2OKUA

The crystal structure of the acyl-coa dehydrogenase family protein from porphyromonas gingivalis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
122
structure length
122
Chain Sequence
QVVAAIRHITTGTYIARIREEYQQTEVKPELQPMKEALARMTDRAEALIAFVTEQKDQELLDFQARRLVEMTAHAVFGHLLMLAANDDDSFRQSAEVYLRYGQAEQEKIDSYVRAFRPEELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of the acyl-CoA dehydrogenase family protein from Porphyromonas gingivalis
rcsb
source organism Porphyromonas gingivalis
molecule tags Oxidoreductase
molecule keywords Acyl-CoA dehydrogenase family protein
total genus 46
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12186 AcylCoA_dehyd_C Acyl-CoA dehydrogenase C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.470 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Acyl-CoA dehydrogenase, C-terminal domain 2okuA00
2OKUA
chains in the Genus database with same CATH superfamily
3AQCA 4IAOA 2GFHA 5E3AA 4I1OB 3EG9B 4JKVA 1O5HA 3BEHA 1LPEA 2VCBA 2YKZA 2Y3GA 3S28A 1Y4CA 4EKWA 2GWWA 1B68A 3JYYA 3U0CA 5T3TA 2EPNA 1KTMA 5L0IA 3KMIA 3LLKA 1NU7D 3MLGA 3QVZA 5COMA 1O87A 3ABKC 5D92A 3W2WA 2ZXWC 3WODF 4BJ6C 2KSFA 2NSGA 2Y39A 3B29A 4KBLA 3RF3A 4P6IC 2HJMA 4CJOA 4XLPF 3JZ0A 4OD5A 2DYSC 3M15A 1ZU5A 1VMAA 3G4XA 2W45A 4JW1A 2J9BA 2Q4FA 2D4UA 4H4KC 3RVZA 1TR2A 2QUPA 4E18A 3T6GB 1H9TA 1RJ9A 1PD0A 1T6IA 1OXBA 3LS0A 3NKEA 3NMIA 2M4EA 3TJ6A 1YDIA 3I4UA 4PFPA 1A41A 2D5RB 3VF0A 4MNDA 3CAXA 3C8GD 2TMVP 4IARA 1BR1A 2OEVA 3L1MA 1M2OA 1A7DA 2IOQA 2OJQA 2YL0A 1VB5A 5T3WA 2ICWG 3EG9A 2ASRA 3K1IC 2KQ9A 2L6HA 4G78A 1TFKB 1Q0FA 4CS9C 1C02A 1OCZC 4YWQA 2YLGA 5BQIA 2HS5A 2LFFA 3EGXB 4CS7A 5KYXA 2R7UA 1MMAA 3F46A 2QE9A 2B0JA 4MQ9F 1RKEB 3FVYA 1Q0MA 2MHRA 3ATPA 3M4BA 2XRHA 2ZXRA 4JEBA 4EIYA 2R7WA 4C3EA 4Q7CA 4A4AA 3M1CB 2NSFA 4AE4B 4OIPF 2L7AA 1C17M 1KNYA 1YARO 1YZAA 3QTHA 4O79A 3SEOA 5AC4A 2GAQA 1NBBA 3N0TA 4YK5A 2YRFA 4BJ5A 4U5BE 4A2NB 2QY9A 1Z6AA 4CDYA 4FAPB 3TULA 1D0ZA 1Q0GA 4K7BA 1MMGA 3DKAA 5E2QA 1MNDA 3EZHA 4BJ1A 1Z7Qc 5B1AC 5HSWA 3DJUB 5DS5A 2R7VA 2H7BA 1T9KA 2OCCC 4BJTA 3SNHA 4QI0A 1ORYA 2XLEA 1G4WR 2ZXOA 3C7JA 3O10A 3RQGA 3ZTZA 4B6IA 1F1MA 2XSEA 1ZHTA 2YL7A 3DZAA 4GEHA 2FAPB 3UGOA 1TWCA 2EPLX 2XL6A 2HMQA 3RW0A 4XLNF 2A0BA 1RXQA 3SXYA 4Z9HA 5COFA 4LLCA 2HMZA 3H2VA 3LEOA 1V55C 3M4CA 3Q6MA 4U5FE 4JE9A 3V5XA 4ANJA 1APCA 4WGZA 3E9VA 1LS4A 4PJJA 1UFBA 3OEOA 3IHUA 1R5ID 1JOGA 3SP1A 3MFNA 3L8JA 3GODA 3X1OA 3GM3A 1YA7O 2XLDA 4Q4ZF 4EHPA 1J8MF 3WG7C 1VK5A 2PX3A 1IZMA 1T01A 1TKNA 1ZYRF 1NFOA 5F5HA 4KI2A 2OU6A 3SZRA 4JEAA 4K0DA 4N4WA 3V5YA 1WTYA 4W8KA 1U89A 4O7GA 3L34A 3K66A 3O55A 4U5HA 5CIVA 1FNTc 3TOMA 1OCOC 5L3QA 4IWBA 4X0RA 2XLMA 2XL8A 1VLSA 3DD7A 4W8PA 3G4ZA 2GA0A 2LSEA 3NG1A 3LUTB 3GEIA 3L8IA 4JZAA 2QNLA 3B9QA 3POVA 3HNJA 4JTAB 1T6UA 2A69F 4U5DE 1SR2A 3K1IA 4BG0A 4E17A 2O9XA 3B0VC 2H8AA 3EQLF 3T9OA 4YL0A 4DOZA 2AU5A 4MW8A 2EIMC 4XPWA 3GANA 3RKOF 3JYHA 2J7PA 3HLZA 3WHNA 2A0UA 3HKKA 4MVQA 5BUOA 1NG1A 4YT2A 4G0HA 2MYSA 4OIRF 2NUTA 4AL0A 5DLJA 4JJGA 3RFYA 4ZLCA 1I4YA 1QLEC 3EGDA 2KYHA 2NUPB 2F22A 4PACA 3LESA 1M6TA 2J9WA 3EHNA 2YL1A 2CDQA 3DMDA 4JTCB 3QZCA 3ZQVA 2HUJA 2H7OA 4JCZA 3ZWIA 5A6JA 1A7EA 1YAUO 5KYUA 5EGYA 3LJBA 2OJED 1LS1A 2DYRC 3EFOA 1ZZPA 2MWQA 2EILC 4ONSA 2KNHA 1FTSA 2Y3BA 2P6VA 3O39A 3ZVRA 2UUIA 4BEMJ 3S84A 2YWAA 1K04A 2HFIA 3AOUA 2A1DD 2XM4A 4CIPA 3QW1A 3DXJF 1GQAA 1L7CA 1PCXA 4CDAA 4D4XA 1E83A 3G50A 5E33A 2C03A 4MS2A 3T4RA 5IY5C 4YL1A 2FGYA 2QTVA 2P1AA 1CPRA 2YEVA 4XPYA 2LFDA 2W4MA 4U9EA 2IBFA 1D0YA 1ORJA 4XEFA 3CEXA 1YVIA 4MW3A 4MVRA 4OIQF 2WZGA 2V26A 3DAFA 4BJ5C 1NSGB 1OW7A 4AE4A 4CS8C 3B71A 4I44A 2UUHA 5A6BD 5KYNA 1GS9A 3MBGA 1QSPA 1K40A 4MVUA 256BA 1YLMA 3L0IA 5L0JA 4WGYA 1WASA 1OXKA 4MTOA 2HV6A 3FHDA 4YT5A 5A69A 3AGUA 5KYXB 4HFFB 1Z63A 2XS8A 3GWNA 2LD6A 3M79A 3GEHA 4WABA 3AG3C 4K1OA 1QKRA 3JTLO 2HV7A 4KNVA 5HV9A 3UMKA 4NC3A 1EKYA 2WZFA 4XPXA 3TJ5A 2EPMX 1KU2A 3DM5A 2R03A 3DE9A 3ZG1A 1LKXA 2Q00A 2EINC 2B0HA 2IXNA 4YL3A 3U9JA 3IEEA 4FWVA 3FOOA 4JVSA 1M2VB 4JC7A 5A6KA 3V7OA 1E85A 4HFKB 1UG7A 2KW3C 3U2MA 1VTMP 2G3KA 1LI7A 2YVKA 4R32A 3CZ6A 1Q0KA 3JT1A 3PCVA 4U5GA 1VYIA 4LACB 2EIJC 1NLXA 3HTKC 4IAQA 4G7OF 4CDVA 4DRIB 5L0FA 3RVYA 1AVOB 1U6HA 5KYUB 3ZTMA 3IQ5A 1WATA 3DI5A 1RCPA 1XZPA 4N6CA 1E2XA 1RJ9B 3EPVA 1Z5ZA 2LK4A 5D91A 3RYLA 3NMJA 1MMNA 3CSKA 3U9MA 5KYWA 1YYJA 2P0NA 2X51A 3KYIA 4E0HA 3UNGC 1OKKD 2L6GA 4I1MA 3ITFA 1PD1A 4XQ1A 2R7TA 3DE8A 1MQVA 1K05A 2J8WA 4HEAJ 4H54A 4KC9A 3UMHA 2XLOA 3N24A 4PJMA 3ABMC 3U5SA 2PF4E 4EBKA 4DJ9A 2YZSA 3E70C 3SXZA 3U8PA 3KPHA 1QPUA 3NYLA 2M64A 3K6BA 3W2VA 4M63A 4RDAA 3U3BA 3EH2A 3NKDA 4O6NA 4DBQA 5B1BC 5BQHA 2IXPA 4C3BA 4G7ZF 4G7HF 4JCHA 5AC5A 3RQFA 2XL4A 1WWPA 2AWYA 1CPQA 5KYYA 4C7OB 3AJMA 4CSAC 1CGNA 1OR2A 1JRAA 1Q0DA 2WL8A 3IQ6A 4YT4A 1JPNA 1QVXA 2PBEA 4NTBA 1Z3IX 2YL3A 1ZW3A 4XEKA 2OKUA 1N1CA 1NZEA 3S0XA 4IGGA 3U2LA 4EUKB 1TWAA 2CW0F 2Q9CA 3FOPA 2VH3A 3RH3A 4EBJA 5GPGB 1HY5A 3QMKA 2P7VA 1CGOA 2ETSA 3GORA 1ZVZA 1JPJA 4CIHA 2R7RA 1J8YF 1S7ZA 4CSAA 1BDJB 3OA1A 4GQHA 3JCUQ 2R05A 4PJNA 4XEVA 1L3PA 2HKVA 2VASA 3HNKA 1BR4A 2HZ8A 3Q7GA 5B3SC 2AVKA 4JURI 4IB4A 4JTDB 3ZC4A 5JT4A 2XXAA 1MNEA 3TOLA 4D4NA 4DVZA 2I15A 2R7SA 2KC3A 2YLDA 4EBBA 2KJGA 5DS6A 2EPKX 2WVNA 2C04A 5BQGA 3R7CA 2JPUA 2L81A 2J0WA 2XS1A 2WVQA 3SXKA 2EIKC 3GM2A 3UGPA 1RKEA 2A6EF 3EFOB 1TWHA 3HNLA 3TD7A 3W4YA 1FFHA 1H7IA 4PR9A 2ZD9A 3IPMO 4OD4A 4NY3A 2Q3TA 1FMWA 3Q6NA 5CI8A 1BBHA 1OKKA 1W2WA 2A6HF 1OW8A 1D1AA 2DGJA 2A68F 1WGWA 1LE2A 1EA8A 2H7VC 3NRHA 4CS9A 4DRHB 5DS4A 2R7QA 1VOMA 5FZTA 4O6MA 1M2VA 3C62A 5DVWA 1YZCA 1HW2A 2G3VA 4AL1A 4DRJB 5L0GA 3QW0A 3MYIA 4U9DA 4CJGA 1NU9C 3N2ZB 2XXAB 2DB4A 2R7OA 5COGA 2LP4A 1JR8A 3PMRA 2VB6A 3EH1A 3F47A 4RBNA 2HJ3A 4XTKA 5JSLA 3S9OA 4DBRA 3J06A 3LEVA 1HE1A 5JUAA 2DI3A 1C03A 4HE8D 2IXOA 1WN0A 3KH2A 1BZ4A 1JMWA 4LLEA 1LM3B 4MVOA 3O6XA 4CBEA 4LDQA 4RD9A 2PX0A 4J7YA 5L0CA 5A6BA 1OW6A 4GYTA 2CNWA 1E86A 2NG1A 3EGXA 2GDCA 3HNIA 3JSEO 4E0IA 1LVKA 2BE5F 3EGDB 1HMDA 4LDRA 2XM0A 5DQZA 2W4BA 2VCCA 3US6A 3DJNB 4F4BA 1V74B 3LLIA 3S29A 3VRCA 1A7VA 3NYJA 3CQZA 1T6QA 3W8IA 1I5NA 1VYKA 3LS1A 3QVYA 2Q7RA 3ZSUA 1U0BB 2JD3A 2RSEB 1RKCA 3JRMO 2Y3HA 5EK0A 4U5EE 4U5CE 3H65A 4MVMA 4IJJA 3AG4C 5JP7A 3FXHA 4LERA 3NYMA 3W8HA 4AK9A 4YJWA 4OINF 5JRAA 4ZLDA 4PK4A 3OWTA 4ULWA 5T1DB 2Z15A 2J9UA 3RQEA 1FFTC 1E84A 1LIHA 1JAFA 3AG2C 1EI7A 3PHF2 1OCRC 3T6BA 5A6AA 1OR3A 3JRTA 4CX9A 4I3MA 1M57C 1ZHYA 2OEXA 3DWWA 1NFNA 3MX3A 3NDBB 2CNWD 3VAYA 2EPOA 1Y6DA 3ZQYA 1ST6A 3Q7LA 5DQTA 3UMIA 1RMVA 5JLIA 4DXWA 2XLWA 2CCYA 3C8GB 2KK1A 3GEEA 3C18A 1V54C 3EZIA 3NMKA 4KNWA 3LNRA 1GGQA 5L0DA 1ZHXA 3V5ZA 1HW1A 3T6JA 3DM9B 4Z9JA 3TQOA 1EQ1A 4PFOA 2NPUA 1Z23A 4JJFA 4N06A 2J9VA 3I5PA 1D0XA 3SXMA 4DVYP 2RD9A 3GWLA 4J32B 1A0BA 1BR2A 4BJ6A 5F5FA 1XZQA 1H9GA 1GM5A 3BRJA 4FESA 2JX0A 1HMOA 2ZXPA 4BPMA 1CGME 3EHMA 2BC5A 1V4AA 4YN0B 2CYDA 4WJ0A 3S27A 1ZHWA 1ORSC 4QDLA 4ULVA 1DOWA 4AX2A 4E7ZA 1S05A 4JIOA 2Q9AA 5L3VA 2PNOA 2IM8A 3B0UX 3FAPB 2LCHA 5E3CA 1QQ3A 4CS8A 2G62A 3RIPA 1DOVA 2R7XA 3WAQA 4J30B 2NUTB 3ASNC 3C63A 1R4TA 1SMYF 2LIGA 3VYWA 2J7PD 1LE4A 2HSQA 2I8BA 2IXMA 1SYQA 1TWGA 3K1HA 4MTFA 1ZW2A 4Q5SF 1G8XA 2YHSA 3A9CA 5TJ5E 1SZIA 2AP3A 1YYXA 2OQMA 3AGTA 2WB7A 3GM1A 5B3IA 3I5QA 2PP4A 2L6FA 2Q9BA 2YQYA 3X2QC 2FFHA 1I4ZA 1D1BA 5KYYB 4C7OA 2L9JA 4E7SA 3H2UA 1D1CA 3PDMP 3KL4A 1LI5A 4MTGA 2J0XA 4EWCA 3A11A 1VLTA 1TFOB 1YJGA 5FCLA 2CGEA 3ASOC 3R2PA 4C3DA 2Y69C 1G4US 4P9TA 2P61A 3HJCA 3TK0A 5CI9A 3KYJA 1FAPB 2VC9A 3UR3C 2ZPAA 5F28E 5AGFA 4NTAA 4MVSA 1IW7F 4QI2A 3AQBA 2WZLA 1PV3A 5L0HA 1YA9A 4J7TA 4JRZA 3ABLC 3JSZA 3FDQA 2WVOA 2HSBA 3AG1C 3IQCA 4UDVA 2PFDA 4OIOF 3U3FA 4NTFA 3C8ZA 3DAGA 3EJNA 2KGOA 1WOLA 2J45A 3K7DA 3LNMB 4NQFA 2R25A 1T5OA 2XLHA 3VM6A 2BL2A 4LDKA 1XWJA 2J46A 4PJLA 3ZIBA 1G5ZA 3MYFA 3U8VA 3S90A 4Z9IA 1AEPA 2QLAA 2NUPA 5EHHA 2R02A 3SYNA 1HE9A 2AWCA 2IYLD 1FR0A 3ECSA 2X0CA 2Y3DA 1AUEA 2OG2A 4IRUA 3KKBA 1QZXA 3IQTA 4FX5A 2W9YA 4L6RA 2E87A 3FMSA 4P9FA 4YT8A 4XWJA 5K0IA 4NCQA 3ZDLA 1TQGA 5KYWB 2YLIA 3LAYA 2VCAA 2R9RB 4O6YA 1MMDA 1O3UA 3K33A 1H6GA 1M56C 4N6HA 5JVEA 3B0PA 3FAJA 1OCCC 4MVZA 1ZU4A 1SF8A 2OOCA 1ZHZA 5JS5A 3C8GA 4BEJA 2V3CC 1OQCA 2XLVA 4ER9A 1FMVA 2LQGA
chains in the Genus database with same CATH topology
2OKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OKU A; 
#chains in the Genus database with same CATH topology
 3AQC A;  4IAO A;  2GFH A;  5E3A A;  4I1O B;  3EG9 B;  4JKV A;  1O5H A;  3BEH A;  1LPE A;  2VCB A;  2YKZ A;  2Y3G A;  3S28 A;  1Y4C A;  4EKW A;  2GWW A;  1B68 A;  3JYY A;  3U0C A;  5T3T A;  2EPN A;  1KTM A;  5L0I A;  3KMI A;  3LLK A;  1NU7 D;  3MLG A;  3QVZ A;  5COM A;  1O87 A;  3ABK C;  5D92 A;  3W2W A;  2ZXW C;  3WOD F;  4BJ6 C;  2KSF A;  2NSG A;  2Y39 A;  3B29 A;  4KBL A;  3RF3 A;  4P6I C;  2HJM A;  4CJO A;  4XLP F;  3JZ0 A;  4OD5 A;  2DYS C;  3M15 A;  1ZU5 A;  1VMA A;  3G4X A;  2W45 A;  4JW1 A;  2J9B A;  2Q4F A;  2D4U A;  4H4K C;  3RVZ A;  1TR2 A;  2QUP A;  4E18 A;  3T6G B;  1H9T A;  1RJ9 A;  1PD0 A;  1T6I A;  1OXB A;  3LS0 A;  3NKE A;  3NMI A;  2M4E A;  3TJ6 A;  1YDI A;  3I4U A;  4PFP A;  1A41 A;  2D5R B;  3VF0 A;  4MND A;  3CAX A;  3C8G D;  2TMV P;  4IAR A;  1BR1 A;  2OEV A;  3L1M A;  1M2O A;  1A7D A;  2IOQ A;  2OJQ A;  2YL0 A;  1VB5 A;  5T3W A;  2ICW G;  3EG9 A;  2ASR A;  3K1I C;  2KQ9 A;  2L6H A;  4G78 A;  1TFK B;  1Q0F A;  4CS9 C;  1C02 A;  1OCZ C;  4YWQ A;  2YLG A;  5BQI A;  2HS5 A;  2LFF A;  3EGX B;  4CS7 A;  5KYX A;  2R7U A;  1MMA A;  3F46 A;  2QE9 A;  2B0J A;  4MQ9 F;  1RKE B;  3FVY A;  1Q0M A;  2MHR A;  3ATP A;  3M4B A;  2XRH A;  2ZXR A;  4JEB A;  4EIY A;  2R7W A;  4C3E A;  4Q7C A;  4A4A A;  3M1C B;  2NSF A;  4AE4 B;  4OIP F;  2L7A A;  1C17 M;  1KNY A;  1YAR O;  1YZA A;  3QTH A;  4O79 A;  3SEO A;  5AC4 A;  2GAQ A;  1NBB A;  3N0T A;  4YK5 A;  2YRF A;  4BJ5 A;  4U5B E;  4A2N B;  2QY9 A;  1Z6A A;  4CDY A;  4FAP B;  3TUL A;  1D0Z A;  1Q0G A;  4K7B A;  1MMG A;  3DKA A;  5E2Q A;  1MND A;  3EZH A;  4BJ1 A;  1Z7Q c;  5B1A C;  5HSW A;  3DJU B;  5DS5 A;  2R7V A;  2H7B A;  1T9K A;  2OCC C;  4BJT A;  3SNH A;  4QI0 A;  1ORY A;  2XLE A;  1G4W R;  2ZXO A;  3C7J A;  3O10 A;  3RQG A;  3ZTZ A;  4B6I A;  1F1M A;  2XSE A;  1ZHT A;  2YL7 A;  3DZA A;  4GEH A;  2FAP B;  3UGO A;  1TWC A;  2EPL X;  2XL6 A;  2HMQ A;  3RW0 A;  4XLN F;  2A0B A;  1RXQ A;  3SXY A;  4Z9H A;  5COF A;  4LLC A;  2HMZ A;  3H2V A;  3LEO A;  1V55 C;  3M4C A;  3Q6M A;  4U5F E;  4JE9 A;  3V5X A;  4ANJ A;  1APC A;  4WGZ A;  3E9V A;  1LS4 A;  4PJJ A;  1UFB A;  3OEO A;  3IHU A;  1R5I D;  1JOG A;  3SP1 A;  3MFN A;  3L8J A;  3GOD A;  3X1O A;  3GM3 A;  1YA7 O;  2XLD A;  4Q4Z F;  4EHP A;  1J8M F;  3WG7 C;  1VK5 A;  2PX3 A;  1IZM A;  1T01 A;  1TKN A;  1ZYR F;  1NFO A;  5F5H A;  4KI2 A;  2OU6 A;  3SZR A;  4JEA A;  4K0D A;  4N4W A;  3V5Y A;  1WTY A;  4W8K A;  1U89 A;  4O7G A;  3L34 A;  3K66 A;  3O55 A;  4U5H A;  5CIV A;  1FNT c;  3TOM A;  1OCO C;  5L3Q A;  4IWB A;  4X0R A;  2XLM A;  2XL8 A;  1VLS A;  3DD7 A;  4W8P A;  3G4Z A;  2GA0 A;  2LSE A;  3NG1 A;  3LUT B;  3GEI A;  3L8I A;  4JZA A;  2QNL A;  3B9Q A;  3POV A;  3HNJ A;  4JTA B;  1T6U A;  2A69 F;  4U5D E;  1SR2 A;  3K1I A;  4BG0 A;  4E17 A;  2O9X A;  3B0V C;  2H8A A;  3EQL F;  3T9O A;  4YL0 A;  4DOZ A;  2AU5 A;  4MW8 A;  2EIM C;  4XPW A;  3GAN A;  3RKO F;  3JYH A;  2J7P A;  3HLZ A;  3WHN A;  2A0U A;  3HKK A;  4MVQ A;  5BUO A;  1NG1 A;  4YT2 A;  4G0H A;  2MYS A;  4OIR F;  2NUT A;  4AL0 A;  5DLJ A;  4JJG A;  3RFY A;  4ZLC A;  1I4Y A;  1QLE C;  3EGD A;  2KYH A;  2NUP B;  2F22 A;  4PAC A;  3LES A;  1M6T A;  2J9W A;  3EHN A;  2YL1 A;  2CDQ A;  3DMD A;  4JTC B;  3QZC A;  3ZQV A;  2HUJ A;  2H7O A;  4JCZ A;  3ZWI A;  5A6J A;  1A7E A;  1YAU O;  5KYU A;  5EGY A;  3LJB A;  2OJE D;  1LS1 A;  2DYR C;  3EFO A;  1ZZP A;  2MWQ A;  2EIL C;  4ONS A;  2KNH A;  1FTS A;  2Y3B A;  2P6V A;  3O39 A;  3ZVR A;  2UUI A;  4BEM J;  3S84 A;  2YWA A;  1K04 A;  2HFI A;  3AOU A;  2A1D D;  2XM4 A;  4CIP A;  3QW1 A;  3DXJ F;  1GQA A;  1L7C A;  1PCX A;  4CDA A;  4D4X A;  1E83 A;  3G50 A;  5E33 A;  2C03 A;  4MS2 A;  3T4R A;  5IY5 C;  4YL1 A;  2FGY A;  2QTV A;  2P1A A;  1CPR A;  2YEV A;  4XPY A;  2LFD A;  2W4M A;  4U9E A;  2IBF A;  1D0Y A;  1ORJ A;  4XEF A;  3CEX A;  1YVI A;  4MW3 A;  4MVR A;  4OIQ F;  2WZG A;  2V26 A;  3DAF A;  4BJ5 C;  1NSG B;  1OW7 A;  4AE4 A;  4CS8 C;  3B71 A;  4I44 A;  2UUH A;  5A6B D;  5KYN A;  1GS9 A;  3MBG A;  1QSP A;  1K40 A;  4MVU A;  256B A;  1YLM A;  3L0I A;  5L0J A;  4WGY A;  1WAS A;  1OXK A;  4MTO A;  2HV6 A;  3FHD A;  4YT5 A;  5A69 A;  3AGU A;  5KYX B;  4HFF B;  1Z63 A;  2XS8 A;  3GWN A;  2LD6 A;  3M79 A;  3GEH A;  4WAB A;  3AG3 C;  4K1O A;  1QKR A;  3JTL O;  2HV7 A;  4KNV A;  5HV9 A;  3UMK A;  4NC3 A;  1EKY A;  2WZF A;  4XPX A;  3TJ5 A;  2EPM X;  1KU2 A;  3DM5 A;  2R03 A;  3DE9 A;  3ZG1 A;  1LKX A;  2Q00 A;  2EIN C;  2B0H A;  2IXN A;  4YL3 A;  3U9J A;  3IEE A;  4FWV A;  3FOO A;  4JVS A;  1M2V B;  4JC7 A;  5A6K A;  3V7O A;  1E85 A;  4HFK B;  1UG7 A;  2KW3 C;  3U2M A;  1VTM P;  2G3K A;  1LI7 A;  2YVK A;  4R32 A;  3CZ6 A;  1Q0K A;  3JT1 A;  3PCV A;  4U5G A;  1VYI A;  4LAC B;  2EIJ C;  1NLX A;  3HTK C;  4IAQ A;  4G7O F;  4CDV A;  4DRI B;  5L0F A;  3RVY A;  1AVO B;  1U6H A;  5KYU B;  3ZTM A;  3IQ5 A;  1WAT A;  3DI5 A;  1RCP A;  1XZP A;  4N6C A;  1E2X A;  1RJ9 B;  3EPV A;  1Z5Z A;  2LK4 A;  5D91 A;  3RYL A;  3NMJ A;  1MMN A;  3CSK A;  3U9M A;  5KYW A;  1YYJ A;  2P0N A;  2X51 A;  3KYI A;  4E0H A;  3UNG C;  1OKK D;  2L6G A;  4I1M A;  3ITF A;  1PD1 A;  4XQ1 A;  2R7T A;  3DE8 A;  1MQV A;  1K05 A;  2J8W A;  4HEA J;  4H54 A;  4KC9 A;  3UMH A;  2XLO A;  3N24 A;  4PJM A;  3ABM C;  3U5S A;  2PF4 E;  4EBK A;  4DJ9 A;  2YZS A;  3E70 C;  3SXZ A;  3U8P A;  3KPH A;  1QPU A;  3NYL A;  2M64 A;  3K6B A;  3W2V A;  4M63 A;  4RDA A;  3U3B A;  3EH2 A;  3NKD A;  4O6N A;  4DBQ A;  5B1B C;  5BQH A;  2IXP A;  4C3B A;  4G7Z F;  4G7H F;  4JCH A;  5AC5 A;  3RQF A;  2XL4 A;  1WWP A;  2AWY A;  1CPQ A;  5KYY A;  4C7O B;  3AJM A;  4CSA C;  1CGN A;  1OR2 A;  1JRA A;  1Q0D A;  2WL8 A;  3IQ6 A;  4YT4 A;  1JPN A;  1QVX A;  2PBE A;  4NTB A;  1Z3I X;  2YL3 A;  1ZW3 A;  4XEK A;  2OKU A;  1N1C A;  1NZE A;  3S0X A;  4IGG A;  3U2L A;  4EUK B;  1TWA A;  2CW0 F;  2Q9C A;  3FOP A;  2VH3 A;  3RH3 A;  4EBJ A;  5GPG B;  1HY5 A;  3QMK A;  2P7V A;  1CGO A;  2ETS A;  3GOR A;  1ZVZ A;  1JPJ A;  4CIH A;  2R7R A;  1J8Y F;  1S7Z A;  4CSA A;  1BDJ B;  3OA1 A;  4GQH A;  3JCU Q;  2R05 A;  4PJN A;  4XEV A;  1L3P A;  2HKV A;  2VAS A;  3HNK A;  1BR4 A;  2HZ8 A;  3Q7G A;  5B3S C;  2AVK A;  4JUR I;  4IB4 A;  4JTD B;  3ZC4 A;  5JT4 A;  2XXA A;  1MNE A;  3TOL A;  4D4N A;  4DVZ A;  2I15 A;  2R7S A;  2KC3 A;  2YLD A;  4EBB A;  2KJG A;  5DS6 A;  2EPK X;  2WVN A;  2C04 A;  5BQG A;  3R7C A;  2JPU A;  2L81 A;  2J0W A;  2XS1 A;  2WVQ A;  3SXK A;  2EIK C;  3GM2 A;  3UGP A;  1RKE A;  2A6E F;  3EFO B;  1TWH A;  3HNL A;  3TD7 A;  3W4Y A;  1FFH A;  1H7I A;  4PR9 A;  2ZD9 A;  3IPM O;  4OD4 A;  4NY3 A;  2Q3T A;  1FMW A;  3Q6N A;  5CI8 A;  1BBH A;  1OKK A;  1W2W A;  2A6H F;  1OW8 A;  1D1A A;  2DGJ A;  2A68 F;  1WGW A;  1LE2 A;  1EA8 A;  2H7V C;  3NRH A;  4CS9 A;  4DRH B;  5DS4 A;  2R7Q A;  1VOM A;  5FZT A;  4O6M A;  1M2V A;  3C62 A;  5DVW A;  1YZC A;  1HW2 A;  2G3V A;  4AL1 A;  4DRJ B;  5L0G A;  3QW0 A;  3MYI A;  4U9D A;  4CJG A;  1NU9 C;  3N2Z B;  2XXA B;  2DB4 A;  2R7O A;  5COG A;  2LP4 A;  1JR8 A;  3PMR A;  2VB6 A;  3EH1 A;  3F47 A;  4RBN A;  2HJ3 A;  4XTK A;  5JSL A;  3S9O A;  4DBR A;  3J06 A;  3LEV A;  1HE1 A;  5JUA A;  2DI3 A;  1C03 A;  4HE8 D;  2IXO A;  1WN0 A;  3KH2 A;  1BZ4 A;  1JMW A;  4LLE A;  1LM3 B;  4MVO A;  3O6X A;  4CBE A;  4LDQ A;  4RD9 A;  2PX0 A;  4J7Y A;  5L0C A;  5A6B A;  1OW6 A;  4GYT A;  2CNW A;  1E86 A;  2NG1 A;  3EGX A;  2GDC A;  3HNI A;  3JSE O;  4E0I A;  1LVK A;  2BE5 F;  3EGD B;  1HMD A;  4LDR A;  2XM0 A;  5DQZ A;  2W4B A;  2VCC A;  3US6 A;  3DJN B;  4F4B A;  1V74 B;  3LLI A;  3S29 A;  3VRC A;  1A7V A;  3NYJ A;  3CQZ A;  1T6Q A;  3W8I A;  1I5N A;  1VYK A;  3LS1 A;  3QVY A;  2Q7R A;  3ZSU A;  1U0B B;  2JD3 A;  2RSE B;  1RKC A;  3JRM O;  2Y3H A;  5EK0 A;  4U5E E;  4U5C E;  3H65 A;  4MVM A;  4IJJ A;  3AG4 C;  5JP7 A;  3FXH A;  4LER A;  3NYM A;  3W8H A;  4AK9 A;  4YJW A;  4OIN F;  5JRA A;  4ZLD A;  4PK4 A;  3OWT A;  4ULW A;  5T1D B;  2Z15 A;  2J9U A;  3RQE A;  1FFT C;  1E84 A;  1LIH A;  1JAF A;  3AG2 C;  1EI7 A;  3PHF 2;  1OCR C;  3T6B A;  5A6A A;  1OR3 A;  3JRT A;  4CX9 A;  4I3M A;  1M57 C;  1ZHY A;  2OEX A;  3DWW A;  1NFN A;  3MX3 A;  3NDB B;  2CNW D;  3VAY A;  2EPO A;  1Y6D A;  3ZQY A;  1ST6 A;  3Q7L A;  5DQT A;  3UMI A;  1RMV A;  5JLI A;  4DXW A;  2XLW A;  2CCY A;  3C8G B;  2KK1 A;  3GEE A;  3C18 A;  1V54 C;  3EZI A;  3NMK A;  4KNW A;  3LNR A;  1GGQ A;  5L0D A;  1ZHX A;  3V5Z A;  1HW1 A;  3T6J A;  3DM9 B;  4Z9J A;  3TQO A;  1EQ1 A;  4PFO A;  2NPU A;  1Z23 A;  4JJF A;  4N06 A;  2J9V A;  3I5P A;  1D0X A;  3SXM A;  4DVY P;  2RD9 A;  3GWL A;  4J32 B;  1A0B A;  1BR2 A;  4BJ6 A;  5F5F A;  1XZQ A;  1H9G A;  1GM5 A;  3BRJ A;  4FES A;  2JX0 A;  1HMO A;  2ZXP A;  4BPM A;  1CGM E;  3EHM A;  2BC5 A;  1V4A A;  4YN0 B;  2CYD A;  4WJ0 A;  3S27 A;  1ZHW A;  1ORS C;  4QDL A;  4ULV A;  1DOW A;  4AX2 A;  4E7Z A;  1S05 A;  4JIO A;  2Q9A A;  5L3V A;  2PNO A;  2IM8 A;  3B0U X;  3FAP B;  2LCH A;  5E3C A;  1QQ3 A;  4CS8 A;  2G62 A;  3RIP A;  1DOV A;  2R7X A;  3WAQ A;  4J30 B;  2NUT B;  3ASN C;  3C63 A;  1R4T A;  1SMY F;  2LIG A;  3VYW A;  2J7P D;  1LE4 A;  2HSQ A;  2I8B A;  2IXM A;  1SYQ A;  1TWG A;  3K1H A;  4MTF A;  1ZW2 A;  4Q5S F;  1G8X A;  2YHS A;  3A9C A;  5TJ5 E;  1SZI A;  2AP3 A;  1YYX A;  2OQM A;  3AGT A;  2WB7 A;  3GM1 A;  5B3I A;  3I5Q A;  2PP4 A;  2L6F A;  2Q9B A;  2YQY A;  3X2Q C;  2FFH A;  1I4Z A;  1D1B A;  5KYY B;  4C7O A;  2L9J A;  4E7S A;  3H2U A;  1D1C A;  3PDM P;  3KL4 A;  1LI5 A;  4MTG A;  2J0X A;  4EWC A;  3A11 A;  1VLT A;  1TFO B;  1YJG A;  5FCL A;  2CGE A;  3ASO C;  3R2P A;  4C3D A;  2Y69 C;  1G4U S;  4P9T A;  2P61 A;  3HJC A;  3TK0 A;  5CI9 A;  3KYJ A;  1FAP B;  2VC9 A;  3UR3 C;  2ZPA A;  5F28 E;  5AGF A;  4NTA A;  4MVS A;  1IW7 F;  4QI2 A;  3AQB A;  2WZL A;  1PV3 A;  5L0H A;  1YA9 A;  4J7T A;  4JRZ A;  3ABL C;  3JSZ A;  3FDQ A;  2WVO A;  2HSB A;  3AG1 C;  3IQC A;  4UDV A;  2PFD A;  4OIO F;  3U3F A;  4NTF A;  3C8Z A;  3DAG A;  3EJN A;  2KGO A;  1WOL A;  2J45 A;  3K7D A;  3LNM B;  4NQF A;  2R25 A;  1T5O A;  2XLH A;  3VM6 A;  2BL2 A;  4LDK A;  1XWJ A;  2J46 A;  4PJL A;  3ZIB A;  1G5Z A;  3MYF A;  3U8V A;  3S90 A;  4Z9I A;  1AEP A;  2QLA A;  2NUP A;  5EHH A;  2R02 A;  3SYN A;  1HE9 A;  2AWC A;  2IYL D;  1FR0 A;  3ECS A;  2X0C A;  2Y3D A;  1AUE A;  2OG2 A;  4IRU A;  3KKB A;  1QZX A;  3IQT A;  4FX5 A;  2W9Y A;  4L6R A;  2E87 A;  3FMS A;  4P9F A;  4YT8 A;  4XWJ A;  5K0I A;  4NCQ A;  3ZDL A;  1TQG A;  5KYW B;  2YLI A;  3LAY A;  2VCA A;  2R9R B;  4O6Y A;  1MMD A;  1O3U A;  3K33 A;  1H6G A;  1M56 C;  4N6H A;  5JVE A;  3B0P A;  3FAJ A;  1OCC C;  4MVZ A;  1ZU4 A;  1SF8 A;  2OOC A;  1ZHZ A;  5JS5 A;  3C8G A;  4BEJ A;  2V3C C;  1OQC A;  2XLV A;  4ER9 A;  1FMV A;  2LQG A; 
#chains in the Genus database with same CATH homology
 2OKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...