4AL1A

Crystal structure of human ps-1 gsh-analog complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
143
structure length
143
Chain Sequence
b'SPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROSTAGLANDIN E SYNTHASE
publication title Crystal Structure of Microsomal Prostaglandin E2 Synthase Provides Insight Into Diversity in the Mapeg Superfamily.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 64
structure length 143
sequence length 143
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4al1A00
5BQIA 3DWWA 5BQGA 3LEOA 5HV9A 4J7YA 4WABA 4JC7A 4JCZA 4NTBA 4BPMA 2PNOA 4YL3A 5K0IA 5BQHA 3B29A 2Q7RA 2UUHA 4NTAA 4JRZA 4AL0A 3PCVA 2H8AA 4AL1A 4YL1A 2UUIA 4YK5A 4J7TA 3HKKA 4YL0A 4NTFA
chains in the Genus database with same CATH superfamily
3EGDB 3TULA 1WASA 2IXNA 3SXYA 1HMOA 2KQ9A 1D1CA 1ZHYA 2HJ3A 3B0PA 1G4US 4XQ1A 3V7OA 2Y69C 4MVQA 2AU5A 5JRAA 5B1AC 1D1BA 5CI9A 3RQEA 4ULVA 4Q5SF 1TWHA 4KNVA 3Q6NA 3GWNA 3QMKA 1JAFA 1N1CA 2KSFA 1IZMA 2OEVA 3SXKA 3JSEO 2R7XA 3UR3C 1BDJB 4AK9A 4WGYA 2P6VA 2EPNA 2JD3A 3JRMO 1ZU4A 2EILC 4DVZA 3JSZA 3VRCA 2DGJA 3K7DA 4CS9C 4CIHA 5A6BA 3QW0A 4U5DE 2W45A 3L34A 1C17M 2J45A 2YL7A 3RYLA 2EPMX 4BJ6A 3SZRA 3JZ0A 3AGUA 1T9KA 5BQIA 5FCLA 1T5OA 2WZGA 2IXOA 2XM4A 4HFKB 5BQGA 5KYUA 2NUTA 2CW0F 3RF3A 3DAFA 1E2XA 1LI5A 2X51A 3T6BA 4DVYP 4OIPF 4KC9A 4PR9A 1RCPA 2FGYA 4NTBA 3DJUB 4MVSA 1OCRC 1PD0A 1O5HA 2FFHA 2YZSA 2Y3HA 2W4BA 3AJMA 4JTDB 4G0HA 3KMIA 2HMZA 3QW1A 3NMIA 1O3UA 3EFOA 5B3IA 1Z5ZA 4HE8D 2ZXOA 4DRJB 3ZC4A 2Q7RA 1G8XA 5T3WA 3HJCA 4G7HF 4CSAC 1Z63A 4K0DA 5L0HA 4JRZA 5DS5A 2B0JA 1A7VA 4JIOA 3DAGA 4DBRA 3GWLA 4YJWA 4NQFA 1CGOA 3V5XA 2W9YA 4JZAA 4C3BA 2R05A 4YT8A 1JRAA 1WATA 4HFFB 3MYIA 2PX0A 1LVKA 2BE5F 4E18A 4N6CA 3EZIA 1HE9A 3W2VA 3WG7C 1E86A 2YVKA 4EWCA 5L0FA 1ZHTA 3KYIA 1D0ZA 1OW7A 4OD4A 2WZFA 4YL3A 3ZIBA 5K0IA 1OKKD 3ABMC 1H9TA 1LE2A 4LDKA 3UGPA 4E0HA 2EPLX 1ZU5A 5T3TA 4PACA 3U9JA 4EBKA 5KYYB 4OIQF 1NZEA 1A41A 1ORJA 5L3QA 2YL3A 1YA9A 3NDBB 3GORA 2YLDA 3E9VA 4FAPB 2NSFA 1A7DA 1H7IA 3HNKA 4P9FA 3U9MA 5A6JA 2HZ8A 2YRFA 4C3DA 1J8YF 3B0UX 2CYDA 2GDCA 3CAXA 3ZG1A 1VK5A 2ZXPA 2ICWG 4E0IA 3S0XA 4PJLA 2XLMA 1WN0A 3S29A 4ZLDA 1ZW2A 3C8GD 1SR2A 3JRTA 4RDAA 5D92A 1YVIA 3J06A 1MMGA 1SZIA 3SEOA 2YWAA 1GM5A 2XXAB 1OR2A 2VH3A 2VC9A 1MNEA 2LFFA 2MYSA 2Y3DA 1MMNA 2Y3GA 3EGXA 4I1MA 4MTFA 5JSLA 2R7TA 1SMYF 4ULWA 2ZPAA 1NFNA 1CGNA 1LS4A 1JPJA 3DJNB 5B3SC 1YZAA 1TQGA 4E7ZA 4YL1A 2CGEA 1Q0DA 3RIPA 2R7SA 5JT4A 3VM6A 1GQAA 2Q9BA 3NG1A 2XRHA 1XWJA 1QVXA 2QE9A 4HEAJ 4X0RA 4OINF 4CJOA 4MQ9F 4MTGA 4XLPF 3EG9A 2B0HA 1D1AA 1ST6A 3EH1A 2A6HF 3LEOA 4A2NB 1DOVA 1UFBA 3L0IA 2GAQA 4J7YA 4H4KC 3ZTMA 1QQ3A 2BL2A 1D0YA 4JC7A 4DBQA 3OWTA 4O7GA 5EHHA 2Q00A 5KYXA 1DOWA 3Q7LA 2KGOA 3IPMO 1VB5A 4JJFA 4DRHB 3TOMA 3WODF 1IW7F 2L81A 1BR1A 4GEHA 3B0VC 1TFKB 2BC5A 3IQCA 1T01A 2VB6A 3MFNA 3SNHA 2P7VA 5L0DA 2J7PA 2AVKA 2R7WA 4K1OA 3BEHA 2H8AA 3LS0A 4Z9IA 4AE4A 4DRIB 1I5NA 2OG2A 3RFYA 3LEVA 4CBEA 3M79A 5BUOA 3RW0A 3U0CA 2NUPA 2VCAA 2RD9A 4YL0A 4CDAA 4NTFA 4EKWA 2XL6A 3C62A 4JKVA 4I3MA 1H6GA 3SXMA 1YLMA 2J8WA 1C02A 1LM3B 1KTMA 2NPUA 1VLTA 4FX5A 3RKOF 4U5BE 3K1IC 3ASOC 3OEOA 2VASA 3HNLA 5CIVA 4O79A 3SXZA 3O6XA 4KI2A 1Q0MA 1G5ZA 3ZQVA 2OQMA 2VCCA 3NYLA 4N06A 1RKEB 3AOUA 4KBLA 4W8PA 4CX9A 2DI3A 1QLEC 4BJ5C 4CS8C 4C7OA 5A6BD 2HV7A 4C3EA 4IGGA 5JP7A 4JJGA 1JMWA 4NTAA 3H65A 1Z7Qc 3NYMA 3T9OA 5IY5C 1AUEA 4EBJA 1B68A 1NSGB 4YK5A 2CCYA 4J7TA 4U5FE 2G3VA 1S7ZA 3EJNA 1VYIA 1PV3A 4JEAA 2KYHA 3KKBA 5DS6A 3DI5A 1UG7A 2V3CC 5KYWA 5F5FA 2AWYA 2WB7A 1V4AA 3AG1C 1V54C 2L7AA 3B9QA 3KPHA 3EQLF 2IM8A 2PX3A 2EIMC 1FAPB 3ITFA 1YAUO 3MBGA 3S27A 4Z9JA 5EGYA 2LSEA 1CPRA 3VF0A 2XM0A 2F22A 3C8GB 3A11A 4MTOA 1V74B 1PCXA 3SYNA 3ECSA 3KH2A 1R5ID 3NMJA 3CZ6A 5E3CA 2XS1A 2A1DD 2Q9AA 2VCBA 3FVYA 1XZPA 3NYJA 1LPEA 2YKZA 4NCQA 2L6HA 4BJTA 4AL0A 5DQTA 2L6FA 4JTCB 3JTLO 1EI7A 3G4XA 3JYHA 1M2VB 2YLIA 5DVWA 3AG4C 3FAJA 3K1HA 2J9VA 1WOLA 1BR2A 3LAYA 4U9DA 1BR4A 3MLGA 1M56C 2LQGA 2PFDA 4XWJA 4LDRA 3EHMA 1MNDA 2R7OA 1NG1A 4MS2A 3U3BA 2W4MA 3DM5A 4MNDA 1D0XA 1G4WR 2PP4A 1T6UA 3TOLA 1V55C 1T6QA 4MVRA 4PJNA 3H2VA 4IB4A 1S05A 2JX0A 1KU2A 2YL1A 4ONSA 3TJ5A 4FESA 1ZW3A 4B6IA 2J9BA 2JPUA 3DD7A 5L0CA 3PHF2 1WTYA 2D4UA 2RSEB 3UMIA 2ETSA 2Y39A 1YDIA 2J9WA 3AQBA 3PCVA 4BEMJ 3U2MA 3UNGC 5L3VA 1Q0GA 3FOPA 2QNLA 1TFOB 4Q4ZF 5COMA 4CIPA 1U89A 2XS8A 1EQ1A 1RJ9A 2PBEA 2IXMA 4K7BA 5B1BC 4BJ6C 2AP3A 3O39A 5T1DB 1VTMP 3EGDA 1OXKA 4PFPA 2J0XA 1YZCA 1U0BB 1FFHA 1OW6A 2XL8A 3EPVA 5E2QA 2XLVA 1MQVA 1NBBA 5JLIA 3Q6MA 3GEIA 5COGA 1VOMA 3LUTB 1OCZC 1Z3IX 5JS5A 5L0GA 4U5GA 2OKUA 2P0NA 3MYFA 1Z6AA 3CQZA 1LIHA 3PMRA 1ORSC 3U8PA 4JW1A 2C04A 4D4XA 2ASRA 4EUKB 2L6GA 2WVNA 4MVMA 3L8JA 3HLZA 5L0IA 2G62A 1FNTc 2GFHA 3F46A 4O6MA 4IAOA 3KYJA 1SF8A 3W8IA 4EBBA 1R4TA 1O87A 2OEXA 4LLCA 2OCCC 1M2OA 2Q9CA 4MVUA 1TR2A 1ORYA 1WWPA 2NUTB 4L6RA 4PFOA 3RQFA 5KYUB 1Y4CA 3T6JA 3HNJA 3I5PA 4CJGA 1I4ZA 2EPKX 2R7VA 2Y3BA 4XEFA 2H7VC 3RH3A 4OIOF 3N24A 3DXJF 3HTKC 2CNWA 1QPUA 4IRUA 2XLOA 3G50A 3NRHA 1CPQA 3EFOB 3U5SA 3US6A 4RBNA 2MHRA 3GM1A 3K33A 4O6NA 4CDYA 1Q0FA 3NMKA 3ZTZA 1VLSA 2OJQA 4MVOA 4CS9A 3T6GB 4WGZA 1GS9A 4GYTA 3L8IA 2R7UA 4KNWA 4I1OB 2GA0A 1E85A 4E17A 3RVYA 1EA8A 3TK0A 2WZLA 3AGTA 4EHPA 1OQCA 2PF4E 3AQCA 4UDVA 4XEKA 3VAYA 1NU9C 2OU6A 4JTAB 3DE8A 5JUAA 3DKAA 3IQTA 4XPWA 1QZXA 3U2LA 1L3PA 2EIJC 3VYWA 2LCHA 4G7OF 1T6IA 4U5HA 2E87A 3BRJA 3LNMB 2YQYA 2EIKC 2DB4A 5TJ5E 3ZWIA 2HSBA 3GANA 1ZZPA 1VMAA 5AC4A 4CSAA 1HW2A 3IQ5A 2MWQA 3N0TA 5BQHA 2KC3A 1XZQA 3KL4A 1ZVZA 2ZXWC 3G4ZA 1NU7D 2UUHA 3QVYA 2J46A 4Q7CA 3V5YA 3W2WA 3QTHA 4JCHA 3LJBA 3T4RA 1J8MF 4H54A 1F1MA 1BZ4A 5KYYA 1YARO 5L0JA 1NFOA 4QI2A 4I44A 2YHSA 3IQ6A 2CDQA 3ABKC 3NKEA 2I8BA 4O6YA 3QZCA 4DOZA 5E3AA 1E83A 2KK1A 1H9GA 2HS5A 4P9TA 4PJMA 4OD5A 3WAQA 2L9JA 3CSKA 3DM9B 3ZDLA 1I4YA 4G7ZF 3ABLC 3MX3A 1YJGA 1SYQA 3B71A 3Q7GA 3UMKA 4BPMA 1OW8A 3EGXB 1FMVA 1LE4A 5GPGB 2I15A 1HY5A 4W8KA 1M6TA 2X0CA 2C03A 1U6HA 1RKCA 2EPOA 4BG0A 2XXAA 1PD1A 2M4EA 3M4CA 3LESA 4Z9HA 5A6AA 1OXBA 4DXWA 4LACB 2R7RA 2LD6A 4FWVA 4N6HA 4MVZA 3C63A 4QI0A 3ZVRA 3X1OA 5EK0A 2M64A 4LDQA 3EG9B 2A0UA 3W4YA 3FAPB 4YT4A 3M15A 3NKDA 2HKVA 4LLEA 3EZHA 4XPXA 2J0WA 2EINC 5KYXB 5DLJA 1TWCA 3TQOA 3FXHA 1FFTC 1Z23A 4JCZA 4M63A 1WGWA 2A6EF 3JCUQ 4IAQA 2IOQA 2LIGA 4OIRF 4ZLCA 4JURI 5FZTA 4JVSA 4J32B 3EHNA 1K04A 2WVQA 3S9OA 4D4NA 4XTKA 4PJJA 2YEVA 3B29A 2GWWA 5CI8A 5DQZA 3L1MA 3S84A 1A0BA 3DE9A 4AE4B 2WL8A 4XLNF 5F28E 3I5QA 4YT5A 1E84A 2TMVP 2NG1A 2NUPB 3JT1A 2HUJA 4N4WA 4P6IC 4XPYA 5JVEA 2R02A 1Y6DA 4CS7A 4MW8A 2XLEA 3O10A 1YYXA 3ZQYA 4WABA 2LFDA 2D5RB 2KNHA 3K66A 2XLDA 4LERA 1FTSA 5E33A 1LKXA 1APCA 1JOGA 3K6BA 1HW1A 2ZD9A 4U5CE 4WJ0A 2H7BA 1QSPA 4YT2A 1ZHWA 2IYLD 2OJED 4U9EA 2HMQA 3ATPA 4R32A 2PNOA 3C7JA 4IWBA 3IEEA 4C7OB 3HNIA 3FMSA 1QKRA 1EKYA 3A9CA 2XLWA 1VYKA 3LLIA 1OCOC 2A69F 2LP4A 2Q3TA 3GODA 3M1CB 2R9RB 4IARA 4IJJA 1OKKA 2AWCA 3I4UA 1RKEA 2QY9A 4J30B 3TD7A 1LI7A 1TWAA 3OA1A 4YWQA 3S90A 1K40A 3POVA 5F5HA 1A7EA 3X2QC 4F4BA 1HMDA 1YA7O 2DYRC 2UUIA 5KYNA 3DMDA 2G3KA 3DZAA 4AX2A 5KYWB 1FR0A 3PDMP 4QDLA 1BBHA 1C03A 3JYYA 2LK4A 5AGFA 2CNWD 2Z15A 5D91A 3W8HA 1JPNA 3TJ6A 1LS1A 3O55A 3K1IA 3U3FA 5A69A 5HV9A 3FDQA 3GM3A 4U5EE 1L7CA 1MMAA 2NSGA 3V5ZA 2P61A 2OOCA 1NLXA 2QLAA 3ASNC 1W2WA 4A4AA 3F47A 2WVOA 4JE9A 2QTVA 2IBFA 4BJ5A 4CS8A 3SP1A 2QUPA 5DS4A 1RMVA 2J7PD 4EIYA 5HSWA 3GM2A 4JEBA 4MW3A 1MMDA 3C8GA 2A0BA 4RD9A 4ER9A 2R7QA 2YL0A 4GQHA 4DJ9A 5A6KA 3LS1A 3CEXA 1GGQA 1ZHZA 4YN0B 4AL1A 1K05A 4XEVA 1FMWA 5COFA 4NC3A 3LNRA 4ANJA 3FHDA 2Q4FA 1M2VA 2R03A 1OR3A 2XL4A 1ZHXA 1M57C 2FAPB 2R25A 3DWWA 1TKNA 2XLHA 3FOOA 256BA 3AG2C 3E70C 4G78A 3C8ZA 3N2ZB 4NY3A 3RQGA 3UGOA 3R7CA 4BEJA 4BJ1A 4E7SA 1KNYA 3QVZA 1TWGA 2O9XA 2ZXRA 2HJMA 3H2UA 2YLGA 3C18A 1AVOB 3R2PA 3EH2A 2HV6A 1CGME 1RXQA 4CDVA 3UMHA 1ZYRF 4PK4A 1AEPA 1OCCC 2J9UA 3AG3C 2KW3C 3ZSUA 3M4BA 2HSQA 2V26A 3IHUA 2KJGA 2XSEA 2HFIA 3RVZA 1HE1A 2A68F 5AC5A 2IXPA 2H7OA 3WHNA 3U8VA 3GEEA 1RJ9B 2DYSC 3LLKA 2P1AA 1JR8A 3S28A 3HKKA 1YYJA 1Q0KA 3GEHA
chains in the Genus database with same CATH topology
5BQIA 3DWWA 5BQGA 3LEOA 5HV9A 4J7YA 4WABA 4JC7A 4JCZA 4NTBA 4BPMA 2PNOA 4YL3A 5K0IA 5BQHA 3B29A 2Q7RA 2UUHA 4NTAA 4JRZA 4AL0A 3PCVA 2H8AA 4AL1A 4YL1A 2UUIA 4YK5A 4J7TA 3HKKA 4YL0A 4NTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BQI A;  3DWW A;  5BQG A;  3LEO A;  5HV9 A;  4J7Y A;  4WAB A;  4JC7 A;  4JCZ A;  4NTB A;  4BPM A;  2PNO A;  4YL3 A;  5K0I A;  5BQH A;  3B29 A;  2Q7R A;  2UUH A;  4NTA A;  4JRZ A;  4AL0 A;  3PCV A;  2H8A A;  4AL1 A;  4YL1 A;  2UUI A;  4YK5 A;  4J7T A;  3HKK A;  4YL0 A;  4NTF A; 
#chains in the Genus database with same CATH topology
 3EGD B;  3TUL A;  1WAS A;  2IXN A;  3SXY A;  1HMO A;  2KQ9 A;  1D1C A;  1ZHY A;  2HJ3 A;  3B0P A;  1G4U S;  4XQ1 A;  3V7O A;  2Y69 C;  4MVQ A;  2AU5 A;  5JRA A;  5B1A C;  1D1B A;  5CI9 A;  3RQE A;  4ULV A;  4Q5S F;  1TWH A;  4KNV A;  3Q6N A;  3GWN A;  3QMK A;  1JAF A;  1N1C A;  2KSF A;  1IZM A;  2OEV A;  3SXK A;  3JSE O;  2R7X A;  3UR3 C;  1BDJ B;  4AK9 A;  4WGY A;  2P6V A;  2EPN A;  2JD3 A;  3JRM O;  1ZU4 A;  2EIL C;  4DVZ A;  3JSZ A;  3VRC A;  2DGJ A;  3K7D A;  4CS9 C;  4CIH A;  5A6B A;  3QW0 A;  4U5D E;  2W45 A;  3L34 A;  1C17 M;  2J45 A;  2YL7 A;  3RYL A;  2EPM X;  4BJ6 A;  3SZR A;  3JZ0 A;  3AGU A;  1T9K A;  5BQI A;  5FCL A;  1T5O A;  2WZG A;  2IXO A;  2XM4 A;  4HFK B;  5BQG A;  5KYU A;  2NUT A;  2CW0 F;  3RF3 A;  3DAF A;  1E2X A;  1LI5 A;  2X51 A;  3T6B A;  4DVY P;  4OIP F;  4KC9 A;  4PR9 A;  1RCP A;  2FGY A;  4NTB A;  3DJU B;  4MVS A;  1OCR C;  1PD0 A;  1O5H A;  2FFH A;  2YZS A;  2Y3H A;  2W4B A;  3AJM A;  4JTD B;  4G0H A;  3KMI A;  2HMZ A;  3QW1 A;  3NMI A;  1O3U A;  3EFO A;  5B3I A;  1Z5Z A;  4HE8 D;  2ZXO A;  4DRJ B;  3ZC4 A;  2Q7R A;  1G8X A;  5T3W A;  3HJC A;  4G7H F;  4CSA C;  1Z63 A;  4K0D A;  5L0H A;  4JRZ A;  5DS5 A;  2B0J A;  1A7V A;  4JIO A;  3DAG A;  4DBR A;  3GWL A;  4YJW A;  4NQF A;  1CGO A;  3V5X A;  2W9Y A;  4JZA A;  4C3B A;  2R05 A;  4YT8 A;  1JRA A;  1WAT A;  4HFF B;  3MYI A;  2PX0 A;  1LVK A;  2BE5 F;  4E18 A;  4N6C A;  3EZI A;  1HE9 A;  3W2V A;  3WG7 C;  1E86 A;  2YVK A;  4EWC A;  5L0F A;  1ZHT A;  3KYI A;  1D0Z A;  1OW7 A;  4OD4 A;  2WZF A;  4YL3 A;  3ZIB A;  5K0I A;  1OKK D;  3ABM C;  1H9T A;  1LE2 A;  4LDK A;  3UGP A;  4E0H A;  2EPL X;  1ZU5 A;  5T3T A;  4PAC A;  3U9J A;  4EBK A;  5KYY B;  4OIQ F;  1NZE A;  1A41 A;  1ORJ A;  5L3Q A;  2YL3 A;  1YA9 A;  3NDB B;  3GOR A;  2YLD A;  3E9V A;  4FAP B;  2NSF A;  1A7D A;  1H7I A;  3HNK A;  4P9F A;  3U9M A;  5A6J A;  2HZ8 A;  2YRF A;  4C3D A;  1J8Y F;  3B0U X;  2CYD A;  2GDC A;  3CAX A;  3ZG1 A;  1VK5 A;  2ZXP A;  2ICW G;  4E0I A;  3S0X A;  4PJL A;  2XLM A;  1WN0 A;  3S29 A;  4ZLD A;  1ZW2 A;  3C8G D;  1SR2 A;  3JRT A;  4RDA A;  5D92 A;  1YVI A;  3J06 A;  1MMG A;  1SZI A;  3SEO A;  2YWA A;  1GM5 A;  2XXA B;  1OR2 A;  2VH3 A;  2VC9 A;  1MNE A;  2LFF A;  2MYS A;  2Y3D A;  1MMN A;  2Y3G A;  3EGX A;  4I1M A;  4MTF A;  5JSL A;  2R7T A;  1SMY F;  4ULW A;  2ZPA A;  1NFN A;  1CGN A;  1LS4 A;  1JPJ A;  3DJN B;  5B3S C;  1YZA A;  1TQG A;  4E7Z A;  4YL1 A;  2CGE A;  1Q0D A;  3RIP A;  2R7S A;  5JT4 A;  3VM6 A;  1GQA A;  2Q9B A;  3NG1 A;  2XRH A;  1XWJ A;  1QVX A;  2QE9 A;  4HEA J;  4X0R A;  4OIN F;  4CJO A;  4MQ9 F;  4MTG A;  4XLP F;  3EG9 A;  2B0H A;  1D1A A;  1ST6 A;  3EH1 A;  2A6H F;  3LEO A;  4A2N B;  1DOV A;  1UFB A;  3L0I A;  2GAQ A;  4J7Y A;  4H4K C;  3ZTM A;  1QQ3 A;  2BL2 A;  1D0Y A;  4JC7 A;  4DBQ A;  3OWT A;  4O7G A;  5EHH A;  2Q00 A;  5KYX A;  1DOW A;  3Q7L A;  2KGO A;  3IPM O;  1VB5 A;  4JJF A;  4DRH B;  3TOM A;  3WOD F;  1IW7 F;  2L81 A;  1BR1 A;  4GEH A;  3B0V C;  1TFK B;  2BC5 A;  3IQC A;  1T01 A;  2VB6 A;  3MFN A;  3SNH A;  2P7V A;  5L0D A;  2J7P A;  2AVK A;  2R7W A;  4K1O A;  3BEH A;  2H8A A;  3LS0 A;  4Z9I A;  4AE4 A;  4DRI B;  1I5N A;  2OG2 A;  3RFY A;  3LEV A;  4CBE A;  3M79 A;  5BUO A;  3RW0 A;  3U0C A;  2NUP A;  2VCA A;  2RD9 A;  4YL0 A;  4CDA A;  4NTF A;  4EKW A;  2XL6 A;  3C62 A;  4JKV A;  4I3M A;  1H6G A;  3SXM A;  1YLM A;  2J8W A;  1C02 A;  1LM3 B;  1KTM A;  2NPU A;  1VLT A;  4FX5 A;  3RKO F;  4U5B E;  3K1I C;  3ASO C;  3OEO A;  2VAS A;  3HNL A;  5CIV A;  4O79 A;  3SXZ A;  3O6X A;  4KI2 A;  1Q0M A;  1G5Z A;  3ZQV A;  2OQM A;  2VCC A;  3NYL A;  4N06 A;  1RKE B;  3AOU A;  4KBL A;  4W8P A;  4CX9 A;  2DI3 A;  1QLE C;  4BJ5 C;  4CS8 C;  4C7O A;  5A6B D;  2HV7 A;  4C3E A;  4IGG A;  5JP7 A;  4JJG A;  1JMW A;  4NTA A;  3H65 A;  1Z7Q c;  3NYM A;  3T9O A;  5IY5 C;  1AUE A;  4EBJ A;  1B68 A;  1NSG B;  4YK5 A;  2CCY A;  4J7T A;  4U5F E;  2G3V A;  1S7Z A;  3EJN A;  1VYI A;  1PV3 A;  4JEA A;  2KYH A;  3KKB A;  5DS6 A;  3DI5 A;  1UG7 A;  2V3C C;  5KYW A;  5F5F A;  2AWY A;  2WB7 A;  1V4A A;  3AG1 C;  1V54 C;  2L7A A;  3B9Q A;  3KPH A;  3EQL F;  2IM8 A;  2PX3 A;  2EIM C;  1FAP B;  3ITF A;  1YAU O;  3MBG A;  3S27 A;  4Z9J A;  5EGY A;  2LSE A;  1CPR A;  3VF0 A;  2XM0 A;  2F22 A;  3C8G B;  3A11 A;  4MTO A;  1V74 B;  1PCX A;  3SYN A;  3ECS A;  3KH2 A;  1R5I D;  3NMJ A;  3CZ6 A;  5E3C A;  2XS1 A;  2A1D D;  2Q9A A;  2VCB A;  3FVY A;  1XZP A;  3NYJ A;  1LPE A;  2YKZ A;  4NCQ A;  2L6H A;  4BJT A;  4AL0 A;  5DQT A;  2L6F A;  4JTC B;  3JTL O;  1EI7 A;  3G4X A;  3JYH A;  1M2V B;  2YLI A;  5DVW A;  3AG4 C;  3FAJ A;  3K1H A;  2J9V A;  1WOL A;  1BR2 A;  3LAY A;  4U9D A;  1BR4 A;  3MLG A;  1M56 C;  2LQG A;  2PFD A;  4XWJ A;  4LDR A;  3EHM A;  1MND A;  2R7O A;  1NG1 A;  4MS2 A;  3U3B A;  2W4M A;  3DM5 A;  4MND A;  1D0X A;  1G4W R;  2PP4 A;  1T6U A;  3TOL A;  1V55 C;  1T6Q A;  4MVR A;  4PJN A;  3H2V A;  4IB4 A;  1S05 A;  2JX0 A;  1KU2 A;  2YL1 A;  4ONS A;  3TJ5 A;  4FES A;  1ZW3 A;  4B6I A;  2J9B A;  2JPU A;  3DD7 A;  5L0C A;  3PHF 2;  1WTY A;  2D4U A;  2RSE B;  3UMI A;  2ETS A;  2Y39 A;  1YDI A;  2J9W A;  3AQB A;  3PCV A;  4BEM J;  3U2M A;  3UNG C;  5L3V A;  1Q0G A;  3FOP A;  2QNL A;  1TFO B;  4Q4Z F;  5COM A;  4CIP A;  1U89 A;  2XS8 A;  1EQ1 A;  1RJ9 A;  2PBE A;  2IXM A;  4K7B A;  5B1B C;  4BJ6 C;  2AP3 A;  3O39 A;  5T1D B;  1VTM P;  3EGD A;  1OXK A;  4PFP A;  2J0X A;  1YZC A;  1U0B B;  1FFH A;  1OW6 A;  2XL8 A;  3EPV A;  5E2Q A;  2XLV A;  1MQV A;  1NBB A;  5JLI A;  3Q6M A;  3GEI A;  5COG A;  1VOM A;  3LUT B;  1OCZ C;  1Z3I X;  5JS5 A;  5L0G A;  4U5G A;  2OKU A;  2P0N A;  3MYF A;  1Z6A A;  3CQZ A;  1LIH A;  3PMR A;  1ORS C;  3U8P A;  4JW1 A;  2C04 A;  4D4X A;  2ASR A;  4EUK B;  2L6G A;  2WVN A;  4MVM A;  3L8J A;  3HLZ A;  5L0I A;  2G62 A;  1FNT c;  2GFH A;  3F46 A;  4O6M A;  4IAO A;  3KYJ A;  1SF8 A;  3W8I A;  4EBB A;  1R4T A;  1O87 A;  2OEX A;  4LLC A;  2OCC C;  1M2O A;  2Q9C A;  4MVU A;  1TR2 A;  1ORY A;  1WWP A;  2NUT B;  4L6R A;  4PFO A;  3RQF A;  5KYU B;  1Y4C A;  3T6J A;  3HNJ A;  3I5P A;  4CJG A;  1I4Z A;  2EPK X;  2R7V A;  2Y3B A;  4XEF A;  2H7V C;  3RH3 A;  4OIO F;  3N24 A;  3DXJ F;  3HTK C;  2CNW A;  1QPU A;  4IRU A;  2XLO A;  3G50 A;  3NRH A;  1CPQ A;  3EFO B;  3U5S A;  3US6 A;  4RBN A;  2MHR A;  3GM1 A;  3K33 A;  4O6N A;  4CDY A;  1Q0F A;  3NMK A;  3ZTZ A;  1VLS A;  2OJQ A;  4MVO A;  4CS9 A;  3T6G B;  4WGZ A;  1GS9 A;  4GYT A;  3L8I A;  2R7U A;  4KNW A;  4I1O B;  2GA0 A;  1E85 A;  4E17 A;  3RVY A;  1EA8 A;  3TK0 A;  2WZL A;  3AGT A;  4EHP A;  1OQC A;  2PF4 E;  3AQC A;  4UDV A;  4XEK A;  3VAY A;  1NU9 C;  2OU6 A;  4JTA B;  3DE8 A;  5JUA A;  3DKA A;  3IQT A;  4XPW A;  1QZX A;  3U2L A;  1L3P A;  2EIJ C;  3VYW A;  2LCH A;  4G7O F;  1T6I A;  4U5H A;  2E87 A;  3BRJ A;  3LNM B;  2YQY A;  2EIK C;  2DB4 A;  5TJ5 E;  3ZWI A;  2HSB A;  3GAN A;  1ZZP A;  1VMA A;  5AC4 A;  4CSA A;  1HW2 A;  3IQ5 A;  2MWQ A;  3N0T A;  5BQH A;  2KC3 A;  1XZQ A;  3KL4 A;  1ZVZ A;  2ZXW C;  3G4Z A;  1NU7 D;  2UUH A;  3QVY A;  2J46 A;  4Q7C A;  3V5Y A;  3W2W A;  3QTH A;  4JCH A;  3LJB A;  3T4R A;  1J8M F;  4H54 A;  1F1M A;  1BZ4 A;  5KYY A;  1YAR O;  5L0J A;  1NFO A;  4QI2 A;  4I44 A;  2YHS A;  3IQ6 A;  2CDQ A;  3ABK C;  3NKE A;  2I8B A;  4O6Y A;  3QZC A;  4DOZ A;  5E3A A;  1E83 A;  2KK1 A;  1H9G A;  2HS5 A;  4P9T A;  4PJM A;  4OD5 A;  3WAQ A;  2L9J A;  3CSK A;  3DM9 B;  3ZDL A;  1I4Y A;  4G7Z F;  3ABL C;  3MX3 A;  1YJG A;  1SYQ A;  3B71 A;  3Q7G A;  3UMK A;  4BPM A;  1OW8 A;  3EGX B;  1FMV A;  1LE4 A;  5GPG B;  2I15 A;  1HY5 A;  4W8K A;  1M6T A;  2X0C A;  2C03 A;  1U6H A;  1RKC A;  2EPO A;  4BG0 A;  2XXA A;  1PD1 A;  2M4E A;  3M4C A;  3LES A;  4Z9H A;  5A6A A;  1OXB A;  4DXW A;  4LAC B;  2R7R A;  2LD6 A;  4FWV A;  4N6H A;  4MVZ A;  3C63 A;  4QI0 A;  3ZVR A;  3X1O A;  5EK0 A;  2M64 A;  4LDQ A;  3EG9 B;  2A0U A;  3W4Y A;  3FAP B;  4YT4 A;  3M15 A;  3NKD A;  2HKV A;  4LLE A;  3EZH A;  4XPX A;  2J0W A;  2EIN C;  5KYX B;  5DLJ A;  1TWC A;  3TQO A;  3FXH A;  1FFT C;  1Z23 A;  4JCZ A;  4M63 A;  1WGW A;  2A6E F;  3JCU Q;  4IAQ A;  2IOQ A;  2LIG A;  4OIR F;  4ZLC A;  4JUR I;  5FZT A;  4JVS A;  4J32 B;  3EHN A;  1K04 A;  2WVQ A;  3S9O A;  4D4N A;  4XTK A;  4PJJ A;  2YEV A;  3B29 A;  2GWW A;  5CI8 A;  5DQZ A;  3L1M A;  3S84 A;  1A0B A;  3DE9 A;  4AE4 B;  2WL8 A;  4XLN F;  5F28 E;  3I5Q A;  4YT5 A;  1E84 A;  2TMV P;  2NG1 A;  2NUP B;  3JT1 A;  2HUJ A;  4N4W A;  4P6I C;  4XPY A;  5JVE A;  2R02 A;  1Y6D A;  4CS7 A;  4MW8 A;  2XLE A;  3O10 A;  1YYX A;  3ZQY A;  4WAB A;  2LFD A;  2D5R B;  2KNH A;  3K66 A;  2XLD A;  4LER A;  1FTS A;  5E33 A;  1LKX A;  1APC A;  1JOG A;  3K6B A;  1HW1 A;  2ZD9 A;  4U5C E;  4WJ0 A;  2H7B A;  1QSP A;  4YT2 A;  1ZHW A;  2IYL D;  2OJE D;  4U9E A;  2HMQ A;  3ATP A;  4R32 A;  2PNO A;  3C7J A;  4IWB A;  3IEE A;  4C7O B;  3HNI A;  3FMS A;  1QKR A;  1EKY A;  3A9C A;  2XLW A;  1VYK A;  3LLI A;  1OCO C;  2A69 F;  2LP4 A;  2Q3T A;  3GOD A;  3M1C B;  2R9R B;  4IAR A;  4IJJ A;  1OKK A;  2AWC A;  3I4U A;  1RKE A;  2QY9 A;  4J30 B;  3TD7 A;  1LI7 A;  1TWA A;  3OA1 A;  4YWQ A;  3S90 A;  1K40 A;  3POV A;  5F5H A;  1A7E A;  3X2Q C;  4F4B A;  1HMD A;  1YA7 O;  2DYR C;  2UUI A;  5KYN A;  3DMD A;  2G3K A;  3DZA A;  4AX2 A;  5KYW B;  1FR0 A;  3PDM P;  4QDL A;  1BBH A;  1C03 A;  3JYY A;  2LK4 A;  5AGF A;  2CNW D;  2Z15 A;  5D91 A;  3W8H A;  1JPN A;  3TJ6 A;  1LS1 A;  3O55 A;  3K1I A;  3U3F A;  5A69 A;  5HV9 A;  3FDQ A;  3GM3 A;  4U5E E;  1L7C A;  1MMA A;  2NSG A;  3V5Z A;  2P61 A;  2OOC A;  1NLX A;  2QLA A;  3ASN C;  1W2W A;  4A4A A;  3F47 A;  2WVO A;  4JE9 A;  2QTV A;  2IBF A;  4BJ5 A;  4CS8 A;  3SP1 A;  2QUP A;  5DS4 A;  1RMV A;  2J7P D;  4EIY A;  5HSW A;  3GM2 A;  4JEB A;  4MW3 A;  1MMD A;  3C8G A;  2A0B A;  4RD9 A;  4ER9 A;  2R7Q A;  2YL0 A;  4GQH A;  4DJ9 A;  5A6K A;  3LS1 A;  3CEX A;  1GGQ A;  1ZHZ A;  4YN0 B;  4AL1 A;  1K05 A;  4XEV A;  1FMW A;  5COF A;  4NC3 A;  3LNR A;  4ANJ A;  3FHD A;  2Q4F A;  1M2V A;  2R03 A;  1OR3 A;  2XL4 A;  1ZHX A;  1M57 C;  2FAP B;  2R25 A;  3DWW A;  1TKN A;  2XLH A;  3FOO A;  256B A;  3AG2 C;  3E70 C;  4G78 A;  3C8Z A;  3N2Z B;  4NY3 A;  3RQG A;  3UGO A;  3R7C A;  4BEJ A;  4BJ1 A;  4E7S A;  1KNY A;  3QVZ A;  1TWG A;  2O9X A;  2ZXR A;  2HJM A;  3H2U A;  2YLG A;  3C18 A;  1AVO B;  3R2P A;  3EH2 A;  2HV6 A;  1CGM E;  1RXQ A;  4CDV A;  3UMH A;  1ZYR F;  4PK4 A;  1AEP A;  1OCC C;  2J9U A;  3AG3 C;  2KW3 C;  3ZSU A;  3M4B A;  2HSQ A;  2V26 A;  3IHU A;  2KJG A;  2XSE A;  2HFI A;  3RVZ A;  1HE1 A;  2A68 F;  5AC5 A;  2IXP A;  2H7O A;  3WHN A;  3U8V A;  3GEE A;  1RJ9 B;  2DYS C;  3LLK A;  2P1A A;  1JR8 A;  3S28 A;  3HKK A;  1YYJ A;  1Q0K A;  3GEH A; 
#chains in the Genus database with same CATH homology
 5BQI A;  3DWW A;  5BQG A;  3LEO A;  5HV9 A;  4J7Y A;  4WAB A;  4JC7 A;  4JCZ A;  4NTB A;  4BPM A;  2PNO A;  4YL3 A;  5K0I A;  5BQH A;  3B29 A;  2Q7R A;  2UUH A;  4NTA A;  4JRZ A;  4AL0 A;  3PCV A;  2H8A A;  4AL1 A;  4YL1 A;  2UUI A;  4YK5 A;  4J7T A;  3HKK A;  4YL0 A;  4NTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...