2OKUA

The crystal structure of the acyl-coa dehydrogenase family protein from porphyromonas gingivalis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
122
structure length
122
Chain Sequence
b'QVVAAIRHITTGTYIARIREEYQQTEVKPELQPMKEALARMTDRAEALIAFVTEQKDQELLDFQARRLVEMTAHAVFGHLLMLAANDDDSFRQSAEVYLRYGQAEQEKIDSYVRAFRPEELT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Acyl-CoA dehydrogenase family protein
publication title The crystal structure of the acyl-CoA dehydrogenase family protein from Porphyromonas gingivalis
rcsb
source organism Porphyromonas gingivalis
molecule tags Oxidoreductase
total genus 46
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12186 AcylCoA_dehyd_C Acyl-CoA dehydrogenase C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.470 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Acyl-CoA dehydrogenase, C-terminal domain 2okuA00
2OKUA
chains in the Genus database with same CATH superfamily
1E2XA 4K0DA 2P1AA 2YRFA 3IQTA 4O6NA 3G4ZA 4K7BA 4BJ6A 2HZ8A 4EWCA 5DS6A 5DLJA 3KPHA 4I44A 3EHMA 2OJED 2VH3A 2P61A 1QQ3A 2QLAA 1L3PA 3O6XA 2L81A 3UMIA 1R5ID 2RD9A 3IPMO 3RFYA 3SXKA 2MYSA 4ULVA 5JSLA 4WGYA 5B1AC 4U5CE 2IXOA 2FAPB 3NYJA 3T6GB 4FAPB 5COMA 2DYSC 4BJTA 3RIPA 1FMVA 5JT4A 4QDLA 2Z15A 3U9MA 3DAFA 2HV7A 4N06A 2CDQA 3PCVA 4CBEA 4EKWA 3POVA 2G62A 3E9VA 3O39A 1F1MA 3GM1A 1VMAA 1FAPB 1HMOA 1M2VB 2HV6A 4CS9C 2R7VA 3FMSA 1SR2A 2KNHA 5F5FA 4L6RA 1BR1A 4OIRF 2XM0A 3LLIA 4LLEA 2ZD9A 2ICWG 3RYLA 2ETSA 2EPKX 3AOUA 2HMZA 3GEEA 4G78A 4XLNF 4CJGA 4DRHB 2DB4A 4PK4A 3NMIA 3DD7A 2PX3A 4BJ6C 1AEPA 2CNWA 2GAQA 1RKCA 4DBQA 1RXQA 1L7CA 3QW0A 2UUIA 3EZIA 4WGZA 256BA 3NYLA 1YJGA 2J8WA 1Z3IX 2PF4E 4CIHA 4NQFA 3RVYA 4MS2A 2R7UA 3HNKA 2YLGA 1RKEB 1LS4A 3U3FA 4DRJB 3K1IA 1WATA 1CPRA 1ORSC 2OJQA 4YL3A 3JRMO 2UUHA 1OCRC 3DAGA 4C3DA 4E18A 3JSZA 3AGTA 3VAYA 2R7WA 1D1AA 4G7ZF 2KQ9A 1AVOB 1QZXA 2Y3DA 2YQYA 2IBFA 3C7JA 4KBLA 4YL0A 3GM3A 4CS8A 2Q00A 1U6HA 3GEIA 3C8GA 3DWWA 2IM8A 1GM5A 1B68A 1BR2A 2JX0A 4ER9A 2XSEA 3AQBA 3S84A 4OD4A 1Q0FA 5E2QA 5BQIA 3SEOA 1PCXA 4CJOA 2ZXPA 2WVNA 4AL0A 1YDIA 2NG1A 1S7ZA 2LQGA 3RKOF 1V54C 2KK1A 4C7OA 3IQ6A 2C03A 3TOLA 4U5FE 1JR8A 4XEVA 3BEHA 4XQ1A 1YYXA 2DYRC 3MYFA 1ZYRF 2CW0F 4BEMJ 5IY5C 1K40A 2AVKA 3AG1C 4DBRA 1C02A 4PJJA 2NUTA 1TR2A 3V7OA 3F47A 4AK9A 1IW7F 4C3EA 2A6HF 3KL4A 4U9EA 1OQCA 3TK0A 4ANJA 3U5SA 5A6BD 5KYNA 4M63A 3S0XA 2M4EA 4A2NB 2HUJA 4G0HA 1HW1A 1M57C 4R32A 2R9RB 3NRHA 1BZ4A 2P0NA 2YL0A 4CS8C 3B0VC 5EK0A 5L3QA 2Q9AA 3JYHA 4Q7CA 5KYXB 4YN0B 5HV9A 3B0UX 3G4XA 3OWTA 3RF3A 4EHPA 1NU9C 1Z23A 2IXMA 3NMKA 3S9OA 3ZVRA 2R7TA 1Z6AA 1NFNA 2A1DD 2GFHA 3M4CA 2HMQA 1OXBA 3T6JA 4JCHA 4YWQA 3PDMP 5GPGB 5DQZA 1ORJA 1LM3B 2R7QA 3NMJA 4WJ0A 3US6A 1D1BA 2LP4A 1JOGA 2HJ3A 2IYLD 1QLEC 4QI2A 1J8MF 4N6CA 1HW2A 4NY3A 4DVZA 4BJ1A 1Q0KA 3LS1A 4I1OB 2PX0A 4JVSA 5E33A 4A4AA 2NUPB 2L7AA 1Q0DA 3I5QA 3QTHA 3JSEO 4YK5A 3SXMA 3ZTZA 3C8GB 4NC3A 3EGDA 5F28E 1VLSA 5A6JA 1U89A 3ASNC 1YA7O 4EUKB 1LKXA 3HNJA 3QMKA 3S27A 5COGA 4J7YA 3C62A 4DOZA 2HSBA 3L8JA 4PJMA 4WABA 3L8IA 3GWLA 3X1OA 5EHHA 1E86A 4EBJA 1TWGA 2QNLA 2OU6A 1RMVA 5T3WA 4C7OB 1OKKD 1A7EA 3TJ6A 1T01A 2R03A 3S29A 2EPNA 1KU2A 2PNOA 1YA9A 2OKUA 1YZCA 3L34A 4JE9A 1H6GA 1MMDA 2LCHA 1QPUA 4IAOA 4U5EE 5D91A 3ITFA 3HLZA 1HE1A 3V5YA 5KYWA 1BDJB 1JRAA 1Y4CA 1ZU4A 5JLIA 4MVRA 4I1MA 3IQ5A 2EILC 2EINC 1I4ZA 3FHDA 1D0XA 1TWHA 2A6EF 4JKVA 3I5PA 1MMAA 3ZIBA 1NLXA 5T3TA 1EA8A 2QE9A 3ABLC 2J9WA 2R7OA 4NTFA 1PD0A 2YL3A 3R7CA 3ECSA 3VRCA 5AC5A 1C17M 5CI8A 1NG1A 4YT4A 1M6TA 1K05A 3T9OA 3W8IA 2J45A 2NPUA 4IJJA 5JVEA 4XLPF 1DOWA 2YLIA 2OEXA 2XL4A 3KH2A 3M79A 3DKAA 2HJMA 3ZQYA 4BJ5C 2HSQA 2H7VC 1YVIA 1FR0A 2CYDA 3HNLA 4X0RA 3G50A 2XXAB 5L0DA 2H7BA 3DJUB 2FFHA 5KYUA 1ZHYA 2HFIA 1WWPA 4HE8D 3CAXA 1Z7Qc 2W4BA 4D4XA 1ZU5A 2Q7RA 1Y6DA 1A41A 4K1OA 2R7SA 3GORA 2NSGA 4JRZA 1QKRA 2WL8A 3HJCA 2W9YA 3EJNA 3ZTMA 4RDAA 2WZLA 2ZXOA 2XLWA 3EFOA 3EGDB 2ZXRA 4J30B 3L0IA 4LDRA 3IEEA 3W2WA 3ZG1A 4AE4B 4P9TA 5F5HA 4Q5SF 3N2ZB 2V26A 4XPWA 1KTMA 1VOMA 3Q7LA 5HSWA 3SZRA 2DGJA 3RVZA 4JTCB 1IZMA 2YL1A 5A6KA 1APCA 2KC3A 2I8BA 4U5GA 4YT2A 4MQ9F 1R4TA 3NDBB 2YEVA 3EG9A 1JPJA 3GODA 1TFKB 3WODF 3DM9B 2Y69C 1TQGA 5DQTA 3CZ6A 3MLGA 1SMYF 3FVYA 1VK5A 2A0BA 2VCAA 3LNRA 4MVMA 4U5DE 2KYHA 4HEAJ 4ZLCA 1VYKA 3OA1A 1OW6A 2OG2A 3VM6A 2H8AA 3WAQA 5KYWB 1WGWA 3U2MA 4C3BA 3DMDA 3Q6MA 1D1CA 1UG7A 3B71A 3LLKA 2LD6A 3IQCA 4FWVA 3DI5A 2TMVP 2V3CC 3M1CB 1M56C 1FFHA 1ZHTA 2D4UA 3U0CA 2GWWA 4ONSA 3SXYA 5FZTA 3H2UA 5L0FA 2J7PA 3MX3A 2HS5A 4MTOA 3AG3C 4QI0A 3VYWA 1TFOB 4MVUA 3X2QC 1NSGB 3UMKA 2R05A 4O7GA 3V5XA 3R2PA 2KSFA 3DE8A 4PFOA 1G4WR 1ZHWA 3A9CA 1GS9A 4E0HA 3PHF2 2WZGA 2XLMA 3K1IC 4IGGA 2F22A 1YZAA 1I5NA 1YYJA 2EIMC 2VCBA 5AGFA 2J46A 1YAUO 2J9UA 1FFTC 2YKZA 4N4WA 2L6FA 4JEAA 4RD9A 1QVXA 3O55A 1G8XA 3ATPA 4BPMA 1OW8A 4Q4ZF 3UGOA 1WOLA 1O3UA 1FTSA 3W2VA 5B1BC 2X51A 1RJ9A 3CEXA 3U8VA 3S28A 2FGYA 2JD3A 4Z9HA 4IWBA 1E83A 2Y3HA 3C8GD 3ZWIA 2XLDA 1ZW2A 1KNYA 3KYIA 1HMDA 4GEHA 3AG2C 2G3VA 1J8YF 2YL7A 3IHUA 4H54A 4NTBA 3UR3C 4B6IA 1OKKA 3EG9B 5JRAA 2Y3BA 3EGXA 1MMGA 4FX5A 2O9XA 4U5HA 5CIVA 2L6HA 4OD5A 1VTMP 4U9DA 1ZVZA 3TOMA 1NFOA 1XZQA 1DOVA 3NKEA 1MNDA 4MVQA 2QY9A 2VASA 4O6MA 3LEOA 2R25A 1T6UA 3UGPA 5L0IA 3F46A 2B0HA 1JPNA 3TQOA 3LNMB 3SXZA 1ZHXA 1OCOC 4OIOF 4KI2A 1QSPA 3KMIA 4J32B 2X0CA 3OEOA 2GA0A 4MNDA 4Z9JA 5JUAA 3EHNA 2AP3A 1V74B 4JURI 4G7HF 4JJFA 1LE4A 3DJNB 3FAPB 4MW3A 5JP7A 2QUPA 3MBGA 4JTAB 4OINF 3S90A 5D92A 3FDQA 1A7DA 1ZW3A 2HKVA 3QVYA 4JCZA 3U8PA 4H4KC 5L0CA 2WVOA 2NUTB 2L9JA 3EPVA 4CIPA 1C03A 1T6IA 2MWQA 2BC5A 4JJGA 4LDKA 3WG7C 1E84A 2OQMA 1HY5A 2CCYA 2GDCA 2R7RA 1NZEA 3NKDA 3H65A 2J9VA 5COFA 3UMHA 3LUTB 3JRTA 4YT8A 4UDVA 3RW0A 4NTAA 3ZC4A 1FNTc 1Q0GA 3LJBA 1RKEA 2KGOA 4MTGA 1CPQA 5JS5A 4JZAA 2LFFA 1E85A 3L1MA 1RCPA 2YLDA 3SP1A 4CX9A 4JIOA 3A11A 3JT1A 2L6GA 3JCUQ 3N24A 5L0GA 5K0IA 4GYTA 3W4YA 2OEVA 1O5HA 2VB6A 2BL2A 3ZQVA 2LK4A 3EGXB 2PFDA 3FOPA 3DZAA 3PMRA 2AU5A 1OW7A 4HFKB 4IB4A 4ZLDA 1Q0MA 2YWAA 3GANA 4XPYA 5TJ5E 2PBEA 2WB7A 2EPOA 3K1HA 4PACA 3CSKA 1T5OA 3DE9A 4FESA 4JEBA 3MYIA 2P7VA 2XLHA 2LIGA 1LIHA 2IXPA 4JC7A 2ZXWC 3N0TA 3E70C 2B0JA 3EQLF 2KW3C 3Q7GA 4PJLA 2XS8A 4XEFA 3RQGA 4LDQA 1GQAA 2IOQA 3VF0A 1M2OA 2XRHA 4CDYA 4CDAA 1MNEA 2IXNA 3NYMA 2ASRA 3B29A 3T4RA 1EQ1A 1SF8A 1H9GA 1LPEA 1LS1A 1OR2A 1ZHZA 5KYXA 2A68F 4XEKA 5A6BA 2P6VA 1VYIA 1TWAA 1G4US 4LACB 1OCZC 1WTYA 3K33A 3J06A 1BBHA 1S05A 1V4AA 4JW1A 3TJ5A 1EI7A 4F4BA 2XM4A 4DRIB 3LS0A 4D4NA 1JMWA 4DXWA 4BEJA 4IRUA 3K66A 3SYNA 3FXHA 2MHRA 3K6BA 3CQZA 4EIYA 4OIQF 3QW1A 3JYYA 4NCQA 1YLMA 5B3SC 4XTKA 5T1DB 3LAYA 5BQGA 3FAJA 4MW8A 2OOCA 1JAFA 1WASA 2AWYA 3HKKA 4LLCA 4YL1A 5KYYA 1H9TA 4O79A 4YJWA 1LI5A 1T6QA 2NUPA 3I4UA 4CS7A 2A69F 2CNWD 3WHNA 3JZ0A 2A0UA 3ZDLA 2R7XA 2WVQA 4DVYP 1D0ZA 2YZSA 2XL8A 1Z5ZA 2EIJC 2J9BA 3C18A 2C04A 1OR3A 4AX2A 1G5ZA 1LI7A 2XLVA 3B0PA 4W8KA 3ABMC 5KYUB 1N1CA 4E7ZA 1AUEA 1I4YA 1MMNA 1PD1A 1CGOA 4EBBA 4BG0A 3JTLO 1FMWA 2OCCC 1VLTA 1A7VA 3C8ZA 1V55C 2D5RB 2Y39A 3EFOB 1TWCA 2ZPAA 5DS4A 1T9KA 5A69A 4OIPF 2G3KA 1U0BB 3EH1A 3C63A 1K04A 1CGNA 5EGYA 2RSEB 2XLOA 1A0BA 3HNIA 4PFPA 3ZSUA 3M4BA 4IAQA 5L3VA 1PV3A 4MVOA 4EBKA 1O87A 3ABKC 3AJMA 3MFNA 1ZZPA 4KC9A 4YT5A 2EPMX 4CSAA 2WZFA 5DS5A 2M64A 2YVKA 4XWJA 5E3CA 1WN0A 3ASOC 4E17A 5B3IA 2CGEA 5A6AA 1W2WA 2KJGA 2BE5F 3AQCA 4XPXA 3BRJA 1VB5A 4LERA 4E0IA 5FCLA 1BR4A 2AWCA 4E7SA 2VCCA 1OCCC 2J7PD 2DI3A 5AC4A 3AG4C 2PP4A 2I15A 4N6HA 1MQVA 1H7IA 2JPUA 3NG1A 1LE2A 3K7DA 3AGUA 2LSEA 1HE9A 3M15A 2Q3TA 5CI9A 4DJ9A 3UNGC 4KNWA 3TD7A 4MVZA 1GGQA 4ULWA 2VC9A 2E87A 2Q9BA 1M2VA 3LEVA 2Q9CA 4GQHA 2J0XA 3W8HA 2W4MA 3KYJA 3LESA 2W45A 4CDVA 5BQHA 4G7OF 3RQEA 2XXAA 1EKYA 2R02A 1XWJA 4IARA 4J7TA 4AL1A 4RBNA 5L0JA 1LVKA 1ST6A 2XS1A 4HFFB 3RH3A 2EPLX 2YHSA 3GEHA 1NBBA 5L0HA 2QTVA 5KYYB 3RQFA 3DM5A 1CGME 1D0YA 1XZPA 4KNVA 1SYQA 3QVZA 3H2VA 4CSAC 1ORYA 3QZCA 3HTKC 3U2LA 4AE4A 3EH2A 5BUOA 3T6BA 1YARO 3KKBA 4PR9A 3EZHA 3U3BA 4I3MA 4P9FA 2J0WA 1UFBA 3TULA 2XLEA 3O10A 2Q4FA 2Y3GA 3SNHA 3V5ZA 4MTFA 1SZIA 2EIKC 3FOOA 2XL6A 4W8PA 4BJ5A 4Z9IA 1TKNA 4CS9A 1Z63A 5DVWA 3U9JA 4U5BE 2LFDA 3Q6NA 3GWNA 4P6IC 3B9QA 4PJNA 4MVSA 5E3AA 2H7OA 4O6YA 1RJ9B 1NU7D 3GM2A 1OXKA 3DXJF 2NSFA 4JTDB
chains in the Genus database with same CATH topology
2OKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OKU A; 
#chains in the Genus database with same CATH topology
 1E2X A;  4K0D A;  2P1A A;  2YRF A;  3IQT A;  4O6N A;  3G4Z A;  4K7B A;  4BJ6 A;  2HZ8 A;  4EWC A;  5DS6 A;  5DLJ A;  3KPH A;  4I44 A;  3EHM A;  2OJE D;  2VH3 A;  2P61 A;  1QQ3 A;  2QLA A;  1L3P A;  3O6X A;  2L81 A;  3UMI A;  1R5I D;  2RD9 A;  3IPM O;  3RFY A;  3SXK A;  2MYS A;  4ULV A;  5JSL A;  4WGY A;  5B1A C;  4U5C E;  2IXO A;  2FAP B;  3NYJ A;  3T6G B;  4FAP B;  5COM A;  2DYS C;  4BJT A;  3RIP A;  1FMV A;  5JT4 A;  4QDL A;  2Z15 A;  3U9M A;  3DAF A;  2HV7 A;  4N06 A;  2CDQ A;  3PCV A;  4CBE A;  4EKW A;  3POV A;  2G62 A;  3E9V A;  3O39 A;  1F1M A;  3GM1 A;  1VMA A;  1FAP B;  1HMO A;  1M2V B;  2HV6 A;  4CS9 C;  2R7V A;  3FMS A;  1SR2 A;  2KNH A;  5F5F A;  4L6R A;  1BR1 A;  4OIR F;  2XM0 A;  3LLI A;  4LLE A;  2ZD9 A;  2ICW G;  3RYL A;  2ETS A;  2EPK X;  3AOU A;  2HMZ A;  3GEE A;  4G78 A;  4XLN F;  4CJG A;  4DRH B;  2DB4 A;  4PK4 A;  3NMI A;  3DD7 A;  2PX3 A;  4BJ6 C;  1AEP A;  2CNW A;  2GAQ A;  1RKC A;  4DBQ A;  1RXQ A;  1L7C A;  3QW0 A;  2UUI A;  3EZI A;  4WGZ A;  256B A;  3NYL A;  1YJG A;  2J8W A;  1Z3I X;  2PF4 E;  4CIH A;  4NQF A;  3RVY A;  4MS2 A;  2R7U A;  3HNK A;  2YLG A;  1RKE B;  1LS4 A;  3U3F A;  4DRJ B;  3K1I A;  1WAT A;  1CPR A;  1ORS C;  2OJQ A;  4YL3 A;  3JRM O;  2UUH A;  1OCR C;  3DAG A;  4C3D A;  4E18 A;  3JSZ A;  3AGT A;  3VAY A;  2R7W A;  1D1A A;  4G7Z F;  2KQ9 A;  1AVO B;  1QZX A;  2Y3D A;  2YQY A;  2IBF A;  3C7J A;  4KBL A;  4YL0 A;  3GM3 A;  4CS8 A;  2Q00 A;  1U6H A;  3GEI A;  3C8G A;  3DWW A;  2IM8 A;  1GM5 A;  1B68 A;  1BR2 A;  2JX0 A;  4ER9 A;  2XSE A;  3AQB A;  3S84 A;  4OD4 A;  1Q0F A;  5E2Q A;  5BQI A;  3SEO A;  1PCX A;  4CJO A;  2ZXP A;  2WVN A;  4AL0 A;  1YDI A;  2NG1 A;  1S7Z A;  2LQG A;  3RKO F;  1V54 C;  2KK1 A;  4C7O A;  3IQ6 A;  2C03 A;  3TOL A;  4U5F E;  1JR8 A;  4XEV A;  3BEH A;  4XQ1 A;  1YYX A;  2DYR C;  3MYF A;  1ZYR F;  2CW0 F;  4BEM J;  5IY5 C;  1K40 A;  2AVK A;  3AG1 C;  4DBR A;  1C02 A;  4PJJ A;  2NUT A;  1TR2 A;  3V7O A;  3F47 A;  4AK9 A;  1IW7 F;  4C3E A;  2A6H F;  3KL4 A;  4U9E A;  1OQC A;  3TK0 A;  4ANJ A;  3U5S A;  5A6B D;  5KYN A;  4M63 A;  3S0X A;  2M4E A;  4A2N B;  2HUJ A;  4G0H A;  1HW1 A;  1M57 C;  4R32 A;  2R9R B;  3NRH A;  1BZ4 A;  2P0N A;  2YL0 A;  4CS8 C;  3B0V C;  5EK0 A;  5L3Q A;  2Q9A A;  3JYH A;  4Q7C A;  5KYX B;  4YN0 B;  5HV9 A;  3B0U X;  3G4X A;  3OWT A;  3RF3 A;  4EHP A;  1NU9 C;  1Z23 A;  2IXM A;  3NMK A;  3S9O A;  3ZVR A;  2R7T A;  1Z6A A;  1NFN A;  2A1D D;  2GFH A;  3M4C A;  2HMQ A;  1OXB A;  3T6J A;  4JCH A;  4YWQ A;  3PDM P;  5GPG B;  5DQZ A;  1ORJ A;  1LM3 B;  2R7Q A;  3NMJ A;  4WJ0 A;  3US6 A;  1D1B A;  2LP4 A;  1JOG A;  2HJ3 A;  2IYL D;  1QLE C;  4QI2 A;  1J8M F;  4N6C A;  1HW2 A;  4NY3 A;  4DVZ A;  4BJ1 A;  1Q0K A;  3LS1 A;  4I1O B;  2PX0 A;  4JVS A;  5E33 A;  4A4A A;  2NUP B;  2L7A A;  1Q0D A;  3I5Q A;  3QTH A;  3JSE O;  4YK5 A;  3SXM A;  3ZTZ A;  3C8G B;  4NC3 A;  3EGD A;  5F28 E;  1VLS A;  5A6J A;  1U89 A;  3ASN C;  1YA7 O;  4EUK B;  1LKX A;  3HNJ A;  3QMK A;  3S27 A;  5COG A;  4J7Y A;  3C62 A;  4DOZ A;  2HSB A;  3L8J A;  4PJM A;  4WAB A;  3L8I A;  3GWL A;  3X1O A;  5EHH A;  1E86 A;  4EBJ A;  1TWG A;  2QNL A;  2OU6 A;  1RMV A;  5T3W A;  4C7O B;  1OKK D;  1A7E A;  3TJ6 A;  1T01 A;  2R03 A;  3S29 A;  2EPN A;  1KU2 A;  2PNO A;  1YA9 A;  2OKU A;  1YZC A;  3L34 A;  4JE9 A;  1H6G A;  1MMD A;  2LCH A;  1QPU A;  4IAO A;  4U5E E;  5D91 A;  3ITF A;  3HLZ A;  1HE1 A;  3V5Y A;  5KYW A;  1BDJ B;  1JRA A;  1Y4C A;  1ZU4 A;  5JLI A;  4MVR A;  4I1M A;  3IQ5 A;  2EIL C;  2EIN C;  1I4Z A;  3FHD A;  1D0X A;  1TWH A;  2A6E F;  4JKV A;  3I5P A;  1MMA A;  3ZIB A;  1NLX A;  5T3T A;  1EA8 A;  2QE9 A;  3ABL C;  2J9W A;  2R7O A;  4NTF A;  1PD0 A;  2YL3 A;  3R7C A;  3ECS A;  3VRC A;  5AC5 A;  1C17 M;  5CI8 A;  1NG1 A;  4YT4 A;  1M6T A;  1K05 A;  3T9O A;  3W8I A;  2J45 A;  2NPU A;  4IJJ A;  5JVE A;  4XLP F;  1DOW A;  2YLI A;  2OEX A;  2XL4 A;  3KH2 A;  3M79 A;  3DKA A;  2HJM A;  3ZQY A;  4BJ5 C;  2HSQ A;  2H7V C;  1YVI A;  1FR0 A;  2CYD A;  3HNL A;  4X0R A;  3G50 A;  2XXA B;  5L0D A;  2H7B A;  3DJU B;  2FFH A;  5KYU A;  1ZHY A;  2HFI A;  1WWP A;  4HE8 D;  3CAX A;  1Z7Q c;  2W4B A;  4D4X A;  1ZU5 A;  2Q7R A;  1Y6D A;  1A41 A;  4K1O A;  2R7S A;  3GOR A;  2NSG A;  4JRZ A;  1QKR A;  2WL8 A;  3HJC A;  2W9Y A;  3EJN A;  3ZTM A;  4RDA A;  2WZL A;  2ZXO A;  2XLW A;  3EFO A;  3EGD B;  2ZXR A;  4J30 B;  3L0I A;  4LDR A;  3IEE A;  3W2W A;  3ZG1 A;  4AE4 B;  4P9T A;  5F5H A;  4Q5S F;  3N2Z B;  2V26 A;  4XPW A;  1KTM A;  1VOM A;  3Q7L A;  5HSW A;  3SZR A;  2DGJ A;  3RVZ A;  4JTC B;  1IZM A;  2YL1 A;  5A6K A;  1APC A;  2KC3 A;  2I8B A;  4U5G A;  4YT2 A;  4MQ9 F;  1R4T A;  3NDB B;  2YEV A;  3EG9 A;  1JPJ A;  3GOD A;  1TFK B;  3WOD F;  3DM9 B;  2Y69 C;  1TQG A;  5DQT A;  3CZ6 A;  3MLG A;  1SMY F;  3FVY A;  1VK5 A;  2A0B A;  2VCA A;  3LNR A;  4MVM A;  4U5D E;  2KYH A;  4HEA J;  4ZLC A;  1VYK A;  3OA1 A;  1OW6 A;  2OG2 A;  3VM6 A;  2H8A A;  3WAQ A;  5KYW B;  1WGW A;  3U2M A;  4C3B A;  3DMD A;  3Q6M A;  1D1C A;  1UG7 A;  3B71 A;  3LLK A;  2LD6 A;  3IQC A;  4FWV A;  3DI5 A;  2TMV P;  2V3C C;  3M1C B;  1M56 C;  1FFH A;  1ZHT A;  2D4U A;  3U0C A;  2GWW A;  4ONS A;  3SXY A;  5FZT A;  3H2U A;  5L0F A;  2J7P A;  3MX3 A;  2HS5 A;  4MTO A;  3AG3 C;  4QI0 A;  3VYW A;  1TFO B;  4MVU A;  3X2Q C;  1NSG B;  3UMK A;  2R05 A;  4O7G A;  3V5X A;  3R2P A;  2KSF A;  3DE8 A;  4PFO A;  1G4W R;  1ZHW A;  3A9C A;  1GS9 A;  4E0H A;  3PHF 2;  2WZG A;  2XLM A;  3K1I C;  4IGG A;  2F22 A;  1YZA A;  1I5N A;  1YYJ A;  2EIM C;  2VCB A;  5AGF A;  2J46 A;  1YAU O;  2J9U A;  1FFT C;  2YKZ A;  4N4W A;  2L6F A;  4JEA A;  4RD9 A;  1QVX A;  3O55 A;  1G8X A;  3ATP A;  4BPM A;  1OW8 A;  4Q4Z F;  3UGO A;  1WOL A;  1O3U A;  1FTS A;  3W2V A;  5B1B C;  2X51 A;  1RJ9 A;  3CEX A;  3U8V A;  3S28 A;  2FGY A;  2JD3 A;  4Z9H A;  4IWB A;  1E83 A;  2Y3H A;  3C8G D;  3ZWI A;  2XLD A;  1ZW2 A;  1KNY A;  3KYI A;  1HMD A;  4GEH A;  3AG2 C;  2G3V A;  1J8Y F;  2YL7 A;  3IHU A;  4H54 A;  4NTB A;  3UR3 C;  4B6I A;  1OKK A;  3EG9 B;  5JRA A;  2Y3B A;  3EGX A;  1MMG A;  4FX5 A;  2O9X A;  4U5H A;  5CIV A;  2L6H A;  4OD5 A;  1VTM P;  4U9D A;  1ZVZ A;  3TOM A;  1NFO A;  1XZQ A;  1DOV A;  3NKE A;  1MND A;  4MVQ A;  2QY9 A;  2VAS A;  4O6M A;  3LEO A;  2R25 A;  1T6U A;  3UGP A;  5L0I A;  3F46 A;  2B0H A;  1JPN A;  3TQO A;  3LNM B;  3SXZ A;  1ZHX A;  1OCO C;  4OIO F;  4KI2 A;  1QSP A;  3KMI A;  4J32 B;  2X0C A;  3OEO A;  2GA0 A;  4MND A;  4Z9J A;  5JUA A;  3EHN A;  2AP3 A;  1V74 B;  4JUR I;  4G7H F;  4JJF A;  1LE4 A;  3DJN B;  3FAP B;  4MW3 A;  5JP7 A;  2QUP A;  3MBG A;  4JTA B;  4OIN F;  3S90 A;  5D92 A;  3FDQ A;  1A7D A;  1ZW3 A;  2HKV A;  3QVY A;  4JCZ A;  3U8P A;  4H4K C;  5L0C A;  2WVO A;  2NUT B;  2L9J A;  3EPV A;  4CIP A;  1C03 A;  1T6I A;  2MWQ A;  2BC5 A;  4JJG A;  4LDK A;  3WG7 C;  1E84 A;  2OQM A;  1HY5 A;  2CCY A;  2GDC A;  2R7R A;  1NZE A;  3NKD A;  3H65 A;  2J9V A;  5COF A;  3UMH A;  3LUT B;  3JRT A;  4YT8 A;  4UDV A;  3RW0 A;  4NTA A;  3ZC4 A;  1FNT c;  1Q0G A;  3LJB A;  1RKE A;  2KGO A;  4MTG A;  1CPQ A;  5JS5 A;  4JZA A;  2LFF A;  1E85 A;  3L1M A;  1RCP A;  2YLD A;  3SP1 A;  4CX9 A;  4JIO A;  3A11 A;  3JT1 A;  2L6G A;  3JCU Q;  3N24 A;  5L0G A;  5K0I A;  4GYT A;  3W4Y A;  2OEV A;  1O5H A;  2VB6 A;  2BL2 A;  3ZQV A;  2LK4 A;  3EGX B;  2PFD A;  3FOP A;  3DZA A;  3PMR A;  2AU5 A;  1OW7 A;  4HFK B;  4IB4 A;  4ZLD A;  1Q0M A;  2YWA A;  3GAN A;  4XPY A;  5TJ5 E;  2PBE A;  2WB7 A;  2EPO A;  3K1H A;  4PAC A;  3CSK A;  1T5O A;  3DE9 A;  4FES A;  4JEB A;  3MYI A;  2P7V A;  2XLH A;  2LIG A;  1LIH A;  2IXP A;  4JC7 A;  2ZXW C;  3N0T A;  3E70 C;  2B0J A;  3EQL F;  2KW3 C;  3Q7G A;  4PJL A;  2XS8 A;  4XEF A;  3RQG A;  4LDQ A;  1GQA A;  2IOQ A;  3VF0 A;  1M2O A;  2XRH A;  4CDY A;  4CDA A;  1MNE A;  2IXN A;  3NYM A;  2ASR A;  3B29 A;  3T4R A;  1EQ1 A;  1SF8 A;  1H9G A;  1LPE A;  1LS1 A;  1OR2 A;  1ZHZ A;  5KYX A;  2A68 F;  4XEK A;  5A6B A;  2P6V A;  1VYI A;  1TWA A;  1G4U S;  4LAC B;  1OCZ C;  1WTY A;  3K33 A;  3J06 A;  1BBH A;  1S05 A;  1V4A A;  4JW1 A;  3TJ5 A;  1EI7 A;  4F4B A;  2XM4 A;  4DRI B;  3LS0 A;  4D4N A;  1JMW A;  4DXW A;  4BEJ A;  4IRU A;  3K66 A;  3SYN A;  3FXH A;  2MHR A;  3K6B A;  3CQZ A;  4EIY A;  4OIQ F;  3QW1 A;  3JYY A;  4NCQ A;  1YLM A;  5B3S C;  4XTK A;  5T1D B;  3LAY A;  5BQG A;  3FAJ A;  4MW8 A;  2OOC A;  1JAF A;  1WAS A;  2AWY A;  3HKK A;  4LLC A;  4YL1 A;  5KYY A;  1H9T A;  4O79 A;  4YJW A;  1LI5 A;  1T6Q A;  2NUP A;  3I4U A;  4CS7 A;  2A69 F;  2CNW D;  3WHN A;  3JZ0 A;  2A0U A;  3ZDL A;  2R7X A;  2WVQ A;  4DVY P;  1D0Z A;  2YZS A;  2XL8 A;  1Z5Z A;  2EIJ C;  2J9B A;  3C18 A;  2C04 A;  1OR3 A;  4AX2 A;  1G5Z A;  1LI7 A;  2XLV A;  3B0P A;  4W8K A;  3ABM C;  5KYU B;  1N1C A;  4E7Z A;  1AUE A;  1I4Y A;  1MMN A;  1PD1 A;  1CGO A;  4EBB A;  4BG0 A;  3JTL O;  1FMW A;  2OCC C;  1VLT A;  1A7V A;  3C8Z A;  1V55 C;  2D5R B;  2Y39 A;  3EFO B;  1TWC A;  2ZPA A;  5DS4 A;  1T9K A;  5A69 A;  4OIP F;  2G3K A;  1U0B B;  3EH1 A;  3C63 A;  1K04 A;  1CGN A;  5EGY A;  2RSE B;  2XLO A;  1A0B A;  3HNI A;  4PFP A;  3ZSU A;  3M4B A;  4IAQ A;  5L3V A;  1PV3 A;  4MVO A;  4EBK A;  1O87 A;  3ABK C;  3AJM A;  3MFN A;  1ZZP A;  4KC9 A;  4YT5 A;  2EPM X;  4CSA A;  2WZF A;  5DS5 A;  2M64 A;  2YVK A;  4XWJ A;  5E3C A;  1WN0 A;  3ASO C;  4E17 A;  5B3I A;  2CGE A;  5A6A A;  1W2W A;  2KJG A;  2BE5 F;  3AQC A;  4XPX A;  3BRJ A;  1VB5 A;  4LER A;  4E0I A;  5FCL A;  1BR4 A;  2AWC A;  4E7S A;  2VCC A;  1OCC C;  2J7P D;  2DI3 A;  5AC4 A;  3AG4 C;  2PP4 A;  2I15 A;  4N6H A;  1MQV A;  1H7I A;  2JPU A;  3NG1 A;  1LE2 A;  3K7D A;  3AGU A;  2LSE A;  1HE9 A;  3M15 A;  2Q3T A;  5CI9 A;  4DJ9 A;  3UNG C;  4KNW A;  3TD7 A;  4MVZ A;  1GGQ A;  4ULW A;  2VC9 A;  2E87 A;  2Q9B A;  1M2V A;  3LEV A;  2Q9C A;  4GQH A;  2J0X A;  3W8H A;  2W4M A;  3KYJ A;  3LES A;  2W45 A;  4CDV A;  5BQH A;  4G7O F;  3RQE A;  2XXA A;  1EKY A;  2R02 A;  1XWJ A;  4IAR A;  4J7T A;  4AL1 A;  4RBN A;  5L0J A;  1LVK A;  1ST6 A;  2XS1 A;  4HFF B;  3RH3 A;  2EPL X;  2YHS A;  3GEH A;  1NBB A;  5L0H A;  2QTV A;  5KYY B;  3RQF A;  3DM5 A;  1CGM E;  1D0Y A;  1XZP A;  4KNV A;  1SYQ A;  3QVZ A;  3H2V A;  4CSA C;  1ORY A;  3QZC A;  3HTK C;  3U2L A;  4AE4 A;  3EH2 A;  5BUO A;  3T6B A;  1YAR O;  3KKB A;  4PR9 A;  3EZH A;  3U3B A;  4I3M A;  4P9F A;  2J0W A;  1UFB A;  3TUL A;  2XLE A;  3O10 A;  2Q4F A;  2Y3G A;  3SNH A;  3V5Z A;  4MTF A;  1SZI A;  2EIK C;  3FOO A;  2XL6 A;  4W8P A;  4BJ5 A;  4Z9I A;  1TKN A;  4CS9 A;  1Z63 A;  5DVW A;  3U9J A;  4U5B E;  2LFD A;  3Q6N A;  3GWN A;  4P6I C;  3B9Q A;  4PJN A;  4MVS A;  5E3A A;  2H7O A;  4O6Y A;  1RJ9 B;  1NU7 D;  3GM2 A;  1OXK A;  3DXJ F;  2NSF A;  4JTD B; 
#chains in the Genus database with same CATH homology
 2OKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...