2OKUA

The crystal structure of the acyl-coa dehydrogenase family protein from porphyromonas gingivalis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
122
structure length
122
Chain Sequence
QVVAAIRHITTGTYIARIREEYQQTEVKPELQPMKEALARMTDRAEALIAFVTEQKDQELLDFQARRLVEMTAHAVFGHLLMLAANDDDSFRQSAEVYLRYGQAEQEKIDSYVRAFRPEELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of the acyl-CoA dehydrogenase family protein from Porphyromonas gingivalis
rcsb
source organism Porphyromonas gingivalis
molecule tags Oxidoreductase
molecule keywords Acyl-CoA dehydrogenase family protein
total genus 46
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12186 AcylCoA_dehyd_C Acyl-CoA dehydrogenase C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.470 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Acyl-CoA dehydrogenase, C-terminal domain 2okuA00
2OKUA
chains in the Genus database with same CATH superfamily
3EH2A 1WWPA 4C7OA 4BEMJ 3W8IA 1RMVA 4JE9A 4Q7CA 2Q9CA 2XXAB 3JYYA 3DM5A 4NC3A 4R32A 5JRAA 3EGXA 5BQHA 2ICWG 4CS8C 1XZQA 4N6HA 256BA 2KK1A 2YL0A 3M79A 3JT1A 4D4XA 4DOZA 5AC5A 4XTKA 5CI8A 2VC9A 4HFKB 2R7WA 1QSPA 5HSWA 1RKEA 3A11A 1BZ4A 1MNEA 1ZW3A 3C8ZA 1L3PA 5T3WA 4Z9HA 4C7OB 4WABA 2V3CC 2DI3A 1XZPA 1AEPA 4XQ1A 1HMDA 4ULVA 2OJED 1W2WA 4IJJA 4Z9IA 4AK9A 3AQCA 3V7OA 5E2QA 2PX0A 4K7BA 4BPMA 3ZQVA 1HY5A 1Q0GA 3US6A 4NTAA 2R7UA 4PACA 3MYFA 2KSFA 1M56C 4A4AA 3UMIA 5A6BD 3ZTMA 3PHF2 5L0HA 1ZHTA 5TJ5E 2RD9A 3KMIA 4E17A 1E83A 1WTYA 1RJ9A 4MS2A 3VRCA 2H7BA 4DXWA 3B0VC 3QMKA 3RVZA 2HSBA 2J8WA 2XM4A 3U0CA 4ZLDA 3ZDLA 3DAFA 2LFDA 3HNIA 5B3IA 3ABMC 3LS1A 3WAQA 3DE9A 2VB6A 4O6MA 4XEFA 2HJ3A 1FAPB 3K1IC 1AVOB 3LESA 4DBRA 1QZXA 1M2OA 1SF8A 3B9QA 2I8BA 2DGJA 2UUHA 2AP3A 4RDAA 2XS1A 3ZVRA 1IZMA 3E70C 3EFOA 3TOLA 4AL0A 2KC3A 1D0YA 4JCHA 4P9TA 2LP4A 4F4BA 1O87A 2YRFA 3O10A 2Y3BA 2ZD9A 5EGYA 3R7CA 2QE9A 3U8PA 4LDKA 4XEVA 2HFIA 1D0XA 2WL8A 2A0UA 2ZXOA 1MMAA 3BEHA 3EPVA 3AOUA 3IQ6A 5B3SC 4U5HA 2W9YA 4LDQA 4AX2A 3NYJA 1I4ZA 2PX3A 2HV7A 1VYKA 1Z3IX 4IAQA 3B0UX 3T6BA 3Q6NA 3AGUA 2XL8A 2R7VA 3MX3A 5JT4A 1J8MF 3J06A 5COMA 1DOVA 4AL1A 4XLPF 1T6UA 1RKEB 4FESA 5A69A 2YLGA 4Z9JA 4U5CE 5COFA 3GM2A 4BG0A 1Z6AA 4WGZA 5T1DB 3NKDA 1Q0FA 1TKNA 3KH2A 3MFNA 3QTHA 2A68F 2Q3TA 2Q9AA 4J30B 2HUJA 3K7DA 4FWVA 1V74B 3TJ6A 5DVWA 2CNWA 2WZGA 2YL7A 1MQVA 2VCAA 2CCYA 3JYHA 4X0RA 5AC4A 1NBBA 3LJBA 3CEXA 2B0JA 3LEOA 2P7VA 1VLTA 3EG9A 1U0BB 5A6JA 4M63A 1ZYRF 2VCBA 5A6KA 3Q6MA 1K40A 3EH1A 3L1MA 1SZIA 4CIPA 3M4CA 3W4YA 2P0NA 4A2NB 1BR1A 1T6QA 3VM6A 3NKEA 3W2WA 4DJ9A 4EUKB 2NUPB 4GQHA 2EPOA 2WVQA 4YL0A 2R25A 3ITFA 1LIHA 4E18A 2BL2A 4LERA 1WOLA 1TWAA 2P61A 2ZXPA 3C8GD 2KJGA 4CS9A 3LEVA 4EHPA 1APCA 3NYMA 1A0BA 2NUTB 3LLIA 3UMHA 3S29A 4YL3A 3SXYA 5E3AA 1N1CA 3HJCA 4U9DA 5JLIA 2EPNA 2KQ9A 1U6HA 1M57C 2GAQA 2IOQA 1WGWA 2P6VA 2YZSA 3EHNA 4PR9A 3S0XA 4MVRA 3RH3A 4HEAJ 4LACB 4XLNF 3V5YA 2DYRC 2Y69C 2AWCA 2H7OA 2R9RB 5DS6A 2Z15A 1HMOA 4YWQA 1FFHA 2PP4A 3DD7A 3L0IA 3U2LA 2AWYA 4I1OB 1M2VA 3B29A 1ZU4A 3K6BA 4BEJA 4DRHB 4I3MA 5CI9A 3FXHA 2W4MA 2L9JA 4XPYA 3S84A 2NSFA 3ZC4A 5BUOA 4O6YA 1RCPA 2YWAA 1OXBA 4YT5A 3H65A 2OG2A 1TWHA 3FOPA 1NFNA 2R7QA 5DS5A 1JAFA 2YLDA 3GODA 2DB4A 3IQ5A 2GDCA 3JSZA 2HS5A 4OD5A 2D4UA 3T6GB 5KYUB 1C03A 4K0DA 5KYYB 3Q7LA 3FHDA 5F28E 3TD7A 4KI2A 3KL4A 4GYTA 3RQGA 2EPLX 5L0FA 1LS4A 4BJ5A 3IQTA 1AUEA 3DMDA 3QW1A 3HNKA 1WASA 4O7GA 1H9GA 1D0ZA 2NSGA 2OOCA 2VCCA 3RF3A 2GFHA 2R7OA 1T9KA 3WHNA 1WATA 5D92A 1I4YA 2XXAA 4OIPF 2O9XA 3S28A 3IPMO 2M4EA 3JRTA 2IXPA 3JTLO 4JURI 2EINC 3AG1C 3ZTZA 1MMNA 3ASOC 3GEIA 1NFOA 2WZFA 4ULWA 1FMWA 1NG1A 1YA7O 4PJLA 3ZWIA 2KNHA 3AQBA 4ZLCA 2L6GA 2AVKA 1OCCC 2WVNA 3JSEO 2B0HA 4Q5SF 1BR2A 2FFHA 1JPNA 4H4KC 2OJQA 1YYJA 2R05A 3C7JA 3I5PA 4MVOA 2ETSA 1V55C 1KTMA 2PF4E 2YHSA 2HV6A 5FCLA 5L3VA 2IXOA 1EA8A 2J9WA 4D4NA 2C03A 2IM8A 1JMWA 1VB5A 1FFTC 1FMVA 2OEVA 2L7AA 4XEKA 2AU5A 4BJ6C 3B0PA 3PMRA 4ER9A 3TQOA 1OR3A 2PFDA 3VF0A 3NMJA 2Y3DA 1DOWA 4KNVA 4EBJA 4DBQA 1RJ9B 4JEBA 1OXKA 1J8YF 1F1MA 1SYQA 1YYXA 3DJUB 1JOGA 3EHMA 3SXZA 3ZIBA 4H54A 1CPQA 2DYSC 3ABLC 4MQ9F 2EPMX 3ABKC 2PBEA 4JC7A 3POVA 5IY5C 5L0GA 4C3BA 2A1DD 2FGYA 4IWBA 2IBFA 1ORYA 2CYDA 1OW6A 1C17M 3AG3C 3M15A 4PJNA 5EK0A 1WN0A 4WGYA 1TWGA 3N2ZB 1PCXA 3TK0A 2HKVA 3RKOF 2CNWD 3FOOA 4NTBA 2CDQA 2LK4A 4CX9A 3PDMP 5L0JA 1LI5A 3KYJA 4OIOF 4HE8D 4XWJA 4CSAC 2XSEA 4CSAA 4MW8A 3EGXB 4NTFA 5F5FA 4CDVA 2XM0A 3S9OA 3ZG1A 3LS0A 5KYYA 2J9UA 3C18A 3EJNA 1HE1A 4JRZA 2GA0A 3DM9B 2YL3A 2YEVA 4JIOA 3MYIA 4KC9A 1NU7D 4G78A 2PNOA 3TULA 3ASNC 1Z23A 3H2UA 1GGQA 3PCVA 3C8GA 4PJJA 4W8KA 3SNHA 3ZSUA 1OCRC 1TFKB 2QY9A 3T4RA 3DE8A 3RYLA 1ZVZA 3L8IA 2ASRA 5HV9A 2L6HA 4YN0B 3SZRA 3K1HA 1H7IA 3F47A 4C3EA 3GEEA 4P9FA 3LNRA 2HMZA 3FVYA 3LLKA 1EKYA 1LM3B 4QDLA 1IW7F 3U8VA 1LS1A 4E7SA 1K05A 1HE9A 4U9EA 4JVSA 1ZHXA 4J7YA 3QW0A 1GS9A 1YZCA 2QTVA 3DAGA 2YL1A 2L81A 3VAYA 4YT2A 1OKKA 4U5FE 1RXQA 2EIJC 1YLMA 2XLWA 4YJWA 2LQGA 3AJMA 1FTSA 3DZAA 3RQFA 4IB4A 3O39A 1Q0MA 2XLEA 4DVZA 2CW0F 3AGTA 2YLIA 4MVMA 3FAJA 3N0TA 4MVSA 4J32B 2Y3GA 3O55A 4MTGA 5AGFA 2L6FA 2J9VA 4IGGA 1YDIA 1MNDA 4JTCB 1D1CA 4IARA 4OIRF 1R4TA 1QVXA 3IEEA 3HKKA 1KU2A 3T6JA 2HMQA 5A6BA 5KYWA 4CBEA 3SEOA 1QLEC 3L34A 4MW3A 4N06A 1FR0A 1Y6DA 3GANA 3DJNB 3EZIA 2BE5F 2XRHA 5FZTA 3VYWA 3QZCA 4JW1A 1TQGA 1OKKD 1NZEA 2UUIA 2A6HF 4EBBA 3GM3A 1S05A 1U89A 3I4UA 3CSKA 4CJGA 3TOMA 4G7OF 1A7EA 3GWLA 5CIVA 2IXMA 1PD1A 2V26A 1CPRA 3KPHA 3U3BA 4G0HA 1QKRA 2X51A 3G50A 4MTFA 3HLZA 3LAYA 4CDAA 5L0CA 4JTAB 1HW2A 1Z5ZA 3X1OA 1GQAA 4U5DE 3NRHA 2D5RB 4U5GA 4EBKA 1LE2A 3NG1A 1OR2A 3SXMA 2MYSA 3T9OA 4AE4B 3AG2C 3NMKA 1UFBA 3KYIA 2RSEB 1JR8A 3OWTA 2OEXA 3GEHA 4DRIB 2Y3HA 5COGA 1YVIA 1A41A 4KBLA 2H7VC 5BQIA 4N6CA 3FDQA 3FMSA 1O3UA 4PK4A 3RIPA 1OCZC 4MNDA 4BJ5C 1E2XA 2Q7RA 2HSQA 1NSGB 1BBHA 5DS4A 5DQTA 2A69F 3IHUA 2J7PD 4RD9A 3S27A 4CDYA 4LLEA 3V5XA 3SP1A 1D1BA 2IXNA 4MVQA 2QNLA 2W45A 3B71A 3M4BA 1Z7Qc 2I15A 3U9MA 3EQLF 3NMIA 4JCZA 4G7ZF 1EI7A 3EG9B 4EIYA 2JPUA 4JKVA 4JTDB 2EILC 1MMDA 3A9CA 1CGNA 1TWCA 1Z63A 3ATPA 1VOMA 2LIGA 2YVKA 5DLJA 4E0IA 1G4WR 3C63A 3CQZA 4XPXA 3OA1A 5F5HA 1V54C 5B1AC 1MMGA 1A7VA 1OW7A 4N4WA 5A6AA 2QLAA 3IQCA 2EIMC 4NCQA 3SXKA 2XS8A 3GWNA 3V5ZA 2J0XA 2OCCC 1L7CA 3HTKC 4JJGA 2NUTA 2HJMA 2KW3C 2JX0A 2LSEA 3K66A 4ONSA 3DI5A 1RKCA 5KYNA 2JD3A 3UGPA 1GM5A 1PD0A 1B68A 1QPUA 2R7TA 4U5BE 4BJ1A 4J7TA 3EGDA 4O6NA 1UG7A 4O79A 4BJTA 1PV3A 4I1MA 2G3VA 2EPKX 3JRMO 4ANJA 1E85A 4Q4ZF 1OQCA 3LUTB 2C04A 4LLCA 5KYXB 3I5QA 5L0IA 5KYXA 4FAPB 2XL6A 2MHRA 4MTOA 1ZW2A 2NG1A 4PFPA 3RFYA 3BRJA 5K0IA 3NDBB 3DXJF 3S90A 1LVKA 3EFOB 2R7RA 2Q00A 4PFOA 4K1OA 1T01A 2J0WA 3EGDB 3UNGC 3MLGA 3R2PA 3U2MA 1BDJB 4KNWA 1CGOA 1S7ZA 1T6IA 2CGEA 1NLXA 4YT8A 2H8AA 2TMVP 1Q0DA 1ZZPA 2OQMA 1Q0KA 3CAXA 4YL1A 4NY3A 2EIKC 3ECSA 4FX5A 1O5HA 3G4ZA 2XLVA 2Y39A 4W8PA 3H2VA 2XL4A 2OU6A 3RVYA 1CGME 4E7ZA 3RQEA 2G3KA 5D91A 1LKXA 3RW0A 3F46A 1VYIA 2WZLA 4U5EE 3M1CB 3U5SA 4IAOA 2XLOA 5E33A 3MBGA 1G8XA 2WVOA 4RBNA 3W2VA 3GORA 1M2VB 2XLMA 3E9VA 2ZXRA 2R03A 2R7SA 1G5ZA 1VTMP 2F22A 3TJ5A 5E3CA 3X2QC 5JSLA 3GM1A 4OINF 3O6XA 4GEHA 4IRUA 3SYNA 3W8HA 4E0HA 2A6EF 2GWWA 5DQZA 2YQYA 2LD6A 2ZXWC 1C02A 1G4US 5T3TA 4JJFA 1ZHYA 4CJOA 5KYUA 1YZAA 3CZ6A 1E84A 1E86A 4G7HF 4P6IC 2LFFA 3OEOA 2OKUA 1ORJA 1YJGA 1LE4A 2G62A 5EHHA 2YKZA 4CS7A 4LDRA 5JVEA 2Q4FA 2KGOA 3U9JA 4WJ0A 3DKAA 3QVZA 1LPEA 2WB7A 4OIQF 1OCOC 2NPUA 3G4XA 4I44A 5GPGB 1YA9A 2NUPA 1I5NA 1JRAA 5B1BC 4JEAA 4YT4A 2VH3A 3K33A 3WODF 4DVYP 1HW1A 1VMAA 2P1AA 1VK5A 1ST6A 1TFOB 1SR2A 5BQGA 2W4BA 4C3DA 4BJ6A 1KNYA 2Q9BA 2R02A 1Y4CA 2J7PA 3JZ0A 2FAPB 3KKBA 2MWQA 1BR4A 1QQ3A 1XWJA 4XPWA 1FNTc 3N24A 1YARO 1JPJA 4YK5A 5L0DA 1TR2A 1YAUO 1M6TA 3HNLA 5JP7A 5KYWB 5L3QA 3L8JA 1H9TA 2VASA 4CIHA 3WG7C 4NQFA 2E87A 3QVYA 4HFFB 4EWCA 1ZU5A 3UGOA 3AG4C 4PJMA 1D1AA 4MVZA 3UMKA 1VLSA 1EQ1A 1OW8A 3NYLA 4OD4A 4UDVA 2XLHA 2ZPAA 2M64A 3FAPB 2J46A 3Q7GA 3JCUQ 1SMYF 2J45A 1ZHZA 1ZHWA 1A7DA 2HZ8A 3C8GB 1NU9C 3HNJA 2XLDA 3EZHA 2R7XA 4QI2A 4QI0A 1K04A 3DWWA 1V4AA 2J9BA 3U3FA 2X0CA 4DRJB 2KYHA 5JUAA 1ORSC 4EKWA 4CS9C 5JS5A 4JZAA 4B6IA 3ZQYA 1H6GA 2A0BA 2BC5A 1LI7A 4AE4A 2QUPA 4MVUA 1R5ID 4CS8A 3C62A 2IYLD 3K1IA 1T5OA 3LNMB 2LCHA 4L6RA 3UR3C
chains in the Genus database with same CATH topology
2OKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OKU A; 
#chains in the Genus database with same CATH topology
 3EH2 A;  1WWP A;  4C7O A;  4BEM J;  3W8I A;  1RMV A;  4JE9 A;  4Q7C A;  2Q9C A;  2XXA B;  3JYY A;  3DM5 A;  4NC3 A;  4R32 A;  5JRA A;  3EGX A;  5BQH A;  2ICW G;  4CS8 C;  1XZQ A;  4N6H A;  256B A;  2KK1 A;  2YL0 A;  3M79 A;  3JT1 A;  4D4X A;  4DOZ A;  5AC5 A;  4XTK A;  5CI8 A;  2VC9 A;  4HFK B;  2R7W A;  1QSP A;  5HSW A;  1RKE A;  3A11 A;  1BZ4 A;  1MNE A;  1ZW3 A;  3C8Z A;  1L3P A;  5T3W A;  4Z9H A;  4C7O B;  4WAB A;  2V3C C;  2DI3 A;  1XZP A;  1AEP A;  4XQ1 A;  1HMD A;  4ULV A;  2OJE D;  1W2W A;  4IJJ A;  4Z9I A;  4AK9 A;  3AQC A;  3V7O A;  5E2Q A;  2PX0 A;  4K7B A;  4BPM A;  3ZQV A;  1HY5 A;  1Q0G A;  3US6 A;  4NTA A;  2R7U A;  4PAC A;  3MYF A;  2KSF A;  1M56 C;  4A4A A;  3UMI A;  5A6B D;  3ZTM A;  3PHF 2;  5L0H A;  1ZHT A;  5TJ5 E;  2RD9 A;  3KMI A;  4E17 A;  1E83 A;  1WTY A;  1RJ9 A;  4MS2 A;  3VRC A;  2H7B A;  4DXW A;  3B0V C;  3QMK A;  3RVZ A;  2HSB A;  2J8W A;  2XM4 A;  3U0C A;  4ZLD A;  3ZDL A;  3DAF A;  2LFD A;  3HNI A;  5B3I A;  3ABM C;  3LS1 A;  3WAQ A;  3DE9 A;  2VB6 A;  4O6M A;  4XEF A;  2HJ3 A;  1FAP B;  3K1I C;  1AVO B;  3LES A;  4DBR A;  1QZX A;  1M2O A;  1SF8 A;  3B9Q A;  2I8B A;  2DGJ A;  2UUH A;  2AP3 A;  4RDA A;  2XS1 A;  3ZVR A;  1IZM A;  3E70 C;  3EFO A;  3TOL A;  4AL0 A;  2KC3 A;  1D0Y A;  4JCH A;  4P9T A;  2LP4 A;  4F4B A;  1O87 A;  2YRF A;  3O10 A;  2Y3B A;  2ZD9 A;  5EGY A;  3R7C A;  2QE9 A;  3U8P A;  4LDK A;  4XEV A;  2HFI A;  1D0X A;  2WL8 A;  2A0U A;  2ZXO A;  1MMA A;  3BEH A;  3EPV A;  3AOU A;  3IQ6 A;  5B3S C;  4U5H A;  2W9Y A;  4LDQ A;  4AX2 A;  3NYJ A;  1I4Z A;  2PX3 A;  2HV7 A;  1VYK A;  1Z3I X;  4IAQ A;  3B0U X;  3T6B A;  3Q6N A;  3AGU A;  2XL8 A;  2R7V A;  3MX3 A;  5JT4 A;  1J8M F;  3J06 A;  5COM A;  1DOV A;  4AL1 A;  4XLP F;  1T6U A;  1RKE B;  4FES A;  5A69 A;  2YLG A;  4Z9J A;  4U5C E;  5COF A;  3GM2 A;  4BG0 A;  1Z6A A;  4WGZ A;  5T1D B;  3NKD A;  1Q0F A;  1TKN A;  3KH2 A;  3MFN A;  3QTH A;  2A68 F;  2Q3T A;  2Q9A A;  4J30 B;  2HUJ A;  3K7D A;  4FWV A;  1V74 B;  3TJ6 A;  5DVW A;  2CNW A;  2WZG A;  2YL7 A;  1MQV A;  2VCA A;  2CCY A;  3JYH A;  4X0R A;  5AC4 A;  1NBB A;  3LJB A;  3CEX A;  2B0J A;  3LEO A;  2P7V A;  1VLT A;  3EG9 A;  1U0B B;  5A6J A;  4M63 A;  1ZYR F;  2VCB A;  5A6K A;  3Q6M A;  1K40 A;  3EH1 A;  3L1M A;  1SZI A;  4CIP A;  3M4C A;  3W4Y A;  2P0N A;  4A2N B;  1BR1 A;  1T6Q A;  3VM6 A;  3NKE A;  3W2W A;  4DJ9 A;  4EUK B;  2NUP B;  4GQH A;  2EPO A;  2WVQ A;  4YL0 A;  2R25 A;  3ITF A;  1LIH A;  4E18 A;  2BL2 A;  4LER A;  1WOL A;  1TWA A;  2P61 A;  2ZXP A;  3C8G D;  2KJG A;  4CS9 A;  3LEV A;  4EHP A;  1APC A;  3NYM A;  1A0B A;  2NUT B;  3LLI A;  3UMH A;  3S29 A;  4YL3 A;  3SXY A;  5E3A A;  1N1C A;  3HJC A;  4U9D A;  5JLI A;  2EPN A;  2KQ9 A;  1U6H A;  1M57 C;  2GAQ A;  2IOQ A;  1WGW A;  2P6V A;  2YZS A;  3EHN A;  4PR9 A;  3S0X A;  4MVR A;  3RH3 A;  4HEA J;  4LAC B;  4XLN F;  3V5Y A;  2DYR C;  2Y69 C;  2AWC A;  2H7O A;  2R9R B;  5DS6 A;  2Z15 A;  1HMO A;  4YWQ A;  1FFH A;  2PP4 A;  3DD7 A;  3L0I A;  3U2L A;  2AWY A;  4I1O B;  1M2V A;  3B29 A;  1ZU4 A;  3K6B A;  4BEJ A;  4DRH B;  4I3M A;  5CI9 A;  3FXH A;  2W4M A;  2L9J A;  4XPY A;  3S84 A;  2NSF A;  3ZC4 A;  5BUO A;  4O6Y A;  1RCP A;  2YWA A;  1OXB A;  4YT5 A;  3H65 A;  2OG2 A;  1TWH A;  3FOP A;  1NFN A;  2R7Q A;  5DS5 A;  1JAF A;  2YLD A;  3GOD A;  2DB4 A;  3IQ5 A;  2GDC A;  3JSZ A;  2HS5 A;  4OD5 A;  2D4U A;  3T6G B;  5KYU B;  1C03 A;  4K0D A;  5KYY B;  3Q7L A;  3FHD A;  5F28 E;  3TD7 A;  4KI2 A;  3KL4 A;  4GYT A;  3RQG A;  2EPL X;  5L0F A;  1LS4 A;  4BJ5 A;  3IQT A;  1AUE A;  3DMD A;  3QW1 A;  3HNK A;  1WAS A;  4O7G A;  1H9G A;  1D0Z A;  2NSG A;  2OOC A;  2VCC A;  3RF3 A;  2GFH A;  2R7O A;  1T9K A;  3WHN A;  1WAT A;  5D92 A;  1I4Y A;  2XXA A;  4OIP F;  2O9X A;  3S28 A;  3IPM O;  2M4E A;  3JRT A;  2IXP A;  3JTL O;  4JUR I;  2EIN C;  3AG1 C;  3ZTZ A;  1MMN A;  3ASO C;  3GEI A;  1NFO A;  2WZF A;  4ULW A;  1FMW A;  1NG1 A;  1YA7 O;  4PJL A;  3ZWI A;  2KNH A;  3AQB A;  4ZLC A;  2L6G A;  2AVK A;  1OCC C;  2WVN A;  3JSE O;  2B0H A;  4Q5S F;  1BR2 A;  2FFH A;  1JPN A;  4H4K C;  2OJQ A;  1YYJ A;  2R05 A;  3C7J A;  3I5P A;  4MVO A;  2ETS A;  1V55 C;  1KTM A;  2PF4 E;  2YHS A;  2HV6 A;  5FCL A;  5L3V A;  2IXO A;  1EA8 A;  2J9W A;  4D4N A;  2C03 A;  2IM8 A;  1JMW A;  1VB5 A;  1FFT C;  1FMV A;  2OEV A;  2L7A A;  4XEK A;  2AU5 A;  4BJ6 C;  3B0P A;  3PMR A;  4ER9 A;  3TQO A;  1OR3 A;  2PFD A;  3VF0 A;  3NMJ A;  2Y3D A;  1DOW A;  4KNV A;  4EBJ A;  4DBQ A;  1RJ9 B;  4JEB A;  1OXK A;  1J8Y F;  1F1M A;  1SYQ A;  1YYX A;  3DJU B;  1JOG A;  3EHM A;  3SXZ A;  3ZIB A;  4H54 A;  1CPQ A;  2DYS C;  3ABL C;  4MQ9 F;  2EPM X;  3ABK C;  2PBE A;  4JC7 A;  3POV A;  5IY5 C;  5L0G A;  4C3B A;  2A1D D;  2FGY A;  4IWB A;  2IBF A;  1ORY A;  2CYD A;  1OW6 A;  1C17 M;  3AG3 C;  3M15 A;  4PJN A;  5EK0 A;  1WN0 A;  4WGY A;  1TWG A;  3N2Z B;  1PCX A;  3TK0 A;  2HKV A;  3RKO F;  2CNW D;  3FOO A;  4NTB A;  2CDQ A;  2LK4 A;  4CX9 A;  3PDM P;  5L0J A;  1LI5 A;  3KYJ A;  4OIO F;  4HE8 D;  4XWJ A;  4CSA C;  2XSE A;  4CSA A;  4MW8 A;  3EGX B;  4NTF A;  5F5F A;  4CDV A;  2XM0 A;  3S9O A;  3ZG1 A;  3LS0 A;  5KYY A;  2J9U A;  3C18 A;  3EJN A;  1HE1 A;  4JRZ A;  2GA0 A;  3DM9 B;  2YL3 A;  2YEV A;  4JIO A;  3MYI A;  4KC9 A;  1NU7 D;  4G78 A;  2PNO A;  3TUL A;  3ASN C;  1Z23 A;  3H2U A;  1GGQ A;  3PCV A;  3C8G A;  4PJJ A;  4W8K A;  3SNH A;  3ZSU A;  1OCR C;  1TFK B;  2QY9 A;  3T4R A;  3DE8 A;  3RYL A;  1ZVZ A;  3L8I A;  2ASR A;  5HV9 A;  2L6H A;  4YN0 B;  3SZR A;  3K1H A;  1H7I A;  3F47 A;  4C3E A;  3GEE A;  4P9F A;  3LNR A;  2HMZ A;  3FVY A;  3LLK A;  1EKY A;  1LM3 B;  4QDL A;  1IW7 F;  3U8V A;  1LS1 A;  4E7S A;  1K05 A;  1HE9 A;  4U9E A;  4JVS A;  1ZHX A;  4J7Y A;  3QW0 A;  1GS9 A;  1YZC A;  2QTV A;  3DAG A;  2YL1 A;  2L81 A;  3VAY A;  4YT2 A;  1OKK A;  4U5F E;  1RXQ A;  2EIJ C;  1YLM A;  2XLW A;  4YJW A;  2LQG A;  3AJM A;  1FTS A;  3DZA A;  3RQF A;  4IB4 A;  3O39 A;  1Q0M A;  2XLE A;  4DVZ A;  2CW0 F;  3AGT A;  2YLI A;  4MVM A;  3FAJ A;  3N0T A;  4MVS A;  4J32 B;  2Y3G A;  3O55 A;  4MTG A;  5AGF A;  2L6F A;  2J9V A;  4IGG A;  1YDI A;  1MND A;  4JTC B;  1D1C A;  4IAR A;  4OIR F;  1R4T A;  1QVX A;  3IEE A;  3HKK A;  1KU2 A;  3T6J A;  2HMQ A;  5A6B A;  5KYW A;  4CBE A;  3SEO A;  1QLE C;  3L34 A;  4MW3 A;  4N06 A;  1FR0 A;  1Y6D A;  3GAN A;  3DJN B;  3EZI A;  2BE5 F;  2XRH A;  5FZT A;  3VYW A;  3QZC A;  4JW1 A;  1TQG A;  1OKK D;  1NZE A;  2UUI A;  2A6H F;  4EBB A;  3GM3 A;  1S05 A;  1U89 A;  3I4U A;  3CSK A;  4CJG A;  3TOM A;  4G7O F;  1A7E A;  3GWL A;  5CIV A;  2IXM A;  1PD1 A;  2V26 A;  1CPR A;  3KPH A;  3U3B A;  4G0H A;  1QKR A;  2X51 A;  3G50 A;  4MTF A;  3HLZ A;  3LAY A;  4CDA A;  5L0C A;  4JTA B;  1HW2 A;  1Z5Z A;  3X1O A;  1GQA A;  4U5D E;  3NRH A;  2D5R B;  4U5G A;  4EBK A;  1LE2 A;  3NG1 A;  1OR2 A;  3SXM A;  2MYS A;  3T9O A;  4AE4 B;  3AG2 C;  3NMK A;  1UFB A;  3KYI A;  2RSE B;  1JR8 A;  3OWT A;  2OEX A;  3GEH A;  4DRI B;  2Y3H A;  5COG A;  1YVI A;  1A41 A;  4KBL A;  2H7V C;  5BQI A;  4N6C A;  3FDQ A;  3FMS A;  1O3U A;  4PK4 A;  3RIP A;  1OCZ C;  4MND A;  4BJ5 C;  1E2X A;  2Q7R A;  2HSQ A;  1NSG B;  1BBH A;  5DS4 A;  5DQT A;  2A69 F;  3IHU A;  2J7P D;  4RD9 A;  3S27 A;  4CDY A;  4LLE A;  3V5X A;  3SP1 A;  1D1B A;  2IXN A;  4MVQ A;  2QNL A;  2W45 A;  3B71 A;  3M4B A;  1Z7Q c;  2I15 A;  3U9M A;  3EQL F;  3NMI A;  4JCZ A;  4G7Z F;  1EI7 A;  3EG9 B;  4EIY A;  2JPU A;  4JKV A;  4JTD B;  2EIL C;  1MMD A;  3A9C A;  1CGN A;  1TWC A;  1Z63 A;  3ATP A;  1VOM A;  2LIG A;  2YVK A;  5DLJ A;  4E0I A;  1G4W R;  3C63 A;  3CQZ A;  4XPX A;  3OA1 A;  5F5H A;  1V54 C;  5B1A C;  1MMG A;  1A7V A;  1OW7 A;  4N4W A;  5A6A A;  2QLA A;  3IQC A;  2EIM C;  4NCQ A;  3SXK A;  2XS8 A;  3GWN A;  3V5Z A;  2J0X A;  2OCC C;  1L7C A;  3HTK C;  4JJG A;  2NUT A;  2HJM A;  2KW3 C;  2JX0 A;  2LSE A;  3K66 A;  4ONS A;  3DI5 A;  1RKC A;  5KYN A;  2JD3 A;  3UGP A;  1GM5 A;  1PD0 A;  1B68 A;  1QPU A;  2R7T A;  4U5B E;  4BJ1 A;  4J7T A;  3EGD A;  4O6N A;  1UG7 A;  4O79 A;  4BJT A;  1PV3 A;  4I1M A;  2G3V A;  2EPK X;  3JRM O;  4ANJ A;  1E85 A;  4Q4Z F;  1OQC A;  3LUT B;  2C04 A;  4LLC A;  5KYX B;  3I5Q A;  5L0I A;  5KYX A;  4FAP B;  2XL6 A;  2MHR A;  4MTO A;  1ZW2 A;  2NG1 A;  4PFP A;  3RFY A;  3BRJ A;  5K0I A;  3NDB B;  3DXJ F;  3S90 A;  1LVK A;  3EFO B;  2R7R A;  2Q00 A;  4PFO A;  4K1O A;  1T01 A;  2J0W A;  3EGD B;  3UNG C;  3MLG A;  3R2P A;  3U2M A;  1BDJ B;  4KNW A;  1CGO A;  1S7Z A;  1T6I A;  2CGE A;  1NLX A;  4YT8 A;  2H8A A;  2TMV P;  1Q0D A;  1ZZP A;  2OQM A;  1Q0K A;  3CAX A;  4YL1 A;  4NY3 A;  2EIK C;  3ECS A;  4FX5 A;  1O5H A;  3G4Z A;  2XLV A;  2Y39 A;  4W8P A;  3H2V A;  2XL4 A;  2OU6 A;  3RVY A;  1CGM E;  4E7Z A;  3RQE A;  2G3K A;  5D91 A;  1LKX A;  3RW0 A;  3F46 A;  1VYI A;  2WZL A;  4U5E E;  3M1C B;  3U5S A;  4IAO A;  2XLO A;  5E33 A;  3MBG A;  1G8X A;  2WVO A;  4RBN A;  3W2V A;  3GOR A;  1M2V B;  2XLM A;  3E9V A;  2ZXR A;  2R03 A;  2R7S A;  1G5Z A;  1VTM P;  2F22 A;  3TJ5 A;  5E3C A;  3X2Q C;  5JSL A;  3GM1 A;  4OIN F;  3O6X A;  4GEH A;  4IRU A;  3SYN A;  3W8H A;  4E0H A;  2A6E F;  2GWW A;  5DQZ A;  2YQY A;  2LD6 A;  2ZXW C;  1C02 A;  1G4U S;  5T3T A;  4JJF A;  1ZHY A;  4CJO A;  5KYU A;  1YZA A;  3CZ6 A;  1E84 A;  1E86 A;  4G7H F;  4P6I C;  2LFF A;  3OEO A;  2OKU A;  1ORJ A;  1YJG A;  1LE4 A;  2G62 A;  5EHH A;  2YKZ A;  4CS7 A;  4LDR A;  5JVE A;  2Q4F A;  2KGO A;  3U9J A;  4WJ0 A;  3DKA A;  3QVZ A;  1LPE A;  2WB7 A;  4OIQ F;  1OCO C;  2NPU A;  3G4X A;  4I44 A;  5GPG B;  1YA9 A;  2NUP A;  1I5N A;  1JRA A;  5B1B C;  4JEA A;  4YT4 A;  2VH3 A;  3K33 A;  3WOD F;  4DVY P;  1HW1 A;  1VMA A;  2P1A A;  1VK5 A;  1ST6 A;  1TFO B;  1SR2 A;  5BQG A;  2W4B A;  4C3D A;  4BJ6 A;  1KNY A;  2Q9B A;  2R02 A;  1Y4C A;  2J7P A;  3JZ0 A;  2FAP B;  3KKB A;  2MWQ A;  1BR4 A;  1QQ3 A;  1XWJ A;  4XPW A;  1FNT c;  3N24 A;  1YAR O;  1JPJ A;  4YK5 A;  5L0D A;  1TR2 A;  1YAU O;  1M6T A;  3HNL A;  5JP7 A;  5KYW B;  5L3Q A;  3L8J A;  1H9T A;  2VAS A;  4CIH A;  3WG7 C;  4NQF A;  2E87 A;  3QVY A;  4HFF B;  4EWC A;  1ZU5 A;  3UGO A;  3AG4 C;  4PJM A;  1D1A A;  4MVZ A;  3UMK A;  1VLS A;  1EQ1 A;  1OW8 A;  3NYL A;  4OD4 A;  4UDV A;  2XLH A;  2ZPA A;  2M64 A;  3FAP B;  2J46 A;  3Q7G A;  3JCU Q;  1SMY F;  2J45 A;  1ZHZ A;  1ZHW A;  1A7D A;  2HZ8 A;  3C8G B;  1NU9 C;  3HNJ A;  2XLD A;  3EZH A;  2R7X A;  4QI2 A;  4QI0 A;  1K04 A;  3DWW A;  1V4A A;  2J9B A;  3U3F A;  2X0C A;  4DRJ B;  2KYH A;  5JUA A;  1ORS C;  4EKW A;  4CS9 C;  5JS5 A;  4JZA A;  4B6I A;  3ZQY A;  1H6G A;  2A0B A;  2BC5 A;  1LI7 A;  4AE4 A;  2QUP A;  4MVU A;  1R5I D;  4CS8 A;  3C62 A;  2IYL D;  3K1I A;  1T5O A;  3LNM B;  2LCH A;  4L6R A;  3UR3 C; 
#chains in the Genus database with same CATH homology
 2OKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...