3X1OA

Crystal structure of the roq domain of human roquin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
151
structure length
149
Chain Sequence
QQLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Roquin-1
publication title Roquin binds microRNA-146a and Argonaute2 to regulate microRNA homeostasis
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 149
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3x1oA00
4QI2A 5F5HA 4ZLCA 5F5FA 4ZLDA 4YWQA 4ULWA 3X1OA 4QI0A
chains in the Genus database with same CATH superfamily
1EKYA 3KMIA 1LIHA 3O10A 5CI9A 3PHF2 4OD4A 1JPJA 1A7DA 3M4CA 2R05A 1K05A 1ZU5A 3SXKA 4EBJA 4YK5A 1BR4A 1MMAA 3PMRA 1DOVA 1ZHXA 2YL3A 2H8AA 1FAPB 3MYFA 2OJED 3EZHA 3Q7LA 1H9TA 1CGOA 4FWVA 2YLGA 4G7ZF 1FMWA 2NSGA 1I4ZA 2OU6A 3IPMO 1OKKA 4U5GA 3L0IA 1YZCA 5JUAA 1VTMP 1QQ3A 3AGUA 2YVKA 1WATA 2XS1A 1A41A 3NKDA 1R4TA 3ITFA 5A6BD 2NUPB 4OIPF 4MVRA 4NTBA 2IM8A 3C8ZA 1V55C 3WG7C 4YWQA 4G7OF 2GWWA 2NUPA 2J0XA 3MYIA 4GQHA 3B71A 2O9XA 3TOLA 2H7VC 3JT1A 2W4BA 3TD7A 4C3EA 1QKRA 1G8XA 1XZQA 1V74B 2E87A 3F46A 3GEIA 3QVZA 3GEEA 2IXPA 1JRAA 3JYYA 4WGZA 3SEOA 2X51A 4DBQA 2TMVP 4D4XA 1ZW2A 1LKXA 1ZVZA 3MLGA 3NMJA 2WL8A 4QI2A 2ICWG 5L0FA 4G0HA 3I5QA 2GA0A 2XM0A 2G3VA 4U5HA 5AC5A 4O79A 5E3AA 3OA1A 1ZHYA 3DJNB 1BDJB 5DS5A 2FFHA 3K1IA 1YLMA 2XLDA 1MNEA 3H2UA 4ULVA 3JYHA 1ORSC 2KQ9A 1D0ZA 1DOWA 2BC5A 3NMIA 5JS5A 3HLZA 1EI7A 3SXYA 3X2QC 4F4BA 1OR3A 4FESA 3LLIA 1LPEA 1YA7O 1Q0MA 4NQFA 5JSLA 3ZDLA 1LVKA 4OINF 4A4AA 5IY5C 3LS0A 3NYMA 3POVA 1B68A 4CIPA 4MTOA 4U5BE 1K40A 1OW8A 2YL0A 1RXQA 2Z15A 4DOZA 2L6FA 1G4WR 1WWPA 2R9RB 3V7OA 2R7UA 3Q7GA 1TFKB 2J46A 3LJBA 4XLNF 4CS8A 1UG7A 1T6QA 4EUKB 3K7DA 2B0HA 3RW0A 3N24A 3U5SA 2YWAA 2NPUA 2CCYA 4O6MA 5B1BC 4PK4A 1NG1A 3GM3A 3T6JA 2XRHA 1WOLA 2J0WA 2XLVA 2EINC 3FVYA 1OCCC 4JZAA 4O6YA 2UUHA 3AG2C 2X0CA 3EH2A 1T5OA 4FX5A 4E7ZA 4YT5A 2EPLX 3V5ZA 4O6NA 5T1DB 5BUOA 4XLPF 1OKKD 3SP1A 3V5YA 1HMOA 1FNTc 1E84A 2FGYA 1AVOB 3ZC4A 2R03A 5COMA 3AGTA 2ETSA 3RFYA 4X0RA 4EHPA 4JTDB 2A69F 4G7HF 1FMVA 5D91A 3HKKA 2IYLD 1LI5A 1R5ID 1ORJA 1QLEC 1TKNA 1YYXA 2LSEA 3DD7A 3N2ZB 3AQBA 4JC7A 3ZQVA 3S27A 2WZLA 1NFNA 1Z23A 3W4YA 1YJGA 4HFFB 4XWJA 4PJNA 2PP4A 3DKAA 4OIRF 5JRAA 3EHNA 3L8JA 5F5HA 4JURI 4MQ9F 4CX9A 1MMNA 5E2QA 4YT8A 2AVKA 1K04A 2XSEA 4I1MA 4B6IA 2XL6A 2HFIA 2CDQA 2JD3A 2AWYA 4PJMA 5AC4A 4H54A 4MVMA 4MVZA 3WODF 4N6CA 2XLHA 2OEXA 5E33A 3LEVA 2R02A 1XZPA 1O5HA 3O6XA 2MWQA 1MMDA 1Q0DA 1OCOC 1GGQA 2VH3A 2WVQA 3DZAA 3LESA 1YYJA 4J30B 2WB7A 2M4EA 4R32A 4YL3A 3ASOC 2J7PA 4EKWA 1CPQA 4I1OB 4LDRA 4XEFA 4BJ1A 2VCBA 3L34A 1I5NA 3QW1A 1Z7Qc 4RDAA 3ATPA 3MX3A 4JJFA 3UMIA 2L6HA 5DQTA 5DLJA 4CJOA 5FCLA 4NY3A 2R7XA 5DS6A 3AQCA 1HE9A 2VCAA 3FXHA 3GODA 4ONSA 2DGJA 2NSFA 4XPXA 5GPGB 4DBRA 4ER9A 2HZ8A 5EK0A 3C7JA 3HNIA 1D0XA 4AX2A 2XLWA 4OD5A 5B1AC 2MYSA 3L8IA 4AE4B 1D1CA 3R7CA 1GM5A 4MTGA 3QVYA 2HKVA 4BJTA 2DI3A 1GQAA 1T6IA 5L0JA 2XXAB 2R7TA 4AE4A 4NTFA 1MNDA 1QVXA 2PF4E 3ZVRA 4WABA 2XXAA 2IXNA 2M64A 3BRJA 2VC9A 4Q4ZF 3EJNA 3KL4A 1NFOA 3B0UX 1NLXA 4YT4A 3DAFA 5B3IA 1E83A 1WTYA 2EPKX 4IJJA 2V26A 4MS2A 3A9CA 2QLAA 3HJCA 2B0JA 4KC9A 4XPWA 4E18A 3K1IC 2C03A 3NG1A 3RIPA 1KU2A 1VYKA 5JP7A 5A69A 1ST6A 4JJGA 5FZTA 4ZLDA 4IB4A 1Q0GA 3AJMA 2OOCA 3ZG1A 2G3KA 3S0XA 1SYQA 4AL0A 2OG2A 3F47A 1PV3A 2HS5A 5CI8A 1TFOB 4WGYA 3FOPA 1M57C 3FAPB 3O39A 4IRUA 4PR9A 1E86A 3TJ6A 2XL8A 2XL4A 1ZU4A 2D4UA 4IAOA 1M2VB 5E3CA 2F22A 4CS8C 1T9KA 1O3UA 1M2VA 1LS1A 4IWBA 2JPUA 2LFDA 1OQCA 4U5DE 2QTVA 4MW3A 2P6VA 3UGPA 1F1MA 1VB5A 2LQGA 2NUTB 1ZW3A 1L7CA 1HW2A 3U9JA 4C3DA 1S7ZA 2VCCA 1PCXA 3K33A 1MQVA 4N6HA 1JOGA 4MVQA 1OW7A 4WJ0A 2NUTA 4BJ5A 4YT2A 1TWGA 3LNMB 1A7EA 2J45A 2J7PD 3C8GB 4CBEA 1BZ4A 3HTKC 1CGNA 3WAQA 4JIOA 2XM4A 4MNDA 4DRJB 1D1AA 4LDQA 3IHUA 3C8GA 4JRZA 1SMYF 2ZXPA 3FHDA 2XLEA 3MBGA 2J9BA 1GS9A 3JRMO 4W8KA 1FFTC 1TWHA 2CYDA 2PX0A 2HV7A 4JCZA 5T3TA 1EA8A 4HFKB 4XQ1A 2Q7RA 3B0VC 1OXKA 2PFDA 5A6KA 3DE9A 4CSAA 4U5FE 2HUJA 3DM5A 2HSQA 3JCUQ 3LNRA 4D4NA 3EQLF 4Z9JA 3W8IA 5A6AA 2HJ3A 3CEXA 3ZIBA 1SZIA 2P7VA 4BEMJ 2BL2A 256BA 1TQGA 3SZRA 4AL1A 4K1OA 3I5PA 5BQIA 4CS9A 2CNWA 3HNJA 3ABKC 3E70C 1U6HA 2LD6A 5COFA 1T01A 2EPNA 3ASNC 3KH2A 3LUTB 4YL0A 4PACA 1QZXA 2EILC 4QDLA 5L3VA 2A1DD 3T6BA 3ZQYA 3ZSUA 4XTKA 5B3SC 1Q0KA 2YL7A 3KYJA 1KNYA 2KSFA 2LIGA 4JKVA 3N0TA 2VASA 5BQGA 3RH3A 4NTAA 2AU5A 3U3BA 4YL1A 2KK1A 3AG3C 4DRHB 3EH1A 2IOQA 1OR2A 1HE1A 1T6UA 1UFBA 2EIJC 2WVOA 2Y3HA 3I4UA 3QMKA 3QTHA 2J9UA 3RQGA 3S9OA 3W8HA 4CS7A 5KYXB 3UGOA 2A6HF 1HW1A 1OW6A 3G50A 4XEKA 3DAGA 2ZXOA 3FMSA 3GEHA 1YVIA 2XLOA 4DVYP 5KYXA 4MVSA 3ABMC 2P1AA 1OCZC 1M6TA 2OJQA 3ZWIA 5JLIA 4JCHA 3A11A 3IQTA 2EIKC 3NMKA 2FAPB 2Y69C 1LI7A 3VYWA 3TK0A 5KYWB 3AG4C 1PD1A 3C18A 3K66A 3U8VA 2I15A 3TULA 2GAQA 2ZXRA 3FAJA 5KYWA 1Z3IX 3LEOA 2YQYA 4LACB 5L0DA 4KNWA 4U5EE 5L0IA 4PFOA 2KNHA 4E7SA 3C8GD 2I8BA 3NYLA 4BG0A 2YRFA 3CZ6A 2KJGA 4JEBA 2KC3A 4JTAB 5F28E 2R7RA 3Q6MA 3RVZA 2W9YA 1VOMA 4U9EA 2MHRA 2Q00A 4E0IA 5DS4A 1G4US 3DXJF 1JPNA 3WHNA 1H7IA 2DYRC 2L81A 4CDAA 5CIVA 2L9JA 4A2NB 2Q9BA 2IXMA 3QZCA 3ZTMA 3UMKA 2R7SA 2W4MA 2HMZA 1FTSA 1YA9A 3GM1A 5L0CA 1YARO 1ZZPA 2NG1A 4PJLA 4Q5SF 4K7BA 1I4YA 4O7GA 5DVWA 2EPOA 3VRCA 4DJ9A 4LLCA 2CNWD 2ZD9A 3RF3A 3V5XA 4RD9A 1D0YA 1N1CA 1YAUO 2Y3GA 4EBBA 3PDMP 4MVOA 1PD0A 2A0BA 3VF0A 1ZHZA 3M15A 4G78A 4HEAJ 3U2LA 1BR2A 1NSGB 3M4BA 3EZIA 1YDIA 3G4ZA 3PCVA 4DRIB 4EBKA 2R7OA 3KYIA 2RSEB 5A6JA 2CW0F 4BJ5C 2YZSA 2D5RB 1LS4A 1RKCA 2VB6A 5KYUB 3NDBB 5JT4A 3G4XA 4HE8D 1JAFA 2BE5F 1W2WA 3CSKA 3EGDB 3M79A 3MFNA 5KYUA 2QE9A 3OWTA 3U0CA 1OCRC 3H2VA 3TQOA 4AK9A 3EGDA 3HNLA 1BBHA 2YLDA 4JEAA 1CGME 2Q9AA 4Z9IA 4EWCA 5F5FA 5KYNA 4ULWA 4DXWA 3EPVA 3K6BA 3ECSA 2Y3BA 4BJ6A 4QI0A 4CJGA 4LDKA 2Q3TA 3GORA 1L3PA 2HSBA 4J7YA 3NYJA 4CSAC 2A0UA 1M56C 1NU7D 2C04A 2H7BA 2J8WA 4Q7CA 1WN0A 1H9GA 1BR1A 1VLSA 3AG1C 3KKBA 4IGGA 2R7WA 3S28A 3W2WA 1NBBA 1FR0A 1C03A 2KYHA 3X1OA 1HMDA 3KPHA 1RKEB 4BEJA 2G62A 4E17A 1ZHWA 2P61A 3NKEA 3Q6NA 1C17M 3JSEO 1AUEA 4BPMA 4C3BA 1V54C 4CS9C 1RKEA 3RQEA 3IEEA 2YL1A 4I3MA 2A6EF 4W8PA 1KTMA 1O87A 5HV9A 1Y6DA 4I44A 1AEPA 2HJMA 4MW8A 4NCQA 1RCPA 1LE4A 4U5CE 3SYNA 3TOMA 1E2XA 3US6A 3JRTA 1TWAA 1EQ1A 1TWCA 1CPRA 1VYIA 4IARA 1ORYA 2J9WA 2XLMA 4XPYA 2YLIA 4GYTA 1M2OA 4LLEA 1IW7F 3GWLA 3BEHA 1MMGA 1U0BB 3AOUA 3GANA 2IBFA 2WZGA 5DQZA 4KNVA 3B29A 2EIMC 4ZLCA 1G5ZA 1ZYRF 3DJUB 4P6IC 5L0GA 2PNOA 3DM9B 1NU9C 3FOOA 4J32B 4KBLA 5L3QA 2GDCA 3UNGC 1QPUA 2KW3C 2YEVA 4MTFA 1A0BA 3TJ5A 2PBEA 1ZHTA 3K1HA 3U2MA 1V4AA 3U9MA 4DVZA 3LLKA 4H4KC 4EIYA 3EG9B 3EFOB 3RYLA 3C62A 3C63A 4N06A 3DWWA 3ZTZA 2IXOA 3EFOA 3EG9A 4IAQA 2WZFA 3EHMA 1SR2A 3OEOA 2AWCA 3DE8A 3U3FA 1Z63A 3DMDA 2KGOA 3FDQA 2DYSC 3EGXB 2R7QA 3LS1A 2H7OA 1RJ9B 4CIHA 4GEHA 3T9OA 2RD9A 3VM6A 4NC3A 2YKZA 5COGA 2LK4A 4P9FA 3EGXA 3IQ6A 4YN0B 1RJ9A 4K0DA 1JR8A 3IQCA 3S90A 3T6GB 2L7AA 1YZAA 2W45A 3M1CB 2OQMA 2HV6A 4MVUA 3S84A 3L1MA 2OCCC 1TR2A 4OIQF 1WASA 1U89A 3IQ5A 1E85A 1VMAA 3JSZA 1A7VA 3SXMA 5HSWA 1VK5A 2AP3A 1FFHA 2ZPAA 3VAYA 3B0PA 3SXZA 5JVEA 2JX0A 5EGYA 5EHHA 3JZ0A 2J9VA 4JVSA 4JE9A 1Z5ZA 2ASRA 4PJJA 4P9TA 1VLTA 2R7VA 1LE2A 2R25A 2QNLA 3GM2A 2QUPA 3E9VA 1IZMA 2YHSA 4UDVA 5A6BA 3CQZA 3RKOF 2OKUA 1QSPA 1WGWA 2LP4A 2QY9A 2UUIA 3O55A 3JTLO 2L6GA 3B9QA 3J06A 2HMQA 3R2PA 3H65A 4JW1A 4E0HA 3SNHA 1XWJA 1Z6AA 2OEVA 2V3CC 3S29A 4M63A 2P0NA 2XS8A 3UR3C 4BJ6C 1JMWA 1D1BA 2EPMX 3NRHA 4U9DA 5TJ5E 5KYYB 3U8PA 3ABLC 4PFPA 5AGFA 4C7OB 1J8MF 1LM3B 4RBNA 1OXBA 4N4WA 4FAPB 5KYYA 3LAYA 5L0HA 4KI2A 1J8YF 3HNKA 1C02A 1Q0FA 4C7OA 3DI5A 4L6RA 4CDVA 3QW0A 3RQFA 3W2VA 2Y3DA 2DB4A 4YJWA 2CGEA 4J7TA 2LFFA 5D92A 2Q4FA 4LERA 4OIOF 1RMVA 2A68F 2Q9CA 2GFHA 2Y39A 4Z9HA 3CAXA 1HY5A 1APCA 5BQHA 3RVYA 1H6GA 3T4RA 2PX3A 1S05A 3UMHA 4XEVA 2ZXWC 3GWNA 4CDYA 4JTCB 4ANJA 2LCHA 1NZEA 5T3WA 1Y4CA 2WVNA 1SF8A 5K0IA
chains in the Genus database with same CATH topology
3KMIA 5CI9A 3PHF2 4OD4A 1JPJA 1ZU5A 1BR4A 1MMAA 3PMRA 1ZHXA 3EZHA 3Q7LA 4FWVA 4G7ZF 1FMWA 1OKKA 4U5GA 3L0IA 3NKDA 4OIPF 3ITFA 2NUPB 1V55C 3WG7C 4YWQA 4G7OF 2NUPA 2J0XA 2O9XA 2H7VC 3JT1A 2W4BA 3TD7A 4C3EA 2E87A 1G8XA 3F46A 4MNDA 2IXPA 3SEOA 4DBQA 2X51A 1LKXA 3MLGA 2WL8A 4QI2A 4G0HA 3I5QA 2G3VA 4U5HA 4O79A 5E3AA 3OA1A 1ZHYA 3DJNB 5DS5A 2FFHA 1MNEA 3JYHA 2KQ9A 1D0ZA 3HLZA 3X2QC 4F4BA 4FESA 3LLIA 1LVKA 4OINF 5IY5C 3LS0A 3NYMA 3POVA 4U5BE 4DOZA 2Z15A 2R7UA 3V7OA 3Q7GA 2J46A 3LJBA 4XLNF 4CS8A 3K7DA 3N24A 4O6MA 5B1BC 4PK4A 1NG1A 3T6JA 2XRHA 4O6YA 2J0WA 2EINC 3FVYA 1OCCC 4JZAA 5F5HA 3AG2C 4E7ZA 3EH2A 4FX5A 4YT5A 4O6NA 5T1DB 5BUOA 4XLPF 1OKKD 3SP1A 2FGYA 3ZC4A 3RFYA 4X0RA 2A69F 4G7HF 1FMVA 5D91A 2IYLD 1TKNA 1QLEC 3DD7A 2LSEA 3N2ZB 3AQBA 3S27A 2WZLA 1Z23A 4HFFB 4OIRF 4XWJA 4PJNA 2PP4A 3EHNA 4JURI 4MQ9F 1MMNA 5E2QA 4YT8A 2XSEA 4I1MA 4B6IA 2CDQA 2JD3A 4PJMA 3WODF 5E33A 3LEVA 1O5HA 3O6XA 2MWQA 1MMDA 2VH3A 1OCOC 2WVQA 3DZAA 3LESA 4J30B 2WB7A 2M4EA 3ASOC 2J7PA 4I1OB 4BJ1A 3L34A 4RDAA 3MX3A 4JJFA 3UMIA 5DQTA 5FCLA 5DLJA 4NY3A 2R7XA 5DS6A 3AQCA 3GODA 4Q5SF 2DGJA 4DBRA 4AX2A 1D0XA 4OD5A 5B1AC 2MYSA 4AE4B 1D1CA 4BJTA 2XXAB 2R7TA 4AE4A 1MNDA 2PF4E 3ZVRA 2XXAA 2IXNA 4Q4ZF 3EJNA 3KL4A 3B0UX 4YT4A 3DAFA 4IJJA 2V26A 3HJCA 4KC9A 2B0JA 3K1IC 2C03A 3NG1A 3RIPA 1KU2A 1VYKA 1ST6A 4JJGA 4ZLDA 3ZG1A 2G3KA 3S0XA 2OG2A 3F47A 5CI8A 1M57C 4IRUA 3O39A 2XL4A 1ZU4A 4IAOA 1M2VB 5E3CA 4CS8C 1M2VA 1LS1A 4IWBA 4U5DE 2QTVA 2P6VA 3UGPA 2NUTB 4C3DA 1S7ZA 4WJ0A 1PCXA 3K33A 4BJ5A 4YT2A 2NUTA 1TWGA 2J45A 2J7PD 4CBEA 3HTKC 1D1AA 1SMYF 2ZXPA 3FHDA 4W8KA 1TWHA 1FFTC 2PX0A 5T3TA 2HV7A 4HFKB 3B0VC 2PFDA 4CSAA 4U5FE 3DM5A 3JCUQ 3LNRA 3EQLF 3W8IA 3ZIBA 1SZIA 2P7VA 3SZRA 3I5PA 4CS9A 2CNWA 3ABKC 3E70C 3ASNC 3KH2A 1QZXA 2EILC 4QDLA 5L3VA 2A1DD 3T6BA 3ZSUA 4XTKA 5B3SC 3RH3A 3N0TA 2VASA 3AG3C 3EH1A 2IOQA 3I4UA 2EIJC 2WVOA 2Y3HA 3QMKA 3UGOA 2J9UA 5KYXB 3W8HA 4CS7A 2A6HF 3DAGA 2ZXOA 4DVYP 5KYXA 3ABMC 1OCZC 4JCHA 2EIKC 2Y69C 3VYWA 5KYWB 3AG4C 1PD1A 3K66A 2ZXRA 3FAJA 5KYWA 1Z3IX 4LACB 4KNWA 4U5EE 4PFOA 2KNHA 4E7SA 4BG0A 2I8BA 3NYLA 3CZ6A 2R7RA 2KJGA 3Q6MA 2W9YA 1VOMA 5DS4A 3DXJF 1JPNA 2DYRC 2L81A 2L9JA 4A2NB 2Q9BA 2IXMA 3QZCA 3UMKA 2R7SA 2W4MA 1FTSA 2NG1A 4PJLA 4K7BA 4O7GA 5DVWA 4LLCA 2CNWD 4EBBA 4RD9A 1N1CA 1D0YA 2Y3GA 1PD0A 1ZHZA 4HEAJ 1BR2A 3EZIA 2R7OA 2CW0F 4BJ5C 2YZSA 2D5RB 2VB6A 5KYUB 3NDBB 4HE8D 3CSKA 2BE5F 1W2WA 3EGDB 5KYUA 3OWTA 1OCRC 4AK9A 3EGDA 2Q9AA 4EWCA 5F5FA 5KYNA 4ULWA 3EPVA 3K6BA 3ECSA 2Y3BA 4BJ6A 4QI0A 2Q3TA 4CSAC 3NYJA 1M56C 1NU7D 2C04A 2H7BA 4Q7CA 1BR1A 3AG1C 2R7WA 3KKBA 3S28A 3W2WA 3X1OA 4BEJA 2G62A 1ZHWA 3Q6NA 3NKEA 4C3BA 4CS9C 1V54C 3IEEA 4I3MA 2A6EF 1O87A 4I44A 3SYNA 4U5CE 3JRTA 1TWAA 1TWCA 1VYIA 2J9WA 4GYTA 1M2OA 4LLEA 1IW7F 1MMGA 3GANA 2WZGA 5DQZA 4KNVA 2EIMC 4ZLCA 3DJUB 1ZYRF 4P6IC 3DM9B 1NU9C 4J32B 4KBLA 5L3QA 3UNGC 2KW3C 2YEVA 3K1HA 1ZHTA 4DVZA 3LLKA 4H4KC 3EG9B 3EFOB 3RYLA 4N06A 2IXOA 3EFOA 3EG9A 2WZFA 3EHMA 1Z63A 3OEOA 3DMDA 2KGOA 3FDQA 2DYSC 3EGXB 2R7QA 3LS1A 2H7OA 1RJ9B 4CIHA 4GEHA 3EGXA 4YN0B 1RJ9A 4K0DA 2W45A 3M1CB 2HV6A 2OCCC 1TR2A 4OIQF 1VMAA 3JSZA 5HSWA 1VK5A 2ZPAA 1FFHA 3VAYA 3B0PA 5EGYA 5EHHA 2J9VA 4JVSA 1Z5ZA 4PJJA 2R7VA 3E9VA 1IZMA 2YHSA 3CQZA 3RKOF 1WGWA 2QY9A 3B9QA 3H65A 4JW1A 3SNHA 1Z6AA 2V3CC 3S29A 4M63A 3UR3C 4BJ6C 1D1BA 3NRHA 5KYYB 3ABLC 4PFPA 4C7OB 1J8MF 4RBNA 4KI2A 5KYYA 3LAYA 1J8YF 4C7OA 3W2VA 2Y3DA 4YJWA 2CGEA 5D92A 4LERA 4OIOF 2A68F 2Q9CA 2GFHA 2Y39A 3T4RA 2PX3A 3UMHA 2ZXWC 4ANJA 1NZEA 5T3WA 2WVNA 1SF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QI2 A;  5F5H A;  4ZLC A;  5F5F A;  4ZLD A;  4YWQ A;  4ULW A;  3X1O A;  4QI0 A; 
#chains in the Genus database with same CATH topology
 1EKY A;  3KMI A;  1LIH A;  3O10 A;  5CI9 A;  3PHF 2;  4OD4 A;  1JPJ A;  1A7D A;  3M4C A;  2R05 A;  1K05 A;  1ZU5 A;  3SXK A;  4EBJ A;  4YK5 A;  1BR4 A;  1MMA A;  3PMR A;  1DOV A;  1ZHX A;  2YL3 A;  2H8A A;  1FAP B;  3MYF A;  2OJE D;  3EZH A;  3Q7L A;  1H9T A;  1CGO A;  4FWV A;  2YLG A;  4G7Z F;  1FMW A;  2NSG A;  1I4Z A;  2OU6 A;  3IPM O;  1OKK A;  4U5G A;  3L0I A;  1YZC A;  5JUA A;  1VTM P;  1QQ3 A;  3AGU A;  2YVK A;  1WAT A;  2XS1 A;  1A41 A;  3NKD A;  1R4T A;  3ITF A;  5A6B D;  2NUP B;  4OIP F;  4MVR A;  4NTB A;  2IM8 A;  3C8Z A;  1V55 C;  3WG7 C;  4YWQ A;  4G7O F;  2GWW A;  2NUP A;  2J0X A;  3MYI A;  4GQH A;  3B71 A;  2O9X A;  3TOL A;  2H7V C;  3JT1 A;  2W4B A;  3TD7 A;  4C3E A;  1QKR A;  1G8X A;  1XZQ A;  1V74 B;  2E87 A;  3F46 A;  3GEI A;  3QVZ A;  3GEE A;  2IXP A;  1JRA A;  3JYY A;  4WGZ A;  3SEO A;  2X51 A;  4DBQ A;  2TMV P;  4D4X A;  1ZW2 A;  1LKX A;  1ZVZ A;  3MLG A;  3NMJ A;  2WL8 A;  4QI2 A;  2ICW G;  5L0F A;  4G0H A;  3I5Q A;  2GA0 A;  2XM0 A;  2G3V A;  4U5H A;  5AC5 A;  4O79 A;  5E3A A;  3OA1 A;  1ZHY A;  3DJN B;  1BDJ B;  5DS5 A;  2FFH A;  3K1I A;  1YLM A;  2XLD A;  1MNE A;  3H2U A;  4ULV A;  3JYH A;  1ORS C;  2KQ9 A;  1D0Z A;  1DOW A;  2BC5 A;  3NMI A;  5JS5 A;  3HLZ A;  1EI7 A;  3SXY A;  3X2Q C;  4F4B A;  1OR3 A;  4FES A;  3LLI A;  1LPE A;  1YA7 O;  1Q0M A;  4NQF A;  5JSL A;  3ZDL A;  1LVK A;  4OIN F;  4A4A A;  5IY5 C;  3LS0 A;  3NYM A;  3POV A;  1B68 A;  4CIP A;  4MTO A;  4U5B E;  1K40 A;  1OW8 A;  2YL0 A;  1RXQ A;  2Z15 A;  4DOZ A;  2L6F A;  1G4W R;  1WWP A;  2R9R B;  3V7O A;  2R7U A;  3Q7G A;  1TFK B;  2J46 A;  3LJB A;  4XLN F;  4CS8 A;  1UG7 A;  1T6Q A;  4EUK B;  3K7D A;  2B0H A;  3RW0 A;  3N24 A;  3U5S A;  2YWA A;  2NPU A;  2CCY A;  4O6M A;  5B1B C;  4PK4 A;  1NG1 A;  3GM3 A;  3T6J A;  2XRH A;  1WOL A;  2J0W A;  2XLV A;  2EIN C;  3FVY A;  1OCC C;  4JZA A;  4O6Y A;  2UUH A;  3AG2 C;  2X0C A;  3EH2 A;  1T5O A;  4FX5 A;  4E7Z A;  4YT5 A;  2EPL X;  3V5Z A;  4O6N A;  5T1D B;  5BUO A;  4XLP F;  1OKK D;  3SP1 A;  3V5Y A;  1HMO A;  1FNT c;  1E84 A;  2FGY A;  1AVO B;  3ZC4 A;  2R03 A;  5COM A;  3AGT A;  2ETS A;  3RFY A;  4X0R A;  4EHP A;  4JTD B;  2A69 F;  4G7H F;  1FMV A;  5D91 A;  3HKK A;  2IYL D;  1LI5 A;  1R5I D;  1ORJ A;  1QLE C;  1TKN A;  1YYX A;  2LSE A;  3DD7 A;  3N2Z B;  3AQB A;  4JC7 A;  3ZQV A;  3S27 A;  2WZL A;  1NFN A;  1Z23 A;  3W4Y A;  1YJG A;  4HFF B;  4XWJ A;  4PJN A;  2PP4 A;  3DKA A;  4OIR F;  5JRA A;  3EHN A;  3L8J A;  5F5H A;  4JUR I;  4MQ9 F;  4CX9 A;  1MMN A;  5E2Q A;  4YT8 A;  2AVK A;  1K04 A;  2XSE A;  4I1M A;  4B6I A;  2XL6 A;  2HFI A;  2CDQ A;  2JD3 A;  2AWY A;  4PJM A;  5AC4 A;  4H54 A;  4MVM A;  4MVZ A;  3WOD F;  4N6C A;  2XLH A;  2OEX A;  5E33 A;  3LEV A;  2R02 A;  1XZP A;  1O5H A;  3O6X A;  2MWQ A;  1MMD A;  1Q0D A;  1OCO C;  1GGQ A;  2VH3 A;  2WVQ A;  3DZA A;  3LES A;  1YYJ A;  4J30 B;  2WB7 A;  2M4E A;  4R32 A;  4YL3 A;  3ASO C;  2J7P A;  4EKW A;  1CPQ A;  4I1O B;  4LDR A;  4XEF A;  4BJ1 A;  2VCB A;  3L34 A;  1I5N A;  3QW1 A;  1Z7Q c;  4RDA A;  3ATP A;  3MX3 A;  4JJF A;  3UMI A;  2L6H A;  5DQT A;  5DLJ A;  4CJO A;  5FCL A;  4NY3 A;  2R7X A;  5DS6 A;  3AQC A;  1HE9 A;  2VCA A;  3FXH A;  3GOD A;  4ONS A;  2DGJ A;  2NSF A;  4XPX A;  5GPG B;  4DBR A;  4ER9 A;  2HZ8 A;  5EK0 A;  3C7J A;  3HNI A;  1D0X A;  4AX2 A;  2XLW A;  4OD5 A;  5B1A C;  2MYS A;  3L8I A;  4AE4 B;  1D1C A;  3R7C A;  1GM5 A;  4MTG A;  3QVY A;  2HKV A;  4BJT A;  2DI3 A;  1GQA A;  1T6I A;  5L0J A;  2XXA B;  2R7T A;  4AE4 A;  4NTF A;  1MND A;  1QVX A;  2PF4 E;  3ZVR A;  4WAB A;  2XXA A;  2IXN A;  2M64 A;  3BRJ A;  2VC9 A;  4Q4Z F;  3EJN A;  3KL4 A;  1NFO A;  3B0U X;  1NLX A;  4YT4 A;  3DAF A;  5B3I A;  1E83 A;  1WTY A;  2EPK X;  4IJJ A;  2V26 A;  4MS2 A;  3A9C A;  2QLA A;  3HJC A;  2B0J A;  4KC9 A;  4XPW A;  4E18 A;  3K1I C;  2C03 A;  3NG1 A;  3RIP A;  1KU2 A;  1VYK A;  5JP7 A;  5A69 A;  1ST6 A;  4JJG A;  5FZT A;  4ZLD A;  4IB4 A;  1Q0G A;  3AJM A;  2OOC A;  3ZG1 A;  2G3K A;  3S0X A;  1SYQ A;  4AL0 A;  2OG2 A;  3F47 A;  1PV3 A;  2HS5 A;  5CI8 A;  1TFO B;  4WGY A;  3FOP A;  1M57 C;  3FAP B;  3O39 A;  4IRU A;  4PR9 A;  1E86 A;  3TJ6 A;  2XL8 A;  2XL4 A;  1ZU4 A;  2D4U A;  4IAO A;  1M2V B;  5E3C A;  2F22 A;  4CS8 C;  1T9K A;  1O3U A;  1M2V A;  1LS1 A;  4IWB A;  2JPU A;  2LFD A;  1OQC A;  4U5D E;  2QTV A;  4MW3 A;  2P6V A;  3UGP A;  1F1M A;  1VB5 A;  2LQG A;  2NUT B;  1ZW3 A;  1L7C A;  1HW2 A;  3U9J A;  4C3D A;  1S7Z A;  2VCC A;  1PCX A;  3K33 A;  1MQV A;  4N6H A;  1JOG A;  4MVQ A;  1OW7 A;  4WJ0 A;  2NUT A;  4BJ5 A;  4YT2 A;  1TWG A;  3LNM B;  1A7E A;  2J45 A;  2J7P D;  3C8G B;  4CBE A;  1BZ4 A;  3HTK C;  1CGN A;  3WAQ A;  4JIO A;  2XM4 A;  4MND A;  4DRJ B;  1D1A A;  4LDQ A;  3IHU A;  3C8G A;  4JRZ A;  1SMY F;  2ZXP A;  3FHD A;  2XLE A;  3MBG A;  2J9B A;  1GS9 A;  3JRM O;  4W8K A;  1FFT C;  1TWH A;  2CYD A;  2PX0 A;  2HV7 A;  4JCZ A;  5T3T A;  1EA8 A;  4HFK B;  4XQ1 A;  2Q7R A;  3B0V C;  1OXK A;  2PFD A;  5A6K A;  3DE9 A;  4CSA A;  4U5F E;  2HUJ A;  3DM5 A;  2HSQ A;  3JCU Q;  3LNR A;  4D4N A;  3EQL F;  4Z9J A;  3W8I A;  5A6A A;  2HJ3 A;  3CEX A;  3ZIB A;  1SZI A;  2P7V A;  4BEM J;  2BL2 A;  256B A;  1TQG A;  3SZR A;  4AL1 A;  4K1O A;  3I5P A;  5BQI A;  4CS9 A;  2CNW A;  3HNJ A;  3ABK C;  3E70 C;  1U6H A;  2LD6 A;  5COF A;  1T01 A;  2EPN A;  3ASN C;  3KH2 A;  3LUT B;  4YL0 A;  4PAC A;  1QZX A;  2EIL C;  4QDL A;  5L3V A;  2A1D D;  3T6B A;  3ZQY A;  3ZSU A;  4XTK A;  5B3S C;  1Q0K A;  2YL7 A;  3KYJ A;  1KNY A;  2KSF A;  2LIG A;  4JKV A;  3N0T A;  2VAS A;  5BQG A;  3RH3 A;  4NTA A;  2AU5 A;  3U3B A;  4YL1 A;  2KK1 A;  3AG3 C;  4DRH B;  3EH1 A;  2IOQ A;  1OR2 A;  1HE1 A;  1T6U A;  1UFB A;  2EIJ C;  2WVO A;  2Y3H A;  3I4U A;  3QMK A;  3QTH A;  2J9U A;  3RQG A;  3S9O A;  3W8H A;  4CS7 A;  5KYX B;  3UGO A;  2A6H F;  1HW1 A;  1OW6 A;  3G50 A;  4XEK A;  3DAG A;  2ZXO A;  3FMS A;  3GEH A;  1YVI A;  2XLO A;  4DVY P;  5KYX A;  4MVS A;  3ABM C;  2P1A A;  1OCZ C;  1M6T A;  2OJQ A;  3ZWI A;  5JLI A;  4JCH A;  3A11 A;  3IQT A;  2EIK C;  3NMK A;  2FAP B;  2Y69 C;  1LI7 A;  3VYW A;  3TK0 A;  5KYW B;  3AG4 C;  1PD1 A;  3C18 A;  3K66 A;  3U8V A;  2I15 A;  3TUL A;  2GAQ A;  2ZXR A;  3FAJ A;  5KYW A;  1Z3I X;  3LEO A;  2YQY A;  4LAC B;  5L0D A;  4KNW A;  4U5E E;  5L0I A;  4PFO A;  2KNH A;  4E7S A;  3C8G D;  2I8B A;  3NYL A;  4BG0 A;  2YRF A;  3CZ6 A;  2KJG A;  4JEB A;  2KC3 A;  4JTA B;  5F28 E;  2R7R A;  3Q6M A;  3RVZ A;  2W9Y A;  1VOM A;  4U9E A;  2MHR A;  2Q00 A;  4E0I A;  5DS4 A;  1G4U S;  3DXJ F;  1JPN A;  3WHN A;  1H7I A;  2DYR C;  2L81 A;  4CDA A;  5CIV A;  2L9J A;  4A2N B;  2Q9B A;  2IXM A;  3QZC A;  3ZTM A;  3UMK A;  2R7S A;  2W4M A;  2HMZ A;  1FTS A;  1YA9 A;  3GM1 A;  5L0C A;  1YAR O;  1ZZP A;  2NG1 A;  4PJL A;  4Q5S F;  4K7B A;  1I4Y A;  4O7G A;  5DVW A;  2EPO A;  3VRC A;  4DJ9 A;  4LLC A;  2CNW D;  2ZD9 A;  3RF3 A;  3V5X A;  4RD9 A;  1D0Y A;  1N1C A;  1YAU O;  2Y3G A;  4EBB A;  3PDM P;  4MVO A;  1PD0 A;  2A0B A;  3VF0 A;  1ZHZ A;  3M15 A;  4G78 A;  4HEA J;  3U2L A;  1BR2 A;  1NSG B;  3M4B A;  3EZI A;  1YDI A;  3G4Z A;  3PCV A;  4DRI B;  4EBK A;  2R7O A;  3KYI A;  2RSE B;  5A6J A;  2CW0 F;  4BJ5 C;  2YZS A;  2D5R B;  1LS4 A;  1RKC A;  2VB6 A;  5KYU B;  3NDB B;  5JT4 A;  3G4X A;  4HE8 D;  1JAF A;  2BE5 F;  1W2W A;  3CSK A;  3EGD B;  3M79 A;  3MFN A;  5KYU A;  2QE9 A;  3OWT A;  3U0C A;  1OCR C;  3H2V A;  3TQO A;  4AK9 A;  3EGD A;  3HNL A;  1BBH A;  2YLD A;  4JEA A;  1CGM E;  2Q9A A;  4Z9I A;  4EWC A;  5F5F A;  5KYN A;  4ULW A;  4DXW A;  3EPV A;  3K6B A;  3ECS A;  2Y3B A;  4BJ6 A;  4QI0 A;  4CJG A;  4LDK A;  2Q3T A;  3GOR A;  1L3P A;  2HSB A;  4J7Y A;  3NYJ A;  4CSA C;  2A0U A;  1M56 C;  1NU7 D;  2C04 A;  2H7B A;  2J8W A;  4Q7C A;  1WN0 A;  1H9G A;  1BR1 A;  1VLS A;  3AG1 C;  3KKB A;  4IGG A;  2R7W A;  3S28 A;  3W2W A;  1NBB A;  1FR0 A;  1C03 A;  2KYH A;  3X1O A;  1HMD A;  3KPH A;  1RKE B;  4BEJ A;  2G62 A;  4E17 A;  1ZHW A;  2P61 A;  3NKE A;  3Q6N A;  1C17 M;  3JSE O;  1AUE A;  4BPM A;  4C3B A;  1V54 C;  4CS9 C;  1RKE A;  3RQE A;  3IEE A;  2YL1 A;  4I3M A;  2A6E F;  4W8P A;  1KTM A;  1O87 A;  5HV9 A;  1Y6D A;  4I44 A;  1AEP A;  2HJM A;  4MW8 A;  4NCQ A;  1RCP A;  1LE4 A;  4U5C E;  3SYN A;  3TOM A;  1E2X A;  3US6 A;  3JRT A;  1TWA A;  1EQ1 A;  1TWC A;  1CPR A;  1VYI A;  4IAR A;  1ORY A;  2J9W A;  2XLM A;  4XPY A;  2YLI A;  4GYT A;  1M2O A;  4LLE A;  1IW7 F;  3GWL A;  3BEH A;  1MMG A;  1U0B B;  3AOU A;  3GAN A;  2IBF A;  2WZG A;  5DQZ A;  4KNV A;  3B29 A;  2EIM C;  4ZLC A;  1G5Z A;  1ZYR F;  3DJU B;  4P6I C;  5L0G A;  2PNO A;  3DM9 B;  1NU9 C;  3FOO A;  4J32 B;  4KBL A;  5L3Q A;  2GDC A;  3UNG C;  1QPU A;  2KW3 C;  2YEV A;  4MTF A;  1A0B A;  3TJ5 A;  2PBE A;  1ZHT A;  3K1H A;  3U2M A;  1V4A A;  3U9M A;  4DVZ A;  3LLK A;  4H4K C;  4EIY A;  3EG9 B;  3EFO B;  3RYL A;  3C62 A;  3C63 A;  4N06 A;  3DWW A;  3ZTZ A;  2IXO A;  3EFO A;  3EG9 A;  4IAQ A;  2WZF A;  3EHM A;  1SR2 A;  3OEO A;  2AWC A;  3DE8 A;  3U3F A;  1Z63 A;  3DMD A;  2KGO A;  3FDQ A;  2DYS C;  3EGX B;  2R7Q A;  3LS1 A;  2H7O A;  1RJ9 B;  4CIH A;  4GEH A;  3T9O A;  2RD9 A;  3VM6 A;  4NC3 A;  2YKZ A;  5COG A;  2LK4 A;  4P9F A;  3EGX A;  3IQ6 A;  4YN0 B;  1RJ9 A;  4K0D A;  1JR8 A;  3IQC A;  3S90 A;  3T6G B;  2L7A A;  1YZA A;  2W45 A;  3M1C B;  2OQM A;  2HV6 A;  4MVU A;  3S84 A;  3L1M A;  2OCC C;  1TR2 A;  4OIQ F;  1WAS A;  1U89 A;  3IQ5 A;  1E85 A;  1VMA A;  3JSZ A;  1A7V A;  3SXM A;  5HSW A;  1VK5 A;  2AP3 A;  1FFH A;  2ZPA A;  3VAY A;  3B0P A;  3SXZ A;  5JVE A;  2JX0 A;  5EGY A;  5EHH A;  3JZ0 A;  2J9V A;  4JVS A;  4JE9 A;  1Z5Z A;  2ASR A;  4PJJ A;  4P9T A;  1VLT A;  2R7V A;  1LE2 A;  2R25 A;  2QNL A;  3GM2 A;  2QUP A;  3E9V A;  1IZM A;  2YHS A;  4UDV A;  5A6B A;  3CQZ A;  3RKO F;  2OKU A;  1QSP A;  1WGW A;  2LP4 A;  2QY9 A;  2UUI A;  3O55 A;  3JTL O;  2L6G A;  3B9Q A;  3J06 A;  2HMQ A;  3R2P A;  3H65 A;  4JW1 A;  4E0H A;  3SNH A;  1XWJ A;  1Z6A A;  2OEV A;  2V3C C;  3S29 A;  4M63 A;  2P0N A;  2XS8 A;  3UR3 C;  4BJ6 C;  1JMW A;  1D1B A;  2EPM X;  3NRH A;  4U9D A;  5TJ5 E;  5KYY B;  3U8P A;  3ABL C;  4PFP A;  5AGF A;  4C7O B;  1J8M F;  1LM3 B;  4RBN A;  1OXB A;  4N4W A;  4FAP B;  5KYY A;  3LAY A;  5L0H A;  4KI2 A;  1J8Y F;  3HNK A;  1C02 A;  1Q0F A;  4C7O A;  3DI5 A;  4L6R A;  4CDV A;  3QW0 A;  3RQF A;  3W2V A;  2Y3D A;  2DB4 A;  4YJW A;  2CGE A;  4J7T A;  2LFF A;  5D92 A;  2Q4F A;  4LER A;  4OIO F;  1RMV A;  2A68 F;  2Q9C A;  2GFH A;  2Y39 A;  4Z9H A;  3CAX A;  1HY5 A;  1APC A;  5BQH A;  3RVY A;  1H6G A;  3T4R A;  2PX3 A;  1S05 A;  3UMH A;  4XEV A;  2ZXW C;  3GWN A;  4CDY A;  4JTC B;  4ANJ A;  2LCH A;  1NZE A;  5T3W A;  1Y4C A;  2WVN A;  1SF8 A;  5K0I A; 
#chains in the Genus database with same CATH homology
 3KMI A;  5CI9 A;  3PHF 2;  4OD4 A;  1JPJ A;  1ZU5 A;  1BR4 A;  1MMA A;  3PMR A;  1ZHX A;  3EZH A;  3Q7L A;  4FWV A;  4G7Z F;  1FMW A;  1OKK A;  4U5G A;  3L0I A;  3NKD A;  4OIP F;  3ITF A;  2NUP B;  1V55 C;  3WG7 C;  4YWQ A;  4G7O F;  2NUP A;  2J0X A;  2O9X A;  2H7V C;  3JT1 A;  2W4B A;  3TD7 A;  4C3E A;  2E87 A;  1G8X A;  3F46 A;  4MND A;  2IXP A;  3SEO A;  4DBQ A;  2X51 A;  1LKX A;  3MLG A;  2WL8 A;  4QI2 A;  4G0H A;  3I5Q A;  2G3V A;  4U5H A;  4O79 A;  5E3A A;  3OA1 A;  1ZHY A;  3DJN B;  5DS5 A;  2FFH A;  1MNE A;  3JYH A;  2KQ9 A;  1D0Z A;  3HLZ A;  3X2Q C;  4F4B A;  4FES A;  3LLI A;  1LVK A;  4OIN F;  5IY5 C;  3LS0 A;  3NYM A;  3POV A;  4U5B E;  4DOZ A;  2Z15 A;  2R7U A;  3V7O A;  3Q7G A;  2J46 A;  3LJB A;  4XLN F;  4CS8 A;  3K7D A;  3N24 A;  4O6M A;  5B1B C;  4PK4 A;  1NG1 A;  3T6J A;  2XRH A;  4O6Y A;  2J0W A;  2EIN C;  3FVY A;  1OCC C;  4JZA A;  5F5H A;  3AG2 C;  4E7Z A;  3EH2 A;  4FX5 A;  4YT5 A;  4O6N A;  5T1D B;  5BUO A;  4XLP F;  1OKK D;  3SP1 A;  2FGY A;  3ZC4 A;  3RFY A;  4X0R A;  2A69 F;  4G7H F;  1FMV A;  5D91 A;  2IYL D;  1TKN A;  1QLE C;  3DD7 A;  2LSE A;  3N2Z B;  3AQB A;  3S27 A;  2WZL A;  1Z23 A;  4HFF B;  4OIR F;  4XWJ A;  4PJN A;  2PP4 A;  3EHN A;  4JUR I;  4MQ9 F;  1MMN A;  5E2Q A;  4YT8 A;  2XSE A;  4I1M A;  4B6I A;  2CDQ A;  2JD3 A;  4PJM A;  3WOD F;  5E33 A;  3LEV A;  1O5H A;  3O6X A;  2MWQ A;  1MMD A;  2VH3 A;  1OCO C;  2WVQ A;  3DZA A;  3LES A;  4J30 B;  2WB7 A;  2M4E A;  3ASO C;  2J7P A;  4I1O B;  4BJ1 A;  3L34 A;  4RDA A;  3MX3 A;  4JJF A;  3UMI A;  5DQT A;  5FCL A;  5DLJ A;  4NY3 A;  2R7X A;  5DS6 A;  3AQC A;  3GOD A;  4Q5S F;  2DGJ A;  4DBR A;  4AX2 A;  1D0X A;  4OD5 A;  5B1A C;  2MYS A;  4AE4 B;  1D1C A;  4BJT A;  2XXA B;  2R7T A;  4AE4 A;  1MND A;  2PF4 E;  3ZVR A;  2XXA A;  2IXN A;  4Q4Z F;  3EJN A;  3KL4 A;  3B0U X;  4YT4 A;  3DAF A;  4IJJ A;  2V26 A;  3HJC A;  4KC9 A;  2B0J A;  3K1I C;  2C03 A;  3NG1 A;  3RIP A;  1KU2 A;  1VYK A;  1ST6 A;  4JJG A;  4ZLD A;  3ZG1 A;  2G3K A;  3S0X A;  2OG2 A;  3F47 A;  5CI8 A;  1M57 C;  4IRU A;  3O39 A;  2XL4 A;  1ZU4 A;  4IAO A;  1M2V B;  5E3C A;  4CS8 C;  1M2V A;  1LS1 A;  4IWB A;  4U5D E;  2QTV A;  2P6V A;  3UGP A;  2NUT B;  4C3D A;  1S7Z A;  4WJ0 A;  1PCX A;  3K33 A;  4BJ5 A;  4YT2 A;  2NUT A;  1TWG A;  2J45 A;  2J7P D;  4CBE A;  3HTK C;  1D1A A;  1SMY F;  2ZXP A;  3FHD A;  4W8K A;  1TWH A;  1FFT C;  2PX0 A;  5T3T A;  2HV7 A;  4HFK B;  3B0V C;  2PFD A;  4CSA A;  4U5F E;  3DM5 A;  3JCU Q;  3LNR A;  3EQL F;  3W8I A;  3ZIB A;  1SZI A;  2P7V A;  3SZR A;  3I5P A;  4CS9 A;  2CNW A;  3ABK C;  3E70 C;  3ASN C;  3KH2 A;  1QZX A;  2EIL C;  4QDL A;  5L3V A;  2A1D D;  3T6B A;  3ZSU A;  4XTK A;  5B3S C;  3RH3 A;  3N0T A;  2VAS A;  3AG3 C;  3EH1 A;  2IOQ A;  3I4U A;  2EIJ C;  2WVO A;  2Y3H A;  3QMK A;  3UGO A;  2J9U A;  5KYX B;  3W8H A;  4CS7 A;  2A6H F;  3DAG A;  2ZXO A;  4DVY P;  5KYX A;  3ABM C;  1OCZ C;  4JCH A;  2EIK C;  2Y69 C;  3VYW A;  5KYW B;  3AG4 C;  1PD1 A;  3K66 A;  2ZXR A;  3FAJ A;  5KYW A;  1Z3I X;  4LAC B;  4KNW A;  4U5E E;  4PFO A;  2KNH A;  4E7S A;  4BG0 A;  2I8B A;  3NYL A;  3CZ6 A;  2R7R A;  2KJG A;  3Q6M A;  2W9Y A;  1VOM A;  5DS4 A;  3DXJ F;  1JPN A;  2DYR C;  2L81 A;  2L9J A;  4A2N B;  2Q9B A;  2IXM A;  3QZC A;  3UMK A;  2R7S A;  2W4M A;  1FTS A;  2NG1 A;  4PJL A;  4K7B A;  4O7G A;  5DVW A;  4LLC A;  2CNW D;  4EBB A;  4RD9 A;  1N1C A;  1D0Y A;  2Y3G A;  1PD0 A;  1ZHZ A;  4HEA J;  1BR2 A;  3EZI A;  2R7O A;  2CW0 F;  4BJ5 C;  2YZS A;  2D5R B;  2VB6 A;  5KYU B;  3NDB B;  4HE8 D;  3CSK A;  2BE5 F;  1W2W A;  3EGD B;  5KYU A;  3OWT A;  1OCR C;  4AK9 A;  3EGD A;  2Q9A A;  4EWC A;  5F5F A;  5KYN A;  4ULW A;  3EPV A;  3K6B A;  3ECS A;  2Y3B A;  4BJ6 A;  4QI0 A;  2Q3T A;  4CSA C;  3NYJ A;  1M56 C;  1NU7 D;  2C04 A;  2H7B A;  4Q7C A;  1BR1 A;  3AG1 C;  2R7W A;  3KKB A;  3S28 A;  3W2W A;  3X1O A;  4BEJ A;  2G62 A;  1ZHW A;  3Q6N A;  3NKE A;  4C3B A;  4CS9 C;  1V54 C;  3IEE A;  4I3M A;  2A6E F;  1O87 A;  4I44 A;  3SYN A;  4U5C E;  3JRT A;  1TWA A;  1TWC A;  1VYI A;  2J9W A;  4GYT A;  1M2O A;  4LLE A;  1IW7 F;  1MMG A;  3GAN A;  2WZG A;  5DQZ A;  4KNV A;  2EIM C;  4ZLC A;  3DJU B;  1ZYR F;  4P6I C;  3DM9 B;  1NU9 C;  4J32 B;  4KBL A;  5L3Q A;  3UNG C;  2KW3 C;  2YEV A;  3K1H A;  1ZHT A;  4DVZ A;  3LLK A;  4H4K C;  3EG9 B;  3EFO B;  3RYL A;  4N06 A;  2IXO A;  3EFO A;  3EG9 A;  2WZF A;  3EHM A;  1Z63 A;  3OEO A;  3DMD A;  2KGO A;  3FDQ A;  2DYS C;  3EGX B;  2R7Q A;  3LS1 A;  2H7O A;  1RJ9 B;  4CIH A;  4GEH A;  3EGX A;  4YN0 B;  1RJ9 A;  4K0D A;  2W45 A;  3M1C B;  2HV6 A;  2OCC C;  1TR2 A;  4OIQ F;  1VMA A;  3JSZ A;  5HSW A;  1VK5 A;  2ZPA A;  1FFH A;  3VAY A;  3B0P A;  5EGY A;  5EHH A;  2J9V A;  4JVS A;  1Z5Z A;  4PJJ A;  2R7V A;  3E9V A;  1IZM A;  2YHS A;  3CQZ A;  3RKO F;  1WGW A;  2QY9 A;  3B9Q A;  3H65 A;  4JW1 A;  3SNH A;  1Z6A A;  2V3C C;  3S29 A;  4M63 A;  3UR3 C;  4BJ6 C;  1D1B A;  3NRH A;  5KYY B;  3ABL C;  4PFP A;  4C7O B;  1J8M F;  4RBN A;  4KI2 A;  5KYY A;  3LAY A;  1J8Y F;  4C7O A;  3W2V A;  2Y3D A;  4YJW A;  2CGE A;  5D92 A;  4LER A;  4OIO F;  2A68 F;  2Q9C A;  2GFH A;  2Y39 A;  3T4R A;  2PX3 A;  3UMH A;  2ZXW C;  4ANJ A;  1NZE A;  5T3W A;  2WVN A;  1SF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...