2OKUA

The crystal structure of the acyl-coa dehydrogenase family protein from porphyromonas gingivalis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
122
structure length
122
Chain Sequence
QVVAAIRHITTGTYIARIREEYQQTEVKPELQPMKEALARMTDRAEALIAFVTEQKDQELLDFQARRLVEMTAHAVFGHLLMLAANDDDSFRQSAEVYLRYGQAEQEKIDSYVRAFRPEELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Acyl-CoA dehydrogenase family protein
publication title The crystal structure of the acyl-CoA dehydrogenase family protein from Porphyromonas gingivalis
rcsb
source organism Porphyromonas gingivalis
total genus 46
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12186 AcylCoA_dehyd_C Acyl-CoA dehydrogenase C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.470 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Acyl-CoA dehydrogenase, C-terminal domain 2okuA00
2OKUA
chains in the Genus database with same CATH superfamily
1BR1A 3S28A 3ZG1A 4JVSA 4X0RA 4MVUA 1U0BB 2OCCC 3CAXA 4JE9A 2P6VA 4DRHB 3EG9B 3NKEA 2FGYA 3EH1A 1WATA 1ZW3A 3EZHA 4DVYP 4ONSA 4A4AA 3SNHA 2MHRA 4ZLCA 3M15A 3I5PA 3Q7LA 1APCA 1N1CA 4Z9IA 2FAPB 4LDQA 2P1AA 3G50A 4PR9A 1L3PA 3LJBA 1B68A 3JZ0A 1D0ZA 5E3AA 4ANJA 1DOWA 2H8AA 4DBQA 5L0JA 3CQZA 4ULWA 2XL6A 1OR2A 3LESA 2YEVA 3RQEA 3EJNA 2J8WA 4YK5A 1J8MF 1S05A 4P6IC 1W2WA 2QLAA 1NBBA 3WAQA 1HMOA 2EPKX 1FFTC 3N24A 4J7TA 4JTAB 5JRAA 3A9CA 2IXOA 3DD7A 4KNWA 5F28E 1G4WR 2HUJA 2YKZA 2BC5A 4XTKA 4OIQF 4PACA 5EK0A 3AJMA 5COGA 4XEFA 3SXKA 3LLIA 3GORA 3U9JA 2B0JA 3B71A 1SF8A 2C04A 3JYYA 4IGGA 4MVSA 4C7OB 3GEEA 2XLEA 4OIOF 3DM9B 1CPRA 3FVYA 2Q7RA 3V5XA 4JCZA 1RMVA 4MVZA 1V4AA 3KYIA 5T3WA 5FZTA 1D1CA 2I8BA 3WHNA 5GPGB 3ZIBA 2XS8A 2UUHA 3E70C 1LE2A 2XXAB 2ZPAA 1Z5ZA 4PJMA 2AU5A 5IY5C 3SXMA 4JJGA 3C7JA 1LM3B 2OJQA 2R7TA 4MW3A 1CGME 2AWYA 4U5DE 1YLMA 4YL3A 3AG4C 3LS0A 3EFOA 4DXWA 5E3CA 1NFOA 3C62A 3NKDA 1F1MA 1I5NA 1T5OA 2XM0A 3QMKA 4GEHA 1YZAA 4H4KC 2CCYA 4JW1A 4O7GA 1L7CA 2XLWA 5JS5A 5L0DA 2QTVA 2L6GA 2QNLA 3MYFA 2XM4A 5F5FA 1V74B 1KU2A 2IXNA 5B1AC 1OCCC 2KYHA 1FMWA 3R7CA 4NQFA 2LQGA 1MMDA 4JIOA 3M4BA 3L1MA 3AQCA 3V5ZA 3IQ5A 3BRJA 2EILC 3NRHA 3NYLA 4MQ9F 3NDBB 3DJUB 4YT8A 4CS9A 1IZMA 2GFHA 2HKVA 3WG7C 1K40A 2ZD9A 5COMA 3SZRA 1LKXA 3EG9A 3JYHA 1PCXA 2B0HA 3GANA 2QUPA 3EGDB 2J46A 2J9BA 3K1HA 4DRJB 3S84A 1VLSA 4LLEA 4OIRF 1VK5A 4CJOA 2ZXWC 5L0GA 1QSPA 2OEVA 2EPLX 3QW0A 3KKBA 3LEOA 2HSQA 2XLOA 3QTHA 3UNGC 1LI5A 1Z23A 1TWGA 1GS9A 5EHHA 1J8YF 2W4BA 3LAYA 3V7OA 1RKCA 3UR3C 5KYUB 1AVOB 4L6RA 1YVIA 4BPMA 4CS9C 3F47A 2CNWD 3V5YA 2JX0A 2WZFA 3L8IA 3MFNA 1HMDA 2LIGA 3JSEO 1NZEA 4E0IA 1UFBA 4DBRA 5KYYB 1I4YA 1WOLA 5A6BA 1MNEA 4AX2A 1YARO 2Q9BA 5F5HA 1A7DA 2HMQA 4YL0A 4YT4A 3FOOA 1D1BA 4Z9JA 2YL7A 3J06A 1ZU5A 3AGUA 3OEOA 3AG3C 3L34A 1D0XA 4E17A 5KYXB 3S90A 5T3TA 4E7SA 2CYDA 5DS4A 1BR2A 2XSEA 2I15A 3UGPA 4A2NB 3R2PA 3U9MA 2WZLA 4Q5SF 3DZAA 4BEJA 4MTFA 4AE4B 4IWBA 1Y4CA 1OXBA 1TFKB 5BQHA 3NMJA 5B3IA 4Z9HA 3B0PA 4FX5A 2OJED 1K04A 4N6HA 1OCOC 2YQYA 3AG2C 1Z6AA 2EIJC 3IEEA 3SXYA 3SP1A 1KNYA 2WB7A 4MVOA 5D91A 4G7HF 2EIMC 4E7ZA 3VAYA 1ZW2A 4I1OB 4BJTA 4C3BA 2L6HA 3OA1A 3K33A 2L81A 3KYJA 1G4US 5L0IA 1ZHWA 1VOMA 1MMAA 3K1IA 3DAGA 4JZAA 2A0UA 2H7BA 3T4RA 2KW3C 1OR3A 1GGQA 1ZHXA 3O55A 3T6GB 2YL3A 4IB4A 1T6QA 5JLIA 4EIYA 1JPNA 1V55C 1YJGA 2D5RB 2XLVA 3HNIA 4IJJA 5FCLA 3ABLC 3M79A 5E33A 1VYIA 2Q00A 4NTAA 3MLGA 4YT2A 2KK1A 1C17M 5DQZA 5A6AA 1WASA 3EPVA 1ZVZA 4BJ6A 4U5GA 5JP7A 2P61A 2VCAA 1JRAA 2VCBA 3HKKA 3K66A 3RVZA 4FWVA 4AL1A 3B0VC 1VB5A 1AEPA 1R5ID 2D4UA 4UDVA 2Y3HA 4J7YA 3GM1A 3K1IC 3U0CA 2J7PA 1O3UA 4XLPF 4U5CE 4JTDB 3UMHA 3EGDA 2XRHA 2R02A 2YRFA 3DKAA 4JKVA 1JPJA 3NYMA 3FMSA 4U9DA 3RW0A 5B3SC 3RQGA 3PDMP 1LS4A 1ZU4A 2L6FA 4GYTA 4NCQA 2JD3A 3S29A 5JT4A 1M6TA 2IM8A 4K0DA 1OQCA 4HFKB 3E9VA 2KQ9A 4MTGA 3UMKA 3AG1C 4BJ6C 5A6KA 4QDLA 3TOLA 2XL4A 3FOPA 2YLIA 1K05A 5KYUA 4C3DA 2CW0F 4PFOA 3DE8A 5BQIA 5A6JA 4BG0A 1BZ4A 2WL8A 5JSLA 3MBGA 3U3BA 5KYYA 3EHNA 3FAJA 3LS1A 2YZSA 2NG1A 2PF4E 2RSEB 1VTMP 1ZHZA 5JVEA 4EBBA 4EBJA 4IARA 3C8GB 4GQHA 4NTFA 4AK9A 1OCRC 3OWTA 1Z63A 1H7IA 5KYXA 3C18A 1BDJB 2LK4A 1SMYF 1Q0GA 1QPUA 2OG2A 2V26A 4NTBA 4EKWA 3BEHA 4G7ZF 1MMNA 2IXMA 4HEAJ 3U8VA 5TJ5E 2XLHA 2Q3TA 1S7ZA 4O6YA 1E83A 2HS5A 1RKEA 1LIHA 1Z7Qc 4U9EA 3VM6A 3IQTA 2P0NA 5DVWA 2GA0A 4EBKA 1ZYRF 4XEVA 4BJ5A 2O9XA 4P9TA 1IW7F 3LUTB 4OD5A 2LFFA 1M2VB 3ZC4A 1TWAA 3JSZA 3C63A 4J30B 3M4CA 5E2QA 1PD1A 2GDCA 3X2QC 5DLJA 2ETSA 4W8PA 1A7EA 4KNVA 2HJ3A 1CGOA 1CPQA 2X51A 1ZZPA 3TQOA 1U6HA 4RD9A 3EQLF 3ZDLA 4B6IA 5HSWA 1EKYA 3K6BA 4I3MA 2R7UA 5DS6A 3W2WA 1BR4A 2XS1A 3ATPA 4LERA 2IXPA 2IBFA 3G4ZA 3RYLA 1RCPA 4EHPA 3TULA 2IOQA 1EA8A 4DOZA 3POVA 3ZQVA 3CSKA 1SZIA 2R7OA 4O79A 4OD4A 2ASRA 4BJ5C 3ZTMA 1V54C 2KSFA 1MNDA 1OKKA 1M56C 4JTCB 1VLTA 4CS8A 1TR2A 3FXHA 2CGEA 1H6GA 1NLXA 1YDIA 3HJCA 3M1CB 1CGNA 1QKRA 4OINF 4CBEA 4IAOA 3Q6NA 3T6JA 1AUEA 1JMWA 1LI7A 1XZPA 2J9UA 4CSAA 2R9RB 4EUKB 1Y6DA 3HNKA 4YWQA 3T6BA 2AP3A 3N2ZB 3TOMA 5L3VA 3UGOA 4U5EE 1YYXA 3FDQA 1OXKA 3AQBA 1NG1A 1HW2A 1YAUO 3KPHA 3VRCA 1OW6A 1T6IA 4U5BE 4CIPA 4YN0B 3FHDA 4CS8C 4D4NA 2E87A 2OU6A 2LP4A 2R25A 3S27A 4PFPA 2G3VA 4MVQA 2M64A 2A1DD 3KH2A 4N6CA 4XWJA 3UMIA 2A6HF 5AC4A 2W4MA 5EGYA 1NU9C 2EINC 1E86A 4BEMJ 4G78A 3AOUA 4KC9A 4CSAC 3B0UX 4E18A 2P7VA 2AVKA 2DGJA 3MYIA 4K1OA 4M63A 2YLGA 2ICWG 2OKUA 4G7OF 5T1DB 5A69A 1RKEB 3C8GA 2VH3A 3PMRA 4JRZA 4QI0A 1G8XA 4C3EA 5BUOA 2H7OA 2X0CA 1FR0A 2PFDA 4XPYA 4JJFA 3U5SA 1ST6A 4PJJA 2OOCA 2Z15A 3AGTA 4MVMA 2NUTA 4CDVA 3ASOC 3JTLO 3IPMO 3ITFA 3L8JA 4IRUA 1QZXA 1ZHTA 3H2UA 2J9VA 2XLMA 1RXQA 3CZ6A 3DAFA 1WGWA 1XWJA 3DM5A 3N0TA 3RQFA 1VMAA 4D4XA 3O6XA 1NFNA 4FAPB 2JPUA 2HJMA 3I5QA 2A6EF 3SXZA 1M2VA 2OEXA 3NG1A 3DWWA 1OW7A 2YHSA 4CDAA 2Y39A 2R7RA 2HMZA 4MTOA 1FTSA 3PHF2 4AL0A 1ORSC 3CEXA 1EI7A 1GQAA 1KTMA 4DJ9A 2R7QA 4LDRA 5A6BD 3C8ZA 2YL1A 1M2OA 2WZGA 1LE4A 2HZ8A 4MVRA 5B1BC 1HE9A 4RDAA 5AGFA 3TJ6A 3U2LA 1DOVA 1A41A 2AWCA 4NY3A 3K7DA 5CI9A 2R05A 2VASA 4N06A 1VYKA 2Y69C 1TQGA 4WGZA 1ORJA 2BE5F 4XPWA 3PCVA 3B9QA 3C8GD 5JUAA 3EGXA 4MNDA 3SYNA 3TD7A 1SR2A 4JEBA 4U5FE 4IAQA 1LS1A 4Q7CA 2YWAA 2DI3A 3IQ6A 5D92A 4FESA 1E84A 1MMGA 1WTYA 1NSGB 2G62A 3DMDA 1PV3A 1UG7A 4F4BA 4PJNA 4HFFB 2Y3GA 1ZHYA 3Q7GA 2GAQA 4E0HA 4YT5A 2MWQA 2R7WA 4J32B 1RJ9A 2W9YA 4NC3A 1LPEA 1TWCA 3U8PA 2ZXOA 2DB4A 3QVYA 4PK4A 1O5HA 1T01A 2A69F 2EPMX 2HSBA 3ECSA 5L0CA 3U2MA 2UUIA 4EWCA 3ZWIA 2R7XA 4JEAA 5L0HA 1LVKA 3JT1A 5BQGA 2R7VA 2V3CC 2LFDA 3W8HA 2NUTB 1TFOB 2NSGA 2VB6A 4XPXA 4JURI 3X1OA 4BJ1A 2EIKC 1QLEC 3QVZA 4CJGA 1G5ZA 3ZSUA 1FNTc 1ORYA 3RFYA 3W2VA 2LCHA 2J7PD 2Y3BA 3GEIA 3JRTA 4Q4ZF 3ZTZA 1YA9A 2Q9CA 3GODA 4DVZA 4U5HA 4H54A 2C03A 2YLDA 5HV9A 3EH2A 1M57C 1Q0FA 4AE4A 5AC5A 4KI2A 2NPUA 2Y3DA 4JC7A 4RBNA 3I4UA 4XEKA 5CI8A 3RH3A 2NUPB 256BA 3ZVRA 4O6MA 1U89A 3HNJA 4LACB 3US6A 4G0HA 2TMVP 2HV6A 5CIVA 1GM5A 2OQMA 4JCHA 2HV7A 3DXJF 4ULVA 2PP4A 2YL0A 2CNWA 1JOGA 1Z3IX 2W45A 3SEOA 4ZLDA 3TK0A 2M4EA 2ZXPA 3VF0A 3EZIA 2A0BA 2WVNA 2QY9A 3LNRA 1FMVA 4P9FA 3RKOF 1OCZC 3EGXB 3A11A 3DJNB 1JR8A 3HNLA 1QQ3A 3Q6MA 4WABA 4CDYA 4PJLA 5KYWA 3KMIA 4MW8A 3QW1A 2L9JA 2J45A 1H9TA 1Q0DA 4QI2A 3LLKA 3IHUA 3EHMA 4XQ1A 1MQVA 5K0IA 5COFA 1HE1A 5DS5A 2J0XA 4LLCA 4CX9A 1D1AA 1NU7D 3ZQYA 3T9OA 3IQCA 4O6NA 3S0XA 1T9KA 2KNHA 1YZCA 1RJ9B 3RF3A 2LD6A 3O10A 2ZXRA 4I1MA 2PX0A 4CS7A 3W8IA 3ASNC 3RVYA 1OW8A 2VC9A 1D0YA 1C03A 1R4TA 1TWHA 1A7VA 1BBHA 5L0FA 2EPOA 1PD0A 1T6UA 1YYJA 2XL8A 3RIPA 3LNMB 3W4YA 1HW1A 2Q4FA 4N4WA 2F22A 4OIPF 2XLDA 3F46A 3NMKA 2HFIA 3GWLA 1SYQA 1I4ZA 1E85A 2CDQA 1A0BA 1OKKD 2J0WA 3GM2A 3HLZA 2EPNA 2H7VC 2PBEA 2MYSA 3O39A 4I44A 4YL1A 4R32A 2A68F 3GWNA 3TJ5A 1Q0MA 1WN0A 2BL2A 3B29A 2IYLD 3MX3A 1QVXA 1TKNA 2RD9A 3H65A 4CIHA 2WVQA 2QE9A 3NYJA 2PNOA 2PX3A 2GWWA 4KBLA 2WVOA 3HTKC 1JAFA 2KJGA 3FAPB 4MS2A 5L3QA 4C7OA 1EQ1A 2NSFA 1FFHA 2KC3A 2DYRC 2KGOA 3QZCA 2R7SA 3JRMO 4WGYA 1C02A 4DRIB 3ABKC 3EFOB 3L0IA 3GM3A 2YVKA 3JCUQ 3LEVA 3G4XA 2LSEA 2XXAA 2J9WA 2NUPA 1XZQA 3S9OA 3ABMC 3VYWA 1Q0KA 1H9GA 1YA7O 3DI5A 3GEHA 3KL4A 4K7BA 3U3FA 1WWPA 5KYNA 2L7AA 4LDKA 2VCCA 4XLNF 5DQTA 3DE9A 3NMIA 2R03A 2FFHA 1E2XA 3H2VA 4HE8D 5KYWB 2Q9AA 4WJ0A 1FAPB 3WODF 4ER9A 4YJWA 1HY5A 2G3KA 1O87A 4W8KA 2DYSC
chains in the Genus database with same CATH topology
2OKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OKU A; 
#chains in the Genus database with same CATH topology
 1BR1 A;  3S28 A;  3ZG1 A;  4JVS A;  4X0R A;  4MVU A;  1U0B B;  2OCC C;  3CAX A;  4JE9 A;  2P6V A;  4DRH B;  3EG9 B;  3NKE A;  2FGY A;  3EH1 A;  1WAT A;  1ZW3 A;  3EZH A;  4DVY P;  4ONS A;  4A4A A;  3SNH A;  2MHR A;  4ZLC A;  3M15 A;  3I5P A;  3Q7L A;  1APC A;  1N1C A;  4Z9I A;  2FAP B;  4LDQ A;  2P1A A;  3G50 A;  4PR9 A;  1L3P A;  3LJB A;  1B68 A;  3JZ0 A;  1D0Z A;  5E3A A;  4ANJ A;  1DOW A;  2H8A A;  4DBQ A;  5L0J A;  3CQZ A;  4ULW A;  2XL6 A;  1OR2 A;  3LES A;  2YEV A;  3RQE A;  3EJN A;  2J8W A;  4YK5 A;  1J8M F;  1S05 A;  4P6I C;  1W2W A;  2QLA A;  1NBB A;  3WAQ A;  1HMO A;  2EPK X;  1FFT C;  3N24 A;  4J7T A;  4JTA B;  5JRA A;  3A9C A;  2IXO A;  3DD7 A;  4KNW A;  5F28 E;  1G4W R;  2HUJ A;  2YKZ A;  2BC5 A;  4XTK A;  4OIQ F;  4PAC A;  5EK0 A;  3AJM A;  5COG A;  4XEF A;  3SXK A;  3LLI A;  3GOR A;  3U9J A;  2B0J A;  3B71 A;  1SF8 A;  2C04 A;  3JYY A;  4IGG A;  4MVS A;  4C7O B;  3GEE A;  2XLE A;  4OIO F;  3DM9 B;  1CPR A;  3FVY A;  2Q7R A;  3V5X A;  4JCZ A;  1RMV A;  4MVZ A;  1V4A A;  3KYI A;  5T3W A;  5FZT A;  1D1C A;  2I8B A;  3WHN A;  5GPG B;  3ZIB A;  2XS8 A;  2UUH A;  3E70 C;  1LE2 A;  2XXA B;  2ZPA A;  1Z5Z A;  4PJM A;  2AU5 A;  5IY5 C;  3SXM A;  4JJG A;  3C7J A;  1LM3 B;  2OJQ A;  2R7T A;  4MW3 A;  1CGM E;  2AWY A;  4U5D E;  1YLM A;  4YL3 A;  3AG4 C;  3LS0 A;  3EFO A;  4DXW A;  5E3C A;  1NFO A;  3C62 A;  3NKD A;  1F1M A;  1I5N A;  1T5O A;  2XM0 A;  3QMK A;  4GEH A;  1YZA A;  4H4K C;  2CCY A;  4JW1 A;  4O7G A;  1L7C A;  2XLW A;  5JS5 A;  5L0D A;  2QTV A;  2L6G A;  2QNL A;  3MYF A;  2XM4 A;  5F5F A;  1V74 B;  1KU2 A;  2IXN A;  5B1A C;  1OCC C;  2KYH A;  1FMW A;  3R7C A;  4NQF A;  2LQG A;  1MMD A;  4JIO A;  3M4B A;  3L1M A;  3AQC A;  3V5Z A;  3IQ5 A;  3BRJ A;  2EIL C;  3NRH A;  3NYL A;  4MQ9 F;  3NDB B;  3DJU B;  4YT8 A;  4CS9 A;  1IZM A;  2GFH A;  2HKV A;  3WG7 C;  1K40 A;  2ZD9 A;  5COM A;  3SZR A;  1LKX A;  3EG9 A;  3JYH A;  1PCX A;  2B0H A;  3GAN A;  2QUP A;  3EGD B;  2J46 A;  2J9B A;  3K1H A;  4DRJ B;  3S84 A;  1VLS A;  4LLE A;  4OIR F;  1VK5 A;  4CJO A;  2ZXW C;  5L0G A;  1QSP A;  2OEV A;  2EPL X;  3QW0 A;  3KKB A;  3LEO A;  2HSQ A;  2XLO A;  3QTH A;  3UNG C;  1LI5 A;  1Z23 A;  1TWG A;  1GS9 A;  5EHH A;  1J8Y F;  2W4B A;  3LAY A;  3V7O A;  1RKC A;  3UR3 C;  5KYU B;  1AVO B;  4L6R A;  1YVI A;  4BPM A;  4CS9 C;  3F47 A;  2CNW D;  3V5Y A;  2JX0 A;  2WZF A;  3L8I A;  3MFN A;  1HMD A;  2LIG A;  3JSE O;  1NZE A;  4E0I A;  1UFB A;  4DBR A;  5KYY B;  1I4Y A;  1WOL A;  5A6B A;  1MNE A;  4AX2 A;  1YAR O;  2Q9B A;  5F5H A;  1A7D A;  2HMQ A;  4YL0 A;  4YT4 A;  3FOO A;  1D1B A;  4Z9J A;  2YL7 A;  3J06 A;  1ZU5 A;  3AGU A;  3OEO A;  3AG3 C;  3L34 A;  1D0X A;  4E17 A;  5KYX B;  3S90 A;  5T3T A;  4E7S A;  2CYD A;  5DS4 A;  1BR2 A;  2XSE A;  2I15 A;  3UGP A;  4A2N B;  3R2P A;  3U9M A;  2WZL A;  4Q5S F;  3DZA A;  4BEJ A;  4MTF A;  4AE4 B;  4IWB A;  1Y4C A;  1OXB A;  1TFK B;  5BQH A;  3NMJ A;  5B3I A;  4Z9H A;  3B0P A;  4FX5 A;  2OJE D;  1K04 A;  4N6H A;  1OCO C;  2YQY A;  3AG2 C;  1Z6A A;  2EIJ C;  3IEE A;  3SXY A;  3SP1 A;  1KNY A;  2WB7 A;  4MVO A;  5D91 A;  4G7H F;  2EIM C;  4E7Z A;  3VAY A;  1ZW2 A;  4I1O B;  4BJT A;  4C3B A;  2L6H A;  3OA1 A;  3K33 A;  2L81 A;  3KYJ A;  1G4U S;  5L0I A;  1ZHW A;  1VOM A;  1MMA A;  3K1I A;  3DAG A;  4JZA A;  2A0U A;  2H7B A;  3T4R A;  2KW3 C;  1OR3 A;  1GGQ A;  1ZHX A;  3O55 A;  3T6G B;  2YL3 A;  4IB4 A;  1T6Q A;  5JLI A;  4EIY A;  1JPN A;  1V55 C;  1YJG A;  2D5R B;  2XLV A;  3HNI A;  4IJJ A;  5FCL A;  3ABL C;  3M79 A;  5E33 A;  1VYI A;  2Q00 A;  4NTA A;  3MLG A;  4YT2 A;  2KK1 A;  1C17 M;  5DQZ A;  5A6A A;  1WAS A;  3EPV A;  1ZVZ A;  4BJ6 A;  4U5G A;  5JP7 A;  2P61 A;  2VCA A;  1JRA A;  2VCB A;  3HKK A;  3K66 A;  3RVZ A;  4FWV A;  4AL1 A;  3B0V C;  1VB5 A;  1AEP A;  1R5I D;  2D4U A;  4UDV A;  2Y3H A;  4J7Y A;  3GM1 A;  3K1I C;  3U0C A;  2J7P A;  1O3U A;  4XLP F;  4U5C E;  4JTD B;  3UMH A;  3EGD A;  2XRH A;  2R02 A;  2YRF A;  3DKA A;  4JKV A;  1JPJ A;  3NYM A;  3FMS A;  4U9D A;  3RW0 A;  5B3S C;  3RQG A;  3PDM P;  1LS4 A;  1ZU4 A;  2L6F A;  4GYT A;  4NCQ A;  2JD3 A;  3S29 A;  5JT4 A;  1M6T A;  2IM8 A;  4K0D A;  1OQC A;  4HFK B;  3E9V A;  2KQ9 A;  4MTG A;  3UMK A;  3AG1 C;  4BJ6 C;  5A6K A;  4QDL A;  3TOL A;  2XL4 A;  3FOP A;  2YLI A;  1K05 A;  5KYU A;  4C3D A;  2CW0 F;  4PFO A;  3DE8 A;  5BQI A;  5A6J A;  4BG0 A;  1BZ4 A;  2WL8 A;  5JSL A;  3MBG A;  3U3B A;  5KYY A;  3EHN A;  3FAJ A;  3LS1 A;  2YZS A;  2NG1 A;  2PF4 E;  2RSE B;  1VTM P;  1ZHZ A;  5JVE A;  4EBB A;  4EBJ A;  4IAR A;  3C8G B;  4GQH A;  4NTF A;  4AK9 A;  1OCR C;  3OWT A;  1Z63 A;  1H7I A;  5KYX A;  3C18 A;  1BDJ B;  2LK4 A;  1SMY F;  1Q0G A;  1QPU A;  2OG2 A;  2V26 A;  4NTB A;  4EKW A;  3BEH A;  4G7Z F;  1MMN A;  2IXM A;  4HEA J;  3U8V A;  5TJ5 E;  2XLH A;  2Q3T A;  1S7Z A;  4O6Y A;  1E83 A;  2HS5 A;  1RKE A;  1LIH A;  1Z7Q c;  4U9E A;  3VM6 A;  3IQT A;  2P0N A;  5DVW A;  2GA0 A;  4EBK A;  1ZYR F;  4XEV A;  4BJ5 A;  2O9X A;  4P9T A;  1IW7 F;  3LUT B;  4OD5 A;  2LFF A;  1M2V B;  3ZC4 A;  1TWA A;  3JSZ A;  3C63 A;  4J30 B;  3M4C A;  5E2Q A;  1PD1 A;  2GDC A;  3X2Q C;  5DLJ A;  2ETS A;  4W8P A;  1A7E A;  4KNV A;  2HJ3 A;  1CGO A;  1CPQ A;  2X51 A;  1ZZP A;  3TQO A;  1U6H A;  4RD9 A;  3EQL F;  3ZDL A;  4B6I A;  5HSW A;  1EKY A;  3K6B A;  4I3M A;  2R7U A;  5DS6 A;  3W2W A;  1BR4 A;  2XS1 A;  3ATP A;  4LER A;  2IXP A;  2IBF A;  3G4Z A;  3RYL A;  1RCP A;  4EHP A;  3TUL A;  2IOQ A;  1EA8 A;  4DOZ A;  3POV A;  3ZQV A;  3CSK A;  1SZI A;  2R7O A;  4O79 A;  4OD4 A;  2ASR A;  4BJ5 C;  3ZTM A;  1V54 C;  2KSF A;  1MND A;  1OKK A;  1M56 C;  4JTC B;  1VLT A;  4CS8 A;  1TR2 A;  3FXH A;  2CGE A;  1H6G A;  1NLX A;  1YDI A;  3HJC A;  3M1C B;  1CGN A;  1QKR A;  4OIN F;  4CBE A;  4IAO A;  3Q6N A;  3T6J A;  1AUE A;  1JMW A;  1LI7 A;  1XZP A;  2J9U A;  4CSA A;  2R9R B;  4EUK B;  1Y6D A;  3HNK A;  4YWQ A;  3T6B A;  2AP3 A;  3N2Z B;  3TOM A;  5L3V A;  3UGO A;  4U5E E;  1YYX A;  3FDQ A;  1OXK A;  3AQB A;  1NG1 A;  1HW2 A;  1YAU O;  3KPH A;  3VRC A;  1OW6 A;  1T6I A;  4U5B E;  4CIP A;  4YN0 B;  3FHD A;  4CS8 C;  4D4N A;  2E87 A;  2OU6 A;  2LP4 A;  2R25 A;  3S27 A;  4PFP A;  2G3V A;  4MVQ A;  2M64 A;  2A1D D;  3KH2 A;  4N6C A;  4XWJ A;  3UMI A;  2A6H F;  5AC4 A;  2W4M A;  5EGY A;  1NU9 C;  2EIN C;  1E86 A;  4BEM J;  4G78 A;  3AOU A;  4KC9 A;  4CSA C;  3B0U X;  4E18 A;  2P7V A;  2AVK A;  2DGJ A;  3MYI A;  4K1O A;  4M63 A;  2YLG A;  2ICW G;  2OKU A;  4G7O F;  5T1D B;  5A69 A;  1RKE B;  3C8G A;  2VH3 A;  3PMR A;  4JRZ A;  4QI0 A;  1G8X A;  4C3E A;  5BUO A;  2H7O A;  2X0C A;  1FR0 A;  2PFD A;  4XPY A;  4JJF A;  3U5S A;  1ST6 A;  4PJJ A;  2OOC A;  2Z15 A;  3AGT A;  4MVM A;  2NUT A;  4CDV A;  3ASO C;  3JTL O;  3IPM O;  3ITF A;  3L8J A;  4IRU A;  1QZX A;  1ZHT A;  3H2U A;  2J9V A;  2XLM A;  1RXQ A;  3CZ6 A;  3DAF A;  1WGW A;  1XWJ A;  3DM5 A;  3N0T A;  3RQF A;  1VMA A;  4D4X A;  3O6X A;  1NFN A;  4FAP B;  2JPU A;  2HJM A;  3I5Q A;  2A6E F;  3SXZ A;  1M2V A;  2OEX A;  3NG1 A;  3DWW A;  1OW7 A;  2YHS A;  4CDA A;  2Y39 A;  2R7R A;  2HMZ A;  4MTO A;  1FTS A;  3PHF 2;  4AL0 A;  1ORS C;  3CEX A;  1EI7 A;  1GQA A;  1KTM A;  4DJ9 A;  2R7Q A;  4LDR A;  5A6B D;  3C8Z A;  2YL1 A;  1M2O A;  2WZG A;  1LE4 A;  2HZ8 A;  4MVR A;  5B1B C;  1HE9 A;  4RDA A;  5AGF A;  3TJ6 A;  3U2L A;  1DOV A;  1A41 A;  2AWC A;  4NY3 A;  3K7D A;  5CI9 A;  2R05 A;  2VAS A;  4N06 A;  1VYK A;  2Y69 C;  1TQG A;  4WGZ A;  1ORJ A;  2BE5 F;  4XPW A;  3PCV A;  3B9Q A;  3C8G D;  5JUA A;  3EGX A;  4MND A;  3SYN A;  3TD7 A;  1SR2 A;  4JEB A;  4U5F E;  4IAQ A;  1LS1 A;  4Q7C A;  2YWA A;  2DI3 A;  3IQ6 A;  5D92 A;  4FES A;  1E84 A;  1MMG A;  1WTY A;  1NSG B;  2G62 A;  3DMD A;  1PV3 A;  1UG7 A;  4F4B A;  4PJN A;  4HFF B;  2Y3G A;  1ZHY A;  3Q7G A;  2GAQ A;  4E0H A;  4YT5 A;  2MWQ A;  2R7W A;  4J32 B;  1RJ9 A;  2W9Y A;  4NC3 A;  1LPE A;  1TWC A;  3U8P A;  2ZXO A;  2DB4 A;  3QVY A;  4PK4 A;  1O5H A;  1T01 A;  2A69 F;  2EPM X;  2HSB A;  3ECS A;  5L0C A;  3U2M A;  2UUI A;  4EWC A;  3ZWI A;  2R7X A;  4JEA A;  5L0H A;  1LVK A;  3JT1 A;  5BQG A;  2R7V A;  2V3C C;  2LFD A;  3W8H A;  2NUT B;  1TFO B;  2NSG A;  2VB6 A;  4XPX A;  4JUR I;  3X1O A;  4BJ1 A;  2EIK C;  1QLE C;  3QVZ A;  4CJG A;  1G5Z A;  3ZSU A;  1FNT c;  1ORY A;  3RFY A;  3W2V A;  2LCH A;  2J7P D;  2Y3B A;  3GEI A;  3JRT A;  4Q4Z F;  3ZTZ A;  1YA9 A;  2Q9C A;  3GOD A;  4DVZ A;  4U5H A;  4H54 A;  2C03 A;  2YLD A;  5HV9 A;  3EH2 A;  1M57 C;  1Q0F A;  4AE4 A;  5AC5 A;  4KI2 A;  2NPU A;  2Y3D A;  4JC7 A;  4RBN A;  3I4U A;  4XEK A;  5CI8 A;  3RH3 A;  2NUP B;  256B A;  3ZVR A;  4O6M A;  1U89 A;  3HNJ A;  4LAC B;  3US6 A;  4G0H A;  2TMV P;  2HV6 A;  5CIV A;  1GM5 A;  2OQM A;  4JCH A;  2HV7 A;  3DXJ F;  4ULV A;  2PP4 A;  2YL0 A;  2CNW A;  1JOG A;  1Z3I X;  2W45 A;  3SEO A;  4ZLD A;  3TK0 A;  2M4E A;  2ZXP A;  3VF0 A;  3EZI A;  2A0B A;  2WVN A;  2QY9 A;  3LNR A;  1FMV A;  4P9F A;  3RKO F;  1OCZ C;  3EGX B;  3A11 A;  3DJN B;  1JR8 A;  3HNL A;  1QQ3 A;  3Q6M A;  4WAB A;  4CDY A;  4PJL A;  5KYW A;  3KMI A;  4MW8 A;  3QW1 A;  2L9J A;  2J45 A;  1H9T A;  1Q0D A;  4QI2 A;  3LLK A;  3IHU A;  3EHM A;  4XQ1 A;  1MQV A;  5K0I A;  5COF A;  1HE1 A;  5DS5 A;  2J0X A;  4LLC A;  4CX9 A;  1D1A A;  1NU7 D;  3ZQY A;  3T9O A;  3IQC A;  4O6N A;  3S0X A;  1T9K A;  2KNH A;  1YZC A;  1RJ9 B;  3RF3 A;  2LD6 A;  3O10 A;  2ZXR A;  4I1M A;  2PX0 A;  4CS7 A;  3W8I A;  3ASN C;  3RVY A;  1OW8 A;  2VC9 A;  1D0Y A;  1C03 A;  1R4T A;  1TWH A;  1A7V A;  1BBH A;  5L0F A;  2EPO A;  1PD0 A;  1T6U A;  1YYJ A;  2XL8 A;  3RIP A;  3LNM B;  3W4Y A;  1HW1 A;  2Q4F A;  4N4W A;  2F22 A;  4OIP F;  2XLD A;  3F46 A;  3NMK A;  2HFI A;  3GWL A;  1SYQ A;  1I4Z A;  1E85 A;  2CDQ A;  1A0B A;  1OKK D;  2J0W A;  3GM2 A;  3HLZ A;  2EPN A;  2H7V C;  2PBE A;  2MYS A;  3O39 A;  4I44 A;  4YL1 A;  4R32 A;  2A68 F;  3GWN A;  3TJ5 A;  1Q0M A;  1WN0 A;  2BL2 A;  3B29 A;  2IYL D;  3MX3 A;  1QVX A;  1TKN A;  2RD9 A;  3H65 A;  4CIH A;  2WVQ A;  2QE9 A;  3NYJ A;  2PNO A;  2PX3 A;  2GWW A;  4KBL A;  2WVO A;  3HTK C;  1JAF A;  2KJG A;  3FAP B;  4MS2 A;  5L3Q A;  4C7O A;  1EQ1 A;  2NSF A;  1FFH A;  2KC3 A;  2DYR C;  2KGO A;  3QZC A;  2R7S A;  3JRM O;  4WGY A;  1C02 A;  4DRI B;  3ABK C;  3EFO B;  3L0I A;  3GM3 A;  2YVK A;  3JCU Q;  3LEV A;  3G4X A;  2LSE A;  2XXA A;  2J9W A;  2NUP A;  1XZQ A;  3S9O A;  3ABM C;  3VYW A;  1Q0K A;  1H9G A;  1YA7 O;  3DI5 A;  3GEH A;  3KL4 A;  4K7B A;  3U3F A;  1WWP A;  5KYN A;  2L7A A;  4LDK A;  2VCC A;  4XLN F;  5DQT A;  3DE9 A;  3NMI A;  2R03 A;  2FFH A;  1E2X A;  3H2V A;  4HE8 D;  5KYW B;  2Q9A A;  4WJ0 A;  1FAP B;  3WOD F;  4ER9 A;  4YJW A;  1HY5 A;  2G3K A;  1O87 A;  4W8K A;  2DYS C; 
#chains in the Genus database with same CATH homology
 2OKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...