3I5PA

Nup170(aa979-1502), s.cerevisiae
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
503
structure length
449
Chain Sequence
b'DILGFRAIEHLRRAKEIYDSLNYHLKNATAIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLENDDRKQYYDKRILVYDLVFDTLIKVDLRQKSYEAALKYNDRLFHYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGKISNILWVYYSRRSKFFESAEILYRLATSNFDITLFERIEFLSRANGFCQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQDSEFIFPIFELFPIVCNFFYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSDNSVFNKEMTWLIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nucleoporin NUP170
publication title Architectural nucleoporins Nup157/170 and Nup133 are structurally related and descend from a second ancestral element.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 145
structure length 449
sequence length 503
ec nomenclature
pdb deposition date 2009-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1880 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3i5pA03
1.25.40.440 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3i5pA02
1.25.40.450 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3i5pA01
3I5PA
chains in the Genus database with same CATH superfamily
3PVLA 4GTMA 5L3VA 1J8YF 3H65A 1PC2A 1PAQA 4JCZA 4U9EA 4B0ZA 4CYMD 2KCKA 1OCOE 4MTGA 1LI7A 1NU7D 2GAQA 5KYUA 4I9EA 2C0LA 3VYWA 2VGXB 1YYXA 1YDIA 4G11A 5A6BD 3APCA 2L9BA 3EGXA 4G25A 3NRHA 2AXZA 4K5AB 3TWQA 4EBAA 2EIMC 3AGUA 4XZ4A 1Q0KA 3RQGA 2DVWA 2YEVA 4BEJA 5BQHA 2LSEA 2DBAA 2ZXPA 2XXAB 1M2VA 1HW2A 2HMQA 3AJIA 2AWIA 4UQZA 4IN3B 4WWPA 3EH1A 3QTHA 3QWVA 2BKKB 3SBSA 2YQ8A 2I1JA 3FU0A 2I8BA 3MA5A 3ZG1A 3UINC 3DXKG 5FIOA 2X6HA 5CHEE 4AM9A 4ACLA 3B13A 4YK5A 3CVVA 3DZAA 1T6QA 4BEPA 2DYRE 4HS2A 4BX8A 4JHJA 4ABNA 4CS9A 1S70B 4AE4A 1AP7A 1TWCA 1T6UA 1MNDA 1H0AA 3QWPA 3HVEA 2IOLA 1YARO 2YL0A 3HDXA 2P58C 2D5RB 2H6HA 3TG5A 3ATPA 2Y3BA 3H2VA 1BI8B 2A0UA 4U5CE 2YL7A 3ZTMA 2X0CA 1OR2A 5L0GA 3S7DA 4CGWA 3T9OA 2FO1E 2V8SE 5D91A 4L2LA 3T6JA 4XTKA 1D0ZA 1TNOA 2J9BA 4MVMA 1OKKA 3Q15A 1Y6IA 3DE9A 2FO7A 1JMWA 2CG2A 2P61A 3EU9A 2DYRC 2IM8A 2A6HF 3C8ZA 3O55A 4J0UA 4CBEA 3TWWA 4EZJA 2R9RB 3T6BA 1V74B 3NOGD 1RJ9B 3PMRA 1BR2A 3NMKA 3FOPA 2FAPB 2P9KG 3UGPA 4CIPA 4TXRA 2KK1A 4JEAA 4RSYA 1BDJB 4H54A 3FH8A 3P1UA 2JD3A 4JC8A 4O1PA 3Q79A 3ULQA 2KM4A 2J0WA 4Z9HA 4GZDA 3FH7A 4RLYA 2KXPC 3FHDA 4M63A 1GW6A 2XZTG 3AQBA 4K1OA 1QZ2A 4U0UA 4ANWA 1LPEA 1D8EA 5ENNA 3OEOA 1VTMP 3AG4E 4E7SA 1UW4B 1ELWA 4U8VD 3SXYA 3PNTB 1AVOB 4HVBA 3AU4A 1B68A 4MVRA 1SW6A 3TJ5A 2LSUA 4XKCA 3ZIMA 2UUHA 2CGEA 3ASOE 3ABKE 5CEAA 4XEVA 3SYNA 5ENPD 3ZFWA 1OR3A 5CCLA 4FLHA 1ZHWA 2IFUA 1IYGA 3EQLF 2FULA 2IEJA 4U5FE 3JSEO 3NQPA 4F3VA 2P7VA 3U3WA 3AJMA 5EX0A 5A6AA 1LE4A 3TAXA 5T1DB 5BQIA 5G04C 3AG4C 2KSFA 3TWTA 3FULA 2OOCA 2XLOA 4TUMA 4EZKA 4GMJA 2P9SG 3A11A 4YT2A 3EG9B 3Q6MA 5KJNA 2OJED 3FEXA 2AWCA 4GEHA 5DS4A 4FLBA 4OD5A 3QB2A 5EIBE 1FVHA 3PRZA 2W9YA 3GWNA 2R7VA 1A7DA 3WHNA 5DBKA 2FGYA 3S0XA 3D9KA 4DJAA 3SI5A 4CDVA 3LJBA 1EI7A 2BTDA 1BI7B 1OWLA 2J8SD 4R7LA 4Z9IA 1VYKA 3O10A 4YL0A 3HHMA 3BQOA 4J8SA 3L8IA 3JRTA 5D66A 3LVQE 3EGDA 4FU3A 4HOSA 3W4YA 1Q0MA 1NZEA 1OCZE 2XPZA 3V79K 1E86A 4DX2A 3QW1A 1D1CA 3HVEB 3ASNC 2WVQA 1SA4A 3RAUA 3MCXA 3TWXA 3LS0A 3S84A 5KYNA 1BBHA 2PX3A 1Q0GA 4UUCA 2G62A 3L9TA 1W3BA 3UMKA 2EINE 3B95A 5ARGA 3C72A 3ZTZA 3IEGA 1O3UA 4AX2A 3TD7A 4KBLA 5KYYA 4HI9A 2ZXOA 2XLEA 4OAVB 1ZU5A 5B3SE 2QE9A 2V5QC 1OCZC 4ANVA 1E96B 2H6FA 4A2NB 3V2OA 4DLOA 2JLBA 1JCRA 1IW7F 1E8XA 4QFVA 2R7QA 2ETBA 2CHZA 4IGGA 2XQ0A 4WWOA 2VQ2A 3DSVA 4K0RA 3QAQA 2OEXA 1H9TA 3LUTB 4JJFA 1QLEC 2KGOA 3ZWIA 1T6IA 5BNWA 4A63B 1TN8A 2J8WA 4WJ0A 3IV0A 1H2TC 3CVQA 3D9JA 2VCCA 1K3ZD 3W2WA 3CSFA 4D10C 3L8JA 4KZCA 5DLJA 2WXQA 3LY7A 5JLIA 5AQBA 1HS6A 4HFGA 5ITZF 3CVXA 4MVUA 3D9NA 2PZIA 4Y6CA 1RCPA 2H7VC 2IYLD 3TWRA 4BPMA 1WG0A 2GROB 2RG8A 2Q9BA 1LS4A 5B1BE 3MYIA 5FCLA 3DBSA 3ULYA 5JSLA 2XEEA 1JWGA 1YYHA 4PH4B 2IXPA 1S64A 1IQRA 4WAFA 3FUMA 1Z23A 2XGOA 3ESLA 3EIQC 1FFTC 1MYOA 3MBGA 3EFOA 3GWLA 1YCSB 5HRYA 3QZCA 4FJZA 4JC7A 4EIYA 3EHMA 3ZIBA 3SXMA 2Q9AA 1KTMA 1ZBPA 3X2QE 3ZHEA 5J08A 3X1OA 2KW3C 4CGVA 2LCHA 3I4UA 1RKCA 3KMIA 4X0RA 2WVNA 1K04A 2R7SA 3VLEA 2JABA 2PNOA 2Q4FA 2GRMA 1N0RA 4IARA 4MLPA 5B1BC 5COGA 4UWLA 4WWNA 5M72A 1TNUA 1HXIA 4NY3A 4JTDB 5ENOD 1SVXA 2NC9A 2AXVA 4CDYA 3RQEA 4BJ1A 2Y3DA 1OUVA 4L23A 2FEZA 3X2QC 3VLFA 2J9VA 1EDUA 1JPLA 2R7WA 2KBXA 5E3AA 5AQ9A 4HRMB 4CDAA 4E0HA 4AY6A 2IXMA 2E87A 4NC3A 1DCEA 4TV3A 3DEPA 3T6GB 2LAHA 4JB8P 5CI9A 4JEBA 3QOUA 4ANUA 1QQ3A 4LSZE 2RSEB 3CHRA 3CHPA 3ZU7B 1XGWA 2LIGA 3UQ3A 4P29A 3ECSA 1MX6A 3UT4A 4EBAG 2ILRA 4E17A 3FTYA 2OV8A 2VJ8A 1HG5A 2DB4A 3O39A 3S7FA 5D92A 4DI3A 2IXNA 4N6CA 3QVZA 1Z3XA 3NYMA 4I44A 2GRNB 1U0BB 5LOZA 2WMNA 3AAAC 4F1SA 4BY6A 5GPGB 3CQGB 4DVYP 4C9BB 4CDRA 4B8AA 4W8KA 2WXJA 2WXGA 1TWHA 3P2BA 2P9NG 3PDMP 4N3BA 2RFAA 2MYOA 3ZYLA 5EKQD 1A17A 4GZCA 1OXJA 4O79A 2YHSA 2LNIA 5KYXA 2XS8A 2PP4A 3B9QA 3KPHA 4NQFA 4CSAC 2BE5F 2A5UA 1FNTc 5AC4A 4GU5A 4AJWA 3PDNA 4XLNF 5C2YA 4JD2G 4DI4A 3R2PA 1N95A 4N4WA 2OEVA 1ORYA 2GDCA 1TQGA 4PDXA 1BR1A 3WXXA 4BSZB 1JR8A 4FULA 1OT8A 4CEMA 4BJ5A 2IBFA 4I6GA 5G05J 2ZISA 2J08A 5E33A 1ORSC 3LLIA 1WATA 5A6JA 1A0BA 4J7TA 2IOQA 3L1MA 2IONA 4AVXA 4JA9A 3U66A 4I1AA 2VC9A 3DXMG 3G2WA 4U8HA 2A0BA 3JYHA 1CGME 2GRQB 4XPWA 2KQ9A 1T9KA 4EHPA 2QYJA 2VGXA 2R7XA 4L1BA 2GFHA 2WXNA 1WY6A 3PH0C 1DC2A 2GRRB 2KNHA 3VAYA 3SNXA 2R5SA 1U3DA 3ABLE 2QC9A 1E83A 3DKAA 3U4TA 4LERA 4DRIB 2L81A 4EPZA 3W9GA 2XXAA 1BLXB 1J8MF 3UI2A 2XL8A 3FUFA 4GZ6A 4HNAD 4DX1A 3IQTA 2QY9A 4MTFA 4DRHB 5BXUA 1HZ4A 5JA4D 4GYWA 5DS6A 1M57C 3NKEA 2L7AA 2L6HA 3HKKA 4UWKA 2AVPA 5L0JA 4ATZD 2W4MA 1OWMA 1QSPA 3CVYA 1O5HA 2MHKA 4ULVA 4MVSA 1YAUO 2VB6A 3H2UA 3Q47B 4APOA 4QI2A 3D9OA 2LSVA 2DGJA 2LP4A 2PM7A 4L2YA 2A68F 4LG6A 1N94A 4B93B 2O9XA 1ORJA 3AG3C 2NG1A 4W8PA 5KYWB 2J7PA 1C17M 3TXNA 3U64A 5L0CA 5FTPA 3TGOA 3FU6A 3AU5A 3BEHA 3LDZA 4ILGA 1DCQA 3NYLA 4O6NA 2F37A 4AY5A 1HMOA 4KBQA 2Y3AA 4D4XA 3PZ1A 3KYJA 3RQFA 1DOWA 4MTOA 4YDWA 2DYSE 4FESA 1RJ9A 3AG2E 2V5FA 3W2VA 5G2NA 3AQCA 2FF4A 3QW0A 2EPMX 2VSNA 2D4UA 1SZAA 2IF4A 1NL4A 1N54A 3MLGA 5DQZA 2YL3A 2L0IA 2IO3C 2ZU6B 3B7TA 2YLGA 4C7OB 1LF8A 4EZLA 4HI8A 1IXVA 5A7DB 1HY5A 3ZXPA 3JRMO 1BU9A 2EIKE 2Q7FA 3HXEA 4JPSA 2GA0A 3UT8A 4B6IA 3C3OA 2ETCA 5HSWA 1XZPA 1LE2A 3EHNA 3PE3A 5ENRD 3Q73A 3SZ7A 3UMVA 3DMDA 2EIME 1HFAA 2UUIA 3WAQA 2W45A 4H4KC 1K1BA 3B7BA 1C02A 3L22A 2HM8A 1K05A 3KSQA 3JSZA 3MKQB 2CDQA 4UQYA 1D1BA 2WPVA 4U5HA 1LI5A 1UN9A 3TXMA 2XLVA 1JCQA 4PACA 4FJYA 5G55A 1E8WA 3PS6A 5FJYA 3Q6NA 4WABA 4JEUA 2Q9CA 2EIKC 4F6RD 2X6KA 2ZGDA 1TFKB 5ENTD 2PNNA 2OCCE 3FUNA 3EG9A 4JCHA 1U3CA 4E18A 1Z5SC 3FTSA 4LUNU 3FUEA 3OWTA 3G2TA 4FHKA 1HX8A 1MMGA 5A6KA 3QWWA 5BXOA 3D9IA 5JMND 3OAWA 3L0IA 1AUEA 4OYSA 4EBJA 2R25A 5JHAA 4OIPF 1E7VA 4YDOA 4HORA 3RKOF 5ENQD 5ARFA 2X38A 3UX4A 4DRXE 5HV9A 4F7AA 1KNYA 3RVZA 4Z9JA 4HB5A 3G2UA 3PZ4A 3GZ2A 3UKRG 1VLSA 4MKTA 4JL0A 2OKUA 1ZU4A 3J06A 4DX5D 4N5CA 3ZW3A 1LIHA 2OCCC 3Q49B 3QMKA 1LD8A 2WXRA 2CNWD 2X6FA 2ZXWE 5FQ7A 3IXEA 3UM0A 3B7UX 2AJAA 3MZLB 4CT0A 4F53A 1C03A 2X3MA 1UJKA 5CMYA 256BA 1JUQA 3FDHA 2J49A 3DXJF 4R32A 2J4BA 3RRNB 3APDA 3V5YA 1FT1A 4RQIA 2YWAA 2J07A 3VTXA 3MJWA 2WXLA 2J0XA 4ACKA 4GB9A 3CSTA 2FBNA 1W2WA 4IAOA 3PCVA 3DI5A 2J7PD 4YL1A 2J46A 3GYZA 1NZNA 1H2VC 3U9JA 3CEXA 1FT2A 2LQGA 3Q78A 1A41A 3SP1A 3KSLA 4O7GA 4XEFA 3ASDA 2ZXWC 3RF3A 3V2XA 2QLAA 2F8XK 3LJ3A 4FADA 5AN8A 4MBGA 2GRPB 3LJNA 3Q7LA 4CX9A 2XLDA 4DBRA 2QFCA 4ILHB 1Y6DA 1D1AA 3TK0A 3NMJA 1FR0A 3K1HA 2WXMA 3RIPA 2NUPB 4BG0A 5JVEA 3SXZA 2DWZA 1H6KA 4G7ZF 3NZUA 2V0PA 5AARA 3PNLB 3NG1A 3Q4AB 3U9WA 3B71A 4UI9J 4U5EE 1NA3A 4NTBA 3QKYA 1E7UA 2Y4TA 5D0OD 4EKWA 4ZLDA 3UM3A 2A5EA 5FZQA 2NSGA 4C3EA 1TFOB 3ZRHA 2GRLA 4OD4A 1Q0FA 2AP3A 4LLEA 1U6HA 3E4BA 1MMDA 3W9FA 2B0JA 1S7ZA 3FWVA 2MWQA 1O1RA 5DVWA 2PQNA 1YZCA 3C8GD 3U2LA 2V26A 4NTFA 2XRYA 2JX0A 3LCAA 4NACA 3HG0D 3GANA 3DPDA 3FY4A 2E0IA 1MNEA 2WMOA 1KLXA 4GCOA 2KATA 3LPZA 4I2ZA 1WWPA 5AYWD 1I4ZA 5L3QA 3EZHA 1WDYA 3TJ6A 1E84A 2LFFA 1WN0A 5JRAA 3ASNE 2KJGA 1FFHA 4DLQA 3B29A 4URKA 1OW8A 2J45A 3L6AA 4DK5A 1MQVA 3KAEA 4WNDA 3M15A 3E33A 4GCNA 2HV7A 3FXHA 3UGOA 3BRJA 3HLZA 2NSFA 1G3NB 2XENA 1XNFA 2HV6A 2V3CC 3R7CA 4DUIA 1OCCC 2HE0A 4PFPA 2KYHA 3UNGC 4LCTA 5EK0A 2A4ZA 4J6IA 3Q9UC 4XEIG 5EYLA 3CK8A 4JTCB 3T4RA 1UG3A 3FDQA 2AW6A 4YN0B 4MVQA 2CG3A 4IB4A 1ZHZA 2I6HA 3N71A 3ABME 1JCSA 2B0OE 1Y4CA 3ML9A 1UG7A 3I4GA 2B0HA 5FQ4A 5A23A 1WAO1 4N3CA 2KZTB 1Z3IX 4RD9A 1O1SA 4Q94A 4LACB 2XPYA 4K5BA 3JQ0A 4OVVA 2CYDA 4CS8C 5FZTA 1G8XA 3UT7A 1P5QA 3ZEFA 3MFNA 2VSOE 3ZDLA 3TWVA 3UTMA 2GWWA 2JPUA 1SR2A 3RO2A 1Z5ZA 4OIQF 3UXGA 5CBOA 1OKKD 3E30A 4BSXA 4Q4ZF 3CKBA 4F4BA 2HFIA 3FVYA 3O48A 3ABMC 1MMAA 3L16A 3IPMO 3Q7AA 3L54A 3PZ2A 1G5ZA 1Z63A 4YVQC 2BC5A 3UKUG 3F46A 2Q3TA 3B0UX 1S0PA 4JEHA 1YA0A 1D0XA 2VH3A 3LNRA 4E7ZA 4E6HA 2KCVA 3CV0A 1Z3YA 2HO1A 4U0ZA 4G23A 2XCCA 4GTPA 2F0YA 1QPUA 2HZ8A 3LNMB 1H2UA 3ZNGA 1N9AA 3AS4A 3HNIA 4BJ5C 4KNWA 4HEAJ 2EILE 4N3AA 5AAOA 4IYPA 3HRAA 3PUJA 4ONSA 5AQ7A 2OVFA 4I6JA 3EJNA 1YJGA 3AOUA 3Q7GA 4RG6A 3LAYA 2YINA 4PJMA 1LTXA 2W4BA 1GM5A 3FHEA 2VGYA 3RIBA 4FAPB 4QI0A 2Y39A 2Y4UA 2ICWG 4J7YA 1S63A 5JT4A 5T4YA 3HIZA 1N11A 4IULA 2RKKA 3GORA 1QBQA 3K7DA 5TJ5E 1ZHYA 3D9PA 4OVUA 1SZ9A 5KNGA 4LDRA 2UY1B 4I6EA 3C18A 3U9MA 2VASA 1RXQA 2EILC 4FX5A 2LAIA 5KJMA 2R7UA 4K03A 3ASHA 3AS8A 4KVMA 1TWGA 1OCRC 3AGTA 3K9IA 2H6GA 2MRIA 1TEZA 3FTUA 4MW8A 3DAGA 3HYMB 5LCWJ 5AGFA 1H9GA 4U07A 1LM3B 5D2MC 3GM1A 3D9HA 4BEMJ 5BQGA 1ZZPA 5B1AC 2M63A 4PS8A 4UQXA 4RG9A 4JURI 4Z68A 4AL1A 4G8KA 3CEQA 3DM9B 5DS5A 3K1IA 2ZGGA 4YDEA 4LDKA 2L6JA 2MYSA 1NP7A 2YLDA 3ZC4A 1XWJA 2H7OA 1YA9A 2PF4E 4APFA 3CHSA 2KCLA 2C2LA 1AEPA 1HO8A 1TN6A 5KCMA 3KH2A 5KYWA 4NCQA 4P9FA 1OXKA 3LS1A 1HE1A 1NFNA 3AG1E 3PUKA 1E8ZA 2LFDA 2HS5A 4CS8A 1MHQA 3DPYA 3ZYMA 2EPLX 1SQMA 3Q9NC 3SFZA 5F5HA 4Q96A 1A5EA 2R03A 2Q7RA 1SMYF 2JEKA 3QC1A 2I9CA 4KMOA 3V30A 4IJJA 4C0EA 1LD7A 3SGHA 3IQCA 2E2EA 3R7RA 2CW0F 3N24A 1GQAA 3RW0A 4C7OA 1ST6A 2XM0A 1LS1A 2BL2A 2NUTB 4GA1A 2LXMA 2XS1A 5DIZA 4BJ6C 4TRQA 4L6RA 5EIDA 5CI8A 4JJGA 4HRLA 3AG1C 2TMVP 3JTLO 3SEOA 2F8YA 2Y1LE 1TWAA 5JUAA 4J8YA 1SZIA 3KEZA 3V31A 3RJVA 3ASFA 3W8IA 4JIOA 2PM6A 4HE8D 3VLDA 2PX0A 4IAQA 1FVFA 3FUHA 2VCBA 3GODA 4M7CA 5E76A 2A6EF 4FWVA 3G50A 3QDNA 4GMLA 3MKQA 4PJNA 4XX5A 1JWFA 2XL4A 1A7VA 2WQHA 3BU8A 3ONLA 4U96D 1M6TA 2A69F 2XLMA 2V4LA 4BETA 3D9LA 2L6FA 4ILIA 4YNDA 3IHUA 4B94A 1H6PA 2WB2A 2HJMA 2PFDA 5G05C 3DD7A 3GZSA 2X51A 4O6FA 4NRHB 3CVUA 3U8VA 3CSKA 1ZVZA 2C04A 1ZB1A 3CVNA 5C1DA 3CQCB 3APFA 3POVA 3MYFA 4U0SA 1OWOA 4Y6WA 5A6BA 4O6YA 3U2MA 1F1MA 5FZSA 4CCAA 3RH3A 3G2VA 1ZU2A 1I4YA 5K0IA 4FA6A 3S28A 2EIJC 5BV0A 5T3TA 3AG3E 2CFUA 3IEEA 5LFAA 2ETAA 3MYVA 3MV3B 4RDAA 4XKBA 1M56C 3GZ1A 5AJDA 5LP0A 1H6GA 2HJ3A 2RD9A 5E75A 4E85A 3U8PA 2Y3HA 3IHYA 4JZYA 3TWUA 2QY7A 1Z7Qc 1Q0DA 3EU5A 3O6XA 3FP3A 3L13A 1RZ4A 1IKND 4G7HF 4HOUA 3JYSA 2ZXRA 4JE9A 4G8LA 4WUYA 4AK9A 4HOQA 3ASGA 2IQCA 3DSXA 4GZ5A 3S27A 4GTQA 5KBAA 1DNPA 1VMAA 5AENA 1VLTA 3J5PA 3T8KA 4G24A 4GTRA 1Z6AA 4BTBA 3PEUB 3R9AB 3EZIA 4XPXA 3UIPC 3OXFA 1PV3A 4OIRF 4PS3A 4XLPF 3CR3A 3KL4A 4DXWA 4DPRA 4J30B 5CIVA 4LDQA 1IZMA 5JHBA 4PJLA 1QYMA 5KWDA 2ZIRA 4U5DE 1MX4A 2AWYA 4EUKB 3WG7E 2HKVA 5L0DA 3LS8A 4RBNA 3SO8A 3C3QA 2G3KA 3LY9A 2VYIA 4AV7A 2IOSA 3RRUA 4BT8A 5COMA 2GGFA 3CHQA 3CHOA 1OW6A 3OA1A 1NSGB 5JJ7A 2NUPA 2R7TA 3IBEA 1ZW3A 2QNLA 3DWWA 4CS7A 3OXLA 1E90A 2AVKA 2J4DA 3LLKA 3CHMA 4J7WA 2WXFA 1KT0A 4BJ6A 3RRMB 1PCXA 3GW4A 1H19A 3EIJA 1WTYA 3TG4A 4HFFB 4YT5A 5CECB 2WXKA 2NYJA 4GYOA 3D9MA 4YWQA 3WG7C 4JZAA 2VSXE 5AQAA 4GYYA 4CZ2D 4AL0A 2IO2C 4XPYA 3B7RL 4JHRA 2YZSA 3NZSA 3PZ3A 3L17A 4FP7A 4GA2A 3EHRA 2FI7A 3BEEA 3LYAA 4ME2A 3I3NA 4MW3A 3TL5A 2L6BA 2Q00A 3CIAA 4K5CA 2J9WA 3FAPB 1BD8A 1CGOA 1X5BA 1EPUA 1IHBA 3S9OA 2YLIA 3HTKC 2PL2A 4I1OB 5EHHA 2KC7A 3UIOC 1L5JA 3CVLA 2XM4A 5EDSA 1FAPB 1WOLA 3E9VA 5D0QD 4CDMA 4GPMA 1HF8A 2KC3A 1G4US 3DAFA 3FTVA 1UOHA 3WODF 3JUEA 4ATGA 3FTZA 4MRUA 5CCMA 4AIFA 1Q2ZA 3SD5A 1NA0A 4BESA 3MKRA 2X6JA 1CPRA 1K1AA 2HSBA 3FUJA 1R4TA 4PFOA 4AEZC 3E70C 3HXFA 1IHGA 2WB7A 2YVKA 3ZUVB 3W8HA 5J90A 1N4SA 1QKRA 4CJOA 3E32A 4WNFA 3SY2A 3F47A 3KKBA 4IWBA 1O87A 1BZ4A 2HMZA 1UJJA 1QQEA 2M64A 4L7TA 3U3FA 5EILA 1OCOC 3RYLA 1TR2A 3LVRE 3LEWA 2R05A 1R5ID 2LK4A 3URZA 3TOMA 4P9TA 1TJFA 4G2VA 3G4ZA 1PD1A 4K7BA 2KZTA 1N1CA 4GYTA 4G7OF 3BG1B 1TN7A 1NFIE 3ZXSA 4DX7D 3PZDA 4WNGA 3EPVA 5T8IA 3HXDA 1E2XA 3HXBA 4MNDA 3V7OA 2YL1A 2L6GA 1GGQA 5HKPA 4MQ9F 2P9IG 4K0DA 4DX6D 3JXIA 2R7OA 1NG1A 4HFKB 1N4RA 1N4QA 2WQ6A 4A1SA 4UWFA 4NQ0A 1HH8A 4BFRA 2IU1A 3NKDA 1S05A 1HMDA 3CK9A 3ZQVA 4ANJA 3K33A 4OINF 4O60A 1G4WR 4U7EB 3O4ZA 3MX3A 3ESKA 4HOTA 2EPNA 2H6IA 3N0TA 3CGHA 3EUVA 1EA8A 4HBDA 2XSEA 4N39A 1D0YA 3C7JA 2I1KA 2MOWA 1FMVA 1APCA 2XRHA 3TOLA 3C98A 4HLLA 4G0HA 4UI9K 4Q5SF 1O1TA 3NDBB 3VTYA 5F5FA 5KJKA 3ZVRA 4YT8A 4U9DA 2P0NA 4EHMA 3ONKA 2CFZA 3JYYA 4N06A 3GM2A 4BX9A 4GTVA 4UI9C 2VTBB 1TKNA 4XWJA 2GW1A 1H6OA 3RKVA 3V5ZA 1L3PA 1OCCE 1CPQA 3S7BA 5EX3A 1EQ1A 3C8GB 5L0IA 4G78A 3R7QA 5LX8A 1MJ0A 4O1OA 2UY1A 5G04J 4A3VA 4GMRA 4JXTA 1KT1A 5CMWA 1N52A 3JCUQ 4UDVA 5JJTA 3MGBA 2BF0X 2H8AA 4C3DA 4TXPA 4ZHBA 3Q5MA 2G3VA 5JS5A 4PJJA 3R9MA 1ZYRF 3PE4A 1B89A 1L7CA 5KYUB 3RSEG 4ANXA 4N6HA 4OIOF 3DM5A 2L0TB 2OG2A 1VDYA 3LXUX 4U04A 4JHKA 3TWSA 4DVZA 5A6CA 3EGXB 3RK6A 3TJPA 3BUAA 3FUDA 2CCYA 1JPJA 2WL8A 3PHF2 3K1IC 3ENEA 5FZRA 3B0PA 1CGNA 2YHEA 3ASOC 3CVWA 4PS7A 3ABKC 3ZQYA 5BUOA 3RVYA 1M2VB 2AU5A 3L34A 1TYQG 4ZFHA 2PBEA 3SF4A 4MVZA 4ZLCA 1HU3A 3DEOA 2YKZA 2Y69E 5CRVA 4PR9A 3ISMC 4A3TA 4MS6A 3GEIA 3FEYA 4JTAB 4EBBA 4AE4B 2OQMA 1TR4A 3IKOB 4KT6B 4F1PA 2B6CA 3CK7A 2DIWA 3T5XA 1A7EA 4KNVA 4HQDA 2XLWA 4XIFA 4CRWA 4GAAA 4CT4A 1OW7A 4HLEA 3T5VA 1KU2A 2XLHA 3NOCD 3UMIA 4KXKB 4KYOB 3CVPA 4H7YA 4RVBA 1DVPA 1DOVA 2RFMA 4A55A 3CQZA 2Z15A 5ENSD 5F28E 2Y69C 2H7BA 4GTOA 2NUTA 1T01A 3KYIA 4A4AA 4U95D 1I5NA 1K40A 4MVOA 4B8CB 4KC9A 5FQ8A 4TUUA 1HE9A 4XEKA 4G1TA 1VK5A 5FWQA 3FOOA 1U2VG 2DZOA 3FAJA 3PEVB 4V3IA 2M4EA 1SA5A 3FMSA 4A1GA 5AIJA 3G4XA 1QVXA 3LY8A 1OQCA 2IY0C 3F6QA 4UWGA 4DBQA 3KS2A 2EINC 1V54E 2R59A 2WZGA 1RW2A 3LESA 4FHJA 5FQ6A 4GTSA 5BW8C 3RO3A 4U5BE 2LUHA 1OCRE 5COFA 3T8MA 4XI0A 3J5QB 3UUXA 2DZNA 5B3SC 4Q7CA 2XRZA 5E3CA 2YNQA 3NMIA 2ZD9A 4N5QA 5A69A 1FPPA 2J09A 4PUCA 5KJLA 3V5XA 3JT1A 2WXOA 3ZGQA 1WASA 3S90A 1NLXA 2YRFA 4WGYA 3DSTA 5B1AE 1OY3D 4KI2A 3DJUB 3DSWA 5BPPA 5HQ8A 3SBTB 3KEAA 2QTVA 2L9JA 1LKXA 1RMVA 3ULEG 4CIHA 1ZHTA 1MQSA 2IJGX 1V54C 4PK4A 1N4PA 3C3RA 3FTWA 2J9QA 2XGSA 2MHRA 4KVOA 1N0QA 3GM3A 4XQ1A 1INZA 2PQRA 1WM5A 5BT1A 4YL3A 4DJ9A 5H7PA 3CZ6A 1TNYA 2F22A 3FFLA 1NFOA 2QZAA 4KZ0A 3FTXA 4H7XA 3B7SA 1PY1A 1XZQA 4I9CA 2HUJA 3U3BA 4EECA 2XEVA 4EQFA 3C62A 2WXIA 3IHVA 2NPUA 3SXKA 1O5MA 4DRJB 1D8DA 5L0HA 3NBNB 5AJLA 5CRUA 4JA7A 2FFHA 5ANRA 4ER9A 5LCWC 2LXLA 1YLMA 2R02A 4WGZA 3ZYQA 1OWNA 2HSQA 4P6IC 1GS9A 3ML8A 4AP2A 3HNLA 3C63A 1UN8A 5FT9A 2WVOA 2XL6A 1MZCA 1YZAA 2VGEA 5FINA 4QQIA 4B89A 2P6VA 2P9LG 3HNJA 3EGDB 5E2QA 4LEUA 3I5QA 4N2QA 3QJZA 1HE8A 4XE0A 2OJQA 3E37A 1YVIA 4JRZA 3UM2A 3ZPJA 3K66A 3RFYA 1IQUA 3M4BA 4TXQA 3CAXA 4YDYA 3SHFA 1JPNA 1WGWA 4E0IA 4M3OA 4BJTA 3TQOA 3L08A 4GTTA 4GA0A 5JJ6A 2LO6A 4LNGA 2P2CP 1V4AA 5IY5E 2R2LA 2I15A 1KZPA 5T3WA 4WNEA 3K6BA 1TNBA 2BEDA 4EBKA 1MMNA 1E8YA 1FMWA 4J8FA 3GEEA 3OXGA 2XEHA 2HR2A 5KYYB 2R7RA 4NURA 3US6A 4HRNA 2ONDA 2P9UG 2AXUA 3UM1A 5BV1A 1QNFA 3S2AA 1EKYA 1Y8MA 3FU3A 1EF1C 1AWCB 4LRZA 3MV2B 2BKGA 2BUGA 4J8DA 4LNUD 4N2SA 3ZSUA 3EHQA 4X8QA 3JCKC 4YT4A 1ELRA 2WXPA 5EGYA 3NF1A 1QZXA 3LKUA 4Q69A 3VM6A 4I3MA 2OOEA 4I43A 5IY5C 3JZ0A 5JP7A 2I2OA 1FTSA 4C0MA 2RD0A 1ZHXA 2DI3A 1MX2A 4GQHA 5EYPF 4O6MA 2UWJG 3Q7FA 1NU9C 2R17C 4CDNA 2EIJE 4J32B 2XGMA 2ZPAA 1M2OA 4I17A 5ANLA 2WM9A 1TJCA 2P9PG 3JXJA 3A9CA 4GPKA 2WZLA 2QYUA 1RKEA 3SNHA 4J8EA 4EWCA 2A1DD 3S29A 3U5SA 4JW1A 2XCBA 4U5GA 2C03A 1E85A 3LEOA 2NXPA 5DQTA 3D3MA 3DJNB 4NTAA 1SF8A 2WXHA 3EFOB 1JAFA 3DE8A 3L82A 1D9SA 3QVYA 2DCPA 4MS2A 3VRCA 5CBNA 1FCHA 3ZHEB 2VCAA 4I1MA 4XI9A 3IQ5A 2EPOA 4FC8A 2VSYA 3ZN3A 3AS5A 3M79A 3M1CB 3OTNA 3FUKA 2C0MA 3U0CA 3EH2A 3SFXA 2QUPA 3SQVA 2LD6A 3NYJA 3SZRA 3FH5A 3HXCA 3E34A 4U63A 3UMHA 4I2WA 2IXOA 4NIKA 1OWPA 4HXIA 1SYQA 4C48B 5AC5A 2OU6A 1V55E 4L9PA 3S7JA 1H7IA 4CS9C 3UR3C 4AXHA 3JUIA 4LNBA 4U8YD 2CNWA 1OXBA 1U89A 1YYJA 1K8KG 1YA7O 3DRAA 1HW1A 2Y0BG 3FUIA 3I4RB 1VOMA 1JOGA 4BT9A 3KD7A 3ITFA 1T5OA 2ETSA 3ABLC 3QNKA 1LVKA 1NI1A 3UPVA 1KPSB 1YMPA 4BWRA 2P1AA 4QDLA 5B3IA 4C3BA 5CERB 4D4NA 2NSZA 3G2SA 4JKVA 1BPOA 2ASRA 3RU0A 3FU5A 3ZVVA 1KZOA 1V55C 5HS0A 2CHWA 2X6IA 2V4HC 5KNHD 4W9RA 2YHCA 2XPIA 2EQXA 1PD0A 4YJWA 1VB5A 4AOFA 3EDTB 5T3RA 5L0FA 3BG0B 3Q75A 2CHXA 3C5RA 2OVBA 4OAUC 5EN5D 5BUZA 1ZW2A 3CLJA 3LEVA 2HYZA 4YVOA 1NBBA 2WQ7A 2YQYA 2WZFA 3B0VC 3SFYA 4ULWA 2WVIA 4G26A 3DWLG 1ELKA 1VYIA 4IRUA 1JRAA 3GEHA 3DSSA 3NAWA 4JVSA 1BR4A 3HNKA 3CKCA 1EYHA 4LLCA 3ZKJA 3MEKA 2J9UA 3I5PA 5CEDB 2Y3GA 2XHEA 3DSUA 4BTAA 2EPKX 3IQ6A 5KYXB 1Z6TA 1UFBA 3TULA 3QARA 2VTBA 1X81A 2OEWA 3VF0A 3NB2A 2XZDG 3T9KA 3JQ1A 1TNZA 4UWHA 3QK0A 5HI7A 1HG2A 1RKEB 4CJGA 4CSAA 2DYSC 3AG2C 3C8GA 4GZ3A 4DOZA 3PREA 3ZYKA 3N2ZB 3HJCA 4BERA 3M4CA
chains in the Genus database with same CATH topology
3PVLA 5L3VA 1J8YF 3H65A 1PC2A 1PAQA 4B0ZA 2KCKA 1NU7D 5KYUA 4I9EA 2C0LA 3VYWA 2VGXB 4G11A 3APCA 2L9BA 3EGXA 4G25A 3NRHA 2AXZA 4EBAA 2EIMC 4XZ4A 2YEVA 4BEJA 2LSEA 2DBAA 2ZXPA 2XXAB 1M2VA 2AWIA 4UQZA 4IN3B 4WWPA 3EH1A 3QWVA 3SBSA 2YQ8A 2I1JA 3FU0A 2I8BA 3MA5A 3ZG1A 2X6HA 5CHEE 4AM9A 4ACLA 3B13A 3CVVA 3DZAA 4HS2A 4BX8A 4JHJA 4ABNA 4CS9A 4AE4A 1TWCA 1MNDA 1H0AA 3QWPA 3HVEA 2IOLA 3HDXA 2P58C 2D5RB 3TG5A 2Y3BA 4U5CE 3S7DA 4CGWA 2V8SE 5D91A 4L2LA 3T6JA 4XTKA 1D0ZA 1OKKA 3Q15A 1Y6IA 2FO7A 2CG2A 2DYRC 2A6HF 4J0UA 4CBEA 4EZJA 3T6BA 1RJ9B 3PMRA 1BR2A 3UGPA 4RSYA 3FH8A 3P1UA 2JD3A 4JC8A 3ULQA 2KM4A 2J0WA 4GZDA 3FH7A 3FHDA 4M63A 1GW6A 4U0UA 3AQBA 1QZ2A 4ANWA 5ENNA 3OEOA 4E7SA 1UW4B 1ELWA 3PNTB 4HVBA 3AU4A 2LSUA 4XKCA 3ZIMA 2CGEA 3SYNA 3ZFWA 5CCLA 4FLHA 1ZHWA 2IFUA 1IYGA 3EQLF 2FULA 4U5FE 3NQPA 4F3VA 2P7VA 3U3WA 5EX0A 3TAXA 5T1DB 5G04C 3AG4C 3FULA 4EZKA 4GMJA 4YT2A 3EG9B 3Q6MA 5KJNA 3FEXA 4GEHA 5DS4A 4FLBA 4OD5A 3QB2A 1FVHA 3PRZA 2W9YA 2R7VA 5DBKA 2FGYA 3S0XA 3D9KA 4DJAA 3SI5A 3LJBA 2BTDA 1OWLA 4R7LA 1VYKA 3HHMA 4J8SA 3JRTA 3LVQE 3EGDA 4FU3A 4HOSA 1NZEA 2XPZA 1D1CA 3HVEB 3ASNC 2WVQA 3MCXA 3LS0A 5KYNA 2PX3A 2G62A 1W3BA 3UMKA 5ARGA 3IEGA 4AX2A 3TD7A 4KBLA 5KYYA 2ZXOA 1ZU5A 1OCZC 4ANVA 1E96B 4A2NB 4DLOA 2JLBA 1IW7F 1E8XA 4QFVA 2R7QA 2CHZA 2XQ0A 4WWOA 2VQ2A 4K0RA 3QAQA 4JJFA 1QLEC 2KGOA 5BNWA 4WJ0A 3IV0A 1H2TC 3CVQA 3D9JA 3W2WA 3CSFA 4D10C 4KZCA 5DLJA 2WXQA 3LY7A 1HS6A 4HFGA 3CVXA 3D9NA 2PZIA 4Y6CA 2H7VC 2IYLD 2RG8A 2Q9BA 5FCLA 3DBSA 1JWGA 4PH4B 2IXPA 1IQRA 4WAFA 3FUMA 1Z23A 2XGOA 3ESLA 3EIQC 1FFTC 3EFOA 3QZCA 4FJZA 3EHMA 3ZIBA 2Q9AA 1ZBPA 3ZHEA 5J08A 3X1OA 2KW3C 4CGVA 3I4UA 3KMIA 4X0RA 2WVNA 2R7SA 3VLEA 2GRMA 4MLPA 5B1BC 4UWLA 4WWNA 5M72A 1HXIA 4NY3A 2NC9A 2AXVA 4BJ1A 2Y3DA 1OUVA 4L23A 2FEZA 3X2QC 3VLFA 2J9VA 1EDUA 1JPLA 2R7WA 5E3AA 4AY6A 2IXMA 2E87A 4TV3A 2LAHA 5CI9A 3QOUA 4ANUA 3CHRA 3CHPA 1XGWA 3UQ3A 4P29A 3ECSA 3UT4A 4EBAG 2ILRA 3FTYA 2OV8A 2VJ8A 1HG5A 3O39A 4DI3A 3S7FA 5D92A 2IXNA 1Z3XA 3NYMA 4I44A 5LOZA 2WMNA 4F1SA 4BY6A 3CQGB 4DVYP 4C9BB 4CDRA 4B8AA 4W8KA 2WXJA 2WXGA 1TWHA 3P2BA 4N3BA 3ZYLA 5EKQD 1A17A 4GZCA 4O79A 2YHSA 2LNIA 5KYXA 2PP4A 3B9QA 4CSAC 2BE5F 2A5UA 4GU5A 4AJWA 3PDNA 4XLNF 5C2YA 4DI4A 4PDXA 1BR1A 3WXXA 4FULA 4CEMA 4BJ5A 4I6GA 5G05J 2J08A 5E33A 3LLIA 2IOQA 2IONA 4AVXA 4JA9A 3U66A 4I1AA 3G2WA 4U8HA 3JYHA 2KQ9A 2VGXA 2R7XA 4L1BA 2GFHA 2WXNA 1WY6A 3PH0C 2KNHA 3VAYA 3SNXA 2R5SA 1U3DA 3U4TA 4LERA 2L81A 4EPZA 2XXAA 1J8MF 3FUFA 4GZ6A 2QY9A 1HZ4A 4GYWA 5DS6A 1M57C 3NKEA 4UWKA 2AVPA 2W4MA 1OWMA 3CVYA 1O5HA 2MHKA 2VB6A 3Q47B 4APOA 4QI2A 3D9OA 2LSVA 2DGJA 2PM7A 4L2YA 2A68F 2O9XA 3AG3C 2NG1A 5KYWB 2J7PA 3TXNA 3U64A 3TGOA 5FTPA 3FU6A 3AU5A 4ILGA 3LDZA 3NYLA 4O6NA 4AY5A 4KBQA 2Y3AA 4FESA 1RJ9A 2V5FA 3W2VA 5G2NA 3AQCA 2FF4A 2VSNA 1SZAA 2IF4A 1N54A 3MLGA 5DQZA 2L0IA 2ZU6B 3B7TA 4C7OB 1LF8A 4EZLA 5A7DB 2Q7FA 4JPSA 3UT8A 4B6IA 5HSWA 3EHNA 3PE3A 3SZ7A 3UMVA 3DMDA 1HFAA 2W45A 4H4KC 3L22A 2HM8A 3JSZA 3MKQB 2CDQA 4UQYA 1D1BA 2WPVA 4U5HA 1UN9A 3TXMA 4FJYA 5G55A 1E8WA 3PS6A 5FJYA 3Q6NA 4JEUA 2Q9CA 2EIKC 2X6KA 3FUNA 3EG9A 4JCHA 1U3CA 3FTSA 4LUNU 3FUEA 3OWTA 4FHKA 3G2TA 1MMGA 1HX8A 3QWWA 3D9IA 3OAWA 3L0IA 4OYSA 5JHAA 4OIPF 1E7VA 4HORA 3RKOF 5ARFA 2X38A 3UX4A 4F7AA 3G2UA 3GZ2A 4MKTA 4JL0A 1ZU4A 4N5CA 3ZW3A 2OCCC 3Q49B 3QMKA 2WXRA 2CNWD 2X6FA 5FQ7A 3B7UX 4F53A 3MZLB 4CT0A 2X3MA 1UJKA 5CMYA 1JUQA 3FDHA 2J49A 3DXJF 2J4BA 3RRNB 3APDA 2J07A 3VTXA 3MJWA 2WXLA 2J0XA 4ACKA 4GB9A 3CSTA 2FBNA 1W2WA 4IAOA 2J7PD 2J46A 3GYZA 1NZNA 1H2VC 3SP1A 4O7GA 3ASDA 2ZXWC 3LJ3A 4FADA 3Q7LA 4DBRA 2QFCA 4ILHB 1D1AA 3K1HA 2WXMA 3RIPA 2NUPB 4BG0A 3NZUA 1H6KA 4G7ZF 2V0PA 3PNLB 3NG1A 3Q4AB 3U9WA 4UI9J 4U5EE 1NA3A 3QKYA 1E7UA 2Y4TA 5D0OD 4ZLDA 5FZQA 4C3EA 3ZRHA 2GRLA 4OD4A 3E4BA 4LLEA 1MMDA 2B0JA 1S7ZA 3FWVA 2MWQA 5DVWA 2PQNA 2V26A 2XRYA 3LCAA 4NACA 3GANA 3DPDA 3FY4A 2E0IA 1MNEA 2WMOA 1KLXA 4GCOA 2KATA 3LPZA 4I2ZA 5AYWD 5L3QA 3EZHA 2KJGA 1FFHA 4DLQA 4URKA 2J45A 3L6AA 4DK5A 3KAEA 4WNDA 4GCNA 2HV7A 3UGOA 3HLZA 1XNFA 2HV6A 2V3CC 1OCCC 4PFPA 3UNGC 4LCTA 2A4ZA 4J6IA 3CK8A 3T4RA 1UG3A 3FDQA 2AW6A 4YN0B 2CG3A 1ZHZA 2I6HA 3N71A 3ML9A 3I4GA 5FQ4A 5A23A 1WAO1 4N3CA 2KZTB 1Z3IX 4RD9A 4Q94A 4LACB 2XPYA 3JQ0A 4OVVA 4CS8C 1G8XA 3UT7A 1P5QA 3ZEFA 2VSOE 3RO2A 1Z5ZA 4OIQF 1OKKD 4BSXA 4Q4ZF 3CKBA 4F4BA 3FVYA 3O48A 3ABMC 1MMAA 3L16A 3L54A 1Z63A 4YVQC 3F46A 2Q3TA 3B0UX 1S0PA 4JEHA 1YA0A 1D0XA 2VH3A 3LNRA 4E7ZA 4E6HA 2KCVA 3CV0A 1Z3YA 2HO1A 4U0ZA 4G23A 2XCCA 1H2UA 3AS4A 4BJ5C 4KNWA 4HEAJ 4N3AA 4IYPA 3PUJA 2OVFA 4I6JA 3EJNA 3Q7GA 4RG6A 3LAYA 2YINA 4PJMA 2W4BA 3FHEA 2VGYA 3RIBA 4QI0A 2Y39A 2Y4UA 5T4YA 3HIZA 4IULA 3K7DA 1ZHYA 3D9PA 4OVUA 1SZ9A 2UY1B 4I6EA 2VASA 2EILC 4FX5A 2LAIA 5KJMA 2R7UA 4K03A 3ASHA 3AS8A 4KVMA 1TWGA 1OCRC 3K9IA 2MRIA 1TEZA 3FTUA 3DAGA 3HYMB 5LCWJ 4U07A 2M63A 5B1AC 4PS8A 4UQXA 4RG9A 4JURI 3CEQA 3DM9B 5DS5A 2L6JA 2MYSA 1NP7A 3ZC4A 2H7OA 2PF4E 4APFA 3CHSA 2KCLA 2C2LA 1HO8A 5KCMA 3KH2A 5KYWA 3LS1A 3PUKA 1E8ZA 4CS8A 1MHQA 3ZYMA 3SFZA 1SQMA 5F5HA 4Q96A 1SMYF 2JEKA 3QC1A 2I9CA 4KMOA 4IJJA 4C0EA 3SGHA 2E2EA 3R7RA 2CW0F 3N24A 4C7OA 1ST6A 1LS1A 4GA1A 2NUTB 5DIZA 4BJ6C 4TRQA 5CI8A 4JJGA 3AG1C 3SEOA 1TWAA 1SZIA 3KEZA 3RJVA 3ASFA 3W8IA 2PM6A 4HE8D 3VLDA 2PX0A 1FVFA 5E76A 3FUHA 3GODA 2A6EF 4FWVA 3QDNA 4GMLA 3MKQA 4PJNA 4XX5A 1JWFA 2XL4A 3ONLA 2WQHA 2A69F 2V4LA 3D9LA 4ILIA 4YNDA 4B94A 2WB2A 2PFDA 5G05C 3DD7A 3GZSA 2X51A 4O6FA 4NRHB 3CVUA 3CSKA 2C04A 3CVNA 5C1DA 3CQCB 3APFA 3POVA 4U0SA 1OWOA 4Y6WA 4O6YA 4CCAA 5FZSA 3RH3A 3G2VA 1ZU2A 4FA6A 3S28A 2EIJC 5BV0A 5T3TA 2CFUA 3IEEA 5LFAA 3MYVA 3MV3B 4RDAA 4XKBA 1M56C 3GZ1A 5AJDA 5LP0A 5E75A 4E85A 2Y3HA 3IHYA 4JZYA 2QY7A 3O6XA 3FP3A 3L13A 4G7HF 4HOUA 3JYSA 2ZXRA 4WUYA 4AK9A 4HOQA 3ASGA 2IQCA 4GZ5A 3S27A 1DNPA 1VMAA 5AENA 4G24A 1Z6AA 4BTBA 3PEUB 3R9AB 3EZIA 3OXFA 4OIRF 4PS3A 4XLPF 3CR3A 3KL4A 4DPRA 4J30B 1IZMA 5JHBA 4PJLA 4U5DE 3LS8A 4RBNA 2G3KA 3LY9A 2VYIA 4AV7A 2IOSA 3RRUA 4BT8A 2GGFA 3CHQA 3CHOA 3OA1A 5JJ7A 2NUPA 2R7TA 3IBEA 4CS7A 3OXLA 1E90A 2J4DA 3LLKA 3CHMA 2WXFA 1KT0A 4BJ6A 3RRMB 1PCXA 3GW4A 1H19A 3EIJA 3TG4A 4HFFB 4YT5A 2WXKA 4GYOA 3D9MA 4YWQA 3WG7C 4JZAA 2VSXE 4GYYA 3B7RL 4JHRA 2YZSA 3NZSA 4FP7A 3L17A 4GA2A 2FI7A 3BEEA 3LYAA 4ME2A 3I3NA 3TL5A 3CIAA 2J9WA 1X5BA 1EPUA 3HTKC 2PL2A 4I1OB 5EHHA 2KC7A 1L5JA 3CVLA 5EDSA 3E9VA 5D0QD 4CDMA 1HF8A 3DAFA 3FTVA 3WODF 4ATGA 3FTZA 4MRUA 5CCMA 4AIFA 3SD5A 1NA0A 3MKRA 2X6JA 3FUJA 4PFOA 4AEZC 3E70C 1IHGA 2WB7A 3W8HA 5J90A 4WNFA 3F47A 3KKBA 4IWBA 1O87A 1UJJA 1QQEA 4L7TA 1OCOC 3RYLA 1TR2A 3LVRE 3LEWA 3URZA 1TJFA 4G2VA 1PD1A 4K7BA 2KZTA 1N1CA 4GYTA 4G7OF 3BG1B 3ZXSA 3PZDA 4WNGA 3EPVA 5T8IA 4MNDA 3V7OA 4MQ9F 4K0DA 2R7OA 1NG1A 4HFKB 2WQ6A 4A1SA 4UWFA 4NQ0A 1HH8A 4BFRA 2IU1A 3NKDA 3CK9A 4ANJA 3K33A 4OINF 3O4ZA 3MX3A 3ESKA 4HOTA 3N0TA 3CGHA 2XSEA 4N39A 1D0YA 2I1KA 2MOWA 1FMVA 2XRHA 3C98A 4G0HA 4UI9K 4Q5SF 3NDBB 3VTYA 5F5FA 5KJKA 3ZVRA 4YT8A 3ONKA 2CFZA 4N06A 4BX9A 4UI9C 2VTBB 1TKNA 4XWJA 2GW1A 3RKVA 3S7BA 5EX3A 3R7QA 5LX8A 2UY1A 5G04J 4A3VA 4JXTA 1KT1A 5CMWA 1N52A 3JCUQ 5JJTA 3MGBA 2BF0X 4C3DA 3Q5MA 2G3VA 4PJJA 1ZYRF 3PE4A 1B89A 5KYUB 4ANXA 4OIOF 3DM5A 2L0TB 2OG2A 1VDYA 3LXUX 4U04A 4JHKA 4DVZA 5A6CA 3EGXB 3RK6A 3TJPA 3FUDA 1JPJA 2WL8A 3PHF2 3K1IC 3ENEA 5FZRA 3B0PA 2YHEA 3CVWA 3ASOC 4PS7A 3ABKC 5BUOA 1M2VB 3L34A 3SF4A 4ZLCA 1HU3A 4A3TA 4MS6A 3FEYA 4EBBA 4AE4B 3IKOB 4KT6B 3CK7A 2DIWA 3T5XA 4KNVA 4XIFA 4CRWA 4GAAA 4CT4A 4HLEA 3T5VA 1KU2A 3UMIA 4KXKB 4KYOB 3CVPA 4H7YA 4RVBA 1DVPA 4A55A 3CQZA 2Z15A 2Y69C 2H7BA 2NUTA 4B8CB 4KC9A 5FQ8A 4TUUA 4G1TA 1VK5A 5FWQA 3FAJA 3PEVB 4V3IA 2M4EA 4A1GA 5AIJA 3LY8A 4UWGA 4DBQA 3KS2A 2EINC 2R59A 2WZGA 3LESA 4FHJA 5FQ6A 5BW8C 3RO3A 4U5BE 3T8MA 4XI0A 3UUXA 5B3SC 4Q7CA 2XRZA 5E3CA 2YNQA 5KJLA 2J09A 4PUCA 3JT1A 2WXOA 3ZGQA 4KI2A 3DJUB 5BPPA 5HQ8A 3SBTB 2QTVA 2L9JA 1LKXA 4CIHA 1ZHTA 1MQSA 2IJGX 1V54C 4PK4A 3FTWA 2J9QA 2XGSA 4KVOA 1INZA 2PQRA 1WM5A 5BT1A 3CZ6A 3FFLA 4KZ0A 3FTXA 4H7XA 3B7SA 1PY1A 4I9CA 4EECA 2XEVA 4EQFA 2WXIA 3IHVA 5AJLA 4JA7A 2FFHA 5ANRA 5LCWC 3ZYQA 1OWNA 4P6IC 3ML8A 4AP2A 1UN8A 5FT9A 2WVOA 4B89A 2P6VA 3EGDB 5E2QA 4LEUA 3I5QA 4N2QA 3QJZA 1HE8A 4XE0A 3ZPJA 3K66A 3RFYA 1IQUA 3SHFA 1JPNA 1WGWA 4M3OA 4BJTA 3L08A 4GA0A 5JJ6A 2LO6A 5T3WA 4WNEA 3K6BA 1MMNA 1E8YA 1FMWA 4J8FA 3OXGA 2HR2A 5KYYB 2R7RA 4NURA 2ONDA 2AXUA 5BV1A 1QNFA 3S2AA 1Y8MA 3FU3A 1EF1C 4LRZA 3MV2B 2BUGA 4J8DA 4N2SA 3ZSUA 3JCKC 4YT4A 1ELRA 2WXPA 5EGYA 3NF1A 1QZXA 3LKUA 4Q69A 4I3MA 2OOEA 4I43A 5IY5C 2I2OA 1FTSA 4C0MA 2RD0A 1ZHXA 4O6MA 2UWJG 1NU9C 2R17C 4CDNA 4J32B 2XGMA 2ZPAA 1M2OA 4I17A 5ANLA 2WM9A 1TJCA 4GPKA 2WZLA 3SNHA 4J8EA 4EWCA 2A1DD 3S29A 4JW1A 2XCBA 4U5GA 2C03A 2NXPA 5DQTA 3D3MA 3DJNB 1SF8A 2WXHA 3EFOB 2DCPA 1FCHA 3ZHEB 4I1MA 4XI9A 4FC8A 2VSYA 3ZN3A 3AS5A 3OTNA 3M1CB 3FUKA 2C0MA 3EH2A 3NYJA 3SZRA 3FH5A 4U63A 3UMHA 4I2WA 2IXOA 1OWPA 4HXIA 3S7JA 4CS9C 3UR3C 4AXHA 3JUIA 2CNWA 3FUIA 3I4RB 1VOMA 4BT9A 3KD7A 3ITFA 3ABLC 3QNKA 1LVKA 3UPVA 4BWRA 4QDLA 4C3BA 2NSZA 3G2SA 1BPOA 3RU0A 3FU5A 3ZVVA 1V55C 2CHWA 2X6IA 4W9RA 2YHCA 2XPIA 2EQXA 1PD0A 4YJWA 4AOFA 3EDTB 5T3RA 3BG0B 2CHXA 2OVBA 5BUZA 3CLJA 3LEVA 2HYZA 4YVOA 2WQ7A 2WZFA 3B0VC 4ULWA 2WVIA 4G26A 1ELKA 1VYIA 4IRUA 4JVSA 1BR4A 3CKCA 1EYHA 4LLCA 3MEKA 2J9UA 3I5PA 2Y3GA 2XHEA 4BTAA 5KYXB 1Z6TA 3QARA 2VTBA 3JQ1A 4UWHA 3QK0A 5HI7A 1HG2A 4CSAA 2DYSC 3AG2C 4GZ3A 4DOZA 3PREA 3ZYKA 3N2ZB 3HJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5P A; 
#chains in the Genus database with same CATH topology
 3PVL A;  4GTM A;  5L3V A;  1J8Y F;  3H65 A;  1PC2 A;  1PAQ A;  4JCZ A;  4U9E A;  4B0Z A;  4CYM D;  2KCK A;  1OCO E;  4MTG A;  1LI7 A;  1NU7 D;  2GAQ A;  5KYU A;  4I9E A;  2C0L A;  3VYW A;  2VGX B;  1YYX A;  1YDI A;  4G11 A;  5A6B D;  3APC A;  2L9B A;  3EGX A;  4G25 A;  3NRH A;  2AXZ A;  4K5A B;  3TWQ A;  4EBA A;  2EIM C;  3AGU A;  4XZ4 A;  1Q0K A;  3RQG A;  2DVW A;  2YEV A;  4BEJ A;  5BQH A;  2LSE A;  2DBA A;  2ZXP A;  2XXA B;  1M2V A;  1HW2 A;  2HMQ A;  3AJI A;  2AWI A;  4UQZ A;  4IN3 B;  4WWP A;  3EH1 A;  3QTH A;  3QWV A;  2BKK B;  3SBS A;  2YQ8 A;  2I1J A;  3FU0 A;  2I8B A;  3MA5 A;  3ZG1 A;  3UIN C;  3DXK G;  5FIO A;  2X6H A;  5CHE E;  4AM9 A;  4ACL A;  3B13 A;  4YK5 A;  3CVV A;  3DZA A;  1T6Q A;  4BEP A;  2DYR E;  4HS2 A;  4BX8 A;  4JHJ A;  4ABN A;  4CS9 A;  1S70 B;  4AE4 A;  1AP7 A;  1TWC A;  1T6U A;  1MND A;  1H0A A;  3QWP A;  3HVE A;  2IOL A;  1YAR O;  2YL0 A;  3HDX A;  2P58 C;  2D5R B;  2H6H A;  3TG5 A;  3ATP A;  2Y3B A;  3H2V A;  1BI8 B;  2A0U A;  4U5C E;  2YL7 A;  3ZTM A;  2X0C A;  1OR2 A;  5L0G A;  3S7D A;  4CGW A;  3T9O A;  2FO1 E;  2V8S E;  5D91 A;  4L2L A;  3T6J A;  4XTK A;  1D0Z A;  1TNO A;  2J9B A;  4MVM A;  1OKK A;  3Q15 A;  1Y6I A;  3DE9 A;  2FO7 A;  1JMW A;  2CG2 A;  2P61 A;  3EU9 A;  2DYR C;  2IM8 A;  2A6H F;  3C8Z A;  3O55 A;  4J0U A;  4CBE A;  3TWW A;  4EZJ A;  2R9R B;  3T6B A;  1V74 B;  3NOG D;  1RJ9 B;  3PMR A;  1BR2 A;  3NMK A;  3FOP A;  2FAP B;  2P9K G;  3UGP A;  4CIP A;  4TXR A;  2KK1 A;  4JEA A;  4RSY A;  1BDJ B;  4H54 A;  3FH8 A;  3P1U A;  2JD3 A;  4JC8 A;  4O1P A;  3Q79 A;  3ULQ A;  2KM4 A;  2J0W A;  4Z9H A;  4GZD A;  3FH7 A;  4RLY A;  2KXP C;  3FHD A;  4M63 A;  1GW6 A;  2XZT G;  3AQB A;  4K1O A;  1QZ2 A;  4U0U A;  4ANW A;  1LPE A;  1D8E A;  5ENN A;  3OEO A;  1VTM P;  3AG4 E;  4E7S A;  1UW4 B;  1ELW A;  4U8V D;  3SXY A;  3PNT B;  1AVO B;  4HVB A;  3AU4 A;  1B68 A;  4MVR A;  1SW6 A;  3TJ5 A;  2LSU A;  4XKC A;  3ZIM A;  2UUH A;  2CGE A;  3ASO E;  3ABK E;  5CEA A;  4XEV A;  3SYN A;  5ENP D;  3ZFW A;  1OR3 A;  5CCL A;  4FLH A;  1ZHW A;  2IFU A;  1IYG A;  3EQL F;  2FUL A;  2IEJ A;  4U5F E;  3JSE O;  3NQP A;  4F3V A;  2P7V A;  3U3W A;  3AJM A;  5EX0 A;  5A6A A;  1LE4 A;  3TAX A;  5T1D B;  5BQI A;  5G04 C;  3AG4 C;  2KSF A;  3TWT A;  3FUL A;  2OOC A;  2XLO A;  4TUM A;  4EZK A;  4GMJ A;  2P9S G;  3A11 A;  4YT2 A;  3EG9 B;  3Q6M A;  5KJN A;  2OJE D;  3FEX A;  2AWC A;  4GEH A;  5DS4 A;  4FLB A;  4OD5 A;  3QB2 A;  5EIB E;  1FVH A;  3PRZ A;  2W9Y A;  3GWN A;  2R7V A;  1A7D A;  3WHN A;  5DBK A;  2FGY A;  3S0X A;  3D9K A;  4DJA A;  3SI5 A;  4CDV A;  3LJB A;  1EI7 A;  2BTD A;  1BI7 B;  1OWL A;  2J8S D;  4R7L A;  4Z9I A;  1VYK A;  3O10 A;  4YL0 A;  3HHM A;  3BQO A;  4J8S A;  3L8I A;  3JRT A;  5D66 A;  3LVQ E;  3EGD A;  4FU3 A;  4HOS A;  3W4Y A;  1Q0M A;  1NZE A;  1OCZ E;  2XPZ A;  3V79 K;  1E86 A;  4DX2 A;  3QW1 A;  1D1C A;  3HVE B;  3ASN C;  2WVQ A;  1SA4 A;  3RAU A;  3MCX A;  3TWX A;  3LS0 A;  3S84 A;  5KYN A;  1BBH A;  2PX3 A;  1Q0G A;  4UUC A;  2G62 A;  3L9T A;  1W3B A;  3UMK A;  2EIN E;  3B95 A;  5ARG A;  3C72 A;  3ZTZ A;  3IEG A;  1O3U A;  4AX2 A;  3TD7 A;  4KBL A;  5KYY A;  4HI9 A;  2ZXO A;  2XLE A;  4OAV B;  1ZU5 A;  5B3S E;  2QE9 A;  2V5Q C;  1OCZ C;  4ANV A;  1E96 B;  2H6F A;  4A2N B;  3V2O A;  4DLO A;  2JLB A;  1JCR A;  1IW7 F;  1E8X A;  4QFV A;  2R7Q A;  2ETB A;  2CHZ A;  4IGG A;  2XQ0 A;  4WWO A;  2VQ2 A;  3DSV A;  4K0R A;  3QAQ A;  2OEX A;  1H9T A;  3LUT B;  4JJF A;  1QLE C;  2KGO A;  3ZWI A;  1T6I A;  5BNW A;  4A63 B;  1TN8 A;  2J8W A;  4WJ0 A;  3IV0 A;  1H2T C;  3CVQ A;  3D9J A;  2VCC A;  1K3Z D;  3W2W A;  3CSF A;  4D10 C;  3L8J A;  4KZC A;  5DLJ A;  2WXQ A;  3LY7 A;  5JLI A;  5AQB A;  1HS6 A;  4HFG A;  5ITZ F;  3CVX A;  4MVU A;  3D9N A;  2PZI A;  4Y6C A;  1RCP A;  2H7V C;  2IYL D;  3TWR A;  4BPM A;  1WG0 A;  2GRO B;  2RG8 A;  2Q9B A;  1LS4 A;  5B1B E;  3MYI A;  5FCL A;  3DBS A;  3ULY A;  5JSL A;  2XEE A;  1JWG A;  1YYH A;  4PH4 B;  2IXP A;  1S64 A;  1IQR A;  4WAF A;  3FUM A;  1Z23 A;  2XGO A;  3ESL A;  3EIQ C;  1FFT C;  1MYO A;  3MBG A;  3EFO A;  3GWL A;  1YCS B;  5HRY A;  3QZC A;  4FJZ A;  4JC7 A;  4EIY A;  3EHM A;  3ZIB A;  3SXM A;  2Q9A A;  1KTM A;  1ZBP A;  3X2Q E;  3ZHE A;  5J08 A;  3X1O A;  2KW3 C;  4CGV A;  2LCH A;  3I4U A;  1RKC A;  3KMI A;  4X0R A;  2WVN A;  1K04 A;  2R7S A;  3VLE A;  2JAB A;  2PNO A;  2Q4F A;  2GRM A;  1N0R A;  4IAR A;  4MLP A;  5B1B C;  5COG A;  4UWL A;  4WWN A;  5M72 A;  1TNU A;  1HXI A;  4NY3 A;  4JTD B;  5ENO D;  1SVX A;  2NC9 A;  2AXV A;  4CDY A;  3RQE A;  4BJ1 A;  2Y3D A;  1OUV A;  4L23 A;  2FEZ A;  3X2Q C;  3VLF A;  2J9V A;  1EDU A;  1JPL A;  2R7W A;  2KBX A;  5E3A A;  5AQ9 A;  4HRM B;  4CDA A;  4E0H A;  4AY6 A;  2IXM A;  2E87 A;  4NC3 A;  1DCE A;  4TV3 A;  3DEP A;  3T6G B;  2LAH A;  4JB8 P;  5CI9 A;  4JEB A;  3QOU A;  4ANU A;  1QQ3 A;  4LSZ E;  2RSE B;  3CHR A;  3CHP A;  3ZU7 B;  1XGW A;  2LIG A;  3UQ3 A;  4P29 A;  3ECS A;  1MX6 A;  3UT4 A;  4EBA G;  2ILR A;  4E17 A;  3FTY A;  2OV8 A;  2VJ8 A;  1HG5 A;  2DB4 A;  3O39 A;  3S7F A;  5D92 A;  4DI3 A;  2IXN A;  4N6C A;  3QVZ A;  1Z3X A;  3NYM A;  4I44 A;  2GRN B;  1U0B B;  5LOZ A;  2WMN A;  3AAA C;  4F1S A;  4BY6 A;  5GPG B;  3CQG B;  4DVY P;  4C9B B;  4CDR A;  4B8A A;  4W8K A;  2WXJ A;  2WXG A;  1TWH A;  3P2B A;  2P9N G;  3PDM P;  4N3B A;  2RFA A;  2MYO A;  3ZYL A;  5EKQ D;  1A17 A;  4GZC A;  1OXJ A;  4O79 A;  2YHS A;  2LNI A;  5KYX A;  2XS8 A;  2PP4 A;  3B9Q A;  3KPH A;  4NQF A;  4CSA C;  2BE5 F;  2A5U A;  1FNT c;  5AC4 A;  4GU5 A;  4AJW A;  3PDN A;  4XLN F;  5C2Y A;  4JD2 G;  4DI4 A;  3R2P A;  1N95 A;  4N4W A;  2OEV A;  1ORY A;  2GDC A;  1TQG A;  4PDX A;  1BR1 A;  3WXX A;  4BSZ B;  1JR8 A;  4FUL A;  1OT8 A;  4CEM A;  4BJ5 A;  2IBF A;  4I6G A;  5G05 J;  2ZIS A;  2J08 A;  5E33 A;  1ORS C;  3LLI A;  1WAT A;  5A6J A;  1A0B A;  4J7T A;  2IOQ A;  3L1M A;  2ION A;  4AVX A;  4JA9 A;  3U66 A;  4I1A A;  2VC9 A;  3DXM G;  3G2W A;  4U8H A;  2A0B A;  3JYH A;  1CGM E;  2GRQ B;  4XPW A;  2KQ9 A;  1T9K A;  4EHP A;  2QYJ A;  2VGX A;  2R7X A;  4L1B A;  2GFH A;  2WXN A;  1WY6 A;  3PH0 C;  1DC2 A;  2GRR B;  2KNH A;  3VAY A;  3SNX A;  2R5S A;  1U3D A;  3ABL E;  2QC9 A;  1E83 A;  3DKA A;  3U4T A;  4LER A;  4DRI B;  2L81 A;  4EPZ A;  3W9G A;  2XXA A;  1BLX B;  1J8M F;  3UI2 A;  2XL8 A;  3FUF A;  4GZ6 A;  4HNA D;  4DX1 A;  3IQT A;  2QY9 A;  4MTF A;  4DRH B;  5BXU A;  1HZ4 A;  5JA4 D;  4GYW A;  5DS6 A;  1M57 C;  3NKE A;  2L7A A;  2L6H A;  3HKK A;  4UWK A;  2AVP A;  5L0J A;  4ATZ D;  2W4M A;  1OWM A;  1QSP A;  3CVY A;  1O5H A;  2MHK A;  4ULV A;  4MVS A;  1YAU O;  2VB6 A;  3H2U A;  3Q47 B;  4APO A;  4QI2 A;  3D9O A;  2LSV A;  2DGJ A;  2LP4 A;  2PM7 A;  4L2Y A;  2A68 F;  4LG6 A;  1N94 A;  4B93 B;  2O9X A;  1ORJ A;  3AG3 C;  2NG1 A;  4W8P A;  5KYW B;  2J7P A;  1C17 M;  3TXN A;  3U64 A;  5L0C A;  5FTP A;  3TGO A;  3FU6 A;  3AU5 A;  3BEH A;  3LDZ A;  4ILG A;  1DCQ A;  3NYL A;  4O6N A;  2F37 A;  4AY5 A;  1HMO A;  4KBQ A;  2Y3A A;  4D4X A;  3PZ1 A;  3KYJ A;  3RQF A;  1DOW A;  4MTO A;  4YDW A;  2DYS E;  4FES A;  1RJ9 A;  3AG2 E;  2V5F A;  3W2V A;  5G2N A;  3AQC A;  2FF4 A;  3QW0 A;  2EPM X;  2VSN A;  2D4U A;  1SZA A;  2IF4 A;  1NL4 A;  1N54 A;  3MLG A;  5DQZ A;  2YL3 A;  2L0I A;  2IO3 C;  2ZU6 B;  3B7T A;  2YLG A;  4C7O B;  1LF8 A;  4EZL A;  4HI8 A;  1IXV A;  5A7D B;  1HY5 A;  3ZXP A;  3JRM O;  1BU9 A;  2EIK E;  2Q7F A;  3HXE A;  4JPS A;  2GA0 A;  3UT8 A;  4B6I A;  3C3O A;  2ETC A;  5HSW A;  1XZP A;  1LE2 A;  3EHN A;  3PE3 A;  5ENR D;  3Q73 A;  3SZ7 A;  3UMV A;  3DMD A;  2EIM E;  1HFA A;  2UUI A;  3WAQ A;  2W45 A;  4H4K C;  1K1B A;  3B7B A;  1C02 A;  3L22 A;  2HM8 A;  1K05 A;  3KSQ A;  3JSZ A;  3MKQ B;  2CDQ A;  4UQY A;  1D1B A;  2WPV A;  4U5H A;  1LI5 A;  1UN9 A;  3TXM A;  2XLV A;  1JCQ A;  4PAC A;  4FJY A;  5G55 A;  1E8W A;  3PS6 A;  5FJY A;  3Q6N A;  4WAB A;  4JEU A;  2Q9C A;  2EIK C;  4F6R D;  2X6K A;  2ZGD A;  1TFK B;  5ENT D;  2PNN A;  2OCC E;  3FUN A;  3EG9 A;  4JCH A;  1U3C A;  4E18 A;  1Z5S C;  3FTS A;  4LUN U;  3FUE A;  3OWT A;  3G2T A;  4FHK A;  1HX8 A;  1MMG A;  5A6K A;  3QWW A;  5BXO A;  3D9I A;  5JMN D;  3OAW A;  3L0I A;  1AUE A;  4OYS A;  4EBJ A;  2R25 A;  5JHA A;  4OIP F;  1E7V A;  4YDO A;  4HOR A;  3RKO F;  5ENQ D;  5ARF A;  2X38 A;  3UX4 A;  4DRX E;  5HV9 A;  4F7A A;  1KNY A;  3RVZ A;  4Z9J A;  4HB5 A;  3G2U A;  3PZ4 A;  3GZ2 A;  3UKR G;  1VLS A;  4MKT A;  4JL0 A;  2OKU A;  1ZU4 A;  3J06 A;  4DX5 D;  4N5C A;  3ZW3 A;  1LIH A;  2OCC C;  3Q49 B;  3QMK A;  1LD8 A;  2WXR A;  2CNW D;  2X6F A;  2ZXW E;  5FQ7 A;  3IXE A;  3UM0 A;  3B7U X;  2AJA A;  3MZL B;  4CT0 A;  4F53 A;  1C03 A;  2X3M A;  1UJK A;  5CMY A;  256B A;  1JUQ A;  3FDH A;  2J49 A;  3DXJ F;  4R32 A;  2J4B A;  3RRN B;  3APD A;  3V5Y A;  1FT1 A;  4RQI A;  2YWA A;  2J07 A;  3VTX A;  3MJW A;  2WXL A;  2J0X A;  4ACK A;  4GB9 A;  3CST A;  2FBN A;  1W2W A;  4IAO A;  3PCV A;  3DI5 A;  2J7P D;  4YL1 A;  2J46 A;  3GYZ A;  1NZN A;  1H2V C;  3U9J A;  3CEX A;  1FT2 A;  2LQG A;  3Q78 A;  1A41 A;  3SP1 A;  3KSL A;  4O7G A;  4XEF A;  3ASD A;  2ZXW C;  3RF3 A;  3V2X A;  2QLA A;  2F8X K;  3LJ3 A;  4FAD A;  5AN8 A;  4MBG A;  2GRP B;  3LJN A;  3Q7L A;  4CX9 A;  2XLD A;  4DBR A;  2QFC A;  4ILH B;  1Y6D A;  1D1A A;  3TK0 A;  3NMJ A;  1FR0 A;  3K1H A;  2WXM A;  3RIP A;  2NUP B;  4BG0 A;  5JVE A;  3SXZ A;  2DWZ A;  1H6K A;  4G7Z F;  3NZU A;  2V0P A;  5AAR A;  3PNL B;  3NG1 A;  3Q4A B;  3U9W A;  3B71 A;  4UI9 J;  4U5E E;  1NA3 A;  4NTB A;  3QKY A;  1E7U A;  2Y4T A;  5D0O D;  4EKW A;  4ZLD A;  3UM3 A;  2A5E A;  5FZQ A;  2NSG A;  4C3E A;  1TFO B;  3ZRH A;  2GRL A;  4OD4 A;  1Q0F A;  2AP3 A;  4LLE A;  1U6H A;  3E4B A;  1MMD A;  3W9F A;  2B0J A;  1S7Z A;  3FWV A;  2MWQ A;  1O1R A;  5DVW A;  2PQN A;  1YZC A;  3C8G D;  3U2L A;  2V26 A;  4NTF A;  2XRY A;  2JX0 A;  3LCA A;  4NAC A;  3HG0 D;  3GAN A;  3DPD A;  3FY4 A;  2E0I A;  1MNE A;  2WMO A;  1KLX A;  4GCO A;  2KAT A;  3LPZ A;  4I2Z A;  1WWP A;  5AYW D;  1I4Z A;  5L3Q A;  3EZH A;  1WDY A;  3TJ6 A;  1E84 A;  2LFF A;  1WN0 A;  5JRA A;  3ASN E;  2KJG A;  1FFH A;  4DLQ A;  3B29 A;  4URK A;  1OW8 A;  2J45 A;  3L6A A;  4DK5 A;  1MQV A;  3KAE A;  4WND A;  3M15 A;  3E33 A;  4GCN A;  2HV7 A;  3FXH A;  3UGO A;  3BRJ A;  3HLZ A;  2NSF A;  1G3N B;  2XEN A;  1XNF A;  2HV6 A;  2V3C C;  3R7C A;  4DUI A;  1OCC C;  2HE0 A;  4PFP A;  2KYH A;  3UNG C;  4LCT A;  5EK0 A;  2A4Z A;  4J6I A;  3Q9U C;  4XEI G;  5EYL A;  3CK8 A;  4JTC B;  3T4R A;  1UG3 A;  3FDQ A;  2AW6 A;  4YN0 B;  4MVQ A;  2CG3 A;  4IB4 A;  1ZHZ A;  2I6H A;  3N71 A;  3ABM E;  1JCS A;  2B0O E;  1Y4C A;  3ML9 A;  1UG7 A;  3I4G A;  2B0H A;  5FQ4 A;  5A23 A;  1WAO 1;  4N3C A;  2KZT B;  1Z3I X;  4RD9 A;  1O1S A;  4Q94 A;  4LAC B;  2XPY A;  4K5B A;  3JQ0 A;  4OVV A;  2CYD A;  4CS8 C;  5FZT A;  1G8X A;  3UT7 A;  1P5Q A;  3ZEF A;  3MFN A;  2VSO E;  3ZDL A;  3TWV A;  3UTM A;  2GWW A;  2JPU A;  1SR2 A;  3RO2 A;  1Z5Z A;  4OIQ F;  3UXG A;  5CBO A;  1OKK D;  3E30 A;  4BSX A;  4Q4Z F;  3CKB A;  4F4B A;  2HFI A;  3FVY A;  3O48 A;  3ABM C;  1MMA A;  3L16 A;  3IPM O;  3Q7A A;  3L54 A;  3PZ2 A;  1G5Z A;  1Z63 A;  4YVQ C;  2BC5 A;  3UKU G;  3F46 A;  2Q3T A;  3B0U X;  1S0P A;  4JEH A;  1YA0 A;  1D0X A;  2VH3 A;  3LNR A;  4E7Z A;  4E6H A;  2KCV A;  3CV0 A;  1Z3Y A;  2HO1 A;  4U0Z A;  4G23 A;  2XCC A;  4GTP A;  2F0Y A;  1QPU A;  2HZ8 A;  3LNM B;  1H2U A;  3ZNG A;  1N9A A;  3AS4 A;  3HNI A;  4BJ5 C;  4KNW A;  4HEA J;  2EIL E;  4N3A A;  5AAO A;  4IYP A;  3HRA A;  3PUJ A;  4ONS A;  5AQ7 A;  2OVF A;  4I6J A;  3EJN A;  1YJG A;  3AOU A;  3Q7G A;  4RG6 A;  3LAY A;  2YIN A;  4PJM A;  1LTX A;  2W4B A;  1GM5 A;  3FHE A;  2VGY A;  3RIB A;  4FAP B;  4QI0 A;  2Y39 A;  2Y4U A;  2ICW G;  4J7Y A;  1S63 A;  5JT4 A;  5T4Y A;  3HIZ A;  1N11 A;  4IUL A;  2RKK A;  3GOR A;  1QBQ A;  3K7D A;  5TJ5 E;  1ZHY A;  3D9P A;  4OVU A;  1SZ9 A;  5KNG A;  4LDR A;  2UY1 B;  4I6E A;  3C18 A;  3U9M A;  2VAS A;  1RXQ A;  2EIL C;  4FX5 A;  2LAI A;  5KJM A;  2R7U A;  4K03 A;  3ASH A;  3AS8 A;  4KVM A;  1TWG A;  1OCR C;  3AGT A;  3K9I A;  2H6G A;  2MRI A;  1TEZ A;  3FTU A;  4MW8 A;  3DAG A;  3HYM B;  5LCW J;  5AGF A;  1H9G A;  4U07 A;  1LM3 B;  5D2M C;  3GM1 A;  3D9H A;  4BEM J;  5BQG A;  1ZZP A;  5B1A C;  2M63 A;  4PS8 A;  4UQX A;  4RG9 A;  4JUR I;  4Z68 A;  4AL1 A;  4G8K A;  3CEQ A;  3DM9 B;  5DS5 A;  3K1I A;  2ZGG A;  4YDE A;  4LDK A;  2L6J A;  2MYS A;  1NP7 A;  2YLD A;  3ZC4 A;  1XWJ A;  2H7O A;  1YA9 A;  2PF4 E;  4APF A;  3CHS A;  2KCL A;  2C2L A;  1AEP A;  1HO8 A;  1TN6 A;  5KCM A;  3KH2 A;  5KYW A;  4NCQ A;  4P9F A;  1OXK A;  3LS1 A;  1HE1 A;  1NFN A;  3AG1 E;  3PUK A;  1E8Z A;  2LFD A;  2HS5 A;  4CS8 A;  1MHQ A;  3DPY A;  3ZYM A;  2EPL X;  1SQM A;  3Q9N C;  3SFZ A;  5F5H A;  4Q96 A;  1A5E A;  2R03 A;  2Q7R A;  1SMY F;  2JEK A;  3QC1 A;  2I9C A;  4KMO A;  3V30 A;  4IJJ A;  4C0E A;  1LD7 A;  3SGH A;  3IQC A;  2E2E A;  3R7R A;  2CW0 F;  3N24 A;  1GQA A;  3RW0 A;  4C7O A;  1ST6 A;  2XM0 A;  1LS1 A;  2BL2 A;  2NUT B;  4GA1 A;  2LXM A;  2XS1 A;  5DIZ A;  4BJ6 C;  4TRQ A;  4L6R A;  5EID A;  5CI8 A;  4JJG A;  4HRL A;  3AG1 C;  2TMV P;  3JTL O;  3SEO A;  2F8Y A;  2Y1L E;  1TWA A;  5JUA A;  4J8Y A;  1SZI A;  3KEZ A;  3V31 A;  3RJV A;  3ASF A;  3W8I A;  4JIO A;  2PM6 A;  4HE8 D;  3VLD A;  2PX0 A;  4IAQ A;  1FVF A;  3FUH A;  2VCB A;  3GOD A;  4M7C A;  5E76 A;  2A6E F;  4FWV A;  3G50 A;  3QDN A;  4GML A;  3MKQ A;  4PJN A;  4XX5 A;  1JWF A;  2XL4 A;  1A7V A;  2WQH A;  3BU8 A;  3ONL A;  4U96 D;  1M6T A;  2A69 F;  2XLM A;  2V4L A;  4BET A;  3D9L A;  2L6F A;  4ILI A;  4YND A;  3IHU A;  4B94 A;  1H6P A;  2WB2 A;  2HJM A;  2PFD A;  5G05 C;  3DD7 A;  3GZS A;  2X51 A;  4O6F A;  4NRH B;  3CVU A;  3U8V A;  3CSK A;  1ZVZ A;  2C04 A;  1ZB1 A;  3CVN A;  5C1D A;  3CQC B;  3APF A;  3POV A;  3MYF A;  4U0S A;  1OWO A;  4Y6W A;  5A6B A;  4O6Y A;  3U2M A;  1F1M A;  5FZS A;  4CCA A;  3RH3 A;  3G2V A;  1ZU2 A;  1I4Y A;  5K0I A;  4FA6 A;  3S28 A;  2EIJ C;  5BV0 A;  5T3T A;  3AG3 E;  2CFU A;  3IEE A;  5LFA A;  2ETA A;  3MYV A;  3MV3 B;  4RDA A;  4XKB A;  1M56 C;  3GZ1 A;  5AJD A;  5LP0 A;  1H6G A;  2HJ3 A;  2RD9 A;  5E75 A;  4E85 A;  3U8P A;  2Y3H A;  3IHY A;  4JZY A;  3TWU A;  2QY7 A;  1Z7Q c;  1Q0D A;  3EU5 A;  3O6X A;  3FP3 A;  3L13 A;  1RZ4 A;  1IKN D;  4G7H F;  4HOU A;  3JYS A;  2ZXR A;  4JE9 A;  4G8L A;  4WUY A;  4AK9 A;  4HOQ A;  3ASG A;  2IQC A;  3DSX A;  4GZ5 A;  3S27 A;  4GTQ A;  5KBA A;  1DNP A;  1VMA A;  5AEN A;  1VLT A;  3J5P A;  3T8K A;  4G24 A;  4GTR A;  1Z6A A;  4BTB A;  3PEU B;  3R9A B;  3EZI A;  4XPX A;  3UIP C;  3OXF A;  1PV3 A;  4OIR F;  4PS3 A;  4XLP F;  3CR3 A;  3KL4 A;  4DXW A;  4DPR A;  4J30 B;  5CIV A;  4LDQ A;  1IZM A;  5JHB A;  4PJL A;  1QYM A;  5KWD A;  2ZIR A;  4U5D E;  1MX4 A;  2AWY A;  4EUK B;  3WG7 E;  2HKV A;  5L0D A;  3LS8 A;  4RBN A;  3SO8 A;  3C3Q A;  2G3K A;  3LY9 A;  2VYI A;  4AV7 A;  2IOS A;  3RRU A;  4BT8 A;  5COM A;  2GGF A;  3CHQ A;  3CHO A;  1OW6 A;  3OA1 A;  1NSG B;  5JJ7 A;  2NUP A;  2R7T A;  3IBE A;  1ZW3 A;  2QNL A;  3DWW A;  4CS7 A;  3OXL A;  1E90 A;  2AVK A;  2J4D A;  3LLK A;  3CHM A;  4J7W A;  2WXF A;  1KT0 A;  4BJ6 A;  3RRM B;  1PCX A;  3GW4 A;  1H19 A;  3EIJ A;  1WTY A;  3TG4 A;  4HFF B;  4YT5 A;  5CEC B;  2WXK A;  2NYJ A;  4GYO A;  3D9M A;  4YWQ A;  3WG7 C;  4JZA A;  2VSX E;  5AQA A;  4GYY A;  4CZ2 D;  4AL0 A;  2IO2 C;  4XPY A;  3B7R L;  4JHR A;  2YZS A;  3NZS A;  3PZ3 A;  3L17 A;  4FP7 A;  4GA2 A;  3EHR A;  2FI7 A;  3BEE A;  3LYA A;  4ME2 A;  3I3N A;  4MW3 A;  3TL5 A;  2L6B A;  2Q00 A;  3CIA A;  4K5C A;  2J9W A;  3FAP B;  1BD8 A;  1CGO A;  1X5B A;  1EPU A;  1IHB A;  3S9O A;  2YLI A;  3HTK C;  2PL2 A;  4I1O B;  5EHH A;  2KC7 A;  3UIO C;  1L5J A;  3CVL A;  2XM4 A;  5EDS A;  1FAP B;  1WOL A;  3E9V A;  5D0Q D;  4CDM A;  4GPM A;  1HF8 A;  2KC3 A;  1G4U S;  3DAF A;  3FTV A;  1UOH A;  3WOD F;  3JUE A;  4ATG A;  3FTZ A;  4MRU A;  5CCM A;  4AIF A;  1Q2Z A;  3SD5 A;  1NA0 A;  4BES A;  3MKR A;  2X6J A;  1CPR A;  1K1A A;  2HSB A;  3FUJ A;  1R4T A;  4PFO A;  4AEZ C;  3E70 C;  3HXF A;  1IHG A;  2WB7 A;  2YVK A;  3ZUV B;  3W8H A;  5J90 A;  1N4S A;  1QKR A;  4CJO A;  3E32 A;  4WNF A;  3SY2 A;  3F47 A;  3KKB A;  4IWB A;  1O87 A;  1BZ4 A;  2HMZ A;  1UJJ A;  1QQE A;  2M64 A;  4L7T A;  3U3F A;  5EIL A;  1OCO C;  3RYL A;  1TR2 A;  3LVR E;  3LEW A;  2R05 A;  1R5I D;  2LK4 A;  3URZ A;  3TOM A;  4P9T A;  1TJF A;  4G2V A;  3G4Z A;  1PD1 A;  4K7B A;  2KZT A;  1N1C A;  4GYT A;  4G7O F;  3BG1 B;  1TN7 A;  1NFI E;  3ZXS A;  4DX7 D;  3PZD A;  4WNG A;  3EPV A;  5T8I A;  3HXD A;  1E2X A;  3HXB A;  4MND A;  3V7O A;  2YL1 A;  2L6G A;  1GGQ A;  5HKP A;  4MQ9 F;  2P9I G;  4K0D A;  4DX6 D;  3JXI A;  2R7O A;  1NG1 A;  4HFK B;  1N4R A;  1N4Q A;  2WQ6 A;  4A1S A;  4UWF A;  4NQ0 A;  1HH8 A;  4BFR A;  2IU1 A;  3NKD A;  1S05 A;  1HMD A;  3CK9 A;  3ZQV A;  4ANJ A;  3K33 A;  4OIN F;  4O60 A;  1G4W R;  4U7E B;  3O4Z A;  3MX3 A;  3ESK A;  4HOT A;  2EPN A;  2H6I A;  3N0T A;  3CGH A;  3EUV A;  1EA8 A;  4HBD A;  2XSE A;  4N39 A;  1D0Y A;  3C7J A;  2I1K A;  2MOW A;  1FMV A;  1APC A;  2XRH A;  3TOL A;  3C98 A;  4HLL A;  4G0H A;  4UI9 K;  4Q5S F;  1O1T A;  3NDB B;  3VTY A;  5F5F A;  5KJK A;  3ZVR A;  4YT8 A;  4U9D A;  2P0N A;  4EHM A;  3ONK A;  2CFZ A;  3JYY A;  4N06 A;  3GM2 A;  4BX9 A;  4GTV A;  4UI9 C;  2VTB B;  1TKN A;  4XWJ A;  2GW1 A;  1H6O A;  3RKV A;  3V5Z A;  1L3P A;  1OCC E;  1CPQ A;  3S7B A;  5EX3 A;  1EQ1 A;  3C8G B;  5L0I A;  4G78 A;  3R7Q A;  5LX8 A;  1MJ0 A;  4O1O A;  2UY1 A;  5G04 J;  4A3V A;  4GMR A;  4JXT A;  1KT1 A;  5CMW A;  1N52 A;  3JCU Q;  4UDV A;  5JJT A;  3MGB A;  2BF0 X;  2H8A A;  4C3D A;  4TXP A;  4ZHB A;  3Q5M A;  2G3V A;  5JS5 A;  4PJJ A;  3R9M A;  1ZYR F;  3PE4 A;  1B89 A;  1L7C A;  5KYU B;  3RSE G;  4ANX A;  4N6H A;  4OIO F;  3DM5 A;  2L0T B;  2OG2 A;  1VDY A;  3LXU X;  4U04 A;  4JHK A;  3TWS A;  4DVZ A;  5A6C A;  3EGX B;  3RK6 A;  3TJP A;  3BUA A;  3FUD A;  2CCY A;  1JPJ A;  2WL8 A;  3PHF 2;  3K1I C;  3ENE A;  5FZR A;  3B0P A;  1CGN A;  2YHE A;  3ASO C;  3CVW A;  4PS7 A;  3ABK C;  3ZQY A;  5BUO A;  3RVY A;  1M2V B;  2AU5 A;  3L34 A;  1TYQ G;  4ZFH A;  2PBE A;  3SF4 A;  4MVZ A;  4ZLC A;  1HU3 A;  3DEO A;  2YKZ A;  2Y69 E;  5CRV A;  4PR9 A;  3ISM C;  4A3T A;  4MS6 A;  3GEI A;  3FEY A;  4JTA B;  4EBB A;  4AE4 B;  2OQM A;  1TR4 A;  3IKO B;  4KT6 B;  4F1P A;  2B6C A;  3CK7 A;  2DIW A;  3T5X A;  1A7E A;  4KNV A;  4HQD A;  2XLW A;  4XIF A;  4CRW A;  4GAA A;  4CT4 A;  1OW7 A;  4HLE A;  3T5V A;  1KU2 A;  2XLH A;  3NOC D;  3UMI A;  4KXK B;  4KYO B;  3CVP A;  4H7Y A;  4RVB A;  1DVP A;  1DOV A;  2RFM A;  4A55 A;  3CQZ A;  2Z15 A;  5ENS D;  5F28 E;  2Y69 C;  2H7B A;  4GTO A;  2NUT A;  1T01 A;  3KYI A;  4A4A A;  4U95 D;  1I5N A;  1K40 A;  4MVO A;  4B8C B;  4KC9 A;  5FQ8 A;  4TUU A;  1HE9 A;  4XEK A;  4G1T A;  1VK5 A;  5FWQ A;  3FOO A;  1U2V G;  2DZO A;  3FAJ A;  3PEV B;  4V3I A;  2M4E A;  1SA5 A;  3FMS A;  4A1G A;  5AIJ A;  3G4X A;  1QVX A;  3LY8 A;  1OQC A;  2IY0 C;  3F6Q A;  4UWG A;  4DBQ A;  3KS2 A;  2EIN C;  1V54 E;  2R59 A;  2WZG A;  1RW2 A;  3LES A;  4FHJ A;  5FQ6 A;  4GTS A;  5BW8 C;  3RO3 A;  4U5B E;  2LUH A;  1OCR E;  5COF A;  3T8M A;  4XI0 A;  3J5Q B;  3UUX A;  2DZN A;  5B3S C;  4Q7C A;  2XRZ A;  5E3C A;  2YNQ A;  3NMI A;  2ZD9 A;  4N5Q A;  5A69 A;  1FPP A;  2J09 A;  4PUC A;  5KJL A;  3V5X A;  3JT1 A;  2WXO A;  3ZGQ A;  1WAS A;  3S90 A;  1NLX A;  2YRF A;  4WGY A;  3DST A;  5B1A E;  1OY3 D;  4KI2 A;  3DJU B;  3DSW A;  5BPP A;  5HQ8 A;  3SBT B;  3KEA A;  2QTV A;  2L9J A;  1LKX A;  1RMV A;  3ULE G;  4CIH A;  1ZHT A;  1MQS A;  2IJG X;  1V54 C;  4PK4 A;  1N4P A;  3C3R A;  3FTW A;  2J9Q A;  2XGS A;  2MHR A;  4KVO A;  1N0Q A;  3GM3 A;  4XQ1 A;  1INZ A;  2PQR A;  1WM5 A;  5BT1 A;  4YL3 A;  4DJ9 A;  5H7P A;  3CZ6 A;  1TNY A;  2F22 A;  3FFL A;  1NFO A;  2QZA A;  4KZ0 A;  3FTX A;  4H7X A;  3B7S A;  1PY1 A;  1XZQ A;  4I9C A;  2HUJ A;  3U3B A;  4EEC A;  2XEV A;  4EQF A;  3C62 A;  2WXI A;  3IHV A;  2NPU A;  3SXK A;  1O5M A;  4DRJ B;  1D8D A;  5L0H A;  3NBN B;  5AJL A;  5CRU A;  4JA7 A;  2FFH A;  5ANR A;  4ER9 A;  5LCW C;  2LXL A;  1YLM A;  2R02 A;  4WGZ A;  3ZYQ A;  1OWN A;  2HSQ A;  4P6I C;  1GS9 A;  3ML8 A;  4AP2 A;  3HNL A;  3C63 A;  1UN8 A;  5FT9 A;  2WVO A;  2XL6 A;  1MZC A;  1YZA A;  2VGE A;  5FIN A;  4QQI A;  4B89 A;  2P6V A;  2P9L G;  3HNJ A;  3EGD B;  5E2Q A;  4LEU A;  3I5Q A;  4N2Q A;  3QJZ A;  1HE8 A;  4XE0 A;  2OJQ A;  3E37 A;  1YVI A;  4JRZ A;  3UM2 A;  3ZPJ A;  3K66 A;  3RFY A;  1IQU A;  3M4B A;  4TXQ A;  3CAX A;  4YDY A;  3SHF A;  1JPN A;  1WGW A;  4E0I A;  4M3O A;  4BJT A;  3TQO A;  3L08 A;  4GTT A;  4GA0 A;  5JJ6 A;  2LO6 A;  4LNG A;  2P2C P;  1V4A A;  5IY5 E;  2R2L A;  2I15 A;  1KZP A;  5T3W A;  4WNE A;  3K6B A;  1TNB A;  2BED A;  4EBK A;  1MMN A;  1E8Y A;  1FMW A;  4J8F A;  3GEE A;  3OXG A;  2XEH A;  2HR2 A;  5KYY B;  2R7R A;  4NUR A;  3US6 A;  4HRN A;  2OND A;  2P9U G;  2AXU A;  3UM1 A;  5BV1 A;  1QNF A;  3S2A A;  1EKY A;  1Y8M A;  3FU3 A;  1EF1 C;  1AWC B;  4LRZ A;  3MV2 B;  2BKG A;  2BUG A;  4J8D A;  4LNU D;  4N2S A;  3ZSU A;  3EHQ A;  4X8Q A;  3JCK C;  4YT4 A;  1ELR A;  2WXP A;  5EGY A;  3NF1 A;  1QZX A;  3LKU A;  4Q69 A;  3VM6 A;  4I3M A;  2OOE A;  4I43 A;  5IY5 C;  3JZ0 A;  5JP7 A;  2I2O A;  1FTS A;  4C0M A;  2RD0 A;  1ZHX A;  2DI3 A;  1MX2 A;  4GQH A;  5EYP F;  4O6M A;  2UWJ G;  3Q7F A;  1NU9 C;  2R17 C;  4CDN A;  2EIJ E;  4J32 B;  2XGM A;  2ZPA A;  1M2O A;  4I17 A;  5ANL A;  2WM9 A;  1TJC A;  2P9P G;  3JXJ A;  3A9C A;  4GPK A;  2WZL A;  2QYU A;  1RKE A;  3SNH A;  4J8E A;  4EWC A;  2A1D D;  3S29 A;  3U5S A;  4JW1 A;  2XCB A;  4U5G A;  2C03 A;  1E85 A;  3LEO A;  2NXP A;  5DQT A;  3D3M A;  3DJN B;  4NTA A;  1SF8 A;  2WXH A;  3EFO B;  1JAF A;  3DE8 A;  3L82 A;  1D9S A;  3QVY A;  2DCP A;  4MS2 A;  3VRC A;  5CBN A;  1FCH A;  3ZHE B;  2VCA A;  4I1M A;  4XI9 A;  3IQ5 A;  2EPO A;  4FC8 A;  2VSY A;  3ZN3 A;  3AS5 A;  3M79 A;  3M1C B;  3OTN A;  3FUK A;  2C0M A;  3U0C A;  3EH2 A;  3SFX A;  2QUP A;  3SQV A;  2LD6 A;  3NYJ A;  3SZR A;  3FH5 A;  3HXC A;  3E34 A;  4U63 A;  3UMH A;  4I2W A;  2IXO A;  4NIK A;  1OWP A;  4HXI A;  1SYQ A;  4C48 B;  5AC5 A;  2OU6 A;  1V55 E;  4L9P A;  3S7J A;  1H7I A;  4CS9 C;  3UR3 C;  4AXH A;  3JUI A;  4LNB A;  4U8Y D;  2CNW A;  1OXB A;  1U89 A;  1YYJ A;  1K8K G;  1YA7 O;  3DRA A;  1HW1 A;  2Y0B G;  3FUI A;  3I4R B;  1VOM A;  1JOG A;  4BT9 A;  3KD7 A;  3ITF A;  1T5O A;  2ETS A;  3ABL C;  3QNK A;  1LVK A;  1NI1 A;  3UPV A;  1KPS B;  1YMP A;  4BWR A;  2P1A A;  4QDL A;  5B3I A;  4C3B A;  5CER B;  4D4N A;  2NSZ A;  3G2S A;  4JKV A;  1BPO A;  2ASR A;  3RU0 A;  3FU5 A;  3ZVV A;  1KZO A;  1V55 C;  5HS0 A;  2CHW A;  2X6I A;  2V4H C;  5KNH D;  4W9R A;  2YHC A;  2XPI A;  2EQX A;  1PD0 A;  4YJW A;  1VB5 A;  4AOF A;  3EDT B;  5T3R A;  5L0F A;  3BG0 B;  3Q75 A;  2CHX A;  3C5R A;  2OVB A;  4OAU C;  5EN5 D;  5BUZ A;  1ZW2 A;  3CLJ A;  3LEV A;  2HYZ A;  4YVO A;  1NBB A;  2WQ7 A;  2YQY A;  2WZF A;  3B0V C;  3SFY A;  4ULW A;  2WVI A;  4G26 A;  3DWL G;  1ELK A;  1VYI A;  4IRU A;  1JRA A;  3GEH A;  3DSS A;  3NAW A;  4JVS A;  1BR4 A;  3HNK A;  3CKC A;  1EYH A;  4LLC A;  3ZKJ A;  3MEK A;  2J9U A;  3I5P A;  5CED B;  2Y3G A;  2XHE A;  3DSU A;  4BTA A;  2EPK X;  3IQ6 A;  5KYX B;  1Z6T A;  1UFB A;  3TUL A;  3QAR A;  2VTB A;  1X81 A;  2OEW A;  3VF0 A;  3NB2 A;  2XZD G;  3T9K A;  3JQ1 A;  1TNZ A;  4UWH A;  3QK0 A;  5HI7 A;  1HG2 A;  1RKE B;  4CJG A;  4CSA A;  2DYS C;  3AG2 C;  3C8G A;  4GZ3 A;  4DOZ A;  3PRE A;  3ZYK A;  3N2Z B;  3HJC A;  4BER A;  3M4C A; 
#chains in the Genus database with same CATH homology
 3PVL A;  5L3V A;  1J8Y F;  3H65 A;  1PC2 A;  1PAQ A;  4B0Z A;  2KCK A;  1NU7 D;  5KYU A;  4I9E A;  2C0L A;  3VYW A;  2VGX B;  4G11 A;  3APC A;  2L9B A;  3EGX A;  4G25 A;  3NRH A;  2AXZ A;  4EBA A;  2EIM C;  4XZ4 A;  2YEV A;  4BEJ A;  2LSE A;  2DBA A;  2ZXP A;  2XXA B;  1M2V A;  2AWI A;  4UQZ A;  4IN3 B;  4WWP A;  3EH1 A;  3QWV A;  3SBS A;  2YQ8 A;  2I1J A;  3FU0 A;  2I8B A;  3MA5 A;  3ZG1 A;  2X6H A;  5CHE E;  4AM9 A;  4ACL A;  3B13 A;  3CVV A;  3DZA A;  4HS2 A;  4BX8 A;  4JHJ A;  4ABN A;  4CS9 A;  4AE4 A;  1TWC A;  1MND A;  1H0A A;  3QWP A;  3HVE A;  2IOL A;  3HDX A;  2P58 C;  2D5R B;  3TG5 A;  2Y3B A;  4U5C E;  3S7D A;  4CGW A;  2V8S E;  5D91 A;  4L2L A;  3T6J A;  4XTK A;  1D0Z A;  1OKK A;  3Q15 A;  1Y6I A;  2FO7 A;  2CG2 A;  2DYR C;  2A6H F;  4J0U A;  4CBE A;  4EZJ A;  3T6B A;  1RJ9 B;  3PMR A;  1BR2 A;  3UGP A;  4RSY A;  3FH8 A;  3P1U A;  2JD3 A;  4JC8 A;  3ULQ A;  2KM4 A;  2J0W A;  4GZD A;  3FH7 A;  3FHD A;  4M63 A;  1GW6 A;  4U0U A;  3AQB A;  1QZ2 A;  4ANW A;  5ENN A;  3OEO A;  4E7S A;  1UW4 B;  1ELW A;  3PNT B;  4HVB A;  3AU4 A;  2LSU A;  4XKC A;  3ZIM A;  2CGE A;  3SYN A;  3ZFW A;  5CCL A;  4FLH A;  1ZHW A;  2IFU A;  1IYG A;  3EQL F;  2FUL A;  4U5F E;  3NQP A;  4F3V A;  2P7V A;  3U3W A;  5EX0 A;  3TAX A;  5T1D B;  5G04 C;  3AG4 C;  3FUL A;  4EZK A;  4GMJ A;  4YT2 A;  3EG9 B;  3Q6M A;  5KJN A;  3FEX A;  4GEH A;  5DS4 A;  4FLB A;  4OD5 A;  3QB2 A;  1FVH A;  3PRZ A;  2W9Y A;  2R7V A;  5DBK A;  2FGY A;  3S0X A;  3D9K A;  4DJA A;  3SI5 A;  3LJB A;  2BTD A;  1OWL A;  4R7L A;  1VYK A;  3HHM A;  4J8S A;  3JRT A;  3LVQ E;  3EGD A;  4FU3 A;  4HOS A;  1NZE A;  2XPZ A;  1D1C A;  3HVE B;  3ASN C;  2WVQ A;  3MCX A;  3LS0 A;  5KYN A;  2PX3 A;  2G62 A;  1W3B A;  3UMK A;  5ARG A;  3IEG A;  4AX2 A;  3TD7 A;  4KBL A;  5KYY A;  2ZXO A;  1ZU5 A;  1OCZ C;  4ANV A;  1E96 B;  4A2N B;  4DLO A;  2JLB A;  1IW7 F;  1E8X A;  4QFV A;  2R7Q A;  2CHZ A;  2XQ0 A;  4WWO A;  2VQ2 A;  4K0R A;  3QAQ A;  4JJF A;  1QLE C;  2KGO A;  5BNW A;  4WJ0 A;  3IV0 A;  1H2T C;  3CVQ A;  3D9J A;  3W2W A;  3CSF A;  4D10 C;  4KZC A;  5DLJ A;  2WXQ A;  3LY7 A;  1HS6 A;  4HFG A;  3CVX A;  3D9N A;  2PZI A;  4Y6C A;  2H7V C;  2IYL D;  2RG8 A;  2Q9B A;  5FCL A;  3DBS A;  1JWG A;  4PH4 B;  2IXP A;  1IQR A;  4WAF A;  3FUM A;  1Z23 A;  2XGO A;  3ESL A;  3EIQ C;  1FFT C;  3EFO A;  3QZC A;  4FJZ A;  3EHM A;  3ZIB A;  2Q9A A;  1ZBP A;  3ZHE A;  5J08 A;  3X1O A;  2KW3 C;  4CGV A;  3I4U A;  3KMI A;  4X0R A;  2WVN A;  2R7S A;  3VLE A;  2GRM A;  4MLP A;  5B1B C;  4UWL A;  4WWN A;  5M72 A;  1HXI A;  4NY3 A;  2NC9 A;  2AXV A;  4BJ1 A;  2Y3D A;  1OUV A;  4L23 A;  2FEZ A;  3X2Q C;  3VLF A;  2J9V A;  1EDU A;  1JPL A;  2R7W A;  5E3A A;  4AY6 A;  2IXM A;  2E87 A;  4TV3 A;  2LAH A;  5CI9 A;  3QOU A;  4ANU A;  3CHR A;  3CHP A;  1XGW A;  3UQ3 A;  4P29 A;  3ECS A;  3UT4 A;  4EBA G;  2ILR A;  3FTY A;  2OV8 A;  2VJ8 A;  1HG5 A;  3O39 A;  4DI3 A;  3S7F A;  5D92 A;  2IXN A;  1Z3X A;  3NYM A;  4I44 A;  5LOZ A;  2WMN A;  4F1S A;  4BY6 A;  3CQG B;  4DVY P;  4C9B B;  4CDR A;  4B8A A;  4W8K A;  2WXJ A;  2WXG A;  1TWH A;  3P2B A;  4N3B A;  3ZYL A;  5EKQ D;  1A17 A;  4GZC A;  4O79 A;  2YHS A;  2LNI A;  5KYX A;  2PP4 A;  3B9Q A;  4CSA C;  2BE5 F;  2A5U A;  4GU5 A;  4AJW A;  3PDN A;  4XLN F;  5C2Y A;  4DI4 A;  4PDX A;  1BR1 A;  3WXX A;  4FUL A;  4CEM A;  4BJ5 A;  4I6G A;  5G05 J;  2J08 A;  5E33 A;  3LLI A;  2IOQ A;  2ION A;  4AVX A;  4JA9 A;  3U66 A;  4I1A A;  3G2W A;  4U8H A;  3JYH A;  2KQ9 A;  2VGX A;  2R7X A;  4L1B A;  2GFH A;  2WXN A;  1WY6 A;  3PH0 C;  2KNH A;  3VAY A;  3SNX A;  2R5S A;  1U3D A;  3U4T A;  4LER A;  2L81 A;  4EPZ A;  2XXA A;  1J8M F;  3FUF A;  4GZ6 A;  2QY9 A;  1HZ4 A;  4GYW A;  5DS6 A;  1M57 C;  3NKE A;  4UWK A;  2AVP A;  2W4M A;  1OWM A;  3CVY A;  1O5H A;  2MHK A;  2VB6 A;  3Q47 B;  4APO A;  4QI2 A;  3D9O A;  2LSV A;  2DGJ A;  2PM7 A;  4L2Y A;  2A68 F;  2O9X A;  3AG3 C;  2NG1 A;  5KYW B;  2J7P A;  3TXN A;  3U64 A;  3TGO A;  5FTP A;  3FU6 A;  3AU5 A;  4ILG A;  3LDZ A;  3NYL A;  4O6N A;  4AY5 A;  4KBQ A;  2Y3A A;  4FES A;  1RJ9 A;  2V5F A;  3W2V A;  5G2N A;  3AQC A;  2FF4 A;  2VSN A;  1SZA A;  2IF4 A;  1N54 A;  3MLG A;  5DQZ A;  2L0I A;  2ZU6 B;  3B7T A;  4C7O B;  1LF8 A;  4EZL A;  5A7D B;  2Q7F A;  4JPS A;  3UT8 A;  4B6I A;  5HSW A;  3EHN A;  3PE3 A;  3SZ7 A;  3UMV A;  3DMD A;  1HFA A;  2W45 A;  4H4K C;  3L22 A;  2HM8 A;  3JSZ A;  3MKQ B;  2CDQ A;  4UQY A;  1D1B A;  2WPV A;  4U5H A;  1UN9 A;  3TXM A;  4FJY A;  5G55 A;  1E8W A;  3PS6 A;  5FJY A;  3Q6N A;  4JEU A;  2Q9C A;  2EIK C;  2X6K A;  3FUN A;  3EG9 A;  4JCH A;  1U3C A;  3FTS A;  4LUN U;  3FUE A;  3OWT A;  4FHK A;  3G2T A;  1MMG A;  1HX8 A;  3QWW A;  3D9I A;  3OAW A;  3L0I A;  4OYS A;  5JHA A;  4OIP F;  1E7V A;  4HOR A;  3RKO F;  5ARF A;  2X38 A;  3UX4 A;  4F7A A;  3G2U A;  3GZ2 A;  4MKT A;  4JL0 A;  1ZU4 A;  4N5C A;  3ZW3 A;  2OCC C;  3Q49 B;  3QMK A;  2WXR A;  2CNW D;  2X6F A;  5FQ7 A;  3B7U X;  4F53 A;  3MZL B;  4CT0 A;  2X3M A;  1UJK A;  5CMY A;  1JUQ A;  3FDH A;  2J49 A;  3DXJ F;  2J4B A;  3RRN B;  3APD A;  2J07 A;  3VTX A;  3MJW A;  2WXL A;  2J0X A;  4ACK A;  4GB9 A;  3CST A;  2FBN A;  1W2W A;  4IAO A;  2J7P D;  2J46 A;  3GYZ A;  1NZN A;  1H2V C;  3SP1 A;  4O7G A;  3ASD A;  2ZXW C;  3LJ3 A;  4FAD A;  3Q7L A;  4DBR A;  2QFC A;  4ILH B;  1D1A A;  3K1H A;  2WXM A;  3RIP A;  2NUP B;  4BG0 A;  3NZU A;  1H6K A;  4G7Z F;  2V0P A;  3PNL B;  3NG1 A;  3Q4A B;  3U9W A;  4UI9 J;  4U5E E;  1NA3 A;  3QKY A;  1E7U A;  2Y4T A;  5D0O D;  4ZLD A;  5FZQ A;  4C3E A;  3ZRH A;  2GRL A;  4OD4 A;  3E4B A;  4LLE A;  1MMD A;  2B0J A;  1S7Z A;  3FWV A;  2MWQ A;  5DVW A;  2PQN A;  2V26 A;  2XRY A;  3LCA A;  4NAC A;  3GAN A;  3DPD A;  3FY4 A;  2E0I A;  1MNE A;  2WMO A;  1KLX A;  4GCO A;  2KAT A;  3LPZ A;  4I2Z A;  5AYW D;  5L3Q A;  3EZH A;  2KJG A;  1FFH A;  4DLQ A;  4URK A;  2J45 A;  3L6A A;  4DK5 A;  3KAE A;  4WND A;  4GCN A;  2HV7 A;  3UGO A;  3HLZ A;  1XNF A;  2HV6 A;  2V3C C;  1OCC C;  4PFP A;  3UNG C;  4LCT A;  2A4Z A;  4J6I A;  3CK8 A;  3T4R A;  1UG3 A;  3FDQ A;  2AW6 A;  4YN0 B;  2CG3 A;  1ZHZ A;  2I6H A;  3N71 A;  3ML9 A;  3I4G A;  5FQ4 A;  5A23 A;  1WAO 1;  4N3C A;  2KZT B;  1Z3I X;  4RD9 A;  4Q94 A;  4LAC B;  2XPY A;  3JQ0 A;  4OVV A;  4CS8 C;  1G8X A;  3UT7 A;  1P5Q A;  3ZEF A;  2VSO E;  3RO2 A;  1Z5Z A;  4OIQ F;  1OKK D;  4BSX A;  4Q4Z F;  3CKB A;  4F4B A;  3FVY A;  3O48 A;  3ABM C;  1MMA A;  3L16 A;  3L54 A;  1Z63 A;  4YVQ C;  3F46 A;  2Q3T A;  3B0U X;  1S0P A;  4JEH A;  1YA0 A;  1D0X A;  2VH3 A;  3LNR A;  4E7Z A;  4E6H A;  2KCV A;  3CV0 A;  1Z3Y A;  2HO1 A;  4U0Z A;  4G23 A;  2XCC A;  1H2U A;  3AS4 A;  4BJ5 C;  4KNW A;  4HEA J;  4N3A A;  4IYP A;  3PUJ A;  2OVF A;  4I6J A;  3EJN A;  3Q7G A;  4RG6 A;  3LAY A;  2YIN A;  4PJM A;  2W4B A;  3FHE A;  2VGY A;  3RIB A;  4QI0 A;  2Y39 A;  2Y4U A;  5T4Y A;  3HIZ A;  4IUL A;  3K7D A;  1ZHY A;  3D9P A;  4OVU A;  1SZ9 A;  2UY1 B;  4I6E A;  2VAS A;  2EIL C;  4FX5 A;  2LAI A;  5KJM A;  2R7U A;  4K03 A;  3ASH A;  3AS8 A;  4KVM A;  1TWG A;  1OCR C;  3K9I A;  2MRI A;  1TEZ A;  3FTU A;  3DAG A;  3HYM B;  5LCW J;  4U07 A;  2M63 A;  5B1A C;  4PS8 A;  4UQX A;  4RG9 A;  4JUR I;  3CEQ A;  3DM9 B;  5DS5 A;  2L6J A;  2MYS A;  1NP7 A;  3ZC4 A;  2H7O A;  2PF4 E;  4APF A;  3CHS A;  2KCL A;  2C2L A;  1HO8 A;  5KCM A;  3KH2 A;  5KYW A;  3LS1 A;  3PUK A;  1E8Z A;  4CS8 A;  1MHQ A;  3ZYM A;  3SFZ A;  1SQM A;  5F5H A;  4Q96 A;  1SMY F;  2JEK A;  3QC1 A;  2I9C A;  4KMO A;  4IJJ A;  4C0E A;  3SGH A;  2E2E A;  3R7R A;  2CW0 F;  3N24 A;  4C7O A;  1ST6 A;  1LS1 A;  4GA1 A;  2NUT B;  5DIZ A;  4BJ6 C;  4TRQ A;  5CI8 A;  4JJG A;  3AG1 C;  3SEO A;  1TWA A;  1SZI A;  3KEZ A;  3RJV A;  3ASF A;  3W8I A;  2PM6 A;  4HE8 D;  3VLD A;  2PX0 A;  1FVF A;  5E76 A;  3FUH A;  3GOD A;  2A6E F;  4FWV A;  3QDN A;  4GML A;  3MKQ A;  4PJN A;  4XX5 A;  1JWF A;  2XL4 A;  3ONL A;  2WQH A;  2A69 F;  2V4L A;  3D9L A;  4ILI A;  4YND A;  4B94 A;  2WB2 A;  2PFD A;  5G05 C;  3DD7 A;  3GZS A;  2X51 A;  4O6F A;  4NRH B;  3CVU A;  3CSK A;  2C04 A;  3CVN A;  5C1D A;  3CQC B;  3APF A;  3POV A;  4U0S A;  1OWO A;  4Y6W A;  4O6Y A;  4CCA A;  5FZS A;  3RH3 A;  3G2V A;  1ZU2 A;  4FA6 A;  3S28 A;  2EIJ C;  5BV0 A;  5T3T A;  2CFU A;  3IEE A;  5LFA A;  3MYV A;  3MV3 B;  4RDA A;  4XKB A;  1M56 C;  3GZ1 A;  5AJD A;  5LP0 A;  5E75 A;  4E85 A;  2Y3H A;  3IHY A;  4JZY A;  2QY7 A;  3O6X A;  3FP3 A;  3L13 A;  4G7H F;  4HOU A;  3JYS A;  2ZXR A;  4WUY A;  4AK9 A;  4HOQ A;  3ASG A;  2IQC A;  4GZ5 A;  3S27 A;  1DNP A;  1VMA A;  5AEN A;  4G24 A;  1Z6A A;  4BTB A;  3PEU B;  3R9A B;  3EZI A;  3OXF A;  4OIR F;  4PS3 A;  4XLP F;  3CR3 A;  3KL4 A;  4DPR A;  4J30 B;  1IZM A;  5JHB A;  4PJL A;  4U5D E;  3LS8 A;  4RBN A;  2G3K A;  3LY9 A;  2VYI A;  4AV7 A;  2IOS A;  3RRU A;  4BT8 A;  2GGF A;  3CHQ A;  3CHO A;  3OA1 A;  5JJ7 A;  2NUP A;  2R7T A;  3IBE A;  4CS7 A;  3OXL A;  1E90 A;  2J4D A;  3LLK A;  3CHM A;  2WXF A;  1KT0 A;  4BJ6 A;  3RRM B;  1PCX A;  3GW4 A;  1H19 A;  3EIJ A;  3TG4 A;  4HFF B;  4YT5 A;  2WXK A;  4GYO A;  3D9M A;  4YWQ A;  3WG7 C;  4JZA A;  2VSX E;  4GYY A;  3B7R L;  4JHR A;  2YZS A;  3NZS A;  4FP7 A;  3L17 A;  4GA2 A;  2FI7 A;  3BEE A;  3LYA A;  4ME2 A;  3I3N A;  3TL5 A;  3CIA A;  2J9W A;  1X5B A;  1EPU A;  3HTK C;  2PL2 A;  4I1O B;  5EHH A;  2KC7 A;  1L5J A;  3CVL A;  5EDS A;  3E9V A;  5D0Q D;  4CDM A;  1HF8 A;  3DAF A;  3FTV A;  3WOD F;  4ATG A;  3FTZ A;  4MRU A;  5CCM A;  4AIF A;  3SD5 A;  1NA0 A;  3MKR A;  2X6J A;  3FUJ A;  4PFO A;  4AEZ C;  3E70 C;  1IHG A;  2WB7 A;  3W8H A;  5J90 A;  4WNF A;  3F47 A;  3KKB A;  4IWB A;  1O87 A;  1UJJ A;  1QQE A;  4L7T A;  1OCO C;  3RYL A;  1TR2 A;  3LVR E;  3LEW A;  3URZ A;  1TJF A;  4G2V A;  1PD1 A;  4K7B A;  2KZT A;  1N1C A;  4GYT A;  4G7O F;  3BG1 B;  3ZXS A;  3PZD A;  4WNG A;  3EPV A;  5T8I A;  4MND A;  3V7O A;  4MQ9 F;  4K0D A;  2R7O A;  1NG1 A;  4HFK B;  2WQ6 A;  4A1S A;  4UWF A;  4NQ0 A;  1HH8 A;  4BFR A;  2IU1 A;  3NKD A;  3CK9 A;  4ANJ A;  3K33 A;  4OIN F;  3O4Z A;  3MX3 A;  3ESK A;  4HOT A;  3N0T A;  3CGH A;  2XSE A;  4N39 A;  1D0Y A;  2I1K A;  2MOW A;  1FMV A;  2XRH A;  3C98 A;  4G0H A;  4UI9 K;  4Q5S F;  3NDB B;  3VTY A;  5F5F A;  5KJK A;  3ZVR A;  4YT8 A;  3ONK A;  2CFZ A;  4N06 A;  4BX9 A;  4UI9 C;  2VTB B;  1TKN A;  4XWJ A;  2GW1 A;  3RKV A;  3S7B A;  5EX3 A;  3R7Q A;  5LX8 A;  2UY1 A;  5G04 J;  4A3V A;  4JXT A;  1KT1 A;  5CMW A;  1N52 A;  3JCU Q;  5JJT A;  3MGB A;  2BF0 X;  4C3D A;  3Q5M A;  2G3V A;  4PJJ A;  1ZYR F;  3PE4 A;  1B89 A;  5KYU B;  4ANX A;  4OIO F;  3DM5 A;  2L0T B;  2OG2 A;  1VDY A;  3LXU X;  4U04 A;  4JHK A;  4DVZ A;  5A6C A;  3EGX B;  3RK6 A;  3TJP A;  3FUD A;  1JPJ A;  2WL8 A;  3PHF 2;  3K1I C;  3ENE A;  5FZR A;  3B0P A;  2YHE A;  3CVW A;  3ASO C;  4PS7 A;  3ABK C;  5BUO A;  1M2V B;  3L34 A;  3SF4 A;  4ZLC A;  1HU3 A;  4A3T A;  4MS6 A;  3FEY A;  4EBB A;  4AE4 B;  3IKO B;  4KT6 B;  3CK7 A;  2DIW A;  3T5X A;  4KNV A;  4XIF A;  4CRW A;  4GAA A;  4CT4 A;  4HLE A;  3T5V A;  1KU2 A;  3UMI A;  4KXK B;  4KYO B;  3CVP A;  4H7Y A;  4RVB A;  1DVP A;  4A55 A;  3CQZ A;  2Z15 A;  2Y69 C;  2H7B A;  2NUT A;  4B8C B;  4KC9 A;  5FQ8 A;  4TUU A;  4G1T A;  1VK5 A;  5FWQ A;  3FAJ A;  3PEV B;  4V3I A;  2M4E A;  4A1G A;  5AIJ A;  3LY8 A;  4UWG A;  4DBQ A;  3KS2 A;  2EIN C;  2R59 A;  2WZG A;  3LES A;  4FHJ A;  5FQ6 A;  5BW8 C;  3RO3 A;  4U5B E;  3T8M A;  4XI0 A;  3UUX A;  5B3S C;  4Q7C A;  2XRZ A;  5E3C A;  2YNQ A;  5KJL A;  2J09 A;  4PUC A;  3JT1 A;  2WXO A;  3ZGQ A;  4KI2 A;  3DJU B;  5BPP A;  5HQ8 A;  3SBT B;  2QTV A;  2L9J A;  1LKX A;  4CIH A;  1ZHT A;  1MQS A;  2IJG X;  1V54 C;  4PK4 A;  3FTW A;  2J9Q A;  2XGS A;  4KVO A;  1INZ A;  2PQR A;  1WM5 A;  5BT1 A;  3CZ6 A;  3FFL A;  4KZ0 A;  3FTX A;  4H7X A;  3B7S A;  1PY1 A;  4I9C A;  4EEC A;  2XEV A;  4EQF A;  2WXI A;  3IHV A;  5AJL A;  4JA7 A;  2FFH A;  5ANR A;  5LCW C;  3ZYQ A;  1OWN A;  4P6I C;  3ML8 A;  4AP2 A;  1UN8 A;  5FT9 A;  2WVO A;  4B89 A;  2P6V A;  3EGD B;  5E2Q A;  4LEU A;  3I5Q A;  4N2Q A;  3QJZ A;  1HE8 A;  4XE0 A;  3ZPJ A;  3K66 A;  3RFY A;  1IQU A;  3SHF A;  1JPN A;  1WGW A;  4M3O A;  4BJT A;  3L08 A;  4GA0 A;  5JJ6 A;  2LO6 A;  5T3W A;  4WNE A;  3K6B A;  1MMN A;  1E8Y A;  1FMW A;  4J8F A;  3OXG A;  2HR2 A;  5KYY B;  2R7R A;  4NUR A;  2OND A;  2AXU A;  5BV1 A;  1QNF A;  3S2A A;  1Y8M A;  3FU3 A;  1EF1 C;  4LRZ A;  3MV2 B;  2BUG A;  4J8D A;  4N2S A;  3ZSU A;  3JCK C;  4YT4 A;  1ELR A;  2WXP A;  5EGY A;  3NF1 A;  1QZX A;  3LKU A;  4Q69 A;  4I3M A;  2OOE A;  4I43 A;  5IY5 C;  2I2O A;  1FTS A;  4C0M A;  2RD0 A;  1ZHX A;  4O6M A;  2UWJ G;  1NU9 C;  2R17 C;  4CDN A;  4J32 B;  2XGM A;  2ZPA A;  1M2O A;  4I17 A;  5ANL A;  2WM9 A;  1TJC A;  4GPK A;  2WZL A;  3SNH A;  4J8E A;  4EWC A;  2A1D D;  3S29 A;  4JW1 A;  2XCB A;  4U5G A;  2C03 A;  2NXP A;  5DQT A;  3D3M A;  3DJN B;  1SF8 A;  2WXH A;  3EFO B;  2DCP A;  1FCH A;  3ZHE B;  4I1M A;  4XI9 A;  4FC8 A;  2VSY A;  3ZN3 A;  3AS5 A;  3OTN A;  3M1C B;  3FUK A;  2C0M A;  3EH2 A;  3NYJ A;  3SZR A;  3FH5 A;  4U63 A;  3UMH A;  4I2W A;  2IXO A;  1OWP A;  4HXI A;  3S7J A;  4CS9 C;  3UR3 C;  4AXH A;  3JUI A;  2CNW A;  3FUI A;  3I4R B;  1VOM A;  4BT9 A;  3KD7 A;  3ITF A;  3ABL C;  3QNK A;  1LVK A;  3UPV A;  4BWR A;  4QDL A;  4C3B A;  2NSZ A;  3G2S A;  1BPO A;  3RU0 A;  3FU5 A;  3ZVV A;  1V55 C;  2CHW A;  2X6I A;  4W9R A;  2YHC A;  2XPI A;  2EQX A;  1PD0 A;  4YJW A;  4AOF A;  3EDT B;  5T3R A;  3BG0 B;  2CHX A;  2OVB A;  5BUZ A;  3CLJ A;  3LEV A;  2HYZ A;  4YVO A;  2WQ7 A;  2WZF A;  3B0V C;  4ULW A;  2WVI A;  4G26 A;  1ELK A;  1VYI A;  4IRU A;  4JVS A;  1BR4 A;  3CKC A;  1EYH A;  4LLC A;  3MEK A;  2J9U A;  3I5P A;  2Y3G A;  2XHE A;  4BTA A;  5KYX B;  1Z6T A;  3QAR A;  2VTB A;  3JQ1 A;  4UWH A;  3QK0 A;  5HI7 A;  1HG2 A;  4CSA A;  2DYS C;  3AG2 C;  4GZ3 A;  4DOZ A;  3PRE A;  3ZYK A;  3N2Z B;  3HJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...