2OKUA

The crystal structure of the acyl-coa dehydrogenase family protein from porphyromonas gingivalis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
122
structure length
122
Chain Sequence
QVVAAIRHITTGTYIARIREEYQQTEVKPELQPMKEALARMTDRAEALIAFVTEQKDQELLDFQARRLVEMTAHAVFGHLLMLAANDDDSFRQSAEVYLRYGQAEQEKIDSYVRAFRPEELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Acyl-CoA dehydrogenase family protein
publication title The crystal structure of the acyl-CoA dehydrogenase family protein from Porphyromonas gingivalis
rcsb
source organism Porphyromonas gingivalis
molecule tags Oxidoreductase
total genus 46
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12186 AcylCoA_dehyd_C Acyl-CoA dehydrogenase C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.470 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Acyl-CoA dehydrogenase, C-terminal domain 2okuA00
2OKUA
chains in the Genus database with same CATH superfamily
1VYIA 2XRHA 4YN0B 3UMIA 5BQGA 2WB7A 2Y3BA 3T4RA 3U3FA 2YL7A 4W8PA 1HMOA 4MTFA 4HE8D 4PJLA 2FAPB 4ANJA 4XLNF 1EKYA 3R7CA 2W45A 3ZDLA 1Y6DA 2Q3TA 3MYIA 1CPQA 1V55C 3RIPA 1LVKA 4IB4A 4G7OF 3LS1A 2NSFA 3GEHA 1FR0A 1PD0A 1K05A 5COFA 4O7GA 2M4EA 4I1MA 3K33A 4YT4A 1D0ZA 3DI5A 3U8PA 4CSAA 2QE9A 5E3AA 3B0UX 3M79A 2XXAA 2J8WA 2KW3C 2VCBA 2YLIA 4QDLA 1YJGA 3HNKA 5T1DB 3ZC4A 3W2VA 1A7VA 4DRJB 2ZPAA 1TWAA 3FAJA 4MVMA 2G3VA 2VC9A 4G78A 2V26A 3MYFA 4XWJA 1O87A 1R4TA 4PJNA 4U5HA 3U0CA 3IQCA 3NDBB 2IYLD 2HJMA 1ZHYA 2LSEA 3A11A 3DZAA 2YHSA 3VF0A 4CDVA 3IHUA 3HJCA 2A0BA 5L0GA 5L0JA 4C7OA 2J0WA 2HS5A 2JD3A 3DAFA 2QUPA 3Q7LA 4I1OB 2P1AA 3EHNA 5A69A 4DBQA 3T6BA 1C17M 1VYKA 4XQ1A 1HW1A 1WOLA 4JCZA 4BEMJ 1Y4CA 1ZYRF 4HFFB 1MNDA 2ZXWC 2DGJA 4XPWA 4JW1A 1OXBA 2WZLA 3NRHA 3IQ5A 2Q9BA 4YWQA 1V54C 1RJ9B 4CJGA 4CS9C 5A6BA 2E87A 1SF8A 1LM3B 5L0FA 5JSLA 3JSZA 1YDIA 2AVKA 2XM0A 2XLWA 1QKRA 3HNLA 4GQHA 5DS4A 4HEAJ 5F5HA 3ZTMA 3HTKC 1LIHA 2PX3A 4EHPA 3RKOF 2VCCA 3RYLA 2BL2A 1M2OA 3DJUB 2HUJA 4JTCB 5JS5A 3O10A 1YA7O 1NU7D 2XL6A 4DVYP 2R7QA 3DXJF 2KJGA 3FOPA 2GFHA 2MYSA 2RSEB 2VH3A 4JCHA 4WGYA 3I5PA 4OIQF 1OR3A 1UG7A 3QZCA 3EPVA 1RMVA 3CQZA 2LQGA 1HY5A 4H54A 5BQIA 3K7DA 3HKKA 4J32B 4OIRF 3EZHA 3GANA 1M2VA 2WVQA 2R7OA 4CS8C 1HE1A 3T6JA 2LK4A 4EIYA 1SMYF 2WVOA 2HJ3A 1CGOA 4KNWA 1BZ4A 2H7OA 2XLVA 3SNHA 2HKVA 3ABKC 4ZLCA 3DMDA 2KC3A 3EFOA 3T9OA 2P0NA 2ASRA 4AE4A 4I3MA 2YZSA 4FESA 4RDAA 3KYIA 5IY5C 1OCCC 2OCCC 1L7CA 2PX0A 5HSWA 1TR2A 1Q0DA 3MFNA 1OKKD 2I8BA 2YRFA 5B1BC 3OWTA 3ASNC 5DLJA 4G7HF 2C03A 3TD7A 4EUKB 5K0IA 3K66A 1F1MA 4JKVA 3TJ5A 2J7PD 2ICWG 4JJFA 1DOVA 2ETSA 3WAQA 1E83A 2KSFA 4NTAA 1ZU4A 2NSGA 1QLEC 1ST6A 2IM8A 5A6AA 1YAUO 1C03A 1Q0GA 3QW1A 2YQYA 2ZD9A 4QI2A 2HV7A 2DYRC 4MVZA 3LLIA 3B71A 4G0HA 3K1IC 4PR9A 3VAYA 3V7OA 5JRAA 2QY9A 3WHNA 1OW6A 5KYYB 1YA9A 3GEIA 3RFYA 2R7VA 4BG0A 1CGNA 1VLSA 2DYSC 2XL8A 2XSEA 5A6KA 1BR2A 3I5QA 1JMWA 3QW0A 4KC9A 4MS2A 3E9VA 3NMJA 3O6XA 5KYNA 1ORJA 2XS8A 4YL3A 3N0TA 1NU9C 1JOGA 3C8GB 2HFIA 3T6GB 4ULVA 3FDQA 4U5GA 1WN0A 3M4CA 5DS6A 4G7ZF 3FAPB 3B9QA 5COMA 2ZXPA 2GAQA 4PK4A 3PHF2 1SR2A 3U2LA 4CSAC 1Z3IX 3H2VA 2PBEA 5KYWB 3QMKA 4XLPF 2EILC 3LEVA 5EGYA 3U2MA 3ABMC 2H7VC 4JC7A 2H8AA 4JZAA 3ZWIA 2CDQA 3AGTA 4N4WA 4BJTA 2HSQA 2VB6A 2A69F 5JP7A 3VM6A 2Q4FA 3NMKA 4WJ0A 4E17A 5JT4A 4LLEA 3W8IA 3ATPA 2YLDA 2HMZA 3JRMO 2LP4A 4O6YA 3EH1A 3TULA 1OW7A 4CIHA 1AUEA 1RJ9A 3DE8A 3X1OA 1VTMP 2PFDA 3C18A 3O55A 4NC3A 2RD9A 4MTGA 2OEVA 1ZHWA 2AWCA 2Q00A 4MQ9F 2R7WA 1FFTC 1NFNA 2KGOA 3Q6NA 3PDMP 3LS0A 2HZ8A 1MNEA 2GA0A 3EHMA 2MHRA 4IAOA 1LI5A 5TJ5E 2J9BA 2WL8A 1ZVZA 3G4ZA 1E84A 1AVOB 3IQTA 5HV9A 5F5FA 2PP4A 1H9TA 2ZXRA 1T6QA 256BA 1NSGB 3BRJA 3TQOA 1LE2A 4OINF 1TFOB 2OU6A 2P6VA 3ITFA 4JJGA 4DBRA 2CGEA 3US6A 4U5BE 1T01A 5COGA 4XTKA 1FMWA 4FWVA 2XLDA 4PFOA 2EPMX 1Q0FA 4L6RA 4GYTA 2XLEA 1HMDA 3Q6MA 4CDAA 2R25A 3ASOC 1XZPA 1YYJA 1MMDA 3M4BA 5CI9A 2X0CA 1YARO 2A6HF 1E85A 2KQ9A 2X51A 1HE9A 3E70C 3NYMA 1S7ZA 2KYHA 3C7JA 4OIOF 1GS9A 3ZSUA 1CPRA 4O79A 3MBGA 3KH2A 5KYXB 4U5FE 1T6IA 4YL0A 3L1MA 1FTSA 3LNMB 5D92A 1IW7F 1FAPB 1S05A 1YZCA 2OG2A 4IGGA 4JEAA 4CDYA 1E86A 1GQAA 1MMGA 2JPUA 2XLMA 2L6HA 3JT1A 1OXKA 1YZAA 3LUTB 5FCLA 3JYHA 2EIMC 1MMNA 2LIGA 2R05A 1ORSC 2D5RB 3GORA 4IJJA 3SP1A 1KNYA 1RXQA 1VMAA 2B0HA 3AQCA 1BR1A 4ER9A 5DQTA 1D0XA 1SZIA 1MQVA 5L0HA 4K1OA 3U3BA 2WVNA 3O39A 4JTDB 1NBBA 2W9YA 4XPXA 3G4XA 4KNVA 4JEBA 3AQBA 4U5CE 1IZMA 2L9JA 1GM5A 2XLHA 5KYYA 1NZEA 4LDRA 4IAQA 3DM9B 3W8HA 1ORYA 1G4US 1YLMA 2DB4A 1T5OA 3LJBA 5L0DA 3Q7GA 3MX3A 3PCVA 2C04A 2YL1A 3MLGA 2OEXA 3C8GA 2EPOA 1ZHZA 4IWBA 1BDJB 3GM2A 4Z9IA 4EBKA 4PJMA 2D4UA 3TOMA 5L0CA 1TWCA 2YEVA 3ZQYA 1OCOC 1GGQA 2Y3HA 3A9CA 2CNWA 4LACB 1OQCA 2BE5F 4MW8A 3SZRA 3UMHA 3W2WA 4YT8A 1R5ID 2LFDA 2BC5A 5KYWA 1KTMA 5AGFA 1TWGA 3FHDA 4NTFA 5A6BD 3V5YA 2IXOA 3CEXA 1H6GA 3EJNA 1Q0MA 3JZ0A 4MTOA 3S27A 2NUTB 1FFHA 1L3PA 3KL4A 2Y69C 1WGWA 4DVZA 2ZXOA 1W2WA 4AL1A 2IXPA 2EIJC 1JR8A 1XWJA 2GDCA 2QTVA 4JTAB 3X2QC 4DXWA 3U8VA 3ZG1A 2YLGA 3C62A 2OJQA 3S28A 4CJOA 2XL4A 2AWYA 1D0YA 4C3DA 4UDVA 2HV6A 1EA8A 2CCYA 5T3TA 3TK0A 5CI8A 2QNLA 1LE4A 4CS8A 3B0VC 1UFBA 2TMVP 3CAXA 4J7TA 2AP3A 2NUPB 3IEEA 2H7BA 4H4KC 4DJ9A 1VOMA 1YVIA 4EBJA 4ONSA 3AJMA 3RW0A 4AK9A 2IXMA 4C7OB 2LD6A 3ZIBA 4M63A 3EGDB 3U9MA 4GEHA 4YL1A 1AEPA 2JX0A 5B3SC 3C63A 4BJ1A 2R7RA 1ZW2A 1OW8A 2Y3GA 1FMVA 2I15A 2J46A 3RVZA 4BJ6A 5B1AC 1QVXA 3EH2A 4JURI 3H65A 2P61A 2NG1A 4EBBA 4PJJA 4D4XA 1T9KA 3F46A 4MVRA 4MW3A 2Q7RA 4P9FA 2QLAA 1E2XA 4U9EA 2LCHA 4Z9HA 5DS5A 4U9DA 1LPEA 3DM5A 3LESA 3QTHA 2YL0A 2V3CC 4U5DE 3UGPA 1A41A 4Q7CA 3S90A 4I44A 4E7ZA 5KYXA 3K1IA 1TKNA 1Z23A 1WASA 4C3EA 2EIKC 1O3UA 5E2QA 3K1HA 3W4YA 2A6EF 3AG1C 5KYUA 4XEKA 3OEOA 1XZQA 2EPNA 1WWPA 1EI7A 4U5EE 4E0HA 2A1DD 1VLTA 4X0RA 3EGXB 4J30B 3S0XA 3RQFA 3SXZA 4XEFA 1WTYA 3ECSA 2CW0F 2UUHA 4N6CA 1VK5A 3FVYA 4FAPB 4BEJA 2PF4E 2XS1A 3LAYA 1QZXA 5L0IA 3UGOA 1A7DA 4YJWA 3R2PA 2EPLX 3AOUA 1K04A 3SEOA 2W4BA 4E0IA 1A0BA 1OCZC 4R32A 3K6BA 1PV3A 1APCA 1LKXA 2GWWA 3DKAA 3EG9B 1NFOA 1Z5ZA 4LDKA 4NCQA 1V4AA 3HNIA 4XPYA 5BQHA 1MMAA 3N24A 4MVOA 4XEVA 3AG2C 4AX2A 4D4NA 1RKEB 4JE9A 4IRUA 3KPHA 1Z7Qc 2KNHA 3RF3A 3L34A 1T6UA 3JSEO 4ZLDA 3GWLA 1JAFA 1KU2A 2HSBA 1ZHTA 2Z15A 1U89A 2EPKX 4RD9A 5JUAA 1D1BA 3TJ6A 3S84A 3S9OA 2IXNA 3GWNA 5EK0A 1G4WR 1OKKA 4K0DA 3AG4C 5AC5A 1PCXA 1RKCA 2FGYA 2R03A 2Y3DA 4KBLA 4MNDA 5D91A 3WODF 4DRIB 3V5ZA 3UNGC 3DE9A 1YYXA 2J7PA 2VASA 3I4UA 1VB5A 5T3WA 2OOCA 3IQ6A 3V5XA 3GM1A 2KK1A 3ZTZA 4CBEA 4MVUA 3UR3C 1HW2A 2WZGA 3ZVRA 4E18A 4IARA 4O6NA 2J9WA 5DVWA 3GEEA 1LS1A 1QSPA 3OA1A 3AGUA 3NMIA 5FZTA 5GPGB 5BUOA 3QVYA 5CIVA 1ZU5A 5A6JA 3L8IA 3NG1A 4YK5A 1ZHXA 2NUTA 2G3KA 4NTBA 3VYWA 4B6IA 5L3VA 2XXAB 3C8ZA 2P7VA 4JIOA 3S29A 2J9VA 4OIPF 1K40A 1H9GA 1TFKB 3TOLA 2W4MA 2Q9CA 4EWCA 3H2UA 2O9XA 2R7XA 4CIPA 1C02A 3G50A 1I5NA 1H7IA 2UUIA 3DJNB 2L7AA 4OD5A 3UMKA 5L3QA 3J06A 1SYQA 4W8KA 1J8YF 1JPJA 1LS4A 1G5ZA 3FOOA 1NLXA 3LNRA 2R9RB 3EZIA 3NKEA 2NUPA 2J9UA 2NPUA 4QI0A 3RVYA 5B3IA 4Q5SF 3PMRA 4NQFA 3SXMA 2J0XA 3IPMO 3N2ZB 4FX5A 5JLIA 4CS9A 1RCPA 1ZW3A 2L6FA 3B29A 3NYLA 5F28E 3VRCA 1M6TA 1Z6AA 2DI3A 4HFKB 5DQZA 4DRHB 3DWWA 3HNJA 4YT5A 3U9JA 2F22A 1O5HA 1U6HA 3EGDA 4CS7A 1PD1A 4F4BA 3GODA 1I4YA 1NG1A 2YWAA 1D1AA 4BPMA 4C3BA 4E7SA 1B68A 3HLZA 4PFPA 2XM4A 3L8JA 3M1CB 4YT2A 2OKUA 2G62A 1DOWA 3RQGA 2R7TA 3JCUQ 3ZQVA 3RQEA 4BJ5C 1OR2A 4RBNA 3M15A 2Q9AA 2R02A 4K7BA 4BJ6C 3EQLF 3QVZA 3CZ6A 3JTLO 4A2NB 4CX9A 1LI7A 1BBHA 3NKDA 4O6MA 1I4ZA 4ULWA 3BEHA 2B0JA 2HMQA 3F47A 4JRZA 2IOQA 4LERA 4MVSA 4A4AA 1ZZPA 4Q4ZF 3SYNA 1OCRC 2YVKA 5E3CA 3ABLC 5JVEA 2CYDA 4JVSA 1M56C 2WZFA 1CGME 4WGZA 3NYJA 4OD4A 1M57C 1M2VB 2VCAA 2LFFA 2EINC 3U5SA 3WG7C 1FNTc 2YKZA 4NY3A 3KKBA 1D1CA 4WABA 1TQGA 3EGXA 3KYJA 5E33A 3KMIA 3EFOB 2MWQA 3L0IA 4AE4B 2L6GA 2R7SA 2A0UA 3RH3A 2R7UA 2OJED 1A7EA 4EKWA 4KI2A 4LLCA 3LEOA 1J8MF 3LLKA 4AL0A 3B0PA 4DOZA 4J7YA 1G8XA 3GM3A 5EHHA 5KYUB 1BR4A 3JYYA 1Z63A 1U0BB 1EQ1A 4MVQA 3POVA 3EG9A 3AG3C 2OQMA 2L81A 4PACA 3C8GD 4N06A 3SXYA 4N6HA 3CSKA 4P9TA 3DAGA 4P6IC 2FFHA 2IBFA 1RKEA 4LDQA 1JPNA 1Q0KA 2AU5A 1QPUA 2CNWD 2Y39A 2A68F 2XLOA 2YL3A 3FXHA 4Z9JA 3DD7A 1N1CA 3FMSA 3JRTA 5AC4A 1TWHA 2M64A 2PNOA 3SXKA 2J45A 1QQ3A 1V74B 4BJ5A 1JRAA 1WATA
chains in the Genus database with same CATH topology
2OKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OKU A; 
#chains in the Genus database with same CATH topology
 1VYI A;  2XRH A;  4YN0 B;  3UMI A;  5BQG A;  2WB7 A;  2Y3B A;  3T4R A;  3U3F A;  2YL7 A;  4W8P A;  1HMO A;  4MTF A;  4HE8 D;  4PJL A;  2FAP B;  4ANJ A;  4XLN F;  1EKY A;  3R7C A;  2W45 A;  3ZDL A;  1Y6D A;  2Q3T A;  3MYI A;  1CPQ A;  1V55 C;  3RIP A;  1LVK A;  4IB4 A;  4G7O F;  3LS1 A;  2NSF A;  3GEH A;  1FR0 A;  1PD0 A;  1K05 A;  5COF A;  4O7G A;  2M4E A;  4I1M A;  3K33 A;  4YT4 A;  1D0Z A;  3DI5 A;  3U8P A;  4CSA A;  2QE9 A;  5E3A A;  3B0U X;  3M79 A;  2XXA A;  2J8W A;  2KW3 C;  2VCB A;  2YLI A;  4QDL A;  1YJG A;  3HNK A;  5T1D B;  3ZC4 A;  3W2V A;  1A7V A;  4DRJ B;  2ZPA A;  1TWA A;  3FAJ A;  4MVM A;  2G3V A;  2VC9 A;  4G78 A;  2V26 A;  3MYF A;  4XWJ A;  1O87 A;  1R4T A;  4PJN A;  4U5H A;  3U0C A;  3IQC A;  3NDB B;  2IYL D;  2HJM A;  1ZHY A;  2LSE A;  3A11 A;  3DZA A;  2YHS A;  3VF0 A;  4CDV A;  3IHU A;  3HJC A;  2A0B A;  5L0G A;  5L0J A;  4C7O A;  2J0W A;  2HS5 A;  2JD3 A;  3DAF A;  2QUP A;  3Q7L A;  4I1O B;  2P1A A;  3EHN A;  5A69 A;  4DBQ A;  3T6B A;  1C17 M;  1VYK A;  4XQ1 A;  1HW1 A;  1WOL A;  4JCZ A;  4BEM J;  1Y4C A;  1ZYR F;  4HFF B;  1MND A;  2ZXW C;  2DGJ A;  4XPW A;  4JW1 A;  1OXB A;  2WZL A;  3NRH A;  3IQ5 A;  2Q9B A;  4YWQ A;  1V54 C;  1RJ9 B;  4CJG A;  4CS9 C;  5A6B A;  2E87 A;  1SF8 A;  1LM3 B;  5L0F A;  5JSL A;  3JSZ A;  1YDI A;  2AVK A;  2XM0 A;  2XLW A;  1QKR A;  3HNL A;  4GQH A;  5DS4 A;  4HEA J;  5F5H A;  3ZTM A;  3HTK C;  1LIH A;  2PX3 A;  4EHP A;  3RKO F;  2VCC A;  3RYL A;  2BL2 A;  1M2O A;  3DJU B;  2HUJ A;  4JTC B;  5JS5 A;  3O10 A;  1YA7 O;  1NU7 D;  2XL6 A;  4DVY P;  2R7Q A;  3DXJ F;  2KJG A;  3FOP A;  2GFH A;  2MYS A;  2RSE B;  2VH3 A;  4JCH A;  4WGY A;  3I5P A;  4OIQ F;  1OR3 A;  1UG7 A;  3QZC A;  3EPV A;  1RMV A;  3CQZ A;  2LQG A;  1HY5 A;  4H54 A;  5BQI A;  3K7D A;  3HKK A;  4J32 B;  4OIR F;  3EZH A;  3GAN A;  1M2V A;  2WVQ A;  2R7O A;  4CS8 C;  1HE1 A;  3T6J A;  2LK4 A;  4EIY A;  1SMY F;  2WVO A;  2HJ3 A;  1CGO A;  4KNW A;  1BZ4 A;  2H7O A;  2XLV A;  3SNH A;  2HKV A;  3ABK C;  4ZLC A;  3DMD A;  2KC3 A;  3EFO A;  3T9O A;  2P0N A;  2ASR A;  4AE4 A;  4I3M A;  2YZS A;  4FES A;  4RDA A;  3KYI A;  5IY5 C;  1OCC C;  2OCC C;  1L7C A;  2PX0 A;  5HSW A;  1TR2 A;  1Q0D A;  3MFN A;  1OKK D;  2I8B A;  2YRF A;  5B1B C;  3OWT A;  3ASN C;  5DLJ A;  4G7H F;  2C03 A;  3TD7 A;  4EUK B;  5K0I A;  3K66 A;  1F1M A;  4JKV A;  3TJ5 A;  2J7P D;  2ICW G;  4JJF A;  1DOV A;  2ETS A;  3WAQ A;  1E83 A;  2KSF A;  4NTA A;  1ZU4 A;  2NSG A;  1QLE C;  1ST6 A;  2IM8 A;  5A6A A;  1YAU O;  1C03 A;  1Q0G A;  3QW1 A;  2YQY A;  2ZD9 A;  4QI2 A;  2HV7 A;  2DYR C;  4MVZ A;  3LLI A;  3B71 A;  4G0H A;  3K1I C;  4PR9 A;  3VAY A;  3V7O A;  5JRA A;  2QY9 A;  3WHN A;  1OW6 A;  5KYY B;  1YA9 A;  3GEI A;  3RFY A;  2R7V A;  4BG0 A;  1CGN A;  1VLS A;  2DYS C;  2XL8 A;  2XSE A;  5A6K A;  1BR2 A;  3I5Q A;  1JMW A;  3QW0 A;  4KC9 A;  4MS2 A;  3E9V A;  3NMJ A;  3O6X A;  5KYN A;  1ORJ A;  2XS8 A;  4YL3 A;  3N0T A;  1NU9 C;  1JOG A;  3C8G B;  2HFI A;  3T6G B;  4ULV A;  3FDQ A;  4U5G A;  1WN0 A;  3M4C A;  5DS6 A;  4G7Z F;  3FAP B;  3B9Q A;  5COM A;  2ZXP A;  2GAQ A;  4PK4 A;  3PHF 2;  1SR2 A;  3U2L A;  4CSA C;  1Z3I X;  3H2V A;  2PBE A;  5KYW B;  3QMK A;  4XLP F;  2EIL C;  3LEV A;  5EGY A;  3U2M A;  3ABM C;  2H7V C;  4JC7 A;  2H8A A;  4JZA A;  3ZWI A;  2CDQ A;  3AGT A;  4N4W A;  4BJT A;  2HSQ A;  2VB6 A;  2A69 F;  5JP7 A;  3VM6 A;  2Q4F A;  3NMK A;  4WJ0 A;  4E17 A;  5JT4 A;  4LLE A;  3W8I A;  3ATP A;  2YLD A;  2HMZ A;  3JRM O;  2LP4 A;  4O6Y A;  3EH1 A;  3TUL A;  1OW7 A;  4CIH A;  1AUE A;  1RJ9 A;  3DE8 A;  3X1O A;  1VTM P;  2PFD A;  3C18 A;  3O55 A;  4NC3 A;  2RD9 A;  4MTG A;  2OEV A;  1ZHW A;  2AWC A;  2Q00 A;  4MQ9 F;  2R7W A;  1FFT C;  1NFN A;  2KGO A;  3Q6N A;  3PDM P;  3LS0 A;  2HZ8 A;  1MNE A;  2GA0 A;  3EHM A;  2MHR A;  4IAO A;  1LI5 A;  5TJ5 E;  2J9B A;  2WL8 A;  1ZVZ A;  3G4Z A;  1E84 A;  1AVO B;  3IQT A;  5HV9 A;  5F5F A;  2PP4 A;  1H9T A;  2ZXR A;  1T6Q A;  256B A;  1NSG B;  3BRJ A;  3TQO A;  1LE2 A;  4OIN F;  1TFO B;  2OU6 A;  2P6V A;  3ITF A;  4JJG A;  4DBR A;  2CGE A;  3US6 A;  4U5B E;  1T01 A;  5COG A;  4XTK A;  1FMW A;  4FWV A;  2XLD A;  4PFO A;  2EPM X;  1Q0F A;  4L6R A;  4GYT A;  2XLE A;  1HMD A;  3Q6M A;  4CDA A;  2R25 A;  3ASO C;  1XZP A;  1YYJ A;  1MMD A;  3M4B A;  5CI9 A;  2X0C A;  1YAR O;  2A6H F;  1E85 A;  2KQ9 A;  2X51 A;  1HE9 A;  3E70 C;  3NYM A;  1S7Z A;  2KYH A;  3C7J A;  4OIO F;  1GS9 A;  3ZSU A;  1CPR A;  4O79 A;  3MBG A;  3KH2 A;  5KYX B;  4U5F E;  1T6I A;  4YL0 A;  3L1M A;  1FTS A;  3LNM B;  5D92 A;  1IW7 F;  1FAP B;  1S05 A;  1YZC A;  2OG2 A;  4IGG A;  4JEA A;  4CDY A;  1E86 A;  1GQA A;  1MMG A;  2JPU A;  2XLM A;  2L6H A;  3JT1 A;  1OXK A;  1YZA A;  3LUT B;  5FCL A;  3JYH A;  2EIM C;  1MMN A;  2LIG A;  2R05 A;  1ORS C;  2D5R B;  3GOR A;  4IJJ A;  3SP1 A;  1KNY A;  1RXQ A;  1VMA A;  2B0H A;  3AQC A;  1BR1 A;  4ER9 A;  5DQT A;  1D0X A;  1SZI A;  1MQV A;  5L0H A;  4K1O A;  3U3B A;  2WVN A;  3O39 A;  4JTD B;  1NBB A;  2W9Y A;  4XPX A;  3G4X A;  4KNV A;  4JEB A;  3AQB A;  4U5C E;  1IZM A;  2L9J A;  1GM5 A;  2XLH A;  5KYY A;  1NZE A;  4LDR A;  4IAQ A;  3DM9 B;  3W8H A;  1ORY A;  1G4U S;  1YLM A;  2DB4 A;  1T5O A;  3LJB A;  5L0D A;  3Q7G A;  3MX3 A;  3PCV A;  2C04 A;  2YL1 A;  3MLG A;  2OEX A;  3C8G A;  2EPO A;  1ZHZ A;  4IWB A;  1BDJ B;  3GM2 A;  4Z9I A;  4EBK A;  4PJM A;  2D4U A;  3TOM A;  5L0C A;  1TWC A;  2YEV A;  3ZQY A;  1OCO C;  1GGQ A;  2Y3H A;  3A9C A;  2CNW A;  4LAC B;  1OQC A;  2BE5 F;  4MW8 A;  3SZR A;  3UMH A;  3W2W A;  4YT8 A;  1R5I D;  2LFD A;  2BC5 A;  5KYW A;  1KTM A;  5AGF A;  1TWG A;  3FHD A;  4NTF A;  5A6B D;  3V5Y A;  2IXO A;  3CEX A;  1H6G A;  3EJN A;  1Q0M A;  3JZ0 A;  4MTO A;  3S27 A;  2NUT B;  1FFH A;  1L3P A;  3KL4 A;  2Y69 C;  1WGW A;  4DVZ A;  2ZXO A;  1W2W A;  4AL1 A;  2IXP A;  2EIJ C;  1JR8 A;  1XWJ A;  2GDC A;  2QTV A;  4JTA B;  3X2Q C;  4DXW A;  3U8V A;  3ZG1 A;  2YLG A;  3C62 A;  2OJQ A;  3S28 A;  4CJO A;  2XL4 A;  2AWY A;  1D0Y A;  4C3D A;  4UDV A;  2HV6 A;  1EA8 A;  2CCY A;  5T3T A;  3TK0 A;  5CI8 A;  2QNL A;  1LE4 A;  4CS8 A;  3B0V C;  1UFB A;  2TMV P;  3CAX A;  4J7T A;  2AP3 A;  2NUP B;  3IEE A;  2H7B A;  4H4K C;  4DJ9 A;  1VOM A;  1YVI A;  4EBJ A;  4ONS A;  3AJM A;  3RW0 A;  4AK9 A;  2IXM A;  4C7O B;  2LD6 A;  3ZIB A;  4M63 A;  3EGD B;  3U9M A;  4GEH A;  4YL1 A;  1AEP A;  2JX0 A;  5B3S C;  3C63 A;  4BJ1 A;  2R7R A;  1ZW2 A;  1OW8 A;  2Y3G A;  1FMV A;  2I15 A;  2J46 A;  3RVZ A;  4BJ6 A;  5B1A C;  1QVX A;  3EH2 A;  4JUR I;  3H65 A;  2P61 A;  2NG1 A;  4EBB A;  4PJJ A;  4D4X A;  1T9K A;  3F46 A;  4MVR A;  4MW3 A;  2Q7R A;  4P9F A;  2QLA A;  1E2X A;  4U9E A;  2LCH A;  4Z9H A;  5DS5 A;  4U9D A;  1LPE A;  3DM5 A;  3LES A;  3QTH A;  2YL0 A;  2V3C C;  4U5D E;  3UGP A;  1A41 A;  4Q7C A;  3S90 A;  4I44 A;  4E7Z A;  5KYX A;  3K1I A;  1TKN A;  1Z23 A;  1WAS A;  4C3E A;  2EIK C;  1O3U A;  5E2Q A;  3K1H A;  3W4Y A;  2A6E F;  3AG1 C;  5KYU A;  4XEK A;  3OEO A;  1XZQ A;  2EPN A;  1WWP A;  1EI7 A;  4U5E E;  4E0H A;  2A1D D;  1VLT A;  4X0R A;  3EGX B;  4J30 B;  3S0X A;  3RQF A;  3SXZ A;  4XEF A;  1WTY A;  3ECS A;  2CW0 F;  2UUH A;  4N6C A;  1VK5 A;  3FVY A;  4FAP B;  4BEJ A;  2PF4 E;  2XS1 A;  3LAY A;  1QZX A;  5L0I A;  3UGO A;  1A7D A;  4YJW A;  3R2P A;  2EPL X;  3AOU A;  1K04 A;  3SEO A;  2W4B A;  4E0I A;  1A0B A;  1OCZ C;  4R32 A;  3K6B A;  1PV3 A;  1APC A;  1LKX A;  2GWW A;  3DKA A;  3EG9 B;  1NFO A;  1Z5Z A;  4LDK A;  4NCQ A;  1V4A A;  3HNI A;  4XPY A;  5BQH A;  1MMA A;  3N24 A;  4MVO A;  4XEV A;  3AG2 C;  4AX2 A;  4D4N A;  1RKE B;  4JE9 A;  4IRU A;  3KPH A;  1Z7Q c;  2KNH A;  3RF3 A;  3L34 A;  1T6U A;  3JSE O;  4ZLD A;  3GWL A;  1JAF A;  1KU2 A;  2HSB A;  1ZHT A;  2Z15 A;  1U89 A;  2EPK X;  4RD9 A;  5JUA A;  1D1B A;  3TJ6 A;  3S84 A;  3S9O A;  2IXN A;  3GWN A;  5EK0 A;  1G4W R;  1OKK A;  4K0D A;  3AG4 C;  5AC5 A;  1PCX A;  1RKC A;  2FGY A;  2R03 A;  2Y3D A;  4KBL A;  4MND A;  5D91 A;  3WOD F;  4DRI B;  3V5Z A;  3UNG C;  3DE9 A;  1YYX A;  2J7P A;  2VAS A;  3I4U A;  1VB5 A;  5T3W A;  2OOC A;  3IQ6 A;  3V5X A;  3GM1 A;  2KK1 A;  3ZTZ A;  4CBE A;  4MVU A;  3UR3 C;  1HW2 A;  2WZG A;  3ZVR A;  4E18 A;  4IAR A;  4O6N A;  2J9W A;  5DVW A;  3GEE A;  1LS1 A;  1QSP A;  3OA1 A;  3AGU A;  3NMI A;  5FZT A;  5GPG B;  5BUO A;  3QVY A;  5CIV A;  1ZU5 A;  5A6J A;  3L8I A;  3NG1 A;  4YK5 A;  1ZHX A;  2NUT A;  2G3K A;  4NTB A;  3VYW A;  4B6I A;  5L3V A;  2XXA B;  3C8Z A;  2P7V A;  4JIO A;  3S29 A;  2J9V A;  4OIP F;  1K40 A;  1H9G A;  1TFK B;  3TOL A;  2W4M A;  2Q9C A;  4EWC A;  3H2U A;  2O9X A;  2R7X A;  4CIP A;  1C02 A;  3G50 A;  1I5N A;  1H7I A;  2UUI A;  3DJN B;  2L7A A;  4OD5 A;  3UMK A;  5L3Q A;  3J06 A;  1SYQ A;  4W8K A;  1J8Y F;  1JPJ A;  1LS4 A;  1G5Z A;  3FOO A;  1NLX A;  3LNR A;  2R9R B;  3EZI A;  3NKE A;  2NUP A;  2J9U A;  2NPU A;  4QI0 A;  3RVY A;  5B3I A;  4Q5S F;  3PMR A;  4NQF A;  3SXM A;  2J0X A;  3IPM O;  3N2Z B;  4FX5 A;  5JLI A;  4CS9 A;  1RCP A;  1ZW3 A;  2L6F A;  3B29 A;  3NYL A;  5F28 E;  3VRC A;  1M6T A;  1Z6A A;  2DI3 A;  4HFK B;  5DQZ A;  4DRH B;  3DWW A;  3HNJ A;  4YT5 A;  3U9J A;  2F22 A;  1O5H A;  1U6H A;  3EGD A;  4CS7 A;  1PD1 A;  4F4B A;  3GOD A;  1I4Y A;  1NG1 A;  2YWA A;  1D1A A;  4BPM A;  4C3B A;  4E7S A;  1B68 A;  3HLZ A;  4PFP A;  2XM4 A;  3L8J A;  3M1C B;  4YT2 A;  2OKU A;  2G62 A;  1DOW A;  3RQG A;  2R7T A;  3JCU Q;  3ZQV A;  3RQE A;  4BJ5 C;  1OR2 A;  4RBN A;  3M15 A;  2Q9A A;  2R02 A;  4K7B A;  4BJ6 C;  3EQL F;  3QVZ A;  3CZ6 A;  3JTL O;  4A2N B;  4CX9 A;  1LI7 A;  1BBH A;  3NKD A;  4O6M A;  1I4Z A;  4ULW A;  3BEH A;  2B0J A;  2HMQ A;  3F47 A;  4JRZ A;  2IOQ A;  4LER A;  4MVS A;  4A4A A;  1ZZP A;  4Q4Z F;  3SYN A;  1OCR C;  2YVK A;  5E3C A;  3ABL C;  5JVE A;  2CYD A;  4JVS A;  1M56 C;  2WZF A;  1CGM E;  4WGZ A;  3NYJ A;  4OD4 A;  1M57 C;  1M2V B;  2VCA A;  2LFF A;  2EIN C;  3U5S A;  3WG7 C;  1FNT c;  2YKZ A;  4NY3 A;  3KKB A;  1D1C A;  4WAB A;  1TQG A;  3EGX A;  3KYJ A;  5E33 A;  3KMI A;  3EFO B;  2MWQ A;  3L0I A;  4AE4 B;  2L6G A;  2R7S A;  2A0U A;  3RH3 A;  2R7U A;  2OJE D;  1A7E A;  4EKW A;  4KI2 A;  4LLC A;  3LEO A;  1J8M F;  3LLK A;  4AL0 A;  3B0P A;  4DOZ A;  4J7Y A;  1G8X A;  3GM3 A;  5EHH A;  5KYU B;  1BR4 A;  3JYY A;  1Z63 A;  1U0B B;  1EQ1 A;  4MVQ A;  3POV A;  3EG9 A;  3AG3 C;  2OQM A;  2L81 A;  4PAC A;  3C8G D;  4N06 A;  3SXY A;  4N6H A;  3CSK A;  4P9T A;  3DAG A;  4P6I C;  2FFH A;  2IBF A;  1RKE A;  4LDQ A;  1JPN A;  1Q0K A;  2AU5 A;  1QPU A;  2CNW D;  2Y39 A;  2A68 F;  2XLO A;  2YL3 A;  3FXH A;  4Z9J A;  3DD7 A;  1N1C A;  3FMS A;  3JRT A;  5AC4 A;  1TWH A;  2M64 A;  2PNO A;  3SXK A;  2J45 A;  1QQ3 A;  1V74 B;  4BJ5 A;  1JRA A;  1WAT A; 
#chains in the Genus database with same CATH homology
 2OKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...