3X1OA

Crystal structure of the roq domain of human roquin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
151
structure length
149
Chain Sequence
QQLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Roquin-1
publication title Roquin binds microRNA-146a and Argonaute2 to regulate microRNA homeostasis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 53
structure length 149
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2014-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18386 ROQ_II Roquin II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1790 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3x1oA00
3X1OA 4ZLCA 4YWQA 4QI0A 4ULWA 5F5FA 4ZLDA 5F5HA 4QI2A
chains in the Genus database with same CATH superfamily
3KPHA 4NTFA 3B29A 3WAQA 2OJED 2OEVA 2XS8A 2R02A 2CNWD 1IW7F 2LD6A 4ULWA 3VYWA 3C63A 3MX3A 4MVMA 4YJWA 3H2VA 4O6YA 1WOLA 1WWPA 4I44A 4BJ5A 4G7OF 3KMIA 3MYFA 4KNVA 3ZQYA 2ZXWC 4FESA 4NC3A 1ZHWA 4MTFA 3CAXA 5TJ5E 1SF8A 1YARO 4CDVA 4C7OA 4CIPA 3EFOB 2ASRA 1NZEA 5JRAA 3CSKA 4RBNA 4IB4A 1VLTA 4K0DA 2IM8A 3G50A 1OW7A 1TWCA 4DRJB 3EH2A 1VB5A 1DOWA 2GAQA 2NG1A 3ECSA 4LDRA 3QW0A 2RSEB 5JSLA 1O87A 3VRCA 2B0JA 2C03A 2WB7A 2XLDA 3C8ZA 1U0BB 3RH3A 4EHPA 2XXAB 3DM5A 3EGDA 3I4UA 2AWCA 4X0RA 5L0HA 2XS1A 2NUPB 3KYJA 3LEVA 3ZTMA 1RMVA 1FAPB 2JD3A 4P9TA 1O5HA 2EINC 3O6XA 4XQ1A 3C62A 2IXMA 1BZ4A 3EG9A 3AG1C 4U9EA 1OCRC 1LS4A 3RVZA 3EZHA 1HW1A 4ULVA 3K1HA 4MTGA 3LS1A 3TULA 4ER9A 3JZ0A 5L0CA 3CQZA 1I4YA 4JEAA 3T4RA 2R7QA 3QMKA 2QLAA 3JT1A 2CGEA 3C18A 4JZAA 2HMQA 4MVOA 3RQFA 4KNWA 2NUTB 3GORA 5E3CA 3JTLO 1D1AA 2QTVA 3B71A 4PK4A 1JR8A 1ZW3A 1JRAA 4NTBA 3RIPA 3V5ZA 3QVZA 3ATPA 1BR2A 3RW0A 1NSGB 3N0TA 2EIMC 2YLGA 1Q0GA 2CYDA 2YLDA 2XLEA 2EPMX 3U3FA 1XZQA 4XEFA 4IGGA 1OW8A 3DZAA 2I8BA 2PF4E 4GEHA 3S27A 4CS7A 4CDYA 4E7ZA 5A6KA 2UUHA 2R7SA 4AL1A 5L0FA 3EH1A 3K1IC 4HFKB 5DS5A 1A41A 2JPUA 5JVEA 256BA 1FMWA 2AP3A 3AQCA 1YYXA 3KH2A 3JCUQ 4JE9A 3U2MA 3NYLA 1ZZPA 1C03A 4U5EE 4J30B 4YL0A 4Z9HA 5KYXA 4RD9A 2A0BA 4W8PA 3F46A 2C04A 1TWAA 1YLMA 2HS5A 2L6GA 5KYWA 2V3CC 3GWLA 3V5XA 1KTMA 2A69F 1FMVA 1OKKD 3NYMA 1YVIA 1UG7A 4JW1A 5L0IA 3C8GB 3RQGA 3SYNA 1AUEA 3UGOA 5BQHA 3M1CB 3NKEA 3MFNA 1HMOA 1CGNA 5JLIA 4U5HA 1YA7O 1ZYRF 2JX0A 1BR1A 3GANA 3R2PA 1M6TA 4MQ9F 1LE4A 1VMAA 2YL7A 3BEHA 1MMAA 2PP4A 3L34A 3ZG1A 3DAFA 4XWJA 2Q00A 3IQTA 5DQZA 4IJJA 4IAQA 3S28A 4XEVA 3S0XA 2ZPAA 3EJNA 4F4BA 4MVQA 1K40A 4D4NA 3ASNC 3S84A 4G7ZF 5AC5A 2DI3A 1VK5A 3W2VA 2TMVP 4PFOA 3AGTA 3FAPB 3QZCA 4EBKA 4C3DA 2V26A 1C17M 4RDAA 3V7OA 5A6BA 4XLPF 4Q5SF 2DB4A 2WL8A 2XLVA 2XM4A 2GA0A 1Y6DA 2Y3BA 4KI2A 4CX9A 4LERA 3JSZA 3JRTA 2L7AA 3DMDA 4LDKA 4U5DE 4JCZA 3X2QC 3ZTZA 4Q4ZF 4W8KA 3QW1A 2AWYA 1WATA 4Q7CA 3WG7C 1H7IA 3FMSA 3K7DA 1MMNA 4P6IC 4G7HF 2H7BA 2Q9BA 1YZCA 3C8GD 1ORSC 3U8VA 4AE4B 3KL4A 4NCQA 4AL0A 4BJ5C 5JS5A 1EQ1A 3ZIBA 2G3KA 4CBEA 3ZSUA 5D92A 4IAOA 5FZTA 5BUOA 3UMIA 2CCYA 3UNGC 4E7SA 1PV3A 5BQIA 3U5SA 2AU5A 1E85A 2ZXOA 1A0BA 4EBBA 2IOQA 3JYHA 3DJNB 5JT4A 2HJMA 1G4WR 2EIJC 1OXBA 3HJCA 3SEOA 4C3EA 4NTAA 3E70C 4BJTA 1M2VA 3K1IA 3ZDLA 3V5YA 4OIRF 1ORJA 1RCPA 4MVSA 4CJGA 5E3AA 4N4WA 2ZXPA 4BPMA 2VASA 1K05A 4U5BE 2I15A 1L3PA 1RJ9A 3H65A 3PMRA 3DWWA 5DS4A 3FOOA 1CPQA 1M2OA 1FFHA 2W45A 3SXZA 3FAJA 2LQGA 1QPUA 4FX5A 1ZHYA 3JSEO 1SYQA 2R7OA 3W8HA 2OQMA 2Y69C 3NG1A 3SXKA 1E86A 1ZHTA 4QDLA 5BQGA 3PHF2 5GPGB 3DJUB 3IQ6A 2IXOA 2Q3TA 3K6BA 4PJLA 3LNMB 1N1CA 3UMHA 2M64A 2W4MA 1D0ZA 5EK0A 3VF0A 3VM6A 2VH3A 2XSEA 4H4KC 5F5HA 4E0HA 1TQGA 1FNTc 2J9VA 4XLNF 2WZLA 1QVXA 3AGUA 4PFPA 3A9CA 4KBLA 5E33A 1E84A 3GM2A 2UUIA 3EGXB 2ZD9A 4N6CA 4FAPB 1FTSA 2IYLD 4MW3A 1I4ZA 4OD4A 1SR2A 3LLKA 3ASOC 1LIHA 3C7JA 3R7CA 4CIHA 1D1CA 2LCHA 3LUTB 1Z63A 2NPUA 1OQCA 1NLXA 1PCXA 3POVA 4ZLCA 2RD9A 1LPEA 1S7ZA 3JYYA 1QZXA 4XEKA 1YJGA 1RKEA 4ANJA 2J45A 3LS0A 5JP7A 1OW6A 4OD5A 2M4EA 2R03A 2OU6A 2Y3DA 1T9KA 1ZHZA 2Q9CA 3I5PA 4J7YA 1WGWA 1D0XA 1TKNA 1TR2A 2YLIA 3GEHA 1G4US 3NYJA 1EI7A 3O10A 1ZW2A 2WVQA 1NG1A 3T6BA 3TK0A 5B3SC 1MMGA 1VOMA 2HZ8A 4IRUA 1KNYA 2MHRA 2YL3A 2OJQA 3HNKA 2YHSA 3DI5A 4IWBA 4B6IA 5DQTA 2F22A 2BE5F 3Q6MA 4BJ6C 3HLZA 4I3MA 1XWJA 4MTOA 4C7OB 3ABLC 4R32A 2LFDA 4EBJA 2KC3A 1LM3B 1V74B 3TD7A 2D4UA 4A2NB 4OIOF 1TWGA 4U5FE 3MLGA 1Q0FA 4WGZA 2QUPA 4MVZA 4UDVA 3GEEA 1YAUO 2XM0A 2NSGA 3G4XA 3L1MA 5KYUA 5EHHA 1T6QA 1J8YF 1WN0A 3ZWIA 1DOVA 2KK1A 2W4BA 1MNDA 3LLIA 2XLMA 4MVUA 3TOLA 2HFIA 3EGDB 4DXWA 2ICWG 3FVYA 4FWVA 4XPWA 4Z9IA 1T6UA 4N6HA 5T1DB 2Q7RA 1TFOB 2MYSA 2XRHA 2ZXRA 4BEMJ 4L6RA 1Z5ZA 4MW8A 3A11A 3U9MA 1Q0DA 3LAYA 4NY3A 2EPKX 2J8WA 2OG2A 4HFFB 4CS8C 5HV9A 3S29A 2A6EF 3EG9B 4DJ9A 1LI5A 2J7PA 3HNIA 4YT8A 1I5NA 4J32B 3TJ6A 2YL1A 3PDMP 1IZMA 3AQBA 4LLEA 4Z9JA 1MNEA 5CI9A 3M4CA 4JKVA 4U5GA 2YWAA 4DBRA 1G5ZA 2FFHA 3Q7GA 2R7UA 3OWTA 1BR4A 5F28E 4ZLDA 2PX0A 1LI7A 3H2UA 1UFBA 3EFOA 3CZ6A 3IPMO 3U2LA 1MMDA 1HMDA 2OKUA 4P9FA 5DLJA 5IY5C 1A7VA 3DE9A 4WJ0A 4XPXA 1A7DA 4HE8D 4U9DA 1JAFA 2YL0A 1GGQA 4LDQA 2XLHA 2FGYA 4O6MA 5COGA 3GEIA 4CS9C 3B0VC 1S05A 3SP1A 3FXHA 3SXYA 1LVKA 3MBGA 1JMWA 2IBFA 4DOZA 3X1OA 5EGYA 1BDJB 2XXAA 1QSPA 2H8AA 2YEVA 4EKWA 2HV6A 5AGFA 2H7OA 4QI0A 3T6JA 2NUPA 5L3VA 2CDQA 4LACB 2LP4A 2QNLA 4C3BA 2A68F 3OEOA 1HE1A 2Q4FA 4MVRA 2KJGA 1YZAA 2L6FA 3I5QA 3NMKA 3T9OA 4CSAC 4OIQF 2L81A 2CW0F 2XLWA 1YYJA 2VCCA 3DKAA 3HNLA 1RKCA 2KSFA 2X51A 3ZQVA 3EPVA 2PX3A 5KYXB 3AG3C 3SXMA 2R7RA 1U6HA 2OCCC 2EPNA 1OKKA 5KYWB 1GM5A 3J06A 3M79A 2L9JA 3NRHA 4PACA 3FOPA 1AVOB 1RXQA 3U8PA 3US6A 3S9OA 5D91A 1Y4CA 2NUTA 2Y3GA 5L3QA 2XL4A 3TOMA 1CGME 3RKOF 4LLCA 2PBEA 4BJ1A 2DYRC 1O3UA 5FCLA 2J9UA 1ZHXA 1BBHA 2YZSA 3L8JA 4J7TA 2LIGA 3SNHA 2E87A 3UR3C 1E83A 2HJ3A 1JPJA 2VB6A 3Q6NA 3CEXA 4U5CE 4WABA 4G0HA 1VTMP 3TJ5A 2BC5A 1JOGA 3RVYA 1T6IA 2GFHA 4I1OB 1VYIA 4CDAA 1F1MA 1ZVZA 4ONSA 3LEOA 5KYYA 3U3BA 1Q0KA 4M63A 4EWCA 1H9TA 1W2WA 2W9YA 5CI8A 2LK4A 1GQAA 3RFYA 1TFKB 3GM1A 1H6GA 1MQVA 4DVYP 3B0PA 4JRZA 3M15A 4CS8A 2YKZA 4GQHA 1VYKA 2XL8A 2PFDA 2HSQA 2Z15A 1J8MF 1PD0A 2WVOA 4JJGA 3DM9B 3IEEA 3RYLA 4AX2A 5DS6A 1AEPA 3FDQA 5AC4A 3KYIA 4OINF 3T6GB 1M56C 1H9GA 1LKXA 2WVNA 2VCAA 1GS9A 2Y3HA 3DAGA 2R7VA 2EPLX 2A1DD 4DRIB 1QLEC 2LSEA 3C8GA 4YWQA 1NBBA 1OXKA 2WZGA 3AG4C 3AJMA 3L0IA 3NDBB 1YA9A 4JTDB 3G4ZA 4JVSA 3ABMC 1VLSA 3IQCA 4JTAB 3UMKA 2A6HF 2D5RB 2DGJA 4IARA 4BEJA 4CS9A 1FFTC 2CNWA 3K66A 2J0XA 2KYHA 4I1MA 3DXJF 2EPOA 4PR9A 4YT2A 2YQYA 5JUAA 5L0DA 3S90A 1YDIA 2Y39A 3EQLF 3EZIA 2H7VC 3W4YA 5T3TA 4H54A 4JC7A 2P1AA 2AVKA 5COMA 2J7PD 4JJFA 5KYNA 4JIOA 1FR0A 2GWWA 4PJMA 3TQOA 5B3IA 1Q0MA 2KW3C 4JEBA 2HSBA 1V55C 1M2VB 3HKKA 1Z6AA 1CGOA 2P61A 1OCCC 2QE9A 4G78A 5A6JA 5L0GA 4CSAA 2EIKC 2EILC 4YT5A 5CIVA 1T5OA 3NKDA 4K7BA 2R05A 1ZU4A 3W2WA 1OR2A 2DYSC 3MYIA 4EUKB 1D0YA 2QY9A 1RJ9B 2LFFA 5A6BD 1LE2A 3WHNA 1L7CA 2XL6A 3DE8A 1WTYA 1ST6A 3HNJA 3NMIA 4DBQA 4K1OA 3GM3A 5DVWA 3N2ZB 1CPRA 2L6HA 4XPYA 5KYYB 2X0CA 1EKYA 1TWHA 4PJJA 4AE4A 3UGPA 2YRFA 3GODA 1D1BA 3W8IA 2IXPA 2J0WA 5B1AC 4JTCB 3RF3A 4JCHA 4DRHB 2ETSA 4JURI 2R25A 2P6VA 2R7WA 1Z3IX 2HUJA 3RQEA 3O55A 1QKRA 2NSFA 1U89A 1A7EA 2HV7A 1KU2A 3ITFA 3QTHA 1EA8A 1SMYF 3U0CA 2HMZA 3LNRA 2R7XA 4NQFA 4DVZA 1SZIA 4GYTA 3NMJA 4XTKA 1OCZC 4O7GA 2IXNA 4MS2A 2YVKA 3BRJA 2OOCA 3O39A 2J46A 5HSWA 3M4BA 1B68A 3SZRA 5A6AA 1R4TA 1APCA 4YL3A 1HE9A 4MNDA 1PD1A 1V4AA 3ZVRA 4A4AA 1QQ3A 2O9XA 4HEAJ 1V54C 2KGOA 2KNHA 2Q9AA 2WZFA 3LJBA 1RKEB 2OEXA 1G8XA 3OA1A 3QVYA 3U9JA 3B0UX 1R5ID 2XLOA 3N24A 1NU7D 2VCBA 3FHDA 4D4XA 5A69A 4E18A 3B9QA 4YK5A 2J9WA 2R7TA 1K04A 2A0UA 4WGYA 1OCOC 2P0NA 1WASA 3KKBA 5F5FA 2FAPB 1C02A 2VC9A 1XZPA 3AOUA 2R9RB 5L0JA 3WODF 5T3WA 4PJNA 2P7VA 4CJOA 1JPNA 1Z7Qc 4AK9A 5K0IA 3AG2C 3K33A 3Q7LA 1HW2A 4QI2A 3L8IA 3DD7A 3GWNA 2PNOA 4E17A 3JRMO 1NU9C 2HKVA 3EGXA 1NFNA 3IHUA 4YL1A 5E2QA 4OIPF 1NFOA 2GDCA 2J9BA 1E2XA 4O79A 3VAYA 4E0IA 2B0HA 1HY5A 2KQ9A 2G62A 3E9VA 1T01A 2MWQA 4BJ6A 3LESA 3IQ5A 3F47A 4YN0B 1Z23A 5KYUB 2G3VA 3EHMA 1OR3A 1M57C 4KC9A 1ZU5A 3ZC4A 4O6NA 4YT4A 3ABKC 1ORYA 2BL2A 3HTKC 3PCVA 5COFA 5B1BC 1LS1A 3EHNA 4EIYA 4BG0A 4N06A
chains in the Genus database with same CATH topology
2CNWD 1IW7F 4ULWA 3VYWA 3MX3A 4YJWA 4O6YA 4I44A 4BJ5A 4G7OF 3KMIA 4KNVA 2ZXWC 4FESA 1ZHWA 1SF8A 4C7OA 3EFOB 1NZEA 3CSKA 4RBNA 4K0DA 1TWCA 3EH2A 2NG1A 3ECSA 1O87A 2B0JA 2C03A 2WB7A 3RH3A 2XXAB 3DM5A 3EGDA 3I4UA 4X0RA 2NUPB 3LEVA 2JD3A 1O5HA 2EINC 3O6XA 2IXMA 3EG9A 3AG1C 1OCRC 3EZHA 3K1HA 3LS1A 3CQZA 3T4RA 2R7QA 3QMKA 3JT1A 2CGEA 4JZAA 4KNWA 2NUTB 5E3CA 1D1AA 2QTVA 4PK4A 3RIPA 1BR2A 3N0TA 2EIMC 3DZAA 2I8BA 2PF4E 4GEHA 3S27A 4CS7A 4E7ZA 2R7SA 3EH1A 3K1IC 4HFKB 5DS5A 1FMWA 3AQCA 3KH2A 3JCUQ 3NYLA 4U5EE 4J30B 5KYXA 4RD9A 3F46A 2C04A 1TWAA 5KYWA 2V3CC 2A69F 1FMVA 1OKKD 3NYMA 4JW1A 3SYNA 3UGOA 3M1CB 3NKEA 3FDQA 4U5HA 1ZYRF 3GANA 1BR1A 4MQ9F 1VMAA 1MMAA 2PP4A 3L34A 3ZG1A 3DAFA 4XWJA 5DQZA 4IJJA 3S28A 3S0XA 3EJNA 2ZPAA 4F4BA 4G7ZF 3ASNC 1VK5A 3W2VA 4PFOA 3QZCA 4C3DA 2V26A 4RDAA 3V7OA 4XLPF 4Q5SF 2WL8A 2Y3BA 4KI2A 4LERA 3JSZA 3JRTA 3DMDA 4U5DE 3X2QC 4Q4ZF 4W8KA 4Q7CA 3WG7C 4G7HF 3K7DA 1MMNA 4P6IC 2H7BA 2Q9BA 4AE4B 3KL4A 3ZIBA 2G3KA 4CBEA 3ZSUA 5D92A 4IAOA 5BUOA 3UMIA 3UNGC 4E7SA 2ZXOA 4EBBA 2IOQA 3JYHA 3DJNB 2EIJC 3HJCA 3SEOA 3E70C 4BJTA 1M2VA 4OIRF 5E3AA 2ZXPA 2VASA 4U5BE 1RJ9A 3H65A 3PMRA 5DS4A 1M2OA 2W45A 1FFHA 3FAJA 4FX5A 1ZHYA 2R7OA 3W8HA 2Y69C 3NG1A 1ZHTA 4QDLA 3PHF2 3DJUB 4PJLA 2IXOA 2Q3TA 3K6BA 1N1CA 3UMHA 2W4MA 1D0ZA 2VH3A 2XSEA 4H4KC 5F5HA 2J9VA 4XLNF 2WZLA 4PFPA 4KBLA 5E33A 3EGXB 1FTSA 2IYLD 4OD4A 2R7UA 3LLKA 4CIHA 3ASOC 1D1CA 1Z63A 1PCXA 3POVA 4ZLCA 1S7ZA 1QZXA 4ANJA 2J45A 3LS0A 4OD5A 2M4EA 2Y3DA 1ZHZA 2Q9CA 3I5PA 1D0XA 1TKNA 1TR2A 1WGWA 3NYJA 2WVQA 1NG1A 3T6BA 5B3SC 1MMGA 1VOMA 4IRUA 2YHSA 4IWBA 4B6IA 5DQTA 3Q6MA 2BE5F 4BJ6C 3HLZA 4I3MA 4C7OB 3ABLC 3TD7A 4A2NB 4OIOF 1TWGA 4U5FE 3MLGA 5KYUA 5EHHA 1J8YF 3LLIA 2W4BA 1MNDA 3EGDB 3FVYA 4FWVA 5T1DB 4BJ5C 3NDBB 4DOZA 2XRHA 2MYSA 2ZXRA 4C3EA 1Z5ZA 3LAYA 4NY3A 2OG2A 4HFFB 4CS8C 3S29A 2A6EF 3EG9B 4YT8A 2J7PA 4J32B 1IZMA 3AQBA 4LLEA 1MNEA 5CI9A 4U5GA 4DBRA 2FFHA 3Q7GA 3OWTA 1BR4A 4ZLDA 2PX0A 3EFOA 3CZ6A 1MMDA 5DLJA 5IY5C 4WJ0A 4HE8D 2FGYA 4O6MA 4CS9C 3B0VC 3SP1A 1LVKA 3X1OA 5EGYA 2XXAA 2YEVA 2HV6A 2H7OA 4QI0A 3T6JA 2NUPA 5L3VA 2CDQA 4LACB 4C3BA 2A68F 3OEOA 2KJGA 3I5QA 4CSAC 4OIQF 2L81A 2CW0F 2X51A 3EPVA 2PX3A 5KYXB 3AG3C 2R7RA 2OCCC 5KYWB 1OKKA 2L9JA 3NRHA 5L3QA 5D91A 2NUTA 2Y3GA 2XL4A 3RKOF 4LLCA 4BJ1A 5FCLA 2DYRC 2J9UA 1ZHXA 3SNHA 2YZSA 2E87A 3UR3C 1JPJA 2VB6A 3Q6NA 4U5CE 4G0HA 4I1OB 2GFHA 1VYIA 5KYYA 4M63A 4EWCA 1W2WA 2W9YA 5CI8A 3RFYA 4DVYP 3B0PA 4CS8A 1VYKA 2PFDA 2Z15A 1J8MF 1PD0A 2WVOA 4JJGA 3DM9B 3IEEA 3RYLA 4AX2A 5DS6A 4OINF 1M56C 1LKXA 2WVNA 2Y3HA 3DAGA 2R7VA 2A1DD 1QLEC 2LSEA 4YWQA 2WZGA 3L0IA 3AG4C 4JVSA 3ABMC 3UMKA 2A6HF 2D5RB 2DGJA 4BEJA 4CS9A 1FFTC 2CNWA 3K66A 2J0XA 4I1MA 3DXJF 4YT2A 3EQLF 2Y39A 3EZIA 2H7VC 5T3TA 2J7PD 4JJFA 5KYNA 4PJMA 2KW3C 1V55C 1M2VB 1Z6AA 1OCCC 4CSAA 2EIKC 2EILC 4YT5A 3NKDA 4K7BA 3W2WA 1ZU4A 2DYSC 1D0YA 2QY9A 1RJ9B 1ST6A 4DBQA 5DVWA 3N2ZB 5KYYB 1TWHA 4PJJA 4AE4A 3UGPA 3GODA 1D1BA 3W8IA 2IXPA 2J0WA 5B1AC 4JCHA 4JURI 2P6VA 2R7WA 1Z3IX 2HV7A 1KU2A 3ITFA 1SMYF 3LNRA 2R7XA 4DVZA 1SZIA 4GYTA 4XTKA 1OCZC 4O7GA 2IXNA 3O39A 2J46A 5HSWA 3SZRA 4MNDA 1PD1A 3ZVRA 2O9XA 4HEAJ 1V54C 2KGOA 2KNHA 2Q9AA 2WZFA 3LJBA 3OA1A 1G8XA 3B0UX 3N24A 1NU7D 3FHDA 3B9QA 2J9WA 2R7TA 1OCOC 3KKBA 5F5FA 3WODF 5T3WA 4PJNA 2P7VA 1JPNA 4AK9A 3AG2C 3K33A 3Q7LA 4QI2A 3DD7A 1NU9C 3EGXA 4OIPF 5E2QA 4O79A 3VAYA 2KQ9A 2G62A 3E9VA 2MWQA 4BJ6A 3LESA 3F47A 4YN0B 1Z23A 5KYUB 2G3VA 3EHMA 3ZC4A 1M57C 4KC9A 1ZU5A 4O6NA 4YT4A 3ABKC 3HTKC 5B1BC 1LS1A 3EHNA 4BG0A 4N06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1O A;  4ZLC A;  4YWQ A;  4QI0 A;  4ULW A;  5F5F A;  4ZLD A;  5F5H A;  4QI2 A; 
#chains in the Genus database with same CATH topology
 3KPH A;  4NTF A;  3B29 A;  3WAQ A;  2OJE D;  2OEV A;  2XS8 A;  2R02 A;  2CNW D;  1IW7 F;  2LD6 A;  4ULW A;  3VYW A;  3C63 A;  3MX3 A;  4MVM A;  4YJW A;  3H2V A;  4O6Y A;  1WOL A;  1WWP A;  4I44 A;  4BJ5 A;  4G7O F;  3KMI A;  3MYF A;  4KNV A;  3ZQY A;  2ZXW C;  4FES A;  4NC3 A;  1ZHW A;  4MTF A;  3CAX A;  5TJ5 E;  1SF8 A;  1YAR O;  4CDV A;  4C7O A;  4CIP A;  3EFO B;  2ASR A;  1NZE A;  5JRA A;  3CSK A;  4RBN A;  4IB4 A;  1VLT A;  4K0D A;  2IM8 A;  3G50 A;  1OW7 A;  1TWC A;  4DRJ B;  3EH2 A;  1VB5 A;  1DOW A;  2GAQ A;  2NG1 A;  3ECS A;  4LDR A;  3QW0 A;  2RSE B;  5JSL A;  1O87 A;  3VRC A;  2B0J A;  2C03 A;  2WB7 A;  2XLD A;  3C8Z A;  1U0B B;  3RH3 A;  4EHP A;  2XXA B;  3DM5 A;  3EGD A;  3I4U A;  2AWC A;  4X0R A;  5L0H A;  2XS1 A;  2NUP B;  3KYJ A;  3LEV A;  3ZTM A;  1RMV A;  1FAP B;  2JD3 A;  4P9T A;  1O5H A;  2EIN C;  3O6X A;  4XQ1 A;  3C62 A;  2IXM A;  1BZ4 A;  3EG9 A;  3AG1 C;  4U9E A;  1OCR C;  1LS4 A;  3RVZ A;  3EZH A;  1HW1 A;  4ULV A;  3K1H A;  4MTG A;  3LS1 A;  3TUL A;  4ER9 A;  3JZ0 A;  5L0C A;  3CQZ A;  1I4Y A;  4JEA A;  3T4R A;  2R7Q A;  3QMK A;  2QLA A;  3JT1 A;  2CGE A;  3C18 A;  4JZA A;  2HMQ A;  4MVO A;  3RQF A;  4KNW A;  2NUT B;  3GOR A;  5E3C A;  3JTL O;  1D1A A;  2QTV A;  3B71 A;  4PK4 A;  1JR8 A;  1ZW3 A;  1JRA A;  4NTB A;  3RIP A;  3V5Z A;  3QVZ A;  3ATP A;  1BR2 A;  3RW0 A;  1NSG B;  3N0T A;  2EIM C;  2YLG A;  1Q0G A;  2CYD A;  2YLD A;  2XLE A;  2EPM X;  3U3F A;  1XZQ A;  4XEF A;  4IGG A;  1OW8 A;  3DZA A;  2I8B A;  2PF4 E;  4GEH A;  3S27 A;  4CS7 A;  4CDY A;  4E7Z A;  5A6K A;  2UUH A;  2R7S A;  4AL1 A;  5L0F A;  3EH1 A;  3K1I C;  4HFK B;  5DS5 A;  1A41 A;  2JPU A;  5JVE A;  256B A;  1FMW A;  2AP3 A;  3AQC A;  1YYX A;  3KH2 A;  3JCU Q;  4JE9 A;  3U2M A;  3NYL A;  1ZZP A;  1C03 A;  4U5E E;  4J30 B;  4YL0 A;  4Z9H A;  5KYX A;  4RD9 A;  2A0B A;  4W8P A;  3F46 A;  2C04 A;  1TWA A;  1YLM A;  2HS5 A;  2L6G A;  5KYW A;  2V3C C;  3GWL A;  3V5X A;  1KTM A;  2A69 F;  1FMV A;  1OKK D;  3NYM A;  1YVI A;  1UG7 A;  4JW1 A;  5L0I A;  3C8G B;  3RQG A;  3SYN A;  1AUE A;  3UGO A;  5BQH A;  3M1C B;  3NKE A;  3MFN A;  1HMO A;  1CGN A;  5JLI A;  4U5H A;  1YA7 O;  1ZYR F;  2JX0 A;  1BR1 A;  3GAN A;  3R2P A;  1M6T A;  4MQ9 F;  1LE4 A;  1VMA A;  2YL7 A;  3BEH A;  1MMA A;  2PP4 A;  3L34 A;  3ZG1 A;  3DAF A;  4XWJ A;  2Q00 A;  3IQT A;  5DQZ A;  4IJJ A;  4IAQ A;  3S28 A;  4XEV A;  3S0X A;  2ZPA A;  3EJN A;  4F4B A;  4MVQ A;  1K40 A;  4D4N A;  3ASN C;  3S84 A;  4G7Z F;  5AC5 A;  2DI3 A;  1VK5 A;  3W2V A;  2TMV P;  4PFO A;  3AGT A;  3FAP B;  3QZC A;  4EBK A;  4C3D A;  2V26 A;  1C17 M;  4RDA A;  3V7O A;  5A6B A;  4XLP F;  4Q5S F;  2DB4 A;  2WL8 A;  2XLV A;  2XM4 A;  2GA0 A;  1Y6D A;  2Y3B A;  4KI2 A;  4CX9 A;  4LER A;  3JSZ A;  3JRT A;  2L7A A;  3DMD A;  4LDK A;  4U5D E;  4JCZ A;  3X2Q C;  3ZTZ A;  4Q4Z F;  4W8K A;  3QW1 A;  2AWY A;  1WAT A;  4Q7C A;  3WG7 C;  1H7I A;  3FMS A;  3K7D A;  1MMN A;  4P6I C;  4G7H F;  2H7B A;  2Q9B A;  1YZC A;  3C8G D;  1ORS C;  3U8V A;  4AE4 B;  3KL4 A;  4NCQ A;  4AL0 A;  4BJ5 C;  5JS5 A;  1EQ1 A;  3ZIB A;  2G3K A;  4CBE A;  3ZSU A;  5D92 A;  4IAO A;  5FZT A;  5BUO A;  3UMI A;  2CCY A;  3UNG C;  4E7S A;  1PV3 A;  5BQI A;  3U5S A;  2AU5 A;  1E85 A;  2ZXO A;  1A0B A;  4EBB A;  2IOQ A;  3JYH A;  3DJN B;  5JT4 A;  2HJM A;  1G4W R;  2EIJ C;  1OXB A;  3HJC A;  3SEO A;  4C3E A;  4NTA A;  3E70 C;  4BJT A;  1M2V A;  3K1I A;  3ZDL A;  3V5Y A;  4OIR F;  1ORJ A;  1RCP A;  4MVS A;  4CJG A;  5E3A A;  4N4W A;  2ZXP A;  4BPM A;  2VAS A;  1K05 A;  4U5B E;  2I15 A;  1L3P A;  1RJ9 A;  3H65 A;  3PMR A;  3DWW A;  5DS4 A;  3FOO A;  1CPQ A;  1M2O A;  1FFH A;  2W45 A;  3SXZ A;  3FAJ A;  2LQG A;  1QPU A;  4FX5 A;  1ZHY A;  3JSE O;  1SYQ A;  2R7O A;  3W8H A;  2OQM A;  2Y69 C;  3NG1 A;  3SXK A;  1E86 A;  1ZHT A;  4QDL A;  5BQG A;  3PHF 2;  5GPG B;  3DJU B;  3IQ6 A;  2IXO A;  2Q3T A;  3K6B A;  4PJL A;  3LNM B;  1N1C A;  3UMH A;  2M64 A;  2W4M A;  1D0Z A;  5EK0 A;  3VF0 A;  3VM6 A;  2VH3 A;  2XSE A;  4H4K C;  5F5H A;  4E0H A;  1TQG A;  1FNT c;  2J9V A;  4XLN F;  2WZL A;  1QVX A;  3AGU A;  4PFP A;  3A9C A;  4KBL A;  5E33 A;  1E84 A;  3GM2 A;  2UUI A;  3EGX B;  2ZD9 A;  4N6C A;  4FAP B;  1FTS A;  2IYL D;  4MW3 A;  1I4Z A;  4OD4 A;  1SR2 A;  3LLK A;  3ASO C;  1LIH A;  3C7J A;  3R7C A;  4CIH A;  1D1C A;  2LCH A;  3LUT B;  1Z63 A;  2NPU A;  1OQC A;  1NLX A;  1PCX A;  3POV A;  4ZLC A;  2RD9 A;  1LPE A;  1S7Z A;  3JYY A;  1QZX A;  4XEK A;  1YJG A;  1RKE A;  4ANJ A;  2J45 A;  3LS0 A;  5JP7 A;  1OW6 A;  4OD5 A;  2M4E A;  2R03 A;  2OU6 A;  2Y3D A;  1T9K A;  1ZHZ A;  2Q9C A;  3I5P A;  4J7Y A;  1WGW A;  1D0X A;  1TKN A;  1TR2 A;  2YLI A;  3GEH A;  1G4U S;  3NYJ A;  1EI7 A;  3O10 A;  1ZW2 A;  2WVQ A;  1NG1 A;  3T6B A;  3TK0 A;  5B3S C;  1MMG A;  1VOM A;  2HZ8 A;  4IRU A;  1KNY A;  2MHR A;  2YL3 A;  2OJQ A;  3HNK A;  2YHS A;  3DI5 A;  4IWB A;  4B6I A;  5DQT A;  2F22 A;  2BE5 F;  3Q6M A;  4BJ6 C;  3HLZ A;  4I3M A;  1XWJ A;  4MTO A;  4C7O B;  3ABL C;  4R32 A;  2LFD A;  4EBJ A;  2KC3 A;  1LM3 B;  1V74 B;  3TD7 A;  2D4U A;  4A2N B;  4OIO F;  1TWG A;  4U5F E;  3MLG A;  1Q0F A;  4WGZ A;  2QUP A;  4MVZ A;  4UDV A;  3GEE A;  1YAU O;  2XM0 A;  2NSG A;  3G4X A;  3L1M A;  5KYU A;  5EHH A;  1T6Q A;  1J8Y F;  1WN0 A;  3ZWI A;  1DOV A;  2KK1 A;  2W4B A;  1MND A;  3LLI A;  2XLM A;  4MVU A;  3TOL A;  2HFI A;  3EGD B;  4DXW A;  2ICW G;  3FVY A;  4FWV A;  4XPW A;  4Z9I A;  1T6U A;  4N6H A;  5T1D B;  2Q7R A;  1TFO B;  2MYS A;  2XRH A;  2ZXR A;  4BEM J;  4L6R A;  1Z5Z A;  4MW8 A;  3A11 A;  3U9M A;  1Q0D A;  3LAY A;  4NY3 A;  2EPK X;  2J8W A;  2OG2 A;  4HFF B;  4CS8 C;  5HV9 A;  3S29 A;  2A6E F;  3EG9 B;  4DJ9 A;  1LI5 A;  2J7P A;  3HNI A;  4YT8 A;  1I5N A;  4J32 B;  3TJ6 A;  2YL1 A;  3PDM P;  1IZM A;  3AQB A;  4LLE A;  4Z9J A;  1MNE A;  5CI9 A;  3M4C A;  4JKV A;  4U5G A;  2YWA A;  4DBR A;  1G5Z A;  2FFH A;  3Q7G A;  2R7U A;  3OWT A;  1BR4 A;  5F28 E;  4ZLD A;  2PX0 A;  1LI7 A;  3H2U A;  1UFB A;  3EFO A;  3CZ6 A;  3IPM O;  3U2L A;  1MMD A;  1HMD A;  2OKU A;  4P9F A;  5DLJ A;  5IY5 C;  1A7V A;  3DE9 A;  4WJ0 A;  4XPX A;  1A7D A;  4HE8 D;  4U9D A;  1JAF A;  2YL0 A;  1GGQ A;  4LDQ A;  2XLH A;  2FGY A;  4O6M A;  5COG A;  3GEI A;  4CS9 C;  3B0V C;  1S05 A;  3SP1 A;  3FXH A;  3SXY A;  1LVK A;  3MBG A;  1JMW A;  2IBF A;  4DOZ A;  3X1O A;  5EGY A;  1BDJ B;  2XXA A;  1QSP A;  2H8A A;  2YEV A;  4EKW A;  2HV6 A;  5AGF A;  2H7O A;  4QI0 A;  3T6J A;  2NUP A;  5L3V A;  2CDQ A;  4LAC B;  2LP4 A;  2QNL A;  4C3B A;  2A68 F;  3OEO A;  1HE1 A;  2Q4F A;  4MVR A;  2KJG A;  1YZA A;  2L6F A;  3I5Q A;  3NMK A;  3T9O A;  4CSA C;  4OIQ F;  2L81 A;  2CW0 F;  2XLW A;  1YYJ A;  2VCC A;  3DKA A;  3HNL A;  1RKC A;  2KSF A;  2X51 A;  3ZQV A;  3EPV A;  2PX3 A;  5KYX B;  3AG3 C;  3SXM A;  2R7R A;  1U6H A;  2OCC C;  2EPN A;  1OKK A;  5KYW B;  1GM5 A;  3J06 A;  3M79 A;  2L9J A;  3NRH A;  4PAC A;  3FOP A;  1AVO B;  1RXQ A;  3U8P A;  3US6 A;  3S9O A;  5D91 A;  1Y4C A;  2NUT A;  2Y3G A;  5L3Q A;  2XL4 A;  3TOM A;  1CGM E;  3RKO F;  4LLC A;  2PBE A;  4BJ1 A;  2DYR C;  1O3U A;  5FCL A;  2J9U A;  1ZHX A;  1BBH A;  2YZS A;  3L8J A;  4J7T A;  2LIG A;  3SNH A;  2E87 A;  3UR3 C;  1E83 A;  2HJ3 A;  1JPJ A;  2VB6 A;  3Q6N A;  3CEX A;  4U5C E;  4WAB A;  4G0H A;  1VTM P;  3TJ5 A;  2BC5 A;  1JOG A;  3RVY A;  1T6I A;  2GFH A;  4I1O B;  1VYI A;  4CDA A;  1F1M A;  1ZVZ A;  4ONS A;  3LEO A;  5KYY A;  3U3B A;  1Q0K A;  4M63 A;  4EWC A;  1H9T A;  1W2W A;  2W9Y A;  5CI8 A;  2LK4 A;  1GQA A;  3RFY A;  1TFK B;  3GM1 A;  1H6G A;  1MQV A;  4DVY P;  3B0P A;  4JRZ A;  3M15 A;  4CS8 A;  2YKZ A;  4GQH A;  1VYK A;  2XL8 A;  2PFD A;  2HSQ A;  2Z15 A;  1J8M F;  1PD0 A;  2WVO A;  4JJG A;  3DM9 B;  3IEE A;  3RYL A;  4AX2 A;  5DS6 A;  1AEP A;  3FDQ A;  5AC4 A;  3KYI A;  4OIN F;  3T6G B;  1M56 C;  1H9G A;  1LKX A;  2WVN A;  2VCA A;  1GS9 A;  2Y3H A;  3DAG A;  2R7V A;  2EPL X;  2A1D D;  4DRI B;  1QLE C;  2LSE A;  3C8G A;  4YWQ A;  1NBB A;  1OXK A;  2WZG A;  3AG4 C;  3AJM A;  3L0I A;  3NDB B;  1YA9 A;  4JTD B;  3G4Z A;  4JVS A;  3ABM C;  1VLS A;  3IQC A;  4JTA B;  3UMK A;  2A6H F;  2D5R B;  2DGJ A;  4IAR A;  4BEJ A;  4CS9 A;  1FFT C;  2CNW A;  3K66 A;  2J0X A;  2KYH A;  4I1M A;  3DXJ F;  2EPO A;  4PR9 A;  4YT2 A;  2YQY A;  5JUA A;  5L0D A;  3S90 A;  1YDI A;  2Y39 A;  3EQL F;  3EZI A;  2H7V C;  3W4Y A;  5T3T A;  4H54 A;  4JC7 A;  2P1A A;  2AVK A;  5COM A;  2J7P D;  4JJF A;  5KYN A;  4JIO A;  1FR0 A;  2GWW A;  4PJM A;  3TQO A;  5B3I A;  1Q0M A;  2KW3 C;  4JEB A;  2HSB A;  1V55 C;  1M2V B;  3HKK A;  1Z6A A;  1CGO A;  2P61 A;  1OCC C;  2QE9 A;  4G78 A;  5A6J A;  5L0G A;  4CSA A;  2EIK C;  2EIL C;  4YT5 A;  5CIV A;  1T5O A;  3NKD A;  4K7B A;  2R05 A;  1ZU4 A;  3W2W A;  1OR2 A;  2DYS C;  3MYI A;  4EUK B;  1D0Y A;  2QY9 A;  1RJ9 B;  2LFF A;  5A6B D;  1LE2 A;  3WHN A;  1L7C A;  2XL6 A;  3DE8 A;  1WTY A;  1ST6 A;  3HNJ A;  3NMI A;  4DBQ A;  4K1O A;  3GM3 A;  5DVW A;  3N2Z B;  1CPR A;  2L6H A;  4XPY A;  5KYY B;  2X0C A;  1EKY A;  1TWH A;  4PJJ A;  4AE4 A;  3UGP A;  2YRF A;  3GOD A;  1D1B A;  3W8I A;  2IXP A;  2J0W A;  5B1A C;  4JTC B;  3RF3 A;  4JCH A;  4DRH B;  2ETS A;  4JUR I;  2R25 A;  2P6V A;  2R7W A;  1Z3I X;  2HUJ A;  3RQE A;  3O55 A;  1QKR A;  2NSF A;  1U89 A;  1A7E A;  2HV7 A;  1KU2 A;  3ITF A;  3QTH A;  1EA8 A;  1SMY F;  3U0C A;  2HMZ A;  3LNR A;  2R7X A;  4NQF A;  4DVZ A;  1SZI A;  4GYT A;  3NMJ A;  4XTK A;  1OCZ C;  4O7G A;  2IXN A;  4MS2 A;  2YVK A;  3BRJ A;  2OOC A;  3O39 A;  2J46 A;  5HSW A;  3M4B A;  1B68 A;  3SZR A;  5A6A A;  1R4T A;  1APC A;  4YL3 A;  1HE9 A;  4MND A;  1PD1 A;  1V4A A;  3ZVR A;  4A4A A;  1QQ3 A;  2O9X A;  4HEA J;  1V54 C;  2KGO A;  2KNH A;  2Q9A A;  2WZF A;  3LJB A;  1RKE B;  2OEX A;  1G8X A;  3OA1 A;  3QVY A;  3U9J A;  3B0U X;  1R5I D;  2XLO A;  3N24 A;  1NU7 D;  2VCB A;  3FHD A;  4D4X A;  5A69 A;  4E18 A;  3B9Q A;  4YK5 A;  2J9W A;  2R7T A;  1K04 A;  2A0U A;  4WGY A;  1OCO C;  2P0N A;  1WAS A;  3KKB A;  5F5F A;  2FAP B;  1C02 A;  2VC9 A;  1XZP A;  3AOU A;  2R9R B;  5L0J A;  3WOD F;  5T3W A;  4PJN A;  2P7V A;  4CJO A;  1JPN A;  1Z7Q c;  4AK9 A;  5K0I A;  3AG2 C;  3K33 A;  3Q7L A;  1HW2 A;  4QI2 A;  3L8I A;  3DD7 A;  3GWN A;  2PNO A;  4E17 A;  3JRM O;  1NU9 C;  2HKV A;  3EGX A;  1NFN A;  3IHU A;  4YL1 A;  5E2Q A;  4OIP F;  1NFO A;  2GDC A;  2J9B A;  1E2X A;  4O79 A;  3VAY A;  4E0I A;  2B0H A;  1HY5 A;  2KQ9 A;  2G62 A;  3E9V A;  1T01 A;  2MWQ A;  4BJ6 A;  3LES A;  3IQ5 A;  3F47 A;  4YN0 B;  1Z23 A;  5KYU B;  2G3V A;  3EHM A;  1OR3 A;  1M57 C;  4KC9 A;  1ZU5 A;  3ZC4 A;  4O6N A;  4YT4 A;  3ABK C;  1ORY A;  2BL2 A;  3HTK C;  3PCV A;  5COF A;  5B1B C;  1LS1 A;  3EHN A;  4EIY A;  4BG0 A;  4N06 A; 
#chains in the Genus database with same CATH homology
 2CNW D;  1IW7 F;  4ULW A;  3VYW A;  3MX3 A;  4YJW A;  4O6Y A;  4I44 A;  4BJ5 A;  4G7O F;  3KMI A;  4KNV A;  2ZXW C;  4FES A;  1ZHW A;  1SF8 A;  4C7O A;  3EFO B;  1NZE A;  3CSK A;  4RBN A;  4K0D A;  1TWC A;  3EH2 A;  2NG1 A;  3ECS A;  1O87 A;  2B0J A;  2C03 A;  2WB7 A;  3RH3 A;  2XXA B;  3DM5 A;  3EGD A;  3I4U A;  4X0R A;  2NUP B;  3LEV A;  2JD3 A;  1O5H A;  2EIN C;  3O6X A;  2IXM A;  3EG9 A;  3AG1 C;  1OCR C;  3EZH A;  3K1H A;  3LS1 A;  3CQZ A;  3T4R A;  2R7Q A;  3QMK A;  3JT1 A;  2CGE A;  4JZA A;  4KNW A;  2NUT B;  5E3C A;  1D1A A;  2QTV A;  4PK4 A;  3RIP A;  1BR2 A;  3N0T A;  2EIM C;  3DZA A;  2I8B A;  2PF4 E;  4GEH A;  3S27 A;  4CS7 A;  4E7Z A;  2R7S A;  3EH1 A;  3K1I C;  4HFK B;  5DS5 A;  1FMW A;  3AQC A;  3KH2 A;  3JCU Q;  3NYL A;  4U5E E;  4J30 B;  5KYX A;  4RD9 A;  3F46 A;  2C04 A;  1TWA A;  5KYW A;  2V3C C;  2A69 F;  1FMV A;  1OKK D;  3NYM A;  4JW1 A;  3SYN A;  3UGO A;  3M1C B;  3NKE A;  3FDQ A;  4U5H A;  1ZYR F;  3GAN A;  1BR1 A;  4MQ9 F;  1VMA A;  1MMA A;  2PP4 A;  3L34 A;  3ZG1 A;  3DAF A;  4XWJ A;  5DQZ A;  4IJJ A;  3S28 A;  3S0X A;  3EJN A;  2ZPA A;  4F4B A;  4G7Z F;  3ASN C;  1VK5 A;  3W2V A;  4PFO A;  3QZC A;  4C3D A;  2V26 A;  4RDA A;  3V7O A;  4XLP F;  4Q5S F;  2WL8 A;  2Y3B A;  4KI2 A;  4LER A;  3JSZ A;  3JRT A;  3DMD A;  4U5D E;  3X2Q C;  4Q4Z F;  4W8K A;  4Q7C A;  3WG7 C;  4G7H F;  3K7D A;  1MMN A;  4P6I C;  2H7B A;  2Q9B A;  4AE4 B;  3KL4 A;  3ZIB A;  2G3K A;  4CBE A;  3ZSU A;  5D92 A;  4IAO A;  5BUO A;  3UMI A;  3UNG C;  4E7S A;  2ZXO A;  4EBB A;  2IOQ A;  3JYH A;  3DJN B;  2EIJ C;  3HJC A;  3SEO A;  3E70 C;  4BJT A;  1M2V A;  4OIR F;  5E3A A;  2ZXP A;  2VAS A;  4U5B E;  1RJ9 A;  3H65 A;  3PMR A;  5DS4 A;  1M2O A;  2W45 A;  1FFH A;  3FAJ A;  4FX5 A;  1ZHY A;  2R7O A;  3W8H A;  2Y69 C;  3NG1 A;  1ZHT A;  4QDL A;  3PHF 2;  3DJU B;  4PJL A;  2IXO A;  2Q3T A;  3K6B A;  1N1C A;  3UMH A;  2W4M A;  1D0Z A;  2VH3 A;  2XSE A;  4H4K C;  5F5H A;  2J9V A;  4XLN F;  2WZL A;  4PFP A;  4KBL A;  5E33 A;  3EGX B;  1FTS A;  2IYL D;  4OD4 A;  2R7U A;  3LLK A;  4CIH A;  3ASO C;  1D1C A;  1Z63 A;  1PCX A;  3POV A;  4ZLC A;  1S7Z A;  1QZX A;  4ANJ A;  2J45 A;  3LS0 A;  4OD5 A;  2M4E A;  2Y3D A;  1ZHZ A;  2Q9C A;  3I5P A;  1D0X A;  1TKN A;  1TR2 A;  1WGW A;  3NYJ A;  2WVQ A;  1NG1 A;  3T6B A;  5B3S C;  1MMG A;  1VOM A;  4IRU A;  2YHS A;  4IWB A;  4B6I A;  5DQT A;  3Q6M A;  2BE5 F;  4BJ6 C;  3HLZ A;  4I3M A;  4C7O B;  3ABL C;  3TD7 A;  4A2N B;  4OIO F;  1TWG A;  4U5F E;  3MLG A;  5KYU A;  5EHH A;  1J8Y F;  3LLI A;  2W4B A;  1MND A;  3EGD B;  3FVY A;  4FWV A;  5T1D B;  4BJ5 C;  3NDB B;  4DOZ A;  2XRH A;  2MYS A;  2ZXR A;  4C3E A;  1Z5Z A;  3LAY A;  4NY3 A;  2OG2 A;  4HFF B;  4CS8 C;  3S29 A;  2A6E F;  3EG9 B;  4YT8 A;  2J7P A;  4J32 B;  1IZM A;  3AQB A;  4LLE A;  1MNE A;  5CI9 A;  4U5G A;  4DBR A;  2FFH A;  3Q7G A;  3OWT A;  1BR4 A;  4ZLD A;  2PX0 A;  3EFO A;  3CZ6 A;  1MMD A;  5DLJ A;  5IY5 C;  4WJ0 A;  4HE8 D;  2FGY A;  4O6M A;  4CS9 C;  3B0V C;  3SP1 A;  1LVK A;  3X1O A;  5EGY A;  2XXA A;  2YEV A;  2HV6 A;  2H7O A;  4QI0 A;  3T6J A;  2NUP A;  5L3V A;  2CDQ A;  4LAC B;  4C3B A;  2A68 F;  3OEO A;  2KJG A;  3I5Q A;  4CSA C;  4OIQ F;  2L81 A;  2CW0 F;  2X51 A;  3EPV A;  2PX3 A;  5KYX B;  3AG3 C;  2R7R A;  2OCC C;  5KYW B;  1OKK A;  2L9J A;  3NRH A;  5L3Q A;  5D91 A;  2NUT A;  2Y3G A;  2XL4 A;  3RKO F;  4LLC A;  4BJ1 A;  5FCL A;  2DYR C;  2J9U A;  1ZHX A;  3SNH A;  2YZS A;  2E87 A;  3UR3 C;  1JPJ A;  2VB6 A;  3Q6N A;  4U5C E;  4G0H A;  4I1O B;  2GFH A;  1VYI A;  5KYY A;  4M63 A;  4EWC A;  1W2W A;  2W9Y A;  5CI8 A;  3RFY A;  4DVY P;  3B0P A;  4CS8 A;  1VYK A;  2PFD A;  2Z15 A;  1J8M F;  1PD0 A;  2WVO A;  4JJG A;  3DM9 B;  3IEE A;  3RYL A;  4AX2 A;  5DS6 A;  4OIN F;  1M56 C;  1LKX A;  2WVN A;  2Y3H A;  3DAG A;  2R7V A;  2A1D D;  1QLE C;  2LSE A;  4YWQ A;  2WZG A;  3L0I A;  3AG4 C;  4JVS A;  3ABM C;  3UMK A;  2A6H F;  2D5R B;  2DGJ A;  4BEJ A;  4CS9 A;  1FFT C;  2CNW A;  3K66 A;  2J0X A;  4I1M A;  3DXJ F;  4YT2 A;  3EQL F;  2Y39 A;  3EZI A;  2H7V C;  5T3T A;  2J7P D;  4JJF A;  5KYN A;  4PJM A;  2KW3 C;  1V55 C;  1M2V B;  1Z6A A;  1OCC C;  4CSA A;  2EIK C;  2EIL C;  4YT5 A;  3NKD A;  4K7B A;  3W2W A;  1ZU4 A;  2DYS C;  1D0Y A;  2QY9 A;  1RJ9 B;  1ST6 A;  4DBQ A;  5DVW A;  3N2Z B;  5KYY B;  1TWH A;  4PJJ A;  4AE4 A;  3UGP A;  3GOD A;  1D1B A;  3W8I A;  2IXP A;  2J0W A;  5B1A C;  4JCH A;  4JUR I;  2P6V A;  2R7W A;  1Z3I X;  2HV7 A;  1KU2 A;  3ITF A;  1SMY F;  3LNR A;  2R7X A;  4DVZ A;  1SZI A;  4GYT A;  4XTK A;  1OCZ C;  4O7G A;  2IXN A;  3O39 A;  2J46 A;  5HSW A;  3SZR A;  4MND A;  1PD1 A;  3ZVR A;  2O9X A;  4HEA J;  1V54 C;  2KGO A;  2KNH A;  2Q9A A;  2WZF A;  3LJB A;  3OA1 A;  1G8X A;  3B0U X;  3N24 A;  1NU7 D;  3FHD A;  3B9Q A;  2J9W A;  2R7T A;  1OCO C;  3KKB A;  5F5F A;  3WOD F;  5T3W A;  4PJN A;  2P7V A;  1JPN A;  4AK9 A;  3AG2 C;  3K33 A;  3Q7L A;  4QI2 A;  3DD7 A;  1NU9 C;  3EGX A;  4OIP F;  5E2Q A;  4O79 A;  3VAY A;  2KQ9 A;  2G62 A;  3E9V A;  2MWQ A;  4BJ6 A;  3LES A;  3F47 A;  4YN0 B;  1Z23 A;  5KYU B;  2G3V A;  3EHM A;  3ZC4 A;  1M57 C;  4KC9 A;  1ZU5 A;  4O6N A;  4YT4 A;  3ABK C;  3HTK C;  5B1B C;  1LS1 A;  3EHN A;  4BG0 A;  4N06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...