4AL1A

Crystal structure of human ps-1 gsh-analog complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
143
structure length
143
Chain Sequence
SPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROSTAGLANDIN E SYNTHASE
publication title Crystal Structure of Microsomal Prostaglandin E2 Synthase Provides Insight Into Diversity in the Mapeg Superfamily.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 64
structure length 143
sequence length 143
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4al1A00
2UUIA 4JCZA 5BQHA 5K0IA 4NTAA 4BPMA 2PNOA 5HV9A 4JRZA 4J7YA 3LEOA 2H8AA 4JC7A 5BQIA 3B29A 4AL0A 2UUHA 4YL3A 4NTFA 4YL0A 4WABA 4YK5A 5BQGA 2Q7RA 3HKKA 3PCVA 4NTBA 4AL1A 4YL1A 3DWWA 4J7TA
chains in the Genus database with same CATH superfamily
2IBFA 4FWVA 1VB5A 2OG2A 3LNMB 3WODF 3B0UX 4JCZA 3K66A 1VYIA 1J8YF 2H7BA 4MVSA 3U0CA 5AC4A 1EKYA 2EPNA 1RXQA 1WWPA 2EINC 2OU6A 3BEHA 4Z9JA 1QZXA 1OKKA 5T1DB 4EBKA 3M15A 1MQVA 3NMJA 2PP4A 1SYQA 4XEFA 3EQLF 1XWJA 2NUTA 3T6JA 4CS8A 3L1MA 3L8IA 3K33A 3CEXA 3VF0A 2NUTB 1OKKD 4YT8A 2OJQA 3N0TA 1MNDA 3SXMA 4JJFA 4PJJA 2XM0A 4N4WA 1TFOB 3EGDA 4RD9A 4XEKA 2W9YA 3DKAA 3ZWIA 4C7OA 1YARO 2A0BA 3EGDB 1VLSA 3U8VA 2FGYA 2ASRA 5KYWA 4C7OB 2VCCA 1A41A 1CGOA 4KNWA 2WVNA 3ZIBA 2HSBA 1Q0FA 4JVSA 3M4BA 4U5EE 5KYWB 3TULA 1RMVA 1WATA 1I4YA 2P6VA 2QUPA 1HE9A 4WGYA 4QI2A 4DVZA 4NTAA 4BPMA 2IXOA 2IXMA 2KJGA 4LERA 4XLNF 5BQIA 1Y4CA 1CGME 3U5SA 4YL3A 4BJ6A 1Q0KA 3DI5A 2YL7A 3G50A 3MYIA 3S0XA 2MWQA 1CPRA 1ZHWA 1AEPA 3K1HA 1YZCA 4YK5A 1EA8A 4FX5A 1BZ4A 5EK0A 4C3BA 2M4EA 3RW0A 2EPKX 1CGNA 2HMQA 1BDJB 3QW0A 3UR3C 4JURI 4U5DE 2LFFA 2LIGA 3RIPA 2UUIA 3R2PA 4D4XA 2XL4A 5T3TA 3SZRA 3KL4A 3FAJA 4LACB 2Y39A 3LEOA 3V5ZA 3NMKA 1K40A 1XZPA 2H8AA 3GEHA 5L0IA 2XLOA 2A1DD 1W2WA 2I8BA 3C63A 2IM8A 1HW1A 3IEEA 3QW1A 2XLEA 3K7DA 3L8JA 4KNVA 4WGZA 2YL0A 3GM3A 5DVWA 1TWHA 4KI2A 2ZPAA 2YLDA 1Q0MA 2Y3DA 3W8HA 1ST6A 2XL6A 3ZSUA 2XS8A 1TWCA 1ZW3A 2Q00A 2QTVA 1A7DA 1GS9A 1LPEA 3AG3C 3DM5A 2YLIA 3NDBB 3LS1A 2DI3A 5CIVA 2J0WA 1JPNA 2XSEA 3C18A 2L6HA 1NG1A 4ONSA 4DOZA 1V55C 1V54C 3DWWA 4D4NA 4EIYA 1MMGA 1UFBA 2KW3C 2LD6A 3ZTMA 1TFKB 2PX0A 1M57C 2M64A 2WL8A 1TWGA 1ZU5A 3EHMA 5B1BC 2O9XA 1YJGA 3T4RA 4CS9A 5JT4A 1OCZC 4IJJA 4MTGA 1ZHZA 3RH3A 1LI7A 4U5BE 5B1AC 4JIOA 4JC7A 3FAPB 2J9UA 1A7EA 4IARA 4PJMA 3K1IC 4K7BA 4XQ1A 2NSGA 4R32A 1U6HA 2LFDA 3SXKA 4CBEA 2HV6A 3S27A 1T6UA 2G3VA 2F22A 4M63A 4PK4A 5EGYA 1FR0A 2EIJC 1QSPA 2A0UA 4MQ9F 2VCBA 4OD5A 5D92A 4O6NA 2EPOA 5CI9A 3OA1A 4DJ9A 3I5QA 4GYTA 5EHHA 5E33A 1Z6AA 3G4ZA 4Z9IA 3T6GB 4CS7A 1R5ID 2WVQA 2R02A 3V5YA 3GANA 2ZXOA 3CQZA 3JRMO 4DRJB 3T9OA 4E0HA 4KC9A 4O79A 1VMAA 2ICWG 3JCUQ 3KYIA 2HFIA 2CGEA 1QQ3A 4IB4A 2L81A 2WZLA 1MNEA 3AQBA 3NRHA 3EFOB 2KNHA 1SZIA 5A6KA 1NU7D 4B6IA 4JTAB 5DQZA 3W4YA 5DS4A 5D91A 2XLDA 3DJNB 5T3WA 1LE2A 3GEEA 4KBLA 2NSFA 4DRIB 2R7UA 1ORYA 3PHF2 2AP3A 3NKDA 1RKCA 5BQGA 2R7OA 2AWCA 2A68F 2LQGA 4BG0A 5IY5C 1WGWA 5F5FA 3JRTA 1KU2A 3ABMC 4J7TA 1JAFA 3AOUA 3U2LA 2C04A 4LDQA 3O6XA 1Z7Qc 5A6JA 4J30B 4CIHA 2Y3HA 1HE1A 2Y3GA 3CZ6A 3KKBA 3SEOA 5L0JA 4A2NB 2HS5A 4RDAA 2JX0A 3ZC4A 2OQMA 4C3EA 5DS6A 1EQ1A 3QVZA 3H2VA 1ORJA 4DBQA 2V26A 2EPMX 4OIPF 3QVYA 4JCHA 4LDKA 1FMWA 4BJ5C 2J9BA 2B0JA 3B29A 3HTKC 1H9TA 2UUHA 3RFYA 4CDAA 4AE4A 5F28E 2V3CC 3ASOC 3O39A 3NYJA 4AE4B 4UDVA 3W8IA 3RYLA 1E2XA 2HV7A 2YVKA 3AG2C 2XM4A 1F1MA 1PV3A 2W45A 2BL2A 1MMAA 3GWNA 3EG9A 4ANJA 3EG9B 2AVKA 3ASNC 1H9GA 2ZD9A 2ZXPA 3M4CA 3UNGC 3WHNA 4U5FE 3EZIA 1E85A 5DQTA 2QE9A 3K1IA 1VYKA 3DXJF 2R03A 2NUPA 4OD4A 3JSEO 4XPYA 2CNWA 5JP7A 3JYHA 2YEVA 3E70C 3MLGA 2G62A 2NUPB 3TK0A 3B0VC 2AU5A 2J7PD 2QY9A 4U5HA 1TR2A 2CYDA 2P1AA 3CSKA 2R05A 4YL0A 2HZ8A 4MVUA 2CNWD 2YKZA 3J06A 3NYMA 1D0XA 1FTSA 4JEAA 3GWLA 3S84A 2OEXA 1I4ZA 4OIQF 3LUTB 1T6IA 4AL1A 1N1CA 4GQHA 4N06A 4YT5A 2J9VA 3EH1A 3A11A 3SXYA 3UGOA 1EI7A 1LS4A 2D4UA 2YHSA 3TJ6A 1E83A 4OIOF 2LP4A 1H6GA 2XLHA 3L34A 3VYWA 3DJUB 5BUOA 5L0GA 2KGOA 1DOVA 4EBJA 3GM2A 1LIHA 3U8PA 2LCHA 5L0FA 2IOQA 3UMHA 4G7OF 2CDQA 3TQOA 2YZSA 2WZFA 5JSLA 3RVZA 1VTMP 4CX9A 2JPUA 4CJGA 1FFTC 1HMOA 1NBBA 3F46A 3TD7A 3PMRA 1O5HA 3AGTA 1SMYF 1KTMA 2D5RB 4U5CE 4QI0A 2GFHA 3SYNA 4O7GA 3ABKC 2X51A 1C17M 4MTOA 1D1AA 1LI5A 3C62A 3CAXA 1OR3A 3PCVA 4IGGA 3LESA 1ZHXA 4EHPA 4DVYP 1OCCC 2A6HF 4NC3A 1VLTA 3ZTZA 2A69F 2FFHA 2OEVA 3JT1A 3NG1A 1ORSC 3SNHA 1O3UA 2J9WA 4EWCA 5BQHA 4ULWA 2Q3TA 4W8KA 1RJ9A 4DBRA 5HV9A 1OCRC 4JKVA 2TMVP 1LKXA 5E3CA 5B3IA 1O87A 5DS5A 2R7XA 5JLIA 2ZXRA 2NG1A 1AUEA 4PJLA 1YA7O 3KYJA 3EJNA 3M79A 4MVOA 1OCOC 3IQ6A 3X1OA 2Y3BA 4IAOA 3DM9B 4MNDA 4PFOA 2XXAA 2L6GA 4I1OB 3O10A 4IAQA 5JVEA 2HUJA 4W8PA 2ZXWC 3RQGA 3Q6MA 4N6HA 4Q5SF 3MBGA 1YA9A 2R7SA 2WVOA 5L0HA 1YDIA 3EHNA 1Z3IX 3VM6A 3KPHA 1U0BB 2EIKC 3G4XA 1ZVZA 3GODA 5GPGB 4N6CA 4P9TA 2RSEB 4AK9A 4X0RA 1BBHA 1H7IA 2IXNA 3FMSA 2OJED 2A6EF 2L9JA 5A6BA 1JPJA 3LLIA 3HJCA 3IQ5A 4K1OA 3SXZA 3EGXA 2KQ9A 4O6YA 5AGFA 3RKOF 4MS2A 5JS5A 2XLWA 3EGXB 5A6BD 3U2MA 4BJ6C 3MYFA 3JYYA 3H65A 3DMDA 2VB6A 4AX2A 5KYXA 1PCXA 2WZGA 5TJ5E 3NYLA 2J0XA 5KYXB 2VC9A 3Q7LA 4LLEA 3FOPA 4Z9HA 1TWAA 2R7RA 1RKEA 2VH3A 4NTBA 2PFDA 2DB4A 3M1CB 4BEMJ 1G4US 1RKEB 3C8ZA 4WJ0A 2HJ3A 5L0DA 2OCCC 2VASA 2PX3A 1SR2A 2KSFA 3AGUA 3TJ5A 4FAPB 4EBBA 1HW2A 5COFA 3U3FA 4XLPF 2PNOA 2Q9BA 4J32B 3U3BA 3L0IA 3Q6NA 2YL1A 1FNTc 1BR4A 4IRUA 4K0DA 1G4WR 2MYSA 1NZEA 4QDLA 3US6A 4I44A 4CSAC 2BE5F 1T9KA 4MW8A 3FXHA 2LK4A 2GDCA 2Z15A 2GAQA 4I1MA 3DE9A 3POVA 1T01A 1L7CA 4MVRA 5F5HA 3LAYA 4FESA 5COMA 4P9FA 3X2QC 4OIRF 3MFNA 1M6TA 2XRHA 4YWQA 1HMDA 1ZYRF 3DE8A 5FZTA 4P6IC 4ZLDA 1Z5ZA 4CJOA 1NFNA 4CS9C 3QMKA 3JZ0A 2HJMA 3EPVA 3T6BA 4DXWA 3O55A 3ATPA 5KYYA 1OXKA 2J8WA 3KH2A 4G7HF 1D0YA 1VOMA 4E7ZA 1D1CA 1LS1A 2BC5A 5A69A 5KYYB 2DGJA 1YYXA 2J7PA 1XZQA 2H7OA 3S29A 2YWAA 1PD0A 3LS0A 1A0BA 2I15A 4PFPA 4JJGA 4CIPA 4Q4ZF 2R7WA 1QVXA 2IXPA 3ITFA 3H2UA 3EH2A 2Q4FA 3QTHA 2GWWA 1M2VA 1QLEC 1IZMA 2R7QA 4U5GA 4WABA 2QLAA 2RD9A 3WG7C 5L0CA 4XTKA 3K6BA 1TQGA 1V74B 1M2VB 2Q9CA 2Q7RA 5JUAA 1AVOB 1GGQA 5A6AA 1WOLA 1SF8A 2KYHA 2E87A 2LSEA 2P7VA 1WN0A 3U9MA 2WB7A 2R7TA 3S9OA 1FAPB 2MHRA 1G8XA 4RBNA 1WTYA 4ULVA 2FAPB 1C02A 2J45A 1GQAA 1FFHA 2XS1A 3DD7A 4J7YA 4JRZA 1LVKA 4JTDB 4EUKB 1TKNA 4XEVA 1L3PA 1UG7A 3C8GA 3F47A 3OEOA 4HFKB 3AG4C 4I3MA 3ZDLA 2L7AA 5JRAA 3HNIA 3C8GB 3N24A 3PDMP 3LNRA 3C8GD 3W2VA 4ER9A 1GM5A 3EZHA 5AC5A 3AQCA 4NTFA 2KK1A 1V4AA 3AG1C 4LLCA 4CDYA 3B9QA 4HFFB 4E0IA 1OW8A 3NKEA 1LE4A 2CCYA 4E18A 3ECSA 5B3SC 3E9VA 2R7VA 2J46A 1YVIA 3IQTA 2GA0A 4LDRA 5FCLA 2ETSA 2Y69C 4O6MA 1Q0GA 3LJBA 1BR1A 1KNYA 1MMDA 2W4BA 3DAGA 4GEHA 2DYRC 4HE8D 4PACA 3SP1A 2AWYA 2B0HA 3A9CA 3B71A 1MMNA 3DZAA 3OWTA 3Q7GA 4PJNA 1C03A 3VAYA 4A4AA 1OW6A 2HKVA 3HNJA 1Q0DA 1S05A 1RJ9B 4CSAA 1RCPA 2QNLA 2C03A 3V7OA 3C7JA 1U89A 4IWBA 5DLJA 4BJ5A 1Z63A 3DAFA 4H4KC 2VCAA 4CS8C 2XL8A 1R4TA 1PD1A 3IHUA 4U9DA 4YN0B 1JMWA 1LM3B 4H54A 3IQCA 1FMVA 1K05A 3N2ZB 3B0PA 2P0NA 4BJ1A 3HNLA 5E2QA 4XPXA 3NMIA 1I5NA 4EKWA 3FDQA 4JW1A 3GORA 3RQEA 3ZQYA 2XXAB 1JRAA 1M56C 3JSZA 5COGA 3TOMA 3GEIA 4G78A 5L3QA 3RF3A 4YT4A 3WAQA 2HMZA 4YL1A 1Y6DA 4HEAJ 3W2WA 1J8MF 4DRHB 3GM1A 1YZAA 2X0CA 2H7VC 4JTCB 2IYLD 3FHDA 2P61A 1NFOA 4ZLCA 1APCA 2EPLX 3I5PA 1QPUA 4MVMA 4NY3A 1CPQA 5E3AA 256BA 5KYUA 3UMIA 3S90A 2XLVA 1ZU4A 4E7SA 1ZW2A 1T5OA 1Z23A 2R25A 3UMKA 5KYUB 5HSWA 1YLMA 4L6RA 4BJTA 2JD3A 3ZVRA 3VRCA 4XPWA 3RQFA 3RVYA 1HY5A 4OINF 3I4UA 2DYSC 3ZQVA 1OQCA 1OXBA 1YYJA 3LLKA 4MW3A 2EIMC 1E84A 2PBEA 1D1BA 2OOCA 2OKUA 2CW0F 1B68A 2YL3A 1ZZPA 1OR2A 1ZHYA 3UGPA 2YRFA 4C3DA 1M2OA 1NU9C 1BR2A 3ZG1A 1JR8A 1WASA 3ABLC 2NPUA 1IW7F 5K0IA 1A7VA 3FVYA 3JTLO 4JZAA 5KYNA 3EFOA 2XLMA 3AJMA 1JOGA 4Q7CA 5L3VA 1DOWA 2R9RB 3FOOA 1OW7A 1D0ZA 3HLZA 3S28A 4F4BA 4PR9A 2Q9AA 1VK5A 1NLXA 4G7ZF 4AL0A 2EILC 3LEVA 4MVZA 2HSQA 5CI8A 3HNKA 2YQYA 1T6QA 4CDVA 1E86A 4MTFA 3IPMO 1K04A 2W4MA 4JE9A 4YT2A 4XWJA 3MX3A 4G0HA 3R7CA 4BEJA 2L6FA 1QKRA 1G5ZA 4YJWA 4U9EA 3U9JA 2YLGA 3KMIA 2PF4E 4MVQA 4NCQA 1ZHTA 2G3KA 1YAUO 3HKKA 3QZCA 4NQFA 4JEBA 3BRJA 2KC3A 4E17A 3V5XA 1S7ZA 1NSGB 3TOLA
chains in the Genus database with same CATH topology
2UUIA 4JCZA 5BQHA 5K0IA 4NTAA 4BPMA 2PNOA 5HV9A 4JRZA 4J7YA 3LEOA 2H8AA 4JC7A 5BQIA 3B29A 4AL0A 2UUHA 4YL3A 4NTFA 4YL0A 4WABA 4YK5A 5BQGA 2Q7RA 3HKKA 3PCVA 4NTBA 4AL1A 4YL1A 3DWWA 4J7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUI A;  4JCZ A;  5BQH A;  5K0I A;  4NTA A;  4BPM A;  2PNO A;  5HV9 A;  4JRZ A;  4J7Y A;  3LEO A;  2H8A A;  4JC7 A;  5BQI A;  3B29 A;  4AL0 A;  2UUH A;  4YL3 A;  4NTF A;  4YL0 A;  4WAB A;  4YK5 A;  5BQG A;  2Q7R A;  3HKK A;  3PCV A;  4NTB A;  4AL1 A;  4YL1 A;  3DWW A;  4J7T A; 
#chains in the Genus database with same CATH topology
 2IBF A;  4FWV A;  1VB5 A;  2OG2 A;  3LNM B;  3WOD F;  3B0U X;  4JCZ A;  3K66 A;  1VYI A;  1J8Y F;  2H7B A;  4MVS A;  3U0C A;  5AC4 A;  1EKY A;  2EPN A;  1RXQ A;  1WWP A;  2EIN C;  2OU6 A;  3BEH A;  4Z9J A;  1QZX A;  1OKK A;  5T1D B;  4EBK A;  3M15 A;  1MQV A;  3NMJ A;  2PP4 A;  1SYQ A;  4XEF A;  3EQL F;  1XWJ A;  2NUT A;  3T6J A;  4CS8 A;  3L1M A;  3L8I A;  3K33 A;  3CEX A;  3VF0 A;  2NUT B;  1OKK D;  4YT8 A;  2OJQ A;  3N0T A;  1MND A;  3SXM A;  4JJF A;  4PJJ A;  2XM0 A;  4N4W A;  1TFO B;  3EGD A;  4RD9 A;  4XEK A;  2W9Y A;  3DKA A;  3ZWI A;  4C7O A;  1YAR O;  2A0B A;  3EGD B;  1VLS A;  3U8V A;  2FGY A;  2ASR A;  5KYW A;  4C7O B;  2VCC A;  1A41 A;  1CGO A;  4KNW A;  2WVN A;  3ZIB A;  2HSB A;  1Q0F A;  4JVS A;  3M4B A;  4U5E E;  5KYW B;  3TUL A;  1RMV A;  1WAT A;  1I4Y A;  2P6V A;  2QUP A;  1HE9 A;  4WGY A;  4QI2 A;  4DVZ A;  4NTA A;  4BPM A;  2IXO A;  2IXM A;  2KJG A;  4LER A;  4XLN F;  5BQI A;  1Y4C A;  1CGM E;  3U5S A;  4YL3 A;  4BJ6 A;  1Q0K A;  3DI5 A;  2YL7 A;  3G50 A;  3MYI A;  3S0X A;  2MWQ A;  1CPR A;  1ZHW A;  1AEP A;  3K1H A;  1YZC A;  4YK5 A;  1EA8 A;  4FX5 A;  1BZ4 A;  5EK0 A;  4C3B A;  2M4E A;  3RW0 A;  2EPK X;  1CGN A;  2HMQ A;  1BDJ B;  3QW0 A;  3UR3 C;  4JUR I;  4U5D E;  2LFF A;  2LIG A;  3RIP A;  2UUI A;  3R2P A;  4D4X A;  2XL4 A;  5T3T A;  3SZR A;  3KL4 A;  3FAJ A;  4LAC B;  2Y39 A;  3LEO A;  3V5Z A;  3NMK A;  1K40 A;  1XZP A;  2H8A A;  3GEH A;  5L0I A;  2XLO A;  2A1D D;  1W2W A;  2I8B A;  3C63 A;  2IM8 A;  1HW1 A;  3IEE A;  3QW1 A;  2XLE A;  3K7D A;  3L8J A;  4KNV A;  4WGZ A;  2YL0 A;  3GM3 A;  5DVW A;  1TWH A;  4KI2 A;  2ZPA A;  2YLD A;  1Q0M A;  2Y3D A;  3W8H A;  1ST6 A;  2XL6 A;  3ZSU A;  2XS8 A;  1TWC A;  1ZW3 A;  2Q00 A;  2QTV A;  1A7D A;  1GS9 A;  1LPE A;  3AG3 C;  3DM5 A;  2YLI A;  3NDB B;  3LS1 A;  2DI3 A;  5CIV A;  2J0W A;  1JPN A;  2XSE A;  3C18 A;  2L6H A;  1NG1 A;  4ONS A;  4DOZ A;  1V55 C;  1V54 C;  3DWW A;  4D4N A;  4EIY A;  1MMG A;  1UFB A;  2KW3 C;  2LD6 A;  3ZTM A;  1TFK B;  2PX0 A;  1M57 C;  2M64 A;  2WL8 A;  1TWG A;  1ZU5 A;  3EHM A;  5B1B C;  2O9X A;  1YJG A;  3T4R A;  4CS9 A;  5JT4 A;  1OCZ C;  4IJJ A;  4MTG A;  1ZHZ A;  3RH3 A;  1LI7 A;  4U5B E;  5B1A C;  4JIO A;  4JC7 A;  3FAP B;  2J9U A;  1A7E A;  4IAR A;  4PJM A;  3K1I C;  4K7B A;  4XQ1 A;  2NSG A;  4R32 A;  1U6H A;  2LFD A;  3SXK A;  4CBE A;  2HV6 A;  3S27 A;  1T6U A;  2G3V A;  2F22 A;  4M63 A;  4PK4 A;  5EGY A;  1FR0 A;  2EIJ C;  1QSP A;  2A0U A;  4MQ9 F;  2VCB A;  4OD5 A;  5D92 A;  4O6N A;  2EPO A;  5CI9 A;  3OA1 A;  4DJ9 A;  3I5Q A;  4GYT A;  5EHH A;  5E33 A;  1Z6A A;  3G4Z A;  4Z9I A;  3T6G B;  4CS7 A;  1R5I D;  2WVQ A;  2R02 A;  3V5Y A;  3GAN A;  2ZXO A;  3CQZ A;  3JRM O;  4DRJ B;  3T9O A;  4E0H A;  4KC9 A;  4O79 A;  1VMA A;  2ICW G;  3JCU Q;  3KYI A;  2HFI A;  2CGE A;  1QQ3 A;  4IB4 A;  2L81 A;  2WZL A;  1MNE A;  3AQB A;  3NRH A;  3EFO B;  2KNH A;  1SZI A;  5A6K A;  1NU7 D;  4B6I A;  4JTA B;  5DQZ A;  3W4Y A;  5DS4 A;  5D91 A;  2XLD A;  3DJN B;  5T3W A;  1LE2 A;  3GEE A;  4KBL A;  2NSF A;  4DRI B;  2R7U A;  1ORY A;  3PHF 2;  2AP3 A;  3NKD A;  1RKC A;  5BQG A;  2R7O A;  2AWC A;  2A68 F;  2LQG A;  4BG0 A;  5IY5 C;  1WGW A;  5F5F A;  3JRT A;  1KU2 A;  3ABM C;  4J7T A;  1JAF A;  3AOU A;  3U2L A;  2C04 A;  4LDQ A;  3O6X A;  1Z7Q c;  5A6J A;  4J30 B;  4CIH A;  2Y3H A;  1HE1 A;  2Y3G A;  3CZ6 A;  3KKB A;  3SEO A;  5L0J A;  4A2N B;  2HS5 A;  4RDA A;  2JX0 A;  3ZC4 A;  2OQM A;  4C3E A;  5DS6 A;  1EQ1 A;  3QVZ A;  3H2V A;  1ORJ A;  4DBQ A;  2V26 A;  2EPM X;  4OIP F;  3QVY A;  4JCH A;  4LDK A;  1FMW A;  4BJ5 C;  2J9B A;  2B0J A;  3B29 A;  3HTK C;  1H9T A;  2UUH A;  3RFY A;  4CDA A;  4AE4 A;  5F28 E;  2V3C C;  3ASO C;  3O39 A;  3NYJ A;  4AE4 B;  4UDV A;  3W8I A;  3RYL A;  1E2X A;  2HV7 A;  2YVK A;  3AG2 C;  2XM4 A;  1F1M A;  1PV3 A;  2W45 A;  2BL2 A;  1MMA A;  3GWN A;  3EG9 A;  4ANJ A;  3EG9 B;  2AVK A;  3ASN C;  1H9G A;  2ZD9 A;  2ZXP A;  3M4C A;  3UNG C;  3WHN A;  4U5F E;  3EZI A;  1E85 A;  5DQT A;  2QE9 A;  3K1I A;  1VYK A;  3DXJ F;  2R03 A;  2NUP A;  4OD4 A;  3JSE O;  4XPY A;  2CNW A;  5JP7 A;  3JYH A;  2YEV A;  3E70 C;  3MLG A;  2G62 A;  2NUP B;  3TK0 A;  3B0V C;  2AU5 A;  2J7P D;  2QY9 A;  4U5H A;  1TR2 A;  2CYD A;  2P1A A;  3CSK A;  2R05 A;  4YL0 A;  2HZ8 A;  4MVU A;  2CNW D;  2YKZ A;  3J06 A;  3NYM A;  1D0X A;  1FTS A;  4JEA A;  3GWL A;  3S84 A;  2OEX A;  1I4Z A;  4OIQ F;  3LUT B;  1T6I A;  4AL1 A;  1N1C A;  4GQH A;  4N06 A;  4YT5 A;  2J9V A;  3EH1 A;  3A11 A;  3SXY A;  3UGO A;  1EI7 A;  1LS4 A;  2D4U A;  2YHS A;  3TJ6 A;  1E83 A;  4OIO F;  2LP4 A;  1H6G A;  2XLH A;  3L34 A;  3VYW A;  3DJU B;  5BUO A;  5L0G A;  2KGO A;  1DOV A;  4EBJ A;  3GM2 A;  1LIH A;  3U8P A;  2LCH A;  5L0F A;  2IOQ A;  3UMH A;  4G7O F;  2CDQ A;  3TQO A;  2YZS A;  2WZF A;  5JSL A;  3RVZ A;  1VTM P;  4CX9 A;  2JPU A;  4CJG A;  1FFT C;  1HMO A;  1NBB A;  3F46 A;  3TD7 A;  3PMR A;  1O5H A;  3AGT A;  1SMY F;  1KTM A;  2D5R B;  4U5C E;  4QI0 A;  2GFH A;  3SYN A;  4O7G A;  3ABK C;  2X51 A;  1C17 M;  4MTO A;  1D1A A;  1LI5 A;  3C62 A;  3CAX A;  1OR3 A;  3PCV A;  4IGG A;  3LES A;  1ZHX A;  4EHP A;  4DVY P;  1OCC C;  2A6H F;  4NC3 A;  1VLT A;  3ZTZ A;  2A69 F;  2FFH A;  2OEV A;  3JT1 A;  3NG1 A;  1ORS C;  3SNH A;  1O3U A;  2J9W A;  4EWC A;  5BQH A;  4ULW A;  2Q3T A;  4W8K A;  1RJ9 A;  4DBR A;  5HV9 A;  1OCR C;  4JKV A;  2TMV P;  1LKX A;  5E3C A;  5B3I A;  1O87 A;  5DS5 A;  2R7X A;  5JLI A;  2ZXR A;  2NG1 A;  1AUE A;  4PJL A;  1YA7 O;  3KYJ A;  3EJN A;  3M79 A;  4MVO A;  1OCO C;  3IQ6 A;  3X1O A;  2Y3B A;  4IAO A;  3DM9 B;  4MND A;  4PFO A;  2XXA A;  2L6G A;  4I1O B;  3O10 A;  4IAQ A;  5JVE A;  2HUJ A;  4W8P A;  2ZXW C;  3RQG A;  3Q6M A;  4N6H A;  4Q5S F;  3MBG A;  1YA9 A;  2R7S A;  2WVO A;  5L0H A;  1YDI A;  3EHN A;  1Z3I X;  3VM6 A;  3KPH A;  1U0B B;  2EIK C;  3G4X A;  1ZVZ A;  3GOD A;  5GPG B;  4N6C A;  4P9T A;  2RSE B;  4AK9 A;  4X0R A;  1BBH A;  1H7I A;  2IXN A;  3FMS A;  2OJE D;  2A6E F;  2L9J A;  5A6B A;  1JPJ A;  3LLI A;  3HJC A;  3IQ5 A;  4K1O A;  3SXZ A;  3EGX A;  2KQ9 A;  4O6Y A;  5AGF A;  3RKO F;  4MS2 A;  5JS5 A;  2XLW A;  3EGX B;  5A6B D;  3U2M A;  4BJ6 C;  3MYF A;  3JYY A;  3H65 A;  3DMD A;  2VB6 A;  4AX2 A;  5KYX A;  1PCX A;  2WZG A;  5TJ5 E;  3NYL A;  2J0X A;  5KYX B;  2VC9 A;  3Q7L A;  4LLE A;  3FOP A;  4Z9H A;  1TWA A;  2R7R A;  1RKE A;  2VH3 A;  4NTB A;  2PFD A;  2DB4 A;  3M1C B;  4BEM J;  1G4U S;  1RKE B;  3C8Z A;  4WJ0 A;  2HJ3 A;  5L0D A;  2OCC C;  2VAS A;  2PX3 A;  1SR2 A;  2KSF A;  3AGU A;  3TJ5 A;  4FAP B;  4EBB A;  1HW2 A;  5COF A;  3U3F A;  4XLP F;  2PNO A;  2Q9B A;  4J32 B;  3U3B A;  3L0I A;  3Q6N A;  2YL1 A;  1FNT c;  1BR4 A;  4IRU A;  4K0D A;  1G4W R;  2MYS A;  1NZE A;  4QDL A;  3US6 A;  4I44 A;  4CSA C;  2BE5 F;  1T9K A;  4MW8 A;  3FXH A;  2LK4 A;  2GDC A;  2Z15 A;  2GAQ A;  4I1M A;  3DE9 A;  3POV A;  1T01 A;  1L7C A;  4MVR A;  5F5H A;  3LAY A;  4FES A;  5COM A;  4P9F A;  3X2Q C;  4OIR F;  3MFN A;  1M6T A;  2XRH A;  4YWQ A;  1HMD A;  1ZYR F;  3DE8 A;  5FZT A;  4P6I C;  4ZLD A;  1Z5Z A;  4CJO A;  1NFN A;  4CS9 C;  3QMK A;  3JZ0 A;  2HJM A;  3EPV A;  3T6B A;  4DXW A;  3O55 A;  3ATP A;  5KYY A;  1OXK A;  2J8W A;  3KH2 A;  4G7H F;  1D0Y A;  1VOM A;  4E7Z A;  1D1C A;  1LS1 A;  2BC5 A;  5A69 A;  5KYY B;  2DGJ A;  1YYX A;  2J7P A;  1XZQ A;  2H7O A;  3S29 A;  2YWA A;  1PD0 A;  3LS0 A;  1A0B A;  2I15 A;  4PFP A;  4JJG A;  4CIP A;  4Q4Z F;  2R7W A;  1QVX A;  2IXP A;  3ITF A;  3H2U A;  3EH2 A;  2Q4F A;  3QTH A;  2GWW A;  1M2V A;  1QLE C;  1IZM A;  2R7Q A;  4U5G A;  4WAB A;  2QLA A;  2RD9 A;  3WG7 C;  5L0C A;  4XTK A;  3K6B A;  1TQG A;  1V74 B;  1M2V B;  2Q9C A;  2Q7R A;  5JUA A;  1AVO B;  1GGQ A;  5A6A A;  1WOL A;  1SF8 A;  2KYH A;  2E87 A;  2LSE A;  2P7V A;  1WN0 A;  3U9M A;  2WB7 A;  2R7T A;  3S9O A;  1FAP B;  2MHR A;  1G8X A;  4RBN A;  1WTY A;  4ULV A;  2FAP B;  1C02 A;  2J45 A;  1GQA A;  1FFH A;  2XS1 A;  3DD7 A;  4J7Y A;  4JRZ A;  1LVK A;  4JTD B;  4EUK B;  1TKN A;  4XEV A;  1L3P A;  1UG7 A;  3C8G A;  3F47 A;  3OEO A;  4HFK B;  3AG4 C;  4I3M A;  3ZDL A;  2L7A A;  5JRA A;  3HNI A;  3C8G B;  3N24 A;  3PDM P;  3LNR A;  3C8G D;  3W2V A;  4ER9 A;  1GM5 A;  3EZH A;  5AC5 A;  3AQC A;  4NTF A;  2KK1 A;  1V4A A;  3AG1 C;  4LLC A;  4CDY A;  3B9Q A;  4HFF B;  4E0I A;  1OW8 A;  3NKE A;  1LE4 A;  2CCY A;  4E18 A;  3ECS A;  5B3S C;  3E9V A;  2R7V A;  2J46 A;  1YVI A;  3IQT A;  2GA0 A;  4LDR A;  5FCL A;  2ETS A;  2Y69 C;  4O6M A;  1Q0G A;  3LJB A;  1BR1 A;  1KNY A;  1MMD A;  2W4B A;  3DAG A;  4GEH A;  2DYR C;  4HE8 D;  4PAC A;  3SP1 A;  2AWY A;  2B0H A;  3A9C A;  3B71 A;  1MMN A;  3DZA A;  3OWT A;  3Q7G A;  4PJN A;  1C03 A;  3VAY A;  4A4A A;  1OW6 A;  2HKV A;  3HNJ A;  1Q0D A;  1S05 A;  1RJ9 B;  4CSA A;  1RCP A;  2QNL A;  2C03 A;  3V7O A;  3C7J A;  1U89 A;  4IWB A;  5DLJ A;  4BJ5 A;  1Z63 A;  3DAF A;  4H4K C;  2VCA A;  4CS8 C;  2XL8 A;  1R4T A;  1PD1 A;  3IHU A;  4U9D A;  4YN0 B;  1JMW A;  1LM3 B;  4H54 A;  3IQC A;  1FMV A;  1K05 A;  3N2Z B;  3B0P A;  2P0N A;  4BJ1 A;  3HNL A;  5E2Q A;  4XPX A;  3NMI A;  1I5N A;  4EKW A;  3FDQ A;  4JW1 A;  3GOR A;  3RQE A;  3ZQY A;  2XXA B;  1JRA A;  1M56 C;  3JSZ A;  5COG A;  3TOM A;  3GEI A;  4G78 A;  5L3Q A;  3RF3 A;  4YT4 A;  3WAQ A;  2HMZ A;  4YL1 A;  1Y6D A;  4HEA J;  3W2W A;  1J8M F;  4DRH B;  3GM1 A;  1YZA A;  2X0C A;  2H7V C;  4JTC B;  2IYL D;  3FHD A;  2P61 A;  1NFO A;  4ZLC A;  1APC A;  2EPL X;  3I5P A;  1QPU A;  4MVM A;  4NY3 A;  1CPQ A;  5E3A A;  256B A;  5KYU A;  3UMI A;  3S90 A;  2XLV A;  1ZU4 A;  4E7S A;  1ZW2 A;  1T5O A;  1Z23 A;  2R25 A;  3UMK A;  5KYU B;  5HSW A;  1YLM A;  4L6R A;  4BJT A;  2JD3 A;  3ZVR A;  3VRC A;  4XPW A;  3RQF A;  3RVY A;  1HY5 A;  4OIN F;  3I4U A;  2DYS C;  3ZQV A;  1OQC A;  1OXB A;  1YYJ A;  3LLK A;  4MW3 A;  2EIM C;  1E84 A;  2PBE A;  1D1B A;  2OOC A;  2OKU A;  2CW0 F;  1B68 A;  2YL3 A;  1ZZP A;  1OR2 A;  1ZHY A;  3UGP A;  2YRF A;  4C3D A;  1M2O A;  1NU9 C;  1BR2 A;  3ZG1 A;  1JR8 A;  1WAS A;  3ABL C;  2NPU A;  1IW7 F;  5K0I A;  1A7V A;  3FVY A;  3JTL O;  4JZA A;  5KYN A;  3EFO A;  2XLM A;  3AJM A;  1JOG A;  4Q7C A;  5L3V A;  1DOW A;  2R9R B;  3FOO A;  1OW7 A;  1D0Z A;  3HLZ A;  3S28 A;  4F4B A;  4PR9 A;  2Q9A A;  1VK5 A;  1NLX A;  4G7Z F;  4AL0 A;  2EIL C;  3LEV A;  4MVZ A;  2HSQ A;  5CI8 A;  3HNK A;  2YQY A;  1T6Q A;  4CDV A;  1E86 A;  4MTF A;  3IPM O;  1K04 A;  2W4M A;  4JE9 A;  4YT2 A;  4XWJ A;  3MX3 A;  4G0H A;  3R7C A;  4BEJ A;  2L6F A;  1QKR A;  1G5Z A;  4YJW A;  4U9E A;  3U9J A;  2YLG A;  3KMI A;  2PF4 E;  4MVQ A;  4NCQ A;  1ZHT A;  2G3K A;  1YAU O;  3HKK A;  3QZC A;  4NQF A;  4JEB A;  3BRJ A;  2KC3 A;  4E17 A;  3V5X A;  1S7Z A;  1NSG B;  3TOL A; 
#chains in the Genus database with same CATH homology
 2UUI A;  4JCZ A;  5BQH A;  5K0I A;  4NTA A;  4BPM A;  2PNO A;  5HV9 A;  4JRZ A;  4J7Y A;  3LEO A;  2H8A A;  4JC7 A;  5BQI A;  3B29 A;  4AL0 A;  2UUH A;  4YL3 A;  4NTF A;  4YL0 A;  4WAB A;  4YK5 A;  5BQG A;  2Q7R A;  3HKK A;  3PCV A;  4NTB A;  4AL1 A;  4YL1 A;  3DWW A;  4J7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...