1TKNA

Solution structure of cappd*, an independently folded extracellular domain of human amyloid-beta precursor protein
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
110
structure length
110
Chain Sequence
RVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Amyloid beta A4 protein
publication title Three-dimensional structure of an independently folded extracellular domain of human amyloid-beta precursor protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2004-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1tknA00
3Q7LA 4YN0B 4RDAA 3UMIA 3QMKA 3K6BA 4RD9A 3UMKA 3NYLA 3NYJA 3UMHA 3Q7GA 5BUOA 3PMRA 1TKNA 3K66A
chains in the Genus database with same CATH superfamily
3ZWIA 4E0HA 1NFNA 4GQHA 2P7VA 2UUIA 4NQFA 3LAYA 2Y39A 3NDBB 1YA9A 1B68A 2KC3A 5B3IA 3DAFA 3E9VA 4Q5SF 5F5FA 1AVOB 1H9GA 2VC9A 1TWAA 4NCQA 1Z5ZA 2A1DD 5JP7A 3ZSUA 1NG1A 1F1MA 3EG9A 4IAQA 4DXWA 5KYYB 4I1OB 3U3BA 3ZIBA 1BDJB 1LE2A 2X51A 1IW7F 1EI7A 1FTSA 2AP3A 1M2OA 4GEHA 3N24A 4W8KA 2PX3A 1JPJA 1K05A 5GPGB 3NMJA 1BBHA 3DJUB 3NYLA 1TFOB 5KYUB 3PHF2 4MS2A 2YL7A 1TWHA 4CS7A 4LDKA 2Y3HA 2YRFA 3FOPA 1LI5A 3K1IA 4F4BA 5L0FA 5T1DB 2L9JA 1YZAA 1YZCA 1PD0A 1S7ZA 2R02A 3EGDA 4LDQA 5L0HA 4XLPF 4C7OB 2KK1A 5CI8A 3S27A 3T6GB 3TULA 2LK4A 5A6KA 3DXJF 3E70C 2Q00A 1RXQA 2G3VA 1G4WR 3AG2C 4BJ6C 4EUKB 4E7SA 5CI9A 1MMNA 3QMKA 1QZXA 3DM9B 2YLIA 4NTAA 1R4TA 2EIMC 2NUTA 5EGYA 3EFOB 1XZPA 3RVZA 3ZVRA 4K7BA 1M57C 1E2XA 1FMVA 1OCCC 2EPNA 4G0HA 1YYJA 4YJWA 1ZZPA 3UMHA 3LJBA 4IB4A 3FOOA 5T3WA 4E18A 2HFIA 1E84A 1EA8A 1GM5A 3U8PA 3J06A 4QI2A 1TR2A 1G8XA 4XEKA 3NMKA 4Z9JA 4MQ9F 1LIHA 1ZVZA 3B71A 3CEXA 3RW0A 3AG3C 1M2VB 5E2QA 1YYXA 2HS5A 5D91A 2Y3DA 3SZRA 3TQOA 4X0RA 2F22A 2PFDA 3G50A 2FFHA 4ANJA 3MYFA 2EINC 1YJGA 2L6FA 3AJMA 3LNMB 5JUAA 4IGGA 1KTMA 1D1BA 2NG1A 1QLEC 1S05A 1Y6DA 3G4XA 5DS4A 4LLCA 1ZW3A 2TMVP 3L34A 3B0VC 2H8AA 2HUJA 2NPUA 3GEIA 1A0BA 4ER9A 1H9TA 1Q0FA 2B0HA 4MVQA 1OCRC 3EPVA 3L8JA 4PR9A 1NU7D 3PCVA 3T4RA 4BEJA 4GYTA 5BQHA 2EIKC 2Y3GA 2J9BA 1ZHYA 2Q9AA 1Q0GA 1RKCA 3TK0A 3ZQVA 2RD9A 3JRMO 3KYIA 2Y3BA 1I5NA 1FFHA 1VB5A 3L1MA 3EG9B 2OOCA 4U5EE 1EQ1A 1GQAA 2Q9CA 5E3AA 5TJ5E 2LCHA 2R7XA 1VLTA 1YLMA 2ICWG 5A6BA 4KNVA 4D4XA 5DQTA 1O5HA 5KYWA 4FX5A 1DOWA 3LESA 1LPEA 4XTKA 3NG1A 1J8MF 4EBJA 1EKYA 2JX0A 4PJMA 2PF4E 4JTDB 4CIPA 2XXAA 4CS8A 3IHUA 5CIVA 4BPMA 2AWCA 3AGUA 2R9RB 4PJLA 4R32A 3ATPA 5EHHA 3EGDB 4IARA 2YKZA 3ABKC 3U8VA 1FR0A 5T3TA 1VYKA 1NFOA 2YZSA 2ZPAA 3DKAA 3NYMA 5JSLA 2R05A 2KYHA 3LEVA 4MTOA 1Q0DA 2J0WA 3A11A 1O3UA 3ABMC 5A6AA 2XLHA 1MMGA 2HSQA 3GWLA 3JYHA 3M15A 3DMDA 4NTBA 4P9FA 4U5BE 4DBRA 1SZIA 2Q7RA 3TJ6A 4YT8A 5L3VA 3GM2A 3K1HA 5DS5A 1JAFA 2NUTB 3DE8A 3T6BA 4DRJB 4DBQA 1IZMA 5L0DA 3SEOA 2EILC 2QNLA 3AQBA 3OA1A 3GM1A 3GORA 1KU2A 2OU6A 3C18A 4EBBA 3CSKA 3MFNA 5B1AC 1TKNA 4JIOA 3LS0A 4WGYA 2QE9A 2IXMA 3AGTA 2WL8A 2XS8A 1A7VA 5A6BD 4N6CA 1V54C 2Y69C 4OIRF 4QI0A 2RSEB 3JZ0A 3ZTZA 1ORYA 1Z3IX 3LUTB 1BR1A 1T01A 4WJ0A 4DRHB 2OJQA 3N2ZB 3R2PA 3Q7GA 2IM8A 2HZ8A 3S90A 3DE9A 1C02A 3KPHA 1WOLA 4KC9A 1SYQA 3LEOA 2HV7A 2HV6A 3SNHA 4OIQF 4BJ1A 4CDVA 2H7VC 2KGOA 3O10A 2QLAA 4LACB 5AGFA 2PBEA 4AE4A 1LM3B 1AEPA 1LE4A 1M6TA 4MVSA 1ZHXA 3ZTMA 1HW2A 2H7BA 3WHNA 3O39A 2C04A 3SXKA 2WVNA 2XM4A 4MVZA 3M4CA 3UR3C 1HMDA 4AL1A 2M64A 4JE9A 5DLJA 4I1MA 2XLWA 4YT5A 2J9VA 3GEHA 4UDVA 1TQGA 2VCBA 4MW3A 1ZHTA 2LFFA 3CQZA 4PJJA 2WZFA 4P6IC 5KYWB 2R7UA 1K04A 5F28E 3O6XA 4Z9HA 1RJ9A 2IBFA 4BG0A 2A0BA 1GGQA 3QVYA 4CIHA 2XXAB 3C7JA 3S9OA 2AWYA 3ASNC 3OEOA 2KSFA 3WAQA 1OR3A 4JCHA 5KYNA 2J46A 3DWWA 3U3FA 1H7IA 3FHDA 2QY9A 3AOUA 3C62A 2LIGA 1V4AA 1AUEA 2GAQA 2ZXOA 4JEBA 3LNRA 4YN0B 4C3BA 4CX9A 4JRZA 4G7ZF 1T6UA 3B29A 3FAPB 1Q0MA 3HNIA 2EIJC 3LLKA 2GA0A 3U0CA 1NLXA 2Q4FA 2W4BA 4AX2A 3KH2A 1HE1A 2CW0F 3V5YA 2UUHA 1E83A 3HTKC 2L81A 4MTGA 3TJ5A 1D1AA 1PCXA 1YVIA 4JCZA 1JRAA 4ULVA 4DVYP 5JVEA 2J9WA 2KW3C 3DM5A 4N06A 3IQTA 1SF8A 1NSGB 2VH3A 4N4WA 4BEMJ 4CS8C 1E86A 2LP4A 4O6MA 4CJOA 3QVZA 1TWGA 2ZXRA 3SXYA 4EBKA 3GM3A 2MYSA 3W2WA 1OW7A 2HMQA 3QW0A 5K0IA 2XLDA 4MVRA 3FMSA 3X2QC 2XLEA 2LFDA 1FNTc 2YL0A 4JTAB 4FAPB 4CDYA 2VCCA 1U0BB 2YL3A 2D4UA 3OWTA 3W8HA 1QKRA 4U5FE 3TOLA 1Q0KA 1SR2A 3MBGA 4U5GA 5IY5C 3KL4A 2YVKA 5AC5A 4O7GA 1ZU4A 3EZHA 2XSEA 1OCZC 4HFKB 4XPYA 4JJFA 2O9XA 3EJNA 2OEVA 2QTVA 1I4ZA 3M79A 5B1BC 4AE4B 4EWCA 4ZLCA 2WVOA 3HJCA 4YWQA 1GS9A 4OIPF 2DYSC 1JMWA 1Y4CA 4MNDA 3TD7A 1C03A 1NZEA 1OW6A 1XZQA 3DI5A 3POVA 2KNHA 2QUPA 5EK0A 3PMRA 2XLMA 1C17M 1VLSA 4DJ9A 3B9QA 4E0IA 5KYXA 3T9OA 1OQCA 4QDLA 3S84A 2OG2A 4G7OF 1MQVA 2P61A 5D92A 3L8IA 4IWBA 4RBNA 4E17A 2DI3A 3LLIA 1BR4A 1M56C 4YL3A 4Q4ZF 5AC4A 1R5ID 3LS1A 1RJ9B 2GFHA 4CJGA 2EPMX 2G3KA 2J9UA 4LLEA 4O6NA 4G7HF 3WODF 1YARO 2R25A 1O87A 3X1OA 3RQEA 5HSWA 1NU9C 3U2MA 1TFKB 1HY5A 4I3MA 1WGWA 3ZDLA 4PK4A 2P6VA 2BC5A 3HLZA 3RVYA 3I4UA 3HNJA 4YT2A 1ZYRF 2R7QA 1CGNA 1CGOA 5JLIA 256BA 4H54A 4O6YA 4OD5A 3F46A 2CCYA 1VOMA 2KJGA 4P9TA 4XEFA 4KI2A 2IXNA 3NKEA 5HV9A 2VB6A 4KNWA 3M1CB 3U9MA 4Q7CA 1JPNA 4JEAA 2MHRA 3AG1C 4ULWA 2YQYA 1A7EA 4YT4A 2P1AA 3ZG1A 1OXBA 1N1CA 3UMIA 3ZQYA 4C3DA 1KNYA 1ZU5A 3KMIA 2V3CC 1CPQA 1U6HA 3K1IC 1WN0A 4M63A 4ONSA 3JT1A 4YL1A 3US6A 3EHNA 3GANA 2Z15A 4JW1A 3CZ6A 3MLGA 4AK9A 5COGA 3S28A 4WABA 3V5ZA 2R7WA 3V7OA 2HKVA 1LVKA 2ASRA 3UGPA 1JR8A 4PFPA 4AL0A 2YLGA 4CSAA 3HNKA 1WTYA 1QVXA 2HJMA 3FXHA 2OQMA 3MYIA 3JSEO 2NSGA 3C8GA 1APCA 2ETSA 4B6IA 1ORJA 1D0YA 2A6EF 1A41A 2KQ9A 4WGZA 3SXMA 4OINF 2R7SA 4JZAA 4BJ5A 2ZD9A 1CGME 4U9EA 2IYLD 1VTMP 3Q6MA 2XL8A 1OW8A 1T6IA 4YL0A 3IQ5A 4XPXA 3UMKA 1LKXA 5JT4A 1ORSC 5KYXB 2J45A 2FGYA 2LD6A 3JSZA 3V5XA 5A6JA 3H65A 4K0DA 1LS4A 2J7PD 1T9KA 2FAPB 2L7AA 2LSEA 3EGXA 4JURI 3PDMP 2VASA 2YWAA 2P0NA 3BRJA 4DVZA 4U5CE 1PD1A 1OCOC 4NY3A 3NYJA 3JYYA 2A68F 2LQGA 3IPMO 5BQGA 2DGJA 3ZC4A 4CS9A 3IEEA 1YA7O 1TWCA 2C03A 3HNLA 3WG7C 4D4NA 1RMVA 5B3SC 4JTCB 3UNGC 3H2UA 2IOQA 2R03A 4HEAJ 4JVSA 4E7ZA 1OKKD 5L0IA 4A2NB 1MMAA 1G4US 2WZLA 1VMAA 4MVOA 4XQ1A 1D0XA 4RD9A 4FESA 3SXZA 1V74B 3EQLF 1J8YF 3C8GD 3RH3A 4U9DA 5COMA 3IQ6A 4J32B 2WVQA 3U9JA 4XEVA 3RKOF 4LDRA 3RQFA 5L0GA 1E85A 2CNWA 1XWJA 4O79A 2OJED 4W8PA 5BUOA 2L6GA 3TOMA 4Z9IA 3U5SA 4I44A 3VM6A 3AG4C 3S29A 1RCPA 3O55A 3VRCA 5L0JA 3IQCA 2PX0A 3ABLC 4K1OA 4U5HA 2CDQA 1JOGA 3JTLO 3G4ZA 2HMZA 1WATA 2NUPA 4MVUA 3GODA 2X0CA 4A4AA 4MTFA 5FZTA 1G5ZA 4J30B 2AU5A 2AVKA 2XL6A 2EPKX 2W9YA 1QSPA 1BR2A 2PNOA 3QTHA 4MW8A 2H7OA 1YAUO 4HE8D 3BEHA 5E3CA 4N6HA 1HMOA 1Z63A 1FFTC 4BJTA 2XL4A 3FDQA 3C8GB 3W4YA 1ZHZA 5DVWA 4J7YA 1K40A 2XLVA 4J7TA 3KKBA 3S0XA 1FMWA 2EPLX 3ECSA 2J0XA 4MVMA 1QQ3A 5DQZA 1W2WA 3K33A 4RDAA 2IXPA 4XLNF 2EPOA 3GWNA 2XS1A 3RFYA 1ST6A 2PP4A 4H4KC 4JC7A 4EHPA 4XPWA 3EZIA 3SYNA 1SMYF 5COFA 1MMDA 1RKEA 2A0UA 2CNWD 1A7DA 3K6BA 3A9CA 3EGXB 4HFFB 4CSAC 2BE5F 2DYRC 3M4BA 2YL1A 2GDCA 3DJNB 4ZLDA 2I15A 4EKWA 3NKDA 2E87A 2NSFA 4EIYA 4U5DE 4CBEA 2L6HA 1ZHWA 2OKUA 3GEEA 4DRIB 4BJ5C 1FAPB 1LS1A 2XM0A 1UFBA 3I5PA 3KYJA 4DOZA 2R7OA 4FWVA 5A69A 1CPRA 5L3QA 1WASA 2OEXA 3H2VA 3FAJA 4NTFA 5E33A 1PV3A 1V55C 2V26A 2ZXPA 3DZAA 1D0ZA 3CAXA 4IAOA 4LERA 5F5HA 2MWQA 3QZCA 4IRUA 1HE9A 2YLDA 3K66A 4PACA 3Q7LA 2A69F 3U2LA 3W2VA 4YK5A 3QW1A 2CYDA 3L0IA 3R7CA 5KYYA 3C8ZA 1DOVA 3MX3A 1L7CA 2J7PA 4PFOA 5DS6A 4CS9C 3B0UX 4BJ6A 3HKKA 3ASOC 1LI7A 3VF0A 4CDAA 5BQIA 2XLOA 3RQGA 4NC3A 3B0PA 3RYLA 2HSBA 2Q3TA 5KYUA 1T6QA 3C63A 2NUPB 2OCCC 2GWWA 1L3PA 1NBBA 2A6HF 4OD4A 3I5QA 2HJ3A 1WWPA 2M4EA 4C7OA 3SP1A 1QPUA 3W8IA 3VAYA 1MNDA 1MNEA 1OKKA 5JRAA 3Q6NA 1ZW2A 2JD3A 1Z23A 1OXKA 2YHSA 2WZGA 3DAGA 4JJGA 1Z7Qc 2CGEA 4C3EA 3NMIA 3ITFA 5JS5A 2W4MA 2I8BA 2XRHA 4XWJA 4PJNA 1YDIA 3AQCA 3K7DA 1VK5A 1UG7A 3T6JA 1Z6AA 1D1CA 3FVYA 2J8WA 2W45A 3EFOA 4JKVA 1VYIA 2VCAA 3RF3A 3N0TA 2B0JA 2BL2A 5FCLA 2YEVA 1U89A 1HW1A 2DB4A 2JPUA 3JCUQ 1RKEB 2R7TA 1T5OA 1I4YA 3DD7A 2D5RB 4OIOF 3JRTA 3EH1A 3NRHA 4KBLA 1H6GA 4G78A 3UGOA 1M2VA 2R7RA 3EHMA 1BZ4A 1OR2A 2G62A 3VYWA 5L0CA 4L6RA 2WB7A 3EH2A 2Q9BA 2ZXWC 2R7VA 3F47A 4IJJA 2IXOA 3RIPA
chains in the Genus database with same CATH topology
2P7VA 3LAYA 2Y39A 3NDBB 3DAFA 3E9VA 4Q5SF 5F5FA 1TWAA 3ZSUA 1Z5ZA 2A1DD 1NG1A 3EG9A 5KYYB 4I1OB 3ZIBA 2X51A 4W8KA 1FTSA 1IW7F 1M2OA 4GEHA 3N24A 2PX3A 1JPJA 3DJUB 3NYLA 5KYUB 3PHF2 1TWHA 4CS7A 2Y3HA 4F4BA 5T1DB 2L9JA 3EGDA 4XLPF 1PD0A 1S7ZA 4C7OB 5CI8A 3S27A 3DXJF 3E70C 2G3VA 3AG2C 4BJ6C 4E7SA 5CI9A 1MMNA 3QMKA 1QZXA 3DM9B 5EGYA 2EIMC 2NUTA 3EFOB 3ZVRA 4K7BA 1M57C 1FMVA 1OCCC 4G0HA 4YJWA 3UMHA 3LJBA 5T3WA 4QI2A 1TR2A 1G8XA 4MQ9F 3AG3C 1M2VB 5E2QA 3SZRA 5D91A 2Y3DA 4ANJA 4X0RA 2PFDA 2FFHA 2EINC 1D1BA 2NG1A 1QLEC 5DS4A 4LLCA 3L34A 3B0VC 1OCRC 3EPVA 1NU7D 3T4RA 4BEJA 4GYTA 2EIKC 2Y3GA 1ZHYA 2Q9AA 2Y3BA 1FFHA 3EG9B 4U5EE 2Q9CA 5E3AA 2R7XA 4KNVA 5DQTA 1O5HA 5KYWA 4FX5A 3LESA 4XTKA 3NG1A 1J8MF 4PJMA 2PF4E 2XXAA 4CS8A 4PJLA 5EHHA 3EGDB 3ABKC 5T3TA 1VYKA 2YZSA 2ZPAA 3NYMA 3LEVA 2J0WA 3ABMC 1MMGA 4U5BE 3JYHA 4DBRA 3DMDA 5L3VA 4YT8A 1SZIA 3K1HA 5DS5A 2NUTB 3T6BA 4DBQA 1IZMA 3SEOA 2EILC 3OA1A 3AQBA 1KU2A 4EBBA 3CSKA 5B1AC 1TKNA 3LS0A 2IXMA 2WL8A 1V54C 2Y69C 4OIRF 4QI0A 1Z3IX 1BR1A 4WJ0A 3N2ZB 3Q7GA 4KC9A 4OIQF 2HV7A 2HV6A 3SNHA 4BJ1A 2H7VC 2KGOA 4LACB 4AE4A 1ZHXA 2H7BA 3O39A 2C04A 2WVNA 3UR3C 5DLJA 4I1MA 4YT5A 2J9VA 1ZHTA 3CQZA 4PJJA 2WZFA 4P6IC 5KYWB 2R7UA 3O6XA 1RJ9A 4BG0A 4CIHA 2XXAB 3ASNC 3OEOA 5KYNA 4JCHA 2J46A 3FHDA 2QY9A 2ZXOA 4C3BA 3LNRA 4YN0B 4G7ZF 2EIJC 3LLKA 2W4BA 4AX2A 3KH2A 2CW0F 3HTKC 2L81A 1D1AA 1PCXA 4DVYP 2J9WA 2KW3C 3DM5A 4N06A 1SF8A 2VH3A 4CS8C 4O6MA 1TWGA 2ZXRA 2MYSA 3W2WA 3X2QC 3OWTA 3W8HA 4U5FE 4U5GA 5IY5C 3KL4A 4O7GA 1ZU4A 3EZHA 2XSEA 1OCZC 4HFKB 4JJFA 2O9XA 3EJNA 2QTVA 5B1BC 4EWCA 4AE4B 4ZLCA 2WVOA 3HJCA 4YWQA 4OIPF 2DYSC 4MNDA 3TD7A 1NZEA 3POVA 2KNHA 3PMRA 3B9QA 5KYXA 4G7OF 4QDLA 2OG2A 5D92A 4IWBA 4RBNA 3LLIA 1BR4A 1M56C 4Q4ZF 3LS1A 1RJ9B 2GFHA 4G7HF 2G3KA 2J9UA 4O6NA 4LLEA 3WODF 1O87A 3X1OA 5HSWA 1NU9C 4I3MA 1WGWA 4PK4A 2P6VA 3HLZA 3I4UA 4YT2A 1ZYRF 2R7QA 4O6YA 4OD5A 3F46A 1VOMA 2KJGA 4KI2A 2IXNA 3NKEA 2VB6A 4KNWA 3M1CB 4Q7CA 1JPNA 3AG1C 4ULWA 4YT4A 3ZG1A 1N1CA 3UMIA 4C3DA 1ZU5A 3KMIA 2V3CC 3K1IC 4M63A 3JT1A 3EHNA 3GANA 2Z15A 4JW1A 3CZ6A 3MLGA 4AK9A 3S28A 2R7WA 3V7OA 1LVKA 3UGPA 4PFPA 4CSAA 4B6IA 1D0YA 2A6EF 2KQ9A 4OINF 2R7SA 4JZAA 4BJ5A 2IYLD 3Q6MA 3UMKA 1LKXA 5KYXB 2J45A 2FGYA 3JSZA 3H65A 4K0DA 2J7PD 3EGXA 4JURI 2LSEA 2VASA 4DVZA 4U5CE 1PD1A 1OCOC 4NY3A 3NYJA 2A68F 3ZC4A 2DGJA 4CS9A 3IEEA 1TWCA 2C03A 3WG7C 5B3SC 3UNGC 2IOQA 4HEAJ 4JVSA 4E7ZA 1OKKD 4A2NB 1MMAA 2WZLA 1VMAA 1D0XA 4RD9A 4FESA 3EQLF 1J8YF 3RH3A 4J32B 2WVQA 3RKOF 2CNWA 5BUOA 4O79A 4I44A 3AG4C 3S29A 2PX0A 3ABLC 4U5HA 2CDQA 2NUPA 3GODA 4J30B 2W9YA 1BR2A 2H7OA 4HE8D 5E3CA 1Z63A 1FFTC 4BJTA 2XL4A 3FDQA 1ZHZA 5DVWA 3KKBA 3S0XA 1FMWA 3ECSA 2J0XA 5DQZA 1W2WA 3K33A 4RDAA 2IXPA 4XLNF 3RFYA 1ST6A 2PP4A 4H4KC 3EZIA 3SYNA 1SMYF 1MMDA 2CNWD 3K6BA 3EGXB 4HFFB 4CSAC 2BE5F 2DYRC 3DJNB 4ZLDA 3NKDA 2E87A 4U5DE 4CBEA 1ZHWA 4BJ5C 1LS1A 3I5PA 4DOZA 2R7OA 4FWVA 5L3QA 3FAJA 5E33A 1V55C 2V26A 2ZXPA 3DZAA 1D0ZA 4LERA 4IAOA 5F5HA 2MWQA 3QZCA 4IRUA 3K66A 3W2VA 3Q7LA 2A69F 3L0IA 5KYYA 3MX3A 2J7PA 4PFOA 5DS6A 4CS9C 3B0UX 4BJ6A 3ASOC 3B0PA 3RYLA 2Q3TA 5KYUA 2NUPB 2OCCC 2A6HF 4OD4A 3I5QA 2M4EA 4C7OA 3SP1A 3W8IA 3VAYA 1MNDA 1MNEA 1OKKA 3Q6NA 2JD3A 1Z23A 2YHSA 2WZGA 3DAGA 4JJGA 2CGEA 4C3EA 3ITFA 2W4MA 2I8BA 2XRHA 4XWJA 4PJNA 3AQCA 3K7DA 1VK5A 3T6JA 1Z6AA 1D1CA 3FVYA 2W45A 3EFOA 1VYIA 3N0TA 2B0JA 5FCLA 2YEVA 2R7TA 3JCUQ 3DD7A 2D5RB 4OIOF 3JRTA 3EH1A 3NRHA 4KBLA 3UGOA 1M2VA 2R7RA 3EHMA 3VYWA 2G62A 2WB7A 3EH2A 2Q9BA 2ZXWC 2R7VA 3F47A 4IJJA 2IXOA 3RIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q7L A;  4YN0 B;  4RDA A;  3UMI A;  3QMK A;  3K6B A;  4RD9 A;  3UMK A;  3NYL A;  3NYJ A;  3UMH A;  3Q7G A;  5BUO A;  3PMR A;  1TKN A;  3K66 A; 
#chains in the Genus database with same CATH topology
 3ZWI A;  4E0H A;  1NFN A;  4GQH A;  2P7V A;  2UUI A;  4NQF A;  3LAY A;  2Y39 A;  3NDB B;  1YA9 A;  1B68 A;  2KC3 A;  5B3I A;  3DAF A;  3E9V A;  4Q5S F;  5F5F A;  1AVO B;  1H9G A;  2VC9 A;  1TWA A;  4NCQ A;  1Z5Z A;  2A1D D;  5JP7 A;  3ZSU A;  1NG1 A;  1F1M A;  3EG9 A;  4IAQ A;  4DXW A;  5KYY B;  4I1O B;  3U3B A;  3ZIB A;  1BDJ B;  1LE2 A;  2X51 A;  1IW7 F;  1EI7 A;  1FTS A;  2AP3 A;  1M2O A;  4GEH A;  3N24 A;  4W8K A;  2PX3 A;  1JPJ A;  1K05 A;  5GPG B;  3NMJ A;  1BBH A;  3DJU B;  3NYL A;  1TFO B;  5KYU B;  3PHF 2;  4MS2 A;  2YL7 A;  1TWH A;  4CS7 A;  4LDK A;  2Y3H A;  2YRF A;  3FOP A;  1LI5 A;  3K1I A;  4F4B A;  5L0F A;  5T1D B;  2L9J A;  1YZA A;  1YZC A;  1PD0 A;  1S7Z A;  2R02 A;  3EGD A;  4LDQ A;  5L0H A;  4XLP F;  4C7O B;  2KK1 A;  5CI8 A;  3S27 A;  3T6G B;  3TUL A;  2LK4 A;  5A6K A;  3DXJ F;  3E70 C;  2Q00 A;  1RXQ A;  2G3V A;  1G4W R;  3AG2 C;  4BJ6 C;  4EUK B;  4E7S A;  5CI9 A;  1MMN A;  3QMK A;  1QZX A;  3DM9 B;  2YLI A;  4NTA A;  1R4T A;  2EIM C;  2NUT A;  5EGY A;  3EFO B;  1XZP A;  3RVZ A;  3ZVR A;  4K7B A;  1M57 C;  1E2X A;  1FMV A;  1OCC C;  2EPN A;  4G0H A;  1YYJ A;  4YJW A;  1ZZP A;  3UMH A;  3LJB A;  4IB4 A;  3FOO A;  5T3W A;  4E18 A;  2HFI A;  1E84 A;  1EA8 A;  1GM5 A;  3U8P A;  3J06 A;  4QI2 A;  1TR2 A;  1G8X A;  4XEK A;  3NMK A;  4Z9J A;  4MQ9 F;  1LIH A;  1ZVZ A;  3B71 A;  3CEX A;  3RW0 A;  3AG3 C;  1M2V B;  5E2Q A;  1YYX A;  2HS5 A;  5D91 A;  2Y3D A;  3SZR A;  3TQO A;  4X0R A;  2F22 A;  2PFD A;  3G50 A;  2FFH A;  4ANJ A;  3MYF A;  2EIN C;  1YJG A;  2L6F A;  3AJM A;  3LNM B;  5JUA A;  4IGG A;  1KTM A;  1D1B A;  2NG1 A;  1QLE C;  1S05 A;  1Y6D A;  3G4X A;  5DS4 A;  4LLC A;  1ZW3 A;  2TMV P;  3L34 A;  3B0V C;  2H8A A;  2HUJ A;  2NPU A;  3GEI A;  1A0B A;  4ER9 A;  1H9T A;  1Q0F A;  2B0H A;  4MVQ A;  1OCR C;  3EPV A;  3L8J A;  4PR9 A;  1NU7 D;  3PCV A;  3T4R A;  4BEJ A;  4GYT A;  5BQH A;  2EIK C;  2Y3G A;  2J9B A;  1ZHY A;  2Q9A A;  1Q0G A;  1RKC A;  3TK0 A;  3ZQV A;  2RD9 A;  3JRM O;  3KYI A;  2Y3B A;  1I5N A;  1FFH A;  1VB5 A;  3L1M A;  3EG9 B;  2OOC A;  4U5E E;  1EQ1 A;  1GQA A;  2Q9C A;  5E3A A;  5TJ5 E;  2LCH A;  2R7X A;  1VLT A;  1YLM A;  2ICW G;  5A6B A;  4KNV A;  4D4X A;  5DQT A;  1O5H A;  5KYW A;  4FX5 A;  1DOW A;  3LES A;  1LPE A;  4XTK A;  3NG1 A;  1J8M F;  4EBJ A;  1EKY A;  2JX0 A;  4PJM A;  2PF4 E;  4JTD B;  4CIP A;  2XXA A;  4CS8 A;  3IHU A;  5CIV A;  4BPM A;  2AWC A;  3AGU A;  2R9R B;  4PJL A;  4R32 A;  3ATP A;  5EHH A;  3EGD B;  4IAR A;  2YKZ A;  3ABK C;  3U8V A;  1FR0 A;  5T3T A;  1VYK A;  1NFO A;  2YZS A;  2ZPA A;  3DKA A;  3NYM A;  5JSL A;  2R05 A;  2KYH A;  3LEV A;  4MTO A;  1Q0D A;  2J0W A;  3A11 A;  1O3U A;  3ABM C;  5A6A A;  2XLH A;  1MMG A;  2HSQ A;  3GWL A;  3JYH A;  3M15 A;  3DMD A;  4NTB A;  4P9F A;  4U5B E;  4DBR A;  1SZI A;  2Q7R A;  3TJ6 A;  4YT8 A;  5L3V A;  3GM2 A;  3K1H A;  5DS5 A;  1JAF A;  2NUT B;  3DE8 A;  3T6B A;  4DRJ B;  4DBQ A;  1IZM A;  5L0D A;  3SEO A;  2EIL C;  2QNL A;  3AQB A;  3OA1 A;  3GM1 A;  3GOR A;  1KU2 A;  2OU6 A;  3C18 A;  4EBB A;  3CSK A;  3MFN A;  5B1A C;  1TKN A;  4JIO A;  3LS0 A;  4WGY A;  2QE9 A;  2IXM A;  3AGT A;  2WL8 A;  2XS8 A;  1A7V A;  5A6B D;  4N6C A;  1V54 C;  2Y69 C;  4OIR F;  4QI0 A;  2RSE B;  3JZ0 A;  3ZTZ A;  1ORY A;  1Z3I X;  3LUT B;  1BR1 A;  1T01 A;  4WJ0 A;  4DRH B;  2OJQ A;  3N2Z B;  3R2P A;  3Q7G A;  2IM8 A;  2HZ8 A;  3S90 A;  3DE9 A;  1C02 A;  3KPH A;  1WOL A;  4KC9 A;  1SYQ A;  3LEO A;  2HV7 A;  2HV6 A;  3SNH A;  4OIQ F;  4BJ1 A;  4CDV A;  2H7V C;  2KGO A;  3O10 A;  2QLA A;  4LAC B;  5AGF A;  2PBE A;  4AE4 A;  1LM3 B;  1AEP A;  1LE4 A;  1M6T A;  4MVS A;  1ZHX A;  3ZTM A;  1HW2 A;  2H7B A;  3WHN A;  3O39 A;  2C04 A;  3SXK A;  2WVN A;  2XM4 A;  4MVZ A;  3M4C A;  3UR3 C;  1HMD A;  4AL1 A;  2M64 A;  4JE9 A;  5DLJ A;  4I1M A;  2XLW A;  4YT5 A;  2J9V A;  3GEH A;  4UDV A;  1TQG A;  2VCB A;  4MW3 A;  1ZHT A;  2LFF A;  3CQZ A;  4PJJ A;  2WZF A;  4P6I C;  5KYW B;  2R7U A;  1K04 A;  5F28 E;  3O6X A;  4Z9H A;  1RJ9 A;  2IBF A;  4BG0 A;  2A0B A;  1GGQ A;  3QVY A;  4CIH A;  2XXA B;  3C7J A;  3S9O A;  2AWY A;  3ASN C;  3OEO A;  2KSF A;  3WAQ A;  1OR3 A;  4JCH A;  5KYN A;  2J46 A;  3DWW A;  3U3F A;  1H7I A;  3FHD A;  2QY9 A;  3AOU A;  3C62 A;  2LIG A;  1V4A A;  1AUE A;  2GAQ A;  2ZXO A;  4JEB A;  3LNR A;  4YN0 B;  4C3B A;  4CX9 A;  4JRZ A;  4G7Z F;  1T6U A;  3B29 A;  3FAP B;  1Q0M A;  3HNI A;  2EIJ C;  3LLK A;  2GA0 A;  3U0C A;  1NLX A;  2Q4F A;  2W4B A;  4AX2 A;  3KH2 A;  1HE1 A;  2CW0 F;  3V5Y A;  2UUH A;  1E83 A;  3HTK C;  2L81 A;  4MTG A;  3TJ5 A;  1D1A A;  1PCX A;  1YVI A;  4JCZ A;  1JRA A;  4ULV A;  4DVY P;  5JVE A;  2J9W A;  2KW3 C;  3DM5 A;  4N06 A;  3IQT A;  1SF8 A;  1NSG B;  2VH3 A;  4N4W A;  4BEM J;  4CS8 C;  1E86 A;  2LP4 A;  4O6M A;  4CJO A;  3QVZ A;  1TWG A;  2ZXR A;  3SXY A;  4EBK A;  3GM3 A;  2MYS A;  3W2W A;  1OW7 A;  2HMQ A;  3QW0 A;  5K0I A;  2XLD A;  4MVR A;  3FMS A;  3X2Q C;  2XLE A;  2LFD A;  1FNT c;  2YL0 A;  4JTA B;  4FAP B;  4CDY A;  2VCC A;  1U0B B;  2YL3 A;  2D4U A;  3OWT A;  3W8H A;  1QKR A;  4U5F E;  3TOL A;  1Q0K A;  1SR2 A;  3MBG A;  4U5G A;  5IY5 C;  3KL4 A;  2YVK A;  5AC5 A;  4O7G A;  1ZU4 A;  3EZH A;  2XSE A;  1OCZ C;  4HFK B;  4XPY A;  4JJF A;  2O9X A;  3EJN A;  2OEV A;  2QTV A;  1I4Z A;  3M79 A;  5B1B C;  4AE4 B;  4EWC A;  4ZLC A;  2WVO A;  3HJC A;  4YWQ A;  1GS9 A;  4OIP F;  2DYS C;  1JMW A;  1Y4C A;  4MND A;  3TD7 A;  1C03 A;  1NZE A;  1OW6 A;  1XZQ A;  3DI5 A;  3POV A;  2KNH A;  2QUP A;  5EK0 A;  3PMR A;  2XLM A;  1C17 M;  1VLS A;  4DJ9 A;  3B9Q A;  4E0I A;  5KYX A;  3T9O A;  1OQC A;  4QDL A;  3S84 A;  2OG2 A;  4G7O F;  1MQV A;  2P61 A;  5D92 A;  3L8I A;  4IWB A;  4RBN A;  4E17 A;  2DI3 A;  3LLI A;  1BR4 A;  1M56 C;  4YL3 A;  4Q4Z F;  5AC4 A;  1R5I D;  3LS1 A;  1RJ9 B;  2GFH A;  4CJG A;  2EPM X;  2G3K A;  2J9U A;  4LLE A;  4O6N A;  4G7H F;  3WOD F;  1YAR O;  2R25 A;  1O87 A;  3X1O A;  3RQE A;  5HSW A;  1NU9 C;  3U2M A;  1TFK B;  1HY5 A;  4I3M A;  1WGW A;  3ZDL A;  4PK4 A;  2P6V A;  2BC5 A;  3HLZ A;  3RVY A;  3I4U A;  3HNJ A;  4YT2 A;  1ZYR F;  2R7Q A;  1CGN A;  1CGO A;  5JLI A;  256B A;  4H54 A;  4O6Y A;  4OD5 A;  3F46 A;  2CCY A;  1VOM A;  2KJG A;  4P9T A;  4XEF A;  4KI2 A;  2IXN A;  3NKE A;  5HV9 A;  2VB6 A;  4KNW A;  3M1C B;  3U9M A;  4Q7C A;  1JPN A;  4JEA A;  2MHR A;  3AG1 C;  4ULW A;  2YQY A;  1A7E A;  4YT4 A;  2P1A A;  3ZG1 A;  1OXB A;  1N1C A;  3UMI A;  3ZQY A;  4C3D A;  1KNY A;  1ZU5 A;  3KMI A;  2V3C C;  1CPQ A;  1U6H A;  3K1I C;  1WN0 A;  4M63 A;  4ONS A;  3JT1 A;  4YL1 A;  3US6 A;  3EHN A;  3GAN A;  2Z15 A;  4JW1 A;  3CZ6 A;  3MLG A;  4AK9 A;  5COG A;  3S28 A;  4WAB A;  3V5Z A;  2R7W A;  3V7O A;  2HKV A;  1LVK A;  2ASR A;  3UGP A;  1JR8 A;  4PFP A;  4AL0 A;  2YLG A;  4CSA A;  3HNK A;  1WTY A;  1QVX A;  2HJM A;  3FXH A;  2OQM A;  3MYI A;  3JSE O;  2NSG A;  3C8G A;  1APC A;  2ETS A;  4B6I A;  1ORJ A;  1D0Y A;  2A6E F;  1A41 A;  2KQ9 A;  4WGZ A;  3SXM A;  4OIN F;  2R7S A;  4JZA A;  4BJ5 A;  2ZD9 A;  1CGM E;  4U9E A;  2IYL D;  1VTM P;  3Q6M A;  2XL8 A;  1OW8 A;  1T6I A;  4YL0 A;  3IQ5 A;  4XPX A;  3UMK A;  1LKX A;  5JT4 A;  1ORS C;  5KYX B;  2J45 A;  2FGY A;  2LD6 A;  3JSZ A;  3V5X A;  5A6J A;  3H65 A;  4K0D A;  1LS4 A;  2J7P D;  1T9K A;  2FAP B;  2L7A A;  2LSE A;  3EGX A;  4JUR I;  3PDM P;  2VAS A;  2YWA A;  2P0N A;  3BRJ A;  4DVZ A;  4U5C E;  1PD1 A;  1OCO C;  4NY3 A;  3NYJ A;  3JYY A;  2A68 F;  2LQG A;  3IPM O;  5BQG A;  2DGJ A;  3ZC4 A;  4CS9 A;  3IEE A;  1YA7 O;  1TWC A;  2C03 A;  3HNL A;  3WG7 C;  4D4N A;  1RMV A;  5B3S C;  4JTC B;  3UNG C;  3H2U A;  2IOQ A;  2R03 A;  4HEA J;  4JVS A;  4E7Z A;  1OKK D;  5L0I A;  4A2N B;  1MMA A;  1G4U S;  2WZL A;  1VMA A;  4MVO A;  4XQ1 A;  1D0X A;  4RD9 A;  4FES A;  3SXZ A;  1V74 B;  3EQL F;  1J8Y F;  3C8G D;  3RH3 A;  4U9D A;  5COM A;  3IQ6 A;  4J32 B;  2WVQ A;  3U9J A;  4XEV A;  3RKO F;  4LDR A;  3RQF A;  5L0G A;  1E85 A;  2CNW A;  1XWJ A;  4O79 A;  2OJE D;  4W8P A;  5BUO A;  2L6G A;  3TOM A;  4Z9I A;  3U5S A;  4I44 A;  3VM6 A;  3AG4 C;  3S29 A;  1RCP A;  3O55 A;  3VRC A;  5L0J A;  3IQC A;  2PX0 A;  3ABL C;  4K1O A;  4U5H A;  2CDQ A;  1JOG A;  3JTL O;  3G4Z A;  2HMZ A;  1WAT A;  2NUP A;  4MVU A;  3GOD A;  2X0C A;  4A4A A;  4MTF A;  5FZT A;  1G5Z A;  4J30 B;  2AU5 A;  2AVK A;  2XL6 A;  2EPK X;  2W9Y A;  1QSP A;  1BR2 A;  2PNO A;  3QTH A;  4MW8 A;  2H7O A;  1YAU O;  4HE8 D;  3BEH A;  5E3C A;  4N6H A;  1HMO A;  1Z63 A;  1FFT C;  4BJT A;  2XL4 A;  3FDQ A;  3C8G B;  3W4Y A;  1ZHZ A;  5DVW A;  4J7Y A;  1K40 A;  2XLV A;  4J7T A;  3KKB A;  3S0X A;  1FMW A;  2EPL X;  3ECS A;  2J0X A;  4MVM A;  1QQ3 A;  5DQZ A;  1W2W A;  3K33 A;  4RDA A;  2IXP A;  4XLN F;  2EPO A;  3GWN A;  2XS1 A;  3RFY A;  1ST6 A;  2PP4 A;  4H4K C;  4JC7 A;  4EHP A;  4XPW A;  3EZI A;  3SYN A;  1SMY F;  5COF A;  1MMD A;  1RKE A;  2A0U A;  2CNW D;  1A7D A;  3K6B A;  3A9C A;  3EGX B;  4HFF B;  4CSA C;  2BE5 F;  2DYR C;  3M4B A;  2YL1 A;  2GDC A;  3DJN B;  4ZLD A;  2I15 A;  4EKW A;  3NKD A;  2E87 A;  2NSF A;  4EIY A;  4U5D E;  4CBE A;  2L6H A;  1ZHW A;  2OKU A;  3GEE A;  4DRI B;  4BJ5 C;  1FAP B;  1LS1 A;  2XM0 A;  1UFB A;  3I5P A;  3KYJ A;  4DOZ A;  2R7O A;  4FWV A;  5A69 A;  1CPR A;  5L3Q A;  1WAS A;  2OEX A;  3H2V A;  3FAJ A;  4NTF A;  5E33 A;  1PV3 A;  1V55 C;  2V26 A;  2ZXP A;  3DZA A;  1D0Z A;  3CAX A;  4IAO A;  4LER A;  5F5H A;  2MWQ A;  3QZC A;  4IRU A;  1HE9 A;  2YLD A;  3K66 A;  4PAC A;  3Q7L A;  2A69 F;  3U2L A;  3W2V A;  4YK5 A;  3QW1 A;  2CYD A;  3L0I A;  3R7C A;  5KYY A;  3C8Z A;  1DOV A;  3MX3 A;  1L7C A;  2J7P A;  4PFO A;  5DS6 A;  4CS9 C;  3B0U X;  4BJ6 A;  3HKK A;  3ASO C;  1LI7 A;  3VF0 A;  4CDA A;  5BQI A;  2XLO A;  3RQG A;  4NC3 A;  3B0P A;  3RYL A;  2HSB A;  2Q3T A;  5KYU A;  1T6Q A;  3C63 A;  2NUP B;  2OCC C;  2GWW A;  1L3P A;  1NBB A;  2A6H F;  4OD4 A;  3I5Q A;  2HJ3 A;  1WWP A;  2M4E A;  4C7O A;  3SP1 A;  1QPU A;  3W8I A;  3VAY A;  1MND A;  1MNE A;  1OKK A;  5JRA A;  3Q6N A;  1ZW2 A;  2JD3 A;  1Z23 A;  1OXK A;  2YHS A;  2WZG A;  3DAG A;  4JJG A;  1Z7Q c;  2CGE A;  4C3E A;  3NMI A;  3ITF A;  5JS5 A;  2W4M A;  2I8B A;  2XRH A;  4XWJ A;  4PJN A;  1YDI A;  3AQC A;  3K7D A;  1VK5 A;  1UG7 A;  3T6J A;  1Z6A A;  1D1C A;  3FVY A;  2J8W A;  2W45 A;  3EFO A;  4JKV A;  1VYI A;  2VCA A;  3RF3 A;  3N0T A;  2B0J A;  2BL2 A;  5FCL A;  2YEV A;  1U89 A;  1HW1 A;  2DB4 A;  2JPU A;  3JCU Q;  1RKE B;  2R7T A;  1T5O A;  1I4Y A;  3DD7 A;  2D5R B;  4OIO F;  3JRT A;  3EH1 A;  3NRH A;  4KBL A;  1H6G A;  4G78 A;  3UGO A;  1M2V A;  2R7R A;  3EHM A;  1BZ4 A;  1OR2 A;  2G62 A;  3VYW A;  5L0C A;  4L6R A;  2WB7 A;  3EH2 A;  2Q9B A;  2ZXW C;  2R7V A;  3F47 A;  4IJJ A;  2IXO A;  3RIP A; 
#chains in the Genus database with same CATH homology
 2P7V A;  3LAY A;  2Y39 A;  3NDB B;  3DAF A;  3E9V A;  4Q5S F;  5F5F A;  1TWA A;  3ZSU A;  1Z5Z A;  2A1D D;  1NG1 A;  3EG9 A;  5KYY B;  4I1O B;  3ZIB A;  2X51 A;  4W8K A;  1FTS A;  1IW7 F;  1M2O A;  4GEH A;  3N24 A;  2PX3 A;  1JPJ A;  3DJU B;  3NYL A;  5KYU B;  3PHF 2;  1TWH A;  4CS7 A;  2Y3H A;  4F4B A;  5T1D B;  2L9J A;  3EGD A;  4XLP F;  1PD0 A;  1S7Z A;  4C7O B;  5CI8 A;  3S27 A;  3DXJ F;  3E70 C;  2G3V A;  3AG2 C;  4BJ6 C;  4E7S A;  5CI9 A;  1MMN A;  3QMK A;  1QZX A;  3DM9 B;  5EGY A;  2EIM C;  2NUT A;  3EFO B;  3ZVR A;  4K7B A;  1M57 C;  1FMV A;  1OCC C;  4G0H A;  4YJW A;  3UMH A;  3LJB A;  5T3W A;  4QI2 A;  1TR2 A;  1G8X A;  4MQ9 F;  3AG3 C;  1M2V B;  5E2Q A;  3SZR A;  5D91 A;  2Y3D A;  4ANJ A;  4X0R A;  2PFD A;  2FFH A;  2EIN C;  1D1B A;  2NG1 A;  1QLE C;  5DS4 A;  4LLC A;  3L34 A;  3B0V C;  1OCR C;  3EPV A;  1NU7 D;  3T4R A;  4BEJ A;  4GYT A;  2EIK C;  2Y3G A;  1ZHY A;  2Q9A A;  2Y3B A;  1FFH A;  3EG9 B;  4U5E E;  2Q9C A;  5E3A A;  2R7X A;  4KNV A;  5DQT A;  1O5H A;  5KYW A;  4FX5 A;  3LES A;  4XTK A;  3NG1 A;  1J8M F;  4PJM A;  2PF4 E;  2XXA A;  4CS8 A;  4PJL A;  5EHH A;  3EGD B;  3ABK C;  5T3T A;  1VYK A;  2YZS A;  2ZPA A;  3NYM A;  3LEV A;  2J0W A;  3ABM C;  1MMG A;  4U5B E;  3JYH A;  4DBR A;  3DMD A;  5L3V A;  4YT8 A;  1SZI A;  3K1H A;  5DS5 A;  2NUT B;  3T6B A;  4DBQ A;  1IZM A;  3SEO A;  2EIL C;  3OA1 A;  3AQB A;  1KU2 A;  4EBB A;  3CSK A;  5B1A C;  1TKN A;  3LS0 A;  2IXM A;  2WL8 A;  1V54 C;  2Y69 C;  4OIR F;  4QI0 A;  1Z3I X;  1BR1 A;  4WJ0 A;  3N2Z B;  3Q7G A;  4KC9 A;  4OIQ F;  2HV7 A;  2HV6 A;  3SNH A;  4BJ1 A;  2H7V C;  2KGO A;  4LAC B;  4AE4 A;  1ZHX A;  2H7B A;  3O39 A;  2C04 A;  2WVN A;  3UR3 C;  5DLJ A;  4I1M A;  4YT5 A;  2J9V A;  1ZHT A;  3CQZ A;  4PJJ A;  2WZF A;  4P6I C;  5KYW B;  2R7U A;  3O6X A;  1RJ9 A;  4BG0 A;  4CIH A;  2XXA B;  3ASN C;  3OEO A;  5KYN A;  4JCH A;  2J46 A;  3FHD A;  2QY9 A;  2ZXO A;  4C3B A;  3LNR A;  4YN0 B;  4G7Z F;  2EIJ C;  3LLK A;  2W4B A;  4AX2 A;  3KH2 A;  2CW0 F;  3HTK C;  2L81 A;  1D1A A;  1PCX A;  4DVY P;  2J9W A;  2KW3 C;  3DM5 A;  4N06 A;  1SF8 A;  2VH3 A;  4CS8 C;  4O6M A;  1TWG A;  2ZXR A;  2MYS A;  3W2W A;  3X2Q C;  3OWT A;  3W8H A;  4U5F E;  4U5G A;  5IY5 C;  3KL4 A;  4O7G A;  1ZU4 A;  3EZH A;  2XSE A;  1OCZ C;  4HFK B;  4JJF A;  2O9X A;  3EJN A;  2QTV A;  5B1B C;  4EWC A;  4AE4 B;  4ZLC A;  2WVO A;  3HJC A;  4YWQ A;  4OIP F;  2DYS C;  4MND A;  3TD7 A;  1NZE A;  3POV A;  2KNH A;  3PMR A;  3B9Q A;  5KYX A;  4G7O F;  4QDL A;  2OG2 A;  5D92 A;  4IWB A;  4RBN A;  3LLI A;  1BR4 A;  1M56 C;  4Q4Z F;  3LS1 A;  1RJ9 B;  2GFH A;  4G7H F;  2G3K A;  2J9U A;  4O6N A;  4LLE A;  3WOD F;  1O87 A;  3X1O A;  5HSW A;  1NU9 C;  4I3M A;  1WGW A;  4PK4 A;  2P6V A;  3HLZ A;  3I4U A;  4YT2 A;  1ZYR F;  2R7Q A;  4O6Y A;  4OD5 A;  3F46 A;  1VOM A;  2KJG A;  4KI2 A;  2IXN A;  3NKE A;  2VB6 A;  4KNW A;  3M1C B;  4Q7C A;  1JPN A;  3AG1 C;  4ULW A;  4YT4 A;  3ZG1 A;  1N1C A;  3UMI A;  4C3D A;  1ZU5 A;  3KMI A;  2V3C C;  3K1I C;  4M63 A;  3JT1 A;  3EHN A;  3GAN A;  2Z15 A;  4JW1 A;  3CZ6 A;  3MLG A;  4AK9 A;  3S28 A;  2R7W A;  3V7O A;  1LVK A;  3UGP A;  4PFP A;  4CSA A;  4B6I A;  1D0Y A;  2A6E F;  2KQ9 A;  4OIN F;  2R7S A;  4JZA A;  4BJ5 A;  2IYL D;  3Q6M A;  3UMK A;  1LKX A;  5KYX B;  2J45 A;  2FGY A;  3JSZ A;  3H65 A;  4K0D A;  2J7P D;  3EGX A;  4JUR I;  2LSE A;  2VAS A;  4DVZ A;  4U5C E;  1PD1 A;  1OCO C;  4NY3 A;  3NYJ A;  2A68 F;  3ZC4 A;  2DGJ A;  4CS9 A;  3IEE A;  1TWC A;  2C03 A;  3WG7 C;  5B3S C;  3UNG C;  2IOQ A;  4HEA J;  4JVS A;  4E7Z A;  1OKK D;  4A2N B;  1MMA A;  2WZL A;  1VMA A;  1D0X A;  4RD9 A;  4FES A;  3EQL F;  1J8Y F;  3RH3 A;  4J32 B;  2WVQ A;  3RKO F;  2CNW A;  5BUO A;  4O79 A;  4I44 A;  3AG4 C;  3S29 A;  2PX0 A;  3ABL C;  4U5H A;  2CDQ A;  2NUP A;  3GOD A;  4J30 B;  2W9Y A;  1BR2 A;  2H7O A;  4HE8 D;  5E3C A;  1Z63 A;  1FFT C;  4BJT A;  2XL4 A;  3FDQ A;  1ZHZ A;  5DVW A;  3KKB A;  3S0X A;  1FMW A;  3ECS A;  2J0X A;  5DQZ A;  1W2W A;  3K33 A;  4RDA A;  2IXP A;  4XLN F;  3RFY A;  1ST6 A;  2PP4 A;  4H4K C;  3EZI A;  3SYN A;  1SMY F;  1MMD A;  2CNW D;  3K6B A;  3EGX B;  4HFF B;  4CSA C;  2BE5 F;  2DYR C;  3DJN B;  4ZLD A;  3NKD A;  2E87 A;  4U5D E;  4CBE A;  1ZHW A;  4BJ5 C;  1LS1 A;  3I5P A;  4DOZ A;  2R7O A;  4FWV A;  5L3Q A;  3FAJ A;  5E33 A;  1V55 C;  2V26 A;  2ZXP A;  3DZA A;  1D0Z A;  4LER A;  4IAO A;  5F5H A;  2MWQ A;  3QZC A;  4IRU A;  3K66 A;  3W2V A;  3Q7L A;  2A69 F;  3L0I A;  5KYY A;  3MX3 A;  2J7P A;  4PFO A;  5DS6 A;  4CS9 C;  3B0U X;  4BJ6 A;  3ASO C;  3B0P A;  3RYL A;  2Q3T A;  5KYU A;  2NUP B;  2OCC C;  2A6H F;  4OD4 A;  3I5Q A;  2M4E A;  4C7O A;  3SP1 A;  3W8I A;  3VAY A;  1MND A;  1MNE A;  1OKK A;  3Q6N A;  2JD3 A;  1Z23 A;  2YHS A;  2WZG A;  3DAG A;  4JJG A;  2CGE A;  4C3E A;  3ITF A;  2W4M A;  2I8B A;  2XRH A;  4XWJ A;  4PJN A;  3AQC A;  3K7D A;  1VK5 A;  3T6J A;  1Z6A A;  1D1C A;  3FVY A;  2W45 A;  3EFO A;  1VYI A;  3N0T A;  2B0J A;  5FCL A;  2YEV A;  2R7T A;  3JCU Q;  3DD7 A;  2D5R B;  4OIO F;  3JRT A;  3EH1 A;  3NRH A;  4KBL A;  3UGO A;  1M2V A;  2R7R A;  3EHM A;  3VYW A;  2G62 A;  2WB7 A;  3EH2 A;  2Q9B A;  2ZXW C;  2R7V A;  3F47 A;  4IJJ A;  2IXO A;  3RIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...