4AL1A

Crystal structure of human ps-1 gsh-analog complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
143
structure length
143
Chain Sequence
SPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Microsomal Prostaglandin E2 Synthase Provides Insight Into Diversity in the Mapeg Superfamily.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PROSTAGLANDIN E SYNTHASE
total genus 64
structure length 143
sequence length 143
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4al1A00
5K0IA 2H8AA 3LEOA 4YL3A 4YL0A 4JC7A 5BQIA 4NTFA 4BPMA 5BQGA 4WABA 4AL1A 4J7TA 3HKKA 2UUIA 4JCZA 2PNOA 5HV9A 3PCVA 4J7YA 2UUHA 4JRZA 4NTAA 4YK5A 5BQHA 4NTBA 4YL1A 4AL0A 2Q7RA 3B29A 3DWWA
chains in the Genus database with same CATH superfamily
2R7XA 3C8GD 3S0XA 1R5ID 2Z15A 1TKNA 2A0BA 2ZD9A 1N1CA 3ABKC 3MYIA 2J7PA 3U2MA 2V3CC 2VCBA 4E0IA 1M6TA 2B0JA 2VC9A 2GA0A 2R7UA 4JIOA 1ST6A 2KNHA 2XL6A 2O9XA 1C03A 3RFYA 3S84A 3ASNC 1U6HA 1SYQA 2PNOA 2YWAA 1RCPA 1FMWA 2L7AA 4IB4A 4J30B 1YZCA 3FXHA 4IJJA 3V7OA 1PD1A 2HS5A 3C63A 1SMYF 2OU6A 3I5QA 1PD0A 2M4EA 1E83A 3RQEA 5L0DA 4MTFA 5A69A 4XPYA 2R7WA 2I8BA 2LCHA 2YEVA 1M2VB 3K1HA 3K33A 1LS4A 4YT4A 4OIPF 1S7ZA 3ZC4A 4YT5A 1TWGA 4FESA 2Q4FA 4BEMJ 1JAFA 1LS1A 2HMZA 4O79A 2AWYA 2OJED 5TJ5E 4EWCA 4XEFA 3IEEA 4IARA 2X51A 3SXZA 4Z9HA 5L0GA 1DOWA 2R7TA 2ZPAA 5CIVA 2XLMA 3AG3C 2H7VC 3V5XA 3GEEA 5DQTA 4RBNA 2KYHA 3DAFA 3M79A 1ZYRF 2Y69C 4MTOA 4BJ5C 4I1MA 3ASOC 1E2XA 3DJUB 3NG1A 5B3IA 1V54C 1YVIA 5A6KA 3FAJA 2E87A 2OG2A 3EH1A 4CDYA 3Q6NA 3R7CA 1ZU5A 4MNDA 4C3BA 1RKCA 1O3UA 3QVYA 4MVRA 1MNEA 4MVOA 3QTHA 4C3DA 1R4TA 4J32B 1OXKA 4BG0A 2LFDA 2AU5A 5KYWB 1K40A 4U9EA 3TOMA 1ZHXA 1TFKB 2CDQA 3G4XA 5T3TA 1TR2A 2DB4A 3MYFA 3TJ6A 4IWBA 4WGZA 3TJ5A 3OEOA 4YT8A 3H65A 4CS8A 5B3SC 4DRJB 2P7VA 1M2OA 4AE4B 2J0XA 4FX5A 4PJLA 4GQHA 2G62A 4CS7A 2AVKA 4O6MA 5L0HA 4MVZA 2DGJA 2IXPA 4D4XA 1BDJB 3TOLA 4U5FE 3VYWA 5CI9A 1PV3A 4NTAA 3MFNA 3U3BA 3EGXB 2PFDA 4XPXA 1D0YA 1YLMA 1VLSA 2EIJC 3CZ6A 2YL3A 3CAXA 5L0FA 3NDBB 1W2WA 1TWCA 2Q9BA 3C18A 2Q7RA 4EBBA 5JLIA 3AQCA 3JRTA 1NU9C 4EHPA 1G4WR 2M64A 2XLDA 4CDAA 3SXMA 2L9JA 3JSZA 3FOPA 2P6VA 2WVOA 2QE9A 5JUAA 5K0IA 1EQ1A 2EPKX 1FR0A 4YL3A 1Q0DA 4FWVA 4C3EA 1EA8A 2I15A 3NYLA 4OD5A 1T9KA 4I3MA 3MLGA 2PBEA 1VK5A 1NSGB 2IM8A 2HMQA 2HJMA 2NG1A 3B0PA 3GODA 1NBBA 2P61A 3NRHA 4BPMA 3HKKA 4WGYA 4E18A 4OIRF 3DAGA 3T4RA 3FDQA 4XEVA 2KC3A 2DYSC 2WZGA 4Z9JA 3L8IA 3NYJA 2YKZA 3RVYA 4JTAB 2PX3A 2XRHA 5E3CA 1CGME 1YARO 3IQ5A 5F5FA 1OW7A 3EHNA 3M4CA 2TMVP 4PR9A 2OCCC 4DOZA 1HW2A 3T6BA 2G3VA 2DYRC 1HE1A 3QMKA 5JP7A 3FHDA 4OINF 1I5NA 4XLNF 4ANJA 2F22A 4DRIB 2IXMA 1SZIA 3EHMA 3HTKC 3LNRA 4NY3A 4DVYP 5L0IA 3NKEA 2R7SA 1A7EA 1SR2A 3CEXA 4CSAA 1A0BA 3W2WA 3WODF 4G7OF 3Q7LA 3U9JA 1QKRA 3VRCA 4QDLA 1EI7A 2XL8A 2Y3DA 5L0JA 2J9VA 1Z3IX 2J0WA 1ZHTA 2Q9AA 3EFOA 3CQZA 3JCUQ 5KYYB 2LP4A 2YL0A 3B9QA 1VTMP 1T01A 1UG7A 3GEHA 5JRAA 1FTSA 3UGPA 2ZXWC 4CDVA 3O10A 1GM5A 4JTCB 1WOLA 1ZHWA 3WHNA 4BJTA 2W9YA 4E7SA 5D92A 2XS8A 4ZLDA 4MVQA 1Z5ZA 2XL4A 4AE4A 4E17A 3HNKA 2YZSA 3EG9B 1PCXA 3CSKA 5E2QA 2KJGA 3JRMO 5A6BD 4BJ5A 5JS5A 1I4YA 1NFNA 3U8PA 4ZLCA 2EILC 5JVEA 3GORA 2C04A 1H9TA 3K1IA 3SZRA 2HUJA 1QPUA 4U5EE 4EBJA 2HV6A 1SF8A 4XEKA 1G5ZA 4XQ1A 5E33A 2JD3A 2RD9A 3IQCA 4QI0A 3NKDA 2H7OA 3K6BA 4X0RA 3UMIA 4I44A 1U0BB 4A2NB 3OWTA 3DJNB 3HLZA 1O87A 3M1CB 2BC5A 4K0DA 3C8ZA 3GANA 2CNWA 3W2VA 3PMRA 4P9TA 5A6JA 4OIOF 3ZSUA 2ZXPA 1O5HA 3SNHA 2HKVA 4QI2A 3LEOA 2XXAB 4YJWA 4U5HA 5B1AC 1E84A 4CBEA 1V74B 3T6JA 4DXWA 3QW0A 3S9OA 5T3WA 2RSEB 1BR4A 2HSQA 2XSEA 1XZPA 1GGQA 3F46A 1HMOA 1H7IA 1TWAA 3FOOA 2YL1A 4ULWA 2NUTA 3GEIA 4CJOA 1DOVA 1Z7Qc 1M2VA 1Z23A 1Q0MA 4MTGA 4FAPB 1E86A 4NTBA 2VB6A 2A68F 1ZW2A 3F47A 3LLKA 1OCCC 3EFOB 4IGGA 5EHHA 4AL0A 1WN0A 4JEAA 3LESA 2NUPA 5COMA 2NUPB 3C8GA 1CGOA 1V55C 2DI3A 2YLGA 3GWNA 1M57C 1H9GA 1KU2A 1HMDA 1CPRA 1G4US 1ZZPA 2PP4A 3AQBA 2KW3C 2LIGA 2GDCA 3GM2A 3NMJA 1MQVA 4O7GA 1BBHA 1LI7A 4YL0A 5BQIA 2YLIA 3QW1A 1C17M 3OA1A 1GQAA 4I1OB 1RJ9A 2GWWA 4N6HA 1RXQA 1XZQA 1T5OA 4P9FA 4C7OA 1JMWA 4G7HF 2EINC 2LD6A 1KTMA 3PCVA 1Y4CA 4J7YA 2UUHA 1F1MA 4HEAJ 1V4AA 3WG7C 2EIKC 4G7ZF 4LERA 3A9CA 2ICWG 3O39A 4XTKA 2XXAA 3AGTA 4MVMA 3ABLC 4GYTA 3TULA 4MW3A 4RD9A 3W8IA 1OXBA 3RQGA 1LE2A 1OCRC 3MBGA 3BEHA 1LE4A 2J45A 4YWQA 1HW1A 1RMVA 3Q6MA 1JR8A 2PF4E 4U5CE 2YRFA 1CPQA 5AGFA 3VM6A 4CX9A 2XLEA 2R7QA 1UFBA 4DBRA 4JW1A 1NU7D 5KYUB 2KGOA 1IZMA 2BL2A 3EZHA 3N2ZB 3DE9A 4JCZA 3RIPA 5KYXA 1APCA 1I4ZA 3LNMB 4IAQA 2NPUA 3G50A 1G8XA 2Q9CA 3U8VA 1OQCA 3C62A 3TK0A 3S28A 4YL1A 1MMDA 3RYLA 1VOMA 1WTYA 3LEVA 3ZIBA 5DQZA 3ZTZA 5FCLA 1HE9A 1WGWA 4RDAA 3KH2A 4M63A 3L8JA 3N24A 2Y39A 3ZVRA 3FAPB 3K1IC 3X2QC 2Y3HA 1NLXA 2CW0F 4Q5SF 4H4KC 4XPWA 1OKKA 4LDRA 1OCOC 2YHSA 2D4UA 3DWWA 5DLJA 5DVWA 4BJ6C 3KL4A 2H8AA 4JJFA 1MNDA 1FFTC 3EGDB 2A6EF 1ZU4A 3TD7A 5COFA 2YQYA 3QZCA 4KBLA 1MMAA 1EKYA 5F28E 2XM0A 4NTFA 5HSWA 3ITFA 4D4NA 1ORYA 4DVZA 1K05A 2W45A 3DZAA 4HFFB 1OR3A 3S90A 3H2UA 2OQMA 2VCAA 3HNLA 4N4WA 3K7DA 5EGYA 1D1BA 2KQ9A 4NCQA 4PFOA 3RQFA 1E85A 1Q0FA 3ZQYA 2QLAA 2HJ3A 2HZ8A 1KNYA 2B0HA 3EGDA 3ATPA 2YLDA 1TWHA 3EJNA 3R2PA 5FZTA 5BQHA 4DJ9A 2J9BA 1D0XA 3L34A 2MHRA 4JE9A 1GS9A 2ASRA 2L6FA 3V5ZA 4CJGA 2ZXOA 1OW8A 4R32A 5JSLA 4H54A 2CCYA 1QVXA 1QZXA 2MWQA 2OKUA 3K66A 3KMIA 1FMVA 3MX3A 4PACA 1L3PA 2QY9A 2GAQA 3EH2A 3S29A 1NFOA 2MYSA 3DXJF 4CSAC 1BR1A 1RKEB 3FVYA 4MVSA 4LACB 1JOGA 2R05A 1D1CA 3L1MA 4K1OA 2BE5F 4KNWA 1OW6A 3US6A 2R9RB 2GFHA 2UUIA 3ECSA 5HV9A 1C02A 1U89A 2QUPA 4CIHA 4UDVA 1FAPB 1VLTA 4JRZA 2QTVA 3JT1A 2G3KA 3JYYA 3KKBA 2J7PD 1LVKA 1NG1A 2FFHA 2C03A 3A11A 4HFKB 3NYMA 1AEPA 3B29A 1A7DA 4LDQA 5DS5A 3UGOA 3WAQA 2W4BA 1TQGA 2ETSA 4N06A 5BUOA 1QQ3A 2L81A 4L6RA 3HNIA 4BEJA 3ZTMA 1BR2A 2VCCA 5CI8A 3SEOA 3DKAA 1YZAA 1WASA 3EGXA 2XLWA 3I5PA 2X0CA 3B0VC 4C7OB 4MW8A 3PDMP 2QNLA 1JRAA 4HE8D 2J9UA 2A69F 5GPGB 4BJ1A 2IBFA 3RF3A 1NZEA 1VYKA 5A6BA 4PJNA 3ZWIA 1XWJA 2WVNA 4IAOA 4LDKA 3W8HA 4KI2A 3EPVA 4JEBA 1Q0KA 2AP3A 1D1AA 4NQFA 3X1OA 3ZQVA 3B0UX 1B68A 1TFOB 1CGNA 3T6GB 4WJ0A 2EPLX 2IXNA 3TQOA 4AX2A 4JTDB 3C8GB 2XS1A 2WZFA 1ORJA 1YYJA 3EQLF 1HY5A 3GM1A 3HJCA 3DI5A 2XLOA 4XLPF 3RKOF 2V26A 2WZLA 3LJBA 2P1AA 4LLEA 3ZG1A 4Z9IA 3UNGC 1J8MF 1YDIA 2LK4A 2NUTB 2IOQA 3E9VA 1WATA 1ORSC 3B71A 4W8PA 4YN0B 4CS8C 1AVOB 2XM4A 3RH3A 1FFHA 4NC3A 4JC7A 3U9MA 4CS9C 3RW0A 4EKWA 4OIQF 1YA7O 2EPMX 3O55A 4CS9A 2L6GA 4CIPA 3KYJA 2HV7A 1MMNA 4Q4ZF 2OEVA 3EZIA 4PK4A 3V5YA 2D5RB 2J46A 4B6IA 1OKKD 1Y6DA 2VASA 1Z6AA 2LSEA 2Q00A 2HSBA 2HFIA 2FAPB 4MS2A 3SXKA 1LM3B 3LUTB 1BZ4A 2ZXRA 3ABMC 4EBKA 5DS6A 1D0ZA 1QSPA 3DMDA 3KPHA 3DE8A 3J06A 2J9WA 1T6UA 3IQ6A 3M15A 1WWPA 4O6NA 1YA9A 2XLHA 1QLEC 2W4MA 4JKVA 2WL8A 4EUKB 1LPEA 1ZW3A 2NSFA 4PFPA 3LAYA 3LS0A 2FGYA 1IW7F 4PJJA 4U9DA 1A7VA 5AC4A 1LKXA 2EPNA 3DM5A 1JPJA 1ZVZA 4ER9A 2JPUA 5DS4A 3GWLA 4IRUA 4U5GA 5COGA 5L0CA 3DD7A 1RKEA 4N6CA 2CNWD 3O6XA 2LFFA 4WABA 4AL1A 4EIYA 2EPOA 5T1DB 1YYXA 3N0TA 4ONSA 2YVKA 2VH3A 256BA 3QVZA 2Y3BA 1T6QA 4Q7CA 4YK5A 1Q0GA 5L3VA 3UMHA 4E0HA 2R7RA 1RJ9B 4F4BA 2A6HF 3U0CA 2OJQA 1AUEA 1K04A 2A1DD 5EK0A 1LIHA 2J8WA 2WB7A 2XLVA 3C7JA 3E70C 3G4ZA 3M4BA 4JCHA 3UR3C 5KYYA 1FNTc 4O6YA 2LQGA 3UMKA 3VF0A 4W8KA 3BRJA 1ZHZA 3GM3A 2NSGA 1S05A 4G0HA 1JPNA 3AGUA 1T6IA 4ULVA 4DRHB 2YL7A 2IXOA 2AWCA 2R25A 3T9OA 5KYWA 2P0NA 1YAUO 3AJMA 3NMKA 3NMIA 4JURI 5BQGA 2R7OA 1YJGA 5D91A 1J8YF 3U3FA 3JZ0A 2Q3TA 4OD4A 5L3QA 1H6GA 1OR2A 3LLIA 4U5DE 4PJMA 3AOUA 1MMGA 1VMAA 2WVQA 3FMSA 4G78A 2CGEA 2H7BA 3IPMO 3U2LA 2CYDA 1Z63A 2OEXA 4GEHA 4DBQA 4LLCA 1A41A 4P6IC 3L0IA 3S27A 4AK9A 4A4AA 5KYXB 4MVUA 5E3AA 5F5HA 5A6AA 4JZAA 3SXYA 2R03A 5KYUA 5KYNA 1VB5A 2IYLD 3AG4C 2KK1A 3I4UA 1LI5A 2PX0A 3PHF2 4JVSA 2L6HA 2OOCA 3W4YA 3ZDLA 4JJGA 2Y3GA 3RVZA 4KC9A 3Q7GA 4BJ6A 4J7TA 5JT4A 3KYIA 3VAYA 4K7BA 3HNJA 4YT2A 2JX0A 3AG2C 2R02A 4XWJA 2KSFA 3DM9B 4U5BE 5IY5C 3IHUA 3H2VA 3SP1A 3AG1C 1ZHYA 3JYHA 1L7CA 3IQTA 3LS1A 2A0UA 1VYIA 2EIMC 3JTLO 3EG9A 3U5SA 4E7ZA 3JSEO 2R7VA 3POVA 1OCZC 4MQ9F 4KNVA 5B1BC 3SYNA 1M56C 5AC5A
chains in the Genus database with same CATH topology
5K0IA 2H8AA 3LEOA 4YL3A 4YL0A 4JC7A 5BQIA 4NTFA 4BPMA 5BQGA 4WABA 4AL1A 4J7TA 3HKKA 2UUIA 4JCZA 2PNOA 5HV9A 3PCVA 4J7YA 2UUHA 4JRZA 4NTAA 4YK5A 5BQHA 4NTBA 4YL1A 4AL0A 2Q7RA 3B29A 3DWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K0I A;  2H8A A;  3LEO A;  4YL3 A;  4YL0 A;  4JC7 A;  5BQI A;  4NTF A;  4BPM A;  5BQG A;  4WAB A;  4AL1 A;  4J7T A;  3HKK A;  2UUI A;  4JCZ A;  2PNO A;  5HV9 A;  3PCV A;  4J7Y A;  2UUH A;  4JRZ A;  4NTA A;  4YK5 A;  5BQH A;  4NTB A;  4YL1 A;  4AL0 A;  2Q7R A;  3B29 A;  3DWW A; 
#chains in the Genus database with same CATH topology
 2R7X A;  3C8G D;  3S0X A;  1R5I D;  2Z15 A;  1TKN A;  2A0B A;  2ZD9 A;  1N1C A;  3ABK C;  3MYI A;  2J7P A;  3U2M A;  2V3C C;  2VCB A;  4E0I A;  1M6T A;  2B0J A;  2VC9 A;  2GA0 A;  2R7U A;  4JIO A;  1ST6 A;  2KNH A;  2XL6 A;  2O9X A;  1C03 A;  3RFY A;  3S84 A;  3ASN C;  1U6H A;  1SYQ A;  2PNO A;  2YWA A;  1RCP A;  1FMW A;  2L7A A;  4IB4 A;  4J30 B;  1YZC A;  3FXH A;  4IJJ A;  3V7O A;  1PD1 A;  2HS5 A;  3C63 A;  1SMY F;  2OU6 A;  3I5Q A;  1PD0 A;  2M4E A;  1E83 A;  3RQE A;  5L0D A;  4MTF A;  5A69 A;  4XPY A;  2R7W A;  2I8B A;  2LCH A;  2YEV A;  1M2V B;  3K1H A;  3K33 A;  1LS4 A;  4YT4 A;  4OIP F;  1S7Z A;  3ZC4 A;  4YT5 A;  1TWG A;  4FES A;  2Q4F A;  4BEM J;  1JAF A;  1LS1 A;  2HMZ A;  4O79 A;  2AWY A;  2OJE D;  5TJ5 E;  4EWC A;  4XEF A;  3IEE A;  4IAR A;  2X51 A;  3SXZ A;  4Z9H A;  5L0G A;  1DOW A;  2R7T A;  2ZPA A;  5CIV A;  2XLM A;  3AG3 C;  2H7V C;  3V5X A;  3GEE A;  5DQT A;  4RBN A;  2KYH A;  3DAF A;  3M79 A;  1ZYR F;  2Y69 C;  4MTO A;  4BJ5 C;  4I1M A;  3ASO C;  1E2X A;  3DJU B;  3NG1 A;  5B3I A;  1V54 C;  1YVI A;  5A6K A;  3FAJ A;  2E87 A;  2OG2 A;  3EH1 A;  4CDY A;  3Q6N A;  3R7C A;  1ZU5 A;  4MND A;  4C3B A;  1RKC A;  1O3U A;  3QVY A;  4MVR A;  1MNE A;  4MVO A;  3QTH A;  4C3D A;  1R4T A;  4J32 B;  1OXK A;  4BG0 A;  2LFD A;  2AU5 A;  5KYW B;  1K40 A;  4U9E A;  3TOM A;  1ZHX A;  1TFK B;  2CDQ A;  3G4X A;  5T3T A;  1TR2 A;  2DB4 A;  3MYF A;  3TJ6 A;  4IWB A;  4WGZ A;  3TJ5 A;  3OEO A;  4YT8 A;  3H65 A;  4CS8 A;  5B3S C;  4DRJ B;  2P7V A;  1M2O A;  4AE4 B;  2J0X A;  4FX5 A;  4PJL A;  4GQH A;  2G62 A;  4CS7 A;  2AVK A;  4O6M A;  5L0H A;  4MVZ A;  2DGJ A;  2IXP A;  4D4X A;  1BDJ B;  3TOL A;  4U5F E;  3VYW A;  5CI9 A;  1PV3 A;  4NTA A;  3MFN A;  3U3B A;  3EGX B;  2PFD A;  4XPX A;  1D0Y A;  1YLM A;  1VLS A;  2EIJ C;  3CZ6 A;  2YL3 A;  3CAX A;  5L0F A;  3NDB B;  1W2W A;  1TWC A;  2Q9B A;  3C18 A;  2Q7R A;  4EBB A;  5JLI A;  3AQC A;  3JRT A;  1NU9 C;  4EHP A;  1G4W R;  2M64 A;  2XLD A;  4CDA A;  3SXM A;  2L9J A;  3JSZ A;  3FOP A;  2P6V A;  2WVO A;  2QE9 A;  5JUA A;  5K0I A;  1EQ1 A;  2EPK X;  1FR0 A;  4YL3 A;  1Q0D A;  4FWV A;  4C3E A;  1EA8 A;  2I15 A;  3NYL A;  4OD5 A;  1T9K A;  4I3M A;  3MLG A;  2PBE A;  1VK5 A;  1NSG B;  2IM8 A;  2HMQ A;  2HJM A;  2NG1 A;  3B0P A;  3GOD A;  1NBB A;  2P61 A;  3NRH A;  4BPM A;  3HKK A;  4WGY A;  4E18 A;  4OIR F;  3DAG A;  3T4R A;  3FDQ A;  4XEV A;  2KC3 A;  2DYS C;  2WZG A;  4Z9J A;  3L8I A;  3NYJ A;  2YKZ A;  3RVY A;  4JTA B;  2PX3 A;  2XRH A;  5E3C A;  1CGM E;  1YAR O;  3IQ5 A;  5F5F A;  1OW7 A;  3EHN A;  3M4C A;  2TMV P;  4PR9 A;  2OCC C;  4DOZ A;  1HW2 A;  3T6B A;  2G3V A;  2DYR C;  1HE1 A;  3QMK A;  5JP7 A;  3FHD A;  4OIN F;  1I5N A;  4XLN F;  4ANJ A;  2F22 A;  4DRI B;  2IXM A;  1SZI A;  3EHM A;  3HTK C;  3LNR A;  4NY3 A;  4DVY P;  5L0I A;  3NKE A;  2R7S A;  1A7E A;  1SR2 A;  3CEX A;  4CSA A;  1A0B A;  3W2W A;  3WOD F;  4G7O F;  3Q7L A;  3U9J A;  1QKR A;  3VRC A;  4QDL A;  1EI7 A;  2XL8 A;  2Y3D A;  5L0J A;  2J9V A;  1Z3I X;  2J0W A;  1ZHT A;  2Q9A A;  3EFO A;  3CQZ A;  3JCU Q;  5KYY B;  2LP4 A;  2YL0 A;  3B9Q A;  1VTM P;  1T01 A;  1UG7 A;  3GEH A;  5JRA A;  1FTS A;  3UGP A;  2ZXW C;  4CDV A;  3O10 A;  1GM5 A;  4JTC B;  1WOL A;  1ZHW A;  3WHN A;  4BJT A;  2W9Y A;  4E7S A;  5D92 A;  2XS8 A;  4ZLD A;  4MVQ A;  1Z5Z A;  2XL4 A;  4AE4 A;  4E17 A;  3HNK A;  2YZS A;  3EG9 B;  1PCX A;  3CSK A;  5E2Q A;  2KJG A;  3JRM O;  5A6B D;  4BJ5 A;  5JS5 A;  1I4Y A;  1NFN A;  3U8P A;  4ZLC A;  2EIL C;  5JVE A;  3GOR A;  2C04 A;  1H9T A;  3K1I A;  3SZR A;  2HUJ A;  1QPU A;  4U5E E;  4EBJ A;  2HV6 A;  1SF8 A;  4XEK A;  1G5Z A;  4XQ1 A;  5E33 A;  2JD3 A;  2RD9 A;  3IQC A;  4QI0 A;  3NKD A;  2H7O A;  3K6B A;  4X0R A;  3UMI A;  4I44 A;  1U0B B;  4A2N B;  3OWT A;  3DJN B;  3HLZ A;  1O87 A;  3M1C B;  2BC5 A;  4K0D A;  3C8Z A;  3GAN A;  2CNW A;  3W2V A;  3PMR A;  4P9T A;  5A6J A;  4OIO F;  3ZSU A;  2ZXP A;  1O5H A;  3SNH A;  2HKV A;  4QI2 A;  3LEO A;  2XXA B;  4YJW A;  4U5H A;  5B1A C;  1E84 A;  4CBE A;  1V74 B;  3T6J A;  4DXW A;  3QW0 A;  3S9O A;  5T3W A;  2RSE B;  1BR4 A;  2HSQ A;  2XSE A;  1XZP A;  1GGQ A;  3F46 A;  1HMO A;  1H7I A;  1TWA A;  3FOO A;  2YL1 A;  4ULW A;  2NUT A;  3GEI A;  4CJO A;  1DOV A;  1Z7Q c;  1M2V A;  1Z23 A;  1Q0M A;  4MTG A;  4FAP B;  1E86 A;  4NTB A;  2VB6 A;  2A68 F;  1ZW2 A;  3F47 A;  3LLK A;  1OCC C;  3EFO B;  4IGG A;  5EHH A;  4AL0 A;  1WN0 A;  4JEA A;  3LES A;  2NUP A;  5COM A;  2NUP B;  3C8G A;  1CGO A;  1V55 C;  2DI3 A;  2YLG A;  3GWN A;  1M57 C;  1H9G A;  1KU2 A;  1HMD A;  1CPR A;  1G4U S;  1ZZP A;  2PP4 A;  3AQB A;  2KW3 C;  2LIG A;  2GDC A;  3GM2 A;  3NMJ A;  1MQV A;  4O7G A;  1BBH A;  1LI7 A;  4YL0 A;  5BQI A;  2YLI A;  3QW1 A;  1C17 M;  3OA1 A;  1GQA A;  4I1O B;  1RJ9 A;  2GWW A;  4N6H A;  1RXQ A;  1XZQ A;  1T5O A;  4P9F A;  4C7O A;  1JMW A;  4G7H F;  2EIN C;  2LD6 A;  1KTM A;  3PCV A;  1Y4C A;  4J7Y A;  2UUH A;  1F1M A;  4HEA J;  1V4A A;  3WG7 C;  2EIK C;  4G7Z F;  4LER A;  3A9C A;  2ICW G;  3O39 A;  4XTK A;  2XXA A;  3AGT A;  4MVM A;  3ABL C;  4GYT A;  3TUL A;  4MW3 A;  4RD9 A;  3W8I A;  1OXB A;  3RQG A;  1LE2 A;  1OCR C;  3MBG A;  3BEH A;  1LE4 A;  2J45 A;  4YWQ A;  1HW1 A;  1RMV A;  3Q6M A;  1JR8 A;  2PF4 E;  4U5C E;  2YRF A;  1CPQ A;  5AGF A;  3VM6 A;  4CX9 A;  2XLE A;  2R7Q A;  1UFB A;  4DBR A;  4JW1 A;  1NU7 D;  5KYU B;  2KGO A;  1IZM A;  2BL2 A;  3EZH A;  3N2Z B;  3DE9 A;  4JCZ A;  3RIP A;  5KYX A;  1APC A;  1I4Z A;  3LNM B;  4IAQ A;  2NPU A;  3G50 A;  1G8X A;  2Q9C A;  3U8V A;  1OQC A;  3C62 A;  3TK0 A;  3S28 A;  4YL1 A;  1MMD A;  3RYL A;  1VOM A;  1WTY A;  3LEV A;  3ZIB A;  5DQZ A;  3ZTZ A;  5FCL A;  1HE9 A;  1WGW A;  4RDA A;  3KH2 A;  4M63 A;  3L8J A;  3N24 A;  2Y39 A;  3ZVR A;  3FAP B;  3K1I C;  3X2Q C;  2Y3H A;  1NLX A;  2CW0 F;  4Q5S F;  4H4K C;  4XPW A;  1OKK A;  4LDR A;  1OCO C;  2YHS A;  2D4U A;  3DWW A;  5DLJ A;  5DVW A;  4BJ6 C;  3KL4 A;  2H8A A;  4JJF A;  1MND A;  1FFT C;  3EGD B;  2A6E F;  1ZU4 A;  3TD7 A;  5COF A;  2YQY A;  3QZC A;  4KBL A;  1MMA A;  1EKY A;  5F28 E;  2XM0 A;  4NTF A;  5HSW A;  3ITF A;  4D4N A;  1ORY A;  4DVZ A;  1K05 A;  2W45 A;  3DZA A;  4HFF B;  1OR3 A;  3S90 A;  3H2U A;  2OQM A;  2VCA A;  3HNL A;  4N4W A;  3K7D A;  5EGY A;  1D1B A;  2KQ9 A;  4NCQ A;  4PFO A;  3RQF A;  1E85 A;  1Q0F A;  3ZQY A;  2QLA A;  2HJ3 A;  2HZ8 A;  1KNY A;  2B0H A;  3EGD A;  3ATP A;  2YLD A;  1TWH A;  3EJN A;  3R2P A;  5FZT A;  5BQH A;  4DJ9 A;  2J9B A;  1D0X A;  3L34 A;  2MHR A;  4JE9 A;  1GS9 A;  2ASR A;  2L6F A;  3V5Z A;  4CJG A;  2ZXO A;  1OW8 A;  4R32 A;  5JSL A;  4H54 A;  2CCY A;  1QVX A;  1QZX A;  2MWQ A;  2OKU A;  3K66 A;  3KMI A;  1FMV A;  3MX3 A;  4PAC A;  1L3P A;  2QY9 A;  2GAQ A;  3EH2 A;  3S29 A;  1NFO A;  2MYS A;  3DXJ F;  4CSA C;  1BR1 A;  1RKE B;  3FVY A;  4MVS A;  4LAC B;  1JOG A;  2R05 A;  1D1C A;  3L1M A;  4K1O A;  2BE5 F;  4KNW A;  1OW6 A;  3US6 A;  2R9R B;  2GFH A;  2UUI A;  3ECS A;  5HV9 A;  1C02 A;  1U89 A;  2QUP A;  4CIH A;  4UDV A;  1FAP B;  1VLT A;  4JRZ A;  2QTV A;  3JT1 A;  2G3K A;  3JYY A;  3KKB A;  2J7P D;  1LVK A;  1NG1 A;  2FFH A;  2C03 A;  3A11 A;  4HFK B;  3NYM A;  1AEP A;  3B29 A;  1A7D A;  4LDQ A;  5DS5 A;  3UGO A;  3WAQ A;  2W4B A;  1TQG A;  2ETS A;  4N06 A;  5BUO A;  1QQ3 A;  2L81 A;  4L6R A;  3HNI A;  4BEJ A;  3ZTM A;  1BR2 A;  2VCC A;  5CI8 A;  3SEO A;  3DKA A;  1YZA A;  1WAS A;  3EGX A;  2XLW A;  3I5P A;  2X0C A;  3B0V C;  4C7O B;  4MW8 A;  3PDM P;  2QNL A;  1JRA A;  4HE8 D;  2J9U A;  2A69 F;  5GPG B;  4BJ1 A;  2IBF A;  3RF3 A;  1NZE A;  1VYK A;  5A6B A;  4PJN A;  3ZWI A;  1XWJ A;  2WVN A;  4IAO A;  4LDK A;  3W8H A;  4KI2 A;  3EPV A;  4JEB A;  1Q0K A;  2AP3 A;  1D1A A;  4NQF A;  3X1O A;  3ZQV A;  3B0U X;  1B68 A;  1TFO B;  1CGN A;  3T6G B;  4WJ0 A;  2EPL X;  2IXN A;  3TQO A;  4AX2 A;  4JTD B;  3C8G B;  2XS1 A;  2WZF A;  1ORJ A;  1YYJ A;  3EQL F;  1HY5 A;  3GM1 A;  3HJC A;  3DI5 A;  2XLO A;  4XLP F;  3RKO F;  2V26 A;  2WZL A;  3LJB A;  2P1A A;  4LLE A;  3ZG1 A;  4Z9I A;  3UNG C;  1J8M F;  1YDI A;  2LK4 A;  2NUT B;  2IOQ A;  3E9V A;  1WAT A;  1ORS C;  3B71 A;  4W8P A;  4YN0 B;  4CS8 C;  1AVO B;  2XM4 A;  3RH3 A;  1FFH A;  4NC3 A;  4JC7 A;  3U9M A;  4CS9 C;  3RW0 A;  4EKW A;  4OIQ F;  1YA7 O;  2EPM X;  3O55 A;  4CS9 A;  2L6G A;  4CIP A;  3KYJ A;  2HV7 A;  1MMN A;  4Q4Z F;  2OEV A;  3EZI A;  4PK4 A;  3V5Y A;  2D5R B;  2J46 A;  4B6I A;  1OKK D;  1Y6D A;  2VAS A;  1Z6A A;  2LSE A;  2Q00 A;  2HSB A;  2HFI A;  2FAP B;  4MS2 A;  3SXK A;  1LM3 B;  3LUT B;  1BZ4 A;  2ZXR A;  3ABM C;  4EBK A;  5DS6 A;  1D0Z A;  1QSP A;  3DMD A;  3KPH A;  3DE8 A;  3J06 A;  2J9W A;  1T6U A;  3IQ6 A;  3M15 A;  1WWP A;  4O6N A;  1YA9 A;  2XLH A;  1QLE C;  2W4M A;  4JKV A;  2WL8 A;  4EUK B;  1LPE A;  1ZW3 A;  2NSF A;  4PFP A;  3LAY A;  3LS0 A;  2FGY A;  1IW7 F;  4PJJ A;  4U9D A;  1A7V A;  5AC4 A;  1LKX A;  2EPN A;  3DM5 A;  1JPJ A;  1ZVZ A;  4ER9 A;  2JPU A;  5DS4 A;  3GWL A;  4IRU A;  4U5G A;  5COG A;  5L0C A;  3DD7 A;  1RKE A;  4N6C A;  2CNW D;  3O6X A;  2LFF A;  4WAB A;  4AL1 A;  4EIY A;  2EPO A;  5T1D B;  1YYX A;  3N0T A;  4ONS A;  2YVK A;  2VH3 A;  256B A;  3QVZ A;  2Y3B A;  1T6Q A;  4Q7C A;  4YK5 A;  1Q0G A;  5L3V A;  3UMH A;  4E0H A;  2R7R A;  1RJ9 B;  4F4B A;  2A6H F;  3U0C A;  2OJQ A;  1AUE A;  1K04 A;  2A1D D;  5EK0 A;  1LIH A;  2J8W A;  2WB7 A;  2XLV A;  3C7J A;  3E70 C;  3G4Z A;  3M4B A;  4JCH A;  3UR3 C;  5KYY A;  1FNT c;  4O6Y A;  2LQG A;  3UMK A;  3VF0 A;  4W8K A;  3BRJ A;  1ZHZ A;  3GM3 A;  2NSG A;  1S05 A;  4G0H A;  1JPN A;  3AGU A;  1T6I A;  4ULV A;  4DRH B;  2YL7 A;  2IXO A;  2AWC A;  2R25 A;  3T9O A;  5KYW A;  2P0N A;  1YAU O;  3AJM A;  3NMK A;  3NMI A;  4JUR I;  5BQG A;  2R7O A;  1YJG A;  5D91 A;  1J8Y F;  3U3F A;  3JZ0 A;  2Q3T A;  4OD4 A;  5L3Q A;  1H6G A;  1OR2 A;  3LLI A;  4U5D E;  4PJM A;  3AOU A;  1MMG A;  1VMA A;  2WVQ A;  3FMS A;  4G78 A;  2CGE A;  2H7B A;  3IPM O;  3U2L A;  2CYD A;  1Z63 A;  2OEX A;  4GEH A;  4DBQ A;  4LLC A;  1A41 A;  4P6I C;  3L0I A;  3S27 A;  4AK9 A;  4A4A A;  5KYX B;  4MVU A;  5E3A A;  5F5H A;  5A6A A;  4JZA A;  3SXY A;  2R03 A;  5KYU A;  5KYN A;  1VB5 A;  2IYL D;  3AG4 C;  2KK1 A;  3I4U A;  1LI5 A;  2PX0 A;  3PHF 2;  4JVS A;  2L6H A;  2OOC A;  3W4Y A;  3ZDL A;  4JJG A;  2Y3G A;  3RVZ A;  4KC9 A;  3Q7G A;  4BJ6 A;  4J7T A;  5JT4 A;  3KYI A;  3VAY A;  4K7B A;  3HNJ A;  4YT2 A;  2JX0 A;  3AG2 C;  2R02 A;  4XWJ A;  2KSF A;  3DM9 B;  4U5B E;  5IY5 C;  3IHU A;  3H2V A;  3SP1 A;  3AG1 C;  1ZHY A;  3JYH A;  1L7C A;  3IQT A;  3LS1 A;  2A0U A;  1VYI A;  2EIM C;  3JTL O;  3EG9 A;  3U5S A;  4E7Z A;  3JSE O;  2R7V A;  3POV A;  1OCZ C;  4MQ9 F;  4KNV A;  5B1B C;  3SYN A;  1M56 C;  5AC5 A; 
#chains in the Genus database with same CATH homology
 5K0I A;  2H8A A;  3LEO A;  4YL3 A;  4YL0 A;  4JC7 A;  5BQI A;  4NTF A;  4BPM A;  5BQG A;  4WAB A;  4AL1 A;  4J7T A;  3HKK A;  2UUI A;  4JCZ A;  2PNO A;  5HV9 A;  3PCV A;  4J7Y A;  2UUH A;  4JRZ A;  4NTA A;  4YK5 A;  5BQH A;  4NTB A;  4YL1 A;  4AL0 A;  2Q7R A;  3B29 A;  3DWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...