3I5PA

Nup170(aa979-1502), s.cerevisiae
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
503
structure length
449
Chain Sequence
DILGFRAIEHLRRAKEIYDSLNYHLKNATAIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLENDDRKQYYDKRILVYDLVFDTLIKVDLRQKSYEAALKYNDRLFHYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGKISNILWVYYSRRSKFFESAEILYRLATSNFDITLFERIEFLSRANGFCQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQDSEFIFPIFELFPIVCNFFYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSDNSVFNKEMTWLIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nucleoporin NUP170
publication title Architectural nucleoporins Nup157/170 and Nup133 are structurally related and descend from a second ancestral element.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 145
structure length 449
sequence length 503
ec nomenclature
pdb deposition date 2009-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1880 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3i5pA03
1.25.40.440 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3i5pA02
1.25.40.450 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3i5pA01
3I5PA
chains in the Genus database with same CATH superfamily
4J8EA 5JHBA 3HLZA 3Q7FA 3EGDB 3UMVA 2P9KG 1G5ZA 5AIJA 3C8GA 3LPZA 4AL1A 4JHRA 4OVVA 5BV0A 3D9LA 1YYXA 4AY6A 4KT6B 3U8VA 4KVOA 2DYSC 4GQHA 2KC3A 1HW2A 2H6IA 2H7OA 2GRQB 2H6HA 3SY2A 4HQDA 4HBDA 4EQFA 2V4HC 3LJNA 2P9SG 3TAXA 2XPYA 2XLHA 2PM7A 2IFUA 1VOMA 4DVYP 4CT0A 3FU6A 3ULQA 3GZ1A 3I4GA 5L3QA 3I4RB 4U07A 2YZSA 1U0BB 3B95A 4J0UA 3W8HA 4NTAA 5COMA 3EIQC 4H54A 5BV1A 4W9RA 4EUKB 3VTYA 2KCVA 1MX4A 2LAIA 3JCUQ 5B3SC 4AV7A 1YZAA 1KNYA 3QW1A 3MGBA 3SNXA 5E3CA 4E6HA 3OXFA 1IQUA 2M4EA 4OD5A 5BUOA 1A5EA 2AU5A 4CDVA 3QJZA 2XPIA 1AEPA 2HFIA 4GZ6A 3LNMB 5T4YA 3S84A 2IQCA 3RW0A 3AG4C 3EGXA 1A17A 2J9BA 4MVMA 3RQFA 2LSVA 3ZNGA 4IARA 1A41A 4XEVA 2OOCA 3RH3A 2XM0A 5JRAA 1OY3D 4PJNA 3FXHA 4LACB 3FDHA 4GTVA 3E30A 4HRLA 2O9XA 3M15A 1SZIA 4N3CA 3X2QE 3EZIA 4MVQA 1TQGA 1H9TA 1QQEA 4E18A 3KSLA 1ELRA 3ISMC 4I6EA 2YQ8A 2J07A 4TV3A 3JQ1A 2E0IA 3NMKA 5LX8A 4UUCA 2Q9AA 2YHCA 2UUIA 4K5BA 2EPLX 3SFYA 3DBSA 2GRPB 4XWJA 1J8MF 4UDVA 2HM8A 3ABKE 2CFZA 1LE4A 2J49A 2P7VA 4PJMA 3NYJA 3CVWA 3OA1A 2BF0X 1G4US 1H2UA 3LY7A 1BI8B 4N5CA 3CHRA 2XLWA 4B89A 3S28A 4CS7A 1E84A 4N5QA 2JX0A 4YL3A 1DOWA 2NUTB 1H6GA 1E8YA 4PH4B 3LS0A 2RKKA 1T6QA 1S7ZA 1IKND 1UG7A 2LFFA 4UWKA 1FAPB 2I9CA 5G04C 1ELWA 3IQ5A 3K33A 4YT8A 3UINC 3W2WA 5CCLA 4DJAA 2R25A 1YYHA 2HJ3A 3FTYA 1HW1A 3NQPA 5DS5A 3HNKA 3JUEA 4J7YA 4FESA 4CGWA 5FZQA 2V8SE 3G2UA 5HS0A 3L34A 2GRRB 4CX9A 2UY1A 1OW8A 3CR3A 3ITFA 3NAWA 2ZU6B 3ASNE 1DCEA 4HOTA 3ASOE 3PS6A 3C8GB 4JZYA 4HXIA 4JXTA 3PVLA 1NA0A 4FLBA 5C1DA 4QDLA 4C3BA 5D0QD 1U3CA 5IY5C 3CLJA 1ORYA 2LAHA 2YVKA 1UJJA 2EPNA 3SD5A 3UKRG 4BEMJ 1A7VA 5DS4A 4TUUA 2XRZA 2IOLA 2L6GA 4NIKA 4GZDA 1LS1A 4O6NA 3MJWA 5A7DB 1S0PA 3ZU7B 4XQ1A 1P5QA 4OIOF 4CS8A 4GYWA 1H6OA 3Q15A 2YINA 4BJ5C 5JJ6A 1EI7A 3IXEA 3DD7A 4JA9A 2YL1A 4RBNA 4X8QA 2EIMC 1O1RA 2VGYA 2VSXE 4CCAA 3PNLB 1JWFA 3RO3A 2ZIRA 5T1DB 2ZPAA 3NF1A 3RYLA 3CSFA 2ZXWC 3LY8A 1OCOE 1PC2A 5CCMA 2VSYA 5BNWA 2XGMA 4U8VD 3D9PA 4EBJA 2KW3C 4NRHB 1K8KG 1YZCA 3EGXB 3L54A 3QOUA 3RU0A 4UI9K 3EFOA 2A69F 3FOPA 3JYYA 2IU1A 4BTAA 2HKVA 4K0DA 3S7JA 2WQ6A 1CGNA 2ETBA 1QVXA 2L81A 2WL8A 2AVPA 1NFNA 1ZHYA 4H7YA 5EDSA 4GTOA 5DS6A 1BD8A 4ILGA 3DEOA 2GRLA 2XL8A 1JPNA 4ULVA 4BX9A 2WXIA 4APOA 2PX3A 2WVIA 4O7GA 2P2CP 3LLIA 2VCBA 2FGYA 3TOMA 4V3IA 4GTTA 5EHHA 4BSZB 4Q7CA 4U5HA 1E7VA 3B7UX 4HE8D 2L6FA 3V5YA 2HS5A 4N4WA 3POVA 3CGHA 1O5MA 3K66A 3CVUA 4MVZA 3Q79A 4HI8A 5DBKA 4F6RD 2QY9A 1OWMA 2NSGA 1H9GA 4BJTA 4CSAA 3GW4A 4I2WA 4A1SA 1VYIA 4C0EA 1D8EA 3DMDA 2GDCA 1FFHA 4BT8A 3FFLA 3UIOC 5EILA 1VK5A 1NG1A 2FO7A 2LNIA 3TJ6A 4MW8A 1HE8A 1OWOA 4UQZA 5BXOA 1Z23A 2UY1B 4Z68A 4L2LA 2F22A 5KYUA 2R05A 5T3TA 3QB2A 2BKGA 3ML8A 2YNQA 2WXLA 1H6KA 4BX8A 2QTVA 4EHPA 1Q0DA 3PDNA 4XI9A 2HR2A 4I6JA 1HY5A 1C02A 2J9QA 4L9PA 2XZTG 5JP7A 1NU7D 1SA5A 4LDRA 1I4ZA 4U95D 3R9MA 4EBAA 3CHOA 4HB5A 4C3EA 1FFTC 2C0LA 2Q7FA 2G62A 4GTMA 4U5EE 3KMIA 1NSGB 4E0HA 1AP7A 4FLHA 2FF4A 3PEUB 3HXDA 5KYYB 5A23A 4NACA 3ASHA 4OIPF 3U9WA 5JS5A 1LI5A 2HV6A 3LEWA 2WXNA 3CQZA 4NTFA 1N4SA 4BJ6C 4NQFA 3JXJA 1RZ4A 3CV0A 1Y6DA 3ZUVB 2WXFA 2I1JA 2LQGA 2XRHA 3NKEA 3EFOB 1LVKA 3DM5A 1OT8A 1LD7A 3DZAA 3EG9A 4GYTA 1S05A 4U9EA 3EUVA 1TNUA 1GGQA 5ENOD 5HRYA 2Y4UA 3FHDA 3EHNA 1KT1A 4AM9A 3AGTA 4GTSA 4F7AA 2V3CC 1YARO 4L1BA 4LLEA 3UKUG 4XLNF 5DLJA 3ZG1A 2AWYA 1X81A 4MRUA 1V54E 3U3BA 2MHKA 2ASRA 2Q9CA 4AE4A 2ILRA 4E0IA 4G23A 1Z3IX 3BEHA 1PCXA 2DVWA 4PS8A 4DK5A 3DRAA 3Q73A 3HNLA 2LXMA 2XZDG 3C3OA 5HI7A 2AXVA 1EKYA 3EIJA 3VYWA 5KBAA 2D5RB 3LS8A 5J90A 1O5HA 3SBTB 5F28E 3X2QC 4U5CE 5L0GA 3AJIA 1QQ3A 1G3NB 1FT1A 3V7OA 3O4ZA 5AQAA 4BEPA 4OD4A 1JUQA 3KSQA 4MKTA 3JYHA 2WPVA 4G7OF 2ZXOA 1LS4A 4CS9A 3E4BA 3FEYA 1KT0A 3T8MA 3ABKC 1MX2A 3RSEG 4BTBA 1Z6TA 3KPHA 4O60A 4HLLA 1SZ9A 1OCRC 4IYPA 3ABLE 3TWVA 3W8IA 5AQ9A 1FVFA 3TG4A 4N39A 5EN5D 1ORSC 1GS9A 3FUJA 1HZ4A 3SFZA 4HRMB 3ZHEA 4O79A 1A0BA 1ZW3A 2Q3TA 2Y39A 3H2UA 3HXCA 5FQ8A 4LCTA 2D4UA 3DAGA 3IQCA 2J8WA 5CMYA 5KYUB 4C3DA 2KSFA 1Z3YA 2NYJA 2WXPA 3FTXA 4KYOB 3L82A 5D2MC 3TJ5A 4EIYA 3J5QB 3Q5MA 1K04A 1YYJA 3FUNA 2AVKA 3IEGA 3QWVA 1GQAA 3CQGB 3UI2A 2OVBA 1OW7A 2DZNA 3IHUA 4PS7A 1N4PA 1OWNA 3OXGA 4YDEA 3C63A 4FWVA 2Y1LE 1ORJA 2UWJG 1MHQA 1XGWA 4XEFA 1MMDA 4DRIB 3C62A 3ASNC 4KXKB 3ASOC 5ENRD 3RQEA 4MW3A 2YEVA 3NOCD 1BI7B 3HKKA 2BUGA 2XRYA 3DSWA 1BR2A 2KXPC 3LNRA 4J7TA 1JOGA 3RRMB 1PAQA 4WJ0A 2WB7A 4LUNU 2AXZA 3D9HA 4M7CA 3UT7A 2FO1E 2IBFA 2XPZA 3C3RA 4BESA 2OQMA 3R2PA 5ENQD 1SR2A 5J08A 2YKZA 3FEXA 3DE8A 5AC4A 4A3VA 1IW7F 2EPKX 3W4YA 3APCA 1A7DA 4JURI 1YJGA 3HDXA 1WY6A 4E17A 3UM2A 2YLIA 4F4BA 1I5NA 3EG9B 4K7BA 4NC3A 3WG7E 2BL2A 4GZCA 4AIFA 5A6KA 4BWRA 1OCOC 4G26A 3AG3E 4Y6CA 1N95A 1TN7A 5FQ4A 2F8YA 3Q7GA 2CHWA 4ANVA 3ZXPA 3G2TA 1NBBA 4AE4B 3W9FA 4HFFB 2A5UA 1ZB1A 4EBAG 3F46A 1KZPA 256BA 3CHMA 2X6FA 2LO6A 3DWLG 1O1SA 3NB2A 4ZHBA 2G3KA 4CSAC 3L13A 3QWPA 2KJGA 4WWNA 1VB5A 2ETSA 4YWQA 2MYSA 4PFOA 3JUIA 2WZGA 4EBBA 2X51A 5ENNA 3VAYA 5KJMA 1T6UA 3UNGC 2XENA 2EIJC 5CBOA 4KNWA 3IHYA 5DIZA 3DSUA 3CHSA 3JQ0A 4FC8A 3UPVA 2Q9BA 4ZFHA 1L3PA 4J8SA 4JL0A 1E7UA 4LDQA 3FAJA 2P9IG 4UWFA 3L22A 4DBQA 1PY1A 5LOZA 3ZHEB 2MWQA 1I4YA 4UI9C 5F5FA 1HX8A 1OCZE 2DCPA 5KNHD 5T8IA 4JEUA 5G05J 2R02A 3L17A 5CEAA 5LFAA 4P9FA 2ONDA 4I44A 2B0OE 5BQGA 2WXRA 4JEHA 5ENTD 4ONSA 1N9AA 4P29A 3CVXA 3JXIA 3VF0A 2NPUA 5FZTA 5KJLA 1JR8A 4TXRA 5BQIA 3D9OA 5ANRA 4I3MA 4A55A 3S0XA 3WAQA 5FCLA 5B1BE 3ATPA 4MVSA 3G2SA 3RKOF 3T5VA 4I17A 2VSNA 4WNDA 4Q94A 2PX0A 4YNDA 3NKDA 2MRIA 4ACLA 3KYJA 4YJWA 5JLIA 3QDNA 1C17M 1D0YA 3E34A 3CIAA 4G25A 3D9MA 1FPPA 3NDBB 2HJMA 4MVUA 3Q6MA 4JRZA 4KBLA 3LY9A 3GWLA 4B6IA 3IEEA 3B7RL 4F53A 5A6BD 4ANXA 5JT4A 3E33A 3VLDA 1TKNA 4PUCA 3EPVA 1FTSA 3TWRA 1YAUO 3MYFA 4YN0B 2V26A 3DXKG 5H7PA 4Y6WA 1Q2ZA 5EYPF 3SF4A 2J0WA 2ZXPA 1IQRA 1NFOA 4PFPA 2W9YA 3M79A 3RRNB 3RFYA 3A11A 3DSSA 1M2OA 4MLPA 5FZRA 5AC5A 5A6BA 3CKCA 4YVOA 3Q47B 4AP2A 1ZW2A 5KYXA 2L9JA 3EHMA 1KU2A 1N52A 3D9KA 3QC1A 2EILC 2DBAA 1TWHA 3FUMA 4DPRA 3QVYA 2WVOA 1AWCB 1RKEA 4LG6A 2H7BA 5EYLA 4CDYA 1RXQA 1IXVA 5G55A 3UTMA 5T3WA 2OEVA 5C2YA 2FULA 1TFKB 1TNOA 4O1PA 1ZHWA 4JW1A 1G4WR 4DUIA 5L3VA 3EH2A 4L7TA 2Y3BA 2LSEA 4AOFA 3PZDA 3ZWIA 4BEJA 3V31A 2ZGDA 4GA1A 4FJYA 2VCAA 4APFA 5CBNA 3S7DA 2XXAB 2X6KA 1V54C 3KAEA 3TQOA 4L2YA 2HMQA 3MLGA 4EECA 1JCQA 4N2QA 1MYOA 3U2LA 3VRCA 3PZ1A 3NBNB 2R17C 3B7SA 5CIVA 3Q9NC 3SXMA 3ML9A 5LCWJ 3B0VC 2R59A 3V79K 4RD9A 3K7DA 4GA2A 1V74B 3ENEA 2Q4FA 1LD8A 3L1MA 1M2VA 3MYIA 4J32B 4AJWA 1T6IA 1M56C 3OEOA 4URKA 3RF3A 2QY7A 1GW6A 2KZTA 4NURA 2ZXRA 4G78A 4XPWA 5ARGA 4JTDB 1OWPA 4LERA 2H6GA 4Q96A 4CGVA 3Q4AB 2QE9A 1SQMA 3SP1A 3FUDA 2J8SD 4XIFA 4EWCA 3KS2A 1K05A 2VYIA 3K1IA 3UX4A 4GYYA 4DLQA 3PMRA 3UM0A 4CJGA 4PK4A 1TN6A 2QYUA 4LNGA 3DJNB 4RVBA 1SYQA 2LSUA 5D66A 3S7BA 2WMNA 2YRFA 1U89A 1B68A 5TJ5E 3RQGA 3DSXA 2R7WA 3ASDA 4I9CA 3JYSA 1UFBA 5KJNA 1NL4A 2YL7A 4Q69A 3PRZA 1NP7A 5AQ7A 5AN8A 2V5QC 1RW2A 2BEDA 3EHQA 3MKQA 2CHXA 2W45A 4KMOA 4QI2A 2WB2A 4DLOA 5BPPA 4OVUA 2XS8A 3QZCA 2R7VA 3M1CB 4H4KC 1MX6A 3SXYA 2WXJA 3W9GA 2M63A 1HS6A 4AEZC 1T9KA 2OJQA 2VH3A 2J4DA 2YHSA 3FVYA 3ZQYA 2JABA 5L0DA 4WGYA 5E3AA 3KL4A 3HVEA 4A1GA 4EZJA 3SGHA 5D0OD 2X38A 5CI9A 3PZ2A 3P1UA 2L0TB 2R7RA 3CVNA 2Z15A 4HORA 4JTAB 2NUPA 5FJYA 3PZ4A 4AXHA 3H65A 3MKRA 4R7LA 3NG1A 1RKEB 3DSVA 2G3VA 3V2XA 3BG0B 3C5RA 1RCPA 3UT4A 4D10C 4KZCA 5FINA 2WZLA 3KEAA 4CDMA 3GM3A 1S63A 1Q0GA 2XM4A 1Y8MA 3GYZA 3EZHA 2X3MA 3WG7C 3RKVA 5DVWA 4GTQA 3L0IA 1HXIA 3AG3C 2B0JA 2HV7A 2F0YA 5FIOA 1YA0A 3T8KA 2NG1A 5AENA 1QLEC 1N4QA 3CVVA 1SW6A 3PEVB 1IHGA 3I4UA 1DC2A 3R7RA 2KNHA 1L5JA 2R03A 4RQIA 2FI7A 2XLVA 2A4ZA 4GYOA 1TWAA 5E75A 2J9WA 2AWCA 1E90A 1H2VC 3SQVA 1X5BA 4ER9A 2GRNB 4XE0A 4G2VA 2KCKA 5DQZA 2F8XK 2VJ8A 3PCVA 1VLTA 4DXWA 5HV9A 5KYWA 3DE9A 1MMAA 2IXNA 2HO1A 1W2WA 1UG3A 2XS1A 1V4AA 2PNOA 3EJNA 1M2VB 2ICWG 3BRJA 3C3QA 2KZTB 1BR1A 2XLDA 1D9SA 3DM9B 3BUAA 4GCNA 4LRZA 4HFKB 3AG1E 1OKKD 3AGUA 1OR2A 4CBEA 1APCA 3QK0A 4JE9A 3B0UX 4HFGA 3Q6NA 2P9LG 1WASA 2HSQA 3AQCA 1H6PA 1OCZC 4UQYA 1DNPA 3ECSA 1WG0A 2A0BA 2P58C 3HXFA 3B0PA 2A5EA 2C0MA 1TWCA 4IGGA 5COGA 3J5PA 3CKBA 2P6VA 3SXKA 1OKKA 1DOVA 2I15A 5DQTA 5AQBA 1QKRA 1SF8A 2NC9A 3CEQA 3M4CA 3MKQB 2YLGA 3S2AA 5B1BC 1JAFA 4ATGA 2CGEA 3UM3A 4EHMA 3U2MA 4X0RA 3GZ2A 3T6BA 4WABA 4JZAA 4MVRA 4WNEA 4JJFA 3ZGQA 1JMWA 3E32A 1NA3A 2HE0A 3ZVRA 2JEKA 4CRWA 3SHFA 4KBQA 1JPJA 4GPMA 2XEHA 4HVBA 5K0IA 2W4BA 3HVEB 3UM1A 1OXBA 5L0FA 1ZU2A 1BR4A 1LPEA 3LCAA 1IYGA 1XZQA 2ZGGA 2PNNA 4GMJA 1E2XA 1E96B 5L0CA 4Z9IA 2CNWD 3KYIA 3KEZA 4EPZA 2PM6A 3FHEA 2NUPB 5CHEE 3EDTB 3NZSA 1YCSB 4YT2A 4IAQA 2HSBA 2ZD9A 3NOGD 4D4XA 3DXMG 4WNGA 4YT4A 4JPSA 3FOOA 3L8JA 4JHJA 2CNWA 2MHRA 3C18A 1PD0A 5A6JA 5CRUA 3JT1A 3DJUB 2OEXA 3TWSA 2YHEA 1FNTc 3PHF2 3TWTA 4FADA 5T3RA 2KCLA 2NXPA 4IULA 3U4TA 1ELKA 2PZIA 2AJAA 2FAPB 2IM8A 4JC8A 5HKPA 3LAYA 2IEJA 4C0MA 4J8YA 1K3ZD 3ZDLA 5KYWB 2NSZA 5JVEA 4GAAA 4ATZD 1HMDA 2WM9A 1OR3A 4GZ5A 1TNYA 2MYOA 4G8KA 4DX1A 2J9UA 3L08A 3SNHA 2VQ2A 3Q78A 3EH1A 3UXGA 3OWTA 1LIHA 1MQVA 4CDAA 3ONKA 2Y3GA 1HMOA 5ITZF 2UUHA 4OINF 4I2ZA 2VSOE 4JJGA 4F3VA 3BG1B 2H8AA 4CS8C 4HRNA 2LFDA 4DX7D 1ZHZA 3Q7LA 3FTSA 1EYHA 1LE2A 4TRQA 1CPRA 3AJMA 2X6JA 3S90A 2ZISA 4RDAA 2WMOA 5EX3A 2IY0C 4BT9A 1C03A 4U0ZA 4C7OA 4TUMA 4U5GA 5G2NA 4AK9A 3FMSA 3TWXA 4M3OA 1D1AA 4H7XA 4GTRA 4CIHA 4CEMA 3TG5A 5JA4D 3U3WA 3T6GB 2FEZA 4UQXA 5KJKA 3RVZA 3NYMA 2YWAA 5CECB 4M63A 1GM5A 4CYMD 1WM5A 3CVLA 3EU5A 4ME2A 1N94A 1WATA 4B8CB 1H7IA 3GEEA 1MZCA 1ZBPA 4K0RA 3OAWA 2OJED 4GZ3A 3ZXSA 1TJCA 5AARA 3ULYA 2R5SA 1PD1A 2WXGA 2KATA 2A1DD 1YVIA 3QVZA 4QQIA 4WWPA 1HFAA 3ESLA 3FH8A 4G7HF 3DPDA 3JSEO 3MEKA 2ETCA 4K03A 1HF8A 4N3AA 4Z9JA 5FWQA 3FP3A 4XLPF 4JKVA 1YMPA 2IXMA 2PF4E 2WXQA 2OOEA 2X6HA 3O48A 1HE9A 1JCRA 3HIZA 3EU9A 1FMVA 3EQLF 2I6HA 4XTKA 3FU0A 4DX5D 4J8FA 4NQ0A 4BJ5A 3O39A 4JVSA 1WWPA 1MNDA 2GA0A 4LDKA 2L7AA 1SA4A 5JHAA 3TK0A 3G4XA 2P0NA 1R5ID 2CYDA 1EA8A 3IV0A 5JUAA 1OWLA 4CJOA 5D92A 2LP4A 1BDJB 3D9JA 2Y3HA 1Y4CA 4MQ9F 2X0CA 4RLYA 4MVOA 3RO2A 2WVQA 1VLSA 2R7XA 3UQ3A 1FVHA 3RVYA 1XZPA 2R7SA 3TD7A 2KBXA 1BPOA 3F47A 4WGZA 1LI7A 3ZN3A 5LP0A 1HG2A 4BG0A 2P9UG 2WZFA 4FX5A 1Q0FA 2GRMA 1TWGA 3JSZA 5BQHA 3AQBA 2KQ9A 3TULA 3LVQE 2IOQA 4YVQC 2C2LA 5A6AA 1KLXA 4E85A 2VGEA 1TNZA 1CPQA 2V5FA 2XLOA 2LCHA 3JZ0A 4BPMA 1Z5SC 5BT1A 4JCZA 4DI3A 1ZU5A 1V55E 3D9IA 4N3BA 1D0ZA 2A6EF 1TNBA 1MNEA 3B9QA 4GMRA 4HOSA 4XX5A 2HMZA 1IHBA 1N1CA 3SZ7A 3ZYQA 1Q0MA 3NZUA 2TMVP 3D9NA 3AAAC 3G50A 5G04J 3PDMP 5CRVA 4A3TA 3U64A 4XPXA 3P2BA 3MFNA 5AAOA 3O10A 2GFHA 1NZNA 3QTHA 4W8PA 4XZ4A 4C7OB 2Y0BG 2WQHA 3SYNA 4P9TA 1WTYA 4IWBA 1TR2A 3OXLA 4KNVA 2R7QA 3AG1C 4XI0A 3GZSA 2PQNA 2AP3A 3AU4A 4K5AB 1H2TC 2IXPA 4O6MA 3MZLB 2RD9A 3PZ3A 5EK0A 1CGME 4FP7A 2XCCA 3S27A 2XGOA 1N54A 4U9DA 5FT9A 2PL2A 1D8DA 5L0JA 3E70C 4WNFA 2R7TA 1SZAA 3FH5A 1OW6A 1ZHTA 4U7EB 3QW0A 4NCQA 2CG3A 4KVMA 2XQ0A 2R2LA 5JSLA 3U8PA 2XSEA 4U8HA 2EIKE 1BLXB 3CZ6A 1RMVA 3IQ6A 3KKBA 4FULA 4W8KA 3U66A 3Q49B 2QZAA 5HSWA 3I5PA 4HNAD 3GEIA 3B13A 3QAQA 1S70B 2M64A 4LSZE 2OV8A 3JRTA 2XEVA 2F37A 4FAPB 2JLBA 1RJ9A 3TWWA 1TFOB 1KZOA 1FR0A 1Z3XA 4IB4A 3HXEA 4N6HA 3R7CA 4G8LA 1M6TA 4ABNA 5E2QA 2EINE 3UMKA 3U5SA 3QKYA 3UT8A 1UN8A 2Q00A 3EHRA 3MV2B 3PE4A 4XEKA 5E33A 5EKQD 2I8BA 3DKAA 5FTPA 3HJCA 2XL4A 4K1OA 4UWGA 3FWVA 3ZRHA 2KGOA 1FT2A 1H0AA 2DI3A 4CS9C 4U5FE 3B29A 2YLDA 2J45A 4MS2A 3FTUA 4I9EA 2J4BA 4BSXA 4PR9A 2PFDA 1ZVZA 1HG5A 3U9MA 3MA5A 1EF1C 1QSPA 4DRXE 2LIGA 3M4BA 2P9PG 4BJ6A 3LVRE 1MMGA 1D0XA 4LNUD 4R32A 4U8YD 3G2WA 4AVXA 4BETA 2IF4A 4P6IC 2DWZA 3TWQA 5COFA 1W3BA 2H6FA 1QBQA 4ANJA 4FHJA 2GROB 3JTLO 1WGWA 3Q7AA 3SO8A 3W2VA 4AL0A 1OCRE 1RKCA 1G8XA 1SMYF 2Q7RA 5KWDA 1HO8A 3FAPB 3C7JA 3CHQA 1YLMA 3JCKC 5G05C 4U0UA 2R7OA 1VDYA 1YA9A 2QC9A 2V4LA 3N0TA 5GPGB 1LF8A 2EPOA 4A2NB 5BUZA 3RRUA 2ETAA 1YA7O 5B1AE 2DYRE 5AYWD 4C48B 2OCCE 3US6A 4IRUA 3ABLC 1JRAA 3BU8A 3IKOB 5EIDA 2MOWA 3FULA 4GU5A 4I43A 4YT5A 2J7PD 4E7ZA 2Y69E 4XKBA 1OQCA 3C72A 3LKUA 1QPUA 1N0RA 4LEUA 4RSYA 3TXNA 3APFA 1QZ2A 4HI9A 3HRAA 4BERA 4O1OA 2FFHA 5EGYA 3N2ZB 4DX6D 2HUJA 2B6CA 3FDQA 4CIPA 2IYLD 4J30B 3LJ3A 3NMIA 3PNTB 2J7PA 3HG0D 3VLFA 2J08A 3O6XA 5ARFA 4PJLA 3IHVA 1NU9C 4GA0A 2BE5F 4RG6A 4OIRF 3ONLA 3DPYA 3RJVA 4JCHA 3FUFA 3AU5A 3U9JA 4XKCA 3ZTMA 2IO2C 2Y3DA 3ZC4A 1AUEA 4XPYA 4HS2A 3FUIA 3QWWA 3ZYMA 4CZ2D 4TXPA 1Q0KA 1QNFA 3PE3A 3VLEA 1UJKA 5KYYA 5KYXB 3QNKA 3AG2E 4NY3A 4BJ1A 3IQTA 1RJ9B 4GEHA 4ULWA 3ABME 5AJLA 2LD6A 2V0PA 4I6GA 5EIBE 4U5BE 2GW1A 2XGSA 4KC9A 1L7CA 2WQ7A 3FUHA 3FH7A 1VTMP 2EQXA 3L16A 3UIPC 2IXOA 2QYJA 1E8WA 3HNJA 3A9CA 3GANA 2RFMA 3QMKA 2WXKA 2CFUA 1EDUA 3B71A 2QLAA 4YDYA 1NI1A 3RK6A 3GODA 2L6HA 3L9TA 2HYZA 3LLKA 3I3NA 1D1CA 1E8ZA 3C98A 4DJ9A 3PREA 4I1AA 4MTGA 3T6JA 3ZSUA 1EPUA 3CEXA 1UW4B 3HNIA 3ZTZA 1BU9A 1K40A 5D91A 4Z9HA 3AS8A 1INZA 1O3UA 1BZ4A 2E87A 2JD3A 1OCCE 3L8IA 3NYLA 3NMJA 3UGOA 3FTZA 4ILIA 3PUKA 2J0XA 3ZFWA 5A6CA 2LUHA 3UUXA 3ZYLA 1EQ1A 2QUPA 5M72A 4ANWA 2EIJE 4QFVA 5FZSA 5LCWC 4G24A 3H2VA 1HE1A 3LJBA 1PV3A 3V30A 3VM6A 2VTBA 1E83A 1YDIA 3ZEFA 3LXUX 2J09A 3CVQA 1N4RA 1JWGA 2L6JA 4EKWA 2CHZA 3ZYKA 2KYHA 2KM4A 4JB8P 2C04A 2CG2A 1JPLA 4GPKA 1Z63A 4MTFA 3V5XA 1KTMA 5BW8C 2YL3A 3ZKJA 5JJ7A 3WHNA 3CK7A 3L6AA 4I1OB 4FHKA 4L23A 4L6RA 1NZEA 3KD7A 3FTVA 4YDOA 2DB4A 1E8XA 4OAUC 3GM1A 5KCMA 1R4TA 3TJPA 3GWNA 1V55C 2OKUA 4U63A 2DYSE 4ILHB 5CEDB 3T4RA 1N11A 3CHPA 4N6CA 4LNBA 2GAQA 4U04A 1TEZA 3FY4A 1WAO1 4IJJA 3BQOA 4D4NA 2VC9A 4PDXA 5ANLA 1FMWA 3FU3A 1XNFA 3E37A 4B0ZA 1SVXA 3DSTA 4Q5SF 4PACA 4GCOA 4UWHA 2VGXA 3PUJA 3J06A 3ULEG 3APDA 4GTPA 4YDWA 2WVNA 2PP4A 4DVZA 3HTKC 3LS1A 5B3SE 3SBSA 4DX2A 4EBKA 4UWLA 1H19A 2CCYA 4F1PA 1ST6A 5F5HA 2IONA 4CT4A 4DOZA 2IOSA 4HLEA 4OIQF 4FA6A 4ZLDA 4F1SA 2Y4TA 2J9VA 1TR4A 3IBEA 3AG4E 4ACKA 1Y6IA 2EIKC 3LDZA 5JJTA 4N06A 3K6BA 2BC5A 2EILE 1WN0A 3X1OA 2CW0F 1WOLA 3ZVVA 3Q9UC 3ZIBA 1OXJA 2WXHA 4CDNA 2OEWA 2QFCA 2VCCA 1MQSA 4U96D 1MMNA 2I2OA 2OU6A 4DBRA 2XCBA 4B8AA 1HH8A 1F1MA 2XLEA 4BFRA 3S9OA 4YK5A 1K1AA 3SXZA 3GORA 2QNLA 4JHKA 2EINC 1Z7Qc 3TWUA 4B94A 4G11A 3TXMA 1K1BA 2PQRA 4FU3A 1TN8A 4HEAJ 4K5CA 1QZXA 4QI0A 4O6YA 3BEEA 2R7UA 3U3FA 2LK4A 3URZA 1E86A 3GEHA 3TOLA 5FQ6A 3G4ZA 1VMAA 3K1HA 3HXBA 3Q75A 1QYMA 2BKKB 5FQ7A 3S7FA 2RFAA 1NLXA 3IPMO 2VTBB 3UMIA 1KPSB 1N0QA 2AWIA 4N2SA 1WDYA 4U5DE 3K1IC 2L0IA 2OVFA 3CK9A 1S64A 4GMLA 2DZOA 1M57C 1OUVA 4JD2G 3DI5A 3F6QA 3ASFA 2VASA 3AOUA 1MJ0A 3MYVA 3T9KA 1IZMA 3I5QA 3ZQVA 5ENSD 2L6BA 4YL0A 4HOQA 5E76A 5EX0A 3K9IA 3V5ZA 2LXLA 4KZ0A 4BY6A 4WWOA 2AW6A 2A6HF 5JMND 4HOUA 2DGJA 4UI9J 4GB9A 5AJDA 3DAFA 3UMHA 4J8DA 3WODF 3RIPA 5IY5E 4IAOA 1LTXA 2H7VC 1Z6AA 4IN3B 4PJJA 1T01A 2DYRC 5B1AC 2OCCC 2P61A 3G2VA 4B93B 1LKXA 1BBHA 5CMWA 4CDRA 3C8ZA 1TJFA 1DCQA 4JTCB 2HZ8A 3EGDA 2Y69C 1CGOA 4EZLA 1U6HA 2VGXB 3B7TA 3CK8A 2P9NG 3WXXA 4A63B 4JIOA 3PH0C 4Q4ZF 3LYAA 4MNDA 3R7QA 3LEOA 3AS5A 2EIME 2PBEA 3HYMB 3GM2A 4AY5A 2B0HA 3S29A 2GWWA 3AS4A 3TL5A 2IJGX 3FUKA 1J8YF 1O87A 2ZXWE 1D1BA 3LEVA 4MTOA 3CQCB 2KC7A 3RIBA 1ZHXA 4XEIG 4OAVB 3DEPA 2X6IA 3B7BA 3CSTA 2R9RB 3JRMO 2E2EA 2VB6A 1UN9A 2J46A 2KK1A 2CDQA 1VYKA 3LUTB 3U0CA 1UOHA 4J7WA 3CSKA 5KNGA 5L0IA 4YL1A 2AXUA 4MBGA 4RG9A 4U0SA 3ZPJA 3RAUA 1XWJA 2P1AA 2RSEB 3N24A 4JEBA 4DI4A 3TGOA 1ZU4A 2FBNA 1HU3A 5KYNA 3O55A 2Y3AA 2L9BA 3AG2C 3FUEA 1U2VG 2IO3C 4G0HA 1ZZPA 3ABMC 2NSFA 2WXMA 5CI8A 1E85A 4LLCA 1FCHA 3CVYA 4I1MA 4JA7A 5CERB 4EZKA 3MBGA 3KH2A 3SEOA 4AX2A 3SI5A 1T5OA 4ZLCA 2XEEA 4G1TA 5HQ8A 3D3MA 3NRHA 4JC7A 1DVPA 4KI2A 2JPUA 3ESKA 3R9AB 2DIWA 4DRHB 3CVPA 2RD0A 1TYQG 4ANUA 3N71A 4J6IA 2W4MA 2XLMA 3MX3A 1Z5ZA 4FJZA 4JEAA 5AGFA 4WUYA 4A4AA 3V2OA 4PS3A 3UGPA 1OCCC 2WXOA 2YQYA 4DRJB 3MCXA 2XXAA 3LESA 2BTDA 3ZW3A 3CAXA 5ENPD 1B89A 3E9VA 4WAFA 1ZYRF 2EPMX 1OXKA 1O1TA 3ASGA 5B3IA 3HHMA 3QARA 2A68F 4MS6A 2OG2A 1U3DA 4O6FA 5BXUA 1JCSA 2XL6A 4OYSA 1LM3B 3SZRA 2I1KA 3UR3C 3T5XA 2YL0A 4NTBA 3ZIMA 1A7EA 4C9BB 2NUTA 3C8GD 2C03A 2A0UA 1NFIE 4TXQA 3FU5A 3MV3B 3DXJF 3SFXA 1AVOB 3DWWA 2GGFA 3OTNA 3T9OA 3FTWA 5L0HA 3VTXA 5A69A 2RG8A 4G7ZF 4E7SA 2XHEA
chains in the Genus database with same CATH topology
4J8EA 5JHBA 3HLZA 3EGDB 3UMVA 5AIJA 3LPZA 4JHRA 4OVVA 5BV0A 3D9LA 4AY6A 4KT6B 4KVOA 2DYSC 2H7OA 4EQFA 3TAXA 2XPYA 2PM7A 2IFUA 1VOMA 4DVYP 4CT0A 3FU6A 3ULQA 3GZ1A 3I4GA 5L3QA 3I4RB 4U07A 2YZSA 4J0UA 3W8HA 3EIQC 5BV1A 4W9RA 3VTYA 2KCVA 2LAIA 3JCUQ 5B3SC 4AV7A 3MGBA 3SNXA 5E3CA 4E6HA 3OXFA 1IQUA 2M4EA 4OD5A 5BUOA 3QJZA 2XPIA 4GZ6A 5T4YA 2IQCA 3AG4C 3EGXA 1A17A 2LSVA 3RH3A 4PJNA 4LACB 3FDHA 2O9XA 1SZIA 4N3CA 3EZIA 1QQEA 1ELRA 4I6EA 2YQ8A 2J07A 4TV3A 3JQ1A 2E0IA 5LX8A 2Q9AA 2YHCA 3DBSA 4XWJA 1J8MF 2HM8A 2CFZA 2J49A 2P7VA 4PJMA 3NYJA 3CVWA 3OA1A 2BF0X 1H2UA 3LY7A 4N5CA 3CHRA 4B89A 3S28A 4CS7A 2NUTB 1E8YA 4PH4B 3LS0A 1S7ZA 4UWKA 2I9CA 5G04C 1ELWA 3K33A 4YT8A 5CCLA 3W2WA 4DJAA 3FTYA 3NQPA 5DS5A 4FESA 4CGWA 5FZQA 2V8SE 3G2UA 3L34A 2UY1A 3CR3A 3ITFA 2ZU6B 4HOTA 3PS6A 4JZYA 4HXIA 4JXTA 3PVLA 1NA0A 4FLBA 5C1DA 4QDLA 4C3BA 5D0QD 1U3CA 5IY5C 3CLJA 2LAHA 3SD5A 1UJJA 5DS4A 4TUUA 2XRZA 2IOLA 4GZDA 1LS1A 4O6NA 3MJWA 5A7DB 1S0PA 1P5QA 4OIOF 4CS8A 4GYWA 3Q15A 2YINA 4BJ5C 5JJ6A 3DD7A 4JA9A 4RBNA 2EIMC 2VGYA 2VSXE 4CCAA 3PNLB 1JWFA 3RO3A 5T1DB 2ZPAA 3NF1A 3RYLA 3CSFA 2ZXWC 3LY8A 1PC2A 5CCMA 2VSYA 5BNWA 2XGMA 3D9PA 2KW3C 4NRHB 3EGXB 3L54A 3QOUA 3RU0A 4UI9K 3EFOA 2A69F 2IU1A 4BTAA 4K0DA 3S7JA 2WQ6A 2L81A 2WL8A 2AVPA 1ZHYA 4H7YA 5EDSA 5DS6A 4ILGA 2GRLA 1JPNA 4BX9A 2WXIA 4APOA 2PX3A 2WVIA 4O7GA 3LLIA 2FGYA 4V3IA 5EHHA 4Q7CA 4U5HA 1E7VA 3B7UX 4HE8D 3POVA 3CGHA 3K66A 3CVUA 5DBKA 2QY9A 1OWMA 4BJTA 4CSAA 3GW4A 4I2WA 4A1SA 1VYIA 4C0EA 3DMDA 1FFHA 4BT8A 3FFLA 1VK5A 1NG1A 2FO7A 2LNIA 1HE8A 1OWOA 4UQZA 1Z23A 2UY1B 4L2LA 5KYUA 5T3TA 3QB2A 3ML8A 2YNQA 2WXLA 1H6KA 4BX8A 2QTVA 3PDNA 4XI9A 2HR2A 4I6JA 2J9QA 1NU7D 4EBAA 3CHOA 4C3EA 1FFTC 2C0LA 2Q7FA 2G62A 4U5EE 3KMIA 4FLHA 2FF4A 3PEUB 5KYYB 5A23A 4NACA 3ASHA 4OIPF 3U9WA 2HV6A 3LEWA 2WXNA 3CQZA 4BJ6C 3CV0A 2WXFA 2I1JA 2XRHA 3NKEA 3EFOB 1LVKA 3DM5A 3DZAA 3EG9A 4GYTA 2Y4UA 3FHDA 3EHNA 1KT1A 4AM9A 4F7AA 2V3CC 4L1BA 4LLEA 4XLNF 5DLJA 3ZG1A 4MRUA 2MHKA 4AE4A 2Q9CA 2ILRA 4G23A 1Z3IX 1PCXA 4PS8A 4DK5A 5HI7A 2AXVA 3EIJA 3VYWA 2D5RB 3LS8A 5J90A 1O5HA 3SBTB 3X2QC 4U5CE 3V7OA 3O4ZA 4OD4A 1JUQA 4MKTA 3JYHA 2WPVA 4G7OF 2ZXOA 4CS9A 3E4BA 3FEYA 1KT0A 3T8MA 3ABKC 4BTBA 1Z6TA 1SZ9A 1OCRC 4IYPA 3W8IA 3TG4A 1FVFA 4N39A 3FUJA 1HZ4A 3SFZA 3ZHEA 4O79A 2Y39A 2Q3TA 5FQ8A 4LCTA 3DAGA 5CMYA 5KYUB 4C3DA 1Z3YA 3FTXA 2WXPA 4KYOB 3Q5MA 3FUNA 3IEGA 3QWVA 3CQGB 2OVBA 4PS7A 1OWNA 3OXGA 4FWVA 2UWJG 1MHQA 1XGWA 1MMDA 3ASNC 4KXKB 3ASOC 2YEVA 2BUGA 2XRYA 1BR2A 3LNRA 3RRMB 1PAQA 4WJ0A 2WB7A 4LUNU 2AXZA 3UT7A 2XPZA 5J08A 3FEXA 4A3VA 1IW7F 3APCA 4JURI 3HDXA 1WY6A 4F4BA 3EG9B 4K7BA 4GZCA 4AIFA 4BWRA 1OCOC 4G26A 4Y6CA 5FQ4A 3Q7GA 2CHWA 4ANVA 3G2TA 4AE4B 4HFFB 2A5UA 4EBAG 3F46A 3CHMA 2X6FA 2LO6A 2G3KA 4CSAC 3L13A 3QWPA 2KJGA 4WWNA 4YWQA 2MYSA 4PFOA 3JUIA 2WZGA 4EBBA 2X51A 5ENNA 3VAYA 5KJMA 3UNGC 2EIJC 4KNWA 3IHYA 5DIZA 3CHSA 3JQ0A 4FC8A 3UPVA 2Q9BA 4J8SA 4JL0A 1E7UA 3FAJA 4UWFA 3L22A 4DBQA 1PY1A 5LOZA 3ZHEB 2MWQA 4UI9C 5F5FA 1HX8A 2DCPA 5T8IA 4JEUA 5G05J 3L17A 5LFAA 2ONDA 4I44A 2WXRA 4JEHA 4P29A 3CVXA 5KJLA 3D9OA 5ANRA 4I3MA 4A55A 3S0XA 5FCLA 3G2SA 3RKOF 3T5VA 4I17A 2VSNA 4WNDA 4Q94A 2PX0A 4YNDA 3NKDA 2MRIA 4ACLA 4YJWA 3QDNA 1D0YA 3CIAA 4G25A 3D9MA 3NDBB 3Q6MA 4KBLA 3LY9A 4B6IA 3IEEA 3B7RL 4F53A 4ANXA 3VLDA 1TKNA 4PUCA 3EPVA 1FTSA 4YN0B 2V26A 4Y6WA 3SF4A 2J0WA 2ZXPA 1IQRA 4PFPA 2W9YA 3RRNB 3RFYA 1M2OA 4MLPA 5FZRA 3CKCA 4YVOA 3Q47B 4AP2A 5KYXA 2L9JA 3EHMA 1KU2A 1N52A 3D9KA 3QC1A 2EILC 2DBAA 1TWHA 3FUMA 4DPRA 2WVOA 2H7BA 5G55A 5T3WA 5C2YA 2FULA 1ZHWA 4JW1A 5L3VA 3EH2A 4L7TA 2Y3BA 2LSEA 4AOFA 3PZDA 4BEJA 4GA1A 4FJYA 4APFA 3S7DA 2XXAB 2X6KA 1V54C 3KAEA 4L2YA 3MLGA 4EECA 4N2QA 2R17C 3B7SA 3ML9A 5LCWJ 3B0VC 2R59A 4RD9A 3K7DA 4GA2A 3ENEA 1M2VA 4J32B 4AJWA 1M56C 3OEOA 4URKA 2QY7A 1GW6A 2KZTA 4NURA 2ZXRA 5ARGA 1OWPA 4LERA 4Q96A 4CGVA 3Q4AB 1SQMA 3SP1A 3FUDA 4XIFA 4EWCA 3KS2A 2VYIA 3UX4A 4GYYA 4DLQA 3PMRA 4PK4A 3DJNB 4RVBA 2LSUA 3S7BA 2WMNA 2R7WA 3ASDA 4I9CA 3JYSA 5KJNA 4Q69A 3PRZA 1NP7A 3MKQA 2CHXA 2W45A 4KMOA 4QI2A 2WB2A 4DLOA 5BPPA 4OVUA 3QZCA 2R7VA 3M1CB 4H4KC 2WXJA 2M63A 1HS6A 4AEZC 2VH3A 2J4DA 2YHSA 3FVYA 5E3AA 3KL4A 3HVEA 4A1GA 4EZJA 3SGHA 5D0OD 2X38A 5CI9A 3P1UA 2L0TB 2R7RA 3CVNA 2Z15A 4HORA 2NUPA 5FJYA 4AXHA 3H65A 3MKRA 4R7LA 3NG1A 2G3VA 3BG0B 3UT4A 4D10C 4KZCA 2WZLA 4CDMA 1Y8MA 3GYZA 3EZHA 2X3MA 3WG7C 3RKVA 5DVWA 3L0IA 1HXIA 3AG3C 2B0JA 2HV7A 1YA0A 5AENA 2NG1A 1QLEC 3CVVA 3PEVB 1IHGA 3I4UA 3R7RA 2KNHA 1L5JA 2FI7A 2A4ZA 4GYOA 5E75A 1TWAA 2J9WA 1E90A 1H2VC 1X5BA 4XE0A 4G2VA 2KCKA 5DQZA 2VJ8A 5KYWA 1MMAA 2IXNA 2HO1A 1W2WA 1UG3A 3EJNA 1M2VB 2KZTB 1BR1A 3DM9B 4GCNA 4LRZA 4HFKB 1OKKD 4CBEA 3QK0A 3B0UX 4HFGA 3Q6NA 3AQCA 1OCZC 4UQYA 1DNPA 3ECSA 2P58C 3B0PA 2C0MA 1TWCA 3CKBA 2P6VA 1OKKA 5DQTA 1SF8A 2NC9A 3CEQA 3MKQB 3S2AA 5B1BC 4ATGA 2CGEA 4X0RA 3GZ2A 3T6BA 4JZAA 4WNEA 4JJFA 3ZGQA 1NA3A 4CRWA 3ZVRA 2JEKA 3SHFA 4KBQA 1JPJA 4HVBA 2W4BA 3HVEB 3LCAA 1ZU2A 1BR4A 1IYGA 4GMJA 1E96B 3KEZA 2CNWD 4EPZA 2PM6A 3FHEA 2NUPB 5CHEE 3EDTB 3NZSA 4YT2A 4WNGA 4YT4A 4JPSA 4JHJA 2CNWA 1PD0A 3JT1A 3DJUB 2YHEA 3PHF2 4FADA 5T3RA 2KCLA 2NXPA 4IULA 3U4TA 1ELKA 2PZIA 4JC8A 3LAYA 4C0MA 5KYWB 2NSZA 4GAAA 2WM9A 4GZ5A 2J9UA 3L08A 3SNHA 2VQ2A 3EH1A 3OWTA 3ONKA 2Y3GA 4OINF 4I2ZA 2VSOE 4JJGA 4F3VA 3BG1B 4CS8C 1ZHZA 3Q7LA 3FTSA 1EYHA 4TRQA 2X6JA 4RDAA 2WMOA 5EX3A 4BT9A 4U0ZA 4C7OA 5G2NA 4U5GA 4AK9A 4M3OA 1D1AA 4H7XA 4CIHA 4CEMA 3TG5A 3U3WA 2FEZA 4UQXA 5KJKA 3NYMA 4M63A 1WM5A 3CVLA 4ME2A 4B8CB 4K0RA 1ZBPA 3OAWA 4GZ3A 3ZXSA 1TJCA 2R5SA 1PD1A 2WXGA 2KATA 2A1DD 4WWPA 1HFAA 3ESLA 3FH8A 4G7HF 3DPDA 3MEKA 4K03A 1HF8A 4N3AA 5FWQA 3FP3A 4XLPF 2IXMA 2PF4E 2WXQA 2OOEA 2X6HA 3O48A 3HIZA 1FMVA 3EQLF 2I6HA 4XTKA 3FU0A 4J8FA 4NQ0A 3O39A 4JVSA 4BJ5A 1MNDA 5JHAA 3IV0A 1OWLA 5D92A 3D9JA 2Y3HA 4MQ9F 3RO2A 2WVQA 2R7XA 3UQ3A 1FVHA 2R7SA 3TD7A 1BPOA 3F47A 3ZN3A 5LP0A 1HG2A 4BG0A 2WZFA 4FX5A 2GRMA 1TWGA 3JSZA 3AQBA 2KQ9A 3LVQE 2IOQA 4YVQC 2C2LA 1KLXA 4E85A 2V5FA 5BT1A 4DI3A 1ZU5A 3D9IA 4N3BA 1D0ZA 2A6EF 1MNEA 3B9QA 4HOSA 4XX5A 3SZ7A 1N1CA 3ZYQA 3NZUA 3D9NA 5G04J 4A3TA 3U64A 3P2BA 2GFHA 1NZNA 4XZ4A 4C7OB 2WQHA 3SYNA 4IWBA 1TR2A 3OXLA 4KNVA 2R7QA 3AG1C 4XI0A 3GZSA 2PQNA 3AU4A 1H2TC 2IXPA 4O6MA 3MZLB 4FP7A 2XCCA 3S27A 2XGOA 1N54A 5FT9A 2PL2A 3E70C 4WNFA 2R7TA 1SZAA 3FH5A 1ZHTA 2CG3A 4KVMA 2XQ0A 2XSEA 4U8HA 3CZ6A 3KKBA 4FULA 4W8KA 3U66A 3Q49B 5HSWA 3I5PA 3B13A 3QAQA 2OV8A 3JRTA 2XEVA 2JLBA 1RJ9A 1Z3XA 4ABNA 5E2QA 3UMKA 3QKYA 3UT8A 1UN8A 3MV2B 3PE4A 5E33A 5EKQD 2I8BA 5FTPA 3HJCA 2XL4A 4UWGA 3ZRHA 3FWVA 2KGOA 1H0AA 4CS9C 4U5FE 2J45A 3FTUA 4I9EA 2J4BA 4BSXA 2PFDA 1HG5A 3MA5A 1EF1C 4BJ6A 3LVRE 1MMGA 1D0XA 3G2WA 4AVXA 2IF4A 4P6IC 1W3BA 4ANJA 4FHJA 1WGWA 3W2VA 1G8XA 1SMYF 1HO8A 3CHQA 3JCKC 5G05C 4U0UA 2R7OA 1VDYA 2V4LA 3N0TA 1LF8A 4A2NB 5BUZA 3RRUA 5AYWD 4IRUA 3ABLC 3IKOB 2MOWA 3FULA 4GU5A 4I43A 4YT5A 2J7PD 4E7ZA 4XKBA 3LKUA 4LEUA 3TXNA 4RSYA 3APFA 1QZ2A 2FFHA 5EGYA 3N2ZB 3FDQA 2IYLD 4J30B 3LJ3A 3PNTB 2J7PA 3VLFA 2J08A 3O6XA 5ARFA 4PJLA 3IHVA 1NU9C 4GA0A 2BE5F 4RG6A 4OIRF 3ONLA 3RJVA 4JCHA 3FUFA 3AU5A 4XKCA 2Y3DA 3ZC4A 4HS2A 3FUIA 3QWWA 3ZYMA 1QNFA 3PE3A 3VLEA 1UJKA 5KYYA 5KYXB 3QNKA 4NY3A 4BJ1A 1RJ9B 4GEHA 4ULWA 5AJLA 2V0PA 4I6GA 4U5BE 2GW1A 2XGSA 4KC9A 2WQ7A 3FUHA 3FH7A 2EQXA 3L16A 2IXOA 1E8WA 3GANA 2WXKA 3QMKA 2CFUA 1EDUA 3RK6A 3GODA 2HYZA 3LLKA 3I3NA 1D1CA 1E8ZA 3C98A 3PREA 4I1AA 3T6JA 3ZSUA 1EPUA 1UW4B 5D91A 3AS8A 1INZA 2E87A 2JD3A 3NYLA 3UGOA 3FTZA 4ILIA 3PUKA 2J0XA 3ZFWA 5A6CA 3UUXA 3ZYLA 5M72A 4ANWA 4QFVA 5FZSA 5LCWC 4G24A 3LJBA 2VTBA 3ZEFA 3LXUX 2J09A 3CVQA 1JWGA 2L6JA 3ZYKA 2CHZA 2KM4A 2C04A 2CG2A 1JPLA 4GPKA 1Z63A 5BW8C 5JJ7A 3CK7A 3L6AA 4I1OB 4FHKA 4L23A 1NZEA 3KD7A 3FTVA 1E8XA 5KCMA 3TJPA 1V55C 4U63A 4ILHB 3T4RA 3CHPA 4U04A 1TEZA 3FY4A 1WAO1 4IJJA 4PDXA 5ANLA 1FMWA 3FU3A 1XNFA 4B0ZA 4Q5SF 4GCOA 4UWHA 2VGXA 3PUJA 3APDA 2WVNA 2PP4A 4DVZA 3HTKC 3LS1A 3SBSA 4UWLA 1H19A 1ST6A 5F5HA 2IONA 4CT4A 4DOZA 2IOSA 4HLEA 4OIQF 4FA6A 4ZLDA 4F1SA 2Y4TA 2J9VA 3IBEA 4ACKA 1Y6IA 2EIKC 3LDZA 5JJTA 4N06A 3K6BA 3X1OA 2CW0F 3ZVVA 3ZIBA 2WXHA 4CDNA 2QFCA 1MQSA 1MMNA 2I2OA 4DBRA 2XCBA 4B8AA 1HH8A 4BFRA 4JHKA 2EINC 4B94A 4G11A 3TXMA 2PQRA 4FU3A 4HEAJ 1QZXA 4QI0A 4O6YA 3BEEA 2R7UA 3URZA 5FQ6A 1VMAA 3K1HA 5FQ7A 3S7FA 2VTBB 3UMIA 2AWIA 4N2SA 4U5DE 3K1IC 2L0IA 2OVFA 3CK9A 4GMLA 1M57C 1OUVA 3ASFA 2VASA 3MYVA 1IZMA 3I5QA 4HOQA 5E76A 5EX0A 3K9IA 4KZ0A 4BY6A 4WWOA 2AW6A 2A6HF 4HOUA 2DGJA 4UI9J 4GB9A 5AJDA 3DAFA 3UMHA 4J8DA 3WODF 3RIPA 4IAOA 2H7VC 1Z6AA 4IN3B 4PJJA 5B1AC 2DYRC 2OCCC 3G2VA 1LKXA 5CMWA 4CDRA 1TJFA 3EGDA 2Y69C 4EZLA 2VGXB 3B7TA 3CK8A 3WXXA 3PH0C 4Q4ZF 3LYAA 4MNDA 3R7QA 3AS5A 3HYMB 4AY5A 3S29A 3AS4A 3TL5A 2IJGX 3FUKA 1J8YF 1O87A 1D1BA 3LEVA 3CQCB 2KC7A 3RIBA 1ZHXA 2X6IA 3CSTA 2E2EA 2VB6A 1UN9A 2J46A 2CDQA 1VYKA 3CSKA 2AXUA 4RG9A 4U0SA 3ZPJA 4DI4A 3N24A 3TGOA 1ZU4A 2FBNA 1HU3A 5KYNA 2Y3AA 2L9BA 3AG2C 3FUEA 4G0HA 3ABMC 2WXMA 5CI8A 3CVYA 4LLCA 1FCHA 4I1MA 4JA7A 4EZKA 3KH2A 3SEOA 4AX2A 3SI5A 4ZLCA 4G1TA 5HQ8A 3D3MA 3NRHA 1DVPA 4KI2A 3ESKA 3R9AB 2DIWA 3CVPA 2RD0A 4ANUA 3N71A 4J6IA 2W4MA 3MX3A 1Z5ZA 4FJZA 4WUYA 4PS3A 3UGPA 1OCCC 2WXOA 3MCXA 2XXAA 3LESA 2BTDA 3ZW3A 1B89A 3E9VA 4WAFA 1ZYRF 3ASGA 3HHMA 3QARA 2A68F 4MS6A 2OG2A 1U3DA 4O6FA 4OYSA 3SZRA 2I1KA 3UR3C 3T5XA 3ZIMA 4C9BB 2NUTA 2C03A 3FU5A 3MV3B 3DXJF 2GGFA 3OTNA 3FTWA 3VTXA 2RG8A 4G7ZF 4E7SA 2XHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5P A; 
#chains in the Genus database with same CATH topology
 4J8E A;  5JHB A;  3HLZ A;  3Q7F A;  3EGD B;  3UMV A;  2P9K G;  1G5Z A;  5AIJ A;  3C8G A;  3LPZ A;  4AL1 A;  4JHR A;  4OVV A;  5BV0 A;  3D9L A;  1YYX A;  4AY6 A;  4KT6 B;  3U8V A;  4KVO A;  2DYS C;  4GQH A;  2KC3 A;  1HW2 A;  2H6I A;  2H7O A;  2GRQ B;  2H6H A;  3SY2 A;  4HQD A;  4HBD A;  4EQF A;  2V4H C;  3LJN A;  2P9S G;  3TAX A;  2XPY A;  2XLH A;  2PM7 A;  2IFU A;  1VOM A;  4DVY P;  4CT0 A;  3FU6 A;  3ULQ A;  3GZ1 A;  3I4G A;  5L3Q A;  3I4R B;  4U07 A;  2YZS A;  1U0B B;  3B95 A;  4J0U A;  3W8H A;  4NTA A;  5COM A;  3EIQ C;  4H54 A;  5BV1 A;  4W9R A;  4EUK B;  3VTY A;  2KCV A;  1MX4 A;  2LAI A;  3JCU Q;  5B3S C;  4AV7 A;  1YZA A;  1KNY A;  3QW1 A;  3MGB A;  3SNX A;  5E3C A;  4E6H A;  3OXF A;  1IQU A;  2M4E A;  4OD5 A;  5BUO A;  1A5E A;  2AU5 A;  4CDV A;  3QJZ A;  2XPI A;  1AEP A;  2HFI A;  4GZ6 A;  3LNM B;  5T4Y A;  3S84 A;  2IQC A;  3RW0 A;  3AG4 C;  3EGX A;  1A17 A;  2J9B A;  4MVM A;  3RQF A;  2LSV A;  3ZNG A;  4IAR A;  1A41 A;  4XEV A;  2OOC A;  3RH3 A;  2XM0 A;  5JRA A;  1OY3 D;  4PJN A;  3FXH A;  4LAC B;  3FDH A;  4GTV A;  3E30 A;  4HRL A;  2O9X A;  3M15 A;  1SZI A;  4N3C A;  3X2Q E;  3EZI A;  4MVQ A;  1TQG A;  1H9T A;  1QQE A;  4E18 A;  3KSL A;  1ELR A;  3ISM C;  4I6E A;  2YQ8 A;  2J07 A;  4TV3 A;  3JQ1 A;  2E0I A;  3NMK A;  5LX8 A;  4UUC A;  2Q9A A;  2YHC A;  2UUI A;  4K5B A;  2EPL X;  3SFY A;  3DBS A;  2GRP B;  4XWJ A;  1J8M F;  4UDV A;  2HM8 A;  3ABK E;  2CFZ A;  1LE4 A;  2J49 A;  2P7V A;  4PJM A;  3NYJ A;  3CVW A;  3OA1 A;  2BF0 X;  1G4U S;  1H2U A;  3LY7 A;  1BI8 B;  4N5C A;  3CHR A;  2XLW A;  4B89 A;  3S28 A;  4CS7 A;  1E84 A;  4N5Q A;  2JX0 A;  4YL3 A;  1DOW A;  2NUT B;  1H6G A;  1E8Y A;  4PH4 B;  3LS0 A;  2RKK A;  1T6Q A;  1S7Z A;  1IKN D;  1UG7 A;  2LFF A;  4UWK A;  1FAP B;  2I9C A;  5G04 C;  1ELW A;  3IQ5 A;  3K33 A;  4YT8 A;  3UIN C;  3W2W A;  5CCL A;  4DJA A;  2R25 A;  1YYH A;  2HJ3 A;  3FTY A;  1HW1 A;  3NQP A;  5DS5 A;  3HNK A;  3JUE A;  4J7Y A;  4FES A;  4CGW A;  5FZQ A;  2V8S E;  3G2U A;  5HS0 A;  3L34 A;  2GRR B;  4CX9 A;  2UY1 A;  1OW8 A;  3CR3 A;  3ITF A;  3NAW A;  2ZU6 B;  3ASN E;  1DCE A;  4HOT A;  3ASO E;  3PS6 A;  3C8G B;  4JZY A;  4HXI A;  4JXT A;  3PVL A;  1NA0 A;  4FLB A;  5C1D A;  4QDL A;  4C3B A;  5D0Q D;  1U3C A;  5IY5 C;  3CLJ A;  1ORY A;  2LAH A;  2YVK A;  1UJJ A;  2EPN A;  3SD5 A;  3UKR G;  4BEM J;  1A7V A;  5DS4 A;  4TUU A;  2XRZ A;  2IOL A;  2L6G A;  4NIK A;  4GZD A;  1LS1 A;  4O6N A;  3MJW A;  5A7D B;  1S0P A;  3ZU7 B;  4XQ1 A;  1P5Q A;  4OIO F;  4CS8 A;  4GYW A;  1H6O A;  3Q15 A;  2YIN A;  4BJ5 C;  5JJ6 A;  1EI7 A;  3IXE A;  3DD7 A;  4JA9 A;  2YL1 A;  4RBN A;  4X8Q A;  2EIM C;  1O1R A;  2VGY A;  2VSX E;  4CCA A;  3PNL B;  1JWF A;  3RO3 A;  2ZIR A;  5T1D B;  2ZPA A;  3NF1 A;  3RYL A;  3CSF A;  2ZXW C;  3LY8 A;  1OCO E;  1PC2 A;  5CCM A;  2VSY A;  5BNW A;  2XGM A;  4U8V D;  3D9P A;  4EBJ A;  2KW3 C;  4NRH B;  1K8K G;  1YZC A;  3EGX B;  3L54 A;  3QOU A;  3RU0 A;  4UI9 K;  3EFO A;  2A69 F;  3FOP A;  3JYY A;  2IU1 A;  4BTA A;  2HKV A;  4K0D A;  3S7J A;  2WQ6 A;  1CGN A;  2ETB A;  1QVX A;  2L81 A;  2WL8 A;  2AVP A;  1NFN A;  1ZHY A;  4H7Y A;  5EDS A;  4GTO A;  5DS6 A;  1BD8 A;  4ILG A;  3DEO A;  2GRL A;  2XL8 A;  1JPN A;  4ULV A;  4BX9 A;  2WXI A;  4APO A;  2PX3 A;  2WVI A;  4O7G A;  2P2C P;  3LLI A;  2VCB A;  2FGY A;  3TOM A;  4V3I A;  4GTT A;  5EHH A;  4BSZ B;  4Q7C A;  4U5H A;  1E7V A;  3B7U X;  4HE8 D;  2L6F A;  3V5Y A;  2HS5 A;  4N4W A;  3POV A;  3CGH A;  1O5M A;  3K66 A;  3CVU A;  4MVZ A;  3Q79 A;  4HI8 A;  5DBK A;  4F6R D;  2QY9 A;  1OWM A;  2NSG A;  1H9G A;  4BJT A;  4CSA A;  3GW4 A;  4I2W A;  4A1S A;  1VYI A;  4C0E A;  1D8E A;  3DMD A;  2GDC A;  1FFH A;  4BT8 A;  3FFL A;  3UIO C;  5EIL A;  1VK5 A;  1NG1 A;  2FO7 A;  2LNI A;  3TJ6 A;  4MW8 A;  1HE8 A;  1OWO A;  4UQZ A;  5BXO A;  1Z23 A;  2UY1 B;  4Z68 A;  4L2L A;  2F22 A;  5KYU A;  2R05 A;  5T3T A;  3QB2 A;  2BKG A;  3ML8 A;  2YNQ A;  2WXL A;  1H6K A;  4BX8 A;  2QTV A;  4EHP A;  1Q0D A;  3PDN A;  4XI9 A;  2HR2 A;  4I6J A;  1HY5 A;  1C02 A;  2J9Q A;  4L9P A;  2XZT G;  5JP7 A;  1NU7 D;  1SA5 A;  4LDR A;  1I4Z A;  4U95 D;  3R9M A;  4EBA A;  3CHO A;  4HB5 A;  4C3E A;  1FFT C;  2C0L A;  2Q7F A;  2G62 A;  4GTM A;  4U5E E;  3KMI A;  1NSG B;  4E0H A;  1AP7 A;  4FLH A;  2FF4 A;  3PEU B;  3HXD A;  5KYY B;  5A23 A;  4NAC A;  3ASH A;  4OIP F;  3U9W A;  5JS5 A;  1LI5 A;  2HV6 A;  3LEW A;  2WXN A;  3CQZ A;  4NTF A;  1N4S A;  4BJ6 C;  4NQF A;  3JXJ A;  1RZ4 A;  3CV0 A;  1Y6D A;  3ZUV B;  2WXF A;  2I1J A;  2LQG A;  2XRH A;  3NKE A;  3EFO B;  1LVK A;  3DM5 A;  1OT8 A;  1LD7 A;  3DZA A;  3EG9 A;  4GYT A;  1S05 A;  4U9E A;  3EUV A;  1TNU A;  1GGQ A;  5ENO D;  5HRY A;  2Y4U A;  3FHD A;  3EHN A;  1KT1 A;  4AM9 A;  3AGT A;  4GTS A;  4F7A A;  2V3C C;  1YAR O;  4L1B A;  4LLE A;  3UKU G;  4XLN F;  5DLJ A;  3ZG1 A;  2AWY A;  1X81 A;  4MRU A;  1V54 E;  3U3B A;  2MHK A;  2ASR A;  2Q9C A;  4AE4 A;  2ILR A;  4E0I A;  4G23 A;  1Z3I X;  3BEH A;  1PCX A;  2DVW A;  4PS8 A;  4DK5 A;  3DRA A;  3Q73 A;  3HNL A;  2LXM A;  2XZD G;  3C3O A;  5HI7 A;  2AXV A;  1EKY A;  3EIJ A;  3VYW A;  5KBA A;  2D5R B;  3LS8 A;  5J90 A;  1O5H A;  3SBT B;  5F28 E;  3X2Q C;  4U5C E;  5L0G A;  3AJI A;  1QQ3 A;  1G3N B;  1FT1 A;  3V7O A;  3O4Z A;  5AQA A;  4BEP A;  4OD4 A;  1JUQ A;  3KSQ A;  4MKT A;  3JYH A;  2WPV A;  4G7O F;  2ZXO A;  1LS4 A;  4CS9 A;  3E4B A;  3FEY A;  1KT0 A;  3T8M A;  3ABK C;  1MX2 A;  3RSE G;  4BTB A;  1Z6T A;  3KPH A;  4O60 A;  4HLL A;  1SZ9 A;  1OCR C;  4IYP A;  3ABL E;  3TWV A;  3W8I A;  5AQ9 A;  1FVF A;  3TG4 A;  4N39 A;  5EN5 D;  1ORS C;  1GS9 A;  3FUJ A;  1HZ4 A;  3SFZ A;  4HRM B;  3ZHE A;  4O79 A;  1A0B A;  1ZW3 A;  2Q3T A;  2Y39 A;  3H2U A;  3HXC A;  5FQ8 A;  4LCT A;  2D4U A;  3DAG A;  3IQC A;  2J8W A;  5CMY A;  5KYU B;  4C3D A;  2KSF A;  1Z3Y A;  2NYJ A;  2WXP A;  3FTX A;  4KYO B;  3L82 A;  5D2M C;  3TJ5 A;  4EIY A;  3J5Q B;  3Q5M A;  1K04 A;  1YYJ A;  3FUN A;  2AVK A;  3IEG A;  3QWV A;  1GQA A;  3CQG B;  3UI2 A;  2OVB A;  1OW7 A;  2DZN A;  3IHU A;  4PS7 A;  1N4P A;  1OWN A;  3OXG A;  4YDE A;  3C63 A;  4FWV A;  2Y1L E;  1ORJ A;  2UWJ G;  1MHQ A;  1XGW A;  4XEF A;  1MMD A;  4DRI B;  3C62 A;  3ASN C;  4KXK B;  3ASO C;  5ENR D;  3RQE A;  4MW3 A;  2YEV A;  3NOC D;  1BI7 B;  3HKK A;  2BUG A;  2XRY A;  3DSW A;  1BR2 A;  2KXP C;  3LNR A;  4J7T A;  1JOG A;  3RRM B;  1PAQ A;  4WJ0 A;  2WB7 A;  4LUN U;  2AXZ A;  3D9H A;  4M7C A;  3UT7 A;  2FO1 E;  2IBF A;  2XPZ A;  3C3R A;  4BES A;  2OQM A;  3R2P A;  5ENQ D;  1SR2 A;  5J08 A;  2YKZ A;  3FEX A;  3DE8 A;  5AC4 A;  4A3V A;  1IW7 F;  2EPK X;  3W4Y A;  3APC A;  1A7D A;  4JUR I;  1YJG A;  3HDX A;  1WY6 A;  4E17 A;  3UM2 A;  2YLI A;  4F4B A;  1I5N A;  3EG9 B;  4K7B A;  4NC3 A;  3WG7 E;  2BL2 A;  4GZC A;  4AIF A;  5A6K A;  4BWR A;  1OCO C;  4G26 A;  3AG3 E;  4Y6C A;  1N95 A;  1TN7 A;  5FQ4 A;  2F8Y A;  3Q7G A;  2CHW A;  4ANV A;  3ZXP A;  3G2T A;  1NBB A;  4AE4 B;  3W9F A;  4HFF B;  2A5U A;  1ZB1 A;  4EBA G;  3F46 A;  1KZP A;  256B A;  3CHM A;  2X6F A;  2LO6 A;  3DWL G;  1O1S A;  3NB2 A;  4ZHB A;  2G3K A;  4CSA C;  3L13 A;  3QWP A;  2KJG A;  4WWN A;  1VB5 A;  2ETS A;  4YWQ A;  2MYS A;  4PFO A;  3JUI A;  2WZG A;  4EBB A;  2X51 A;  5ENN A;  3VAY A;  5KJM A;  1T6U A;  3UNG C;  2XEN A;  2EIJ C;  5CBO A;  4KNW A;  3IHY A;  5DIZ A;  3DSU A;  3CHS A;  3JQ0 A;  4FC8 A;  3UPV A;  2Q9B A;  4ZFH A;  1L3P A;  4J8S A;  4JL0 A;  1E7U A;  4LDQ A;  3FAJ A;  2P9I G;  4UWF A;  3L22 A;  4DBQ A;  1PY1 A;  5LOZ A;  3ZHE B;  2MWQ A;  1I4Y A;  4UI9 C;  5F5F A;  1HX8 A;  1OCZ E;  2DCP A;  5KNH D;  5T8I A;  4JEU A;  5G05 J;  2R02 A;  3L17 A;  5CEA A;  5LFA A;  4P9F A;  2OND A;  4I44 A;  2B0O E;  5BQG A;  2WXR A;  4JEH A;  5ENT D;  4ONS A;  1N9A A;  4P29 A;  3CVX A;  3JXI A;  3VF0 A;  2NPU A;  5FZT A;  5KJL A;  1JR8 A;  4TXR A;  5BQI A;  3D9O A;  5ANR A;  4I3M A;  4A55 A;  3S0X A;  3WAQ A;  5FCL A;  5B1B E;  3ATP A;  4MVS A;  3G2S A;  3RKO F;  3T5V A;  4I17 A;  2VSN A;  4WND A;  4Q94 A;  2PX0 A;  4YND A;  3NKD A;  2MRI A;  4ACL A;  3KYJ A;  4YJW A;  5JLI A;  3QDN A;  1C17 M;  1D0Y A;  3E34 A;  3CIA A;  4G25 A;  3D9M A;  1FPP A;  3NDB B;  2HJM A;  4MVU A;  3Q6M A;  4JRZ A;  4KBL A;  3LY9 A;  3GWL A;  4B6I A;  3IEE A;  3B7R L;  4F53 A;  5A6B D;  4ANX A;  5JT4 A;  3E33 A;  3VLD A;  1TKN A;  4PUC A;  3EPV A;  1FTS A;  3TWR A;  1YAU O;  3MYF A;  4YN0 B;  2V26 A;  3DXK G;  5H7P A;  4Y6W A;  1Q2Z A;  5EYP F;  3SF4 A;  2J0W A;  2ZXP A;  1IQR A;  1NFO A;  4PFP A;  2W9Y A;  3M79 A;  3RRN B;  3RFY A;  3A11 A;  3DSS A;  1M2O A;  4MLP A;  5FZR A;  5AC5 A;  5A6B A;  3CKC A;  4YVO A;  3Q47 B;  4AP2 A;  1ZW2 A;  5KYX A;  2L9J A;  3EHM A;  1KU2 A;  1N52 A;  3D9K A;  3QC1 A;  2EIL C;  2DBA A;  1TWH A;  3FUM A;  4DPR A;  3QVY A;  2WVO A;  1AWC B;  1RKE A;  4LG6 A;  2H7B A;  5EYL A;  4CDY A;  1RXQ A;  1IXV A;  5G55 A;  3UTM A;  5T3W A;  2OEV A;  5C2Y A;  2FUL A;  1TFK B;  1TNO A;  4O1P A;  1ZHW A;  4JW1 A;  1G4W R;  4DUI A;  5L3V A;  3EH2 A;  4L7T A;  2Y3B A;  2LSE A;  4AOF A;  3PZD A;  3ZWI A;  4BEJ A;  3V31 A;  2ZGD A;  4GA1 A;  4FJY A;  2VCA A;  4APF A;  5CBN A;  3S7D A;  2XXA B;  2X6K A;  1V54 C;  3KAE A;  3TQO A;  4L2Y A;  2HMQ A;  3MLG A;  4EEC A;  1JCQ A;  4N2Q A;  1MYO A;  3U2L A;  3VRC A;  3PZ1 A;  3NBN B;  2R17 C;  3B7S A;  5CIV A;  3Q9N C;  3SXM A;  3ML9 A;  5LCW J;  3B0V C;  2R59 A;  3V79 K;  4RD9 A;  3K7D A;  4GA2 A;  1V74 B;  3ENE A;  2Q4F A;  1LD8 A;  3L1M A;  1M2V A;  3MYI A;  4J32 B;  4AJW A;  1T6I A;  1M56 C;  3OEO A;  4URK A;  3RF3 A;  2QY7 A;  1GW6 A;  2KZT A;  4NUR A;  2ZXR A;  4G78 A;  4XPW A;  5ARG A;  4JTD B;  1OWP A;  4LER A;  2H6G A;  4Q96 A;  4CGV A;  3Q4A B;  2QE9 A;  1SQM A;  3SP1 A;  3FUD A;  2J8S D;  4XIF A;  4EWC A;  3KS2 A;  1K05 A;  2VYI A;  3K1I A;  3UX4 A;  4GYY A;  4DLQ A;  3PMR A;  3UM0 A;  4CJG A;  4PK4 A;  1TN6 A;  2QYU A;  4LNG A;  3DJN B;  4RVB A;  1SYQ A;  2LSU A;  5D66 A;  3S7B A;  2WMN A;  2YRF A;  1U89 A;  1B68 A;  5TJ5 E;  3RQG A;  3DSX A;  2R7W A;  3ASD A;  4I9C A;  3JYS A;  1UFB A;  5KJN A;  1NL4 A;  2YL7 A;  4Q69 A;  3PRZ A;  1NP7 A;  5AQ7 A;  5AN8 A;  2V5Q C;  1RW2 A;  2BED A;  3EHQ A;  3MKQ A;  2CHX A;  2W45 A;  4KMO A;  4QI2 A;  2WB2 A;  4DLO A;  5BPP A;  4OVU A;  2XS8 A;  3QZC A;  2R7V A;  3M1C B;  4H4K C;  1MX6 A;  3SXY A;  2WXJ A;  3W9G A;  2M63 A;  1HS6 A;  4AEZ C;  1T9K A;  2OJQ A;  2VH3 A;  2J4D A;  2YHS A;  3FVY A;  3ZQY A;  2JAB A;  5L0D A;  4WGY A;  5E3A A;  3KL4 A;  3HVE A;  4A1G A;  4EZJ A;  3SGH A;  5D0O D;  2X38 A;  5CI9 A;  3PZ2 A;  3P1U A;  2L0T B;  2R7R A;  3CVN A;  2Z15 A;  4HOR A;  4JTA B;  2NUP A;  5FJY A;  3PZ4 A;  4AXH A;  3H65 A;  3MKR A;  4R7L A;  3NG1 A;  1RKE B;  3DSV A;  2G3V A;  3V2X A;  3BG0 B;  3C5R A;  1RCP A;  3UT4 A;  4D10 C;  4KZC A;  5FIN A;  2WZL A;  3KEA A;  4CDM A;  3GM3 A;  1S63 A;  1Q0G A;  2XM4 A;  1Y8M A;  3GYZ A;  3EZH A;  2X3M A;  3WG7 C;  3RKV A;  5DVW A;  4GTQ A;  3L0I A;  1HXI A;  3AG3 C;  2B0J A;  2HV7 A;  2F0Y A;  5FIO A;  1YA0 A;  3T8K A;  2NG1 A;  5AEN A;  1QLE C;  1N4Q A;  3CVV A;  1SW6 A;  3PEV B;  1IHG A;  3I4U A;  1DC2 A;  3R7R A;  2KNH A;  1L5J A;  2R03 A;  4RQI A;  2FI7 A;  2XLV A;  2A4Z A;  4GYO A;  1TWA A;  5E75 A;  2J9W A;  2AWC A;  1E90 A;  1H2V C;  3SQV A;  1X5B A;  4ER9 A;  2GRN B;  4XE0 A;  4G2V A;  2KCK A;  5DQZ A;  2F8X K;  2VJ8 A;  3PCV A;  1VLT A;  4DXW A;  5HV9 A;  5KYW A;  3DE9 A;  1MMA A;  2IXN A;  2HO1 A;  1W2W A;  1UG3 A;  2XS1 A;  1V4A A;  2PNO A;  3EJN A;  1M2V B;  2ICW G;  3BRJ A;  3C3Q A;  2KZT B;  1BR1 A;  2XLD A;  1D9S A;  3DM9 B;  3BUA A;  4GCN A;  4LRZ A;  4HFK B;  3AG1 E;  1OKK D;  3AGU A;  1OR2 A;  4CBE A;  1APC A;  3QK0 A;  4JE9 A;  3B0U X;  4HFG A;  3Q6N A;  2P9L G;  1WAS A;  2HSQ A;  3AQC A;  1H6P A;  1OCZ C;  4UQY A;  1DNP A;  3ECS A;  1WG0 A;  2A0B A;  2P58 C;  3HXF A;  3B0P A;  2A5E A;  2C0M A;  1TWC A;  4IGG A;  5COG A;  3J5P A;  3CKB A;  2P6V A;  3SXK A;  1OKK A;  1DOV A;  2I15 A;  5DQT A;  5AQB A;  1QKR A;  1SF8 A;  2NC9 A;  3CEQ A;  3M4C A;  3MKQ B;  2YLG A;  3S2A A;  5B1B C;  1JAF A;  4ATG A;  2CGE A;  3UM3 A;  4EHM A;  3U2M A;  4X0R A;  3GZ2 A;  3T6B A;  4WAB A;  4JZA A;  4MVR A;  4WNE A;  4JJF A;  3ZGQ A;  1JMW A;  3E32 A;  1NA3 A;  2HE0 A;  3ZVR A;  2JEK A;  4CRW A;  3SHF A;  4KBQ A;  1JPJ A;  4GPM A;  2XEH A;  4HVB A;  5K0I A;  2W4B A;  3HVE B;  3UM1 A;  1OXB A;  5L0F A;  1ZU2 A;  1BR4 A;  1LPE A;  3LCA A;  1IYG A;  1XZQ A;  2ZGG A;  2PNN A;  4GMJ A;  1E2X A;  1E96 B;  5L0C A;  4Z9I A;  2CNW D;  3KYI A;  3KEZ A;  4EPZ A;  2PM6 A;  3FHE A;  2NUP B;  5CHE E;  3EDT B;  3NZS A;  1YCS B;  4YT2 A;  4IAQ A;  2HSB A;  2ZD9 A;  3NOG D;  4D4X A;  3DXM G;  4WNG A;  4YT4 A;  4JPS A;  3FOO A;  3L8J A;  4JHJ A;  2CNW A;  2MHR A;  3C18 A;  1PD0 A;  5A6J A;  5CRU A;  3JT1 A;  3DJU B;  2OEX A;  3TWS A;  2YHE A;  1FNT c;  3PHF 2;  3TWT A;  4FAD A;  5T3R A;  2KCL A;  2NXP A;  4IUL A;  3U4T A;  1ELK A;  2PZI A;  2AJA A;  2FAP B;  2IM8 A;  4JC8 A;  5HKP A;  3LAY A;  2IEJ A;  4C0M A;  4J8Y A;  1K3Z D;  3ZDL A;  5KYW B;  2NSZ A;  5JVE A;  4GAA A;  4ATZ D;  1HMD A;  2WM9 A;  1OR3 A;  4GZ5 A;  1TNY A;  2MYO A;  4G8K A;  4DX1 A;  2J9U A;  3L08 A;  3SNH A;  2VQ2 A;  3Q78 A;  3EH1 A;  3UXG A;  3OWT A;  1LIH A;  1MQV A;  4CDA A;  3ONK A;  2Y3G A;  1HMO A;  5ITZ F;  2UUH A;  4OIN F;  4I2Z A;  2VSO E;  4JJG A;  4F3V A;  3BG1 B;  2H8A A;  4CS8 C;  4HRN A;  2LFD A;  4DX7 D;  1ZHZ A;  3Q7L A;  3FTS A;  1EYH A;  1LE2 A;  4TRQ A;  1CPR A;  3AJM A;  2X6J A;  3S90 A;  2ZIS A;  4RDA A;  2WMO A;  5EX3 A;  2IY0 C;  4BT9 A;  1C03 A;  4U0Z A;  4C7O A;  4TUM A;  4U5G A;  5G2N A;  4AK9 A;  3FMS A;  3TWX A;  4M3O A;  1D1A A;  4H7X A;  4GTR A;  4CIH A;  4CEM A;  3TG5 A;  5JA4 D;  3U3W A;  3T6G B;  2FEZ A;  4UQX A;  5KJK A;  3RVZ A;  3NYM A;  2YWA A;  5CEC B;  4M63 A;  1GM5 A;  4CYM D;  1WM5 A;  3CVL A;  3EU5 A;  4ME2 A;  1N94 A;  1WAT A;  4B8C B;  1H7I A;  3GEE A;  1MZC A;  1ZBP A;  4K0R A;  3OAW A;  2OJE D;  4GZ3 A;  3ZXS A;  1TJC A;  5AAR A;  3ULY A;  2R5S A;  1PD1 A;  2WXG A;  2KAT A;  2A1D D;  1YVI A;  3QVZ A;  4QQI A;  4WWP A;  1HFA A;  3ESL A;  3FH8 A;  4G7H F;  3DPD A;  3JSE O;  3MEK A;  2ETC A;  4K03 A;  1HF8 A;  4N3A A;  4Z9J A;  5FWQ A;  3FP3 A;  4XLP F;  4JKV A;  1YMP A;  2IXM A;  2PF4 E;  2WXQ A;  2OOE A;  2X6H A;  3O48 A;  1HE9 A;  1JCR A;  3HIZ A;  3EU9 A;  1FMV A;  3EQL F;  2I6H A;  4XTK A;  3FU0 A;  4DX5 D;  4J8F A;  4NQ0 A;  4BJ5 A;  3O39 A;  4JVS A;  1WWP A;  1MND A;  2GA0 A;  4LDK A;  2L7A A;  1SA4 A;  5JHA A;  3TK0 A;  3G4X A;  2P0N A;  1R5I D;  2CYD A;  1EA8 A;  3IV0 A;  5JUA A;  1OWL A;  4CJO A;  5D92 A;  2LP4 A;  1BDJ B;  3D9J A;  2Y3H A;  1Y4C A;  4MQ9 F;  2X0C A;  4RLY A;  4MVO A;  3RO2 A;  2WVQ A;  1VLS A;  2R7X A;  3UQ3 A;  1FVH A;  3RVY A;  1XZP A;  2R7S A;  3TD7 A;  2KBX A;  1BPO A;  3F47 A;  4WGZ A;  1LI7 A;  3ZN3 A;  5LP0 A;  1HG2 A;  4BG0 A;  2P9U G;  2WZF A;  4FX5 A;  1Q0F A;  2GRM A;  1TWG A;  3JSZ A;  5BQH A;  3AQB A;  2KQ9 A;  3TUL A;  3LVQ E;  2IOQ A;  4YVQ C;  2C2L A;  5A6A A;  1KLX A;  4E85 A;  2VGE A;  1TNZ A;  1CPQ A;  2V5F A;  2XLO A;  2LCH A;  3JZ0 A;  4BPM A;  1Z5S C;  5BT1 A;  4JCZ A;  4DI3 A;  1ZU5 A;  1V55 E;  3D9I A;  4N3B A;  1D0Z A;  2A6E F;  1TNB A;  1MNE A;  3B9Q A;  4GMR A;  4HOS A;  4XX5 A;  2HMZ A;  1IHB A;  1N1C A;  3SZ7 A;  3ZYQ A;  1Q0M A;  3NZU A;  2TMV P;  3D9N A;  3AAA C;  3G50 A;  5G04 J;  3PDM P;  5CRV A;  4A3T A;  3U64 A;  4XPX A;  3P2B A;  3MFN A;  5AAO A;  3O10 A;  2GFH A;  1NZN A;  3QTH A;  4W8P A;  4XZ4 A;  4C7O B;  2Y0B G;  2WQH A;  3SYN A;  4P9T A;  1WTY A;  4IWB A;  1TR2 A;  3OXL A;  4KNV A;  2R7Q A;  3AG1 C;  4XI0 A;  3GZS A;  2PQN A;  2AP3 A;  3AU4 A;  4K5A B;  1H2T C;  2IXP A;  4O6M A;  3MZL B;  2RD9 A;  3PZ3 A;  5EK0 A;  1CGM E;  4FP7 A;  2XCC A;  3S27 A;  2XGO A;  1N54 A;  4U9D A;  5FT9 A;  2PL2 A;  1D8D A;  5L0J A;  3E70 C;  4WNF A;  2R7T A;  1SZA A;  3FH5 A;  1OW6 A;  1ZHT A;  4U7E B;  3QW0 A;  4NCQ A;  2CG3 A;  4KVM A;  2XQ0 A;  2R2L A;  5JSL A;  3U8P A;  2XSE A;  4U8H A;  2EIK E;  1BLX B;  3CZ6 A;  1RMV A;  3IQ6 A;  3KKB A;  4FUL A;  4W8K A;  3U66 A;  3Q49 B;  2QZA A;  5HSW A;  3I5P A;  4HNA D;  3GEI A;  3B13 A;  3QAQ A;  1S70 B;  2M64 A;  4LSZ E;  2OV8 A;  3JRT A;  2XEV A;  2F37 A;  4FAP B;  2JLB A;  1RJ9 A;  3TWW A;  1TFO B;  1KZO A;  1FR0 A;  1Z3X A;  4IB4 A;  3HXE A;  4N6H A;  3R7C A;  4G8L A;  1M6T A;  4ABN A;  5E2Q A;  2EIN E;  3UMK A;  3U5S A;  3QKY A;  3UT8 A;  1UN8 A;  2Q00 A;  3EHR A;  3MV2 B;  3PE4 A;  4XEK A;  5E33 A;  5EKQ D;  2I8B A;  3DKA A;  5FTP A;  3HJC A;  2XL4 A;  4K1O A;  4UWG A;  3FWV A;  3ZRH A;  2KGO A;  1FT2 A;  1H0A A;  2DI3 A;  4CS9 C;  4U5F E;  3B29 A;  2YLD A;  2J45 A;  4MS2 A;  3FTU A;  4I9E A;  2J4B A;  4BSX A;  4PR9 A;  2PFD A;  1ZVZ A;  1HG5 A;  3U9M A;  3MA5 A;  1EF1 C;  1QSP A;  4DRX E;  2LIG A;  3M4B A;  2P9P G;  4BJ6 A;  3LVR E;  1MMG A;  1D0X A;  4LNU D;  4R32 A;  4U8Y D;  3G2W A;  4AVX A;  4BET A;  2IF4 A;  4P6I C;  2DWZ A;  3TWQ A;  5COF A;  1W3B A;  2H6F A;  1QBQ A;  4ANJ A;  4FHJ A;  2GRO B;  3JTL O;  1WGW A;  3Q7A A;  3SO8 A;  3W2V A;  4AL0 A;  1OCR E;  1RKC A;  1G8X A;  1SMY F;  2Q7R A;  5KWD A;  1HO8 A;  3FAP B;  3C7J A;  3CHQ A;  1YLM A;  3JCK C;  5G05 C;  4U0U A;  2R7O A;  1VDY A;  1YA9 A;  2QC9 A;  2V4L A;  3N0T A;  5GPG B;  1LF8 A;  2EPO A;  4A2N B;  5BUZ A;  3RRU A;  2ETA A;  1YA7 O;  5B1A E;  2DYR E;  5AYW D;  4C48 B;  2OCC E;  3US6 A;  4IRU A;  3ABL C;  1JRA A;  3BU8 A;  3IKO B;  5EID A;  2MOW A;  3FUL A;  4GU5 A;  4I43 A;  4YT5 A;  2J7P D;  4E7Z A;  2Y69 E;  4XKB A;  1OQC A;  3C72 A;  3LKU A;  1QPU A;  1N0R A;  4LEU A;  4RSY A;  3TXN A;  3APF A;  1QZ2 A;  4HI9 A;  3HRA A;  4BER A;  4O1O A;  2FFH A;  5EGY A;  3N2Z B;  4DX6 D;  2HUJ A;  2B6C A;  3FDQ A;  4CIP A;  2IYL D;  4J30 B;  3LJ3 A;  3NMI A;  3PNT B;  2J7P A;  3HG0 D;  3VLF A;  2J08 A;  3O6X A;  5ARF A;  4PJL A;  3IHV A;  1NU9 C;  4GA0 A;  2BE5 F;  4RG6 A;  4OIR F;  3ONL A;  3DPY A;  3RJV A;  4JCH A;  3FUF A;  3AU5 A;  3U9J A;  4XKC A;  3ZTM A;  2IO2 C;  2Y3D A;  3ZC4 A;  1AUE A;  4XPY A;  4HS2 A;  3FUI A;  3QWW A;  3ZYM A;  4CZ2 D;  4TXP A;  1Q0K A;  1QNF A;  3PE3 A;  3VLE A;  1UJK A;  5KYY A;  5KYX B;  3QNK A;  3AG2 E;  4NY3 A;  4BJ1 A;  3IQT A;  1RJ9 B;  4GEH A;  4ULW A;  3ABM E;  5AJL A;  2LD6 A;  2V0P A;  4I6G A;  5EIB E;  4U5B E;  2GW1 A;  2XGS A;  4KC9 A;  1L7C A;  2WQ7 A;  3FUH A;  3FH7 A;  1VTM P;  2EQX A;  3L16 A;  3UIP C;  2IXO A;  2QYJ A;  1E8W A;  3HNJ A;  3A9C A;  3GAN A;  2RFM A;  3QMK A;  2WXK A;  2CFU A;  1EDU A;  3B71 A;  2QLA A;  4YDY A;  1NI1 A;  3RK6 A;  3GOD A;  2L6H A;  3L9T A;  2HYZ A;  3LLK A;  3I3N A;  1D1C A;  1E8Z A;  3C98 A;  4DJ9 A;  3PRE A;  4I1A A;  4MTG A;  3T6J A;  3ZSU A;  1EPU A;  3CEX A;  1UW4 B;  3HNI A;  3ZTZ A;  1BU9 A;  1K40 A;  5D91 A;  4Z9H A;  3AS8 A;  1INZ A;  1O3U A;  1BZ4 A;  2E87 A;  2JD3 A;  1OCC E;  3L8I A;  3NYL A;  3NMJ A;  3UGO A;  3FTZ A;  4ILI A;  3PUK A;  2J0X A;  3ZFW A;  5A6C A;  2LUH A;  3UUX A;  3ZYL A;  1EQ1 A;  2QUP A;  5M72 A;  4ANW A;  2EIJ E;  4QFV A;  5FZS A;  5LCW C;  4G24 A;  3H2V A;  1HE1 A;  3LJB A;  1PV3 A;  3V30 A;  3VM6 A;  2VTB A;  1E83 A;  1YDI A;  3ZEF A;  3LXU X;  2J09 A;  3CVQ A;  1N4R A;  1JWG A;  2L6J A;  4EKW A;  2CHZ A;  3ZYK A;  2KYH A;  2KM4 A;  4JB8 P;  2C04 A;  2CG2 A;  1JPL A;  4GPK A;  1Z63 A;  4MTF A;  3V5X A;  1KTM A;  5BW8 C;  2YL3 A;  3ZKJ A;  5JJ7 A;  3WHN A;  3CK7 A;  3L6A A;  4I1O B;  4FHK A;  4L23 A;  4L6R A;  1NZE A;  3KD7 A;  3FTV A;  4YDO A;  2DB4 A;  1E8X A;  4OAU C;  3GM1 A;  5KCM A;  1R4T A;  3TJP A;  3GWN A;  1V55 C;  2OKU A;  4U63 A;  2DYS E;  4ILH B;  5CED B;  3T4R A;  1N11 A;  3CHP A;  4N6C A;  4LNB A;  2GAQ A;  4U04 A;  1TEZ A;  3FY4 A;  1WAO 1;  4IJJ A;  3BQO A;  4D4N A;  2VC9 A;  4PDX A;  5ANL A;  1FMW A;  3FU3 A;  1XNF A;  3E37 A;  4B0Z A;  1SVX A;  3DST A;  4Q5S F;  4PAC A;  4GCO A;  4UWH A;  2VGX A;  3PUJ A;  3J06 A;  3ULE G;  3APD A;  4GTP A;  4YDW A;  2WVN A;  2PP4 A;  4DVZ A;  3HTK C;  3LS1 A;  5B3S E;  3SBS A;  4DX2 A;  4EBK A;  4UWL A;  1H19 A;  2CCY A;  4F1P A;  1ST6 A;  5F5H A;  2ION A;  4CT4 A;  4DOZ A;  2IOS A;  4HLE A;  4OIQ F;  4FA6 A;  4ZLD A;  4F1S A;  2Y4T A;  2J9V A;  1TR4 A;  3IBE A;  3AG4 E;  4ACK A;  1Y6I A;  2EIK C;  3LDZ A;  5JJT A;  4N06 A;  3K6B A;  2BC5 A;  2EIL E;  1WN0 A;  3X1O A;  2CW0 F;  1WOL A;  3ZVV A;  3Q9U C;  3ZIB A;  1OXJ A;  2WXH A;  4CDN A;  2OEW A;  2QFC A;  2VCC A;  1MQS A;  4U96 D;  1MMN A;  2I2O A;  2OU6 A;  4DBR A;  2XCB A;  4B8A A;  1HH8 A;  1F1M A;  2XLE A;  4BFR A;  3S9O A;  4YK5 A;  1K1A A;  3SXZ A;  3GOR A;  2QNL A;  4JHK A;  2EIN C;  1Z7Q c;  3TWU A;  4B94 A;  4G11 A;  3TXM A;  1K1B A;  2PQR A;  4FU3 A;  1TN8 A;  4HEA J;  4K5C A;  1QZX A;  4QI0 A;  4O6Y A;  3BEE A;  2R7U A;  3U3F A;  2LK4 A;  3URZ A;  1E86 A;  3GEH A;  3TOL A;  5FQ6 A;  3G4Z A;  1VMA A;  3K1H A;  3HXB A;  3Q75 A;  1QYM A;  2BKK B;  5FQ7 A;  3S7F A;  2RFA A;  1NLX A;  3IPM O;  2VTB B;  3UMI A;  1KPS B;  1N0Q A;  2AWI A;  4N2S A;  1WDY A;  4U5D E;  3K1I C;  2L0I A;  2OVF A;  3CK9 A;  1S64 A;  4GML A;  2DZO A;  1M57 C;  1OUV A;  4JD2 G;  3DI5 A;  3F6Q A;  3ASF A;  2VAS A;  3AOU A;  1MJ0 A;  3MYV A;  3T9K A;  1IZM A;  3I5Q A;  3ZQV A;  5ENS D;  2L6B A;  4YL0 A;  4HOQ A;  5E76 A;  5EX0 A;  3K9I A;  3V5Z A;  2LXL A;  4KZ0 A;  4BY6 A;  4WWO A;  2AW6 A;  2A6H F;  5JMN D;  4HOU A;  2DGJ A;  4UI9 J;  4GB9 A;  5AJD A;  3DAF A;  3UMH A;  4J8D A;  3WOD F;  3RIP A;  5IY5 E;  4IAO A;  1LTX A;  2H7V C;  1Z6A A;  4IN3 B;  4PJJ A;  1T01 A;  2DYR C;  5B1A C;  2OCC C;  2P61 A;  3G2V A;  4B93 B;  1LKX A;  1BBH A;  5CMW A;  4CDR A;  3C8Z A;  1TJF A;  1DCQ A;  4JTC B;  2HZ8 A;  3EGD A;  2Y69 C;  1CGO A;  4EZL A;  1U6H A;  2VGX B;  3B7T A;  3CK8 A;  2P9N G;  3WXX A;  4A63 B;  4JIO A;  3PH0 C;  4Q4Z F;  3LYA A;  4MND A;  3R7Q A;  3LEO A;  3AS5 A;  2EIM E;  2PBE A;  3HYM B;  3GM2 A;  4AY5 A;  2B0H A;  3S29 A;  2GWW A;  3AS4 A;  3TL5 A;  2IJG X;  3FUK A;  1J8Y F;  1O87 A;  2ZXW E;  1D1B A;  3LEV A;  4MTO A;  3CQC B;  2KC7 A;  3RIB A;  1ZHX A;  4XEI G;  4OAV B;  3DEP A;  2X6I A;  3B7B A;  3CST A;  2R9R B;  3JRM O;  2E2E A;  2VB6 A;  1UN9 A;  2J46 A;  2KK1 A;  2CDQ A;  1VYK A;  3LUT B;  3U0C A;  1UOH A;  4J7W A;  3CSK A;  5KNG A;  5L0I A;  4YL1 A;  2AXU A;  4MBG A;  4RG9 A;  4U0S A;  3ZPJ A;  3RAU A;  1XWJ A;  2P1A A;  2RSE B;  3N24 A;  4JEB A;  4DI4 A;  3TGO A;  1ZU4 A;  2FBN A;  1HU3 A;  5KYN A;  3O55 A;  2Y3A A;  2L9B A;  3AG2 C;  3FUE A;  1U2V G;  2IO3 C;  4G0H A;  1ZZP A;  3ABM C;  2NSF A;  2WXM A;  5CI8 A;  1E85 A;  4LLC A;  1FCH A;  3CVY A;  4I1M A;  4JA7 A;  5CER B;  4EZK A;  3MBG A;  3KH2 A;  3SEO A;  4AX2 A;  3SI5 A;  1T5O A;  4ZLC A;  2XEE A;  4G1T A;  5HQ8 A;  3D3M A;  3NRH A;  4JC7 A;  1DVP A;  4KI2 A;  2JPU A;  3ESK A;  3R9A B;  2DIW A;  4DRH B;  3CVP A;  2RD0 A;  1TYQ G;  4ANU A;  3N71 A;  4J6I A;  2W4M A;  2XLM A;  3MX3 A;  1Z5Z A;  4FJZ A;  4JEA A;  5AGF A;  4WUY A;  4A4A A;  3V2O A;  4PS3 A;  3UGP A;  1OCC C;  2WXO A;  2YQY A;  4DRJ B;  3MCX A;  2XXA A;  3LES A;  2BTD A;  3ZW3 A;  3CAX A;  5ENP D;  1B89 A;  3E9V A;  4WAF A;  1ZYR F;  2EPM X;  1OXK A;  1O1T A;  3ASG A;  5B3I A;  3HHM A;  3QAR A;  2A68 F;  4MS6 A;  2OG2 A;  1U3D A;  4O6F A;  5BXU A;  1JCS A;  2XL6 A;  4OYS A;  1LM3 B;  3SZR A;  2I1K A;  3UR3 C;  3T5X A;  2YL0 A;  4NTB A;  3ZIM A;  1A7E A;  4C9B B;  2NUT A;  3C8G D;  2C03 A;  2A0U A;  1NFI E;  4TXQ A;  3FU5 A;  3MV3 B;  3DXJ F;  3SFX A;  1AVO B;  3DWW A;  2GGF A;  3OTN A;  3T9O A;  3FTW A;  5L0H A;  3VTX A;  5A69 A;  2RG8 A;  4G7Z F;  4E7S A;  2XHE A; 
#chains in the Genus database with same CATH homology
 4J8E A;  5JHB A;  3HLZ A;  3EGD B;  3UMV A;  5AIJ A;  3LPZ A;  4JHR A;  4OVV A;  5BV0 A;  3D9L A;  4AY6 A;  4KT6 B;  4KVO A;  2DYS C;  2H7O A;  4EQF A;  3TAX A;  2XPY A;  2PM7 A;  2IFU A;  1VOM A;  4DVY P;  4CT0 A;  3FU6 A;  3ULQ A;  3GZ1 A;  3I4G A;  5L3Q A;  3I4R B;  4U07 A;  2YZS A;  4J0U A;  3W8H A;  3EIQ C;  5BV1 A;  4W9R A;  3VTY A;  2KCV A;  2LAI A;  3JCU Q;  5B3S C;  4AV7 A;  3MGB A;  3SNX A;  5E3C A;  4E6H A;  3OXF A;  1IQU A;  2M4E A;  4OD5 A;  5BUO A;  3QJZ A;  2XPI A;  4GZ6 A;  5T4Y A;  2IQC A;  3AG4 C;  3EGX A;  1A17 A;  2LSV A;  3RH3 A;  4PJN A;  4LAC B;  3FDH A;  2O9X A;  1SZI A;  4N3C A;  3EZI A;  1QQE A;  1ELR A;  4I6E A;  2YQ8 A;  2J07 A;  4TV3 A;  3JQ1 A;  2E0I A;  5LX8 A;  2Q9A A;  2YHC A;  3DBS A;  4XWJ A;  1J8M F;  2HM8 A;  2CFZ A;  2J49 A;  2P7V A;  4PJM A;  3NYJ A;  3CVW A;  3OA1 A;  2BF0 X;  1H2U A;  3LY7 A;  4N5C A;  3CHR A;  4B89 A;  3S28 A;  4CS7 A;  2NUT B;  1E8Y A;  4PH4 B;  3LS0 A;  1S7Z A;  4UWK A;  2I9C A;  5G04 C;  1ELW A;  3K33 A;  4YT8 A;  5CCL A;  3W2W A;  4DJA A;  3FTY A;  3NQP A;  5DS5 A;  4FES A;  4CGW A;  5FZQ A;  2V8S E;  3G2U A;  3L34 A;  2UY1 A;  3CR3 A;  3ITF A;  2ZU6 B;  4HOT A;  3PS6 A;  4JZY A;  4HXI A;  4JXT A;  3PVL A;  1NA0 A;  4FLB A;  5C1D A;  4QDL A;  4C3B A;  5D0Q D;  1U3C A;  5IY5 C;  3CLJ A;  2LAH A;  3SD5 A;  1UJJ A;  5DS4 A;  4TUU A;  2XRZ A;  2IOL A;  4GZD A;  1LS1 A;  4O6N A;  3MJW A;  5A7D B;  1S0P A;  1P5Q A;  4OIO F;  4CS8 A;  4GYW A;  3Q15 A;  2YIN A;  4BJ5 C;  5JJ6 A;  3DD7 A;  4JA9 A;  4RBN A;  2EIM C;  2VGY A;  2VSX E;  4CCA A;  3PNL B;  1JWF A;  3RO3 A;  5T1D B;  2ZPA A;  3NF1 A;  3RYL A;  3CSF A;  2ZXW C;  3LY8 A;  1PC2 A;  5CCM A;  2VSY A;  5BNW A;  2XGM A;  3D9P A;  2KW3 C;  4NRH B;  3EGX B;  3L54 A;  3QOU A;  3RU0 A;  4UI9 K;  3EFO A;  2A69 F;  2IU1 A;  4BTA A;  4K0D A;  3S7J A;  2WQ6 A;  2L81 A;  2WL8 A;  2AVP A;  1ZHY A;  4H7Y A;  5EDS A;  5DS6 A;  4ILG A;  2GRL A;  1JPN A;  4BX9 A;  2WXI A;  4APO A;  2PX3 A;  2WVI A;  4O7G A;  3LLI A;  2FGY A;  4V3I A;  5EHH A;  4Q7C A;  4U5H A;  1E7V A;  3B7U X;  4HE8 D;  3POV A;  3CGH A;  3K66 A;  3CVU A;  5DBK A;  2QY9 A;  1OWM A;  4BJT A;  4CSA A;  3GW4 A;  4I2W A;  4A1S A;  1VYI A;  4C0E A;  3DMD A;  1FFH A;  4BT8 A;  3FFL A;  1VK5 A;  1NG1 A;  2FO7 A;  2LNI A;  1HE8 A;  1OWO A;  4UQZ A;  1Z23 A;  2UY1 B;  4L2L A;  5KYU A;  5T3T A;  3QB2 A;  3ML8 A;  2YNQ A;  2WXL A;  1H6K A;  4BX8 A;  2QTV A;  3PDN A;  4XI9 A;  2HR2 A;  4I6J A;  2J9Q A;  1NU7 D;  4EBA A;  3CHO A;  4C3E A;  1FFT C;  2C0L A;  2Q7F A;  2G62 A;  4U5E E;  3KMI A;  4FLH A;  2FF4 A;  3PEU B;  5KYY B;  5A23 A;  4NAC A;  3ASH A;  4OIP F;  3U9W A;  2HV6 A;  3LEW A;  2WXN A;  3CQZ A;  4BJ6 C;  3CV0 A;  2WXF A;  2I1J A;  2XRH A;  3NKE A;  3EFO B;  1LVK A;  3DM5 A;  3DZA A;  3EG9 A;  4GYT A;  2Y4U A;  3FHD A;  3EHN A;  1KT1 A;  4AM9 A;  4F7A A;  2V3C C;  4L1B A;  4LLE A;  4XLN F;  5DLJ A;  3ZG1 A;  4MRU A;  2MHK A;  4AE4 A;  2Q9C A;  2ILR A;  4G23 A;  1Z3I X;  1PCX A;  4PS8 A;  4DK5 A;  5HI7 A;  2AXV A;  3EIJ A;  3VYW A;  2D5R B;  3LS8 A;  5J90 A;  1O5H A;  3SBT B;  3X2Q C;  4U5C E;  3V7O A;  3O4Z A;  4OD4 A;  1JUQ A;  4MKT A;  3JYH A;  2WPV A;  4G7O F;  2ZXO A;  4CS9 A;  3E4B A;  3FEY A;  1KT0 A;  3T8M A;  3ABK C;  4BTB A;  1Z6T A;  1SZ9 A;  1OCR C;  4IYP A;  3W8I A;  3TG4 A;  1FVF A;  4N39 A;  3FUJ A;  1HZ4 A;  3SFZ A;  3ZHE A;  4O79 A;  2Y39 A;  2Q3T A;  5FQ8 A;  4LCT A;  3DAG A;  5CMY A;  5KYU B;  4C3D A;  1Z3Y A;  3FTX A;  2WXP A;  4KYO B;  3Q5M A;  3FUN A;  3IEG A;  3QWV A;  3CQG B;  2OVB A;  4PS7 A;  1OWN A;  3OXG A;  4FWV A;  2UWJ G;  1MHQ A;  1XGW A;  1MMD A;  3ASN C;  4KXK B;  3ASO C;  2YEV A;  2BUG A;  2XRY A;  1BR2 A;  3LNR A;  3RRM B;  1PAQ A;  4WJ0 A;  2WB7 A;  4LUN U;  2AXZ A;  3UT7 A;  2XPZ A;  5J08 A;  3FEX A;  4A3V A;  1IW7 F;  3APC A;  4JUR I;  3HDX A;  1WY6 A;  4F4B A;  3EG9 B;  4K7B A;  4GZC A;  4AIF A;  4BWR A;  1OCO C;  4G26 A;  4Y6C A;  5FQ4 A;  3Q7G A;  2CHW A;  4ANV A;  3G2T A;  4AE4 B;  4HFF B;  2A5U A;  4EBA G;  3F46 A;  3CHM A;  2X6F A;  2LO6 A;  2G3K A;  4CSA C;  3L13 A;  3QWP A;  2KJG A;  4WWN A;  4YWQ A;  2MYS A;  4PFO A;  3JUI A;  2WZG A;  4EBB A;  2X51 A;  5ENN A;  3VAY A;  5KJM A;  3UNG C;  2EIJ C;  4KNW A;  3IHY A;  5DIZ A;  3CHS A;  3JQ0 A;  4FC8 A;  3UPV A;  2Q9B A;  4J8S A;  4JL0 A;  1E7U A;  3FAJ A;  4UWF A;  3L22 A;  4DBQ A;  1PY1 A;  5LOZ A;  3ZHE B;  2MWQ A;  4UI9 C;  5F5F A;  1HX8 A;  2DCP A;  5T8I A;  4JEU A;  5G05 J;  3L17 A;  5LFA A;  2OND A;  4I44 A;  2WXR A;  4JEH A;  4P29 A;  3CVX A;  5KJL A;  3D9O A;  5ANR A;  4I3M A;  4A55 A;  3S0X A;  5FCL A;  3G2S A;  3RKO F;  3T5V A;  4I17 A;  2VSN A;  4WND A;  4Q94 A;  2PX0 A;  4YND A;  3NKD A;  2MRI A;  4ACL A;  4YJW A;  3QDN A;  1D0Y A;  3CIA A;  4G25 A;  3D9M A;  3NDB B;  3Q6M A;  4KBL A;  3LY9 A;  4B6I A;  3IEE A;  3B7R L;  4F53 A;  4ANX A;  3VLD A;  1TKN A;  4PUC A;  3EPV A;  1FTS A;  4YN0 B;  2V26 A;  4Y6W A;  3SF4 A;  2J0W A;  2ZXP A;  1IQR A;  4PFP A;  2W9Y A;  3RRN B;  3RFY A;  1M2O A;  4MLP A;  5FZR A;  3CKC A;  4YVO A;  3Q47 B;  4AP2 A;  5KYX A;  2L9J A;  3EHM A;  1KU2 A;  1N52 A;  3D9K A;  3QC1 A;  2EIL C;  2DBA A;  1TWH A;  3FUM A;  4DPR A;  2WVO A;  2H7B A;  5G55 A;  5T3W A;  5C2Y A;  2FUL A;  1ZHW A;  4JW1 A;  5L3V A;  3EH2 A;  4L7T A;  2Y3B A;  2LSE A;  4AOF A;  3PZD A;  4BEJ A;  4GA1 A;  4FJY A;  4APF A;  3S7D A;  2XXA B;  2X6K A;  1V54 C;  3KAE A;  4L2Y A;  3MLG A;  4EEC A;  4N2Q A;  2R17 C;  3B7S A;  3ML9 A;  5LCW J;  3B0V C;  2R59 A;  4RD9 A;  3K7D A;  4GA2 A;  3ENE A;  1M2V A;  4J32 B;  4AJW A;  1M56 C;  3OEO A;  4URK A;  2QY7 A;  1GW6 A;  2KZT A;  4NUR A;  2ZXR A;  5ARG A;  1OWP A;  4LER A;  4Q96 A;  4CGV A;  3Q4A B;  1SQM A;  3SP1 A;  3FUD A;  4XIF A;  4EWC A;  3KS2 A;  2VYI A;  3UX4 A;  4GYY A;  4DLQ A;  3PMR A;  4PK4 A;  3DJN B;  4RVB A;  2LSU A;  3S7B A;  2WMN A;  2R7W A;  3ASD A;  4I9C A;  3JYS A;  5KJN A;  4Q69 A;  3PRZ A;  1NP7 A;  3MKQ A;  2CHX A;  2W45 A;  4KMO A;  4QI2 A;  2WB2 A;  4DLO A;  5BPP A;  4OVU A;  3QZC A;  2R7V A;  3M1C B;  4H4K C;  2WXJ A;  2M63 A;  1HS6 A;  4AEZ C;  2VH3 A;  2J4D A;  2YHS A;  3FVY A;  5E3A A;  3KL4 A;  3HVE A;  4A1G A;  4EZJ A;  3SGH A;  5D0O D;  2X38 A;  5CI9 A;  3P1U A;  2L0T B;  2R7R A;  3CVN A;  2Z15 A;  4HOR A;  2NUP A;  5FJY A;  4AXH A;  3H65 A;  3MKR A;  4R7L A;  3NG1 A;  2G3V A;  3BG0 B;  3UT4 A;  4D10 C;  4KZC A;  2WZL A;  4CDM A;  1Y8M A;  3GYZ A;  3EZH A;  2X3M A;  3WG7 C;  3RKV A;  5DVW A;  3L0I A;  1HXI A;  3AG3 C;  2B0J A;  2HV7 A;  1YA0 A;  5AEN A;  2NG1 A;  1QLE C;  3CVV A;  3PEV B;  1IHG A;  3I4U A;  3R7R A;  2KNH A;  1L5J A;  2FI7 A;  2A4Z A;  4GYO A;  5E75 A;  1TWA A;  2J9W A;  1E90 A;  1H2V C;  1X5B A;  4XE0 A;  4G2V A;  2KCK A;  5DQZ A;  2VJ8 A;  5KYW A;  1MMA A;  2IXN A;  2HO1 A;  1W2W A;  1UG3 A;  3EJN A;  1M2V B;  2KZT B;  1BR1 A;  3DM9 B;  4GCN A;  4LRZ A;  4HFK B;  1OKK D;  4CBE A;  3QK0 A;  3B0U X;  4HFG A;  3Q6N A;  3AQC A;  1OCZ C;  4UQY A;  1DNP A;  3ECS A;  2P58 C;  3B0P A;  2C0M A;  1TWC A;  3CKB A;  2P6V A;  1OKK A;  5DQT A;  1SF8 A;  2NC9 A;  3CEQ A;  3MKQ B;  3S2A A;  5B1B C;  4ATG A;  2CGE A;  4X0R A;  3GZ2 A;  3T6B A;  4JZA A;  4WNE A;  4JJF A;  3ZGQ A;  1NA3 A;  4CRW A;  3ZVR A;  2JEK A;  3SHF A;  4KBQ A;  1JPJ A;  4HVB A;  2W4B A;  3HVE B;  3LCA A;  1ZU2 A;  1BR4 A;  1IYG A;  4GMJ A;  1E96 B;  3KEZ A;  2CNW D;  4EPZ A;  2PM6 A;  3FHE A;  2NUP B;  5CHE E;  3EDT B;  3NZS A;  4YT2 A;  4WNG A;  4YT4 A;  4JPS A;  4JHJ A;  2CNW A;  1PD0 A;  3JT1 A;  3DJU B;  2YHE A;  3PHF 2;  4FAD A;  5T3R A;  2KCL A;  2NXP A;  4IUL A;  3U4T A;  1ELK A;  2PZI A;  4JC8 A;  3LAY A;  4C0M A;  5KYW B;  2NSZ A;  4GAA A;  2WM9 A;  4GZ5 A;  2J9U A;  3L08 A;  3SNH A;  2VQ2 A;  3EH1 A;  3OWT A;  3ONK A;  2Y3G A;  4OIN F;  4I2Z A;  2VSO E;  4JJG A;  4F3V A;  3BG1 B;  4CS8 C;  1ZHZ A;  3Q7L A;  3FTS A;  1EYH A;  4TRQ A;  2X6J A;  4RDA A;  2WMO A;  5EX3 A;  4BT9 A;  4U0Z A;  4C7O A;  5G2N A;  4U5G A;  4AK9 A;  4M3O A;  1D1A A;  4H7X A;  4CIH A;  4CEM A;  3TG5 A;  3U3W A;  2FEZ A;  4UQX A;  5KJK A;  3NYM A;  4M63 A;  1WM5 A;  3CVL A;  4ME2 A;  4B8C B;  4K0R A;  1ZBP A;  3OAW A;  4GZ3 A;  3ZXS A;  1TJC A;  2R5S A;  1PD1 A;  2WXG A;  2KAT A;  2A1D D;  4WWP A;  1HFA A;  3ESL A;  3FH8 A;  4G7H F;  3DPD A;  3MEK A;  4K03 A;  1HF8 A;  4N3A A;  5FWQ A;  3FP3 A;  4XLP F;  2IXM A;  2PF4 E;  2WXQ A;  2OOE A;  2X6H A;  3O48 A;  3HIZ A;  1FMV A;  3EQL F;  2I6H A;  4XTK A;  3FU0 A;  4J8F A;  4NQ0 A;  3O39 A;  4JVS A;  4BJ5 A;  1MND A;  5JHA A;  3IV0 A;  1OWL A;  5D92 A;  3D9J A;  2Y3H A;  4MQ9 F;  3RO2 A;  2WVQ A;  2R7X A;  3UQ3 A;  1FVH A;  2R7S A;  3TD7 A;  1BPO A;  3F47 A;  3ZN3 A;  5LP0 A;  1HG2 A;  4BG0 A;  2WZF A;  4FX5 A;  2GRM A;  1TWG A;  3JSZ A;  3AQB A;  2KQ9 A;  3LVQ E;  2IOQ A;  4YVQ C;  2C2L A;  1KLX A;  4E85 A;  2V5F A;  5BT1 A;  4DI3 A;  1ZU5 A;  3D9I A;  4N3B A;  1D0Z A;  2A6E F;  1MNE A;  3B9Q A;  4HOS A;  4XX5 A;  3SZ7 A;  1N1C A;  3ZYQ A;  3NZU A;  3D9N A;  5G04 J;  4A3T A;  3U64 A;  3P2B A;  2GFH A;  1NZN A;  4XZ4 A;  4C7O B;  2WQH A;  3SYN A;  4IWB A;  1TR2 A;  3OXL A;  4KNV A;  2R7Q A;  3AG1 C;  4XI0 A;  3GZS A;  2PQN A;  3AU4 A;  1H2T C;  2IXP A;  4O6M A;  3MZL B;  4FP7 A;  2XCC A;  3S27 A;  2XGO A;  1N54 A;  5FT9 A;  2PL2 A;  3E70 C;  4WNF A;  2R7T A;  1SZA A;  3FH5 A;  1ZHT A;  2CG3 A;  4KVM A;  2XQ0 A;  2XSE A;  4U8H A;  3CZ6 A;  3KKB A;  4FUL A;  4W8K A;  3U66 A;  3Q49 B;  5HSW A;  3I5P A;  3B13 A;  3QAQ A;  2OV8 A;  3JRT A;  2XEV A;  2JLB A;  1RJ9 A;  1Z3X A;  4ABN A;  5E2Q A;  3UMK A;  3QKY A;  3UT8 A;  1UN8 A;  3MV2 B;  3PE4 A;  5E33 A;  5EKQ D;  2I8B A;  5FTP A;  3HJC A;  2XL4 A;  4UWG A;  3ZRH A;  3FWV A;  2KGO A;  1H0A A;  4CS9 C;  4U5F E;  2J45 A;  3FTU A;  4I9E A;  2J4B A;  4BSX A;  2PFD A;  1HG5 A;  3MA5 A;  1EF1 C;  4BJ6 A;  3LVR E;  1MMG A;  1D0X A;  3G2W A;  4AVX A;  2IF4 A;  4P6I C;  1W3B A;  4ANJ A;  4FHJ A;  1WGW A;  3W2V A;  1G8X A;  1SMY F;  1HO8 A;  3CHQ A;  3JCK C;  5G05 C;  4U0U A;  2R7O A;  1VDY A;  2V4L A;  3N0T A;  1LF8 A;  4A2N B;  5BUZ A;  3RRU A;  5AYW D;  4IRU A;  3ABL C;  3IKO B;  2MOW A;  3FUL A;  4GU5 A;  4I43 A;  4YT5 A;  2J7P D;  4E7Z A;  4XKB A;  3LKU A;  4LEU A;  3TXN A;  4RSY A;  3APF A;  1QZ2 A;  2FFH A;  5EGY A;  3N2Z B;  3FDQ A;  2IYL D;  4J30 B;  3LJ3 A;  3PNT B;  2J7P A;  3VLF A;  2J08 A;  3O6X A;  5ARF A;  4PJL A;  3IHV A;  1NU9 C;  4GA0 A;  2BE5 F;  4RG6 A;  4OIR F;  3ONL A;  3RJV A;  4JCH A;  3FUF A;  3AU5 A;  4XKC A;  2Y3D A;  3ZC4 A;  4HS2 A;  3FUI A;  3QWW A;  3ZYM A;  1QNF A;  3PE3 A;  3VLE A;  1UJK A;  5KYY A;  5KYX B;  3QNK A;  4NY3 A;  4BJ1 A;  1RJ9 B;  4GEH A;  4ULW A;  5AJL A;  2V0P A;  4I6G A;  4U5B E;  2GW1 A;  2XGS A;  4KC9 A;  2WQ7 A;  3FUH A;  3FH7 A;  2EQX A;  3L16 A;  2IXO A;  1E8W A;  3GAN A;  2WXK A;  3QMK A;  2CFU A;  1EDU A;  3RK6 A;  3GOD A;  2HYZ A;  3LLK A;  3I3N A;  1D1C A;  1E8Z A;  3C98 A;  3PRE A;  4I1A A;  3T6J A;  3ZSU A;  1EPU A;  1UW4 B;  5D91 A;  3AS8 A;  1INZ A;  2E87 A;  2JD3 A;  3NYL A;  3UGO A;  3FTZ A;  4ILI A;  3PUK A;  2J0X A;  3ZFW A;  5A6C A;  3UUX A;  3ZYL A;  5M72 A;  4ANW A;  4QFV A;  5FZS A;  5LCW C;  4G24 A;  3LJB A;  2VTB A;  3ZEF A;  3LXU X;  2J09 A;  3CVQ A;  1JWG A;  2L6J A;  3ZYK A;  2CHZ A;  2KM4 A;  2C04 A;  2CG2 A;  1JPL A;  4GPK A;  1Z63 A;  5BW8 C;  5JJ7 A;  3CK7 A;  3L6A A;  4I1O B;  4FHK A;  4L23 A;  1NZE A;  3KD7 A;  3FTV A;  1E8X A;  5KCM A;  3TJP A;  1V55 C;  4U63 A;  4ILH B;  3T4R A;  3CHP A;  4U04 A;  1TEZ A;  3FY4 A;  1WAO 1;  4IJJ A;  4PDX A;  5ANL A;  1FMW A;  3FU3 A;  1XNF A;  4B0Z A;  4Q5S F;  4GCO A;  4UWH A;  2VGX A;  3PUJ A;  3APD A;  2WVN A;  2PP4 A;  4DVZ A;  3HTK C;  3LS1 A;  3SBS A;  4UWL A;  1H19 A;  1ST6 A;  5F5H A;  2ION A;  4CT4 A;  4DOZ A;  2IOS A;  4HLE A;  4OIQ F;  4FA6 A;  4ZLD A;  4F1S A;  2Y4T A;  2J9V A;  3IBE A;  4ACK A;  1Y6I A;  2EIK C;  3LDZ A;  5JJT A;  4N06 A;  3K6B A;  3X1O A;  2CW0 F;  3ZVV A;  3ZIB A;  2WXH A;  4CDN A;  2QFC A;  1MQS A;  1MMN A;  2I2O A;  4DBR A;  2XCB A;  4B8A A;  1HH8 A;  4BFR A;  4JHK A;  2EIN C;  4B94 A;  4G11 A;  3TXM A;  2PQR A;  4FU3 A;  4HEA J;  1QZX A;  4QI0 A;  4O6Y A;  3BEE A;  2R7U A;  3URZ A;  5FQ6 A;  1VMA A;  3K1H A;  5FQ7 A;  3S7F A;  2VTB B;  3UMI A;  2AWI A;  4N2S A;  4U5D E;  3K1I C;  2L0I A;  2OVF A;  3CK9 A;  4GML A;  1M57 C;  1OUV A;  3ASF A;  2VAS A;  3MYV A;  1IZM A;  3I5Q A;  4HOQ A;  5E76 A;  5EX0 A;  3K9I A;  4KZ0 A;  4BY6 A;  4WWO A;  2AW6 A;  2A6H F;  4HOU A;  2DGJ A;  4UI9 J;  4GB9 A;  5AJD A;  3DAF A;  3UMH A;  4J8D A;  3WOD F;  3RIP A;  4IAO A;  2H7V C;  1Z6A A;  4IN3 B;  4PJJ A;  5B1A C;  2DYR C;  2OCC C;  3G2V A;  1LKX A;  5CMW A;  4CDR A;  1TJF A;  3EGD A;  2Y69 C;  4EZL A;  2VGX B;  3B7T A;  3CK8 A;  3WXX A;  3PH0 C;  4Q4Z F;  3LYA A;  4MND A;  3R7Q A;  3AS5 A;  3HYM B;  4AY5 A;  3S29 A;  3AS4 A;  3TL5 A;  2IJG X;  3FUK A;  1J8Y F;  1O87 A;  1D1B A;  3LEV A;  3CQC B;  2KC7 A;  3RIB A;  1ZHX A;  2X6I A;  3CST A;  2E2E A;  2VB6 A;  1UN9 A;  2J46 A;  2CDQ A;  1VYK A;  3CSK A;  2AXU A;  4RG9 A;  4U0S A;  3ZPJ A;  4DI4 A;  3N24 A;  3TGO A;  1ZU4 A;  2FBN A;  1HU3 A;  5KYN A;  2Y3A A;  2L9B A;  3AG2 C;  3FUE A;  4G0H A;  3ABM C;  2WXM A;  5CI8 A;  3CVY A;  4LLC A;  1FCH A;  4I1M A;  4JA7 A;  4EZK A;  3KH2 A;  3SEO A;  4AX2 A;  3SI5 A;  4ZLC A;  4G1T A;  5HQ8 A;  3D3M A;  3NRH A;  1DVP A;  4KI2 A;  3ESK A;  3R9A B;  2DIW A;  3CVP A;  2RD0 A;  4ANU A;  3N71 A;  4J6I A;  2W4M A;  3MX3 A;  1Z5Z A;  4FJZ A;  4WUY A;  4PS3 A;  3UGP A;  1OCC C;  2WXO A;  3MCX A;  2XXA A;  3LES A;  2BTD A;  3ZW3 A;  1B89 A;  3E9V A;  4WAF A;  1ZYR F;  3ASG A;  3HHM A;  3QAR A;  2A68 F;  4MS6 A;  2OG2 A;  1U3D A;  4O6F A;  4OYS A;  3SZR A;  2I1K A;  3UR3 C;  3T5X A;  3ZIM A;  4C9B B;  2NUT A;  2C03 A;  3FU5 A;  3MV3 B;  3DXJ F;  2GGF A;  3OTN A;  3FTW A;  3VTX A;  2RG8 A;  4G7Z F;  4E7S A;  2XHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...