3X1OA

Crystal structure of the roq domain of human roquin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
151
structure length
149
Chain Sequence
QQLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Roquin-1
publication title Roquin binds microRNA-146a and Argonaute2 to regulate microRNA homeostasis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 53
structure length 149
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3x1oA00
4ZLCA 4YWQA 4ZLDA 5F5HA 4QI0A 4QI2A 5F5FA 3X1OA 4ULWA
chains in the Genus database with same CATH superfamily
5EGYA 2J9WA 3HNJA 5KYWB 2HSBA 4WABA 4E7SA 1D0ZA 2KC3A 2CGEA 4G78A 3RKOF 4JTDB 1M6TA 2Y3HA 1C17M 5K0IA 3RFYA 4G7ZF 3B29A 2TMVP 1ORYA 1NLXA 3EJNA 3TD7A 3DAGA 3TQOA 2HMQA 4AE4A 4HE8D 1HE1A 4DVZA 4N6CA 3B0UX 1QSPA 4XTKA 4MTFA 3RF3A 2Q3TA 1FTSA 1OKKA 4AE4B 4MVMA 4ULVA 2R7SA 4JC7A 1H9GA 3L1MA 3U9MA 2YLDA 4YT5A 1EA8A 4BJ5A 4FWVA 2RSEB 5B1BC 1E83A 4Q7CA 2QY9A 5CIVA 3GODA 4DOZA 2JX0A 5EHHA 2KNHA 4BPMA 1JOGA 3ASNC 2IXOA 2W4BA 2DB4A 2L7AA 2OEVA 2XS1A 2EPMX 3DJUB 3EPVA 3TOMA 1YA7O 1OKKD 2YQYA 3AGUA 3EHNA 4K1OA 3SXMA 3MLGA 2XL4A 3EH2A 3NMJA 1QQ3A 1TKNA 3QW0A 4WJ0A 3LNRA 4XLNF 3UMHA 1YARO 1M2VA 3KPHA 3WHNA 1OXBA 4D4NA 4MW8A 4NCQA 4HFFB 2HFIA 1BDJB 1K04A 1TFOB 2CW0F 4YJWA 4MVQA 1M2VB 3KMIA 3C63A 4JE9A 4U5DE 4D4XA 3L8IA 3M4BA 3DD7A 4YT2A 3DKAA 4G7OF 2LIGA 3AOUA 4I1OB 5F5HA 3U3FA 2OQMA 4JW1A 1SMYF 5DS6A 2OG2A 5B3SC 2EPOA 1JPJA 4N4WA 2Z15A 1WOLA 4EBBA 3A11A 4A2NB 5L3VA 1A41A 3AGTA 5DS4A 4XPYA 3HJCA 5BQHA 3FDQA 4JVSA 2A1DD 4CS7A 3L8JA 1CGME 5DQZA 1ZVZA 4XEKA 5IY5C 1L7CA 5T3TA 3LUTB 2R7VA 4DJ9A 2ETSA 5E3AA 2KJGA 3EG9B 3Q6MA 3QW1A 2FAPB 2J8WA 2YL1A 5E3CA 1U0BB 3QMKA 1TR2A 1VYKA 2XL6A 3I5QA 3B9QA 2YEVA 2RD9A 4CDAA 3LS0A 3OWTA 4LDRA 4E0IA 1LVKA 2WVNA 2OKUA 5L0JA 3G4ZA 1NFNA 2IXNA 2HS5A 2VH3A 3JZ0A 3LAYA 4K0DA 1BR2A 3GM1A 1OW8A 4LDQA 3V7OA 3UGOA 1RKEA 4ER9A 4DXWA 3PHF2 2A68F 1OW6A 3M4CA 4E7ZA 2W4MA 2HSQA 3QVYA 1GQAA 1RKEB 3NYMA 4JCZA 4ONSA 5E2QA 3TK0A 2C04A 1HE9A 1D0XA 2V26A 5COMA 2R7OA 3JYYA 3PCVA 1RJ9A 3AG1C 5AC5A 1E85A 2GWWA 3OA1A 4WGYA 5B3IA 1NBBA 1RJ9B 1JRAA 3GANA 3K6BA 4P9FA 4BEMJ 1ZU5A 2L9JA 4MW3A 4CS8A 5DS5A 2QUPA 1KTMA 1L3PA 4ZLDA 4IB4A 3U8VA 1T9KA 5JUAA 4PJNA 3N0TA 3LS1A 4AL0A 4AX2A 2QE9A 4JTAB 1MNEA 2YHSA 2VASA 3NG1A 1FMVA 3C8ZA 5JSLA 2IM8A 3GM3A 3DM5A 4JEAA 2R05A 4CJGA 3PMRA 3SZRA 5BQIA 2HZ8A 4C3DA 3F46A 4J7YA 1LI5A 1GGQA 1V4AA 1ST6A 2D5RB 1HMOA 1RXQA 5EK0A 2P61A 3ATPA 4PK4A 1G8XA 1VMAA 4RD9A 5COFA 3A9CA 4DRJB 4IARA 4DRIB 4EIYA 2O9XA 4N6HA 4Z9IA 3ZTMA 4AK9A 4IRUA 2XLEA 5GPGB 2CCYA 4JIOA 3SNHA 3X1OA 1EQ1A 1YZCA 4L6RA 4CS9C 1TQGA 1VOMA 2LFFA 2XLHA 1LPEA 1U89A 2G62A 3BEHA 1ZHYA 2ZXRA 1ZW2A 1O5HA 5JP7A 2F22A 3JSEO 3M79A 3US6A 1Z3IX 2Q9CA 4JURI 3W2WA 1Z5ZA 2Q9BA 3IPMO 3MFNA 3RQEA 3WAQA 1YLMA 5A6BA 2IOQA 2P1AA 3AQBA 3W8IA 1MNDA 3B0PA 3S28A 2Y39A 3KYJA 2C03A 5KYUA 3TOLA 1VYIA 2YRFA 4YT8A 5HV9A 5HSWA 5KYUB 1OW7A 3MBGA 4W8PA 4EHPA 3S0XA 2EIKC 2VCAA 1R5ID 2XLWA 3HNIA 5F28E 1JR8A 3IQ6A 1UFBA 5A6BD 4J30B 3T9OA 4JCHA 4O6MA 3R7CA 3C8GA 3JRTA 3J06A 1ZU4A 5FZTA 1PD1A 5A6AA 4YN0B 1BBHA 4OIOF 3O55A 4IGGA 4N06A 3FAPB 2EPLX 1LM3B 2H7BA 1NFOA 3K66A 3Q6NA 3NMIA 1Y6DA 3R2PA 4J32B 4OIQF 2DYRC 3MYFA 4MTGA 2WZLA 3HLZA 1OQCA 1E84A 2GDCA 2GAQA 4G7HF 3C8GD 3ZDLA 1IW7F 3HNKA 5L0DA 4CSAA 3POVA 2J46A 1WTYA 2OEXA 1SYQA 3IQ5A 4H4KC 4CBEA 2L6FA 2YZSA 3ZWIA 3ZVRA 1ZW3A 1CGOA 2LQGA 2M64A 3DMDA 2WL8A 1J8YF 2MWQA 4MNDA 4MVOA 3EGDA 3O6XA 3LLIA 4U5CE 3U5SA 1FFTC 4ZLCA 3EGDB 1GM5A 2LP4A 3LJBA 4GEHA 2VCBA 4JJFA 2UUHA 3RVYA 5JLIA 2LD6A 1E2XA 1OCOC 1QVXA 2CNWA 2KYHA 4I1MA 2V3CC 2PX3A 1OR2A 3CQZA 3JTLO 2NUTA 1DOWA 5L0CA 3U9JA 3AJMA 4BJ6A 3K1IA 3JYHA 3JSZA 1KU2A 2NUTB 4K7BA 4HEAJ 1RKCA 1XZQA 3UNGC 4F4BA 3W8HA 2AVKA 5E33A 3W2VA 3U0CA 2Y3DA 2AWCA 1MMAA 3HKKA 4LERA 3ZSUA 5L3QA 3EZHA 2YL3A 2CNWD 4LLEA 4M63A 1WN0A 4CJOA 3EH1A 1T6QA 3ZIBA 2EIMC 3CZ6A 4UDVA 1D1CA 4YWQA 2B0HA 1A7VA 4XEVA 4KNWA 4CX9A 1I5NA 2HMZA 1LE4A 2XRHA 4EKWA 1QKRA 4G0HA 3VF0A 2IYLD 2PFDA 1YYXA 2LK4A 1H6GA 1PCXA 1YAUO 1VK5A 3LNMB 1UG7A 3EQLF 4HFKB 4CDVA 4YT4A 1N1CA 4C7OA 2CDQA 3DZAA 5A6JA 2XM4A 1NU9C 256BA 2A69F 2EIJC 2H7VC 3G50A 1YDIA 4PJLA 1FNTc 4C7OB 2VC9A 5DVWA 3S9OA 4MVUA 1Q0DA 1T6IA 4JEBA 2W9YA 2LSEA 2ZPAA 3QZCA 2PBEA 1EI7A 3FOPA 1JPNA 3TULA 2WZFA 3DJNB 3U2MA 3NYJA 3L34A 2R02A 2FGYA 3ABKC 5JRAA 1NG1A 1TFKB 5KYXA 2Q9AA 3ABLC 1M2OA 3DE8A 3RW0A 2Q4FA 4U5HA 4YL0A 2NSFA 3ITFA 3KL4A 4RBNA 2Q00A 3C18A 2J0WA 4CIPA 5KYXB 2J9UA 2QNLA 1RMVA 3EGXA 4DRHB 2PX0A 1RCPA 2EPKX 1CPQA 3EGXB 2QTVA 4C3BA 4EWCA 3U8PA 3MX3A 3EZIA 3NMKA 1ZHXA 5KYYA 4Q5SF 2ZD9A 4A4AA 2DI3A 2KW3C 1T01A 1YYJA 2XS8A 4MVSA 5JT4A 4Z9HA 2WZGA 5KYYB 4XWJA 3RVZA 3U2LA 4GQHA 3NKDA 4X0RA 1ZZPA 4EUKB 5KYNA 4NQFA 2P0NA 2EILC 3T4RA 1BR4A 4CDYA 3LESA 3N2ZB 5B1AC 4PFPA 2EINC 1FAPB 1M56C 1HY5A 2OOCA 4NC3A 4LLCA 2R7UA 1ORJA 3ASOC 5L0IA 3GM2A 1LI7A 1G4US 4FAPB 2AU5A 3ZQVA 3S27A 1S05A 1H9TA 4FX5A 1ZYRF 1OCRC 3ABMC 5AGFA 1MMDA 1XZPA 3M1CB 4PR9A 1TWCA 3CAXA 4MS2A 4BJ5C 1HW2A 5FCLA 1CPRA 2YL7A 3LEOA 3DE9A 4YL3A 2XM0A 3IQCA 4Z9JA 1Z63A 4PJMA 2Y3GA 1LS1A 4O79A 2XXAA 3QVZA 1LE2A 1ZHZA 4C3EA 1T6UA 2LCHA 1SF8A 1PV3A 4I44A 2IBFA 3SYNA 4KNVA 1WGWA 3ZG1A 2XXAB 1APCA 2W45A 4O7GA 4P6IC 4NTBA 1YA9A 3T6GB 3S90A 1VLTA 1Z7Qc 4BEJA 4ULWA 1AEPA 3C8GB 3H65A 2BC5A 1MMNA 3ZC4A 4JJGA 3TJ5A 2AP3A 1A7EA 2PP4A 5A6KA 4P9TA 4BJTA 2HV6A 3NKEA 4FESA 3V5ZA 3H2VA 1Y4CA 2ZXPA 1Q0KA 3KYIA 1JAFA 1LS4A 3N24A 3AG4C 4OINF 3SXYA 5T3WA 3FXHA 3K33A 3Q7LA 2A0UA 1T5OA 2YKZA 3GWNA 3VAYA 4XQ1A 4IAOA 4I3MA 4MVZA 5JS5A 1LKXA 4XPXA 2YVKA 1D1BA 1JMWA 1NSGB 3RYLA 2G3KA 3W4YA 4OIPF 3FVYA 1ZHTA 3RQFA 3MYIA 1LIHA 1QLEC 1YJGA 3HTKC 4JTCB 3GEHA 4ANJA 2L6GA 4KI2A 3CSKA 2J9VA 3RIPA 4CS9A 2HJMA 1WWPA 4YK5A 1U6HA 3FOOA 2P6VA 1J8MF 4JRZA 2XLMA 3VM6A 1B68A 4AL1A 2M4EA 3JT1A 1V55C 4U5BE 1QZXA 4Q4ZF 3BRJA 1FMWA 3EHMA 4DVYP 2L81A 1OR3A 2IXMA 2A6HF 2D4UA 1VB5A 1SZIA 2OJQA 3OEOA 2WB7A 1F1MA 1VLSA 4B6IA 4E0HA 2J0XA 1OXKA 4XPWA 4U9DA 4EBKA 1ORSC 3GEIA 5CI8A 3VRCA 4CS8C 4O6NA 3FHDA 3NRHA 4H54A 4MTOA 4U5FE 3UR3C 3B71A 3IHUA 4RDAA 1NZEA 4CIHA 2R7TA 1IZMA 3WG7C 3NYLA 3WODF 4PFOA 3U3BA 2R03A 4XLPF 1WASA 1O3UA 3LEVA 4IAQA 1TWHA 2H8AA 4MQ9F 3TJ6A 5TJ5E 1K40A 3DAFA 3T6JA 4QI2A 4WGZA 4MVRA 2DGJA 2R7WA 1BR1A 3DWWA 4BJ1A 4E18A 1E86A 1S7ZA 4PJJA 3E70C 5T1DB 2XLOA 1CGNA 2LFDA 2KSFA 4NY3A 3V5XA 2DYSC 3B0VC 3AG3C 2ZXOA 3X2QC 1GS9A 4J7TA 5DLJA 3EG9A 2GA0A 2I8BA 2ICWG 2IXPA 4R32A 4PACA 3C7JA 3JRMO 5D92A 2UUIA 2MYSA 3UGPA 5JVEA 3DM9B 5L0FA 1O87A 2B0JA 4JZAA 3F47A 1D1AA 1HW1A 1W2WA 4QDLA 3RH3A 2JPUA 4QI0A 3UMIA 5DQTA 1I4ZA 3V5YA 2OJED 4GYTA 1AVOB 2EPNA 4EBJA 4U9EA 2JD3A 1G5ZA 2OU6A 1XWJA 1Z23A 1YZAA 3GWLA 1ZHWA 2J7PA 3HNLA 4KBLA 2R7RA 3I4UA 3M15A 4LACB 3SXZA 5F5FA 2NPUA 2Y69C 4IWBA 4NTFA 4OIRF 1TWGA 4U5GA 5BUOA 1V54C 2WVQA 3GEEA 3FMSA 3T6BA 3ECSA 3ZQYA 1TWAA 1OCZC 2A6EF 4DBRA 2NUPA 2YWAA 3K1HA 2OCCC 3PDMP 3UMKA 1HMDA 4NTAA 2NUPB 2J7PD 2KGOA 2HV7A 3L0IA 1BZ4A 3I5PA 5A69A 5L0GA 3GORA 2R7QA 4O6YA 5AC4A 1EKYA 2J45A 2GFHA 4YL1A 2BE5F 2HJ3A 1A7DA 3DI5A 2R7XA 2X51A 1OCCC 3S84A 1NU7D 2H7OA 2L6HA 2R25A 3E9VA 3CEXA 4LDKA 4XEFA 4DBQA 3DXJF 1M57C 2AWYA 2VCCA 1MQVA 1A0BA 4BG0A 4CSAC 2WVOA 4OD4A 1G4WR 5D91A 3AG2C 3VYWA 5BQGA 3NDBB 2YL0A 2QLAA 3O39A 4JKVA 1PD0A 1R4TA 2YLIA 1FR0A 1C02A 3AQCA 3QTHA 2PF4E 3C62A 2VB6A 2FFHA 1KNYA 3EFOA 3Q7GA 1H7IA 1FFHA 2XLDA 3G4XA 3KKBA 3LLKA 1Q0FA 4KC9A 1Q0GA 2NG1A 3EFOB 3O10A 2X0CA 3SEOA 4IJJA 2P7VA 2I15A 3SXKA 2G3VA 4E17A 2KK1A 4OD5A 3JCUQ 3SP1A 2XSEA 1YVIA 1Q0MA 2CYDA 1DOVA 2MHRA 4U5EE 5COGA 2BL2A 1V74B 2XLVA 3IEEA 2Q7RA 4BJ6C 2PNOA 3K1IC 1WATA 1AUEA 1D0YA 1QPUA 3IQTA 2HKVA 1Z6AA 3K7DA 2NSGA 2YLGA 3S29A 2Y3BA 1VTMP 2ZXWC 2A0BA 5CI9A 2R9RB 2XL8A 1I4YA 2J9BA 1C03A 1MMGA 2HUJA 2KQ9A 3RQGA 1SR2A 2ASRA 3FAJA 5KYWA 3KH2A 3H2UA 1K05A 2E87A 4W8KA 3ZTZA 5L0HA
chains in the Genus database with same CATH topology
5EGYA 2J9WA 5KYWB 4E7SA 1D0ZA 2CGEA 3RKOF 2Y3HA 3RFYA 4G7ZF 3EJNA 3TD7A 3DAGA 4DVZA 4AE4A 4HE8D 3B0UX 4XTKA 2Q3TA 1FTSA 1OKKA 4AE4B 2R7SA 4YT5A 4BJ5A 4FWVA 5B1BC 4Q7CA 2QY9A 3GODA 4DOZA 5EHHA 2KNHA 3ASNC 3DJUB 2IXOA 2W4BA 3EPVA 1OKKD 3EHNA 3MLGA 2XL4A 3EH2A 1TKNA 4WJ0A 4XLNF 3LNRA 3UMHA 1M2VA 4HFFB 2CW0F 4YJWA 1M2VB 3KMIA 4U5DE 4YT2A 3DD7A 4G7OF 5F5HA 4I1OB 4JW1A 1SMYF 5DS6A 2OG2A 5B3SC 1JPJA 2Z15A 4EBBA 4A2NB 5L3VA 5DS4A 3HJCA 3FDQA 4JVSA 2A1DD 4CS7A 5DQZA 5IY5C 5T3TA 2R7VA 5E3AA 2KJGA 3EG9B 3Q6MA 5E3CA 3QMKA 1TR2A 1VYKA 3I5QA 3B9QA 2YEVA 3LS0A 3OWTA 1LVKA 2WVNA 2IXNA 2VH3A 3LAYA 4K0DA 1BR2A 3V7OA 3UGOA 3PHF2 2A68F 4E7ZA 2W4MA 3NYMA 5E2QA 2C04A 1D0XA 2V26A 2R7OA 1RJ9A 3AG1C 3OA1A 1RJ9B 3K6BA 3GANA 1ZU5A 2L9JA 4CS8A 5DS5A 4ZLDA 4PJNA 3N0TA 3LS1A 4AX2A 1MNEA 2YHSA 2VASA 3NG1A 1FMVA 3DM5A 3PMRA 3SZRA 4C3DA 3F46A 1ST6A 2D5RB 4PK4A 1G8XA 1VMAA 4RD9A 2O9XA 4KI2A 4AK9A 4IRUA 3SNHA 3X1OA 4CS9C 1VOMA 2G62A 1ZHYA 2ZXRA 1O5HA 1Z3IX 2Q9CA 4JURI 3W2WA 1Z5ZA 2Q9BA 2IOQA 3AQBA 3W8IA 1MNDA 3B0PA 3S28A 2Y39A 2C03A 5KYUA 1VYIA 5HSWA 5KYUB 3S0XA 2EIKC 4J30B 4JCHA 4O6MA 3JRTA 1ZU4A 1PD1A 4YN0B 4OIOF 4N06A 2H7BA 3K66A 3Q6NA 4J32B 4OIQF 2DYRC 2WZLA 3HLZA 4G7HF 1IW7F 4CSAA 3POVA 2J46A 4H4KC 4CBEA 2YZSA 3ZVRA 3DMDA 2WL8A 1J8YF 2MWQA 4MNDA 3EGDA 3O6XA 3LLIA 4U5CE 1FFTC 4ZLCA 3EGDB 3LJBA 4GEHA 4JJFA 2CNWA 1OCOC 2V3CC 4I1MA 2PX3A 3CQZA 2NUTA 4BJ6A 3JYHA 3JSZA 1KU2A 2NUTB 4K7BA 4HEAJ 3UNGC 4F4BA 3W8HA 5E33A 3W2VA 2Y3DA 3ZSUA 1MMAA 5L3QA 4LERA 3EZHA 2CNWD 4LLEA 4M63A 3EH1A 3ZIBA 2EIMC 3CZ6A 1D1CA 4YWQA 4KNWA 2XRHA 4G0HA 2IYLD 2PFDA 1PCXA 1VK5A 4YT4A 3EQLF 4HFKB 1N1CA 4C7OA 2CDQA 3DZAA 1NU9C 2A69F 2EIJC 2H7VC 4PJLA 4C7OB 5DVWA 2W9YA 2LSEA 2ZPAA 3QZCA 1JPNA 2WZFA 3DJNB 3NYJA 3L34A 2FGYA 3ABKC 1NG1A 5KYXA 2Q9AA 3ABLC 1M2OA 4U5HA 3ITFA 3KL4A 4RBNA 2J0WA 5KYXB 2J9UA 3EGXA 2PX0A 4C3BA 3EGXB 2QTVA 4EWCA 3MX3A 3EZIA 1ZHXA 5KYYA 4Q5SF 2KW3C 2WZGA 5KYYB 4XWJA 3NKDA 4X0RA 5KYNA 2EILC 3T4RA 1BR4A 3LESA 3N2ZB 5B1AC 4PFPA 2EINC 1M56C 2R7UA 4LLCA 3ASOC 3S27A 4FX5A 1ZYRF 1OCRC 3ABMC 1MMDA 3M1CB 4BJ5C 1TWCA 5FCLA 1Z63A 4PJMA 2Y3GA 1LS1A 4O79A 2XXAA 1ZHZA 4C3EA 4I44A 1SF8A 3ZG1A 2XXAB 3SYNA 4KNVA 1WGWA 2W45A 4O7GA 4P6IC 4BEJA 4ULWA 3H65A 3ZC4A 1MMNA 4JJGA 2PP4A 4BJTA 2HV6A 3NKEA 4FESA 2ZXPA 3N24A 3AG4C 4OINF 5T3WA 3K33A 3Q7LA 3VAYA 4IAOA 4I3MA 1LKXA 1D1BA 3RYLA 2G3KA 4OIPF 3FVYA 1ZHTA 1QLEC 3HTKC 4ANJA 3CSKA 2J9VA 3RIPA 4CS9A 2P6VA 1J8MF 2M4EA 3JT1A 1V55C 4U5BE 1QZXA 4Q4ZF 1FMWA 3EHMA 4DVYP 2L81A 2IXMA 2A6HF 1SZIA 3OEOA 2WB7A 4B6IA 2J0XA 5CI8A 4CS8C 4O6NA 3FHDA 3NRHA 4U5FE 3UR3C 4RDAA 1NZEA 2R7TA 1IZMA 3WG7C 3NYLA 3WODF 4PFOA 4XLPF 3LEVA 1TWHA 4MQ9F 3DAFA 3T6JA 4QI2A 2DGJA 2R7WA 1BR1A 4BJ1A 1S7ZA 4PJJA 3E70C 5T1DB 4NY3A 2DYSC 3B0VC 3AG3C 2ZXOA 3X2QC 5DLJA 3EG9A 2I8BA 2IXPA 5D92A 2MYSA 3UGPA 3DM9B 1O87A 2B0JA 4JZAA 3F47A 1D1AA 1W2WA 4QDLA 3RH3A 3UMIA 5DQTA 4QI0A 4GYTA 2JD3A 1Z23A 2R7RA 1ZHWA 2J7PA 4KBLA 3I4UA 4LACB 2Y69C 4IWBA 4OIRF 1TWGA 4U5GA 5BUOA 1V54C 2WVQA 3T6BA 3ECSA 1TWAA 1OCZC 2A6EF 4DBRA 2NUPA 3K1HA 2OCCC 3UMKA 2NUPB 2J7PD 2KGOA 2HV7A 3L0IA 3I5PA 2R7QA 4O6YA 2J45A 2GFHA 2BE5F 2R7XA 2X51A 1OCCC 1NU7D 2H7OA 3E9VA 4CIHA 4DBQA 3DXJF 1M57C 4BG0A 4CSAC 2WVOA 4OD4A 3NDBB 5D91A 3AG2C 3VYWA 3O39A 1PD0A 3AQCA 2PF4E 2VB6A 2FFHA 3EFOA 3Q7GA 1FFHA 3LLKA 4YT8A 3KKBA 4KC9A 2NG1A 3EFOB 3SEOA 4IJJA 2P7VA 2G3VA 4OD5A 3JCUQ 3SP1A 2XSEA 4U5EE 3IEEA 4BJ6C 3K1IC 1D0YA 1Z6AA 3K7DA 3S29A 2Y3BA 2ZXWC 5CI9A 1MMGA 2KQ9A 3FAJA 5KYWA 3KH2A 5F5FA 2E87A 4W8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZLC A;  4YWQ A;  4ZLD A;  5F5H A;  4QI0 A;  4QI2 A;  5F5F A;  3X1O A;  4ULW A; 
#chains in the Genus database with same CATH topology
 5EGY A;  2J9W A;  3HNJ A;  5KYW B;  2HSB A;  4WAB A;  4E7S A;  1D0Z A;  2KC3 A;  2CGE A;  4G78 A;  3RKO F;  4JTD B;  1M6T A;  2Y3H A;  1C17 M;  5K0I A;  3RFY A;  4G7Z F;  3B29 A;  2TMV P;  1ORY A;  1NLX A;  3EJN A;  3TD7 A;  3DAG A;  3TQO A;  2HMQ A;  4AE4 A;  4HE8 D;  1HE1 A;  4DVZ A;  4N6C A;  3B0U X;  1QSP A;  4XTK A;  4MTF A;  3RF3 A;  2Q3T A;  1FTS A;  1OKK A;  4AE4 B;  4MVM A;  4ULV A;  2R7S A;  4JC7 A;  1H9G A;  3L1M A;  3U9M A;  2YLD A;  4YT5 A;  1EA8 A;  4BJ5 A;  4FWV A;  2RSE B;  5B1B C;  1E83 A;  4Q7C A;  2QY9 A;  5CIV A;  3GOD A;  4DOZ A;  2JX0 A;  5EHH A;  2KNH A;  4BPM A;  1JOG A;  3ASN C;  2IXO A;  2W4B A;  2DB4 A;  2L7A A;  2OEV A;  2XS1 A;  2EPM X;  3DJU B;  3EPV A;  3TOM A;  1YA7 O;  1OKK D;  2YQY A;  3AGU A;  3EHN A;  4K1O A;  3SXM A;  3MLG A;  2XL4 A;  3EH2 A;  3NMJ A;  1QQ3 A;  1TKN A;  3QW0 A;  4WJ0 A;  3LNR A;  4XLN F;  3UMH A;  1YAR O;  1M2V A;  3KPH A;  3WHN A;  1OXB A;  4D4N A;  4MW8 A;  4NCQ A;  4HFF B;  2HFI A;  1BDJ B;  1K04 A;  1TFO B;  2CW0 F;  4YJW A;  4MVQ A;  1M2V B;  3KMI A;  3C63 A;  4JE9 A;  4U5D E;  4D4X A;  3L8I A;  3M4B A;  3DD7 A;  4YT2 A;  3DKA A;  4G7O F;  2LIG A;  3AOU A;  4I1O B;  5F5H A;  3U3F A;  2OQM A;  4JW1 A;  1SMY F;  5DS6 A;  2OG2 A;  5B3S C;  2EPO A;  1JPJ A;  4N4W A;  2Z15 A;  1WOL A;  4EBB A;  3A11 A;  4A2N B;  5L3V A;  1A41 A;  3AGT A;  5DS4 A;  4XPY A;  3HJC A;  5BQH A;  3FDQ A;  4JVS A;  2A1D D;  4CS7 A;  3L8J A;  1CGM E;  5DQZ A;  1ZVZ A;  4XEK A;  5IY5 C;  1L7C A;  5T3T A;  3LUT B;  2R7V A;  4DJ9 A;  2ETS A;  5E3A A;  2KJG A;  3EG9 B;  3Q6M A;  3QW1 A;  2FAP B;  2J8W A;  2YL1 A;  5E3C A;  1U0B B;  3QMK A;  1TR2 A;  1VYK A;  2XL6 A;  3I5Q A;  3B9Q A;  2YEV A;  2RD9 A;  4CDA A;  3LS0 A;  3OWT A;  4LDR A;  4E0I A;  1LVK A;  2WVN A;  2OKU A;  5L0J A;  3G4Z A;  1NFN A;  2IXN A;  2HS5 A;  2VH3 A;  3JZ0 A;  3LAY A;  4K0D A;  1BR2 A;  3GM1 A;  1OW8 A;  4LDQ A;  3V7O A;  3UGO A;  1RKE A;  4ER9 A;  4DXW A;  3PHF 2;  2A68 F;  1OW6 A;  3M4C A;  4E7Z A;  2W4M A;  2HSQ A;  3QVY A;  1GQA A;  1RKE B;  3NYM A;  4JCZ A;  4ONS A;  5E2Q A;  3TK0 A;  2C04 A;  1HE9 A;  1D0X A;  2V26 A;  5COM A;  2R7O A;  3JYY A;  3PCV A;  1RJ9 A;  3AG1 C;  5AC5 A;  1E85 A;  2GWW A;  3OA1 A;  4WGY A;  5B3I A;  1NBB A;  1RJ9 B;  1JRA A;  3GAN A;  3K6B A;  4P9F A;  4BEM J;  1ZU5 A;  2L9J A;  4MW3 A;  4CS8 A;  5DS5 A;  2QUP A;  1KTM A;  1L3P A;  4ZLD A;  4IB4 A;  3U8V A;  1T9K A;  5JUA A;  4PJN A;  3N0T A;  3LS1 A;  4AL0 A;  4AX2 A;  2QE9 A;  4JTA B;  1MNE A;  2YHS A;  2VAS A;  3NG1 A;  1FMV A;  3C8Z A;  5JSL A;  2IM8 A;  3GM3 A;  3DM5 A;  4JEA A;  2R05 A;  4CJG A;  3PMR A;  3SZR A;  5BQI A;  2HZ8 A;  4C3D A;  3F46 A;  4J7Y A;  1LI5 A;  1GGQ A;  1V4A A;  1ST6 A;  2D5R B;  1HMO A;  1RXQ A;  5EK0 A;  2P61 A;  3ATP A;  4PK4 A;  1G8X A;  1VMA A;  4RD9 A;  5COF A;  3A9C A;  4DRJ B;  4IAR A;  4DRI B;  4EIY A;  2O9X A;  4N6H A;  4Z9I A;  3ZTM A;  4AK9 A;  4IRU A;  2XLE A;  5GPG B;  2CCY A;  4JIO A;  3SNH A;  3X1O A;  1EQ1 A;  1YZC A;  4L6R A;  4CS9 C;  1TQG A;  1VOM A;  2LFF A;  2XLH A;  1LPE A;  1U89 A;  2G62 A;  3BEH A;  1ZHY A;  2ZXR A;  1ZW2 A;  1O5H A;  5JP7 A;  2F22 A;  3JSE O;  3M79 A;  3US6 A;  1Z3I X;  2Q9C A;  4JUR I;  3W2W A;  1Z5Z A;  2Q9B A;  3IPM O;  3MFN A;  3RQE A;  3WAQ A;  1YLM A;  5A6B A;  2IOQ A;  2P1A A;  3AQB A;  3W8I A;  1MND A;  3B0P A;  3S28 A;  2Y39 A;  3KYJ A;  2C03 A;  5KYU A;  3TOL A;  1VYI A;  2YRF A;  4YT8 A;  5HV9 A;  5HSW A;  5KYU B;  1OW7 A;  3MBG A;  4W8P A;  4EHP A;  3S0X A;  2EIK C;  2VCA A;  1R5I D;  2XLW A;  3HNI A;  5F28 E;  1JR8 A;  3IQ6 A;  1UFB A;  5A6B D;  4J30 B;  3T9O A;  4JCH A;  4O6M A;  3R7C A;  3C8G A;  3JRT A;  3J06 A;  1ZU4 A;  5FZT A;  1PD1 A;  5A6A A;  4YN0 B;  1BBH A;  4OIO F;  3O55 A;  4IGG A;  4N06 A;  3FAP B;  2EPL X;  1LM3 B;  2H7B A;  1NFO A;  3K66 A;  3Q6N A;  3NMI A;  1Y6D A;  3R2P A;  4J32 B;  4OIQ F;  2DYR C;  3MYF A;  4MTG A;  2WZL A;  3HLZ A;  1OQC A;  1E84 A;  2GDC A;  2GAQ A;  4G7H F;  3C8G D;  3ZDL A;  1IW7 F;  3HNK A;  5L0D A;  4CSA A;  3POV A;  2J46 A;  1WTY A;  2OEX A;  1SYQ A;  3IQ5 A;  4H4K C;  4CBE A;  2L6F A;  2YZS A;  3ZWI A;  3ZVR A;  1ZW3 A;  1CGO A;  2LQG A;  2M64 A;  3DMD A;  2WL8 A;  1J8Y F;  2MWQ A;  4MND A;  4MVO A;  3EGD A;  3O6X A;  3LLI A;  4U5C E;  3U5S A;  1FFT C;  4ZLC A;  3EGD B;  1GM5 A;  2LP4 A;  3LJB A;  4GEH A;  2VCB A;  4JJF A;  2UUH A;  3RVY A;  5JLI A;  2LD6 A;  1E2X A;  1OCO C;  1QVX A;  2CNW A;  2KYH A;  4I1M A;  2V3C C;  2PX3 A;  1OR2 A;  3CQZ A;  3JTL O;  2NUT A;  1DOW A;  5L0C A;  3U9J A;  3AJM A;  4BJ6 A;  3K1I A;  3JYH A;  3JSZ A;  1KU2 A;  2NUT B;  4K7B A;  4HEA J;  1RKC A;  1XZQ A;  3UNG C;  4F4B A;  3W8H A;  2AVK A;  5E33 A;  3W2V A;  3U0C A;  2Y3D A;  2AWC A;  1MMA A;  3HKK A;  4LER A;  3ZSU A;  5L3Q A;  3EZH A;  2YL3 A;  2CNW D;  4LLE A;  4M63 A;  1WN0 A;  4CJO A;  3EH1 A;  1T6Q A;  3ZIB A;  2EIM C;  3CZ6 A;  4UDV A;  1D1C A;  4YWQ A;  2B0H A;  1A7V A;  4XEV A;  4KNW A;  4CX9 A;  1I5N A;  2HMZ A;  1LE4 A;  2XRH A;  4EKW A;  1QKR A;  4G0H A;  3VF0 A;  2IYL D;  2PFD A;  1YYX A;  2LK4 A;  1H6G A;  1PCX A;  1YAU O;  1VK5 A;  3LNM B;  1UG7 A;  3EQL F;  4HFK B;  4CDV A;  4YT4 A;  1N1C A;  4C7O A;  2CDQ A;  3DZA A;  5A6J A;  2XM4 A;  1NU9 C;  256B A;  2A69 F;  2EIJ C;  2H7V C;  3G50 A;  1YDI A;  4PJL A;  1FNT c;  4C7O B;  2VC9 A;  5DVW A;  3S9O A;  4MVU A;  1Q0D A;  1T6I A;  4JEB A;  2W9Y A;  2LSE A;  2ZPA A;  3QZC A;  2PBE A;  1EI7 A;  3FOP A;  1JPN A;  3TUL A;  2WZF A;  3DJN B;  3U2M A;  3NYJ A;  3L34 A;  2R02 A;  2FGY A;  3ABK C;  5JRA A;  1NG1 A;  1TFK B;  5KYX A;  2Q9A A;  3ABL C;  1M2O A;  3DE8 A;  3RW0 A;  2Q4F A;  4U5H A;  4YL0 A;  2NSF A;  3ITF A;  3KL4 A;  4RBN A;  2Q00 A;  3C18 A;  2J0W A;  4CIP A;  5KYX B;  2J9U A;  2QNL A;  1RMV A;  3EGX A;  4DRH B;  2PX0 A;  1RCP A;  2EPK X;  1CPQ A;  3EGX B;  2QTV A;  4C3B A;  4EWC A;  3U8P A;  3MX3 A;  3EZI A;  3NMK A;  1ZHX A;  5KYY A;  4Q5S F;  2ZD9 A;  4A4A A;  2DI3 A;  2KW3 C;  1T01 A;  1YYJ A;  2XS8 A;  4MVS A;  5JT4 A;  4Z9H A;  2WZG A;  5KYY B;  4XWJ A;  3RVZ A;  3U2L A;  4GQH A;  3NKD A;  4X0R A;  1ZZP A;  4EUK B;  5KYN A;  4NQF A;  2P0N A;  2EIL C;  3T4R A;  1BR4 A;  4CDY A;  3LES A;  3N2Z B;  5B1A C;  4PFP A;  2EIN C;  1FAP B;  1M56 C;  1HY5 A;  2OOC A;  4NC3 A;  4LLC A;  2R7U A;  1ORJ A;  3ASO C;  5L0I A;  3GM2 A;  1LI7 A;  1G4U S;  4FAP B;  2AU5 A;  3ZQV A;  3S27 A;  1S05 A;  1H9T A;  4FX5 A;  1ZYR F;  1OCR C;  3ABM C;  5AGF A;  1MMD A;  1XZP A;  3M1C B;  4PR9 A;  1TWC A;  3CAX A;  4MS2 A;  4BJ5 C;  1HW2 A;  5FCL A;  1CPR A;  2YL7 A;  3LEO A;  3DE9 A;  4YL3 A;  2XM0 A;  3IQC A;  4Z9J A;  1Z63 A;  4PJM A;  2Y3G A;  1LS1 A;  4O79 A;  2XXA A;  3QVZ A;  1LE2 A;  1ZHZ A;  4C3E A;  1T6U A;  2LCH A;  1SF8 A;  1PV3 A;  4I44 A;  2IBF A;  3SYN A;  4KNV A;  1WGW A;  3ZG1 A;  2XXA B;  1APC A;  2W45 A;  4O7G A;  4P6I C;  4NTB A;  1YA9 A;  3T6G B;  3S90 A;  1VLT A;  1Z7Q c;  4BEJ A;  4ULW A;  1AEP A;  3C8G B;  3H65 A;  2BC5 A;  1MMN A;  3ZC4 A;  4JJG A;  3TJ5 A;  2AP3 A;  1A7E A;  2PP4 A;  5A6K A;  4P9T A;  4BJT A;  2HV6 A;  3NKE A;  4FES A;  3V5Z A;  3H2V A;  1Y4C A;  2ZXP A;  1Q0K A;  3KYI A;  1JAF A;  1LS4 A;  3N24 A;  3AG4 C;  4OIN F;  3SXY A;  5T3W A;  3FXH A;  3K33 A;  3Q7L A;  2A0U A;  1T5O A;  2YKZ A;  3GWN A;  3VAY A;  4XQ1 A;  4IAO A;  4I3M A;  4MVZ A;  5JS5 A;  1LKX A;  4XPX A;  2YVK A;  1D1B A;  1JMW A;  1NSG B;  3RYL A;  2G3K A;  3W4Y A;  4OIP F;  3FVY A;  1ZHT A;  3RQF A;  3MYI A;  1LIH A;  1QLE C;  1YJG A;  3HTK C;  4JTC B;  3GEH A;  4ANJ A;  2L6G A;  4KI2 A;  3CSK A;  2J9V A;  3RIP A;  4CS9 A;  2HJM A;  1WWP A;  4YK5 A;  1U6H A;  3FOO A;  2P6V A;  1J8M F;  4JRZ A;  2XLM A;  3VM6 A;  1B68 A;  4AL1 A;  2M4E A;  3JT1 A;  1V55 C;  4U5B E;  1QZX A;  4Q4Z F;  3BRJ A;  1FMW A;  3EHM A;  4DVY P;  2L81 A;  1OR3 A;  2IXM A;  2A6H F;  2D4U A;  1VB5 A;  1SZI A;  2OJQ A;  3OEO A;  2WB7 A;  1F1M A;  1VLS A;  4B6I A;  4E0H A;  2J0X A;  1OXK A;  4XPW A;  4U9D A;  4EBK A;  1ORS C;  3GEI A;  5CI8 A;  3VRC A;  4CS8 C;  4O6N A;  3FHD A;  3NRH A;  4H54 A;  4MTO A;  4U5F E;  3UR3 C;  3B71 A;  3IHU A;  4RDA A;  1NZE A;  4CIH A;  2R7T A;  1IZM A;  3WG7 C;  3NYL A;  3WOD F;  4PFO A;  3U3B A;  2R03 A;  4XLP F;  1WAS A;  1O3U A;  3LEV A;  4IAQ A;  1TWH A;  2H8A A;  4MQ9 F;  3TJ6 A;  5TJ5 E;  1K40 A;  3DAF A;  3T6J A;  4QI2 A;  4WGZ A;  4MVR A;  2DGJ A;  2R7W A;  1BR1 A;  3DWW A;  4BJ1 A;  4E18 A;  1E86 A;  1S7Z A;  4PJJ A;  3E70 C;  5T1D B;  2XLO A;  1CGN A;  2LFD A;  2KSF A;  4NY3 A;  3V5X A;  2DYS C;  3B0V C;  3AG3 C;  2ZXO A;  3X2Q C;  1GS9 A;  4J7T A;  5DLJ A;  3EG9 A;  2GA0 A;  2I8B A;  2ICW G;  2IXP A;  4R32 A;  4PAC A;  3C7J A;  3JRM O;  5D92 A;  2UUI A;  2MYS A;  3UGP A;  5JVE A;  3DM9 B;  5L0F A;  1O87 A;  2B0J A;  4JZA A;  3F47 A;  1D1A A;  1HW1 A;  1W2W A;  4QDL A;  3RH3 A;  2JPU A;  4QI0 A;  3UMI A;  5DQT A;  1I4Z A;  3V5Y A;  2OJE D;  4GYT A;  1AVO B;  2EPN A;  4EBJ A;  4U9E A;  2JD3 A;  1G5Z A;  2OU6 A;  1XWJ A;  1Z23 A;  1YZA A;  3GWL A;  1ZHW A;  2J7P A;  3HNL A;  4KBL A;  2R7R A;  3I4U A;  3M15 A;  4LAC B;  3SXZ A;  5F5F A;  2NPU A;  2Y69 C;  4IWB A;  4NTF A;  4OIR F;  1TWG A;  4U5G A;  5BUO A;  1V54 C;  2WVQ A;  3GEE A;  3FMS A;  3T6B A;  3ECS A;  3ZQY A;  1TWA A;  1OCZ C;  2A6E F;  4DBR A;  2NUP A;  2YWA A;  3K1H A;  2OCC C;  3PDM P;  3UMK A;  1HMD A;  4NTA A;  2NUP B;  2J7P D;  2KGO A;  2HV7 A;  3L0I A;  1BZ4 A;  3I5P A;  5A69 A;  5L0G A;  3GOR A;  2R7Q A;  4O6Y A;  5AC4 A;  1EKY A;  2J45 A;  2GFH A;  4YL1 A;  2BE5 F;  2HJ3 A;  1A7D A;  3DI5 A;  2R7X A;  2X51 A;  1OCC C;  3S84 A;  1NU7 D;  2H7O A;  2L6H A;  2R25 A;  3E9V A;  3CEX A;  4LDK A;  4XEF A;  4DBQ A;  3DXJ F;  1M57 C;  2AWY A;  2VCC A;  1MQV A;  1A0B A;  4BG0 A;  4CSA C;  2WVO A;  4OD4 A;  1G4W R;  5D91 A;  3AG2 C;  3VYW A;  5BQG A;  3NDB B;  2YL0 A;  2QLA A;  3O39 A;  4JKV A;  1PD0 A;  1R4T A;  2YLI A;  1FR0 A;  1C02 A;  3AQC A;  3QTH A;  2PF4 E;  3C62 A;  2VB6 A;  2FFH A;  1KNY A;  3EFO A;  3Q7G A;  1H7I A;  1FFH A;  2XLD A;  3G4X A;  3KKB A;  3LLK A;  1Q0F A;  4KC9 A;  1Q0G A;  2NG1 A;  3EFO B;  3O10 A;  2X0C A;  3SEO A;  4IJJ A;  2P7V A;  2I15 A;  3SXK A;  2G3V A;  4E17 A;  2KK1 A;  4OD5 A;  3JCU Q;  3SP1 A;  2XSE A;  1YVI A;  1Q0M A;  2CYD A;  1DOV A;  2MHR A;  4U5E E;  5COG A;  2BL2 A;  1V74 B;  2XLV A;  3IEE A;  2Q7R A;  4BJ6 C;  2PNO A;  3K1I C;  1WAT A;  1AUE A;  1D0Y A;  1QPU A;  3IQT A;  2HKV A;  1Z6A A;  3K7D A;  2NSG A;  2YLG A;  3S29 A;  2Y3B A;  1VTM P;  2ZXW C;  2A0B A;  5CI9 A;  2R9R B;  2XL8 A;  1I4Y A;  2J9B A;  1C03 A;  1MMG A;  2HUJ A;  2KQ9 A;  3RQG A;  1SR2 A;  2ASR A;  3FAJ A;  5KYW A;  3KH2 A;  3H2U A;  1K05 A;  2E87 A;  4W8K A;  3ZTZ A;  5L0H A; 
#chains in the Genus database with same CATH homology
 5EGY A;  2J9W A;  5KYW B;  4E7S A;  1D0Z A;  2CGE A;  3RKO F;  2Y3H A;  3RFY A;  4G7Z F;  3EJN A;  3TD7 A;  3DAG A;  4DVZ A;  4AE4 A;  4HE8 D;  3B0U X;  4XTK A;  2Q3T A;  1FTS A;  1OKK A;  4AE4 B;  2R7S A;  4YT5 A;  4BJ5 A;  4FWV A;  5B1B C;  4Q7C A;  2QY9 A;  3GOD A;  4DOZ A;  5EHH A;  2KNH A;  3ASN C;  3DJU B;  2IXO A;  2W4B A;  3EPV A;  1OKK D;  3EHN A;  3MLG A;  2XL4 A;  3EH2 A;  1TKN A;  4WJ0 A;  4XLN F;  3LNR A;  3UMH A;  1M2V A;  4HFF B;  2CW0 F;  4YJW A;  1M2V B;  3KMI A;  4U5D E;  4YT2 A;  3DD7 A;  4G7O F;  5F5H A;  4I1O B;  4JW1 A;  1SMY F;  5DS6 A;  2OG2 A;  5B3S C;  1JPJ A;  2Z15 A;  4EBB A;  4A2N B;  5L3V A;  5DS4 A;  3HJC A;  3FDQ A;  4JVS A;  2A1D D;  4CS7 A;  5DQZ A;  5IY5 C;  5T3T A;  2R7V A;  5E3A A;  2KJG A;  3EG9 B;  3Q6M A;  5E3C A;  3QMK A;  1TR2 A;  1VYK A;  3I5Q A;  3B9Q A;  2YEV A;  3LS0 A;  3OWT A;  1LVK A;  2WVN A;  2IXN A;  2VH3 A;  3LAY A;  4K0D A;  1BR2 A;  3V7O A;  3UGO A;  3PHF 2;  2A68 F;  4E7Z A;  2W4M A;  3NYM A;  5E2Q A;  2C04 A;  1D0X A;  2V26 A;  2R7O A;  1RJ9 A;  3AG1 C;  3OA1 A;  1RJ9 B;  3K6B A;  3GAN A;  1ZU5 A;  2L9J A;  4CS8 A;  5DS5 A;  4ZLD A;  4PJN A;  3N0T A;  3LS1 A;  4AX2 A;  1MNE A;  2YHS A;  2VAS A;  3NG1 A;  1FMV A;  3DM5 A;  3PMR A;  3SZR A;  4C3D A;  3F46 A;  1ST6 A;  2D5R B;  4PK4 A;  1G8X A;  1VMA A;  4RD9 A;  2O9X A;  4KI2 A;  4AK9 A;  4IRU A;  3SNH A;  3X1O A;  4CS9 C;  1VOM A;  2G62 A;  1ZHY A;  2ZXR A;  1O5H A;  1Z3I X;  2Q9C A;  4JUR I;  3W2W A;  1Z5Z A;  2Q9B A;  2IOQ A;  3AQB A;  3W8I A;  1MND A;  3B0P A;  3S28 A;  2Y39 A;  2C03 A;  5KYU A;  1VYI A;  5HSW A;  5KYU B;  3S0X A;  2EIK C;  4J30 B;  4JCH A;  4O6M A;  3JRT A;  1ZU4 A;  1PD1 A;  4YN0 B;  4OIO F;  4N06 A;  2H7B A;  3K66 A;  3Q6N A;  4J32 B;  4OIQ F;  2DYR C;  2WZL A;  3HLZ A;  4G7H F;  1IW7 F;  4CSA A;  3POV A;  2J46 A;  4H4K C;  4CBE A;  2YZS A;  3ZVR A;  3DMD A;  2WL8 A;  1J8Y F;  2MWQ A;  4MND A;  3EGD A;  3O6X A;  3LLI A;  4U5C E;  1FFT C;  4ZLC A;  3EGD B;  3LJB A;  4GEH A;  4JJF A;  2CNW A;  1OCO C;  2V3C C;  4I1M A;  2PX3 A;  3CQZ A;  2NUT A;  4BJ6 A;  3JYH A;  3JSZ A;  1KU2 A;  2NUT B;  4K7B A;  4HEA J;  3UNG C;  4F4B A;  3W8H A;  5E33 A;  3W2V A;  2Y3D A;  3ZSU A;  1MMA A;  5L3Q A;  4LER A;  3EZH A;  2CNW D;  4LLE A;  4M63 A;  3EH1 A;  3ZIB A;  2EIM C;  3CZ6 A;  1D1C A;  4YWQ A;  4KNW A;  2XRH A;  4G0H A;  2IYL D;  2PFD A;  1PCX A;  1VK5 A;  4YT4 A;  3EQL F;  4HFK B;  1N1C A;  4C7O A;  2CDQ A;  3DZA A;  1NU9 C;  2A69 F;  2EIJ C;  2H7V C;  4PJL A;  4C7O B;  5DVW A;  2W9Y A;  2LSE A;  2ZPA A;  3QZC A;  1JPN A;  2WZF A;  3DJN B;  3NYJ A;  3L34 A;  2FGY A;  3ABK C;  1NG1 A;  5KYX A;  2Q9A A;  3ABL C;  1M2O A;  4U5H A;  3ITF A;  3KL4 A;  4RBN A;  2J0W A;  5KYX B;  2J9U A;  3EGX A;  2PX0 A;  4C3B A;  3EGX B;  2QTV A;  4EWC A;  3MX3 A;  3EZI A;  1ZHX A;  5KYY A;  4Q5S F;  2KW3 C;  2WZG A;  5KYY B;  4XWJ A;  3NKD A;  4X0R A;  5KYN A;  2EIL C;  3T4R A;  1BR4 A;  3LES A;  3N2Z B;  5B1A C;  4PFP A;  2EIN C;  1M56 C;  2R7U A;  4LLC A;  3ASO C;  3S27 A;  4FX5 A;  1ZYR F;  1OCR C;  3ABM C;  1MMD A;  3M1C B;  4BJ5 C;  1TWC A;  5FCL A;  1Z63 A;  4PJM A;  2Y3G A;  1LS1 A;  4O79 A;  2XXA A;  1ZHZ A;  4C3E A;  4I44 A;  1SF8 A;  3ZG1 A;  2XXA B;  3SYN A;  4KNV A;  1WGW A;  2W45 A;  4O7G A;  4P6I C;  4BEJ A;  4ULW A;  3H65 A;  3ZC4 A;  1MMN A;  4JJG A;  2PP4 A;  4BJT A;  2HV6 A;  3NKE A;  4FES A;  2ZXP A;  3N24 A;  3AG4 C;  4OIN F;  5T3W A;  3K33 A;  3Q7L A;  3VAY A;  4IAO A;  4I3M A;  1LKX A;  1D1B A;  3RYL A;  2G3K A;  4OIP F;  3FVY A;  1ZHT A;  1QLE C;  3HTK C;  4ANJ A;  3CSK A;  2J9V A;  3RIP A;  4CS9 A;  2P6V A;  1J8M F;  2M4E A;  3JT1 A;  1V55 C;  4U5B E;  1QZX A;  4Q4Z F;  1FMW A;  3EHM A;  4DVY P;  2L81 A;  2IXM A;  2A6H F;  1SZI A;  3OEO A;  2WB7 A;  4B6I A;  2J0X A;  5CI8 A;  4CS8 C;  4O6N A;  3FHD A;  3NRH A;  4U5F E;  3UR3 C;  4RDA A;  1NZE A;  2R7T A;  1IZM A;  3WG7 C;  3NYL A;  3WOD F;  4PFO A;  4XLP F;  3LEV A;  1TWH A;  4MQ9 F;  3DAF A;  3T6J A;  4QI2 A;  2DGJ A;  2R7W A;  1BR1 A;  4BJ1 A;  1S7Z A;  4PJJ A;  3E70 C;  5T1D B;  4NY3 A;  2DYS C;  3B0V C;  3AG3 C;  2ZXO A;  3X2Q C;  5DLJ A;  3EG9 A;  2I8B A;  2IXP A;  5D92 A;  2MYS A;  3UGP A;  3DM9 B;  1O87 A;  2B0J A;  4JZA A;  3F47 A;  1D1A A;  1W2W A;  4QDL A;  3RH3 A;  3UMI A;  5DQT A;  4QI0 A;  4GYT A;  2JD3 A;  1Z23 A;  2R7R A;  1ZHW A;  2J7P A;  4KBL A;  3I4U A;  4LAC B;  2Y69 C;  4IWB A;  4OIR F;  1TWG A;  4U5G A;  5BUO A;  1V54 C;  2WVQ A;  3T6B A;  3ECS A;  1TWA A;  1OCZ C;  2A6E F;  4DBR A;  2NUP A;  3K1H A;  2OCC C;  3UMK A;  2NUP B;  2J7P D;  2KGO A;  2HV7 A;  3L0I A;  3I5P A;  2R7Q A;  4O6Y A;  2J45 A;  2GFH A;  2BE5 F;  2R7X A;  2X51 A;  1OCC C;  1NU7 D;  2H7O A;  3E9V A;  4CIH A;  4DBQ A;  3DXJ F;  1M57 C;  4BG0 A;  4CSA C;  2WVO A;  4OD4 A;  3NDB B;  5D91 A;  3AG2 C;  3VYW A;  3O39 A;  1PD0 A;  3AQC A;  2PF4 E;  2VB6 A;  2FFH A;  3EFO A;  3Q7G A;  1FFH A;  3LLK A;  4YT8 A;  3KKB A;  4KC9 A;  2NG1 A;  3EFO B;  3SEO A;  4IJJ A;  2P7V A;  2G3V A;  4OD5 A;  3JCU Q;  3SP1 A;  2XSE A;  4U5E E;  3IEE A;  4BJ6 C;  3K1I C;  1D0Y A;  1Z6A A;  3K7D A;  3S29 A;  2Y3B A;  2ZXW C;  5CI9 A;  1MMG A;  2KQ9 A;  3FAJ A;  5KYW A;  3KH2 A;  5F5F A;  2E87 A;  4W8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...