4AL1A

Crystal structure of human ps-1 gsh-analog complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
143
structure length
143
Chain Sequence
SPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PROSTAGLANDIN E SYNTHASE
publication title Crystal Structure of Microsomal Prostaglandin E2 Synthase Provides Insight Into Diversity in the Mapeg Superfamily.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 143
sequence length 143
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4al1A00
4JCZA 5BQGA 3HKKA 5BQHA 4NTAA 3DWWA 2UUHA 4BPMA 2PNOA 4JC7A 2H8AA 4JRZA 3LEOA 4YL0A 3PCVA 3B29A 4NTBA 4YK5A 5K0IA 4J7YA 5HV9A 4AL0A 4YL1A 2UUIA 5BQIA 4YL3A 4AL1A 2Q7RA 4NTFA 4WABA 4J7TA
chains in the Genus database with same CATH superfamily
3X1OA 4Z9JA 1WOLA 2A6EF 2ZD9A 3UMIA 2DYRC 1FMVA 3B0UX 1TKNA 3M4BA 2CYDA 2Q3TA 3VRCA 2LFFA 3OA1A 1LIHA 3U3BA 2R7QA 2VH3A 1Z5ZA 4I1MA 1Q0FA 5EGYA 3AG4C 3KKBA 3KMIA 2KQ9A 3VF0A 2J8WA 5JUAA 4GEHA 2KJGA 2QLAA 4I3MA 2J9BA 3G4ZA 3G50A 3IEEA 3KL4A 4AL0A 2Y3GA 4BG0A 1D0ZA 1LM3B 4IB4A 5D92A 4CDVA 3NKDA 3I4UA 1Z63A 2DGJA 2VC9A 3SXMA 5JSLA 4F4BA 2B0HA 3I5PA 1U0BB 2R7XA 2XXAB 3WHNA 2OKUA 1YZCA 3VM6A 2A6HF 3AJMA 4G7ZF 2YLGA 3L34A 2H7BA 1PV3A 1VLTA 3EHMA 3MYFA 2Y3BA 1OXKA 5A6AA 1OKKA 4N06A 3HNJA 3TULA 1H7IA 3QTHA 3RYLA 2EILC 2XL6A 1AUEA 2OEVA 3DKAA 4C3EA 2VASA 1WGWA 4OD4A 2LP4A 3CAXA 4J32B 4YK5A 1CPRA 3K33A 1T5OA 3DZAA 4N6HA 1SR2A 3HLZA 3K1IA 5K0IA 2F22A 3HTKC 2R7UA 1IZMA 4EWCA 1ZHYA 2XM0A 2R7TA 2ETSA 3ZQYA 4BJ1A 1I4ZA 1RKCA 2YQYA 3EQLF 5A6BA 4MVZA 1KTMA 4WJ0A 2AWCA 1TWAA 4PK4A 2FAPB 2WZGA 2KW3C 4U5GA 5CI9A 5D91A 4LDKA 4D4NA 2EIMC 3M79A 2X0CA 1B68A 3EZIA 1BBHA 3LLKA 1IW7F 2C03A 2EPNA 3EHNA 5DS4A 1ZHTA 4G0HA 1JR8A 3TOMA 1EQ1A 2RSEB 4XEKA 5BUOA 2H7OA 2JPUA 4YWQA 4EBBA 1U89A 2H7VC 4HEAJ 5EK0A 2XXAA 4PACA 2IYLD 4CJOA 2HJMA 2GFHA 3B29A 3LNRA 1A7DA 3MLGA 4OINF 5L0IA 1NFNA 1TR2A 1XZPA 4PFPA 1EI7A 4LACB 4RD9A 1M56C 3QW1A 4L6RA 3SNHA 5L0FA 1R4TA 2GDCA 3MX3A 3RVZA 3W2VA 2EIJC 4JW1A 4YL1A 3V5XA 3AG3C 2CNWD 2VB6A 2LD6A 3FAPB 5JLIA 2EINC 1V4AA 2BC5A 1VYIA 3M15A 4XTKA 4PJMA 1ZZPA 1N1CA 3EG9A 2Q7RA 3V5ZA 1JPNA 4EUKB 3JRMO 4U5DE 1HE9A 3GWNA 4MTFA 3O39A 3N2ZB 2Y39A 3C63A 4JIOA 2QNLA 1ZHWA 3HKKA 5B3IA 2R7RA 2OQMA 3EPVA 3U9MA 4DRHB 1TQGA 4C7OB 1YLMA 1O3UA 4YL0A 4AE4B 2IXOA 2NUPB 4K0DA 4XLPF 2OCCC 4C3DA 3RF3A 4JTCB 2CDQA 3WAQA 3Q6MA 2JX0A 5COFA 5AC5A 3WODF 2V3CC 4NC3A 1I4YA 4J7YA 1V74B 3QW0A 4JEBA 3HNIA 5HV9A 3K6BA 5TJ5E 3ZSUA 2YL7A 3QVZA 3DMDA 3RQFA 1YYJA 3ZC4A 1ZVZA 2KGOA 4Q4ZF 2HKVA 4N6CA 4CIPA 1RXQA 3B0PA 3EGXB 1RJ9B 3U9JA 3X2QC 1S7ZA 1H9TA 4MTOA 1M2OA 3ECSA 1QQ3A 4U5CE 1H9GA 5E2QA 3J06A 1D0XA 1OCCC 2P0NA 2J7PA 1A41A 2LCHA 4NQFA 4CSAA 1ZU4A 2OEXA 2ZXOA 1ORYA 1YVIA 5L0GA 3FVYA 3TJ5A 4PFOA 3DXJF 3UNGC 4CS8C 3NG1A 1WTYA 2HMQA 2YEVA 3I5QA 4NTBA 4DJ9A 3F46A 1HMDA 3GANA 3NYJA 1OXBA 1R5ID 4YT5A 4C7OA 2Z15A 4JJGA 1FNTc 3T9OA 3FDQA 4IRUA 4AE4A 2NUPA 3O10A 2J9WA 1QKRA 3BRJA 3Q7LA 3SZRA 5A6KA 3V5YA 5A69A 3LS0A 1V54C 4MVSA 1T6IA 4OIQF 5BQIA 4CIHA 1WN0A 2W45A 3GEIA 2DYSC 4A2NB 4KC9A 4ER9A 3E9VA 2PBEA 1LPEA 2P61A 3L8IA 4DVZA 2YHSA 4R32A 3DM9B 4JE9A 4QDLA 4PR9A 3VYWA 4K1OA 4LERA 2IBFA 3B9QA 4BPMA 2Q00A 3EGXA 1RJ9A 2GA0A 1G4WR 3S90A 1NZEA 3DJNB 3JYHA 4MW3A 4NY3A 2L81A 2XS8A 3AGTA 4U9DA 2VCBA 2A1DD 2DB4A 4KNVA 1APCA 1T6UA 4YT8A 1CGNA 2W9YA 4ZLCA 1SMYF 1E86A 2E87A 3M1CB 3HNKA 4JTDB 4XPYA 4BEMJ 4OD5A 2P6VA 5L0JA 2NUTB 5E3CA 1CGME 4O79A 2Q9BA 2XLVA 2JD3A 5IY5C 3N24A 3NDBB 1YZAA 2XLEA 3AQBA 5JT4A 4Z9HA 5L0DA 5FCLA 2J45A 2OJQA 2R7SA 2AVKA 3L0IA 3TJ6A 5KYYB 3GM2A 5KYWB 4QI0A 4CS9A 1UFBA 1H6GA 1KNYA 3S84A 1SF8A 3GM3A 5A6BD 3KYIA 1T9KA 3RW0A 3ZWIA 3DD7A 4DVYP 1SZIA 1D1BA 4MS2A 4MVQA 4CS9C 3F47A 1SYQA 2HV6A 3JRTA 1BZ4A 2WB7A 4FWVA 4B6IA 2TMVP 2PX3A 2R25A 4EHPA 1BDJB 5COGA 4JTAB 2XLMA 2CCYA 4E7SA 1D0YA 4JKVA 3EH1A 3EH2A 3EG9B 5DLJA 4DRIB 1JOGA 4EBKA 3KYJA 2UUIA 2G62A 3PHF2 3US6A 1EKYA 2J0WA 2MHRA 4YT4A 3H2VA 1QVXA 3B71A 4DBRA 1AEPA 4HE8D 2PFDA 1YAUO 4J7TA 2I8BA 3FOPA 2W4BA 2A0UA 4WGYA 2HJ3A 4JCHA 3T6BA 5A6JA 4JCZA 2GAQA 2WVQA 4BJTA 3ITFA 2B0JA 1LS1A 4RBNA 1XZQA 1FMWA 3U2MA 3GM1A 1BR4A 4IWBA 5KYYA 4IGGA 1EA8A 3GORA 1WWPA 5KYWA 3S0XA 2FGYA 4BJ6C 1OCZC 3LEOA 5B1AC 4XEFA 1S05A 3K1HA 1OW8A 4G7HF 3ZIBA 2L6GA 2P1AA 4ULVA 3ZTMA 1K04A 4KI2A 2YL1A 1MNDA 3OWTA 4JVSA 3JSEO 1J8MF 3TOLA 1HW1A 2G3KA 1VOMA 4U5BE 3TK0A 4XEVA 2LSEA 2J9VA 3ZVRA 4IAOA 2OJED 2ZPAA 4O6MA 3ABKC 2MYSA 4JJFA 2R7VA 2Q9AA 3FMSA 4A4AA 1FR0A 4G7OF 5L0CA 4KBLA 1CGOA 2L6FA 2IXPA 4P9FA 5JRAA 3FAJA 3RH3A 3B0VC 3NRHA 1NU9C 5DVWA 3AGUA 5AGFA 3EGDB 2J46A 1HE1A 4NTAA 3EZHA 5DS5A 3ZQVA 1OCOC 1Q0GA 2PNOA 5T1DB 4JRZA 2VCAA 2EPLX 2WZFA 2CGEA 3N0TA 3UGPA 2IOQA 1PCXA 4CJGA 3U3FA 1O87A 3S9OA 1UG7A 2L6HA 1M6TA 5JVEA 5CI8A 5F5FA 1HMOA 4O6YA 256BA 1Q0DA 2J7PD 4HFKB 1D1CA 1NBBA 1L7CA 1Q0MA 2BE5F 4FESA 3RIPA 2ASRA 3RQGA 2HS5A 3CZ6A 2YZSA 2D5RB 4ULWA 3U8VA 5L3VA 3H65A 1NLXA 2YLIA 4N4WA 3BEHA 3JZ0A 4O6NA 3R7CA 4FX5A 3MFNA 4IAQA 4XWJA 4MVUA 4MVRA 1I5NA 3ZTZA 4IARA 1MMDA 4Q7CA 4P6IC 4PJJA 1JAFA 4CS8A 2A69F 2L9JA 2QY9A 3DWWA 2ZXPA 2CNWA 2XLHA 1JPJA 3C8ZA 2M64A 5KYUB 4QI2A 4XLNF 1RMVA 2C04A 2Q4FA 3EGDA 3CSKA 4MVOA 1T01A 1VB5A 1OCRC 2EPMX 2XL8A 5EHHA 2YL0A 4E7ZA 1ST6A 2KSFA 2R9RB 1U6HA 1Y6DA 1ZW3A 4XPXA 3LNMB 2VCCA 3SEOA 5T3WA 4XPWA 2QE9A 4JZAA 1C02A 4J30B 4X0RA 3NYMA 3SXKA 4OIOF 2NPUA 2OU6A 3C8GB 4YJWA 3NKEA 2O9XA 5E3AA 4P9TA 1E84A 3GEHA 1E85A 3POVA 4DBQA 4BEJA 3C18A 3ABLC 2XM4A 1W2WA 4W8PA 1WATA 1OW7A 3W8IA 5AC4A 5HSWA 3C62A 4WGZA 4CDYA 2ICWG 2CW0F 2KK1A 3PDMP 3ASOC 3DJUB 1M57C 3K7DA 4ANJA 1TFOB 3VAYA 2XRHA 1QZXA 1GM5A 3G4XA 1LI5A 4E0IA 1RCPA 1Z7Qc 2WZLA 3RQEA 4UDVA 5KYUA 5COMA 1FTSA 3IQCA 4LLEA 4H54A 1T6QA 1AVOB 2Y3DA 4FAPB 1OKKD 1VLSA 2NSGA 2HV7A 5KYNA 2V26A 4NTFA 4ONSA 2A68F 3DE8A 3KPHA 4G78A 4BJ5C 4EBJA 2A0BA 2YRFA 2LK4A 3IQ6A 1HW2A 3SXZA 3T6GB 3HJCA 1BR2A 2R02A 3QVYA 3SXYA 3C8GA 3WG7C 3L8JA 1Z6AA 2NG1A 2Y69C 2ZXWC 3NMIA 3RFYA 1MMAA 1QSPA 3DAFA 3IQTA 1QPUA 3AOUA 4ZLDA 3A9CA 2M4EA 2GWWA 4LLCA 2YVKA 3AQCA 3LESA 5DQTA 4D4XA 3M4CA 4U9EA 5KYXB 3ZG1A 3DAGA 2G3VA 3JTLO 3JCUQ 1LS4A 2XLWA 2QTVA 3L1MA 2RD9A 2Y3HA 4M63A 1NU7D 1YDIA 1GGQA 1A7VA 2IXNA 5E33A 3UMHA 3UMKA 4O7GA 1K05A 2R03A 2XLOA 4AK9A 1TWCA 2YLDA 4AL1A 1MMGA 1ZU5A 1OW6A 3S29A 3V7OA 4MVMA 2HMZA 3SP1A 1J8YF 3FOOA 1RKEB 4BJ6A 2AU5A 4W8KA 1QLEC 4MTGA 1GS9A 3DE9A 5BQHA 2OOCA 5DS6A 4RDAA 1Z3IX 1VMAA 1XWJA 2WL8A 2NUTA 2Q9CA 4LDQA 2WVNA 3EFOB 2EPOA 3W4YA 1JMWA 1ORJA 4CBEA 4EIYA 3LEVA 5L0HA 3H2UA 1LI7A 4E0HA 3E70C 1G8XA 3NMKA 1YA9A 3U5SA 4DXWA 2MWQA 1E2XA 3S28A 1MMNA 4EKWA 1OR2A 4PJNA 4C3BA 3QZCA 3UR3C 3O55A 4XQ1A 5JP7A 5KYXA 3OEOA 1VYKA 1E83A 2EIKC 3K1IC 4U5EE 1C03A 1PD1A 1ZW2A 3FHDA 4JURI 5F5HA 2PP4A 2EPKX 3GEEA 3ASNC 3IPMO 3LUTB 3TQOA 3RKOF 1C17M 1D1AA 4MNDA 2KC3A 2NSFA 4I1OB 3RVYA 4DOZA 2UUHA 2DI3A 3SYNA 4Q5SF 3LLIA 1RKEA 3U0CA 3W8HA 2YWAA 1JRAA 3ATPA 2FFHA 3R2PA 5B3SC 1K40A 4BJ5A 2KYHA 3NMJA 2D4UA 2P7VA 3DM5A 1PD0A 2HUJA 3CEXA 2YL3A 1VTMP 3EFOA 3LJBA 4AX2A 3MYIA 1G5ZA 1OR3A 2XS1A 1MNEA 4YL3A 3JYYA 1WASA 3PMRA 4MQ9F 5B1BC 3T4RA 3IHUA 1MQVA 2KNHA 3JT1A 3T6JA 4CS7A 1FFHA 4WABA 3U2LA 3LS1A 1ZHZA 1F1MA 2QUPA 4CX9A 4E18A 4H4KC 4Z9IA 3QMKA 1TWHA 3GWLA 4CDAA 5BQGA 1TFKB 1DOWA 1FFTC 1TWGA 4YN0B 2IXMA 2W4MA 2XLDA 3Q6NA 3JSZA 1YARO 2XL4A 2HSBA 2XSEA 3ABMC 4E17A 3C7JA 3A11A 2H8AA 4JC7A 3Q7GA 1ZYRF 2HFIA 1HY5A 3IQ5A 4K7BA 1LKXA 1YJGA 1LE2A 1M2VB 3ZDLA 2WVOA 1CPQA 3CQZA 1A0BA 2ZXRA 3EJNA 4I44A 3TD7A 2I15A 1G4US 2PX0A 3FXHA 3S27A 1ORSC 2LFDA 4KNWA 4JEAA 4IJJA 2L7AA 1LE4A 2HZ8A 4GQHA 4GYTA 4DRJB 1DOVA 2X51A 3DI5A 2AWYA 4HFFB 5FZTA 2BL2A 5L3QA 5F28E 1L3PA 3AG2C 3MBGA 2J0XA 5CIVA 3GODA 5GPGB 3O6XA 1OQCA 3LAYA 1O5HA 1Q0KA 3AG1C 1LVKA 4NCQA 2J9UA 1GQAA 3NYLA 3UGOA 1YA7O 3KH2A 3W2WA 3PCVA 4OIRF 2R7OA 2OG2A 5T3TA 2R05A 3HNLA 4CSAC 2LQGA 2LIGA 2PF4E 1FAPB 1KU2A 3C8GD 5DQZA 1BR1A 1ZHXA 3K66A 2AP3A 1VK5A 4OIPF 4U5HA 2YKZA 1NSGB 4YT2A 2IM8A 1M2VA 2HSQA 4MW8A 4PJLA 1Z23A 4U5FE 1NFOA 2R7WA 1YYXA 1Y4CA 1NG1A 1A7EA 4LDRA 3U8PA 1V55C 5JS5A
chains in the Genus database with same CATH topology
4JCZA 5BQGA 3HKKA 5BQHA 4NTAA 3DWWA 2UUHA 4BPMA 2PNOA 4JC7A 2H8AA 4JRZA 3LEOA 4YL0A 3PCVA 3B29A 4NTBA 4YK5A 5K0IA 4J7YA 5HV9A 4AL0A 4YL1A 2UUIA 5BQIA 4YL3A 4AL1A 2Q7RA 4NTFA 4WABA 4J7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JCZ A;  5BQG A;  3HKK A;  5BQH A;  4NTA A;  3DWW A;  2UUH A;  4BPM A;  2PNO A;  4JC7 A;  2H8A A;  4JRZ A;  3LEO A;  4YL0 A;  3PCV A;  3B29 A;  4NTB A;  4YK5 A;  5K0I A;  4J7Y A;  5HV9 A;  4AL0 A;  4YL1 A;  2UUI A;  5BQI A;  4YL3 A;  4AL1 A;  2Q7R A;  4NTF A;  4WAB A;  4J7T A; 
#chains in the Genus database with same CATH topology
 3X1O A;  4Z9J A;  1WOL A;  2A6E F;  2ZD9 A;  3UMI A;  2DYR C;  1FMV A;  3B0U X;  1TKN A;  3M4B A;  2CYD A;  2Q3T A;  3VRC A;  2LFF A;  3OA1 A;  1LIH A;  3U3B A;  2R7Q A;  2VH3 A;  1Z5Z A;  4I1M A;  1Q0F A;  5EGY A;  3AG4 C;  3KKB A;  3KMI A;  2KQ9 A;  3VF0 A;  2J8W A;  5JUA A;  4GEH A;  2KJG A;  2QLA A;  4I3M A;  2J9B A;  3G4Z A;  3G50 A;  3IEE A;  3KL4 A;  4AL0 A;  2Y3G A;  4BG0 A;  1D0Z A;  1LM3 B;  4IB4 A;  5D92 A;  4CDV A;  3NKD A;  3I4U A;  1Z63 A;  2DGJ A;  2VC9 A;  3SXM A;  5JSL A;  4F4B A;  2B0H A;  3I5P A;  1U0B B;  2R7X A;  2XXA B;  3WHN A;  2OKU A;  1YZC A;  3VM6 A;  2A6H F;  3AJM A;  4G7Z F;  2YLG A;  3L34 A;  2H7B A;  1PV3 A;  1VLT A;  3EHM A;  3MYF A;  2Y3B A;  1OXK A;  5A6A A;  1OKK A;  4N06 A;  3HNJ A;  3TUL A;  1H7I A;  3QTH A;  3RYL A;  2EIL C;  2XL6 A;  1AUE A;  2OEV A;  3DKA A;  4C3E A;  2VAS A;  1WGW A;  4OD4 A;  2LP4 A;  3CAX A;  4J32 B;  4YK5 A;  1CPR A;  3K33 A;  1T5O A;  3DZA A;  4N6H A;  1SR2 A;  3HLZ A;  3K1I A;  5K0I A;  2F22 A;  3HTK C;  2R7U A;  1IZM A;  4EWC A;  1ZHY A;  2XM0 A;  2R7T A;  2ETS A;  3ZQY A;  4BJ1 A;  1I4Z A;  1RKC A;  2YQY A;  3EQL F;  5A6B A;  4MVZ A;  1KTM A;  4WJ0 A;  2AWC A;  1TWA A;  4PK4 A;  2FAP B;  2WZG A;  2KW3 C;  4U5G A;  5CI9 A;  5D91 A;  4LDK A;  4D4N A;  2EIM C;  3M79 A;  2X0C A;  1B68 A;  3EZI A;  1BBH A;  3LLK A;  1IW7 F;  2C03 A;  2EPN A;  3EHN A;  5DS4 A;  1ZHT A;  4G0H A;  1JR8 A;  3TOM A;  1EQ1 A;  2RSE B;  4XEK A;  5BUO A;  2H7O A;  2JPU A;  4YWQ A;  4EBB A;  1U89 A;  2H7V C;  4HEA J;  5EK0 A;  2XXA A;  4PAC A;  2IYL D;  4CJO A;  2HJM A;  2GFH A;  3B29 A;  3LNR A;  1A7D A;  3MLG A;  4OIN F;  5L0I A;  1NFN A;  1TR2 A;  1XZP A;  4PFP A;  1EI7 A;  4LAC B;  4RD9 A;  1M56 C;  3QW1 A;  4L6R A;  3SNH A;  5L0F A;  1R4T A;  2GDC A;  3MX3 A;  3RVZ A;  3W2V A;  2EIJ C;  4JW1 A;  4YL1 A;  3V5X A;  3AG3 C;  2CNW D;  2VB6 A;  2LD6 A;  3FAP B;  5JLI A;  2EIN C;  1V4A A;  2BC5 A;  1VYI A;  3M15 A;  4XTK A;  4PJM A;  1ZZP A;  1N1C A;  3EG9 A;  2Q7R A;  3V5Z A;  1JPN A;  4EUK B;  3JRM O;  4U5D E;  1HE9 A;  3GWN A;  4MTF A;  3O39 A;  3N2Z B;  2Y39 A;  3C63 A;  4JIO A;  2QNL A;  1ZHW A;  3HKK A;  5B3I A;  2R7R A;  2OQM A;  3EPV A;  3U9M A;  4DRH B;  1TQG A;  4C7O B;  1YLM A;  1O3U A;  4YL0 A;  4AE4 B;  2IXO A;  2NUP B;  4K0D A;  4XLP F;  2OCC C;  4C3D A;  3RF3 A;  4JTC B;  2CDQ A;  3WAQ A;  3Q6M A;  2JX0 A;  5COF A;  5AC5 A;  3WOD F;  2V3C C;  4NC3 A;  1I4Y A;  4J7Y A;  1V74 B;  3QW0 A;  4JEB A;  3HNI A;  5HV9 A;  3K6B A;  5TJ5 E;  3ZSU A;  2YL7 A;  3QVZ A;  3DMD A;  3RQF A;  1YYJ A;  3ZC4 A;  1ZVZ A;  2KGO A;  4Q4Z F;  2HKV A;  4N6C A;  4CIP A;  1RXQ A;  3B0P A;  3EGX B;  1RJ9 B;  3U9J A;  3X2Q C;  1S7Z A;  1H9T A;  4MTO A;  1M2O A;  3ECS A;  1QQ3 A;  4U5C E;  1H9G A;  5E2Q A;  3J06 A;  1D0X A;  1OCC C;  2P0N A;  2J7P A;  1A41 A;  2LCH A;  4NQF A;  4CSA A;  1ZU4 A;  2OEX A;  2ZXO A;  1ORY A;  1YVI A;  5L0G A;  3FVY A;  3TJ5 A;  4PFO A;  3DXJ F;  3UNG C;  4CS8 C;  3NG1 A;  1WTY A;  2HMQ A;  2YEV A;  3I5Q A;  4NTB A;  4DJ9 A;  3F46 A;  1HMD A;  3GAN A;  3NYJ A;  1OXB A;  1R5I D;  4YT5 A;  4C7O A;  2Z15 A;  4JJG A;  1FNT c;  3T9O A;  3FDQ A;  4IRU A;  4AE4 A;  2NUP A;  3O10 A;  2J9W A;  1QKR A;  3BRJ A;  3Q7L A;  3SZR A;  5A6K A;  3V5Y A;  5A69 A;  3LS0 A;  1V54 C;  4MVS A;  1T6I A;  4OIQ F;  5BQI A;  4CIH A;  1WN0 A;  2W45 A;  3GEI A;  2DYS C;  4A2N B;  4KC9 A;  4ER9 A;  3E9V A;  2PBE A;  1LPE A;  2P61 A;  3L8I A;  4DVZ A;  2YHS A;  4R32 A;  3DM9 B;  4JE9 A;  4QDL A;  4PR9 A;  3VYW A;  4K1O A;  4LER A;  2IBF A;  3B9Q A;  4BPM A;  2Q00 A;  3EGX A;  1RJ9 A;  2GA0 A;  1G4W R;  3S90 A;  1NZE A;  3DJN B;  3JYH A;  4MW3 A;  4NY3 A;  2L81 A;  2XS8 A;  3AGT A;  4U9D A;  2VCB A;  2A1D D;  2DB4 A;  4KNV A;  1APC A;  1T6U A;  4YT8 A;  1CGN A;  2W9Y A;  4ZLC A;  1SMY F;  1E86 A;  2E87 A;  3M1C B;  3HNK A;  4JTD B;  4XPY A;  4BEM J;  4OD5 A;  2P6V A;  5L0J A;  2NUT B;  5E3C A;  1CGM E;  4O79 A;  2Q9B A;  2XLV A;  2JD3 A;  5IY5 C;  3N24 A;  3NDB B;  1YZA A;  2XLE A;  3AQB A;  5JT4 A;  4Z9H A;  5L0D A;  5FCL A;  2J45 A;  2OJQ A;  2R7S A;  2AVK A;  3L0I A;  3TJ6 A;  5KYY B;  3GM2 A;  5KYW B;  4QI0 A;  4CS9 A;  1UFB A;  1H6G A;  1KNY A;  3S84 A;  1SF8 A;  3GM3 A;  5A6B D;  3KYI A;  1T9K A;  3RW0 A;  3ZWI A;  3DD7 A;  4DVY P;  1SZI A;  1D1B A;  4MS2 A;  4MVQ A;  4CS9 C;  3F47 A;  1SYQ A;  2HV6 A;  3JRT A;  1BZ4 A;  2WB7 A;  4FWV A;  4B6I A;  2TMV P;  2PX3 A;  2R25 A;  4EHP A;  1BDJ B;  5COG A;  4JTA B;  2XLM A;  2CCY A;  4E7S A;  1D0Y A;  4JKV A;  3EH1 A;  3EH2 A;  3EG9 B;  5DLJ A;  4DRI B;  1JOG A;  4EBK A;  3KYJ A;  2UUI A;  2G62 A;  3PHF 2;  3US6 A;  1EKY A;  2J0W A;  2MHR A;  4YT4 A;  3H2V A;  1QVX A;  3B71 A;  4DBR A;  1AEP A;  4HE8 D;  2PFD A;  1YAU O;  4J7T A;  2I8B A;  3FOP A;  2W4B A;  2A0U A;  4WGY A;  2HJ3 A;  4JCH A;  3T6B A;  5A6J A;  4JCZ A;  2GAQ A;  2WVQ A;  4BJT A;  3ITF A;  2B0J A;  1LS1 A;  4RBN A;  1XZQ A;  1FMW A;  3U2M A;  3GM1 A;  1BR4 A;  4IWB A;  5KYY A;  4IGG A;  1EA8 A;  3GOR A;  1WWP A;  5KYW A;  3S0X A;  2FGY A;  4BJ6 C;  1OCZ C;  3LEO A;  5B1A C;  4XEF A;  1S05 A;  3K1H A;  1OW8 A;  4G7H F;  3ZIB A;  2L6G A;  2P1A A;  4ULV A;  3ZTM A;  1K04 A;  4KI2 A;  2YL1 A;  1MND A;  3OWT A;  4JVS A;  3JSE O;  1J8M F;  3TOL A;  1HW1 A;  2G3K A;  1VOM A;  4U5B E;  3TK0 A;  4XEV A;  2LSE A;  2J9V A;  3ZVR A;  4IAO A;  2OJE D;  2ZPA A;  4O6M A;  3ABK C;  2MYS A;  4JJF A;  2R7V A;  2Q9A A;  3FMS A;  4A4A A;  1FR0 A;  4G7O F;  5L0C A;  4KBL A;  1CGO A;  2L6F A;  2IXP A;  4P9F A;  5JRA A;  3FAJ A;  3RH3 A;  3B0V C;  3NRH A;  1NU9 C;  5DVW A;  3AGU A;  5AGF A;  3EGD B;  2J46 A;  1HE1 A;  4NTA A;  3EZH A;  5DS5 A;  3ZQV A;  1OCO C;  1Q0G A;  2PNO A;  5T1D B;  4JRZ A;  2VCA A;  2EPL X;  2WZF A;  2CGE A;  3N0T A;  3UGP A;  2IOQ A;  1PCX A;  4CJG A;  3U3F A;  1O87 A;  3S9O A;  1UG7 A;  2L6H A;  1M6T A;  5JVE A;  5CI8 A;  5F5F A;  1HMO A;  4O6Y A;  256B A;  1Q0D A;  2J7P D;  4HFK B;  1D1C A;  1NBB A;  1L7C A;  1Q0M A;  2BE5 F;  4FES A;  3RIP A;  2ASR A;  3RQG A;  2HS5 A;  3CZ6 A;  2YZS A;  2D5R B;  4ULW A;  3U8V A;  5L3V A;  3H65 A;  1NLX A;  2YLI A;  4N4W A;  3BEH A;  3JZ0 A;  4O6N A;  3R7C A;  4FX5 A;  3MFN A;  4IAQ A;  4XWJ A;  4MVU A;  4MVR A;  1I5N A;  3ZTZ A;  4IAR A;  1MMD A;  4Q7C A;  4P6I C;  4PJJ A;  1JAF A;  4CS8 A;  2A69 F;  2L9J A;  2QY9 A;  3DWW A;  2ZXP A;  2CNW A;  2XLH A;  1JPJ A;  3C8Z A;  2M64 A;  5KYU B;  4QI2 A;  4XLN F;  1RMV A;  2C04 A;  2Q4F A;  3EGD A;  3CSK A;  4MVO A;  1T01 A;  1VB5 A;  1OCR C;  2EPM X;  2XL8 A;  5EHH A;  2YL0 A;  4E7Z A;  1ST6 A;  2KSF A;  2R9R B;  1U6H A;  1Y6D A;  1ZW3 A;  4XPX A;  3LNM B;  2VCC A;  3SEO A;  5T3W A;  4XPW A;  2QE9 A;  4JZA A;  1C02 A;  4J30 B;  4X0R A;  3NYM A;  3SXK A;  4OIO F;  2NPU A;  2OU6 A;  3C8G B;  4YJW A;  3NKE A;  2O9X A;  5E3A A;  4P9T A;  1E84 A;  3GEH A;  1E85 A;  3POV A;  4DBQ A;  4BEJ A;  3C18 A;  3ABL C;  2XM4 A;  1W2W A;  4W8P A;  1WAT A;  1OW7 A;  3W8I A;  5AC4 A;  5HSW A;  3C62 A;  4WGZ A;  4CDY A;  2ICW G;  2CW0 F;  2KK1 A;  3PDM P;  3ASO C;  3DJU B;  1M57 C;  3K7D A;  4ANJ A;  1TFO B;  3VAY A;  2XRH A;  1QZX A;  1GM5 A;  3G4X A;  1LI5 A;  4E0I A;  1RCP A;  1Z7Q c;  2WZL A;  3RQE A;  4UDV A;  5KYU A;  5COM A;  1FTS A;  3IQC A;  4LLE A;  4H54 A;  1T6Q A;  1AVO B;  2Y3D A;  4FAP B;  1OKK D;  1VLS A;  2NSG A;  2HV7 A;  5KYN A;  2V26 A;  4NTF A;  4ONS A;  2A68 F;  3DE8 A;  3KPH A;  4G78 A;  4BJ5 C;  4EBJ A;  2A0B A;  2YRF A;  2LK4 A;  3IQ6 A;  1HW2 A;  3SXZ A;  3T6G B;  3HJC A;  1BR2 A;  2R02 A;  3QVY A;  3SXY A;  3C8G A;  3WG7 C;  3L8J A;  1Z6A A;  2NG1 A;  2Y69 C;  2ZXW C;  3NMI A;  3RFY A;  1MMA A;  1QSP A;  3DAF A;  3IQT A;  1QPU A;  3AOU A;  4ZLD A;  3A9C A;  2M4E A;  2GWW A;  4LLC A;  2YVK A;  3AQC A;  3LES A;  5DQT A;  4D4X A;  3M4C A;  4U9E A;  5KYX B;  3ZG1 A;  3DAG A;  2G3V A;  3JTL O;  3JCU Q;  1LS4 A;  2XLW A;  2QTV A;  3L1M A;  2RD9 A;  2Y3H A;  4M63 A;  1NU7 D;  1YDI A;  1GGQ A;  1A7V A;  2IXN A;  5E33 A;  3UMH A;  3UMK A;  4O7G A;  1K05 A;  2R03 A;  2XLO A;  4AK9 A;  1TWC A;  2YLD A;  4AL1 A;  1MMG A;  1ZU5 A;  1OW6 A;  3S29 A;  3V7O A;  4MVM A;  2HMZ A;  3SP1 A;  1J8Y F;  3FOO A;  1RKE B;  4BJ6 A;  2AU5 A;  4W8K A;  1QLE C;  4MTG A;  1GS9 A;  3DE9 A;  5BQH A;  2OOC A;  5DS6 A;  4RDA A;  1Z3I X;  1VMA A;  1XWJ A;  2WL8 A;  2NUT A;  2Q9C A;  4LDQ A;  2WVN A;  3EFO B;  2EPO A;  3W4Y A;  1JMW A;  1ORJ A;  4CBE A;  4EIY A;  3LEV A;  5L0H A;  3H2U A;  1LI7 A;  4E0H A;  3E70 C;  1G8X A;  3NMK A;  1YA9 A;  3U5S A;  4DXW A;  2MWQ A;  1E2X A;  3S28 A;  1MMN A;  4EKW A;  1OR2 A;  4PJN A;  4C3B A;  3QZC A;  3UR3 C;  3O55 A;  4XQ1 A;  5JP7 A;  5KYX A;  3OEO A;  1VYK A;  1E83 A;  2EIK C;  3K1I C;  4U5E E;  1C03 A;  1PD1 A;  1ZW2 A;  3FHD A;  4JUR I;  5F5H A;  2PP4 A;  2EPK X;  3GEE A;  3ASN C;  3IPM O;  3LUT B;  3TQO A;  3RKO F;  1C17 M;  1D1A A;  4MND A;  2KC3 A;  2NSF A;  4I1O B;  3RVY A;  4DOZ A;  2UUH A;  2DI3 A;  3SYN A;  4Q5S F;  3LLI A;  1RKE A;  3U0C A;  3W8H A;  2YWA A;  1JRA A;  3ATP A;  2FFH A;  3R2P A;  5B3S C;  1K40 A;  4BJ5 A;  2KYH A;  3NMJ A;  2D4U A;  2P7V A;  3DM5 A;  1PD0 A;  2HUJ A;  3CEX A;  2YL3 A;  1VTM P;  3EFO A;  3LJB A;  4AX2 A;  3MYI A;  1G5Z A;  1OR3 A;  2XS1 A;  1MNE A;  4YL3 A;  3JYY A;  1WAS A;  3PMR A;  4MQ9 F;  5B1B C;  3T4R A;  3IHU A;  1MQV A;  2KNH A;  3JT1 A;  3T6J A;  4CS7 A;  1FFH A;  4WAB A;  3U2L A;  3LS1 A;  1ZHZ A;  1F1M A;  2QUP A;  4CX9 A;  4E18 A;  4H4K C;  4Z9I A;  3QMK A;  1TWH A;  3GWL A;  4CDA A;  5BQG A;  1TFK B;  1DOW A;  1FFT C;  1TWG A;  4YN0 B;  2IXM A;  2W4M A;  2XLD A;  3Q6N A;  3JSZ A;  1YAR O;  2XL4 A;  2HSB A;  2XSE A;  3ABM C;  4E17 A;  3C7J A;  3A11 A;  2H8A A;  4JC7 A;  3Q7G A;  1ZYR F;  2HFI A;  1HY5 A;  3IQ5 A;  4K7B A;  1LKX A;  1YJG A;  1LE2 A;  1M2V B;  3ZDL A;  2WVO A;  1CPQ A;  3CQZ A;  1A0B A;  2ZXR A;  3EJN A;  4I44 A;  3TD7 A;  2I15 A;  1G4U S;  2PX0 A;  3FXH A;  3S27 A;  1ORS C;  2LFD A;  4KNW A;  4JEA A;  4IJJ A;  2L7A A;  1LE4 A;  2HZ8 A;  4GQH A;  4GYT A;  4DRJ B;  1DOV A;  2X51 A;  3DI5 A;  2AWY A;  4HFF B;  5FZT A;  2BL2 A;  5L3Q A;  5F28 E;  1L3P A;  3AG2 C;  3MBG A;  2J0X A;  5CIV A;  3GOD A;  5GPG B;  3O6X A;  1OQC A;  3LAY A;  1O5H A;  1Q0K A;  3AG1 C;  1LVK A;  4NCQ A;  2J9U A;  1GQA A;  3NYL A;  3UGO A;  1YA7 O;  3KH2 A;  3W2W A;  3PCV A;  4OIR F;  2R7O A;  2OG2 A;  5T3T A;  2R05 A;  3HNL A;  4CSA C;  2LQG A;  2LIG A;  2PF4 E;  1FAP B;  1KU2 A;  3C8G D;  5DQZ A;  1BR1 A;  1ZHX A;  3K66 A;  2AP3 A;  1VK5 A;  4OIP F;  4U5H A;  2YKZ A;  1NSG B;  4YT2 A;  2IM8 A;  1M2V A;  2HSQ A;  4MW8 A;  4PJL A;  1Z23 A;  4U5F E;  1NFO A;  2R7W A;  1YYX A;  1Y4C A;  1NG1 A;  1A7E A;  4LDR A;  3U8P A;  1V55 C;  5JS5 A; 
#chains in the Genus database with same CATH homology
 4JCZ A;  5BQG A;  3HKK A;  5BQH A;  4NTA A;  3DWW A;  2UUH A;  4BPM A;  2PNO A;  4JC7 A;  2H8A A;  4JRZ A;  3LEO A;  4YL0 A;  3PCV A;  3B29 A;  4NTB A;  4YK5 A;  5K0I A;  4J7Y A;  5HV9 A;  4AL0 A;  4YL1 A;  2UUI A;  5BQI A;  4YL3 A;  4AL1 A;  2Q7R A;  4NTF A;  4WAB A;  4J7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...