3I5PA

Nup170(aa979-1502), s.cerevisiae
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
503
structure length
449
Chain Sequence
DILGFRAIEHLRRAKEIYDSLNYHLKNATAIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLENDDRKQYYDKRILVYDLVFDTLIKVDLRQKSYEAALKYNDRLFHYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGKISNILWVYYSRRSKFFESAEILYRLATSNFDITLFERIEFLSRANGFCQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQDSEFIFPIFELFPIVCNFFYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSDNSVFNKEMTWLIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Nucleoporin NUP170
publication title Architectural nucleoporins Nup157/170 and Nup133 are structurally related and descend from a second ancestral element.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 145
structure length 449
sequence length 503
ec nomenclature
pdb deposition date 2009-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1880 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3i5pA03
1.25.40.440 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3i5pA02
1.25.40.450 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3i5pA01
3I5PA
chains in the Genus database with same CATH superfamily
3DWWA 5E3AA 1A17A 3DE9A 4KBLA 3V30A 3CK8A 3CQCB 2L6HA 2ZXWC 3ZEFA 3KPHA 3EGXA 3CVXA 4WWOA 3UM0A 2WB7A 4U95D 4BT9A 2RFMA 2AXVA 3L13A 3TWRA 3UKUG 4K7BA 3CHSA 1QLEC 4RG9A 1W3BA 1L3PA 4GMLA 1TR2A 2PL2A 1VMAA 1BR1A 1GGQA 2YLGA 5LOZA 4BTAA 3GWNA 5BT1A 3C3QA 3EG9B 4RD9A 4H54A 1ZBPA 4K0RA 4HE8D 2P9UG 1D8EA 3K33A 3S7DA 1HW2A 5ENSD 5JHAA 5FZTA 1S05A 3UT8A 1O5MA 4W8PA 1CPRA 1EKYA 1BI8B 2GRMA 3FU3A 2HYZA 4ATGA 4U9DA 3U66A 4LDRA 3LJNA 2OKUA 3HXBA 1E86A 3R2PA 3IQ6A 3JCUQ 4Z9JA 4YNDA 3C5RA 2XEEA 3I5QA 2PQNA 4HXIA 3AS8A 3KAEA 3CVWA 5CBOA 3L16A 2LCHA 4K5BA 5T4YA 5L0FA 4GTMA 4XEFA 4AK9A 3L9TA 2A5UA 3W2VA 2Q9BA 3HKKA 4AX2A 1KPSB 2YNQA 4KYOB 4BEJA 1N94A 1SA4A 4XKCA 4XE0A 2DYRC 1YYHA 3L8IA 1V4AA 4GCOA 3N2ZB 4YT5A 3FU6A 5KNGA 4GTQA 1OCRE 1ELWA 1NA3A 1RW2A 4ILHB 1OWPA 2GRLA 2P9KG 2X6KA 4TRQA 2A0BA 3AS4A 4TXQA 1LS1A 4MVSA 4PR9A 4A2NB 5LCWJ 3SNXA 3BG1B 2Q7RA 4ZHBA 3RYLA 1TYQG 3UIOC 2NUPA 3JXJA 4WNDA 4U9EA 3I4UA 4U63A 2B0HA 2PX3A 3U9JA 4XPWA 3NDBB 3FTWA 3D9JA 4J32B 4HBDA 1FFHA 3LY9A 2HE0A 3TWVA 4GTRA 4MVMA 1WN0A 1ZHTA 3EZHA 1HY5A 3O4ZA 3WODF 1MMAA 1OCCC 1TQGA 4EQFA 3QTHA 4LNUD 3T6JA 4X8QA 5F5HA 4FESA 5JA4D 4DI3A 2R7SA 3ZYQA 2A1DD 4AL0A 5KYXB 4HQDA 4KXKB 1RXQA 1KTMA 2J4DA 3HNLA 4WGYA 1QQEA 4K0DA 3C62A 4FADA 3A9CA 1JWFA 5HSWA 3TQOA 2KJGA 5AQ9A 3E32A 2F0YA 3Q4AB 4NURA 4M63A 4N5CA 3PS6A 3QVZA 3LS8A 3JT1A 3U9WA 3U2MA 2WXNA 2LSUA 1E8ZA 1O5HA 4GA0A 2H6FA 5JSLA 1YAUO 2KQ9A 4GZCA 4B94A 3M4BA 2J7PA 3FTSA 5EKQD 4JEHA 3LLIA 2J45A 2VGXA 3JYYA 4MKTA 3PE4A 1SVXA 5JJTA 3CHQA 1DVPA 2JABA 2LFDA 5COGA 3UM1A 1QKRA 3GEHA 1ORYA 1WOLA 1D1BA 2FEZA 1HMDA 1I4ZA 1Z6AA 3AU5A 3MYIA 3ZSUA 1C17M 5BQHA 2J07A 3MEKA 1NG1A 2XXAA 3HDXA 4MS6A 2J9UA 5ITZF 1CGOA 3Q7LA 4HFKB 3RKOF 1TWCA 5D2MC 2KK1A 1GW6A 4JB8P 2XRZA 1LTXA 3T6GB 3ZYMA 1O3UA 3ASDA 4DX5D 3HXEA 4XEIG 3URZA 3S29A 4U0SA 1VLTA 2WXGA 5C2YA 4L7TA 1HH8A 2CHXA 2BC5A 2UY1A 1V54C 4DBRA 3CEQA 4UWLA 5L0JA 3UX4A 4UQYA 3C7JA 4JW1A 1N0RA 3QB2A 3SXMA 4BJ5C 3UINC 5TJ5E 3DXJF 3PH0C 5AN8A 3CR3A 2XGSA 1HG5A 2IM8A 4CDYA 4CIHA 3F6QA 3VF0A 2XZDG 4HRLA 4CDAA 3Q15A 4I43A 4LDQA 3AJIA 3FFLA 4F53A 2LP4A 2CFUA 4FJZA 4WGZA 3CHPA 2HV7A 5E75A 3FAPB 3RK6A 3SGHA 1IW7F 2IYLD 2H7VC 4C7OA 1LIHA 5JP7A 3U8PA 3DEPA 4KI2A 3H2UA 2C2LA 3JZ0A 3DJUB 2B0OE 1WAO1 1K8KG 2D4UA 2C04A 3VTXA 5F28E 4HVBA 4N2QA 3O55A 2WZGA 5KWDA 1SMYF 4J6IA 1NZEA 3EZIA 3UIPC 3CQZA 5AQBA 3KS2A 5DBKA 4YL0A 3C8GB 4DX1A 4XPXA 2Y3GA 1U89A 1LD7A 2NSZA 4UI9K 4JL0A 1YZCA 3FXHA 1L7CA 3UM2A 2IBFA 1BR2A 1MMDA 2R59A 1RJ9B 3NMIA 1G4WR 2WPVA 5JT4A 4WWNA 4EHPA 3EGXB 1M6TA 4JCHA 4EBAG 1NL4A 2Y69C 2M4EA 2ICWG 4ILIA 1N11A 3ECSA 2IU1A 5IY5E 3ZVRA 3HYMB 1A7VA 4FP7A 4ABNA 3EIJA 4A1SA 3FDHA 3TK0A 3PE3A 3HNKA 3KEZA 3CK9A 3LXUX 4TV3A 2L9JA 2HO1A 4EHMA 4A3VA 4I1MA 2XGMA 3CKCA 4Q94A 2WZFA 3G4ZA 3LUTB 1O1RA 4I6JA 2F8XK 2BTDA 3B0VC 1L5JA 5FQ6A 2ASRA 3RVYA 1X5BA 5CI9A 3FWVA 2LSEA 4GMJA 3Q5MA 2KZTA 1WGWA 1T6UA 5KYWA 2WMNA 3KD7A 2P9LG 2VSOE 1INZA 2GAQA 4FHKA 3APDA 4DLOA 3MKRA 3ASFA 2YHSA 1T6IA 3P1UA 5AC4A 2GA0A 2XPIA 2XEVA 1HE1A 2Y0BG 2VCAA 1ZW2A 1JCRA 2WXHA 4ANWA 4PS7A 3W2WA 3POVA 2HV6A 2NSGA 3CIAA 3FU5A 5LP0A 3GZ1A 3RSEG 2XM0A 3GODA 3AAAC 1NFIE 4JA7A 3DSWA 4B8AA 3G4XA 4G11A 2D5RB 4BEMJ 3T8MA 3EH2A 1SZ9A 1K04A 1YA7O 3V5ZA 3UI2A 3SBTB 4CDNA 2AW6A 3FMSA 2RG8A 4GYYA 4J8DA 2WVIA 3DJNB 1Q0KA 2VCCA 2VSXE 1OCRC 2OOCA 1R4TA 3IXEA 2KGOA 3ONKA 1NU7D 2NUPB 3FTVA 4EPZA 3PZ4A 1M57C 4CIPA 5HQ8A 3RFYA 1OWLA 2ETBA 3DPYA 1LVKA 2W4BA 3ZKJA 4V3IA 3T5VA 4XWJA 2W45A 4B8CB 2YL0A 4E17A 2BF0X 2OOEA 4EBJA 1MX2A 1WWPA 3CAXA 1UN8A 4J30B 3ZXSA 3NYLA 2P2CP 1SYQA 2Q4FA 5EYLA 1N4SA 3GYZA 4UI9C 3JQ0A 2HS5A 3CEXA 3CSFA 4DUIA 1R5ID 3LJBA 4HNAD 1ZYRF 4ACLA 2WXKA 5ENRD 1OW7A 2V5FA 1FVHA 2WXOA 3NAWA 1M2OA 4IULA 2WXLA 3Q9UC 4WAFA 1NP7A 3C3RA 4IN3B 2GRQB 4GTPA 4G7HF 4ANXA 2VTBA 1LE2A 4MTGA 2VGYA 2WZLA 5M72A 5COMA 2WQ7A 4LRZA 2MOWA 2H7BA 2XZTG 1SW6A 4GZ6A 2HFIA 4LSZE 3CVPA 3V2OA 3ZC4A 2J9BA 4NRHB 3GM3A 4UWKA 2GWWA 3DD7A 4MVQA 1FMVA 4HEAJ 4IJJA 4G2VA 2WVNA 4FLHA 2PF4E 5A6BA 4Q5SF 3UT7A 4APFA 3ZFWA 2JD3A 4U5HA 4XPYA 5EHHA 2IEJA 3D9KA 1CGME 3MKQA 5DS6A 3B95A 5JMND 2VGXB 4JHJA 1T01A 1VOMA 4J7TA 4LACB 3LEVA 3SF4A 1EA8A 1MHQA 3KH2A 4U8HA 3PMRA 1MX4A 4DBQA 4XTKA 5A69A 2QLAA 3GORA 3VLFA 2DVWA 1Y8MA 3QJZA 2ILRA 2Q7FA 2XXAB 3SHFA 2YZSA 4HRMB 2ETCA 2XEHA 1H9TA 3R9MA 1KT0A 1ZU2A 5A6CA 3K1IC 3ESKA 3V5YA 2XPZA 4F7AA 3HLZA 2E2EA 3J5QB 2LXMA 4OD4A 5CI8A 1BPOA 1I4YA 4XI9A 2JEKA 4XEVA 3D9OA 3QW1A 3EQLF 4DRJB 1M2VA 2Y3DA 2UY1B 3HXFA 4IAOA 4PJNA 2RD0A 1ORJA 4JE9A 3E4BA 1RKCA 1FT2A 5KBAA 1RZ4A 4ULVA 1EDUA 4XIFA 5HKPA 4DXWA 5G04C 1PC2A 2DBAA 1Y6DA 4ANJA 4A3TA 3BRJA 1AWCB 3FTXA 3CQGB 4GPKA 1D1CA 3KKBA 4CT4A 4L23A 4C7OB 2A0UA 4JKVA 4AY6A 4EBAA 1QSPA 4J0UA 3WG7E 2EPOA 3NF1A 4OINF 3IBEA 3LJ3A 3DAFA 1GM5A 4AVXA 3RQGA 2Q00A 1XZQA 3GM2A 3PZ2A 4J8EA 5EYPF 3ZQVA 5KYYA 4L1BA 5ENPD 4QFVA 2IF4A 2WXFA 4XLNF 3CZ6A 4Q4ZF 3I4GA 2YEVA 4KT6B 3MX3A 2OJED 1K40A 3G50A 3MYVA 2Y4UA 2XLEA 4KMOA 3KEAA 1NI1A 4BSXA 3SZ7A 4IB4A 1FNTc 3RQFA 2QY7A 2LSVA 2R03A 2B6CA 3B0PA 4B0ZA 3TJ5A 5KJKA 4LUNU 1WTYA 4HOTA 3MGBA 4C0EA 5KNHD 1E84A 3KSQA 2VSNA 2KCVA 4CCAA 3KL4A 1PV3A 3D9MA 2OG2A 2X0CA 3T5XA 1YYJA 1H6PA 1IXVA 3JUEA 3E9VA 4JVSA 2Y39A 3G2VA 3Q78A 1NSGB 5FZRA 3SFXA 3VLEA 5IY5C 4N5QA 3DSSA 5DQTA 3B7UX 4OD5A 2WXPA 3MJWA 4JEAA 3N71A 4KZ0A 1KZPA 3G2TA 4WNGA 4BPMA 5HRYA 3ZIMA 1XNFA 2NSFA 1QZXA 4ILGA 3MV3B 2AU5A 3FH8A 2V26A 4PUCA 2KZTB 3LNMB 4JIOA 4N4WA 3O6XA 5KYWB 2P6VA 3HNJA 3BEEA 2OJQA 1J8MF 4C48B 5B1BE 1C02A 3E34A 4DX2A 3Q6MA 2B0JA 1CGNA 2YHEA 3PZDA 4GZ3A 4EBKA 4UWHA 2GW1A 3UQ3A 2C0MA 1K1BA 4YWQA 3AJMA 1UJKA 1MJ0A 1IHBA 5EDSA 2XCBA 3EH1A 4G24A 4XKBA 1KZOA 3PZ3A 2I8BA 1YARO 3UMVA 3SXZA 2XRHA 2P9IG 1B89A 1E96B 3G2WA 1BDJB 1PY1A 1ST6A 2ZPAA 3IEEA 2R7RA 3QWVA 1NU9C 3GEEA 3ZDLA 2AVPA 1D0ZA 1EYHA 4FHJA 4Z68A 4GTSA 4BTBA 3ZW3A 5E76A 3U2LA 3N24A 1CPQA 4YDWA 3CVQA 3SD5A 2RSEB 3D9HA 4LG6A 2L6BA 1WM5A 2UUIA 4G1TA 3C8GD 4C0MA 3C18A 5J90A 2HMQA 3BG0B 4MW3A 3ZTMA 3NOCD 4BJ6A 4KC9A 4I6EA 3RVZA 2VYIA 4N06A 4JC8A 5C1DA 3FUMA 3ATPA 1FTSA 2CHZA 4MVOA 4CDVA 1XZPA 1TJFA 5LCWC 4PJJA 1FVFA 1N1CA 5KYUA 2WXRA 4U8YD 3JXIA 2WQHA 4P9TA 1JRAA 1LPEA 3DE8A 4BG0A 2R7UA 3G2SA 3MYFA 4CSAC 5CMWA 2R25A 2W9YA 2L0IA 3IHVA 3U64A 2LO6A 3QWPA 1Q2ZA 4EIYA 3LY7A 5BXOA 2MYSA 3SNHA 1EF1C 4N39A 4I3MA 2QZAA 4I9EA 2XLDA 1E8WA 1RKEA 2H7OA 4O1PA 1BI7B 3IHYA 1Z3XA 4WJ0A 2VTBB 2HM8A 4U0ZA 2XGOA 2IXNA 5A6AA 4PFPA 3EHRA 2J46A 3GZ2A 4N3AA 3QOUA 4IYPA 3EPVA 4LCTA 4YT2A 2OVBA 4RVBA 1N95A 3SO8A 3MFNA 2WXMA 3EU5A 1TWHA 3RRMB 1E8YA 3IQCA 3HRAA 3KYIA 4YT8A 4DVZA 3FUJA 2VH3A 4G25A 4EKWA 2R7VA 1YYXA 5JJ6A 1HMOA 1ZHWA 5BV1A 1ZU4A 3E33A 1TNYA 2KYHA 1VTMP 3M4CA 3C72A 2YL1A 1G5ZA 2J8SD 1KNYA 4KVMA 3UMIA 3MKQB 3QWWA 3TWXA 4TUUA 1B68A 1FMWA 3RAUA 1MQSA 3SXKA 5AJLA 1N0QA 2VQ2A 3M79A 4HOQA 2EILE 4I44A 4A4AA 4JTCB 3D9IA 3TXMA 2HZ8A 4AXHA 2A6HF 5CCMA 1TWGA 3LCAA 3ABKE 5CCLA 3K9IA 5A6KA 4AE4A 2I9CA 2FO1E 5EGYA 3TD7A 4YT4A 3DZAA 4Y6CA 1RCPA 4LNBA 5DLJA 3AG3E 4JC7A 4G7ZF 4XLPF 1OKKD 4O6MA 1AVOB 3NYJA 2QY9A 4G7OF 3SXYA 3S28A 1MMGA 4CEMA 2BKGA 3GM1A 4NTBA 2IJGX 5A6JA 3IEGA 1M2VB 2XENA 2AWCA 1Q0FA 5FTPA 3HG0D 1HE8A 2FFHA 3FH5A 2YQYA 3JSEO 3OEOA 5DS5A 5ENOD 4HLLA 5COFA 1NA0A 2GDCA 1TFOB 2GRPB 4FULA 4BETA 2IQCA 5ENQD 3TJ6A 4KBQA 1Z63A 3LAYA 4MVRA 3RIBA 4NIKA 5FZQA 5KYNA 3QC1A 2Q9AA 2FULA 4LLEA 2VSYA 1LD8A 4B89A 5DVWA 3F46A 5EN5D 4FA6A 1H2TC 4TXRA 1D9SA 2GGFA 4JJFA 3APCA 3C3OA 5AQ7A 4EZLA 5BV0A 2R9RB 1ZVZA 5H7PA 1DOWA 2JX0A 4O6FA 3QKYA 3WXXA 5KYYB 2LAIA 3WG7C 2IOLA 4DRXE 1Z6TA 1LF8A 4YVOA 1MNEA 2AWYA 2IO2C 1TN8A 2AP3A 3S7BA 3EHNA 3RO3A 3B7TA 3RKVA 1G8XA 1JUQA 4U0UA 3OAWA 3TOLA 1JWGA 4XQ1A 1IKND 3E30A 2IXMA 2F37A 4RDAA 4HS2A 4NCQA 1H6OA 4OVVA 3T8KA 4JXTA 2YHCA 4I9CA 5B3IA 4YL1A 4R7LA 4BEPA 4J7YA 4CRWA 3L82A 3FH7A 4ZFHA 3B71A 1APCA 2BL2A 4E0HA 1BD8A 4XI0A 4MQ9F 2PX0A 2HJ3A 5BQGA 4N3CA 3K6BA 1UW4B 3PDNA 2LNIA 1HXIA 3AS5A 3N0TA 3PDMP 1A0BA 5AIJA 5EIBE 3TULA 2C03A 3AG2E 3UMHA 2P0NA 3R7QA 2AXUA 2NG1A 5T3WA 2WXQA 1H19A 2CNWD 3RIPA 1GQAA 4KZCA 3UMKA 2LD6A 3CVYA 4MVZA 1YCSB 2M64A 4JHKA 1D0YA 4N6HA 1ZHXA 2QTVA 4G78A 3U9MA 3DM5A 2V5QC 2L7AA 3FTYA 2XLWA 3SEOA 1OXJA 4OIRF 4U5DE 1O87A 1JPNA 4MS2A 3EJNA 2IO3C 3QVYA 3PUKA 3L1MA 5B1BC 4DJAA 5CEAA 4DRIB 3RW0A 2X38A 3FHDA 2P9SG 3B0UX 4RLYA 1HF8A 2CYDA 2XPYA 2PFDA 3FEYA 2XL8A 3FU0A 3TWQA 3ZVVA 1MYOA 1LS4A 2ETSA 5EK0A 4H4KC 4EZKA 5G05J 3DPDA 4I6GA 1ZB1A 3NMJA 1DCEA 3U5SA 1Q0GA 3ZIBA 4BJ5A 2KC3A 2KNHA 2ZIRA 3JQ1A 3VM6A 4GAAA 3Q73A 3SI5A 3ZRHA 3W8IA 3O10A 3TGOA 5DIZA 2JPUA 4FWVA 3AG4E 4TUMA 4U8VD 5D0OD 4CGWA 3R7CA 2R7TA 4N2SA 2PNNA 2J4BA 3L0IA 3KSLA 3EGDA 5KYUB 3RJVA 4O6NA 1OXBA 2ZXRA 3UPVA 3T9OA 2H8AA 5T8IA 1H0AA 2DWZA 4LNGA 3UKRG 3MCXA 3B13A 2WQ6A 3FUFA 3UR3C 4KVOA 5KJNA 3SY2A 3FUEA 4Z9HA 4LERA 2A68F 1Z3IX 3PHF2 1NFNA 1SZIA 3L08A 1KU2A 2XS8A 4J7WA 1RKEB 4PACA 4D4NA 2GRNB 1PD1A 3V7OA 5AYWD 4HFGA 3PNLB 1WASA 3OXFA 5D92A 3NBNB 3F47A 3ASHA 4BESA 3RRUA 2AXZA 2BE5F 1D1AA 5KJMA 2QUPA 3CK7A 4UQXA 1IZMA 4BSZB 1LE4A 3U8VA 1LI5A 4IAQA 1ELRA 5ENNA 2UWJG 2ZXPA 5JRAA 3M1CB 4UI9J 2Q3TA 3SQVA 4G0HA 1Z7Qc 4MW8A 5BUOA 1Z3YA 2PM6A 1PAQA 3ZU7B 1RMVA 1HFAA 4O60A 2Y3BA 3FHEA 3S9OA 2EPLX 3EFOA 5J08A 2VB6A 1YA0A 3L17A 3S90A 5T1DB 4OAUC 3TWTA 2CDQA 1QYMA 2OEWA 2FF4A 4JZYA 3ZGQA 1JCSA 4EWCA 3QDNA 3LS1A 1VLSA 2EIKE 3CSTA 2GFHA 3EHQA 4AE4B 3RU0A 2XLHA 2EILC 3ASOE 4W9RA 3QW0A 5L0CA 2VCBA 3L54A 4PFOA 1TNBA 2XSEA 3ABKC 1T5OA 1OWOA 2KCKA 4I17A 3HHMA 1UFBA 2I1KA 4PH4B 4G23A 2BKKB 5FJYA 2EPMX 3LESA 4GPMA 3AG3C 3FUIA 3CHRA 3IKOB 1ZU5A 2JLBA 3ISMC 3JRMO 2L81A 1IHGA 3LEWA 1HG2A 4A63B 1DCQA 1QNFA 2AJAA 5D66A 2Y4TA 5HS0A 5JHBA 2DIWA 2VC9A 1HE9A 3CLJA 2WVOA 2MRIA 2P58C 2FGYA 3ML9A 2YKZA 3FULA 1TWAA 3AQBA 5AARA 4U5CE 3TL5A 4ZLDA 2KM4A 2YVKA 3Q6NA 4RBNA 2CW0F 3PVLA 2IONA 2Z15A 4B93B 3I3NA 5JLIA 2P1AA 4A55A 1EI7A 4MRUA 2XM4A 4I1OB 1BU9A 1XWJA 3HXCA 4IGGA 2EPNA 3H2VA 2CGEA 2XL4A 4MBGA 3Q75A 1OW6A 4Q7CA 3FUHA 3V79K 3ABMC 5BW8C 3VLDA 2DYSE 3TXNA 4PJMA 3LKUA 2UUHA 1MZCA 2R05A 1TNZA 3LY8A 2FBNA 1HO8A 2RKKA 3AQCA 5LX8A 5AC5A 2R17C 3GW4A 3B7BA 3FAJA 2V3CC 3ENEA 1S63A 4IRUA 3M15A 4GB9A 4NQ0A 4HLEA 2G3KA 2EIME 4K5AB 1AEPA 3JYHA 3SFYA 3MZLB 4FLBA 3VAYA 4NACA 2RFAA 4DPRA 4RQIA 3DSUA 5HI7A 3FOOA 5JVEA 3Q79A 1OCZE 1VDYA 3FUDA 3LLKA 4F1PA 3D3MA 3HVEA 1W2WA 3T6BA 2R7OA 5T3TA 3HXDA 1IQUA 4JRZA 1FAPB 4JURI 4AL1A 4K5CA 5EX0A 4OIPF 3UTMA 5AAOA 3DM9B 4CS9C 5ANRA 2YLIA 3B29A 4PDXA 2R7XA 2J9QA 2OEXA 5CIVA 3ULEG 2YL3A 3W8HA 5L0IA 2HUJA 2P9PG 3B7RL 1PD0A 2LIGA 3X1OA 3C8GA 4U5GA 4AY5A 3GZSA 1N9AA 4CBEA 3ULQA 2NYJA 2YLDA 3AG2C 4WABA 3S0XA 3KMIA 2LK4A 2G62A 3PUJA 2FI7A 3OXGA 2J09A 1I5NA 4G26A 4JZAA 3DKAA 4ACKA 3QK0A 4CT0A 3PZ1A 1S70B 5L3QA 4M3OA 4NC3A 5L0GA 4URKA 2GROB 5B3SE 2OQMA 3W9FA 5ANLA 5EILA 2EIJE 3GWLA 4NQFA 4A1GA 3LYAA 3UUXA 4JEUA 4GA1A 1SQMA 3UGPA 2MHRA 3UT4A 4YK5A 3LVRE 1ZHYA 3K1IA 2WM9A 3AU4A 5FINA 4U96D 1JR8A 1OQCA 2KXPC 5CMYA 1N4RA 3CHMA 4XX5A 3FVYA 1E85A 4Z9IA 3HNIA 2VGEA 3FEXA 1OXKA 2XHEA 4DK5A 1E83A 4U5FE 4D4XA 2J08A 2V4LA 5L0HA 3D9LA 4F6RD 4XEKA 4N3BA 4OYSA 4UUCA 4D10C 3LEOA 4E7ZA 3A11A 1E8XA 3L6AA 5T3RA 2L6JA 3O48A 1XGWA 1YVIA 1ZHZA 3Q47B 2A4ZA 4PS8A 4E18A 3EGDB 3Q49B 4JPSA 4FJYA 2KC7A 3MA5A 1FFTC 3NB2A 3AG4C 2XLMA 3ZYLA 2LQGA 1JAFA 2OV8A 2L0TB 1QPUA 2P7VA 1V55E 2V4HC 1AP7A 5FT9A 1QQ3A 4BJTA 3B7SA 1IYGA 4HFFB 3OTNA 3MV2B 3DXKG 3DRAA 4GTVA 1HX8A 1TNUA 2BEDA 2PP4A 1WDYA 2XL6A 2NUTA 4C9BB 2LAHA 2XLVA 2V0PA 4X0RA 5FQ4A 2A69F 5KCMA 1D0XA 2R7QA 3ML8A 1OKKA 3TG5A 1TN7A 3OA1A 3ZXPA 4FX5A 1H6KA 4MTFA 1O1SA 4O6YA 3K7DA 1U3DA 4CDRA 4CS9A 4GYWA 5CRUA 4Y6WA 1NZNA 2PBEA 5AENA 4EZJA 2IOQA 4HORA 5GPGB 2C0LA 3ZHEA 1SZAA 3UM3A 1SF8A 3ASGA 4QDLA 2A5EA 2OCCE 4AOFA 2XLOA 4L6RA 1WG0A 4P29A 4GTTA 2R02A 3EFOB 3Q7FA 3US6A 2R5SA 3HTKC 1Y6IA 2HMZA 2HJMA 4LLCA 1ELKA 2ETAA 2ONDA 4WWPA 2H6HA 3ZPJA 3ABLE 5JJ7A 3DI5A 5F5FA 3DXMG 3CVNA 3DSXA 2EIKC 3D9NA 1G4US 3SYNA 4DJ9A 5CECB 2HR2A 2CHWA 5B1AE 3T9KA 3EDTB 3EHMA 4GA2A 3CGHA 1YA9A 3ASOC 3S84A 1A5EA 4HI8A 2X6JA 1J8YF 2AVKA 2LUHA 3EIQC 4YDOA 4ANUA 1VYIA 3ITFA 3BU8A 1N4PA 3NRHA 4ANVA 5BXUA 3BEHA 1EQ1A 1OR3A 2WXIA 1JMWA 4Q69A 1TR4A 1S0PA 3ASNE 4TXPA 2XS1A 4BY6A 3PRZA 4K03A 2OVFA 2R2LA 1OWMA 4YDYA 3R7RA 3SFZA 3CV0A 2X3MA 1VK5A 4GZDA 4BX9A 4C3BA 1P5QA 1JOGA 2NC9A 2EINE 1YZAA 4BFRA 4JD2G 4GCNA 2WL8A 1QVXA 1DOVA 1FCHA 1JPLA 3RQEA 1VYKA 3ABME 3DAGA 3V5XA 2IY0C 4MTOA 3T4RA 3FUNA 3U4TA 2CNWA 4GU5A 1K3ZD 1TKNA 4U5BE 4CSAA 4DLQA 2DYSC 2VASA 2V8SE 3I4RB 1OT8A 4FC8A 3MBGA 4AEZC 5ENTD 2J8WA 1YMPA 5JS5A 3E70C 4ME2A 4JJGA 5BNWA 2KSFA 3S27A 3NKDA 4DX7D 3GANA 3H65A 3JYSA 5A7DB 3CHOA 3X2QC 2KCLA 2DI3A 2LFFA 4JTAB 3Q7GA 3LVQE 3ZN3A 4J8FA 5CRVA 4O79A 4E0IA 2CCYA 3NKEA 3ZYKA 2QC9A 1S64A 2X6HA 1ZZPA 5AJDA 3UNGC 3ZQYA 1ORSC 2J49A 3PREA 2EIMC 3HVEB 1JCQA 4O1OA 2XCCA 2J7PD 1V74B 3DSVA 3NG1A 5E2QA 1OCZC 4I2WA 1JPJA 1U3CA 2KW3C 2F22A 2HSQA 5BUZA 3FP3A 4LDKA 1SA5A 3DMDA 3O39A 3JSZA 2L6FA 1OCOE 2Y3AA 1K1AA 3U3BA 3Q7AA 3C8ZA 4H7XA 1A7DA 1HW1A 3K1HA 4E85A 4PJLA 4F3VA 2XQ0A 2DZOA 4HB5A 4UQZA 5ARFA 4YJWA 4I2ZA 3NZUA 2P61A 2DCPA 4NTAA 3J06A 3CVLA 3FDQA 2CG3A 3AG1E 4KNWA 4UDVA 1ZW3A 2P9NG 3QAQA 1E7UA 2YINA 4FU3A 2DGJA 3NOGD 3S7JA 5FQ8A 3APFA 4J8YA 2E87A 1YDIA 4IWBA 5E33A 4FAPB 3DWLG 4IARA 2ZXWE 3ZUVB 1Q0DA 1QBQA 1TJCA 2EPKX 3BQOA 4C3EA 3V31A 3AOUA 1NLXA 3GEIA 4CS8C 1YLMA 4HOUA 3ZNGA 2F8YA 4CGVA 5B3SC 1KLXA 5LFAA 5FQ7A 2EIJC 1EPUA 1TNOA 1UG3A 1TN6A 4CZ2D 3ULYA 3U0CA 1BBHA 4L9PA 5CBNA 4H7YA 1SR2A 5HV9A 3WAQA 3WHNA 3TOMA 4J8SA 4APOA 4QI2A 1LM3B 4WUYA 4BT8A 2J0WA 4P6IC 1TFKB 4JA9A 4ULWA 1FT1A 3LS0A 3OWTA 2OEVA 4MNDA 3JRTA 3L22A 2YL7A 2HSBA 1UJJA 4GZ5A 5G05C 4DX6D 1TEZA 3EG9A 2L9BA 3K66A 3AGTA 1C03A 3VRCA 2IXOA 2X6FA 3ZG1A 2ZXOA 2I15A 1MQVA 1K05A 4NTFA 2IOSA 4HI9A 4GMRA 1DC2A 1Y4CA 2QE9A 2FAPB 2ZISA 3VYWA 3R9AB 2YRFA 1HZ4A 3J5PA 3JUIA 4U7EB 3TG4A 4AIFA 4AV7A 3JTLO 3RF3A 1FPPA 2AWIA 1VB5A 1BR4A 3TJPA 2J9VA 3PEVB 2GRRB 4GYOA 5L3VA 4YN0B 2DYRE 2Q9CA 4E7SA 3LPZA 1V55C 1UN9A 2YWAA 2NUTB 2ZGDA 1A7EA 1E7VA 4ONSA 2PQRA 3DSTA 5ARGA 2LXLA 2L6GA 2CG2A 1WATA 4F1SA 2NXPA 5BQIA 2J9WA 3S7FA 5CHEE 1H2VC 4EUKB 1U2VG 2QNLA 4ER9A 4L2YA 4LEUA 5D0QD 1D8DA 3FY4A 2I6HA 4JCZA 3U3WA 3DBSA 1OR2A 1U0BB 1Z23A 4YVQC 4DVYP 3ZHEB 5G2NA 4BERA 3G2UA 3B9QA 4O7GA 3V2XA 4HOSA 2HKVA 3FOPA 4DI4A 4ZLCA 4NY3A 4PK4A 3D9PA 5EIDA 3CVVA 2XRYA 4CS7A 1LI7A 2M63A 1WY6A 4MVUA 1HU3A 3QMKA 3QNKA 4GQHA 4CX9A 3RO2A 1UOHA 2QYUA 2O9XA 5G55A 2MWQA 2I1JA 3I5PA 2ZU6B 2WVQA 2CFZA 2OCCC 3EUVA 1OCCE 4JTDB 4Q96A 3SBSA 3P2BA 3NQPA 4WNFA 3CKBA 1OUVA 1IQRA 3PEUB 3RRNB 1GS9A 4BJ1A 4CYMD 4M7CA 4CS8A 4I1AA 1A41A 2IFUA 3ABLC 4U04A 1H6GA 4MLPA 4QQIA 3JCKC 4AP2A 2X51A 2MHKA 1N54A 4YL3A 3E37A 4B6IA 5JUAA 1YJGA 5KYXA 1T6QA 5B1AC 3ZWIA 2H6GA 5L0DA 1Z5ZA 1MX6A 3ONLA 1N52A 1OWNA 4YDEA 4E6HA 4GYTA 3FUKA 1U6HA 1E90A 2WXJA 2J0XA 2PNOA 4F4BA 1Z5SC 1NBBA 3CVUA 1OW8A 2YQ8A 1AUEA 3AGUA 2QYJA 3ESLA 4PS3A 1F1MA 5DS4A 3VTYA 3SZRA 3PNTB 256BA 3TWWA 3ASNC 1H7IA 5AGFA 4G8LA 3U3FA 4OAVB 1FR0A 1MMNA 1MNDA 3IPMO 4U5EE 3S2AA 5FCLA 4XZ4A 2ZD9A 2Y3HA 3QZCA 1N4QA 5CERB 3FTZA 4CDMA 3DEOA 1E2XA 3W4YA 2E0IA 3EU9A 3KYJA 1HS6A 3FTUA 2EINC 4EECA 2G3VA 4L2LA 2WB2A 2I2OA 3BUAA 1OY3D 4GEHA 2DB4A 4HRNA 2X6IA 2PZIA 3L34A 3IQ5A 2EQXA 4RG6A 4C3DA 3QARA 2PM7A 3ZTZA 1PCXA 4KNVA 4CJOA 1O1TA 2DZNA 1V54E 1T9KA 3OXLA 3L8JA 1H9GA 4UWFA 5A23A 2RD9A 2QFCA 4AM9A 1G3NB 1DNPA 1BZ4A 2KBXA 3NZSA 5G04J 3TWSA 5CEDB 4UWGA 2W4MA 3LNRA 3SP1A 3Q9NC 2TMVP 2WMOA 2KATA 3TWUA 3X2QE 5A6BD 5FIOA 4WNEA 2R7WA 1NFOA 5EX3A 3UGOA 2Y1LE 5KJLA 4JEBA 4DRHB 3CSKA 2VJ8A 4BJ6C 1BLXB 4BWRA 2ZGGA 1Q0MA 2IXPA 2NPUA 3C63A 4P9FA 4OIOF 1H2UA 3UXGA 4QI0A 5FZSA 4R32A 4K1OA 3LDZA 5D91A 4ATZD 2H6IA 3C98A 3MLGA 1M56C 3HJCA 3IHUA 5DQZA 4OIQF 4AJWA 3RH3A 1OCOC 1S7ZA 3IV0A 4BX8A 5AQAA 4CJGA 5K0IA 4W8KA 1KT1A 3HIZA 2FO7A 2MYOA 4RSYA 3NMKA 4U07A 3IQTA 1LKXA 4JHRA 5BPPA 3NYMA 5FWQA 3TAXA 4GTOA 4EBBA 4DOZA 1X81A 5E3CA 1QZ2A 2BUGA 2A6EF 3AG1C 1UG7A 3PCVA 1RJ9A 4G8KA 4N6CA 3W9GA 4OVUA 2OU6A 2Y69E
chains in the Genus database with same CATH topology
5E3AA 1A17A 4KBLA 3CK8A 3CQCB 2ZXWC 3ZEFA 3CVXA 3EGXA 4WWOA 2WB7A 4BT9A 2AXVA 3L13A 4K7BA 3CHSA 1QLEC 4RG9A 1W3BA 4GMLA 1TR2A 2PL2A 1VMAA 1BR1A 4BTAA 5LOZA 5BT1A 3EG9B 4RD9A 1ZBPA 4K0RA 4HE8D 3K33A 3S7DA 5JHAA 3UT8A 2GRMA 3FU3A 2HYZA 4ATGA 3U66A 3JCUQ 4YNDA 3I5QA 2PQNA 4HXIA 3AS8A 3KAEA 3CVWA 3L16A 5T4YA 4AK9A 2A5UA 3W2VA 2Q9BA 4AX2A 4KYOB 2YNQA 4XKCA 4BEJA 4XE0A 2DYRC 4GCOA 3N2ZB 4YT5A 3FU6A 1ELWA 1NA3A 4ILHB 1OWPA 2GRLA 2X6KA 4TRQA 3AS4A 1LS1A 4A2NB 5LCWJ 3SNXA 3BG1B 3RYLA 2NUPA 4WNDA 3I4UA 4U63A 2PX3A 3NDBB 3FTWA 3D9JA 4J32B 1FFHA 3LY9A 1ZHTA 3EZHA 3O4ZA 3WODF 1MMAA 1OCCC 4EQFA 3T6JA 5F5HA 4FESA 4DI3A 2R7SA 3ZYQA 2A1DD 5KYXB 4KXKB 2J4DA 1QQEA 4K0DA 4FADA 1JWFA 5HSWA 2KJGA 4NURA 3Q4AB 4M63A 4N5CA 3PS6A 3LS8A 3JT1A 3U9WA 2WXNA 2LSUA 1E8ZA 1O5HA 4GA0A 2KQ9A 4GZCA 4B94A 2J7PA 3FTSA 5EKQD 4JEHA 3LLIA 2J45A 2VGXA 4MKTA 3PE4A 5JJTA 3CHQA 1DVPA 1D1BA 2FEZA 1Z6AA 3AU5A 3ZSUA 2J07A 3MEKA 1NG1A 2XXAA 3HDXA 4MS6A 2J9UA 3Q7LA 4HFKB 3RKOF 1TWCA 1GW6A 2XRZA 3ZYMA 3ASDA 3URZA 3S29A 4U0SA 2WXGA 5C2YA 4L7TA 1HH8A 2CHXA 3UX4A 2UY1A 1V54C 4DBRA 3CEQA 4UWLA 4UQYA 4JW1A 3QB2A 4BJ5C 3DXJF 3PH0C 3CR3A 2XGSA 1HG5A 4CIHA 4I43A 3Q15A 3FFLA 4F53A 2CFUA 4FJZA 3CHPA 2HV7A 5E75A 3RK6A 3SGHA 1IW7F 2IYLD 2H7VC 4C7OA 4KI2A 2C2LA 4HVBA 3DJUB 1WAO1 3VTXA 2C04A 4N2QA 2WZGA 1SMYF 4J6IA 1NZEA 3EZIA 3CQZA 3KS2A 5DBKA 2Y3GA 2NSZA 4UI9K 4JL0A 1BR2A 1MMDA 2R59A 1RJ9B 2WPVA 4WWNA 3EGXB 4JCHA 4EBAG 2Y69C 2M4EA 4ILIA 3ECSA 2IU1A 3ZVRA 3HYMB 4FP7A 4ABNA 3EIJA 4A1SA 3FDHA 3PE3A 3KEZA 3CK9A 3LXUX 4TV3A 2L9JA 2HO1A 4A3VA 4I1MA 2XGMA 3CKCA 4Q94A 2WZFA 4I6JA 2BTDA 3B0VC 1L5JA 5FQ6A 1X5BA 5CI9A 3FWVA 2LSEA 4GMJA 3Q5MA 2KZTA 1WGWA 5KYWA 2WMNA 3KD7A 2VSOE 1INZA 4FHKA 3APDA 4DLOA 3MKRA 3ASFA 2YHSA 3P1UA 2XPIA 2XEVA 4ANWA 2WXHA 4PS7A 3W2WA 2HV6A 3POVA 3CIAA 3FU5A 5LP0A 3GZ1A 3GODA 4JA7A 4B8AA 4G11A 2D5RB 3T8MA 3EH2A 1SZ9A 3SBTB 4CDNA 2AW6A 2RG8A 4GYYA 4J8DA 2WVIA 3DJNB 2VSXE 1OCRC 2KGOA 3ONKA 1NU7D 2NUPB 3FTVA 4EPZA 1M57C 5HQ8A 3RFYA 1OWLA 1LVKA 2W4BA 4V3IA 3T5VA 4XWJA 2W45A 4B8CB 2BF0X 2OOEA 1UN8A 4J30B 3ZXSA 3NYLA 3GYZA 4UI9C 3JQ0A 3CSFA 3LJBA 1ZYRF 4ACLA 2WXKA 2V5FA 1FVHA 2WXOA 1M2OA 4IULA 2WXLA 4WAFA 1NP7A 4IN3B 4G7HF 4ANXA 2VTBA 2VGYA 2WZLA 5M72A 2WQ7A 4LRZA 2MOWA 2H7BA 4GZ6A 3CVPA 3ZC4A 4NRHB 4UWKA 3DD7A 1FMVA 4HEAJ 4IJJA 4G2VA 2WVNA 4FLHA 2PF4E 4Q5SF 3UT7A 4APFA 3ZFWA 2JD3A 4U5HA 5EHHA 3D9KA 3MKQA 5DS6A 2VGXB 4JHJA 1VOMA 4LACB 3LEVA 3SF4A 1MHQA 3KH2A 4U8HA 3PMRA 4DBQA 4XTKA 3VLFA 1Y8MA 3QJZA 2ILRA 2Q7FA 2XXAB 3SHFA 2YZSA 1KT0A 1ZU2A 5A6CA 3K1IC 3ESKA 4F7AA 2XPZA 3HLZA 2E2EA 4OD4A 5CI8A 1BPOA 4XI9A 2JEKA 3D9OA 3EQLF 1M2VA 2Y3DA 2UY1B 4IAOA 4PJNA 2RD0A 3E4BA 1EDUA 4XIFA 5G04C 1PC2A 2DBAA 4ANJA 4A3TA 3FTXA 3CQGB 4GPKA 1D1CA 3KKBA 4CT4A 4L23A 4C7OB 4AY6A 4EBAA 4J0UA 3NF1A 4OINF 3IBEA 3LJ3A 3DAFA 4AVXA 4J8EA 5KYYA 4L1BA 4QFVA 2IF4A 2WXFA 4XLNF 3CZ6A 4Q4ZF 3I4GA 2YEVA 4KT6B 3MX3A 3MYVA 2Y4UA 4KMOA 4BSXA 3SZ7A 2QY7A 2LSVA 3B0PA 4B0ZA 5KJKA 4LUNU 4HOTA 3MGBA 4C0EA 2VSNA 2KCVA 4CCAA 3KL4A 3D9MA 2OG2A 3T5XA 3E9VA 4JVSA 2Y39A 3G2VA 5FZRA 3VLEA 5IY5C 5DQTA 3B7UX 4OD5A 2WXPA 3MJWA 3N71A 4KZ0A 3G2TA 4WNGA 3ZIMA 1XNFA 1QZXA 4ILGA 3MV3B 3FH8A 2V26A 4PUCA 2KZTB 3O6XA 5KYWB 2P6VA 3BEEA 1J8MF 3Q6MA 2B0JA 2YHEA 3PZDA 4GZ3A 4UWHA 2GW1A 3UQ3A 2C0MA 4YWQA 1UJKA 5EDSA 2XCBA 3EH1A 4G24A 4XKBA 2I8BA 3UMVA 2XRHA 1B89A 1E96B 3G2WA 1PY1A 1ST6A 2ZPAA 3IEEA 2R7RA 3QWVA 1NU9C 2AVPA 1D0ZA 1EYHA 4FHJA 4BTBA 3ZW3A 5E76A 3N24A 3SD5A 1WM5A 4G1TA 4C0MA 5J90A 3BG0B 4BJ6A 4KC9A 4I6EA 2VYIA 5C1DA 4N06A 4JC8A 3FUMA 1FTSA 2CHZA 1TJFA 5LCWC 4PJJA 1FVFA 1N1CA 5KYUA 2WXRA 2WQHA 2R7UA 4BG0A 3G2SA 4CSAC 5CMWA 2W9YA 2L0IA 3IHVA 3U64A 2LO6A 3QWPA 3LY7A 2MYSA 3SNHA 1EF1C 4N39A 4I3MA 4I9EA 1E8WA 2H7OA 3IHYA 1Z3XA 4WJ0A 2VTBB 2HM8A 4U0ZA 2XGOA 2IXNA 4PFPA 2J46A 3GZ2A 4N3AA 3QOUA 4IYPA 3EPVA 4LCTA 4YT2A 2OVBA 4RVBA 2WXMA 3RRMB 1TWHA 1E8YA 4YT8A 4DVZA 3FUJA 2VH3A 4G25A 2R7VA 5JJ6A 1ZHWA 5BV1A 1ZU4A 4KVMA 3QWWA 3UMIA 3MKQB 4TUUA 1FMWA 1MQSA 5AJLA 2VQ2A 4HOQA 4I44A 3D9IA 3TXMA 4AXHA 2A6HF 5CCMA 1TWGA 3LCAA 5CCLA 3K9IA 4AE4A 2I9CA 5EGYA 3TD7A 4YT4A 3DZAA 4Y6CA 5DLJA 4G7ZF 4XLPF 1OKKD 4O6MA 3NYJA 2QY9A 4G7OF 3S28A 1MMGA 4CEMA 2IJGX 3IEGA 1M2VB 5FTPA 2FFHA 1HE8A 3FH5A 3OEOA 5DS5A 1NA0A 4FULA 2IQCA 4KBQA 1Z63A 3LAYA 3RIBA 5FZQA 5KYNA 3QC1A 2Q9AA 2FULA 4LLEA 2VSYA 4B89A 5DVWA 3F46A 4FA6A 1H2TC 2GGFA 4JJFA 3APCA 4EZLA 5BV0A 4O6FA 3QKYA 3WXXA 5KYYB 2LAIA 3WG7C 2IOLA 1Z6TA 1LF8A 4YVOA 1MNEA 3S7BA 3EHNA 3RO3A 3B7TA 3RKVA 1G8XA 1JUQA 4U0UA 3OAWA 1JWGA 2IXMA 4RDAA 4HS2A 4OVVA 4JXTA 2YHCA 4I9CA 4R7LA 4CRWA 3FH7A 4XI0A 4MQ9F 2PX0A 4N3CA 3K6BA 1UW4B 3PDNA 2LNIA 1HXIA 3AS5A 3N0TA 5AIJA 2C03A 3UMHA 3R7QA 2AXUA 2NG1A 5T3WA 2WXQA 1H19A 2CNWD 3RIPA 4KZCA 3UMKA 3CVYA 4JHKA 1D0YA 1ZHXA 2QTVA 3DM5A 3FTYA 3SEOA 4OIRF 4U5DE 1O87A 1JPNA 3EJNA 3PUKA 5B1BC 4DJAA 2X38A 3FHDA 3B0UX 1HF8A 2XPYA 2PFDA 3FEYA 3FU0A 3ZVVA 4H4KC 4EZKA 5G05J 3DPDA 4I6GA 3ZIBA 4BJ5A 2KNHA 3JQ1A 4GAAA 3SI5A 3ZRHA 3W8IA 3TGOA 5DIZA 4FWVA 4CGWA 5D0OD 2R7TA 4N2SA 2J4BA 3L0IA 3EGDA 5KYUB 3RJVA 4O6NA 2ZXRA 3UPVA 5T8IA 1H0AA 3MCXA 3B13A 2WQ6A 3FUFA 3UR3C 4KVOA 5KJNA 3FUEA 4LERA 2A68F 1Z3IX 3PHF2 1SZIA 3L08A 1KU2A 1PD1A 3V7OA 5AYWD 4HFGA 3PNLB 3OXFA 5D92A 3F47A 3ASHA 3RRUA 2AXZA 2BE5F 1D1AA 5KJMA 3CK7A 4UQXA 1IZMA 1ELRA 5ENNA 2UWJG 2ZXPA 3M1CB 4UI9J 2Q3TA 4G0HA 5BUOA 1Z3YA 2PM6A 1PAQA 1HFAA 2Y3BA 3FHEA 3EFOA 5J08A 2VB6A 1YA0A 3L17A 5T1DB 2CDQA 2FF4A 4JZYA 3ZGQA 4EWCA 3QDNA 3LS1A 3CSTA 2GFHA 4AE4B 3RU0A 2EILC 4W9RA 3L54A 4PFOA 2XSEA 3ABKC 1OWOA 4I17A 2KCKA 3HHMA 2I1KA 4PH4B 4G23A 5FJYA 3LESA 3AG3C 3FUIA 3CHRA 3IKOB 1ZU5A 2JLBA 2L81A 1IHGA 3LEWA 1HG2A 1QNFA 2Y4TA 5JHBA 2DIWA 3CLJA 2WVOA 2MRIA 2P58C 2FGYA 3ML9A 3FULA 1TWAA 3AQBA 4U5CE 3TL5A 4ZLDA 2KM4A 3Q6NA 4RBNA 2CW0F 3PVLA 2IONA 2Z15A 3I3NA 4A55A 4MRUA 4I1OB 2CGEA 2XL4A 4Q7CA 3FUHA 3ABMC 5BW8C 3VLDA 3TXNA 4PJMA 3LKUA 3LY8A 2FBNA 1HO8A 3AQCA 5LX8A 2R17C 3GW4A 3FAJA 2V3CC 3ENEA 4IRUA 4GB9A 4NQ0A 4HLEA 2G3KA 3JYHA 3MZLB 4FLBA 3VAYA 4NACA 4DPRA 5HI7A 1VDYA 3FUDA 3LLKA 3D3MA 3HVEA 1W2WA 3T6BA 2R7OA 5T3TA 1IQUA 4JURI 5EX0A 4OIPF 3DM9B 4CS9C 5ANRA 4PDXA 2R7XA 2J9QA 3W8HA 3B7RL 1PD0A 3X1OA 4U5GA 4AY5A 3GZSA 4CBEA 3ULQA 3AG2C 3S0XA 3KMIA 2G62A 3PUJA 2FI7A 3OXGA 2J09A 4G26A 4JZAA 4ACKA 3QK0A 4CT0A 5L3QA 4M3OA 4URKA 5ANLA 4A1GA 3LYAA 3UUXA 4JEUA 4GA1A 1SQMA 3UGPA 3UT4A 3LVRE 1ZHYA 2WM9A 3AU4A 5CMYA 3CHMA 4XX5A 3FVYA 3FEXA 2XHEA 4DK5A 4U5FE 2J08A 2V4LA 3D9LA 4N3BA 4OYSA 4D10C 4E7ZA 1E8XA 3L6AA 5T3RA 2L6JA 3O48A 1XGWA 1ZHZA 3Q47B 2A4ZA 4PS8A 3EGDB 3Q49B 4JPSA 4FJYA 2KC7A 3MA5A 1FFTC 3AG4C 3ZYLA 2OV8A 2L0TB 2P7VA 5FT9A 4BJTA 3B7SA 1IYGA 4HFFB 3OTNA 3MV2B 1HX8A 2PP4A 2NUTA 4C9BB 2LAHA 2V0PA 4X0RA 5FQ4A 2A69F 5KCMA 1D0XA 2R7QA 3ML8A 1OKKA 3TG5A 3OA1A 4FX5A 1H6KA 4O6YA 3K7DA 1U3DA 4CDRA 4CS9A 4GYWA 4Y6WA 1NZNA 5AENA 4EZJA 2IOQA 4HORA 2C0LA 3ZHEA 1SZAA 1SF8A 3ASGA 4QDLA 4AOFA 4P29A 3EFOB 2R5SA 3HTKC 1Y6IA 4LLCA 1ELKA 2ONDA 4WWPA 3ZPJA 5JJ7A 5F5FA 3CVNA 2EIKC 3D9NA 3SYNA 2HR2A 2CHWA 3EDTB 3EHMA 4GA2A 3CGHA 3ASOC 2X6JA 1J8YF 3EIQC 4ANUA 1VYIA 3ITFA 3NRHA 4ANVA 2WXIA 4Q69A 1S0PA 4BY6A 3PRZA 4K03A 2OVFA 1OWMA 3R7RA 3SFZA 3CV0A 2X3MA 1VK5A 4GZDA 4BX9A 4C3BA 1P5QA 2NC9A 4BFRA 4GCNA 2WL8A 1FCHA 1JPLA 1VYKA 3DAGA 3FUNA 3T4RA 3U4TA 2CNWA 4GU5A 1TKNA 4U5BE 4CSAA 4DLQA 2DYSC 2VASA 2V8SE 3I4RB 4FC8A 4AEZC 3E70C 4ME2A 4JJGA 5BNWA 3S27A 3NKDA 3GANA 3H65A 3JYSA 5A7DB 3CHOA 3X2QC 2KCLA 3Q7GA 3LVQE 3ZN3A 4J8FA 4O79A 3NKEA 3ZYKA 2X6HA 5AJDA 3UNGC 3PREA 2J49A 2EIMC 3HVEB 2XCCA 2J7PD 3NG1A 5E2QA 1OCZC 4I2WA 1JPJA 1U3CA 2KW3C 5BUZA 3FP3A 3DMDA 3O39A 3JSZA 2Y3AA 4H7XA 3K1HA 4E85A 4PJLA 4F3VA 2XQ0A 4UQZA 5ARFA 4YJWA 4I2ZA 3NZUA 2DCPA 3CVLA 3FDQA 2CG3A 4KNWA 3QAQA 1E7UA 2YINA 4FU3A 2DGJA 3S7JA 5FQ8A 3APFA 2E87A 4IWBA 5E33A 1TJCA 4C3EA 4CS8C 4HOUA 4CGVA 5B3SC 1KLXA 5LFAA 5FQ7A 2EIJC 1EPUA 1UG3A 4H7YA 4J8SA 4APOA 4QI2A 4WUYA 4BT8A 2J0WA 4P6IC 4JA9A 4ULWA 3LS0A 3OWTA 4MNDA 3L22A 3JRTA 1UJJA 5G05C 4GZ5A 1TEZA 3EG9A 2L9BA 3K66A 2IXOA 2X6FA 3ZG1A 2ZXOA 2IOSA 3R9AB 3VYWA 1HZ4A 3JUIA 3TG4A 4AIFA 4AV7A 2AWIA 1BR4A 3TJPA 2J9VA 3PEVB 4GYOA 5L3VA 4YN0B 2Q9CA 4E7SA 3LPZA 1V55C 1UN9A 2NUTB 1E7VA 2PQRA 5ARGA 2CG2A 4F1SA 2NXPA 2J9WA 3S7FA 5CHEE 1H2VC 4L2YA 4LEUA 5D0QD 3FY4A 2I6HA 3U3WA 3DBSA 1Z23A 4YVQC 4DVYP 3ZHEB 5G2NA 3G2UA 3B9QA 4O7GA 4HOSA 4DI4A 4ZLCA 4NY3A 4PK4A 3D9PA 3CVVA 2XRYA 4CS7A 2M63A 1WY6A 1HU3A 3QMKA 3QNKA 3RO2A 2O9XA 5G55A 2MWQA 2I1JA 3I5PA 2ZU6B 2WVQA 2CFZA 2OCCC 4Q96A 3SBSA 3P2BA 3NQPA 4WNFA 3CKBA 1OUVA 1IQRA 3PEUB 3RRNB 4BJ1A 4CS8A 4I1AA 2IFUA 3ABLC 4U04A 4MLPA 3JCKC 4AP2A 2X51A 2MHKA 1N54A 4B6IA 5KYXA 5B1AC 3ONLA 1Z5ZA 1N52A 1OWNA 4E6HA 4GYTA 3FUKA 1E90A 2WXJA 2J0XA 4F4BA 3CVUA 2YQ8A 3VTYA 3ESLA 4PS3A 5DS4A 3SZRA 3PNTB 3ASNC 1MMNA 1MNDA 4U5EE 3S2AA 5FCLA 4XZ4A 2Y3HA 3QZCA 3FTZA 4CDMA 2E0IA 1HS6A 3FTUA 2EINC 4EECA 2G3VA 4L2LA 2WB2A 2I2OA 4GEHA 2X6IA 2PZIA 3L34A 2EQXA 4RG6A 4C3DA 3QARA 2PM7A 1PCXA 4KNVA 3OXLA 4UWFA 5A23A 2QFCA 4AM9A 1DNPA 3NZSA 5G04J 4UWGA 2W4MA 3LNRA 3SP1A 2WMOA 2KATA 4WNEA 2R7WA 5EX3A 3UGOA 5KJLA 3CSKA 2VJ8A 4BJ6C 4BWRA 2IXPA 1H2UA 4OIOF 4QI0A 5FZSA 3LDZA 5D91A 3C98A 3MLGA 1M56C 3HJCA 5DQZA 4OIQF 4AJWA 3RH3A 1OCOC 1S7ZA 3IV0A 4BX8A 4W8KA 1KT1A 3HIZA 2FO7A 4RSYA 4U07A 1LKXA 4JHRA 5BPPA 3NYMA 5FWQA 3TAXA 4EBBA 4DOZA 5E3CA 1QZ2A 2BUGA 2A6EF 3AG1C 1RJ9A 4OVUA 3CVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5P A; 
#chains in the Genus database with same CATH topology
 3DWW A;  5E3A A;  1A17 A;  3DE9 A;  4KBL A;  3V30 A;  3CK8 A;  3CQC B;  2L6H A;  2ZXW C;  3ZEF A;  3KPH A;  3EGX A;  3CVX A;  4WWO A;  3UM0 A;  2WB7 A;  4U95 D;  4BT9 A;  2RFM A;  2AXV A;  3L13 A;  3TWR A;  3UKU G;  4K7B A;  3CHS A;  1QLE C;  4RG9 A;  1W3B A;  1L3P A;  4GML A;  1TR2 A;  2PL2 A;  1VMA A;  1BR1 A;  1GGQ A;  2YLG A;  5LOZ A;  4BTA A;  3GWN A;  5BT1 A;  3C3Q A;  3EG9 B;  4RD9 A;  4H54 A;  1ZBP A;  4K0R A;  4HE8 D;  2P9U G;  1D8E A;  3K33 A;  3S7D A;  1HW2 A;  5ENS D;  5JHA A;  5FZT A;  1S05 A;  3UT8 A;  1O5M A;  4W8P A;  1CPR A;  1EKY A;  1BI8 B;  2GRM A;  3FU3 A;  2HYZ A;  4ATG A;  4U9D A;  3U66 A;  4LDR A;  3LJN A;  2OKU A;  3HXB A;  1E86 A;  3R2P A;  3IQ6 A;  3JCU Q;  4Z9J A;  4YND A;  3C5R A;  2XEE A;  3I5Q A;  2PQN A;  4HXI A;  3AS8 A;  3KAE A;  3CVW A;  5CBO A;  3L16 A;  2LCH A;  4K5B A;  5T4Y A;  5L0F A;  4GTM A;  4XEF A;  4AK9 A;  3L9T A;  2A5U A;  3W2V A;  2Q9B A;  3HKK A;  4AX2 A;  1KPS B;  2YNQ A;  4KYO B;  4BEJ A;  1N94 A;  1SA4 A;  4XKC A;  4XE0 A;  2DYR C;  1YYH A;  3L8I A;  1V4A A;  4GCO A;  3N2Z B;  4YT5 A;  3FU6 A;  5KNG A;  4GTQ A;  1OCR E;  1ELW A;  1NA3 A;  1RW2 A;  4ILH B;  1OWP A;  2GRL A;  2P9K G;  2X6K A;  4TRQ A;  2A0B A;  3AS4 A;  4TXQ A;  1LS1 A;  4MVS A;  4PR9 A;  4A2N B;  5LCW J;  3SNX A;  3BG1 B;  2Q7R A;  4ZHB A;  3RYL A;  1TYQ G;  3UIO C;  2NUP A;  3JXJ A;  4WND A;  4U9E A;  3I4U A;  4U63 A;  2B0H A;  2PX3 A;  3U9J A;  4XPW A;  3NDB B;  3FTW A;  3D9J A;  4J32 B;  4HBD A;  1FFH A;  3LY9 A;  2HE0 A;  3TWV A;  4GTR A;  4MVM A;  1WN0 A;  1ZHT A;  3EZH A;  1HY5 A;  3O4Z A;  3WOD F;  1MMA A;  1OCC C;  1TQG A;  4EQF A;  3QTH A;  4LNU D;  3T6J A;  4X8Q A;  5F5H A;  4FES A;  5JA4 D;  4DI3 A;  2R7S A;  3ZYQ A;  2A1D D;  4AL0 A;  5KYX B;  4HQD A;  4KXK B;  1RXQ A;  1KTM A;  2J4D A;  3HNL A;  4WGY A;  1QQE A;  4K0D A;  3C62 A;  4FAD A;  3A9C A;  1JWF A;  5HSW A;  3TQO A;  2KJG A;  5AQ9 A;  3E32 A;  2F0Y A;  3Q4A B;  4NUR A;  4M63 A;  4N5C A;  3PS6 A;  3QVZ A;  3LS8 A;  3JT1 A;  3U9W A;  3U2M A;  2WXN A;  2LSU A;  1E8Z A;  1O5H A;  4GA0 A;  2H6F A;  5JSL A;  1YAU O;  2KQ9 A;  4GZC A;  4B94 A;  3M4B A;  2J7P A;  3FTS A;  5EKQ D;  4JEH A;  3LLI A;  2J45 A;  2VGX A;  3JYY A;  4MKT A;  3PE4 A;  1SVX A;  5JJT A;  3CHQ A;  1DVP A;  2JAB A;  2LFD A;  5COG A;  3UM1 A;  1QKR A;  3GEH A;  1ORY A;  1WOL A;  1D1B A;  2FEZ A;  1HMD A;  1I4Z A;  1Z6A A;  3AU5 A;  3MYI A;  3ZSU A;  1C17 M;  5BQH A;  2J07 A;  3MEK A;  1NG1 A;  2XXA A;  3HDX A;  4MS6 A;  2J9U A;  5ITZ F;  1CGO A;  3Q7L A;  4HFK B;  3RKO F;  1TWC A;  5D2M C;  2KK1 A;  1GW6 A;  4JB8 P;  2XRZ A;  1LTX A;  3T6G B;  3ZYM A;  1O3U A;  3ASD A;  4DX5 D;  3HXE A;  4XEI G;  3URZ A;  3S29 A;  4U0S A;  1VLT A;  2WXG A;  5C2Y A;  4L7T A;  1HH8 A;  2CHX A;  2BC5 A;  2UY1 A;  1V54 C;  4DBR A;  3CEQ A;  4UWL A;  5L0J A;  3UX4 A;  4UQY A;  3C7J A;  4JW1 A;  1N0R A;  3QB2 A;  3SXM A;  4BJ5 C;  3UIN C;  5TJ5 E;  3DXJ F;  3PH0 C;  5AN8 A;  3CR3 A;  2XGS A;  1HG5 A;  2IM8 A;  4CDY A;  4CIH A;  3F6Q A;  3VF0 A;  2XZD G;  4HRL A;  4CDA A;  3Q15 A;  4I43 A;  4LDQ A;  3AJI A;  3FFL A;  4F53 A;  2LP4 A;  2CFU A;  4FJZ A;  4WGZ A;  3CHP A;  2HV7 A;  5E75 A;  3FAP B;  3RK6 A;  3SGH A;  1IW7 F;  2IYL D;  2H7V C;  4C7O A;  1LIH A;  5JP7 A;  3U8P A;  3DEP A;  4KI2 A;  3H2U A;  2C2L A;  3JZ0 A;  3DJU B;  2B0O E;  1WAO 1;  1K8K G;  2D4U A;  2C04 A;  3VTX A;  5F28 E;  4HVB A;  4N2Q A;  3O55 A;  2WZG A;  5KWD A;  1SMY F;  4J6I A;  1NZE A;  3EZI A;  3UIP C;  3CQZ A;  5AQB A;  3KS2 A;  5DBK A;  4YL0 A;  3C8G B;  4DX1 A;  4XPX A;  2Y3G A;  1U89 A;  1LD7 A;  2NSZ A;  4UI9 K;  4JL0 A;  1YZC A;  3FXH A;  1L7C A;  3UM2 A;  2IBF A;  1BR2 A;  1MMD A;  2R59 A;  1RJ9 B;  3NMI A;  1G4W R;  2WPV A;  5JT4 A;  4WWN A;  4EHP A;  3EGX B;  1M6T A;  4JCH A;  4EBA G;  1NL4 A;  2Y69 C;  2M4E A;  2ICW G;  4ILI A;  1N11 A;  3ECS A;  2IU1 A;  5IY5 E;  3ZVR A;  3HYM B;  1A7V A;  4FP7 A;  4ABN A;  3EIJ A;  4A1S A;  3FDH A;  3TK0 A;  3PE3 A;  3HNK A;  3KEZ A;  3CK9 A;  3LXU X;  4TV3 A;  2L9J A;  2HO1 A;  4EHM A;  4A3V A;  4I1M A;  2XGM A;  3CKC A;  4Q94 A;  2WZF A;  3G4Z A;  3LUT B;  1O1R A;  4I6J A;  2F8X K;  2BTD A;  3B0V C;  1L5J A;  5FQ6 A;  2ASR A;  3RVY A;  1X5B A;  5CI9 A;  3FWV A;  2LSE A;  4GMJ A;  3Q5M A;  2KZT A;  1WGW A;  1T6U A;  5KYW A;  2WMN A;  3KD7 A;  2P9L G;  2VSO E;  1INZ A;  2GAQ A;  4FHK A;  3APD A;  4DLO A;  3MKR A;  3ASF A;  2YHS A;  1T6I A;  3P1U A;  5AC4 A;  2GA0 A;  2XPI A;  2XEV A;  1HE1 A;  2Y0B G;  2VCA A;  1ZW2 A;  1JCR A;  2WXH A;  4ANW A;  4PS7 A;  3W2W A;  3POV A;  2HV6 A;  2NSG A;  3CIA A;  3FU5 A;  5LP0 A;  3GZ1 A;  3RSE G;  2XM0 A;  3GOD A;  3AAA C;  1NFI E;  4JA7 A;  3DSW A;  4B8A A;  3G4X A;  4G11 A;  2D5R B;  4BEM J;  3T8M A;  3EH2 A;  1SZ9 A;  1K04 A;  1YA7 O;  3V5Z A;  3UI2 A;  3SBT B;  4CDN A;  2AW6 A;  3FMS A;  2RG8 A;  4GYY A;  4J8D A;  2WVI A;  3DJN B;  1Q0K A;  2VCC A;  2VSX E;  1OCR C;  2OOC A;  1R4T A;  3IXE A;  2KGO A;  3ONK A;  1NU7 D;  2NUP B;  3FTV A;  4EPZ A;  3PZ4 A;  1M57 C;  4CIP A;  5HQ8 A;  3RFY A;  1OWL A;  2ETB A;  3DPY A;  1LVK A;  2W4B A;  3ZKJ A;  4V3I A;  3T5V A;  4XWJ A;  2W45 A;  4B8C B;  2YL0 A;  4E17 A;  2BF0 X;  2OOE A;  4EBJ A;  1MX2 A;  1WWP A;  3CAX A;  1UN8 A;  4J30 B;  3ZXS A;  3NYL A;  2P2C P;  1SYQ A;  2Q4F A;  5EYL A;  1N4S A;  3GYZ A;  4UI9 C;  3JQ0 A;  2HS5 A;  3CEX A;  3CSF A;  4DUI A;  1R5I D;  3LJB A;  4HNA D;  1ZYR F;  4ACL A;  2WXK A;  5ENR D;  1OW7 A;  2V5F A;  1FVH A;  2WXO A;  3NAW A;  1M2O A;  4IUL A;  2WXL A;  3Q9U C;  4WAF A;  1NP7 A;  3C3R A;  4IN3 B;  2GRQ B;  4GTP A;  4G7H F;  4ANX A;  2VTB A;  1LE2 A;  4MTG A;  2VGY A;  2WZL A;  5M72 A;  5COM A;  2WQ7 A;  4LRZ A;  2MOW A;  2H7B A;  2XZT G;  1SW6 A;  4GZ6 A;  2HFI A;  4LSZ E;  3CVP A;  3V2O A;  3ZC4 A;  2J9B A;  4NRH B;  3GM3 A;  4UWK A;  2GWW A;  3DD7 A;  4MVQ A;  1FMV A;  4HEA J;  4IJJ A;  4G2V A;  2WVN A;  4FLH A;  2PF4 E;  5A6B A;  4Q5S F;  3UT7 A;  4APF A;  3ZFW A;  2JD3 A;  4U5H A;  4XPY A;  5EHH A;  2IEJ A;  3D9K A;  1CGM E;  3MKQ A;  5DS6 A;  3B95 A;  5JMN D;  2VGX B;  4JHJ A;  1T01 A;  1VOM A;  4J7T A;  4LAC B;  3LEV A;  3SF4 A;  1EA8 A;  1MHQ A;  3KH2 A;  4U8H A;  3PMR A;  1MX4 A;  4DBQ A;  4XTK A;  5A69 A;  2QLA A;  3GOR A;  3VLF A;  2DVW A;  1Y8M A;  3QJZ A;  2ILR A;  2Q7F A;  2XXA B;  3SHF A;  2YZS A;  4HRM B;  2ETC A;  2XEH A;  1H9T A;  3R9M A;  1KT0 A;  1ZU2 A;  5A6C A;  3K1I C;  3ESK A;  3V5Y A;  2XPZ A;  4F7A A;  3HLZ A;  2E2E A;  3J5Q B;  2LXM A;  4OD4 A;  5CI8 A;  1BPO A;  1I4Y A;  4XI9 A;  2JEK A;  4XEV A;  3D9O A;  3QW1 A;  3EQL F;  4DRJ B;  1M2V A;  2Y3D A;  2UY1 B;  3HXF A;  4IAO A;  4PJN A;  2RD0 A;  1ORJ A;  4JE9 A;  3E4B A;  1RKC A;  1FT2 A;  5KBA A;  1RZ4 A;  4ULV A;  1EDU A;  4XIF A;  5HKP A;  4DXW A;  5G04 C;  1PC2 A;  2DBA A;  1Y6D A;  4ANJ A;  4A3T A;  3BRJ A;  1AWC B;  3FTX A;  3CQG B;  4GPK A;  1D1C A;  3KKB A;  4CT4 A;  4L23 A;  4C7O B;  2A0U A;  4JKV A;  4AY6 A;  4EBA A;  1QSP A;  4J0U A;  3WG7 E;  2EPO A;  3NF1 A;  4OIN F;  3IBE A;  3LJ3 A;  3DAF A;  1GM5 A;  4AVX A;  3RQG A;  2Q00 A;  1XZQ A;  3GM2 A;  3PZ2 A;  4J8E A;  5EYP F;  3ZQV A;  5KYY A;  4L1B A;  5ENP D;  4QFV A;  2IF4 A;  2WXF A;  4XLN F;  3CZ6 A;  4Q4Z F;  3I4G A;  2YEV A;  4KT6 B;  3MX3 A;  2OJE D;  1K40 A;  3G50 A;  3MYV A;  2Y4U A;  2XLE A;  4KMO A;  3KEA A;  1NI1 A;  4BSX A;  3SZ7 A;  4IB4 A;  1FNT c;  3RQF A;  2QY7 A;  2LSV A;  2R03 A;  2B6C A;  3B0P A;  4B0Z A;  3TJ5 A;  5KJK A;  4LUN U;  1WTY A;  4HOT A;  3MGB A;  4C0E A;  5KNH D;  1E84 A;  3KSQ A;  2VSN A;  2KCV A;  4CCA A;  3KL4 A;  1PV3 A;  3D9M A;  2OG2 A;  2X0C A;  3T5X A;  1YYJ A;  1H6P A;  1IXV A;  3JUE A;  3E9V A;  4JVS A;  2Y39 A;  3G2V A;  3Q78 A;  1NSG B;  5FZR A;  3SFX A;  3VLE A;  5IY5 C;  4N5Q A;  3DSS A;  5DQT A;  3B7U X;  4OD5 A;  2WXP A;  3MJW A;  4JEA A;  3N71 A;  4KZ0 A;  1KZP A;  3G2T A;  4WNG A;  4BPM A;  5HRY A;  3ZIM A;  1XNF A;  2NSF A;  1QZX A;  4ILG A;  3MV3 B;  2AU5 A;  3FH8 A;  2V26 A;  4PUC A;  2KZT B;  3LNM B;  4JIO A;  4N4W A;  3O6X A;  5KYW B;  2P6V A;  3HNJ A;  3BEE A;  2OJQ A;  1J8M F;  4C48 B;  5B1B E;  1C02 A;  3E34 A;  4DX2 A;  3Q6M A;  2B0J A;  1CGN A;  2YHE A;  3PZD A;  4GZ3 A;  4EBK A;  4UWH A;  2GW1 A;  3UQ3 A;  2C0M A;  1K1B A;  4YWQ A;  3AJM A;  1UJK A;  1MJ0 A;  1IHB A;  5EDS A;  2XCB A;  3EH1 A;  4G24 A;  4XKB A;  1KZO A;  3PZ3 A;  2I8B A;  1YAR O;  3UMV A;  3SXZ A;  2XRH A;  2P9I G;  1B89 A;  1E96 B;  3G2W A;  1BDJ B;  1PY1 A;  1ST6 A;  2ZPA A;  3IEE A;  2R7R A;  3QWV A;  1NU9 C;  3GEE A;  3ZDL A;  2AVP A;  1D0Z A;  1EYH A;  4FHJ A;  4Z68 A;  4GTS A;  4BTB A;  3ZW3 A;  5E76 A;  3U2L A;  3N24 A;  1CPQ A;  4YDW A;  3CVQ A;  3SD5 A;  2RSE B;  3D9H A;  4LG6 A;  2L6B A;  1WM5 A;  2UUI A;  4G1T A;  3C8G D;  4C0M A;  3C18 A;  5J90 A;  2HMQ A;  3BG0 B;  4MW3 A;  3ZTM A;  3NOC D;  4BJ6 A;  4KC9 A;  4I6E A;  3RVZ A;  2VYI A;  4N06 A;  4JC8 A;  5C1D A;  3FUM A;  3ATP A;  1FTS A;  2CHZ A;  4MVO A;  4CDV A;  1XZP A;  1TJF A;  5LCW C;  4PJJ A;  1FVF A;  1N1C A;  5KYU A;  2WXR A;  4U8Y D;  3JXI A;  2WQH A;  4P9T A;  1JRA A;  1LPE A;  3DE8 A;  4BG0 A;  2R7U A;  3G2S A;  3MYF A;  4CSA C;  5CMW A;  2R25 A;  2W9Y A;  2L0I A;  3IHV A;  3U64 A;  2LO6 A;  3QWP A;  1Q2Z A;  4EIY A;  3LY7 A;  5BXO A;  2MYS A;  3SNH A;  1EF1 C;  4N39 A;  4I3M A;  2QZA A;  4I9E A;  2XLD A;  1E8W A;  1RKE A;  2H7O A;  4O1P A;  1BI7 B;  3IHY A;  1Z3X A;  4WJ0 A;  2VTB B;  2HM8 A;  4U0Z A;  2XGO A;  2IXN A;  5A6A A;  4PFP A;  3EHR A;  2J46 A;  3GZ2 A;  4N3A A;  3QOU A;  4IYP A;  3EPV A;  4LCT A;  4YT2 A;  2OVB A;  4RVB A;  1N95 A;  3SO8 A;  3MFN A;  2WXM A;  3EU5 A;  1TWH A;  3RRM B;  1E8Y A;  3IQC A;  3HRA A;  3KYI A;  4YT8 A;  4DVZ A;  3FUJ A;  2VH3 A;  4G25 A;  4EKW A;  2R7V A;  1YYX A;  5JJ6 A;  1HMO A;  1ZHW A;  5BV1 A;  1ZU4 A;  3E33 A;  1TNY A;  2KYH A;  1VTM P;  3M4C A;  3C72 A;  2YL1 A;  1G5Z A;  2J8S D;  1KNY A;  4KVM A;  3UMI A;  3MKQ B;  3QWW A;  3TWX A;  4TUU A;  1B68 A;  1FMW A;  3RAU A;  1MQS A;  3SXK A;  5AJL A;  1N0Q A;  2VQ2 A;  3M79 A;  4HOQ A;  2EIL E;  4I44 A;  4A4A A;  4JTC B;  3D9I A;  3TXM A;  2HZ8 A;  4AXH A;  2A6H F;  5CCM A;  1TWG A;  3LCA A;  3ABK E;  5CCL A;  3K9I A;  5A6K A;  4AE4 A;  2I9C A;  2FO1 E;  5EGY A;  3TD7 A;  4YT4 A;  3DZA A;  4Y6C A;  1RCP A;  4LNB A;  5DLJ A;  3AG3 E;  4JC7 A;  4G7Z F;  4XLP F;  1OKK D;  4O6M A;  1AVO B;  3NYJ A;  2QY9 A;  4G7O F;  3SXY A;  3S28 A;  1MMG A;  4CEM A;  2BKG A;  3GM1 A;  4NTB A;  2IJG X;  5A6J A;  3IEG A;  1M2V B;  2XEN A;  2AWC A;  1Q0F A;  5FTP A;  3HG0 D;  1HE8 A;  2FFH A;  3FH5 A;  2YQY A;  3JSE O;  3OEO A;  5DS5 A;  5ENO D;  4HLL A;  5COF A;  1NA0 A;  2GDC A;  1TFO B;  2GRP B;  4FUL A;  4BET A;  2IQC A;  5ENQ D;  3TJ6 A;  4KBQ A;  1Z63 A;  3LAY A;  4MVR A;  3RIB A;  4NIK A;  5FZQ A;  5KYN A;  3QC1 A;  2Q9A A;  2FUL A;  4LLE A;  2VSY A;  1LD8 A;  4B89 A;  5DVW A;  3F46 A;  5EN5 D;  4FA6 A;  1H2T C;  4TXR A;  1D9S A;  2GGF A;  4JJF A;  3APC A;  3C3O A;  5AQ7 A;  4EZL A;  5BV0 A;  2R9R B;  1ZVZ A;  5H7P A;  1DOW A;  2JX0 A;  4O6F A;  3QKY A;  3WXX A;  5KYY B;  2LAI A;  3WG7 C;  2IOL A;  4DRX E;  1Z6T A;  1LF8 A;  4YVO A;  1MNE A;  2AWY A;  2IO2 C;  1TN8 A;  2AP3 A;  3S7B A;  3EHN A;  3RO3 A;  3B7T A;  3RKV A;  1G8X A;  1JUQ A;  4U0U A;  3OAW A;  3TOL A;  1JWG A;  4XQ1 A;  1IKN D;  3E30 A;  2IXM A;  2F37 A;  4RDA A;  4HS2 A;  4NCQ A;  1H6O A;  4OVV A;  3T8K A;  4JXT A;  2YHC A;  4I9C A;  5B3I A;  4YL1 A;  4R7L A;  4BEP A;  4J7Y A;  4CRW A;  3L82 A;  3FH7 A;  4ZFH A;  3B71 A;  1APC A;  2BL2 A;  4E0H A;  1BD8 A;  4XI0 A;  4MQ9 F;  2PX0 A;  2HJ3 A;  5BQG A;  4N3C A;  3K6B A;  1UW4 B;  3PDN A;  2LNI A;  1HXI A;  3AS5 A;  3N0T A;  3PDM P;  1A0B A;  5AIJ A;  5EIB E;  3TUL A;  2C03 A;  3AG2 E;  3UMH A;  2P0N A;  3R7Q A;  2AXU A;  2NG1 A;  5T3W A;  2WXQ A;  1H19 A;  2CNW D;  3RIP A;  1GQA A;  4KZC A;  3UMK A;  2LD6 A;  3CVY A;  4MVZ A;  1YCS B;  2M64 A;  4JHK A;  1D0Y A;  4N6H A;  1ZHX A;  2QTV A;  4G78 A;  3U9M A;  3DM5 A;  2V5Q C;  2L7A A;  3FTY A;  2XLW A;  3SEO A;  1OXJ A;  4OIR F;  4U5D E;  1O87 A;  1JPN A;  4MS2 A;  3EJN A;  2IO3 C;  3QVY A;  3PUK A;  3L1M A;  5B1B C;  4DJA A;  5CEA A;  4DRI B;  3RW0 A;  2X38 A;  3FHD A;  2P9S G;  3B0U X;  4RLY A;  1HF8 A;  2CYD A;  2XPY A;  2PFD A;  3FEY A;  2XL8 A;  3FU0 A;  3TWQ A;  3ZVV A;  1MYO A;  1LS4 A;  2ETS A;  5EK0 A;  4H4K C;  4EZK A;  5G05 J;  3DPD A;  4I6G A;  1ZB1 A;  3NMJ A;  1DCE A;  3U5S A;  1Q0G A;  3ZIB A;  4BJ5 A;  2KC3 A;  2KNH A;  2ZIR A;  3JQ1 A;  3VM6 A;  4GAA A;  3Q73 A;  3SI5 A;  3ZRH A;  3W8I A;  3O10 A;  3TGO A;  5DIZ A;  2JPU A;  4FWV A;  3AG4 E;  4TUM A;  4U8V D;  5D0O D;  4CGW A;  3R7C A;  2R7T A;  4N2S A;  2PNN A;  2J4B A;  3L0I A;  3KSL A;  3EGD A;  5KYU B;  3RJV A;  4O6N A;  1OXB A;  2ZXR A;  3UPV A;  3T9O A;  2H8A A;  5T8I A;  1H0A A;  2DWZ A;  4LNG A;  3UKR G;  3MCX A;  3B13 A;  2WQ6 A;  3FUF A;  3UR3 C;  4KVO A;  5KJN A;  3SY2 A;  3FUE A;  4Z9H A;  4LER A;  2A68 F;  1Z3I X;  3PHF 2;  1NFN A;  1SZI A;  3L08 A;  1KU2 A;  2XS8 A;  4J7W A;  1RKE B;  4PAC A;  4D4N A;  2GRN B;  1PD1 A;  3V7O A;  5AYW D;  4HFG A;  3PNL B;  1WAS A;  3OXF A;  5D92 A;  3NBN B;  3F47 A;  3ASH A;  4BES A;  3RRU A;  2AXZ A;  2BE5 F;  1D1A A;  5KJM A;  2QUP A;  3CK7 A;  4UQX A;  1IZM A;  4BSZ B;  1LE4 A;  3U8V A;  1LI5 A;  4IAQ A;  1ELR A;  5ENN A;  2UWJ G;  2ZXP A;  5JRA A;  3M1C B;  4UI9 J;  2Q3T A;  3SQV A;  4G0H A;  1Z7Q c;  4MW8 A;  5BUO A;  1Z3Y A;  2PM6 A;  1PAQ A;  3ZU7 B;  1RMV A;  1HFA A;  4O60 A;  2Y3B A;  3FHE A;  3S9O A;  2EPL X;  3EFO A;  5J08 A;  2VB6 A;  1YA0 A;  3L17 A;  3S90 A;  5T1D B;  4OAU C;  3TWT A;  2CDQ A;  1QYM A;  2OEW A;  2FF4 A;  4JZY A;  3ZGQ A;  1JCS A;  4EWC A;  3QDN A;  3LS1 A;  1VLS A;  2EIK E;  3CST A;  2GFH A;  3EHQ A;  4AE4 B;  3RU0 A;  2XLH A;  2EIL C;  3ASO E;  4W9R A;  3QW0 A;  5L0C A;  2VCB A;  3L54 A;  4PFO A;  1TNB A;  2XSE A;  3ABK C;  1T5O A;  1OWO A;  2KCK A;  4I17 A;  3HHM A;  1UFB A;  2I1K A;  4PH4 B;  4G23 A;  2BKK B;  5FJY A;  2EPM X;  3LES A;  4GPM A;  3AG3 C;  3FUI A;  3CHR A;  3IKO B;  1ZU5 A;  2JLB A;  3ISM C;  3JRM O;  2L81 A;  1IHG A;  3LEW A;  1HG2 A;  4A63 B;  1DCQ A;  1QNF A;  2AJA A;  5D66 A;  2Y4T A;  5HS0 A;  5JHB A;  2DIW A;  2VC9 A;  1HE9 A;  3CLJ A;  2WVO A;  2MRI A;  2P58 C;  2FGY A;  3ML9 A;  2YKZ A;  3FUL A;  1TWA A;  3AQB A;  5AAR A;  4U5C E;  3TL5 A;  4ZLD A;  2KM4 A;  2YVK A;  3Q6N A;  4RBN A;  2CW0 F;  3PVL A;  2ION A;  2Z15 A;  4B93 B;  3I3N A;  5JLI A;  2P1A A;  4A55 A;  1EI7 A;  4MRU A;  2XM4 A;  4I1O B;  1BU9 A;  1XWJ A;  3HXC A;  4IGG A;  2EPN A;  3H2V A;  2CGE A;  2XL4 A;  4MBG A;  3Q75 A;  1OW6 A;  4Q7C A;  3FUH A;  3V79 K;  3ABM C;  5BW8 C;  3VLD A;  2DYS E;  3TXN A;  4PJM A;  3LKU A;  2UUH A;  1MZC A;  2R05 A;  1TNZ A;  3LY8 A;  2FBN A;  1HO8 A;  2RKK A;  3AQC A;  5LX8 A;  5AC5 A;  2R17 C;  3GW4 A;  3B7B A;  3FAJ A;  2V3C C;  3ENE A;  1S63 A;  4IRU A;  3M15 A;  4GB9 A;  4NQ0 A;  4HLE A;  2G3K A;  2EIM E;  4K5A B;  1AEP A;  3JYH A;  3SFY A;  3MZL B;  4FLB A;  3VAY A;  4NAC A;  2RFA A;  4DPR A;  4RQI A;  3DSU A;  5HI7 A;  3FOO A;  5JVE A;  3Q79 A;  1OCZ E;  1VDY A;  3FUD A;  3LLK A;  4F1P A;  3D3M A;  3HVE A;  1W2W A;  3T6B A;  2R7O A;  5T3T A;  3HXD A;  1IQU A;  4JRZ A;  1FAP B;  4JUR I;  4AL1 A;  4K5C A;  5EX0 A;  4OIP F;  3UTM A;  5AAO A;  3DM9 B;  4CS9 C;  5ANR A;  2YLI A;  3B29 A;  4PDX A;  2R7X A;  2J9Q A;  2OEX A;  5CIV A;  3ULE G;  2YL3 A;  3W8H A;  5L0I A;  2HUJ A;  2P9P G;  3B7R L;  1PD0 A;  2LIG A;  3X1O A;  3C8G A;  4U5G A;  4AY5 A;  3GZS A;  1N9A A;  4CBE A;  3ULQ A;  2NYJ A;  2YLD A;  3AG2 C;  4WAB A;  3S0X A;  3KMI A;  2LK4 A;  2G62 A;  3PUJ A;  2FI7 A;  3OXG A;  2J09 A;  1I5N A;  4G26 A;  4JZA A;  3DKA A;  4ACK A;  3QK0 A;  4CT0 A;  3PZ1 A;  1S70 B;  5L3Q A;  4M3O A;  4NC3 A;  5L0G A;  4URK A;  2GRO B;  5B3S E;  2OQM A;  3W9F A;  5ANL A;  5EIL A;  2EIJ E;  3GWL A;  4NQF A;  4A1G A;  3LYA A;  3UUX A;  4JEU A;  4GA1 A;  1SQM A;  3UGP A;  2MHR A;  3UT4 A;  4YK5 A;  3LVR E;  1ZHY A;  3K1I A;  2WM9 A;  3AU4 A;  5FIN A;  4U96 D;  1JR8 A;  1OQC A;  2KXP C;  5CMY A;  1N4R A;  3CHM A;  4XX5 A;  3FVY A;  1E85 A;  4Z9I A;  3HNI A;  2VGE A;  3FEX A;  1OXK A;  2XHE A;  4DK5 A;  1E83 A;  4U5F E;  4D4X A;  2J08 A;  2V4L A;  5L0H A;  3D9L A;  4F6R D;  4XEK A;  4N3B A;  4OYS A;  4UUC A;  4D10 C;  3LEO A;  4E7Z A;  3A11 A;  1E8X A;  3L6A A;  5T3R A;  2L6J A;  3O48 A;  1XGW A;  1YVI A;  1ZHZ A;  3Q47 B;  2A4Z A;  4PS8 A;  4E18 A;  3EGD B;  3Q49 B;  4JPS A;  4FJY A;  2KC7 A;  3MA5 A;  1FFT C;  3NB2 A;  3AG4 C;  2XLM A;  3ZYL A;  2LQG A;  1JAF A;  2OV8 A;  2L0T B;  1QPU A;  2P7V A;  1V55 E;  2V4H C;  1AP7 A;  5FT9 A;  1QQ3 A;  4BJT A;  3B7S A;  1IYG A;  4HFF B;  3OTN A;  3MV2 B;  3DXK G;  3DRA A;  4GTV A;  1HX8 A;  1TNU A;  2BED A;  2PP4 A;  1WDY A;  2XL6 A;  2NUT A;  4C9B B;  2LAH A;  2XLV A;  2V0P A;  4X0R A;  5FQ4 A;  2A69 F;  5KCM A;  1D0X A;  2R7Q A;  3ML8 A;  1OKK A;  3TG5 A;  1TN7 A;  3OA1 A;  3ZXP A;  4FX5 A;  1H6K A;  4MTF A;  1O1S A;  4O6Y A;  3K7D A;  1U3D A;  4CDR A;  4CS9 A;  4GYW A;  5CRU A;  4Y6W A;  1NZN A;  2PBE A;  5AEN A;  4EZJ A;  2IOQ A;  4HOR A;  5GPG B;  2C0L A;  3ZHE A;  1SZA A;  3UM3 A;  1SF8 A;  3ASG A;  4QDL A;  2A5E A;  2OCC E;  4AOF A;  2XLO A;  4L6R A;  1WG0 A;  4P29 A;  4GTT A;  2R02 A;  3EFO B;  3Q7F A;  3US6 A;  2R5S A;  3HTK C;  1Y6I A;  2HMZ A;  2HJM A;  4LLC A;  1ELK A;  2ETA A;  2OND A;  4WWP A;  2H6H A;  3ZPJ A;  3ABL E;  5JJ7 A;  3DI5 A;  5F5F A;  3DXM G;  3CVN A;  3DSX A;  2EIK C;  3D9N A;  1G4U S;  3SYN A;  4DJ9 A;  5CEC B;  2HR2 A;  2CHW A;  5B1A E;  3T9K A;  3EDT B;  3EHM A;  4GA2 A;  3CGH A;  1YA9 A;  3ASO C;  3S84 A;  1A5E A;  4HI8 A;  2X6J A;  1J8Y F;  2AVK A;  2LUH A;  3EIQ C;  4YDO A;  4ANU A;  1VYI A;  3ITF A;  3BU8 A;  1N4P A;  3NRH A;  4ANV A;  5BXU A;  3BEH A;  1EQ1 A;  1OR3 A;  2WXI A;  1JMW A;  4Q69 A;  1TR4 A;  1S0P A;  3ASN E;  4TXP A;  2XS1 A;  4BY6 A;  3PRZ A;  4K03 A;  2OVF A;  2R2L A;  1OWM A;  4YDY A;  3R7R A;  3SFZ A;  3CV0 A;  2X3M A;  1VK5 A;  4GZD A;  4BX9 A;  4C3B A;  1P5Q A;  1JOG A;  2NC9 A;  2EIN E;  1YZA A;  4BFR A;  4JD2 G;  4GCN A;  2WL8 A;  1QVX A;  1DOV A;  1FCH A;  1JPL A;  3RQE A;  1VYK A;  3ABM E;  3DAG A;  3V5X A;  2IY0 C;  4MTO A;  3T4R A;  3FUN A;  3U4T A;  2CNW A;  4GU5 A;  1K3Z D;  1TKN A;  4U5B E;  4CSA A;  4DLQ A;  2DYS C;  2VAS A;  2V8S E;  3I4R B;  1OT8 A;  4FC8 A;  3MBG A;  4AEZ C;  5ENT D;  2J8W A;  1YMP A;  5JS5 A;  3E70 C;  4ME2 A;  4JJG A;  5BNW A;  2KSF A;  3S27 A;  3NKD A;  4DX7 D;  3GAN A;  3H65 A;  3JYS A;  5A7D B;  3CHO A;  3X2Q C;  2KCL A;  2DI3 A;  2LFF A;  4JTA B;  3Q7G A;  3LVQ E;  3ZN3 A;  4J8F A;  5CRV A;  4O79 A;  4E0I A;  2CCY A;  3NKE A;  3ZYK A;  2QC9 A;  1S64 A;  2X6H A;  1ZZP A;  5AJD A;  3UNG C;  3ZQY A;  1ORS C;  2J49 A;  3PRE A;  2EIM C;  3HVE B;  1JCQ A;  4O1O A;  2XCC A;  2J7P D;  1V74 B;  3DSV A;  3NG1 A;  5E2Q A;  1OCZ C;  4I2W A;  1JPJ A;  1U3C A;  2KW3 C;  2F22 A;  2HSQ A;  5BUZ A;  3FP3 A;  4LDK A;  1SA5 A;  3DMD A;  3O39 A;  3JSZ A;  2L6F A;  1OCO E;  2Y3A A;  1K1A A;  3U3B A;  3Q7A A;  3C8Z A;  4H7X A;  1A7D A;  1HW1 A;  3K1H A;  4E85 A;  4PJL A;  4F3V A;  2XQ0 A;  2DZO A;  4HB5 A;  4UQZ A;  5ARF A;  4YJW A;  4I2Z A;  3NZU A;  2P61 A;  2DCP A;  4NTA A;  3J06 A;  3CVL A;  3FDQ A;  2CG3 A;  3AG1 E;  4KNW A;  4UDV A;  1ZW3 A;  2P9N G;  3QAQ A;  1E7U A;  2YIN A;  4FU3 A;  2DGJ A;  3NOG D;  3S7J A;  5FQ8 A;  3APF A;  4J8Y A;  2E87 A;  1YDI A;  4IWB A;  5E33 A;  4FAP B;  3DWL G;  4IAR A;  2ZXW E;  3ZUV B;  1Q0D A;  1QBQ A;  1TJC A;  2EPK X;  3BQO A;  4C3E A;  3V31 A;  3AOU A;  1NLX A;  3GEI A;  4CS8 C;  1YLM A;  4HOU A;  3ZNG A;  2F8Y A;  4CGV A;  5B3S C;  1KLX A;  5LFA A;  5FQ7 A;  2EIJ C;  1EPU A;  1TNO A;  1UG3 A;  1TN6 A;  4CZ2 D;  3ULY A;  3U0C A;  1BBH A;  4L9P A;  5CBN A;  4H7Y A;  1SR2 A;  5HV9 A;  3WAQ A;  3WHN A;  3TOM A;  4J8S A;  4APO A;  4QI2 A;  1LM3 B;  4WUY A;  4BT8 A;  2J0W A;  4P6I C;  1TFK B;  4JA9 A;  4ULW A;  1FT1 A;  3LS0 A;  3OWT A;  2OEV A;  4MND A;  3JRT A;  3L22 A;  2YL7 A;  2HSB A;  1UJJ A;  4GZ5 A;  5G05 C;  4DX6 D;  1TEZ A;  3EG9 A;  2L9B A;  3K66 A;  3AGT A;  1C03 A;  3VRC A;  2IXO A;  2X6F A;  3ZG1 A;  2ZXO A;  2I15 A;  1MQV A;  1K05 A;  4NTF A;  2IOS A;  4HI9 A;  4GMR A;  1DC2 A;  1Y4C A;  2QE9 A;  2FAP B;  2ZIS A;  3VYW A;  3R9A B;  2YRF A;  1HZ4 A;  3J5P A;  3JUI A;  4U7E B;  3TG4 A;  4AIF A;  4AV7 A;  3JTL O;  3RF3 A;  1FPP A;  2AWI A;  1VB5 A;  1BR4 A;  3TJP A;  2J9V A;  3PEV B;  2GRR B;  4GYO A;  5L3V A;  4YN0 B;  2DYR E;  2Q9C A;  4E7S A;  3LPZ A;  1V55 C;  1UN9 A;  2YWA A;  2NUT B;  2ZGD A;  1A7E A;  1E7V A;  4ONS A;  2PQR A;  3DST A;  5ARG A;  2LXL A;  2L6G A;  2CG2 A;  1WAT A;  4F1S A;  2NXP A;  5BQI A;  2J9W A;  3S7F A;  5CHE E;  1H2V C;  4EUK B;  1U2V G;  2QNL A;  4ER9 A;  4L2Y A;  4LEU A;  5D0Q D;  1D8D A;  3FY4 A;  2I6H A;  4JCZ A;  3U3W A;  3DBS A;  1OR2 A;  1U0B B;  1Z23 A;  4YVQ C;  4DVY P;  3ZHE B;  5G2N A;  4BER A;  3G2U A;  3B9Q A;  4O7G A;  3V2X A;  4HOS A;  2HKV A;  3FOP A;  4DI4 A;  4ZLC A;  4NY3 A;  4PK4 A;  3D9P A;  5EID A;  3CVV A;  2XRY A;  4CS7 A;  1LI7 A;  2M63 A;  1WY6 A;  4MVU A;  1HU3 A;  3QMK A;  3QNK A;  4GQH A;  4CX9 A;  3RO2 A;  1UOH A;  2QYU A;  2O9X A;  5G55 A;  2MWQ A;  2I1J A;  3I5P A;  2ZU6 B;  2WVQ A;  2CFZ A;  2OCC C;  3EUV A;  1OCC E;  4JTD B;  4Q96 A;  3SBS A;  3P2B A;  3NQP A;  4WNF A;  3CKB A;  1OUV A;  1IQR A;  3PEU B;  3RRN B;  1GS9 A;  4BJ1 A;  4CYM D;  4M7C A;  4CS8 A;  4I1A A;  1A41 A;  2IFU A;  3ABL C;  4U04 A;  1H6G A;  4MLP A;  4QQI A;  3JCK C;  4AP2 A;  2X51 A;  2MHK A;  1N54 A;  4YL3 A;  3E37 A;  4B6I A;  5JUA A;  1YJG A;  5KYX A;  1T6Q A;  5B1A C;  3ZWI A;  2H6G A;  5L0D A;  1Z5Z A;  1MX6 A;  3ONL A;  1N52 A;  1OWN A;  4YDE A;  4E6H A;  4GYT A;  3FUK A;  1U6H A;  1E90 A;  2WXJ A;  2J0X A;  2PNO A;  4F4B A;  1Z5S C;  1NBB A;  3CVU A;  1OW8 A;  2YQ8 A;  1AUE A;  3AGU A;  2QYJ A;  3ESL A;  4PS3 A;  1F1M A;  5DS4 A;  3VTY A;  3SZR A;  3PNT B;  256B A;  3TWW A;  3ASN C;  1H7I A;  5AGF A;  4G8L A;  3U3F A;  4OAV B;  1FR0 A;  1MMN A;  1MND A;  3IPM O;  4U5E E;  3S2A A;  5FCL A;  4XZ4 A;  2ZD9 A;  2Y3H A;  3QZC A;  1N4Q A;  5CER B;  3FTZ A;  4CDM A;  3DEO A;  1E2X A;  3W4Y A;  2E0I A;  3EU9 A;  3KYJ A;  1HS6 A;  3FTU A;  2EIN C;  4EEC A;  2G3V A;  4L2L A;  2WB2 A;  2I2O A;  3BUA A;  1OY3 D;  4GEH A;  2DB4 A;  4HRN A;  2X6I A;  2PZI A;  3L34 A;  3IQ5 A;  2EQX A;  4RG6 A;  4C3D A;  3QAR A;  2PM7 A;  3ZTZ A;  1PCX A;  4KNV A;  4CJO A;  1O1T A;  2DZN A;  1V54 E;  1T9K A;  3OXL A;  3L8J A;  1H9G A;  4UWF A;  5A23 A;  2RD9 A;  2QFC A;  4AM9 A;  1G3N B;  1DNP A;  1BZ4 A;  2KBX A;  3NZS A;  5G04 J;  3TWS A;  5CED B;  4UWG A;  2W4M A;  3LNR A;  3SP1 A;  3Q9N C;  2TMV P;  2WMO A;  2KAT A;  3TWU A;  3X2Q E;  5A6B D;  5FIO A;  4WNE A;  2R7W A;  1NFO A;  5EX3 A;  3UGO A;  2Y1L E;  5KJL A;  4JEB A;  4DRH B;  3CSK A;  2VJ8 A;  4BJ6 C;  1BLX B;  4BWR A;  2ZGG A;  1Q0M A;  2IXP A;  2NPU A;  3C63 A;  4P9F A;  4OIO F;  1H2U A;  3UXG A;  4QI0 A;  5FZS A;  4R32 A;  4K1O A;  3LDZ A;  5D91 A;  4ATZ D;  2H6I A;  3C98 A;  3MLG A;  1M56 C;  3HJC A;  3IHU A;  5DQZ A;  4OIQ F;  4AJW A;  3RH3 A;  1OCO C;  1S7Z A;  3IV0 A;  4BX8 A;  5AQA A;  4CJG A;  5K0I A;  4W8K A;  1KT1 A;  3HIZ A;  2FO7 A;  2MYO A;  4RSY A;  3NMK A;  4U07 A;  3IQT A;  1LKX A;  4JHR A;  5BPP A;  3NYM A;  5FWQ A;  3TAX A;  4GTO A;  4EBB A;  4DOZ A;  1X81 A;  5E3C A;  1QZ2 A;  2BUG A;  2A6E F;  3AG1 C;  1UG7 A;  3PCV A;  1RJ9 A;  4G8K A;  4N6C A;  3W9G A;  4OVU A;  2OU6 A;  2Y69 E; 
#chains in the Genus database with same CATH homology
 5E3A A;  1A17 A;  4KBL A;  3CK8 A;  3CQC B;  2ZXW C;  3ZEF A;  3CVX A;  3EGX A;  4WWO A;  2WB7 A;  4BT9 A;  2AXV A;  3L13 A;  4K7B A;  3CHS A;  1QLE C;  4RG9 A;  1W3B A;  4GML A;  1TR2 A;  2PL2 A;  1VMA A;  1BR1 A;  4BTA A;  5LOZ A;  5BT1 A;  3EG9 B;  4RD9 A;  1ZBP A;  4K0R A;  4HE8 D;  3K33 A;  3S7D A;  5JHA A;  3UT8 A;  2GRM A;  3FU3 A;  2HYZ A;  4ATG A;  3U66 A;  3JCU Q;  4YND A;  3I5Q A;  2PQN A;  4HXI A;  3AS8 A;  3KAE A;  3CVW A;  3L16 A;  5T4Y A;  4AK9 A;  2A5U A;  3W2V A;  2Q9B A;  4AX2 A;  4KYO B;  2YNQ A;  4XKC A;  4BEJ A;  4XE0 A;  2DYR C;  4GCO A;  3N2Z B;  4YT5 A;  3FU6 A;  1ELW A;  1NA3 A;  4ILH B;  1OWP A;  2GRL A;  2X6K A;  4TRQ A;  3AS4 A;  1LS1 A;  4A2N B;  5LCW J;  3SNX A;  3BG1 B;  3RYL A;  2NUP A;  4WND A;  3I4U A;  4U63 A;  2PX3 A;  3NDB B;  3FTW A;  3D9J A;  4J32 B;  1FFH A;  3LY9 A;  1ZHT A;  3EZH A;  3O4Z A;  3WOD F;  1MMA A;  1OCC C;  4EQF A;  3T6J A;  5F5H A;  4FES A;  4DI3 A;  2R7S A;  3ZYQ A;  2A1D D;  5KYX B;  4KXK B;  2J4D A;  1QQE A;  4K0D A;  4FAD A;  1JWF A;  5HSW A;  2KJG A;  4NUR A;  3Q4A B;  4M63 A;  4N5C A;  3PS6 A;  3LS8 A;  3JT1 A;  3U9W A;  2WXN A;  2LSU A;  1E8Z A;  1O5H A;  4GA0 A;  2KQ9 A;  4GZC A;  4B94 A;  2J7P A;  3FTS A;  5EKQ D;  4JEH A;  3LLI A;  2J45 A;  2VGX A;  4MKT A;  3PE4 A;  5JJT A;  3CHQ A;  1DVP A;  1D1B A;  2FEZ A;  1Z6A A;  3AU5 A;  3ZSU A;  2J07 A;  3MEK A;  1NG1 A;  2XXA A;  3HDX A;  4MS6 A;  2J9U A;  3Q7L A;  4HFK B;  3RKO F;  1TWC A;  1GW6 A;  2XRZ A;  3ZYM A;  3ASD A;  3URZ A;  3S29 A;  4U0S A;  2WXG A;  5C2Y A;  4L7T A;  1HH8 A;  2CHX A;  3UX4 A;  2UY1 A;  1V54 C;  4DBR A;  3CEQ A;  4UWL A;  4UQY A;  4JW1 A;  3QB2 A;  4BJ5 C;  3DXJ F;  3PH0 C;  3CR3 A;  2XGS A;  1HG5 A;  4CIH A;  4I43 A;  3Q15 A;  3FFL A;  4F53 A;  2CFU A;  4FJZ A;  3CHP A;  2HV7 A;  5E75 A;  3RK6 A;  3SGH A;  1IW7 F;  2IYL D;  2H7V C;  4C7O A;  4KI2 A;  2C2L A;  4HVB A;  3DJU B;  1WAO 1;  3VTX A;  2C04 A;  4N2Q A;  2WZG A;  1SMY F;  4J6I A;  1NZE A;  3EZI A;  3CQZ A;  3KS2 A;  5DBK A;  2Y3G A;  2NSZ A;  4UI9 K;  4JL0 A;  1BR2 A;  1MMD A;  2R59 A;  1RJ9 B;  2WPV A;  4WWN A;  3EGX B;  4JCH A;  4EBA G;  2Y69 C;  2M4E A;  4ILI A;  3ECS A;  2IU1 A;  3ZVR A;  3HYM B;  4FP7 A;  4ABN A;  3EIJ A;  4A1S A;  3FDH A;  3PE3 A;  3KEZ A;  3CK9 A;  3LXU X;  4TV3 A;  2L9J A;  2HO1 A;  4A3V A;  4I1M A;  2XGM A;  3CKC A;  4Q94 A;  2WZF A;  4I6J A;  2BTD A;  3B0V C;  1L5J A;  5FQ6 A;  1X5B A;  5CI9 A;  3FWV A;  2LSE A;  4GMJ A;  3Q5M A;  2KZT A;  1WGW A;  5KYW A;  2WMN A;  3KD7 A;  2VSO E;  1INZ A;  4FHK A;  3APD A;  4DLO A;  3MKR A;  3ASF A;  2YHS A;  3P1U A;  2XPI A;  2XEV A;  4ANW A;  2WXH A;  4PS7 A;  3W2W A;  2HV6 A;  3POV A;  3CIA A;  3FU5 A;  5LP0 A;  3GZ1 A;  3GOD A;  4JA7 A;  4B8A A;  4G11 A;  2D5R B;  3T8M A;  3EH2 A;  1SZ9 A;  3SBT B;  4CDN A;  2AW6 A;  2RG8 A;  4GYY A;  4J8D A;  2WVI A;  3DJN B;  2VSX E;  1OCR C;  2KGO A;  3ONK A;  1NU7 D;  2NUP B;  3FTV A;  4EPZ A;  1M57 C;  5HQ8 A;  3RFY A;  1OWL A;  1LVK A;  2W4B A;  4V3I A;  3T5V A;  4XWJ A;  2W45 A;  4B8C B;  2BF0 X;  2OOE A;  1UN8 A;  4J30 B;  3ZXS A;  3NYL A;  3GYZ A;  4UI9 C;  3JQ0 A;  3CSF A;  3LJB A;  1ZYR F;  4ACL A;  2WXK A;  2V5F A;  1FVH A;  2WXO A;  1M2O A;  4IUL A;  2WXL A;  4WAF A;  1NP7 A;  4IN3 B;  4G7H F;  4ANX A;  2VTB A;  2VGY A;  2WZL A;  5M72 A;  2WQ7 A;  4LRZ A;  2MOW A;  2H7B A;  4GZ6 A;  3CVP A;  3ZC4 A;  4NRH B;  4UWK A;  3DD7 A;  1FMV A;  4HEA J;  4IJJ A;  4G2V A;  2WVN A;  4FLH A;  2PF4 E;  4Q5S F;  3UT7 A;  4APF A;  3ZFW A;  2JD3 A;  4U5H A;  5EHH A;  3D9K A;  3MKQ A;  5DS6 A;  2VGX B;  4JHJ A;  1VOM A;  4LAC B;  3LEV A;  3SF4 A;  1MHQ A;  3KH2 A;  4U8H A;  3PMR A;  4DBQ A;  4XTK A;  3VLF A;  1Y8M A;  3QJZ A;  2ILR A;  2Q7F A;  2XXA B;  3SHF A;  2YZS A;  1KT0 A;  1ZU2 A;  5A6C A;  3K1I C;  3ESK A;  4F7A A;  2XPZ A;  3HLZ A;  2E2E A;  4OD4 A;  5CI8 A;  1BPO A;  4XI9 A;  2JEK A;  3D9O A;  3EQL F;  1M2V A;  2Y3D A;  2UY1 B;  4IAO A;  4PJN A;  2RD0 A;  3E4B A;  1EDU A;  4XIF A;  5G04 C;  1PC2 A;  2DBA A;  4ANJ A;  4A3T A;  3FTX A;  3CQG B;  4GPK A;  1D1C A;  3KKB A;  4CT4 A;  4L23 A;  4C7O B;  4AY6 A;  4EBA A;  4J0U A;  3NF1 A;  4OIN F;  3IBE A;  3LJ3 A;  3DAF A;  4AVX A;  4J8E A;  5KYY A;  4L1B A;  4QFV A;  2IF4 A;  2WXF A;  4XLN F;  3CZ6 A;  4Q4Z F;  3I4G A;  2YEV A;  4KT6 B;  3MX3 A;  3MYV A;  2Y4U A;  4KMO A;  4BSX A;  3SZ7 A;  2QY7 A;  2LSV A;  3B0P A;  4B0Z A;  5KJK A;  4LUN U;  4HOT A;  3MGB A;  4C0E A;  2VSN A;  2KCV A;  4CCA A;  3KL4 A;  3D9M A;  2OG2 A;  3T5X A;  3E9V A;  4JVS A;  2Y39 A;  3G2V A;  5FZR A;  3VLE A;  5IY5 C;  5DQT A;  3B7U X;  4OD5 A;  2WXP A;  3MJW A;  3N71 A;  4KZ0 A;  3G2T A;  4WNG A;  3ZIM A;  1XNF A;  1QZX A;  4ILG A;  3MV3 B;  3FH8 A;  2V26 A;  4PUC A;  2KZT B;  3O6X A;  5KYW B;  2P6V A;  3BEE A;  1J8M F;  3Q6M A;  2B0J A;  2YHE A;  3PZD A;  4GZ3 A;  4UWH A;  2GW1 A;  3UQ3 A;  2C0M A;  4YWQ A;  1UJK A;  5EDS A;  2XCB A;  3EH1 A;  4G24 A;  4XKB A;  2I8B A;  3UMV A;  2XRH A;  1B89 A;  1E96 B;  3G2W A;  1PY1 A;  1ST6 A;  2ZPA A;  3IEE A;  2R7R A;  3QWV A;  1NU9 C;  2AVP A;  1D0Z A;  1EYH A;  4FHJ A;  4BTB A;  3ZW3 A;  5E76 A;  3N24 A;  3SD5 A;  1WM5 A;  4G1T A;  4C0M A;  5J90 A;  3BG0 B;  4BJ6 A;  4KC9 A;  4I6E A;  2VYI A;  5C1D A;  4N06 A;  4JC8 A;  3FUM A;  1FTS A;  2CHZ A;  1TJF A;  5LCW C;  4PJJ A;  1FVF A;  1N1C A;  5KYU A;  2WXR A;  2WQH A;  2R7U A;  4BG0 A;  3G2S A;  4CSA C;  5CMW A;  2W9Y A;  2L0I A;  3IHV A;  3U64 A;  2LO6 A;  3QWP A;  3LY7 A;  2MYS A;  3SNH A;  1EF1 C;  4N39 A;  4I3M A;  4I9E A;  1E8W A;  2H7O A;  3IHY A;  1Z3X A;  4WJ0 A;  2VTB B;  2HM8 A;  4U0Z A;  2XGO A;  2IXN A;  4PFP A;  2J46 A;  3GZ2 A;  4N3A A;  3QOU A;  4IYP A;  3EPV A;  4LCT A;  4YT2 A;  2OVB A;  4RVB A;  2WXM A;  3RRM B;  1TWH A;  1E8Y A;  4YT8 A;  4DVZ A;  3FUJ A;  2VH3 A;  4G25 A;  2R7V A;  5JJ6 A;  1ZHW A;  5BV1 A;  1ZU4 A;  4KVM A;  3QWW A;  3UMI A;  3MKQ B;  4TUU A;  1FMW A;  1MQS A;  5AJL A;  2VQ2 A;  4HOQ A;  4I44 A;  3D9I A;  3TXM A;  4AXH A;  2A6H F;  5CCM A;  1TWG A;  3LCA A;  5CCL A;  3K9I A;  4AE4 A;  2I9C A;  5EGY A;  3TD7 A;  4YT4 A;  3DZA A;  4Y6C A;  5DLJ A;  4G7Z F;  4XLP F;  1OKK D;  4O6M A;  3NYJ A;  2QY9 A;  4G7O F;  3S28 A;  1MMG A;  4CEM A;  2IJG X;  3IEG A;  1M2V B;  5FTP A;  2FFH A;  1HE8 A;  3FH5 A;  3OEO A;  5DS5 A;  1NA0 A;  4FUL A;  2IQC A;  4KBQ A;  1Z63 A;  3LAY A;  3RIB A;  5FZQ A;  5KYN A;  3QC1 A;  2Q9A A;  2FUL A;  4LLE A;  2VSY A;  4B89 A;  5DVW A;  3F46 A;  4FA6 A;  1H2T C;  2GGF A;  4JJF A;  3APC A;  4EZL A;  5BV0 A;  4O6F A;  3QKY A;  3WXX A;  5KYY B;  2LAI A;  3WG7 C;  2IOL A;  1Z6T A;  1LF8 A;  4YVO A;  1MNE A;  3S7B A;  3EHN A;  3RO3 A;  3B7T A;  3RKV A;  1G8X A;  1JUQ A;  4U0U A;  3OAW A;  1JWG A;  2IXM A;  4RDA A;  4HS2 A;  4OVV A;  4JXT A;  2YHC A;  4I9C A;  4R7L A;  4CRW A;  3FH7 A;  4XI0 A;  4MQ9 F;  2PX0 A;  4N3C A;  3K6B A;  1UW4 B;  3PDN A;  2LNI A;  1HXI A;  3AS5 A;  3N0T A;  5AIJ A;  2C03 A;  3UMH A;  3R7Q A;  2AXU A;  2NG1 A;  5T3W A;  2WXQ A;  1H19 A;  2CNW D;  3RIP A;  4KZC A;  3UMK A;  3CVY A;  4JHK A;  1D0Y A;  1ZHX A;  2QTV A;  3DM5 A;  3FTY A;  3SEO A;  4OIR F;  4U5D E;  1O87 A;  1JPN A;  3EJN A;  3PUK A;  5B1B C;  4DJA A;  2X38 A;  3FHD A;  3B0U X;  1HF8 A;  2XPY A;  2PFD A;  3FEY A;  3FU0 A;  3ZVV A;  4H4K C;  4EZK A;  5G05 J;  3DPD A;  4I6G A;  3ZIB A;  4BJ5 A;  2KNH A;  3JQ1 A;  4GAA A;  3SI5 A;  3ZRH A;  3W8I A;  3TGO A;  5DIZ A;  4FWV A;  4CGW A;  5D0O D;  2R7T A;  4N2S A;  2J4B A;  3L0I A;  3EGD A;  5KYU B;  3RJV A;  4O6N A;  2ZXR A;  3UPV A;  5T8I A;  1H0A A;  3MCX A;  3B13 A;  2WQ6 A;  3FUF A;  3UR3 C;  4KVO A;  5KJN A;  3FUE A;  4LER A;  2A68 F;  1Z3I X;  3PHF 2;  1SZI A;  3L08 A;  1KU2 A;  1PD1 A;  3V7O A;  5AYW D;  4HFG A;  3PNL B;  3OXF A;  5D92 A;  3F47 A;  3ASH A;  3RRU A;  2AXZ A;  2BE5 F;  1D1A A;  5KJM A;  3CK7 A;  4UQX A;  1IZM A;  1ELR A;  5ENN A;  2UWJ G;  2ZXP A;  3M1C B;  4UI9 J;  2Q3T A;  4G0H A;  5BUO A;  1Z3Y A;  2PM6 A;  1PAQ A;  1HFA A;  2Y3B A;  3FHE A;  3EFO A;  5J08 A;  2VB6 A;  1YA0 A;  3L17 A;  5T1D B;  2CDQ A;  2FF4 A;  4JZY A;  3ZGQ A;  4EWC A;  3QDN A;  3LS1 A;  3CST A;  2GFH A;  4AE4 B;  3RU0 A;  2EIL C;  4W9R A;  3L54 A;  4PFO A;  2XSE A;  3ABK C;  1OWO A;  4I17 A;  2KCK A;  3HHM A;  2I1K A;  4PH4 B;  4G23 A;  5FJY A;  3LES A;  3AG3 C;  3FUI A;  3CHR A;  3IKO B;  1ZU5 A;  2JLB A;  2L81 A;  1IHG A;  3LEW A;  1HG2 A;  1QNF A;  2Y4T A;  5JHB A;  2DIW A;  3CLJ A;  2WVO A;  2MRI A;  2P58 C;  2FGY A;  3ML9 A;  3FUL A;  1TWA A;  3AQB A;  4U5C E;  3TL5 A;  4ZLD A;  2KM4 A;  3Q6N A;  4RBN A;  2CW0 F;  3PVL A;  2ION A;  2Z15 A;  3I3N A;  4A55 A;  4MRU A;  4I1O B;  2CGE A;  2XL4 A;  4Q7C A;  3FUH A;  3ABM C;  5BW8 C;  3VLD A;  3TXN A;  4PJM A;  3LKU A;  3LY8 A;  2FBN A;  1HO8 A;  3AQC A;  5LX8 A;  2R17 C;  3GW4 A;  3FAJ A;  2V3C C;  3ENE A;  4IRU A;  4GB9 A;  4NQ0 A;  4HLE A;  2G3K A;  3JYH A;  3MZL B;  4FLB A;  3VAY A;  4NAC A;  4DPR A;  5HI7 A;  1VDY A;  3FUD A;  3LLK A;  3D3M A;  3HVE A;  1W2W A;  3T6B A;  2R7O A;  5T3T A;  1IQU A;  4JUR I;  5EX0 A;  4OIP F;  3DM9 B;  4CS9 C;  5ANR A;  4PDX A;  2R7X A;  2J9Q A;  3W8H A;  3B7R L;  1PD0 A;  3X1O A;  4U5G A;  4AY5 A;  3GZS A;  4CBE A;  3ULQ A;  3AG2 C;  3S0X A;  3KMI A;  2G62 A;  3PUJ A;  2FI7 A;  3OXG A;  2J09 A;  4G26 A;  4JZA A;  4ACK A;  3QK0 A;  4CT0 A;  5L3Q A;  4M3O A;  4URK A;  5ANL A;  4A1G A;  3LYA A;  3UUX A;  4JEU A;  4GA1 A;  1SQM A;  3UGP A;  3UT4 A;  3LVR E;  1ZHY A;  2WM9 A;  3AU4 A;  5CMY A;  3CHM A;  4XX5 A;  3FVY A;  3FEX A;  2XHE A;  4DK5 A;  4U5F E;  2J08 A;  2V4L A;  3D9L A;  4N3B A;  4OYS A;  4D10 C;  4E7Z A;  1E8X A;  3L6A A;  5T3R A;  2L6J A;  3O48 A;  1XGW A;  1ZHZ A;  3Q47 B;  2A4Z A;  4PS8 A;  3EGD B;  3Q49 B;  4JPS A;  4FJY A;  2KC7 A;  3MA5 A;  1FFT C;  3AG4 C;  3ZYL A;  2OV8 A;  2L0T B;  2P7V A;  5FT9 A;  4BJT A;  3B7S A;  1IYG A;  4HFF B;  3OTN A;  3MV2 B;  1HX8 A;  2PP4 A;  2NUT A;  4C9B B;  2LAH A;  2V0P A;  4X0R A;  5FQ4 A;  2A69 F;  5KCM A;  1D0X A;  2R7Q A;  3ML8 A;  1OKK A;  3TG5 A;  3OA1 A;  4FX5 A;  1H6K A;  4O6Y A;  3K7D A;  1U3D A;  4CDR A;  4CS9 A;  4GYW A;  4Y6W A;  1NZN A;  5AEN A;  4EZJ A;  2IOQ A;  4HOR A;  2C0L A;  3ZHE A;  1SZA A;  1SF8 A;  3ASG A;  4QDL A;  4AOF A;  4P29 A;  3EFO B;  2R5S A;  3HTK C;  1Y6I A;  4LLC A;  1ELK A;  2OND A;  4WWP A;  3ZPJ A;  5JJ7 A;  5F5F A;  3CVN A;  2EIK C;  3D9N A;  3SYN A;  2HR2 A;  2CHW A;  3EDT B;  3EHM A;  4GA2 A;  3CGH A;  3ASO C;  2X6J A;  1J8Y F;  3EIQ C;  4ANU A;  1VYI A;  3ITF A;  3NRH A;  4ANV A;  2WXI A;  4Q69 A;  1S0P A;  4BY6 A;  3PRZ A;  4K03 A;  2OVF A;  1OWM A;  3R7R A;  3SFZ A;  3CV0 A;  2X3M A;  1VK5 A;  4GZD A;  4BX9 A;  4C3B A;  1P5Q A;  2NC9 A;  4BFR A;  4GCN A;  2WL8 A;  1FCH A;  1JPL A;  1VYK A;  3DAG A;  3FUN A;  3T4R A;  3U4T A;  2CNW A;  4GU5 A;  1TKN A;  4U5B E;  4CSA A;  4DLQ A;  2DYS C;  2VAS A;  2V8S E;  3I4R B;  4FC8 A;  4AEZ C;  3E70 C;  4ME2 A;  4JJG A;  5BNW A;  3S27 A;  3NKD A;  3GAN A;  3H65 A;  3JYS A;  5A7D B;  3CHO A;  3X2Q C;  2KCL A;  3Q7G A;  3LVQ E;  3ZN3 A;  4J8F A;  4O79 A;  3NKE A;  3ZYK A;  2X6H A;  5AJD A;  3UNG C;  3PRE A;  2J49 A;  2EIM C;  3HVE B;  2XCC A;  2J7P D;  3NG1 A;  5E2Q A;  1OCZ C;  4I2W A;  1JPJ A;  1U3C A;  2KW3 C;  5BUZ A;  3FP3 A;  3DMD A;  3O39 A;  3JSZ A;  2Y3A A;  4H7X A;  3K1H A;  4E85 A;  4PJL A;  4F3V A;  2XQ0 A;  4UQZ A;  5ARF A;  4YJW A;  4I2Z A;  3NZU A;  2DCP A;  3CVL A;  3FDQ A;  2CG3 A;  4KNW A;  3QAQ A;  1E7U A;  2YIN A;  4FU3 A;  2DGJ A;  3S7J A;  5FQ8 A;  3APF A;  2E87 A;  4IWB A;  5E33 A;  1TJC A;  4C3E A;  4CS8 C;  4HOU A;  4CGV A;  5B3S C;  1KLX A;  5LFA A;  5FQ7 A;  2EIJ C;  1EPU A;  1UG3 A;  4H7Y A;  4J8S A;  4APO A;  4QI2 A;  4WUY A;  4BT8 A;  2J0W A;  4P6I C;  4JA9 A;  4ULW A;  3LS0 A;  3OWT A;  4MND A;  3L22 A;  3JRT A;  1UJJ A;  5G05 C;  4GZ5 A;  1TEZ A;  3EG9 A;  2L9B A;  3K66 A;  2IXO A;  2X6F A;  3ZG1 A;  2ZXO A;  2IOS A;  3R9A B;  3VYW A;  1HZ4 A;  3JUI A;  3TG4 A;  4AIF A;  4AV7 A;  2AWI A;  1BR4 A;  3TJP A;  2J9V A;  3PEV B;  4GYO A;  5L3V A;  4YN0 B;  2Q9C A;  4E7S A;  3LPZ A;  1V55 C;  1UN9 A;  2NUT B;  1E7V A;  2PQR A;  5ARG A;  2CG2 A;  4F1S A;  2NXP A;  2J9W A;  3S7F A;  5CHE E;  1H2V C;  4L2Y A;  4LEU A;  5D0Q D;  3FY4 A;  2I6H A;  3U3W A;  3DBS A;  1Z23 A;  4YVQ C;  4DVY P;  3ZHE B;  5G2N A;  3G2U A;  3B9Q A;  4O7G A;  4HOS A;  4DI4 A;  4ZLC A;  4NY3 A;  4PK4 A;  3D9P A;  3CVV A;  2XRY A;  4CS7 A;  2M63 A;  1WY6 A;  1HU3 A;  3QMK A;  3QNK A;  3RO2 A;  2O9X A;  5G55 A;  2MWQ A;  2I1J A;  3I5P A;  2ZU6 B;  2WVQ A;  2CFZ A;  2OCC C;  4Q96 A;  3SBS A;  3P2B A;  3NQP A;  4WNF A;  3CKB A;  1OUV A;  1IQR A;  3PEU B;  3RRN B;  4BJ1 A;  4CS8 A;  4I1A A;  2IFU A;  3ABL C;  4U04 A;  4MLP A;  3JCK C;  4AP2 A;  2X51 A;  2MHK A;  1N54 A;  4B6I A;  5KYX A;  5B1A C;  3ONL A;  1Z5Z A;  1N52 A;  1OWN A;  4E6H A;  4GYT A;  3FUK A;  1E90 A;  2WXJ A;  2J0X A;  4F4B A;  3CVU A;  2YQ8 A;  3VTY A;  3ESL A;  4PS3 A;  5DS4 A;  3SZR A;  3PNT B;  3ASN C;  1MMN A;  1MND A;  4U5E E;  3S2A A;  5FCL A;  4XZ4 A;  2Y3H A;  3QZC A;  3FTZ A;  4CDM A;  2E0I A;  1HS6 A;  3FTU A;  2EIN C;  4EEC A;  2G3V A;  4L2L A;  2WB2 A;  2I2O A;  4GEH A;  2X6I A;  2PZI A;  3L34 A;  2EQX A;  4RG6 A;  4C3D A;  3QAR A;  2PM7 A;  1PCX A;  4KNV A;  3OXL A;  4UWF A;  5A23 A;  2QFC A;  4AM9 A;  1DNP A;  3NZS A;  5G04 J;  4UWG A;  2W4M A;  3LNR A;  3SP1 A;  2WMO A;  2KAT A;  4WNE A;  2R7W A;  5EX3 A;  3UGO A;  5KJL A;  3CSK A;  2VJ8 A;  4BJ6 C;  4BWR A;  2IXP A;  1H2U A;  4OIO F;  4QI0 A;  5FZS A;  3LDZ A;  5D91 A;  3C98 A;  3MLG A;  1M56 C;  3HJC A;  5DQZ A;  4OIQ F;  4AJW A;  3RH3 A;  1OCO C;  1S7Z A;  3IV0 A;  4BX8 A;  4W8K A;  1KT1 A;  3HIZ A;  2FO7 A;  4RSY A;  4U07 A;  1LKX A;  4JHR A;  5BPP A;  3NYM A;  5FWQ A;  3TAX A;  4EBB A;  4DOZ A;  5E3C A;  1QZ2 A;  2BUG A;  2A6E F;  3AG1 C;  1RJ9 A;  4OVU A;  3CVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...