FUE A;  4JZY A;  3PDM P;  3W8H A;  3E37 A;  1V54 C;  4FHK A;  1AUE A;  4WNG A;  3TG4 A;  3UM2 A;  3T6J A;  1O1S A;  4UQZ A;  1PD1 A;  4GZC A;  3RSE G;  4MVZ A;  3QZC A;  4YDO A;  3TWX A;  4BTB A;  2C04 A;  3P2B A;  3R9M A;  3ASO E;  5HRY A;  1G3N B;  2Y69 C;  2OVB A;  2CG2 A;  3LJN A;  3O4Z A;  2F0Y A;  4E85 A;  4TUM A;  4B8C B;  4CIP A;  2O9X A;  4BJ6 C;  3B9Q A;  5L0F A;  2W9Y A;  3B0U X;  3CKC A;  1OW7 A;  4Q5S F;  1RXQ A;  4BX9 A;  4I17 A;  3U3W A;  4A55 A;  3FTW A;  3ULE G;  3M4B A;  3CEQ A;  2GRL A;  4GYT A;  2BED A;  4EZJ A;  2HZ8 A;  3BU8 A;  4DXW A;  3DST A;  3EQL F;  3RJV A;  2R05 A;  3JQ1 A;  4U04 A;  5LP0 A;  4E7S A;  4F3V A;  2YNQ A;  4GA2 A;  4HOQ A;  3B0V C;  1SVX A;  4JPS A;  3U66 A;  2F37 A;  4RG9 A;  3TWQ A;  4XLP F;  1M6T A;  4U5H A;  3PZ3 A;  4A1G A;  3T8K A;  4GZ5 A;  3PZD A;  5ENN A;  2G62 A;  3SFX A;  5ENQ D;  4DVY P;  4GYY A;  3B7S A;  5G05 C;  2WQ7 A;  1PY1 A;  4QI2 A;  4A1S A;  4J0U A;  2IOL A;  2D4U A;  5D0Q D;  4ANX A;  2VCA A;  3MFN A;  4GTR A;  3CVV A;  4XI0 A;  1EYH A;  5FCL A;  1TR2 A;  4EHM A;  2R03 A;  1D0Z A;  1ZYR F;  3ZQY A;  3DD7 A;  1K40 A;  3B13 A;  2R7S A;  1YYJ A;  3G2W A;  3ECS A;  4YL1 A;  3AG4 E;  5B1B E;  3DE9 A;  2CHX A;  3UNG C;  1HE9 A;  3EIJ A;  5A6C A;  5D92 A;  1OWL A;  3NG1 A;  5DS4 A;  1N4Q A;  1GS9 A;  2XL4 A;  2ZXO A;  1D8D A;  5FT9 A;  1SYQ A;  1WM5 A;  4ZHB A;  4EKW A;  3RAU A;  5CED B;  1E85 A;  4JEB A;  3SI5 A;  3ZC4 A;  2I15 A;  3W2V A;  2YHE A;  3PE4 A;  1TYQ G;  1UN9 A;  1G8X A;  4GTT A;  1QQE A;  4Q69 A;  5E3A A;  3CKB A;  2KSF A;  4K7B A;  4PJM A;  3MYF A;  2XCC A;  2X38 A;  2CNW D;  3CK9 A;  2B0H A;  4DRJ B;  3JXJ A;  5DQT A;  4DBQ A;  3C98 A;  4H54 A;  4I9E A;  5CCL A;  3QOU A;  3KS2 A;  3B71 A;  4XI9 A;  1U3C A;  3M1C B;  1N52 A;  2VB6 A;  4BSX A;  4A3T A;  4TV3 A;  5JMN D;  4FA6 A;  2JEK A;  3CQG B;  2Y3D A;  4Q96 A;  3L54 A;  2ZGD A;  3Q9U C;  5AQ9 A;  4L1B A;  3UX4 A;  3U0C A;  2PL2 A;  3M15 A;  2QC9 A;  4O79 A;  3AS4 A;  2WMN A;  4PH4 B;  1E7U A;  1DNP A;  5A69 A;  2GAQ A;  1XNF A;  3RK6 A;  5G2N A;  3NYM A;  4NTB A;  3DSU A;  1A0B A;  4PJN A;  4RVB A;  4ME2 A;  5DS5 A;  4MTO A;  3I5P A;  3IHV A;  4ULV A;  3CV0 A;  1BBH A;  2ZU6 B;  4FJZ A;  4AY5 A;  3W9G A;  2WXR A;  4JZA A;  4XEV A;  4CS7 A;  4BY6 A;  2H7B A;  3L1M A;  4JEH A;  1IHG A;  5CBO A;  4FP7 A;  2WVQ A;  4DUI A;  4B8A A;  1ZU5 A;  1RKC A;  3R7C A;  2X6F A;  3FAJ A;  1N4P A;  3U9J A;  2J07 A;  3FOO A;  2KC7 A;  3PZ1 A;  2DZO A;  3LJB A;  2KZT B;  1E83 A;  2IOS A;  3G4X A;  3Q6M A;  4H7X A;  4J6I A;  2VTB B;  3O10 A;  1MZC A;  5AJD A;  4HRN A;  1OXJ A;  3RRU A;  2RD9 A;  4GB9 A;  3ABL C;  3C8G D;  4CIH A;  4NIK A;  3RF3 A;  3PMR A;  2JLB A;  4BT8 A;  3ZHE B;  2PP4 A;  3RIB A;  5JSL A;  3CVY A;  2V3C C;  4I6E A;  1JUQ A;  2YZS A;  5GPG B;  3RIP A;  3FU6 A;  3PEV B;  1SQM A;  3SF4 A;  4MW3 A;  4FES A;  1I4Z A;  5L3V A;  5CBN A;  3EIQ C;  2Y3G A;  3ZYL A;  3MKR A;  3AJM A;  4W9R A;  2L6H A;  3UPV A;  5LCW C;  4JTA B;  4UWG A;  5AJL A;  2H6F A;  2R7V A;  1JR8 A;  4GEH A;  2LSU A;  3ASN E;  1YA7 O;  3IQC A;  3PUK A;  4YN0 B;  2J4D A;  4DX6 D;  4MVS A;  2LCH A;  1FFT C;  3PH0 C;  3Q75 A;  4RLY A;  3FHE A;  4DI4 A;  2XLW A;  2WXF A;  2P0N A;  2Q7F A;  4RBN A;  2KQ9 A;  3DBS A;  4EHP A;  3HVE A;  1N4S A;  1K04 A;  2NG1 A;  3ZTM A;  4IWB A;  1TQG A;  5AQA A;  4K0R A;  1K05 A;  3NQP A;  1A5E A;  3IHY A;  4JUR I;  4A63 B;  2YWA A;  3CVU A;  3LEW A;  5CEC B;  5CRV A;  5D91 A;  3Q6N A;  1CPQ A;  3JSE O;  2KAT A;  4TRQ A;  3ZDL A;  5EHH A;  3CQC B;  4HI8 A;  4L2L A;  5AC5 A;  2PX0 A;  1D8E A;  1Z5Z A;  2QLA A;  4GTQ A;  2XLV A;  3GYZ A;  1JCS A;  3ASN C;  3SFZ A;  1X5B A;  5KNH D;  1AP7 A;  4CRW A;  3HYM B;  3MGB A;  1TWC A;  2DBA A;  3FEY A;  2R25 A;  4JHJ A;  4FJY A;  5BUZ A;  4CJG A;  4CGW A;  2RFM A;  3FXH A;  4O6M A;  4JC8 A;  4LNB A;  4MTG A;  4J8E A;  3UT4 A;  4WGY A;  3BUA A;  1LTX A;  3JQ0 A;  3H2U A;  3Q15 A;  4GTP A;  2A1D D;  3OA1 A;  3VAY A;  4C48 B;  3CEX A;  1YAR O;  3FMS A;  4JTD B;  4YT8 A;  3KEZ A;  3AU5 A;  2XL6 A;  3SFY A;  3BQO A;  4EUK B;  3UMI A;  2WZF A;  4GZ6 A;  4JL0 A;  1JRA A;  1MJ0 A;  3OAW A;  4N3B A;  1JWF A;  2RD0 A;  2XEV A;  4U5B E;  2R2L A;  1JPN A;  3FUH A;  3N2Z B;  4G7Z F;  2YLG A;  4E6H A;  1GGQ A;  4J32 B;  4N2S A;  4N6C A;  1DVP A;  2WXH A;  3O6X A;  2XRH A;  2XL8 A;  4CS8 A;  3HJC A;  4F1P A;  3JT1 A;  1LVK A;  3C18 A;  1OR2 A;  2IU1 A;  2P9U G;  2NUP B;  2BC5 A;  1JCR A;  1T9K A;  3S28 A;  2ASR A;  3C8Z A;  4G0H A;  1KTM A;  4PJL A;  2P2C P;  1C02 A;  1WG0 A;  1Y8M A;  2X51 A;  5FQ4 A;  1R5I D;  2YL3 A;  4AL0 A;  4IGG A;  5D0O D;  2EIM E;  4DX7 D;  3KSQ A;  4FLH A;  4F1S A;  4IB4 A;  1H2U A;  1QZ2 A;  2IXM A;  4N06 A;  4NAC A;  3HNJ A;  4GZ3 A;  1D9S A;  4U5C E;  3KEA A;  2FAP B;  2JAB A;  2OQM A;  2RG8 A;  5T8I A;  3DXM G;  2XSE A;  1FT2 A;  1HU3 A;  1A41 A;  1AWC B;  2IO2 C;  4HVB A;  4N2Q A;  2HR2 A;  3EU5 A;  3RO3 A;  3UIP C;  4OIP F;  2YHS A;  3MV2 B;  1VYK A;  4HI9 A;  1RKE B;  4A2N B;  4OAV B;  2BL2 A;  3TXN A;  4O1P A;  4CSA C;  4LG6 A;  1M2V B;  2XPZ A;  2AVK A;  4XPX A;  4UDV A;  3HLZ A;  1VTM P;  2XHE A;  3BG1 B;  4CDY A;  3LY8 A;  4EBA G;  2BTD A;  5DBK A;  4ANW A;  4JEA A;  4PR9 A;  2L6J A;  2V5Q C;  3SQV A;  4LDQ A;  2HE0 A;  5T3T A;  1S05 A;  2HO1 A;  4J7W A;  1H2T C;  2HSB A;  2PM6 A;  3IXE A;  4Q94 A;  5G05 J;  4K03 A;  5CEA A;  1D1C A;  1DC2 A;  3FTV A;  3U8P A;  4O60 A;  1NI1 A;  3R7R A;  5E75 A;  2L9B A;  5JRA A;  1W2W A;  2NSG A;  5DS6 A;  5T3W A;  4KXK B;  1QBQ A;  2QE9 A;  3ATP A;  4G11 A;  3B7T A;  2G3K A;  4W8P A;  4JE9 A;  3EFO A;  3M4C A;  3JCK C;  4HS2 A;  4PDX A;  3FWV A;  4EBK A;  2XXA B;  1OKK D;  3UMV A;  3VLD A;  2EIN E;  3G50 A;  4D4N A;  5KYU B;  3TL5 A;  3TAX A;  2R7W A;  1N0R A;  3FUD A;  1QYM A;  4EWC A;  3LLK A;  5HKP A;  4E18 A;  5AYW D;  3RH3 A;  4BEM J;  3NDB B;  4U5G A;  4WAF A;  2IF4 A;  2WQ6 A;  4ATG A;  5FQ8 A;  3EHM A;  4CDA A;  2DYS E;  3EGD A;  1EF1 C;  1BZ4 A;  2GRQ B;  4YND A;  3LAY A;  2VJ8 A;  2IXP A;  4U7E B;  5JVE A;  2KC3 A;  2I2O A;  4JJF A;  1TNZ A;  4YT4 A;  5CHE E;  4WUY A;  3D9J A;  1TWH A;  1I5N A;  3L8J A;  2VSX E;  3SNX A;  4HOU A;  4AE4 B;  1DOW A;  1OCC C;  4BT9 A;  1HMO A;  1OR3 A;  3HRA A;  2E2E A;  2XGO A;  3UM0 A;  3NMI A;  1RJ9 B;  3DWL G;  1FT1 A;  3PCV A;  2JX0 A;  1QZX A;  1UFB A;  4OIO F;  4QQI A;  3EDT B;  2AWI A;  4PS7 A;  3S0X A;  1U3D A;  3DSX A;  4JW1 A;  3BG0 B;  5EDS A;  5L0I A;  3L22 A;  4L7T A;  4N3C A;  5FZR A;  1Q0M A;  2AJA A;  4P29 A;  3EPV A;  1H6G A;  3ESL A;  1FMV A;  2P6V A;  1TFO B;  2R7T A;  1E86 A;  1S70 B;  1Z6T A;  1OWN A;  4I3M A;  1O3U A;  1OXB A;  4OIN F;  1NU7 D;  4YT2 A;  1Z63 A;  3W4Y A;  3DPY A;  3UT7 A;  4EQF A;  4HE8 D;  4ANJ A;  3S7J A;  4OIR F;  4P9F A;  4ACL A;  4B93 B;  4TUU A;  1MND A;  4IUL A;  3GZS A;  2GRN B;  3ZRH A;  3ZWI A;  1WGW A;  3AG2 E;  3C3R A;  4NCQ A;  3V5X A;  4LNG A;  3SXK A;  1MQV A;  4AVX A;  4GMJ A;  1BR2 A;  3L9T A;  1BU9 A;  5T4Y A;  4ILI A;  4G1T A;  2Z15 A;  5FIO A;  3MKQ B;  4XEK A;  1G5Z A;  3S27 A;  1RCP A;  3IEE A;  2ZPA A;  5COM A;  5ANL A;  5F28 E;  1ELW A;  3QWW A;  4MBG A;  5FZS A;  3EUV A;  3L0I A;  1IKN D;  2NXP A;  4N3A A;  5FIN A;  1O1R A;  3GOD A;  3LY9 A;  3UM1 A;  3EG9 A;  3Q5M A;  2UUH A;  4CZ2 D;  2X3M A;  3RQF A;  2XS8 A;  2J9B A;  2ETA A;  3SZ7 A;  1N11 A;  3UKR G;  3GEE A;  2Y69 E;  4MLP A;  2OOE A;  3QJZ A;  1ZW3 A;  1LF8 A;  4BER A;  4MS6 A;  3JYH A;  2R7X A;  4U0U A;  4ACK A;  3T5V A;  2PBE A;  4KYO B;  5CIV A;  3T8M A;  4ILH B;  3RU0 A;  2J7P A;  3KL4 A;  2L0T B;  3ZYQ A;  3B7B A;  5LCW J;  1Y6D A;  2J49 A;  4FU3 A;  2B0O E;  2PQR A;  4UQX A;  4EZL A;  3RYL A;  1MMG A;  1VMA A;  2VC9 A;  2CYD A;  2LFD A;  3FY4 A;  1SZA A;  3HHM A;  4JRZ A;  4JD2 G;  3TJP A;  2WMO A;  3G2V A;  1F1M A;  1VLS A;  2YEV A;  3MLG A;  3JSZ A;  1XZQ A;  2YL7 A;  2V4L A;  2BF0 X;  3EU9 A;  4HOS A;  3ENE A;  4J8D A;  4WWP A;  5HV9 A;  2GGF A;  2EPL X;  3ULY A;  2PX3 A;  2ZIS A;  2CHW A;  3V2O A;  3LS0 A;  2WXI A;  4Y6W A;  1Z7Q c;  1H9T A;  5KCM A;  4OIQ F;  3HNK A;  2DI3 A;  3ZGQ A;  2P9N G;  4HFG A;  4KBQ A;  2KK1 A;  2P9L G;  2C2L A;  3PNL B;  1SR2 A;  4MS2 A;  5EID A;  1O5M A;  3V79 K;  1YZA A;  1KT1 A;  4XLN F;  1GW6 A;  4G8L A;  2Q00 A;  3K7D A;  4BET A;  2DVW A;  4UI9 C;  1T6Q A;  1C17 M;  2X6J A;  5ARF A;  3JCU Q;  2XQ0 A;  3MYI A;  1CGM E;  3OEO A;  2P9S G;  1OW8 A;  3Q9N C;  2XZD G;  3CVL A;  5M72 A;  4LDR A;  3S29 A;  1YVI A;  4HB5 A;  4U5F E;  5ENO D;  2PZI A;  1WAT A;  2VGX A;  4XEI G;  2EIK C;  3JUI A;  5FZT A;  3CR3 A;  3NOG D;  2J9U A;  2KM4 A;  3UXG A;  3DM9 B;  3VLE A;  2WL8 A;  1TEZ A;  3ML8 A;  2I8B A;  4GCO A;  1LIH A;  4FWV A;  1N9A A;  4FAP B;  3ZPJ A;  4MVR A;  2VCB A;  2XCB A;  3ZQV A;  2H6I A;  3Q7A A;  2EIL C;  5JS5 A;  2LSE A;  2PNO A;  5AQB A;  2YQ8 A;  2QTV A;  4HBD A;  4LLE A;  3KPH A;  3FU3 A;  2KZT A;  4BEP A;  1NU9 C;  3KYI A;  3N0T A;  2ILR A;  1WTY A;  3E32 A;  4BTA A;  2VTB A;  5AAR A;  4IAO A;  2Q4F A;  1I4Y A;  2XLE A;  4AJW A;  3DWW A;  3JTL O;  3CHS A;  2VAS A;  3B0P A;  3CZ6 A;  5G04 C;  3ZHE A;  5A23 A;  3GM3 A;  4LSZ E;  4MVO A;  2XGS A;  2KNH A;  1PD0 A;  3FHD A;  3SEO A;  1HF8 A;  2X6H A;  4GML A;  1YAU O;  1NG1 A;  2XRY A;  4IRU A;  4DBR A;  3MEK A;  2XS1 A;  2XEE A;  5A6J A;  4UQY A;  1ZHZ A;  4XPW A;  4MTF A;  3MV3 B;  3MYV A;  4M3O A;  1N95 A;  3B7U X;  3D9P A;  3QB2 A;  1UG3 A;  3LUT B;  3CHO A;  1TNB A;  2ION A;  4G2V A;  2L81 A;  2YLD A;  2V8S E;  1G4U S;  1WN0 A;  3VLF A;  4C0M A;  4AXH A;  1NL4 A;  1PAQ A;  5ENS D;  3EHQ A;  2OCC E;  3QWV A;  1LS1 A;  2HUJ A;  3DPD A;  5AGF A;  4L9P A;  4U5D E;  1CGN A;  2WPV A;  4RG6 A;  2XM4 A;  2WXJ A;  1QLE C;  4U95 D;  1HXI A;  3J06 A;  2XZT G;  4U0Z A;  5KYX B;  5FZQ A;  3VYW A;  3V5Z A;  1OCO E;  3QAQ A;  1E2X A;  4KNV A;  2P9I G;  5L0J A;  2J0X A;  4KVM A;  3CVQ A;  1SA5 A;  3KYJ A;  4MVU A;  4G7H F;  2GRP B;  3VRC A;  3ONL A;  3DJU B;  2UUI A;  3CSF A;  4AEZ C;  5EGY A;  5J90 A;  4XEF A;  4WWO A;  4JB8 P;  3ABL E;  3F47 A;  3KD7 A;  3CVX A;  2WXQ A;  3IBE A;  2L6G A;  2OCC C;  4KZC A;  2A6E F;  1LPE A;  2E87 A;  5FQ6 A;  4GA0 A;  1X81 A;  1RZ4 A;  3GW4 A;  3EGX B;  4JA7 A;  1OY3 D;  4D10 C;  3SGH A;  3HXB A;  2IM8 A;  3DJN B;  1CGO A;  2IBF A;  4CT0 A;  4C7O B;  1OCO C;  2IQC A;  3UMH A;  5F5H A;  1EPU A;  3C62 A;  5EYP F;  3ZVV A;  3FOP A;  5EKQ D;  3CHQ A;  1A7V A;  3APC A;  3CHM A;  5AC4 A;  2WXP A;  3DEP A;  2J8W A;  5C2Y A;  3SO8 A;  4KZ0 A;  4LLC A;  2AW6 A;  3UT8 A;  4V3I A;  3H2V A;  2A6H F;  2Q9B A;  4XTK A;  3DI5 A;  3IEG A;  1L7C A;  1OCR C;  1UG7 A;  2I1J A;  3I3N A;  4R7L A;  3PZ4 A;  3ZSU A;  3FH5 A;  5BV0 A;  3C8G B;  5KYN A;  3UMK A;  5L0G A;  4HFK B;  3PNT B;  1YMP A;  1KZP A;  2LAH A;  2Y3B A;  3LLI A;  5JUA A;  3APD A;  5JA4 D;  2NUP A;  2MWQ A;  2FUL A;  2OEV A;  2L6B A;  2QNL A;  3UGP A;  2PFD A;  4RSY A;  4KT6 B;  2C0M A;  1N4R A;  1D0X A;  1MMD A;  1DCE A;  4WNE A;  1KNY A;  1FCH A;  2QY7 A;  4DX5 D;  3Q7L A;  2XM0 A;  4UWL A;  2Y3H A;  5AAO A;  3RQE A;  1HMD A;  3CST A;  4BWR A;  3C72 A;  4GCN A;  4JHK A;  3AQC A;  4O7G A;  1G4W R;  4HXI A;  4GTV A;  1RKE A;  4DRI B;  3G2U A;  3E4B A;  1VB5 A;  4NY3 A;  4ONS A;  1M2V A;  4ABN A;  3L6A A;  1V55 C;  3X1O A;  5J08 A;  5ARG A;  4WAB A;  1IYG A;  4O6Y A;  4HRM B;  3IPM O;  3URZ A;  1O5H A;  2Q9A A;  4JXT A;  2XLM A;  2CCY A;  5JP7 A;  2HFI A;  2J09 A;  1LD8 A;  4GQH A;  5EIL A;  2QZA A;  2Y0B G;  3NZU A;  4GZD A;  2QYJ A;  3FEX A;  4UWH A;  3LEV A;  1A17 A;  1LE4 A;  1IQR A;  4ZLC A;  1MYO A;  4G24 A;  4PUC A;  3JXI A;  3JRT A;  3FUI A;  3TXM A;  4E17 A;  3E33 A;  4QI0 A;  3CK8 A;  2YLI A;  4CBE A;  3DXJ F;  1VYI A;  2NSF A;  3LDZ A;  2P9P G;  2LQG A;  3SNH A;  3T9K A;  5COG A;  4PAC A;  1Z3X A;  4Q4Z F;  1OW6 A;  5AQ7 A;  3FTS A;  1M56 C;  3CSK A;  1SW6 A;  2FBN A;  1BR1 A;  1TN6 A;  3EH2 A;  2XXA A;  5JJ6 A;  2DWZ A;  3V5Y A;  4CGV A;  1KU2 A;  5KYU A;  4U0S A;  2EQX A;  3CVN A;  4AP2 A;  4H7Y A;  2XLH A;  3D9L A;  3FUK A;  1H0A A;  3CQZ A;  1QNF A;  2GDC A;  2IFU A;  2UY1 B;  4IN3 B;  1MQS A;  1UJK A;  3MZL B;  3DXK G;  2AU5 A;  4B89 A;  4URK A;  2A0B A;  4NUR A;  3S90 A;  1E90 A;  2P61 A;  1PCX A;  4O6F A;  4XX5 A;  1OWP A;  2MYO A;  1MMN A;  3KMI A;  3KSL A;  4UWK A;  1N0Q A;  1ORY A;  4NTA A;  2TMV P;  3CK7 A;  1NFI E;  4K5A B;  3CAX A;  2HMZ A;  4JA9 A;  3GEI A;  4AE4 A;  4LDK A;  1S64 A;  1UW4 B;  3NAW A;  1IZM A;  4AX2 A;  4A4A A;  1E7V A;  4RDA A;  4DLO A;  1RJ9 A;  2PQN A;  5EYL A;  1CPR A;  2LFF A;  3S7D A;  5KJN A;  3DMD A;  4EBA A;  3GM2 A;  5F5F A;  5COF A;  2XEH A;  3D9I A;  4U63 A;  1SZ9 A;  1M2O A;  4UI9 J;  4APO A;  5A6B A;  2YL0 A;  2FFH A;  3DAG A;  2NUT A;  4IAQ A;  5BXU A;  3PVL A;  4XPY A;  1HY5 A;  5BQI A;  4CT4 A;  1FFH A;  2L7A A;  4I6G A;  1EA8 A;  5EX0 A;  2BUG A;  3LNM B;  4CS8 C;  1ZHT A;  1MHQ A;  2R17 C;  3PE3 A;  1LM3 B;  1BDJ B;  4E0H A;  3UUX A;  3HG0 D;  4M63 A;  3Q49 B;  4AOF A;  4G26 A;  2HS5 A;  1ELR A;  3J5Q B;  3APF A;  3RRM B;  4DOZ A;  3N71 A;  4DLQ A;  3GAN A;  2JD3 A;  1EQ1 A;  2OJQ A;  3ZXS A;  4MRU A;  3Q78 A;  3TGO A;  3EZH A;  1TKN A;  3LNR A;  1FR0 A;  1OUV A;  1R4T A;  4XZ4 A;  1Q0F A;  4HLL A;  1TNU A;  5EIB E;  1ZU2 A;  4U8V D;  3FUL A;  3S7B A;  4GPK A;  1YZC A;  3ZFW A;  4CDV A;  3FU5 A;  3UKU G;  4J30 B;  4U07 A;  2J0W A;  3AG3 E;  2CDQ A;  3SHF A;  1OCC E;  5KYY B;  3GEH A;  3ASF A;  1O87 A;  3N24 A;  3L17 A;  2LO6 A;  2J8S D;  5G04 J;  3ZVR A;  2IYL D;  2P7V A;  4GYO A;  1VLT A;  5D2M C;  2AXU A;  2X0C A;  3HIZ A;  2WXM A;  3C63 A;  1S63 A;  3ZKJ A;  2ETB A;  5DVW A;  3ZUV B;  3ZW3 A;  3LVR E;  4HRL A;  3VF0 A;  3QVZ A;  3CGH A;  3CIA A;  4BJT A;  2ZXP A;  3V7O A;  4BSZ B;  4DJ9 A;  4XQ1 A;  3DAF A;  3O48 A;  4L6R A;  1D0Y A;  1JPL A;  3LJ3 A;  3SZR A;  3AG3 C;  2EPK X;  3AAA C;  2LXL A;  4X0R A;  4PS3 A;  1RMV A;  4AIF A;  4OVU A;  4QDL A;  3QNK A;  3K6B A;  4E7Z A;  2WVN A;  3FVY A;  5A6A A;  1HZ4 A;  3LCA A;  2VSY A;  3BEE A;  3TQO A;  4NQF A;  1LKX A;  1Q0K A;  3SBS A;  2V4H C;  4NC3 A;  5D66 A;  4A3V A;  4ANU A;  4OAU C;  2AXZ A;  1ZHX A;  2QY9 A;  1E8Z A;  5KNG A;  3DZA A;  3TWW A;  3CVP A;  2Y4T A;  4CX9 A;  3ZYM A;  2IXN A;  3WXX A;  4G23 A;  4HNA D;  4P9T A;  1UOH A;  3ONK A;  1Y4C A;  2EIJ E;  2GFH A;  1FVH A;  4PJJ A;  3ZNG A;  3KKB A;  5ENR D;  3S9O A;  2XGM A;  2YVK A;  3ULQ A;  3FU0 A;  4F6R D;  4J7Y A;  2EPM X;  3Q7F A;  5FWQ A;  2DGJ A;  4XKC A;  3LKU A;  4HFF B;  4WNF A;  3JYS A;  2QFC A;  5EK0 A;  1HO8 A;  1ZW2 A;  1A7D A;  2LUH A;  3LVQ E;  4YDW A;  1LI5 A;  1WOL A;  5CMY A;  5BPP A;  4BG0 A;  4MKT A;  4U9E A;  5E2Q A;  3J5P A;  4CDN A;  3FTU A;  5HSW A;  2WQH A;  1ZB1 A;  3FTY A;  4JCH A;  1T6U A;  2EIJ C;  1O1T A;  3HXE A;  2HKV A;  2LSV A;  2XRZ A;  1H6O A;  2OVF A;  2GRO B;  3A9C A;  5KJK A;  1P5Q A;  2MYS A;  3UIO C;  3X2Q E;  4XKB A;  2IXO A;  1KZO A;  2VGE A;  4B94 A;  1JCQ A;  2H7V C;  3Q79 A;  5CI9 A;  3SD5 A;  5JJ7 A;  2WZL A;  1VDY A;  3QMK A;  1HW1 A;  3HXD A;  4TXQ A;  1HE8 A;  3DEO A;  4M7C A;  5G55 A;  1IXV A;  1H9G A;  3LPZ A;  1BR4 A;  5B1A E;  4K1O A;  2KYH A;  4AV7 A;  4RQI A;  4UUC A;  1IW7 F;  2J45 A;  3FDH A;  3AJI A;  3QTH A;  3AS5 A;  2KGO A;  4I1A A;  4AL1 A;  2J9W A;  3G2T A;  3ZG1 A;  3C7J A;  3HKK A;  3RVY A;  4P6I C;  3LS8 A;  2YIN A;  4I2W A;  3S2A A;  1HE1 A;  2OJE D;  1ZZP A;  3NYL A;  3X2Q C;  2LIG A;  3Q7G A;  1DOV A;  1TJC A;  2L0I A;  2J9Q A;  1Z6A A;  3PHF 2;  3ESK A;  2KCK A;  4BPM A;  4TXR A;  5BQG A;  1B68 A;  3I4G A;  4J8S A;  2AWY A;  2L6F A;  2F8Y A;  4PK4 A;  1NFO A;  1K3Z D;  3O55 A;  4GU5 A;  1FPP A;  4GPM A;  2EIK E;  2LP4 A;  3DSV A;  1BI8 B;  1YDI A;  5B1A C;  4KNW A;  3HDX A;  2J46 A;  4K0D A;  2VSN A;  4DX1 A;  1LE2 A;  5E3C A;  4G7O F;  2CNW A;  4MND A;  3NZS A;  3QKY A;  2AP3 A;  1U2V G;  3R7Q A;  1E8Y A;  3PRZ A;  3ABM C;  4I1M A;  3W8I A;  1S0P A;  3HNL A;  1K8K G;  1NFN A;  3L16 A;  4WWN A;  1NZE A;  3PDN A;  5KYX A; 
#chains in the Genus database with same CATH homology
 2I6H A;  3O39 A;  3AG1 C;  5DIZ A;  2WM9 A;  4XIF A;  5E76 A;  4FAD A;  3H65 A;  4LUN U;  3RFY A;  2DCP A;  2IOQ A;  3ASH A;  2DYR C;  2L9J A;  4LRZ A;  4LAC B;  4GYW A;  3LYA A;  3FDQ A;  2WZG A;  3MJW A;  3OXL A;  1Z23 A;  4FC8 A;  5EX3 A;  3KAE A;  3ASD A;  3EGX A;  5JHB A;  2AXV A;  3ASO C;  4BX8 A;  3PEU B;  4ULW A;  4C7O A;  5L3Q A;  1UJJ A;  4CDR A;  4I9C A;  4U5E E;  5BV1 A;  1ELK A;  4WJ0 A;  4YJW A;  2LAI A;  3D9O A;  2BE5 F;  1Z3Y A;  4LER A;  3NF1 A;  2V0P A;  4FLB A;  2Q3T A;  4W8K A;  4C3D A;  4F53 A;  4O6N A;  4DVZ A;  4FUL A;  3EH1 A;  3EG9 B;  2FGY A;  1N54 A;  1M57 C;  2CFZ A;  2NC9 A;  1W3B A;  2MOW A;  1MNE A;  5A7D B;  2J7P D;  5KYW B;  3AU4 A;  4RD9 A;  1TWG A;  2NSZ A;  1H6K A;  2FF4 A;  1WY6 A;  5T3R A;  4XE0 A;  1HH8 A;  4J8F A;  1ZHW A;  4ZLD A;  4HOR A;  3RO2 A;  1HG2 A;  1S7Z A;  2A4Z A;  4I6J A;  3L08 A;  2WXL A;  3QAR A;  4NRH B;  1SMY F;  3K1H A;  1PC2 A;  3I4U A;  1H2V C;  3L13 A;  5AEN A;  3Q47 B;  3PS6 A;  4KVO A;  3EJN A;  3QDN A;  2CGE A;  2V26 A;  4HEA J;  3OXF A;  4I1O B;  3AG4 C;  2R5S A;  3K9I A;  3D9N A;  2J9V A;  2W4B A;  5B1B C;  4ILG A;  2PF4 E;  5CI8 A;  2OV8 A;  5LFA A;  5T1D B;  2I1K A;  4UWF A;  4CCA A;  1FMW A;  4KBL A;  3K1I C;  1HS6 A;  2W45 A;  3PRE A;  4I2Z A;  1VOM A;  3E70 C;  2VYI A;  3QC1 A;  3RKV A;  3L34 A;  4F4B A;  3RKO F;  5B3S C;  2FEZ A;  2VGX B;  4C0E A;  3NKD A;  1J8M F;  2GW1 A;  3R9A B;  1E96 B;  4DI3 A;  3I5Q A;  4OD4 A;  2V5F A;  3CHR A;  4N39 A;  4KMO A;  2KCL A;  5IY5 C;  3T4R A;  4HOT A;  5FJY A;  3WOD F;  1TJF A;  2OG2 A;  2UY1 A;  3PUJ A;  3FH8 A;  1NP7 A;  4BEJ A;  4OD5 A;  3K66 A;  4N5C A;  3DM5 A;  3CLJ A;  1INZ A;  4AK9 A;  3FUF A;  2J08 A;  4H4K C;  1D1A A;  5JHA A;  3SYN A;  4FX5 A;  2VSO E;  2XPI A;  1SF8 A;  4FHJ A;  3OWT A;  3MA5 A;  4B0Z A;  2WXK A;  3ZN3 A;  4EBB A;  3LES A;  1TWA A;  2A68 F;  1NA3 A;  5KJM A;  2HV6 A;  2R7O A;  1Z3I X;  3VTX A;  1NZN A;  2OND A;  4U8H A;  3I4R B;  2PM7 A;  2WXO A;  2B0J A;  4JVS A;  2C03 A;  5C1D A;  2G3V A;  4HLE A;  4BJ5 A;  3FFL A;  4YT5 A;  3D9K A;  4LEU A;  2R59 A;  3ZEF A;  5DQZ A;  1E8X A;  4YVQ C;  1ST6 A;  1ZBP A;  3TD7 A;  2FI7 A;  3F46 A;  4WND A;  4APF A;  4KC9 A;  3POV A;  4AY6 A;  5BW8 C;  2H7O A;  2HV7 A;  5BUO A;  4DPR A;  4EEC A;  1KLX A;  1L5J A;  2UWJ G;  5HQ8 A;  4ANV A;  5KJL A;  1YA0 A;  3E9V A;  1WAO 1;  5KYY A;  2CW0 F;  3ABK C;  3CHP A;  3QWP A;  4BJ5 C;  1HFA A;  2WVO A;  4Y6C A;  1OKK A;  3VTY A;  1OWM A;  2Q9C A;  3NRH A;  2KCV A;  4Q7C A;  2ZXR A;  3OXG A;  3D3M A;  1ZHY A;  2VH3 A;  2WXG A;  1J8Y F;  3ZYK A;  4BFR A;  4MQ9 F;  3SP1 A;  3GZ2 A;  3TG5 A;  4CDM A;  5E33 A;  2Y4U A;  1JPJ A;  3UQ3 A;  4CSA A;  2Y3A A;  2R7R A;  3MCX A;  2W4M A;  4OYS A;  2CHZ A;  3LXU X;  5CMW A;  2Y39 A;  2A5U A;  4LCT A;  2KJG A;  2WB7 A;  1OCZ C;  2C0L A;  3AS8 A;  2M4E A;  2LNI A;  4EPZ A;  4QFV A;  3ML9 A;  2WVI A;  3SBT B;  5HI7 A;  2X6I A;  2VGY A;  1N1C A;  3HVE B;  4PFP A;  2KW3 C;  3ZIM A;  3K33 A;  4IYP A;  5ANR A;  1KT0 A;  3LS1 A;  1OWO A;  3U4T A;  4PFO A;  1B89 A;  3IKO B;  4GA1 A;  4G25 A;  3MKQ A;  3RRN B;  5CCM A;  2EIM C;  2MHK A;  2GRM A;  3FUM A;  3FTX A;  1EDU A;  4GAA A;  4I43 A;  4DK5 A;  2M63 A;  1HG5 A;  1VK5 A;  4F7A A;  3U9W A;  2R7Q A;  3ITF A;  5DLJ A;  4EZK A;  2J4B A;  5LX8 A;  4JEU A;  3WG7 C;  3NYJ A;  3OTN A;  3FH7 A;  4UI9 K;  4PS8 A;  3FP3 A;  3LY7 A;  3ASG A;  4CEM A;  2X6K A;  3CVW A;  1ZU4 A;  2FO7 A;  5FTP A;  3EZI A;  1FTS A;  2D5R B;  1HX8 A;  3G2S A;  4DJA A;  4CS9 A;  5AIJ A;  2E0I A;  2I9C A;  4IJJ A;  1H19 A;  1UN8 A;  3EHN A;  4C3E A;  4B6I A;  1E8W A;  2EIN C;  2WB2 A;  1NA0 A;  4BJ1 A;  3FUJ A;  4C3B A;  4L23 A;  2CG3 A;  2P58 C;  1D1B A;  3KH2 A;  4AM9 A;  3UR3 C;  2AVP A;  2NUT B;  4OVV A;  3FUN A;  2DYS C;  4JHR A;  1JWG A;  2IJG X;  3MX3 A;  2WXN A;  2YHC A;  2DIW A;  3ZIB A;  1BPO A;  5BT1 A;  3S7F A;  4CS9 C;  4XWJ A;  4KI2 A;  2CFU A;  2HYZ A;  3Q4A B;  4L2Y A;  3AQB A;  2R7U A;  2A69 F;  4NQ0 A;  3GZ1 A;  4C9B B;  1MMA A;  4I44 A;  3T5X A;  1SZI A;  3EFO B;  1IQU A;  3NKE A;  3IV0 A;  3D9M A;  5JJT A;  3B7R L;  5BNW A;  3UGO A;  3U64 A;  2ZXW C;  3T6B A;  3QK0 A;  3HTK C;  3W2W A;  4BJ6 A;  5FQ7 A;  5KYW A;  1FVF A;  1XGW A;  3AG2 C;  2VQ2 A;  4YVO A;  5LOZ A;  1Y6I A;  4YWQ A;  2MRI A;  4JJG A;  2HM8 A;  3P1U A;  3EGD B;  2XPY A;  3FTZ A;  3FUE A;  4JZY A;  3W8H A;  1V54 C;  4FHK A;  4WNG A;  3TG4 A;  3T6J A;  4UQZ A;  1PD1 A;  4GZC A;  3QZC A;  4BTB A;  2C04 A;  3P2B A;  2Y69 C;  2OVB A;  2CG2 A;  3O4Z A;  4E85 A;  4B8C B;  2O9X A;  4BJ6 C;  3B9Q A;  2W9Y A;  3B0U X;  3CKC A;  4Q5S F;  4BX9 A;  3U3W A;  4I17 A;  4A55 A;  3FTW A;  3CEQ A;  2GRL A;  4GYT A;  4EZJ A;  3EQL F;  3RJV A;  4U04 A;  3JQ1 A;  5LP0 A;  4E7S A;  4F3V A;  2YNQ A;  4GA2 A;  4HOQ A;  3B0V C;  4JPS A;  3U66 A;  4RG9 A;  4XLP F;  4U5H A;  4A1G A;  4GZ5 A;  3PZD A;  5ENN A;  2G62 A;  4DVY P;  4GYY A;  3B7S A;  5G05 C;  2WQ7 A;  1PY1 A;  4QI2 A;  4A1S A;  4J0U A;  2IOL A;  5D0Q D;  4ANX A;  3CVV A;  4XI0 A;  1EYH A;  5FCL A;  1TR2 A;  1D0Z A;  1ZYR F;  3DD7 A;  3B13 A;  2R7S A;  3G2W A;  3ECS A;  2CHX A;  3UNG C;  5A6C A;  3EIJ A;  5D92 A;  1OWL A;  3NG1 A;  5DS4 A;  2XL4 A;  2ZXO A;  5FT9 A;  1WM5 A;  3SI5 A;  3ZC4 A;  3W2V A;  2YHE A;  3PE4 A;  1UN9 A;  1G8X A;  1QQE A;  4Q69 A;  5E3A A;  3CKB A;  4K7B A;  4PJM A;  2XCC A;  3CK9 A;  2X38 A;  2CNW D;  5DQT A;  4DBQ A;  3C98 A;  4I9E A;  5CCL A;  3QOU A;  3KS2 A;  4XI9 A;  1U3C A;  3M1C B;  1N52 A;  2VB6 A;  4BSX A;  4A3T A;  4TV3 A;  4FA6 A;  2JEK A;  3CQG B;  2Y3D A;  4Q96 A;  3L54 A;  4L1B A;  3UX4 A;  2PL2 A;  4O79 A;  3AS4 A;  2WMN A;  4PH4 B;  1E7U A;  1DNP A;  1XNF A;  3RK6 A;  5G2N A;  3NYM A;  4PJN A;  4RVB A;  4ME2 A;  5DS5 A;  3I5P A;  3IHV A;  3CV0 A;  2ZU6 B;  4FJZ A;  4AY5 A;  2WXR A;  4JZA A;  4CS7 A;  4BY6 A;  2H7B A;  4JEH A;  1IHG A;  4FP7 A;  2WVQ A;  4B8A A;  1ZU5 A;  2X6F A;  3FAJ A;  2J07 A;  2KC7 A;  3LJB A;  2KZT B;  2IOS A;  3Q6M A;  4H7X A;  4J6I A;  2VTB B;  5AJD A;  3RRU A;  4GB9 A;  3ABL C;  4CIH A;  3PMR A;  2JLB A;  4BT8 A;  3ZHE B;  2PP4 A;  3RIB A;  3CVY A;  2V3C C;  4I6E A;  1JUQ A;  2YZS A;  3RIP A;  3FU6 A;  3PEV B;  1SQM A;  3SF4 A;  4FES A;  5L3V A;  3EIQ C;  2Y3G A;  3ZYL A;  3MKR A;  4W9R A;  3UPV A;  5LCW C;  4UWG A;  5AJL A;  4GEH A;  2R7V A;  2LSU A;  3PUK A;  4YN0 B;  2J4D A;  1FFT C;  3PH0 C;  3FHE A;  4DI4 A;  2WXF A;  2Q7F A;  4RBN A;  2KQ9 A;  3DBS A;  3HVE A;  2NG1 A;  4IWB A;  4K0R A;  3NQP A;  3IHY A;  4JUR I;  3CVU A;  3LEW A;  5D91 A;  3Q6N A;  2KAT A;  4TRQ A;  5EHH A;  3CQC B;  4L2L A;  2PX0 A;  1Z5Z A;  3GYZ A;  3ASN C;  3SFZ A;  1X5B A;  4CRW A;  3HYM B;  3MGB A;  1TWC A;  2DBA A;  3FEY A;  4JHJ A;  4FJY A;  5BUZ A;  4CGW A;  4O6M A;  4JC8 A;  4J8E A;  3UT4 A;  3JQ0 A;  3Q15 A;  2A1D D;  3OA1 A;  3VAY A;  4YT8 A;  3KEZ A;  3AU5 A;  3UMI A;  2WZF A;  4GZ6 A;  4JL0 A;  3OAW A;  4N3B A;  1JWF A;  2RD0 A;  2XEV A;  4U5B E;  1JPN A;  3FUH A;  3N2Z B;  4G7Z F;  4E6H A;  4J32 B;  4N2S A;  1DVP A;  2WXH A;  3O6X A;  2XRH A;  4CS8 A;  3HJC A;  3JT1 A;  1LVK A;  2IU1 A;  2NUP B;  3S28 A;  4G0H A;  4PJL A;  1Y8M A;  2X51 A;  5FQ4 A;  5D0O D;  4FLH A;  4F1S A;  1H2U A;  1QZ2 A;  2IXM A;  4N06 A;  4NAC A;  4GZ3 A;  4U5C E;  2RG8 A;  5T8I A;  2XSE A;  1HU3 A;  4HVB A;  4N2Q A;  2HR2 A;  3RO3 A;  4OIP F;  2YHS A;  3MV2 B;  1VYK A;  4A2N B;  3TXN A;  4CSA C;  1M2V B;  2XPZ A;  3HLZ A;  2XHE A;  3BG1 B;  3LY8 A;  4EBA G;  2BTD A;  5DBK A;  4ANW A;  2L6J A;  5T3T A;  2HO1 A;  1H2T C;  2PM6 A;  4Q94 A;  5G05 J;  4K03 A;  1D1C A;  3FTV A;  3R7R A;  5E75 A;  2L9B A;  1W2W A;  5DS6 A;  5T3W A;  4KXK B;  4G11 A;  3B7T A;  2G3K A;  3EFO A;  3JCK C;  4HS2 A;  4PDX A;  3FWV A;  2XXA B;  1OKK D;  3UMV A;  3VLD A;  5KYU B;  3TL5 A;  3TAX A;  2R7W A;  3FUD A;  4EWC A;  3LLK A;  5AYW D;  3RH3 A;  3NDB B;  4U5G A;  4WAF A;  2IF4 A;  2WQ6 A;  4ATG A;  5FQ8 A;  3EHM A;  4YND A;  3EGD A;  1EF1 C;  3LAY A;  2VJ8 A;  2IXP A;  2I2O A;  4JJF A;  4YT4 A;  5CHE E;  4WUY A;  3D9J A;  1TWH A;  3SNX A;  2VSX E;  4HOU A;  4AE4 B;  1OCC C;  4BT9 A;  2E2E A;  2XGO A;  1RJ9 B;  1QZX A;  4OIO F;  3EDT B;  2AWI A;  4PS7 A;  3S0X A;  1U3D A;  4JW1 A;  3BG0 B;  5EDS A;  3L22 A;  4L7T A;  4N3C A;  5FZR A;  4P29 A;  3EPV A;  3ESL A;  1FMV A;  2P6V A;  2R7T A;  1Z6T A;  1OWN A;  4I3M A;  4OIN F;  1NU7 D;  4YT2 A;  1Z63 A;  3UT7 A;  4EQF A;  4HE8 D;  4ANJ A;  3S7J A;  4OIR F;  4ACL A;  4TUU A;  1MND A;  4IUL A;  3GZS A;  3ZRH A;  1WGW A;  4AVX A;  4GMJ A;  1BR2 A;  5T4Y A;  4ILI A;  4G1T A;  2Z15 A;  3MKQ B;  3S27 A;  3IEE A;  2ZPA A;  5ANL A;  1ELW A;  3QWW A;  5FZS A;  3L0I A;  2NXP A;  4N3A A;  3GOD A;  3LY9 A;  3EG9 A;  3Q5M A;  2X3M A;  3SZ7 A;  4MLP A;  2OOE A;  3QJZ A;  1LF8 A;  4MS6 A;  3JYH A;  2R7X A;  4U0U A;  4ACK A;  3T5V A;  4KYO B;  3T8M A;  4ILH B;  3RU0 A;  2J7P A;  3KL4 A;  2L0T B;  3ZYQ A;  5LCW J;  2J49 A;  4FU3 A;  2PQR A;  4UQX A;  4EZL A;  3RYL A;  1MMG A;  1VMA A;  3HHM A;  3FY4 A;  1SZA A;  3TJP A;  2WMO A;  3G2V A;  2YEV A;  3MLG A;  3JSZ A;  2V4L A;  2BF0 X;  4HOS A;  3ENE A;  4J8D A;  4WWP A;  2GGF A;  2PX3 A;  2CHW A;  3LS0 A;  2WXI A;  4Y6W A;  5KCM A;  4OIQ F;  3ZGQ A;  4HFG A;  4KBQ A;  2C2L A;  3PNL B;  1KT1 A;  4XLN F;  1GW6 A;  3K7D A;  4UI9 C;  2X6J A;  5ARF A;  3JCU Q;  2XQ0 A;  3OEO A;  3CVL A;  5M72 A;  3S29 A;  4U5F E;  2PZI A;  2VGX A;  2EIK C;  3JUI A;  3CR3 A;  2J9U A;  2KM4 A;  3DM9 B;  3VLE A;  2WL8 A;  1TEZ A;  3ML8 A;  2I8B A;  4GCO A;  4FWV A;  3ZPJ A;  2XCB A;  2EIL C;  2LSE A;  2YQ8 A;  2QTV A;  4LLE A;  3FU3 A;  2KZT A;  1NU9 C;  3N0T A;  2ILR A;  2VTB A;  4BTA A;  4IAO A;  4AJW A;  3CHS A;  2VAS A;  3B0P A;  3CZ6 A;  5G04 C;  3ZHE A;  5A23 A;  2XGS A;  2KNH A;  1PD0 A;  3FHD A;  3SEO A;  1HF8 A;  2X6H A;  4GML A;  1NG1 A;  2XRY A;  4IRU A;  4DBR A;  3MEK A;  4UQY A;  1ZHZ A;  3MYV A;  3MV3 B;  4M3O A;  3B7U X;  3D9P A;  3QB2 A;  1UG3 A;  3CHO A;  2ION A;  4G2V A;  2L81 A;  2V8S E;  3VLF A;  4C0M A;  4AXH A;  1PAQ A;  3QWV A;  1LS1 A;  3DPD A;  4U5D E;  2WPV A;  4RG6 A;  2WXJ A;  1QLE C;  1HXI A;  4U0Z A;  5KYX B;  5FZQ A;  3VYW A;  3QAQ A;  4KNV A;  2J0X A;  4KVM A;  3CVQ A;  4G7H F;  3ONL A;  3DJU B;  3CSF A;  4AEZ C;  5EGY A;  5J90 A;  4WWO A;  3F47 A;  3KD7 A;  3CVX A;  2WXQ A;  3IBE A;  2OCC C;  4KZC A;  2A6E F;  2E87 A;  5FQ6 A;  4GA0 A;  3GW4 A;  3EGX B;  4JA7 A;  4D10 C;  3SGH A;  4CT0 A;  3DJN B;  4C7O B;  1OCO C;  2IQC A;  3UMH A;  5F5H A;  1EPU A;  3ZVV A;  5EKQ D;  3CHQ A;  3APC A;  3CHM A;  2WXP A;  5C2Y A;  4KZ0 A;  4LLC A;  2AW6 A;  3UT8 A;  4V3I A;  2A6H F;  2Q9B A;  4XTK A;  3IEG A;  1OCR C;  2I1J A;  3I3N A;  4R7L A;  3ZSU A;  3FH5 A;  5BV0 A;  5KYN A;  3UMK A;  4HFK B;  3PNT B;  2LAH A;  2Y3B A;  3LLI A;  3APD A;  2NUP A;  2MWQ A;  2FUL A;  3UGP A;  2PFD A;  4RSY A;  4KT6 B;  2C0M A;  1D0X A;  1MMD A;  4WNE A;  1FCH A;  2QY7 A;  3Q7L A;  4UWL A;  2Y3H A;  3CST A;  4BWR A;  4GCN A;  4JHK A;  3AQC A;  4O7G A;  4HXI A;  3G2U A;  3E4B A;  4NY3 A;  1M2V A;  4ABN A;  3L6A A;  1V55 C;  3X1O A;  5J08 A;  5ARG A;  1IYG A;  4O6Y A;  3URZ A;  1O5H A;  2Q9A A;  4JXT A;  2J09 A;  3NZU A;  4GZD A;  3FEX A;  4UWH A;  3LEV A;  1A17 A;  1IQR A;  4ZLC A;  4PUC A;  4G24 A;  3JRT A;  3FUI A;  3TXM A;  4QI0 A;  3CK8 A;  4CBE A;  3DXJ F;  1VYI A;  3LDZ A;  3SNH A;  1Z3X A;  4Q4Z F;  3FTS A;  1M56 C;  3CSK A;  2FBN A;  1BR1 A;  3EH2 A;  2XXA A;  5JJ6 A;  4CGV A;  1KU2 A;  5KYU A;  4U0S A;  2EQX A;  3CVN A;  4AP2 A;  4H7Y A;  3D9L A;  3FUK A;  1H0A A;  3CQZ A;  1QNF A;  2IFU A;  2UY1 B;  4IN3 B;  1MQS A;  1UJK A;  3MZL B;  4B89 A;  4URK A;  4NUR A;  1E90 A;  1PCX A;  4O6F A;  4XX5 A;  1OWP A;  1MMN A;  3KMI A;  4UWK A;  3CK7 A;  4JA9 A;  4AE4 A;  1UW4 B;  1IZM A;  4AX2 A;  1E7V A;  4RDA A;  4DLO A;  1RJ9 A;  2PQN A;  3S7D A;  5KJN A;  3DMD A;  4EBA A;  5F5F A;  3D9I A;  4U63 A;  1SZ9 A;  1M2O A;  4UI9 J;  4APO A;  2FFH A;  3DAG A;  2NUT A;  3PVL A;  4CT4 A;  1FFH A;  4I6G A;  5EX0 A;  2BUG A;  4CS8 C;  1MHQ A;  1ZHT A;  2R17 C;  3PE3 A;  3UUX A;  4M63 A;  3Q49 B;  4AOF A;  4G26 A;  1ELR A;  3RRM B;  3APF A;  4DOZ A;  3N71 A;  4DLQ A;  3GAN A;  2JD3 A;  3ZXS A;  4MRU A;  3TGO A;  3EZH A;  1TKN A;  3LNR A;  1OUV A;  4XZ4 A;  1ZU2 A;  3FUL A;  3S7B A;  4GPK A;  3ZFW A;  3FU5 A;  4J30 B;  4U07 A;  2J0W A;  2CDQ A;  3SHF A;  5KYY B;  3ASF A;  1O87 A;  3N24 A;  3L17 A;  2LO6 A;  5G04 J;  3ZVR A;  2IYL D;  2P7V A;  4GYO A;  2AXU A;  3HIZ A;  2WXM A;  5DVW A;  3ZW3 A;  3LVR E;  3CGH A;  3CIA A;  4BJT A;  2ZXP A;  3V7O A;  3DAF A;  3O48 A;  1D0Y A;  1JPL A;  3LJ3 A;  3SZR A;  3AG3 C;  4X0R A;  4PS3 A;  4AIF A;  4OVU A;  4QDL A;  3QNK A;  3K6B A;  4E7Z A;  2WVN A;  3FVY A;  1HZ4 A;  3LCA A;  2VSY A;  3BEE A;  1LKX A;  3SBS A;  4A3V A;  4ANU A;  2AXZ A;  1ZHX A;  2QY9 A;  1E8Z A;  3DZA A;  3CVP A;  2Y4T A;  3ZYM A;  2IXN A;  3WXX A;  4G23 A;  3ONK A;  2GFH A;  1FVH A;  4PJJ A;  3KKB A;  2XGM A;  3ULQ A;  3FU0 A;  5FWQ A;  2DGJ A;  4XKC A;  3LKU A;  4HFF B;  4WNF A;  3JYS A;  2QFC A;  1HO8 A;  3LVQ E;  5CMY A;  5BPP A;  4BG0 A;  4MKT A;  5E2Q A;  4CDN A;  3FTU A;  5HSW A;  2WQH A;  3FTY A;  4JCH A;  2EIJ C;  2LSV A;  2XRZ A;  2OVF A;  5KJK A;  1P5Q A;  2MYS A;  4XKB A;  2IXO A;  4B94 A;  2H7V C;  5CI9 A;  3SD5 A;  5JJ7 A;  2WZL A;  1VDY A;  3QMK A;  1HE8 A;  5G55 A;  3LPZ A;  1BR4 A;  4AV7 A;  1IW7 F;  2J45 A;  3FDH A;  3AS5 A;  2KGO A;  4I1A A;  2J9W A;  3G2T A;  3ZG1 A;  3LS8 A;  4P6I C;  2YIN A;  4I2W A;  3S2A A;  3NYL A;  3X2Q C;  3Q7G A;  1TJC A;  2L0I A;  2J9Q A;  1Z6A A;  3PHF 2;  3ESK A;  2KCK A;  3I4G A;  4J8S A;  4PK4 A;  4GU5 A;  5B1A C;  4KNW A;  3HDX A;  2J46 A;  4K0D A;  2VSN A;  5E3C A;  4G7O F;  2CNW A;  4MND A;  3NZS A;  3QKY A;  3R7Q A;  1E8Y A;  3PRZ A;  3ABM C;  4I1M A;  3W8I A;  1S0P A;  3L16 A;  4WWN A;  1NZE A;  3PDN A;  5KYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...