3X1OA

Crystal structure of the roq domain of human roquin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
151
structure length
149
Chain Sequence
b'QQLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Roquin-1
publication title Roquin binds microRNA-146a and Argonaute2 to regulate microRNA homeostasis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 53
structure length 149
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3x1oA00
3X1OA 5F5HA 4ZLCA 4YWQA 4ZLDA 5F5FA 4ULWA 4QI0A 4QI2A
chains in the Genus database with same CATH superfamily
5BQHA 3S9OA 4MTGA 5B1AC 1YARO 3EFOA 3US6A 2AP3A 4BEJA 4LDRA 4N6HA 2NUPA 4IWBA 2KNHA 1OCZC 3C8GB 4LDQA 4EIYA 1CGME 2YWAA 1YYXA 1IZMA 5JVEA 3U8PA 4DJ9A 4G0HA 2PX0A 1K05A 2ETSA 3Q7GA 4FX5A 2NSFA 1E86A 2YZSA 3EFOB 2ZXPA 2HMQA 1M2OA 2NUPB 3L1MA 4OD5A 3UMKA 2LIGA 1T5OA 3O6XA 4LACB 1SMYF 1C17M 1TFOB 2J45A 4YK5A 3C62A 4N06A 4ZLDA 4GYTA 1TKNA 3NKEA 3QZCA 4KNWA 2JPUA 1IW7F 4ONSA 1WTYA 3WHNA 3H2UA 4HFKB 4LLCA 4JKVA 5JRAA 2A0BA 1Q0KA 3G4ZA 4CIHA 5GPGB 1TWCA 3U5SA 3JT1A 1FMWA 2A69F 2BL2A 3RYLA 3CEXA 4Q7CA 4NCQA 5KYWA 3SNHA 2Q00A 3FVYA 1ZU4A 2W4MA 256BA 5A6BD 3U3FA 2LQGA 3NMKA 3RKOF 1T6QA 2ZPAA 3AG4C 1Z5ZA 4PJLA 4DRIB 4IAQA 5L0JA 3DD7A 2PF4E 3OEOA 2R7VA 1UFBA 1JAFA 2HZ8A 3B71A 1VMAA 3NMJA 5KYWB 3K7DA 1LE4A 2A6HF 3QVZA 4H54A 1T01A 1PV3A 2PP4A 2IXMA 4HE8D 4PJNA 4EWCA 2ICWG 5AC4A 2Q9CA 2IXPA 3DXJF 4OIQF 2R7UA 3IQ6A 5COFA 3L8IA 3O10A 3K6BA 2CNWA 2A1DD 2J7PD 4NTFA 1QQ3A 3T6GB 5L3VA 4CS8C 2R7SA 2P7VA 1CGOA 1M56C 2L9JA 3K66A 4WGYA 3S90A 3AQCA 2GFHA 1D0YA 3ABLC 3NKDA 2QE9A 5JP7A 3GWLA 3VYWA 5A6AA 1NFNA 2V26A 3LESA 3EHNA 3SEOA 1ZW3A 2EPKX 3AQBA 2P1AA 2J0WA 4ER9A 4XPYA 1ZHTA 2YLGA 2EPMX 3S29A 1ZVZA 5IY5C 1NBBA 1CGNA 2LFDA 3B29A 2HSBA 2YQYA 3ABKC 3JRTA 4E0IA 1GM5A 1E83A 4WABA 3EGXA 2OU6A 1AUEA 1M2VA 1O3UA 4U5DE 3C7JA 2XL6A 3RW0A 2DI3A 4N4WA 4D4NA 5DS6A 5KYXA 1A7DA 1RKEB 1TWAA 2DYSC 1YZCA 3T6BA 3IEEA 5AC5A 1OW6A 3WG7C 3N0TA 3CSKA 3V5YA 4CSAA 1FMVA 1T6IA 1Z23A 1MMDA 2RD9A 5EK0A 3ZIBA 4IGGA 3EHMA 5KYXB 1NU7D 3CZ6A 2EIMC 4CS8A 2HV6A 1C02A 3Q6MA 2XLDA 4XEFA 1HE1A 4LERA 4YT5A 1S05A 2XLOA 3TJ5A 4MVSA 1W2WA 4I1MA 4QDLA 1D1CA 1RJ9A 4R32A 4CS7A 1U6HA 2XLVA 3UR3C 2XM4A 4CJOA 4G7ZF 1K04A 4E17A 2HSQA 2JX0A 4K0DA 5L0CA 2YRFA 5HSWA 1LVKA 2HV7A 2VCBA 2EIJC 3V5ZA 3ZTMA 2F22A 2W45A 2VC9A 3LS1A 3NG1A 3V7OA 1OKKD 3SXZA 3EJNA 3G4XA 1FFTC 2EIKC 1QZXA 2OCCC 4EHPA 3KMIA 3PDMP 2GDCA 1FNTc 2HJMA 4J32B 2L6GA 3X2QC 2Y3DA 5B3IA 3B0VC 2AVKA 1VB5A 1Y6DA 5DVWA 3SP1A 2Q7RA 3K1IC 3S84A 1T9KA 5JSLA 1VLSA 4U9EA 4YL3A 1Z6AA 3RVYA 1SF8A 1SZIA 1LIHA 4BJ1A 1NLXA 2YKZA 2XLWA 3JRMO 5B3SC 1WWPA 4DRHB 1ZW2A 4XLPF 2L6FA 3EH2A 3O39A 5KYYA 1ORSC 2QUPA 3RH3A 3W2WA 4ULVA 3B9QA 1BBHA 3B0PA 1WN0A 3AG2C 4MVMA 5AGFA 3LLKA 4Z9IA 2Q9BA 5DQTA 4YT4A 3AG1C 3FDQA 2VCAA 1QSPA 2CW0F 4XTKA 4YWQA 2OJED 1G4WR 1C03A 5KYYB 1H7IA 4JTAB 4XEVA 2Y3GA 1DOVA 4MVRA 4RBNA 4DOZA 1YAUO 2KQ9A 3U9JA 3DM9B 4HEAJ 2LK4A 4Z9JA 2L6HA 2VASA 4JRZA 2WZFA 1E2XA 3AGTA 1D0ZA 5T1DB 3MFNA 1D1BA 3DE9A 2YHSA 4AE4A 4PJMA 2Y3HA 1OCRC 3IQ5A 3K1IA 3GODA 2J8WA 4D4XA 4BG0A 3TJ6A 3JZ0A 1WASA 4YL1A 2UUIA 1NG1A 1QKRA 1LI5A 2J9BA 2XSEA 4JTDB 1YVIA 4O6MA 1OW7A 2CNWD 2M64A 3BEHA 4AE4B 4PR9A 1D0XA 2OJQA 1ST6A 3DJUB 1KTMA 3SXYA 2AWCA 2EPNA 1YZAA 2FFHA 3K33A 1Q0MA 4L6RA 4RDAA 4MVUA 4AL0A 1HE9A 3LLIA 3FOPA 2OEXA 3QTHA 4XPXA 3DAGA 5JS5A 4E7SA 1Q0FA 3C8ZA 4NQFA 1E85A 2YL3A 3NYLA 1QVXA 3ZDLA 2R7RA 3S27A 1ORJA 5CI8A 3C63A 1RXQA 3EQLF 1NSGB 5A6JA 1FAPB 3SXMA 3E70C 4C3BA 5DS5A 4ULWA 4DRJB 1TWHA 4BJTA 4CSAC 2YEVA 4J7YA 1LM3B 1VYIA 3ITFA 2G3KA 1LKXA 4BJ5A 1A7VA 1AVOB 2JD3A 4PACA 4WGZA 2GWWA 4JE9A 4EKWA 1WOLA 4UDVA 2Y3BA 2I15A 4MNDA 2WL8A 4PFPA 3HKKA 2XS8A 3Q6NA 4PK4A 2MHRA 2D4UA 2OEVA 4CDAA 3RVZA 1SR2A 5E3AA 5F28E 3ZVRA 1YJGA 4I44A 3PHF2 3JSZA 1I4YA 3GEIA 4JCHA 4OD4A 1YLMA 3U9MA 4E0HA 4OIPF 4U5EE 1HW2A 5CIVA 4CIPA 5COGA 4BEMJ 4C7OA 2DGJA 3ZQYA 2V3CC 2DB4A 1MNDA 1Z63A 1RKEA 5F5FA 4MW3A 1OQCA 1ZHZA 3ZTZA 1DOWA 3ZSUA 3NDBB 4H4KC 1N1CA 1OCCC 4CX9A 2R05A 1G8XA 3VAYA 2H7VC 1KNYA 3E9VA 4C7OB 2NPUA 1Z3IX 4F4BA 2LCHA 3JYYA 3MBGA 4MVZA 3GANA 4JTCB 1SYQA 4P6IC 5FZTA 5L0GA 4GEHA 2J0XA 4O7GA 3EGDB 5E33A 2IM8A 2WVOA 4EUKB 3EH1A 3LJBA 1WATA 2C03A 4JW1A 3T9OA 1A41A 2R7WA 4G7OF 4I1OB 3C18A 4PFOA 2IOQA 2OG2A 2IYLD 3ZG1A 3G50A 4JIOA 2VH3A 3DI5A 1G5ZA 1MQVA 2IXOA 1LPEA 2IXNA 3AJMA 2XXAB 5L0HA 2MWQA 2CGEA 2Y39A 3DJNB 3L34A 5T3TA 1EI7A 2J7PA 4XPWA 2XLEA 3DE8A 2J46A 4E18A 3EG9B 2G62A 3ABMC 1I4ZA 3GM1A 2XRHA 2LP4A 1OR2A 2YL7A 3MYIA 3NYMA 2R9RB 2VCCA 4K1OA 4NC3A 4YL0A 3SXKA 3TK0A 5F5HA 1NZEA 1VK5A 3ZC4A 3B0UX 1OW8A 2QTVA 4IAOA 4XWJA 2PFDA 2Q4FA 3SZRA 1KU2A 1ZHWA 2LSEA 3C8GD 4EBBA 2WVNA 4W8KA 4DVZA 1LS4A 2GA0A 2HKVA 2ZXOA 3M15A 5KYUA 4CBEA 2XM0A 2NUTB 1R4TA 1VYKA 2H7OA 3IPMO 3LEVA 1JMWA 3JCUQ 4CS9C 3A11A 2P6VA 3J06A 5COMA 3UMIA 4BPMA 2W4BA 1V4AA 4LLEA 2YLIA 3AG3C 4O79A 3W8IA 1JR8A 3HJCA 1YA7O 3MLGA 4MS2A 4CDYA 2H8AA 2XLHA 1FFHA 5KYUB 2YL1A 1RKCA 3K1HA 4Q5SF 3HNIA 3TQOA 3F46A 2VB6A 3EZIA 1PD0A 1XZPA 4P9FA 3GM2A 2ZXWC 3H65A 2J9VA 2D5RB 1LS1A 3AGUA 3TOMA 1EKYA 2W9YA 2R7OA 2HFIA 3FOOA 2ASRA 4J30B 2YLDA 3HNKA 3DWWA 2C04A 2BE5F 3I4UA 1APCA 1TWGA 3W8HA 1GS9A 1HMOA 2DYRC 3U2LA 3UGOA 2J9UA 2KJGA 2L81A 3H2VA 3U3BA 5DLJA 3F47A 5JT4A 5KYNA 4IJJA 4Q4ZF 2R7XA 2RSEB 2B0HA 3RQFA 5BQIA 4MW8A 3HNJA 2X0CA 3DKAA 5JLIA 2ZXRA 3LEOA 3IQTA 4IB4A 4CS9A 3TULA 3QW1A 4BJ5C 1O5HA 4A2NB 4IRUA 3LAYA 3POVA 2ZD9A 1MNEA 3DM5A 4ANJA 4KBLA 1LE2A 1PD1A 2L7AA 2WB7A 4KC9A 1OKKA 1TQGA 5L0FA 3LUTB 4JJFA 5BUOA 1K40A 1OXBA 1HY5A 1A0BA 1YA9A 1CPRA 1VLTA 2KK1A 1J8MF 2XL8A 3M4BA 2R7QA 1XWJA 1CPQA 4PJJA 1J8YF 4IARA 5L0IA 2QLAA 4MVOA 2KW3C 1ZU5A 3UGPA 1EQ1A 3T4RA 1ZZPA 3I5PA 4P9TA 4DBQA 2OKUA 3GEHA 1QPUA 4I3MA 4XLNF 2Q9AA 3L8JA 1M6TA 1TFKB 3KH2A 4FWVA 4U5FE 4OIRF 3MX3A 2HJ3A 2Q3TA 4AL1A 3QW0A 1BZ4A 2HMZA 3IQCA 1JOGA 4JEAA 1Y4CA 4JVSA 3VM6A 2EPLX 3IHUA 4JCZA 1H6GA 4N6CA 5HV9A 4ZLCA 3FAPB 3OA1A 2I8BA 3RIPA 3I5QA 3UMHA 2YVKA 4NTAA 4KI2A 2FAPB 3CAXA 1MMAA 4EBKA 3LNMB 3DAFA 3HLZA 1OR3A 1HMDA 1ZYRF 1GQAA 2WZLA 1UG7A 1V55C 1HW1A 2NSGA 3KYIA 1MMGA 5E3CA 1JRAA 4LDKA 2X51A 4HFFB 5DQZA 4JJGA 1M57C 1XZQA 1Q0DA 4FESA 2PBEA 2A0UA 1EA8A 3LNRA 3RQEA 4J7TA 1BR4A 4XEKA 2G3VA 2Z15A 1FTSA 1V54C 2P0NA 3AOUA 3FHDA 3ASNC 4AK9A 2HS5A 3QMKA 4U5GA 2R7TA 1G4US 1R5ID 4XQ1A 1ORYA 3FMSA 3JTLO 3OWTA 1RMVA 3NMIA 4DVYP 1H9GA 5DS4A 1PCXA 1NFOA 2KYHA 4W8PA 1F1MA 3VRCA 3EGDA 2IBFA 5E2QA 4BJ6C 3DZAA 4MQ9F 3O55A 3R2PA 3M1CB 3ATPA 4G7HF 2A6EF 4JEBA 4K7BA 3GM3A 2QNLA 3WAQA 5EGYA 4U5HA 1ZHXA 1U0BB 3PCVA 2PX3A 4CDVA 1T6UA 5A6BA 4Z9HA 1FR0A 3PMRA 2EILC 2OQMA 2EINC 3EZHA 3GORA 2XXAA 3FXHA 2R02A 4OINF 3UNGC 2YL0A 4QI0A 3EG9A 2CCYA 3A9CA 4DXWA 3X1OA 3HTKC 1RCPA 3HNLA 1V74B 3TD7A 1AEPA 3ZWIA 1OCOC 2B0JA 1U89A 5T3WA 3QVYA 3U0CA 1VTMP 1O87A 2AWYA 3L0IA 2Y69C 4AX2A 2R03A 2H7BA 1BDJB 1QLEC 2WZGA 4RD9A 4C3EA 2NUTA 1TR2A 5B1BC 2KC3A 2J9WA 3Q7LA 5FCLA 2MYSA 3GEEA 2FGYA 4JC7A 1JPNA 3EGXB 3M79A 1H9TA 1YYJA 1M2VB 3SYNA 3M4CA 3W2VA 2TMVP 2PNOA 3NRHA 3DMDA 4KNVA 5D91A 4BJ6A 3JSEO 2CDQA 2KSFA 1S7ZA 2GAQA 4OIOF 4FAPB 3KYJA 4YJWA 3KKBA 1ZHYA 2LD6A 3LS0A 5A69A 1OXKA 1L7CA 2WVQA 1B68A 1Z7Qc 1LI7A 1Q0GA 3BRJA 5EHHA 3JYHA 4CJGA 3CQZA 4E7ZA 2BC5A 3EPVA 3KL4A 3MYFA 5BQGA 1L3PA 4DBRA 1MMNA 4JZAA 4MTFA 4B6IA 2HUJA 2OOCA 3KPHA 1I5NA 2A68F 1JPJA 5D92A 3T6JA 4C3DA 4U5CE 1WGWA 2QY9A 4G78A 4A4AA 3V5XA 1E84A 2EPOA 1YDIA 1RJ9B 1BR1A 2AU5A 4U9DA 3ZQVA 4O6YA 2M4EA 3ASOC 5L0DA 4JURI 4MTOA 4GQHA 3ECSA 4M63A 2XS1A 5JUAA 5K0IA 3S0XA 2XLMA 4EBJA 3S28A 4YT8A 2P61A 3NYJA 5L3QA 3U8VA 1A7EA 3GWNA 3R7CA 4U5BE 5A6KA 2R25A 1D1AA 2CYDA 2LFFA 3RFYA 2XL4A 3FAJA 2UUHA 3N2ZB 3TOLA 4YN0B 3RQGA 3N24A 2KGOA 3U2MA 4YT2A 3WODF 2O9XA 4NY3A 4QI2A 3VF0A 1NU9C 1BR2A 4X0RA 2E87A 1GGQA 5CI9A 3RF3A 5TJ5E 3C8GA 1VOMA 4O6NA 2NG1A 4NTBA 3W4YA 4MVQA 4WJ0A
chains in the Genus database with same CATH topology
5B1AC 3EFOA 4BEJA 2NUPA 4IWBA 2KNHA 1OCZC 1IZMA 4G0HA 2PX0A 4FX5A 3Q7GA 2YZSA 3EFOB 2ZXPA 1M2OA 2NUPB 4OD5A 3UMKA 3O6XA 4LACB 1SMYF 2J45A 4N06A 4ZLDA 1TKNA 3NKEA 3QZCA 4KNWA 1IW7F 4HFKB 4LLCA 4CIHA 1TWCA 3JT1A 1FMWA 2A69F 3RYLA 4Q7CA 5KYWA 3SNHA 3FVYA 1ZU4A 2W4MA 3RKOF 2ZPAA 3AG4C 1Z5ZA 4PJLA 3DD7A 2PF4E 3OEOA 2R7VA 1VMAA 5KYWB 3K7DA 2A6HF 2PP4A 4HE8D 2IXMA 4PJNA 4EWCA 2Q9CA 2IXPA 3DXJF 4OIQF 2R7UA 3K6BA 2CNWA 2A1DD 2J7PD 5L3VA 4CS8C 2R7SA 2P7VA 1M56C 2L9JA 3K66A 3AQCA 2GFHA 1D0YA 3ABLC 3NKDA 3VYWA 2V26A 3LESA 3EHNA 3SEOA 3AQBA 2J0WA 1ZHTA 3S29A 5IY5C 3ABKC 3JRTA 3EGXA 1M2VA 4U5DE 5DS6A 5KYXA 1TWAA 2DYSC 3T6BA 3IEEA 3WG7C 3N0TA 3CSKA 4CSAA 1FMVA 1Z23A 1MMDA 3ZIBA 3EHMA 5KYXB 1NU7D 3CZ6A 2EIMC 4CS8A 2HV6A 3Q6MA 4YT5A 4LERA 1W2WA 4I1MA 4QDLA 1D1CA 1RJ9A 4CS7A 3UR3C 4G7ZF 4K0DA 5HSWA 1LVKA 2HV7A 2EIJC 3LS1A 2W45A 3NG1A 3V7OA 1OKKD 3EJNA 1FFTC 2EIKC 1QZXA 2OCCC 3KMIA 4J32B 3X2QC 2Y3DA 3B0VC 5DVWA 3SP1A 3K1IC 1Z6AA 1SF8A 1SZIA 4BJ1A 5B3SC 4XLPF 3EH2A 3O39A 5KYYA 3W2WA 3RH3A 3B9QA 3B0PA 5DQTA 3AG2C 4YT4A 3LLKA 2Q9BA 3AG1C 3FDQA 2CW0F 4XTKA 4YWQA 5KYYB 4DOZA 2Y3GA 4RBNA 2KQ9A 3DM9B 4HEAJ 2VASA 2WZFA 1D0ZA 5T1DB 1D1BA 4AE4A 2YHSA 4PJMA 2Y3HA 1OCRC 3GODA 4BG0A 2XSEA 1NG1A 4O6MA 2CNWD 4AE4B 1D0XA 1ST6A 3DJUB 2FFHA 3K33A 4RDAA 3LLIA 3DAGA 4E7SA 3NYLA 2R7RA 3S27A 5CI8A 3EQLF 3E70C 4C3BA 5DS5A 4ULWA 1TWHA 4BJTA 4CSAC 2YEVA 1VYIA 3ITFA 1LKXA 2G3KA 4BJ5A 2JD3A 2Y3BA 4MNDA 2WL8A 4PFPA 3Q6NA 4PK4A 5E3AA 3ZVRA 4I44A 3PHF2 3JSZA 4OD4A 4JCHA 4OIPF 4U5EE 4C7OA 2DGJA 2V3CC 1Z63A 1MNDA 5F5FA 1ZHZA 3ZSUA 3NDBB 4H4KC 1N1CA 1OCCC 1G8XA 3VAYA 2H7VC 3E9VA 4C7OB 1Z3IX 4F4BA 3GANA 4P6IC 4GEHA 2J0XA 4O7GA 3EGDB 5E33A 2WVOA 3EH1A 3LJBA 2C03A 4G7OF 4JW1A 2R7WA 4I1OB 4PFOA 2IOQA 2OG2A 2IYLD 3ZG1A 2VH3A 2IXOA 2IXNA 2XXAB 2MWQA 2CGEA 2Y39A 3DJNB 3L34A 5T3TA 2J7PA 2J46A 3EG9B 2G62A 3ABMC 3NYMA 4GYTA 2XRHA 3B0UX 5F5HA 1NZEA 1VK5A 3ZC4A 4XWJA 2QTVA 4IAOA 2PFDA 3SZRA 1KU2A 1ZHWA 2LSEA 4EBBA 2WVNA 4W8KA 4DVZA 4CBEA 2ZXOA 5KYUA 2NUTB 2H7OA 1VYKA 3LEVA 4CS9C 3JCUQ 2P6VA 3UMIA 2W4BA 4LLEA 3AG3C 3W8IA 4O79A 3HJCA 3MLGA 1FFHA 5KYUB 3K1HA 4Q5SF 3F46A 2VB6A 3EZIA 1PD0A 2ZXWC 3H65A 2J9VA 2D5RB 1LS1A 2W9YA 2R7OA 4J30B 2C04A 2BE5F 3I4UA 1TWGA 3W8HA 2DYRC 3UGOA 2J9UA 2KJGA 2L81A 5DLJA 3F47A 4Q4ZF 5KYNA 4IJJA 2R7XA 2ZXRA 4CS9A 4BJ5C 1O5HA 4A2NB 4IRUA 3LAYA 3POVA 1MNEA 3DM5A 4ANJA 4KBLA 2WB7A 1PD1A 4KC9A 1OKKA 4JJFA 5BUOA 1J8MF 2R7QA 4PJJA 1J8YF 3UGPA 2KW3C 1ZU5A 3T4RA 3I5PA 4DBQA 4XLNF 4I3MA 2Q9AA 4OIRF 4FWVA 3KH2A 4U5FE 3MX3A 2Q3TA 4JVSA 4ZLCA 3OA1A 3RIPA 2I8BA 3I5QA 3UMHA 4KI2A 1MMAA 3DAFA 3HLZA 1ZYRF 2WZLA 1V55C 5E3CA 1MMGA 2X51A 4HFFB 5DQZA 4JJGA 1M57C 4FESA 3LNRA 1BR4A 2G3VA 2Z15A 1FTSA 1V54C 3FHDA 4AK9A 3ASNC 3QMKA 4U5GA 2R7TA 3OWTA 4DVYP 5DS4A 1PCXA 3EGDA 5E2QA 4BJ6C 3DZAA 4MQ9F 3M1CB 4G7HF 2A6EF 4K7BA 5EGYA 4U5HA 1ZHXA 2PX3A 3PMRA 2EILC 2EINC 3EZHA 2XXAA 4OINF 3UNGC 4QI0A 3EG9A 3X1OA 3HTKC 3TD7A 1OCOC 2B0JA 5T3WA 1O87A 3L0IA 4AX2A 2Y69C 2H7BA 4RD9A 1QLEC 2WZGA 4C3EA 2NUTA 1TR2A 5B1BC 2J9WA 3Q7LA 5FCLA 2MYSA 2FGYA 1JPNA 3EGXB 3SYNA 1M2VB 3W2VA 3NRHA 3DMDA 4KNVA 5D91A 4BJ6A 2CDQA 1S7ZA 4OIOF 4YJWA 3KKBA 1ZHYA 3LS0A 2WVQA 5EHHA 3JYHA 3CQZA 4E7ZA 3EPVA 3KL4A 4DBRA 1MMNA 4JZAA 4B6IA 5D92A 2A68F 4C3DA 1JPJA 3T6JA 4U5CE 1WGWA 2QY9A 1RJ9B 1BR1A 4O6YA 2M4EA 3ASOC 4JURI 3ECSA 4M63A 3S0XA 3S28A 4YT8A 3NYJA 5L3QA 4U5BE 1D1AA 3RFYA 2XL4A 3FAJA 3N2ZB 4YN0B 3N24A 2KGOA 4YT2A 3WODF 2O9XA 4NY3A 4QI2A 1NU9C 1BR2A 4X0RA 2E87A 5CI9A 1VOMA 4O6NA 2NG1A 4WJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1O A;  5F5H A;  4ZLC A;  4YWQ A;  4ZLD A;  5F5F A;  4ULW A;  4QI0 A;  4QI2 A; 
#chains in the Genus database with same CATH topology
 5BQH A;  3S9O A;  4MTG A;  5B1A C;  1YAR O;  3EFO A;  3US6 A;  2AP3 A;  4BEJ A;  4LDR A;  4N6H A;  2NUP A;  4IWB A;  2KNH A;  1OCZ C;  3C8G B;  4LDQ A;  4EIY A;  1CGM E;  2YWA A;  1YYX A;  1IZM A;  5JVE A;  3U8P A;  4DJ9 A;  4G0H A;  2PX0 A;  1K05 A;  2ETS A;  3Q7G A;  4FX5 A;  2NSF A;  1E86 A;  2YZS A;  3EFO B;  2ZXP A;  2HMQ A;  1M2O A;  2NUP B;  3L1M A;  4OD5 A;  3UMK A;  2LIG A;  1T5O A;  3O6X A;  4LAC B;  1SMY F;  1C17 M;  1TFO B;  2J45 A;  4YK5 A;  3C62 A;  4N06 A;  4ZLD A;  4GYT A;  1TKN A;  3NKE A;  3QZC A;  4KNW A;  2JPU A;  1IW7 F;  4ONS A;  1WTY A;  3WHN A;  3H2U A;  4HFK B;  4LLC A;  4JKV A;  5JRA A;  2A0B A;  1Q0K A;  3G4Z A;  4CIH A;  5GPG B;  1TWC A;  3U5S A;  3JT1 A;  1FMW A;  2A69 F;  2BL2 A;  3RYL A;  3CEX A;  4Q7C A;  4NCQ A;  5KYW A;  3SNH A;  2Q00 A;  3FVY A;  1ZU4 A;  2W4M A;  256B A;  5A6B D;  3U3F A;  2LQG A;  3NMK A;  3RKO F;  1T6Q A;  2ZPA A;  3AG4 C;  1Z5Z A;  4PJL A;  4DRI B;  4IAQ A;  5L0J A;  3DD7 A;  2PF4 E;  3OEO A;  2R7V A;  1UFB A;  1JAF A;  2HZ8 A;  3B71 A;  1VMA A;  3NMJ A;  5KYW B;  3K7D A;  1LE4 A;  2A6H F;  3QVZ A;  4H54 A;  1T01 A;  1PV3 A;  2PP4 A;  2IXM A;  4HE8 D;  4PJN A;  4EWC A;  2ICW G;  5AC4 A;  2Q9C A;  2IXP A;  3DXJ F;  4OIQ F;  2R7U A;  3IQ6 A;  5COF A;  3L8I A;  3O10 A;  3K6B A;  2CNW A;  2A1D D;  2J7P D;  4NTF A;  1QQ3 A;  3T6G B;  5L3V A;  4CS8 C;  2R7S A;  2P7V A;  1CGO A;  1M56 C;  2L9J A;  3K66 A;  4WGY A;  3S90 A;  3AQC A;  2GFH A;  1D0Y A;  3ABL C;  3NKD A;  2QE9 A;  5JP7 A;  3GWL A;  3VYW A;  5A6A A;  1NFN A;  2V26 A;  3LES A;  3EHN A;  3SEO A;  1ZW3 A;  2EPK X;  3AQB A;  2P1A A;  2J0W A;  4ER9 A;  4XPY A;  1ZHT A;  2YLG A;  2EPM X;  3S29 A;  1ZVZ A;  5IY5 C;  1NBB A;  1CGN A;  2LFD A;  3B29 A;  2HSB A;  2YQY A;  3ABK C;  3JRT A;  4E0I A;  1GM5 A;  1E83 A;  4WAB A;  3EGX A;  2OU6 A;  1AUE A;  1M2V A;  1O3U A;  4U5D E;  3C7J A;  2XL6 A;  3RW0 A;  2DI3 A;  4N4W A;  4D4N A;  5DS6 A;  5KYX A;  1A7D A;  1RKE B;  1TWA A;  2DYS C;  1YZC A;  3T6B A;  3IEE A;  5AC5 A;  1OW6 A;  3WG7 C;  3N0T A;  3CSK A;  3V5Y A;  4CSA A;  1FMV A;  1T6I A;  1Z23 A;  1MMD A;  2RD9 A;  5EK0 A;  3ZIB A;  4IGG A;  3EHM A;  5KYX B;  1NU7 D;  3CZ6 A;  2EIM C;  4CS8 A;  2HV6 A;  1C02 A;  3Q6M A;  2XLD A;  4XEF A;  1HE1 A;  4LER A;  4YT5 A;  1S05 A;  2XLO A;  3TJ5 A;  4MVS A;  1W2W A;  4I1M A;  4QDL A;  1D1C A;  1RJ9 A;  4R32 A;  4CS7 A;  1U6H A;  2XLV A;  3UR3 C;  2XM4 A;  4CJO A;  4G7Z F;  1K04 A;  4E17 A;  2HSQ A;  2JX0 A;  4K0D A;  5L0C A;  2YRF A;  5HSW A;  1LVK A;  2HV7 A;  2VCB A;  2EIJ C;  3V5Z A;  3ZTM A;  2F22 A;  2W45 A;  2VC9 A;  3LS1 A;  3NG1 A;  3V7O A;  1OKK D;  3SXZ A;  3EJN A;  3G4X A;  1FFT C;  2EIK C;  1QZX A;  2OCC C;  4EHP A;  3KMI A;  3PDM P;  2GDC A;  1FNT c;  2HJM A;  4J32 B;  2L6G A;  3X2Q C;  2Y3D A;  5B3I A;  3B0V C;  2AVK A;  1VB5 A;  1Y6D A;  5DVW A;  3SP1 A;  2Q7R A;  3K1I C;  3S84 A;  1T9K A;  5JSL A;  1VLS A;  4U9E A;  4YL3 A;  1Z6A A;  3RVY A;  1SF8 A;  1SZI A;  1LIH A;  4BJ1 A;  1NLX A;  2YKZ A;  2XLW A;  3JRM O;  5B3S C;  1WWP A;  4DRH B;  1ZW2 A;  4XLP F;  2L6F A;  3EH2 A;  3O39 A;  5KYY A;  1ORS C;  2QUP A;  3RH3 A;  3W2W A;  4ULV A;  3B9Q A;  1BBH A;  3B0P A;  1WN0 A;  3AG2 C;  4MVM A;  5AGF A;  3LLK A;  4Z9I A;  2Q9B A;  5DQT A;  4YT4 A;  3AG1 C;  3FDQ A;  2VCA A;  1QSP A;  2CW0 F;  4XTK A;  4YWQ A;  2OJE D;  1G4W R;  1C03 A;  5KYY B;  1H7I A;  4JTA B;  4XEV A;  2Y3G A;  1DOV A;  4MVR A;  4RBN A;  4DOZ A;  1YAU O;  2KQ9 A;  3U9J A;  3DM9 B;  4HEA J;  2LK4 A;  4Z9J A;  2L6H A;  2VAS A;  4JRZ A;  2WZF A;  1E2X A;  3AGT A;  1D0Z A;  5T1D B;  3MFN A;  1D1B A;  3DE9 A;  2YHS A;  4AE4 A;  4PJM A;  2Y3H A;  1OCR C;  3IQ5 A;  3K1I A;  3GOD A;  2J8W A;  4D4X A;  4BG0 A;  3TJ6 A;  3JZ0 A;  1WAS A;  4YL1 A;  2UUI A;  1NG1 A;  1QKR A;  1LI5 A;  2J9B A;  2XSE A;  4JTD B;  1YVI A;  4O6M A;  1OW7 A;  2CNW D;  2M64 A;  3BEH A;  4AE4 B;  4PR9 A;  1D0X A;  2OJQ A;  1ST6 A;  3DJU B;  1KTM A;  3SXY A;  2AWC A;  2EPN A;  1YZA A;  2FFH A;  3K33 A;  1Q0M A;  4L6R A;  4RDA A;  4MVU A;  4AL0 A;  1HE9 A;  3LLI A;  3FOP A;  2OEX A;  3QTH A;  4XPX A;  3DAG A;  5JS5 A;  4E7S A;  1Q0F A;  3C8Z A;  4NQF A;  1E85 A;  2YL3 A;  3NYL A;  1QVX A;  3ZDL A;  2R7R A;  3S27 A;  1ORJ A;  5CI8 A;  3C63 A;  1RXQ A;  3EQL F;  1NSG B;  5A6J A;  1FAP B;  3SXM A;  3E70 C;  4C3B A;  5DS5 A;  4ULW A;  4DRJ B;  1TWH A;  4BJT A;  4CSA C;  2YEV A;  4J7Y A;  1LM3 B;  1VYI A;  3ITF A;  2G3K A;  1LKX A;  4BJ5 A;  1A7V A;  1AVO B;  2JD3 A;  4PAC A;  4WGZ A;  2GWW A;  4JE9 A;  4EKW A;  1WOL A;  4UDV A;  2Y3B A;  2I15 A;  4MND A;  2WL8 A;  4PFP A;  3HKK A;  2XS8 A;  3Q6N A;  4PK4 A;  2MHR A;  2D4U A;  2OEV A;  4CDA A;  3RVZ A;  1SR2 A;  5E3A A;  5F28 E;  3ZVR A;  1YJG A;  4I44 A;  3PHF 2;  3JSZ A;  1I4Y A;  3GEI A;  4JCH A;  4OD4 A;  1YLM A;  3U9M A;  4E0H A;  4OIP F;  4U5E E;  1HW2 A;  5CIV A;  4CIP A;  5COG A;  4BEM J;  4C7O A;  2DGJ A;  3ZQY A;  2V3C C;  2DB4 A;  1MND A;  1Z63 A;  1RKE A;  5F5F A;  4MW3 A;  1OQC A;  1ZHZ A;  3ZTZ A;  1DOW A;  3ZSU A;  3NDB B;  4H4K C;  1N1C A;  1OCC C;  4CX9 A;  2R05 A;  1G8X A;  3VAY A;  2H7V C;  1KNY A;  3E9V A;  4C7O B;  2NPU A;  1Z3I X;  4F4B A;  2LCH A;  3JYY A;  3MBG A;  4MVZ A;  3GAN A;  4JTC B;  1SYQ A;  4P6I C;  5FZT A;  5L0G A;  4GEH A;  2J0X A;  4O7G A;  3EGD B;  5E33 A;  2IM8 A;  2WVO A;  4EUK B;  3EH1 A;  3LJB A;  1WAT A;  2C03 A;  4JW1 A;  3T9O A;  1A41 A;  2R7W A;  4G7O F;  4I1O B;  3C18 A;  4PFO A;  2IOQ A;  2OG2 A;  2IYL D;  3ZG1 A;  3G50 A;  4JIO A;  2VH3 A;  3DI5 A;  1G5Z A;  1MQV A;  2IXO A;  1LPE A;  2IXN A;  3AJM A;  2XXA B;  5L0H A;  2MWQ A;  2CGE A;  2Y39 A;  3DJN B;  3L34 A;  5T3T A;  1EI7 A;  2J7P A;  4XPW A;  2XLE A;  3DE8 A;  2J46 A;  4E18 A;  3EG9 B;  2G62 A;  3ABM C;  1I4Z A;  3GM1 A;  2XRH A;  2LP4 A;  1OR2 A;  2YL7 A;  3MYI A;  3NYM A;  2R9R B;  2VCC A;  4K1O A;  4NC3 A;  4YL0 A;  3SXK A;  3TK0 A;  5F5H A;  1NZE A;  1VK5 A;  3ZC4 A;  3B0U X;  1OW8 A;  2QTV A;  4IAO A;  4XWJ A;  2PFD A;  2Q4F A;  3SZR A;  1KU2 A;  1ZHW A;  2LSE A;  3C8G D;  4EBB A;  2WVN A;  4W8K A;  4DVZ A;  1LS4 A;  2GA0 A;  2HKV A;  2ZXO A;  3M15 A;  5KYU A;  4CBE A;  2XM0 A;  2NUT B;  1R4T A;  1VYK A;  2H7O A;  3IPM O;  3LEV A;  1JMW A;  3JCU Q;  4CS9 C;  3A11 A;  2P6V A;  3J06 A;  5COM A;  3UMI A;  4BPM A;  2W4B A;  1V4A A;  4LLE A;  2YLI A;  3AG3 C;  4O79 A;  3W8I A;  1JR8 A;  3HJC A;  1YA7 O;  3MLG A;  4MS2 A;  4CDY A;  2H8A A;  2XLH A;  1FFH A;  5KYU B;  2YL1 A;  1RKC A;  3K1H A;  4Q5S F;  3HNI A;  3TQO A;  3F46 A;  2VB6 A;  3EZI A;  1PD0 A;  1XZP A;  4P9F A;  3GM2 A;  2ZXW C;  3H65 A;  2J9V A;  2D5R B;  1LS1 A;  3AGU A;  3TOM A;  1EKY A;  2W9Y A;  2R7O A;  2HFI A;  3FOO A;  2ASR A;  4J30 B;  2YLD A;  3HNK A;  3DWW A;  2C04 A;  2BE5 F;  3I4U A;  1APC A;  1TWG A;  3W8H A;  1GS9 A;  1HMO A;  2DYR C;  3U2L A;  3UGO A;  2J9U A;  2KJG A;  2L81 A;  3H2V A;  3U3B A;  5DLJ A;  3F47 A;  5JT4 A;  5KYN A;  4IJJ A;  4Q4Z F;  2R7X A;  2RSE B;  2B0H A;  3RQF A;  5BQI A;  4MW8 A;  3HNJ A;  2X0C A;  3DKA A;  5JLI A;  2ZXR A;  3LEO A;  3IQT A;  4IB4 A;  4CS9 A;  3TUL A;  3QW1 A;  4BJ5 C;  1O5H A;  4A2N B;  4IRU A;  3LAY A;  3POV A;  2ZD9 A;  1MNE A;  3DM5 A;  4ANJ A;  4KBL A;  1LE2 A;  1PD1 A;  2L7A A;  2WB7 A;  4KC9 A;  1OKK A;  1TQG A;  5L0F A;  3LUT B;  4JJF A;  5BUO A;  1K40 A;  1OXB A;  1HY5 A;  1A0B A;  1YA9 A;  1CPR A;  1VLT A;  2KK1 A;  1J8M F;  2XL8 A;  3M4B A;  2R7Q A;  1XWJ A;  1CPQ A;  4PJJ A;  1J8Y F;  4IAR A;  5L0I A;  2QLA A;  4MVO A;  2KW3 C;  1ZU5 A;  3UGP A;  1EQ1 A;  3T4R A;  1ZZP A;  3I5P A;  4P9T A;  4DBQ A;  2OKU A;  3GEH A;  1QPU A;  4I3M A;  4XLN F;  2Q9A A;  3L8J A;  1M6T A;  1TFK B;  3KH2 A;  4FWV A;  4U5F E;  4OIR F;  3MX3 A;  2HJ3 A;  2Q3T A;  4AL1 A;  3QW0 A;  1BZ4 A;  2HMZ A;  3IQC A;  1JOG A;  4JEA A;  1Y4C A;  4JVS A;  3VM6 A;  2EPL X;  3IHU A;  4JCZ A;  1H6G A;  4N6C A;  5HV9 A;  4ZLC A;  3FAP B;  3OA1 A;  2I8B A;  3RIP A;  3I5Q A;  3UMH A;  2YVK A;  4NTA A;  4KI2 A;  2FAP B;  3CAX A;  1MMA A;  4EBK A;  3LNM B;  3DAF A;  3HLZ A;  1OR3 A;  1HMD A;  1ZYR F;  1GQA A;  2WZL A;  1UG7 A;  1V55 C;  1HW1 A;  2NSG A;  3KYI A;  1MMG A;  5E3C A;  1JRA A;  4LDK A;  2X51 A;  4HFF B;  5DQZ A;  4JJG A;  1M57 C;  1XZQ A;  1Q0D A;  4FES A;  2PBE A;  2A0U A;  1EA8 A;  3LNR A;  3RQE A;  4J7T A;  1BR4 A;  4XEK A;  2G3V A;  2Z15 A;  1FTS A;  1V54 C;  2P0N A;  3AOU A;  3FHD A;  3ASN C;  4AK9 A;  2HS5 A;  3QMK A;  4U5G A;  2R7T A;  1G4U S;  1R5I D;  4XQ1 A;  1ORY A;  3FMS A;  3JTL O;  3OWT A;  1RMV A;  3NMI A;  4DVY P;  1H9G A;  5DS4 A;  1PCX A;  1NFO A;  2KYH A;  4W8P A;  1F1M A;  3VRC A;  3EGD A;  2IBF A;  5E2Q A;  4BJ6 C;  3DZA A;  4MQ9 F;  3O55 A;  3R2P A;  3M1C B;  3ATP A;  4G7H F;  2A6E F;  4JEB A;  4K7B A;  3GM3 A;  2QNL A;  3WAQ A;  5EGY A;  4U5H A;  1ZHX A;  1U0B B;  3PCV A;  2PX3 A;  4CDV A;  1T6U A;  5A6B A;  4Z9H A;  1FR0 A;  3PMR A;  2EIL C;  2OQM A;  2EIN C;  3EZH A;  3GOR A;  2XXA A;  3FXH A;  2R02 A;  4OIN F;  3UNG C;  2YL0 A;  4QI0 A;  3EG9 A;  2CCY A;  3A9C A;  4DXW A;  3X1O A;  3HTK C;  1RCP A;  3HNL A;  1V74 B;  3TD7 A;  1AEP A;  3ZWI A;  1OCO C;  2B0J A;  1U89 A;  5T3W A;  3QVY A;  3U0C A;  1VTM P;  1O87 A;  2AWY A;  3L0I A;  2Y69 C;  4AX2 A;  2R03 A;  2H7B A;  1BDJ B;  1QLE C;  2WZG A;  4RD9 A;  4C3E A;  2NUT A;  1TR2 A;  5B1B C;  2KC3 A;  2J9W A;  3Q7L A;  5FCL A;  2MYS A;  3GEE A;  2FGY A;  4JC7 A;  1JPN A;  3EGX B;  3M79 A;  1H9T A;  1YYJ A;  1M2V B;  3SYN A;  3M4C A;  3W2V A;  2TMV P;  2PNO A;  3NRH A;  3DMD A;  4KNV A;  5D91 A;  4BJ6 A;  3JSE O;  2CDQ A;  2KSF A;  1S7Z A;  2GAQ A;  4OIO F;  4FAP B;  3KYJ A;  4YJW A;  3KKB A;  1ZHY A;  2LD6 A;  3LS0 A;  5A69 A;  1OXK A;  1L7C A;  2WVQ A;  1B68 A;  1Z7Q c;  1LI7 A;  1Q0G A;  3BRJ A;  5EHH A;  3JYH A;  4CJG A;  3CQZ A;  4E7Z A;  2BC5 A;  3EPV A;  3KL4 A;  3MYF A;  5BQG A;  1L3P A;  4DBR A;  1MMN A;  4JZA A;  4MTF A;  4B6I A;  2HUJ A;  2OOC A;  3KPH A;  1I5N A;  2A68 F;  1JPJ A;  5D92 A;  3T6J A;  4C3D A;  4U5C E;  1WGW A;  2QY9 A;  4G78 A;  4A4A A;  3V5X A;  1E84 A;  2EPO A;  1YDI A;  1RJ9 B;  1BR1 A;  2AU5 A;  4U9D A;  3ZQV A;  4O6Y A;  2M4E A;  3ASO C;  5L0D A;  4JUR I;  4MTO A;  4GQH A;  3ECS A;  4M63 A;  2XS1 A;  5JUA A;  5K0I A;  3S0X A;  2XLM A;  4EBJ A;  3S28 A;  4YT8 A;  2P61 A;  3NYJ A;  5L3Q A;  3U8V A;  1A7E A;  3GWN A;  3R7C A;  4U5B E;  5A6K A;  2R25 A;  1D1A A;  2CYD A;  2LFF A;  3RFY A;  2XL4 A;  3FAJ A;  2UUH A;  3N2Z B;  3TOL A;  4YN0 B;  3RQG A;  3N24 A;  2KGO A;  3U2M A;  4YT2 A;  3WOD F;  2O9X A;  4NY3 A;  4QI2 A;  3VF0 A;  1NU9 C;  1BR2 A;  4X0R A;  2E87 A;  1GGQ A;  5CI9 A;  3RF3 A;  5TJ5 E;  3C8G A;  1VOM A;  4O6N A;  2NG1 A;  4NTB A;  3W4Y A;  4MVQ A;  4WJ0 A; 
#chains in the Genus database with same CATH homology
 5B1A C;  3EFO A;  4BEJ A;  2NUP A;  4IWB A;  2KNH A;  1OCZ C;  1IZM A;  4G0H A;  2PX0 A;  4FX5 A;  3Q7G A;  2YZS A;  3EFO B;  2ZXP A;  1M2O A;  2NUP B;  4OD5 A;  3UMK A;  3O6X A;  4LAC B;  1SMY F;  2J45 A;  4N06 A;  4ZLD A;  1TKN A;  3NKE A;  3QZC A;  4KNW A;  1IW7 F;  4HFK B;  4LLC A;  4CIH A;  1TWC A;  3JT1 A;  1FMW A;  2A69 F;  3RYL A;  4Q7C A;  5KYW A;  3SNH A;  3FVY A;  1ZU4 A;  2W4M A;  3RKO F;  2ZPA A;  3AG4 C;  1Z5Z A;  4PJL A;  3DD7 A;  2PF4 E;  3OEO A;  2R7V A;  1VMA A;  5KYW B;  3K7D A;  2A6H F;  2PP4 A;  4HE8 D;  2IXM A;  4PJN A;  4EWC A;  2Q9C A;  2IXP A;  3DXJ F;  4OIQ F;  2R7U A;  3K6B A;  2CNW A;  2A1D D;  2J7P D;  5L3V A;  4CS8 C;  2R7S A;  2P7V A;  1M56 C;  2L9J A;  3K66 A;  3AQC A;  2GFH A;  1D0Y A;  3ABL C;  3NKD A;  3VYW A;  2V26 A;  3LES A;  3EHN A;  3SEO A;  3AQB A;  2J0W A;  1ZHT A;  3S29 A;  5IY5 C;  3ABK C;  3JRT A;  3EGX A;  1M2V A;  4U5D E;  5DS6 A;  5KYX A;  1TWA A;  2DYS C;  3T6B A;  3IEE A;  3WG7 C;  3N0T A;  3CSK A;  4CSA A;  1FMV A;  1Z23 A;  1MMD A;  3ZIB A;  3EHM A;  5KYX B;  1NU7 D;  3CZ6 A;  2EIM C;  4CS8 A;  2HV6 A;  3Q6M A;  4YT5 A;  4LER A;  1W2W A;  4I1M A;  4QDL A;  1D1C A;  1RJ9 A;  4CS7 A;  3UR3 C;  4G7Z F;  4K0D A;  5HSW A;  1LVK A;  2HV7 A;  2EIJ C;  3LS1 A;  2W45 A;  3NG1 A;  3V7O A;  1OKK D;  3EJN A;  1FFT C;  2EIK C;  1QZX A;  2OCC C;  3KMI A;  4J32 B;  3X2Q C;  2Y3D A;  3B0V C;  5DVW A;  3SP1 A;  3K1I C;  1Z6A A;  1SF8 A;  1SZI A;  4BJ1 A;  5B3S C;  4XLP F;  3EH2 A;  3O39 A;  5KYY A;  3W2W A;  3RH3 A;  3B9Q A;  3B0P A;  5DQT A;  3AG2 C;  4YT4 A;  3LLK A;  2Q9B A;  3AG1 C;  3FDQ A;  2CW0 F;  4XTK A;  4YWQ A;  5KYY B;  4DOZ A;  2Y3G A;  4RBN A;  2KQ9 A;  3DM9 B;  4HEA J;  2VAS A;  2WZF A;  1D0Z A;  5T1D B;  1D1B A;  4AE4 A;  2YHS A;  4PJM A;  2Y3H A;  1OCR C;  3GOD A;  4BG0 A;  2XSE A;  1NG1 A;  4O6M A;  2CNW D;  4AE4 B;  1D0X A;  1ST6 A;  3DJU B;  2FFH A;  3K33 A;  4RDA A;  3LLI A;  3DAG A;  4E7S A;  3NYL A;  2R7R A;  3S27 A;  5CI8 A;  3EQL F;  3E70 C;  4C3B A;  5DS5 A;  4ULW A;  1TWH A;  4BJT A;  4CSA C;  2YEV A;  1VYI A;  3ITF A;  1LKX A;  2G3K A;  4BJ5 A;  2JD3 A;  2Y3B A;  4MND A;  2WL8 A;  4PFP A;  3Q6N A;  4PK4 A;  5E3A A;  3ZVR A;  4I44 A;  3PHF 2;  3JSZ A;  4OD4 A;  4JCH A;  4OIP F;  4U5E E;  4C7O A;  2DGJ A;  2V3C C;  1Z63 A;  1MND A;  5F5F A;  1ZHZ A;  3ZSU A;  3NDB B;  4H4K C;  1N1C A;  1OCC C;  1G8X A;  3VAY A;  2H7V C;  3E9V A;  4C7O B;  1Z3I X;  4F4B A;  3GAN A;  4P6I C;  4GEH A;  2J0X A;  4O7G A;  3EGD B;  5E33 A;  2WVO A;  3EH1 A;  3LJB A;  2C03 A;  4G7O F;  4JW1 A;  2R7W A;  4I1O B;  4PFO A;  2IOQ A;  2OG2 A;  2IYL D;  3ZG1 A;  2VH3 A;  2IXO A;  2IXN A;  2XXA B;  2MWQ A;  2CGE A;  2Y39 A;  3DJN B;  3L34 A;  5T3T A;  2J7P A;  2J46 A;  3EG9 B;  2G62 A;  3ABM C;  3NYM A;  4GYT A;  2XRH A;  3B0U X;  5F5H A;  1NZE A;  1VK5 A;  3ZC4 A;  4XWJ A;  2QTV A;  4IAO A;  2PFD A;  3SZR A;  1KU2 A;  1ZHW A;  2LSE A;  4EBB A;  2WVN A;  4W8K A;  4DVZ A;  4CBE A;  2ZXO A;  5KYU A;  2NUT B;  2H7O A;  1VYK A;  3LEV A;  4CS9 C;  3JCU Q;  2P6V A;  3UMI A;  2W4B A;  4LLE A;  3AG3 C;  3W8I A;  4O79 A;  3HJC A;  3MLG A;  1FFH A;  5KYU B;  3K1H A;  4Q5S F;  3F46 A;  2VB6 A;  3EZI A;  1PD0 A;  2ZXW C;  3H65 A;  2J9V A;  2D5R B;  1LS1 A;  2W9Y A;  2R7O A;  4J30 B;  2C04 A;  2BE5 F;  3I4U A;  1TWG A;  3W8H A;  2DYR C;  3UGO A;  2J9U A;  2KJG A;  2L81 A;  5DLJ A;  3F47 A;  4Q4Z F;  5KYN A;  4IJJ A;  2R7X A;  2ZXR A;  4CS9 A;  4BJ5 C;  1O5H A;  4A2N B;  4IRU A;  3LAY A;  3POV A;  1MNE A;  3DM5 A;  4ANJ A;  4KBL A;  2WB7 A;  1PD1 A;  4KC9 A;  1OKK A;  4JJF A;  5BUO A;  1J8M F;  2R7Q A;  4PJJ A;  1J8Y F;  3UGP A;  2KW3 C;  1ZU5 A;  3T4R A;  3I5P A;  4DBQ A;  4XLN F;  4I3M A;  2Q9A A;  4OIR F;  4FWV A;  3KH2 A;  4U5F E;  3MX3 A;  2Q3T A;  4JVS A;  4ZLC A;  3OA1 A;  3RIP A;  2I8B A;  3I5Q A;  3UMH A;  4KI2 A;  1MMA A;  3DAF A;  3HLZ A;  1ZYR F;  2WZL A;  1V55 C;  5E3C A;  1MMG A;  2X51 A;  4HFF B;  5DQZ A;  4JJG A;  1M57 C;  4FES A;  3LNR A;  1BR4 A;  2G3V A;  2Z15 A;  1FTS A;  1V54 C;  3FHD A;  4AK9 A;  3ASN C;  3QMK A;  4U5G A;  2R7T A;  3OWT A;  4DVY P;  5DS4 A;  1PCX A;  3EGD A;  5E2Q A;  4BJ6 C;  3DZA A;  4MQ9 F;  3M1C B;  4G7H F;  2A6E F;  4K7B A;  5EGY A;  4U5H A;  1ZHX A;  2PX3 A;  3PMR A;  2EIL C;  2EIN C;  3EZH A;  2XXA A;  4OIN F;  3UNG C;  4QI0 A;  3EG9 A;  3X1O A;  3HTK C;  3TD7 A;  1OCO C;  2B0J A;  5T3W A;  1O87 A;  3L0I A;  4AX2 A;  2Y69 C;  2H7B A;  4RD9 A;  1QLE C;  2WZG A;  4C3E A;  2NUT A;  1TR2 A;  5B1B C;  2J9W A;  3Q7L A;  5FCL A;  2MYS A;  2FGY A;  1JPN A;  3EGX B;  3SYN A;  1M2V B;  3W2V A;  3NRH A;  3DMD A;  4KNV A;  5D91 A;  4BJ6 A;  2CDQ A;  1S7Z A;  4OIO F;  4YJW A;  3KKB A;  1ZHY A;  3LS0 A;  2WVQ A;  5EHH A;  3JYH A;  3CQZ A;  4E7Z A;  3EPV A;  3KL4 A;  4DBR A;  1MMN A;  4JZA A;  4B6I A;  5D92 A;  2A68 F;  4C3D A;  1JPJ A;  3T6J A;  4U5C E;  1WGW A;  2QY9 A;  1RJ9 B;  1BR1 A;  4O6Y A;  2M4E A;  3ASO C;  4JUR I;  3ECS A;  4M63 A;  3S0X A;  3S28 A;  4YT8 A;  3NYJ A;  5L3Q A;  4U5B E;  1D1A A;  3RFY A;  2XL4 A;  3FAJ A;  3N2Z B;  4YN0 B;  3N24 A;  2KGO A;  4YT2 A;  3WOD F;  2O9X A;  4NY3 A;  4QI2 A;  1NU9 C;  1BR2 A;  4X0R A;  2E87 A;  5CI9 A;  1VOM A;  4O6N A;  2NG1 A;  4WJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...