3I5PA

Nup170(aa979-1502), s.cerevisiae
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
503
structure length
449
Chain Sequence
DILGFRAIEHLRRAKEIYDSLNYHLKNATAIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLENDDRKQYYDKRILVYDLVFDTLIKVDLRQKSYEAALKYNDRLFHYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGKISNILWVYYSRRSKFFESAEILYRLATSNFDITLFERIEFLSRANGFCQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQDSEFIFPIFELFPIVCNFFYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSDNSVFNKEMTWLIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Architectural nucleoporins Nup157/170 and Nup133 are structurally related and descend from a second ancestral element.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Nucleoporin NUP170
total genus 145
structure length 449
sequence length 503
ec nomenclature
pdb deposition date 2009-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1880 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3i5pA03
1.25.40.440 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3i5pA02
1.25.40.450 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3i5pA01
3I5PA
chains in the Genus database with same CATH superfamily
3U9MA 3EQLF 3U0CA 2UY1A 4M7CA 4C7OB 5T3RA 3MV2B 1WDYA 1TQGA 2HV6A 1EQ1A 3UQ3A 4XX5A 5KYWA 3AG2C 3PCVA 2R02A 3FU6A 4W8PA 3D3MA 2W45A 4KNVA 2ZGGA 3KH2A 5KJNA 3OWTA 2DYSC 2I15A 3QOUA 4HRLA 5CCLA 2WZFA 1O87A 2AVPA 3NOCD 3HYMB 3U3FA 2WXLA 1TWGA 1WY6A 3WG7C 3FEYA 4HEAJ 3J5QB 1RCPA 4U5HA 1HW2A 4WGYA 1EA8A 3FOOA 4DUIA 2XRZA 2RD9A 4CZ2D 4G7HF 2L9BA 2HMZA 1Q0DA 3MKQB 1YAUO 3TWRA 1RZ4A 3BRJA 3PE4A 5L0GA 4HFGA 2P9NG 3DSXA 2X6JA 3FHEA 4K1OA 3JCUQ 1JPJA 2P9IG 1ELWA 3DJNB 3DXKG 4RD9A 2H6FA 2J9VA 3DE8A 1N0RA 2A4ZA 3G50A 3EGXB 4AJWA 1A7DA 3J5PA 4JC7A 4NACA 3AG2E 1XZQA 4JZAA 3T9KA 2A0UA 4N39A 3RF3A 4DX5D 2DCPA 3UXGA 2PL2A 2YQ8A 2J7PD 2NUTA 3I5PA 3CSTA 3ABLC 4G2VA 4UWKA 4UWGA 1HE9A 2G3KA 1TNOA 2DWZA 3S7BA 2L0IA 4E6HA 4K5AB 5AC5A 1Q0FA 5ENSD 3JYHA 3RO2A 2PP4A 3OEOA 4QFVA 1HW1A 4EIYA 5KYWB 1OCOE 1RXQA 4UI9J 4JEUA 2QZAA 1N11A 5AIJA 2CHWA 3RIPA 3CLJA 2F8YA 2IF4A 3CHMA 5HI7A 4BERA 2ZXOA 3T6JA 1CGOA 3BU8A 1TR2A 4GPMA 1BZ4A 3K6BA 5EX3A 4JW1A 2CYDA 3QJZA 1VOMA 3MGBA 4MTGA 2WXOA 4M63A 4MVUA 2P9KG 4C48B 4EBAA 5TJ5E 3ZTZA 4M3OA 4O6FA 4A3VA 1A17A 1A5EA 5DVWA 4L9PA 5CRVA 4R7LA 2KCKA 5F5HA 3PVLA 3C63A 3MKQA 5H7PA 1NLXA 2YWAA 1UG3A 2J4DA 3ZNGA 2FI7A 4TUUA 4WWNA 5KYUA 3V7OA 2L6GA 2IO2C 3SZRA 2NXPA 3LJ3A 4KZCA 1MMDA 3H2UA 5D0OD 4U95D 3T4RA 5A6CA 4YT4A 3U64A 2VQ2A 4EZLA 3PDMP 3LUTB 2RFAA 4GYTA 4G11A 2HSQA 2ZXWC 1IZMA 2E0IA 4BPMA 3EHQA 3L54A 4I6JA 5K0IA 1WAO1 1B89A 2J9QA 1HXIA 1K1AA 2NUTB 4OVVA 2ETCA 3ZRHA 2I8BA 2WVIA 3HXFA 2XLMA 2ZGDA 4KVOA 3TXNA 3LEWA 4ILGA 1C02A 5ENTD 4OD4A 3CSFA 1Z7Qc 2FO7A 4PFPA 1D1CA 4EBKA 3G2TA 2YLDA 1TR4A 1RJ9B 5AJDA 5JRAA 2QYUA 5KJKA 4DBQA 3B13A 4EZJA 5B3IA 3M79A 2XLEA 2B0OE 4DLOA 1K05A 3G4ZA 4YK5A 3MJWA 3DMDA 4ABNA 5LCWJ 3RAUA 4MQ9F 2OCCE 3K7DA 1JR8A 1UFBA 1K3ZD 3NYLA 2X38A 2R7WA 1TN8A 1Q2ZA 4E7SA 3O4ZA 2XLHA 4JC8A 1YLMA 3Q9UC 2HJ3A 2EIKC 1OCCE 2ZPAA 3B0PA 3ISMC 1IYGA 3C3QA 1IHGA 2GRRB 5KNHD 4GTTA 5HKPA 1CPQA 2J4BA 2ZU6B 4K7BA 3IQ5A 5KWDA 3RVYA 2GRLA 5BUOA 3PZ1A 2AWCA 3E4BA 5KYUB 4C3EA 3WHNA 5A6BA 4O1PA 1V4AA 2XLOA 4C9BB 3TWSA 4NQFA 4A63B 5JHBA 4ILHB 4BFRA 2WZLA 1HO8A 2AP3A 1K8KG 1S7ZA 1FFHA 3GORA 2P9UG 2V4LA 4YL3A 4N4WA 3UGPA 1APCA 2AJAA 5T4YA 2EQXA 5HV9A 1A7VA 3RQGA 1V54E 4B8CB 2R7TA 3NRHA 3IXEA 3JRTA 2BL2A 5JA4D 4UQYA 2GAQA 5JHAA 4NY3A 1H6PA 3Q79A 4I44A 4J30B 3UGOA 3L13A 3DJUB 1OCOC 3D9IA 4A55A 1LE2A 3LNRA 1SF8A 1WG0A 4BT9A 3B7UX 4CDYA 2M64A 5KBAA 2H6IA 3C8ZA 5CHEE 3AQBA 5HQ8A 1W3BA 2VYIA 3TG4A 4GPKA 2KATA 1OY3D 3VTXA 3B29A 4G1TA 4MLPA 2ICWG 2GGFA 3B7BA 3AJIA 2L81A 3ASDA 2GRQB 4GTPA 3O55A 4F53A 4L1BA 4PJLA 4QI2A 1HE8A 3TWVA 3A11A 4U5GA 3FP3A 4HOTA 5CIVA 2PNOA 2A1DD 4CDMA 1CGNA 3B0UX 3ZHEB 3D9MA 5AENA 4UI9K 3S90A 4JTDB 3N2ZB 1UOHA 2HUJA 4CCAA 3B95A 4O1OA 4JEAA 4PS7A 1DVPA 4ANUA 2R7OA 1VYKA 1FFTC 4WUYA 4DJAA 4C3BA 4EBBA 2H6GA 1JOGA 1E7UA 4XI0A 2G62A 3FUKA 5B3SE 4IGGA 2A6EF 2NG1A 3ZQYA 2XHEA 4V3IA 1QNFA 2Q7RA 2CCYA 1ZHTA 3QTHA 1TFKB 2J9BA 3UIPC 4GZ3A 1G8XA 4IB4A 1FTSA 1OWPA 4LDRA 1SZ9A 5AC4A 4MNDA 5COMA 1BDJB 4KI2A 1EPUA 2LSVA 3W9GA 4ONSA 2E87A 2ASRA 2P9SG 1ZU4A 3IEEA 2WZGA 1OWMA 3TWTA 4PJNA 4CX9A 2WQ7A 3ABME 2FF4A 3IQ6A 4Q94A 3W9FA 2P58C 1I4ZA 1ORYA 1Q0KA 3GEIA 3OAWA 4UQXA 4HI9A 3TJ6A 4LRZA 5AQ7A 4ZFHA 1YZCA 1BD8A 2I9CA 3IQCA 5JJ6A 2R2LA 1HZ4A 1H2VC 2YNQA 4FJZA 4BEPA 3SNHA 3DAGA 3EH2A 4E17A 4U5FE 2DYRE 3V5YA 1RKCA 4YVQC 4XLNF 4F1PA 3CHSA 1KZOA 2L9JA 2YKZA 4JKVA 1OWNA 4U04A 4WNEA 3JUIA 4PS3A 2IOLA 3MKRA 4HE8D 2JX0A 1V54C 4XEFA 4OIPF 2H7VC 1K04A 3NMKA 3FUFA 3HLZA 3U2MA 5FZQA 3SO8A 4RQIA 2PF4E 5E3CA 1Z5SC 1H19A 1GQAA 1NFOA 3H65A 2VH3A 2HM8A 2EILC 2FBNA 3ULQA 1S63A 2OKUA 2XPYA 3PZ2A 4WGZA 3IHUA 4EHPA 1DCQA 4CSAA 1HY5A 4FP7A 3QW0A 2WB2A 2NSZA 1OWLA 1UJJA 2XXAA 3O6XA 1LI7A 3AJMA 2EPKX 3CR3A 1SR2A 4HI8A 3LEVA 3OA1A 4G23A 1U6HA 1GM5A 3R9AB 3ASFA 4DI4A 2YL7A 4G25A 5EX0A 4JEHA 2A5EA 2I1JA 2R25A 2C03A 2ETBA 4YL0A 2Z15A 1TN7A 3CK7A 1LVKA 1P5QA 2X51A 5CI8A 3QAQA 3R2PA 3TQOA 3GZ2A 5ENNA 2VTBB 5JP7A 1K1BA 1AP7A 1WWPA 4E0IA 1E90A 4EZKA 2QE9A 4LSZE 3ONLA 2W4BA 2PM7A 3T8KA 3TAXA 2PQNA 2LSEA 1RJ9A 3E33A 3FH5A 4MVOA 4ULVA 3CIAA 1Y6IA 3ASNC 5T8IA 2B0HA 4Q4ZF 4J7WA 3VLDA 3CSKA 3R9MA 2BC5A 1D0ZA 5AYWD 1BI8B 2LNIA 1DOWA 4KBQA 4J7TA 4JZYA 2DZNA 4E85A 3L17A 1OW8A 3DBSA 3VAYA 2XS1A 3N24A 1SW6A 2J9UA 1Z6AA 5FTPA 1QYMA 3MYIA 4YT8A 4G8KA 3LY9A 3R7CA 3DZAA 3ABLE 3LJBA 5G05J 5EHHA 2CNWD 3HXBA 3AS5A 2IM8A 2OEWA 1U3DA 3EHNA 5IY5C 2OU6A 1XGWA 3GYZA 3SXZA 2B0JA 5T3WA 3T6GB 3S7DA 1MX4A 2WQHA 4MS6A 4I43A 3SEOA 2HFIA 2C2LA 1NBBA 4GTRA 1ZU5A 4BEJA 2RSEB 3TOMA 1MQSA 4OINF 3FU0A 4A3TA 5DS6A 4CJGA 1F1MA 3VLFA 3UR3C 5HRYA 3V2OA 2RD0A 1LTXA 3SFYA 4CDRA 2JLBA 4YDWA 3U4TA 1LD8A 1T5OA 1AVOB 3RIBA 3FOPA 4U8VD 1BBHA 5B1BC 4TV3A 3EG9A 5A6AA 1YZAA 1EDUA 2OEVA 3ZHEA 1M2VA 3NBNB 2Y4TA 5F5FA 1TFOB 1TJCA 4MRUA 1ZW3A 2LSUA 3DWLG 5A23A 4FULA 3MV3B 1D9SA 2WXNA 3Q9NC 3UMHA 2V4HC 2AU5A 3CKBA 3FXHA 1SQMA 1IXVA 1D1AA 1BLXB 4DRJB 3FTZA 3QB2A 2GWWA 3LNMB 5BPPA 1Z6TA 2LO6A 2X0CA 4JE9A 1T01A 3JXIA 3KEZA 1MHQA 3PZDA 3UMVA 2C04A 4YL1A 3L0IA 2WL8A 1OCCC 2EIKE 3OXGA 3T5XA 4HQDA 1HMOA 2KM4A 2F37A 3LS8A 5D92A 2W4MA 2YL3A 4OYSA 3V79K 3AS8A 3SXYA 2J0WA 1TNZA 3SBSA 2AXZA 3DE9A 3DPDA 3DEPA 2KJGA 3AG4E 3TGOA 2A0BA 5T3TA 4FA6A 3I3NA 5LCWC 2VSYA 1X5BA 4N6CA 3Q47B 4RSYA 4GA1A 4MW8A 1LS1A 2XEVA 2YL1A 4FAPB 4E0HA 3EIJA 2OG2A 4EUKB 4XEIG 4MTOA 1INZA 1WGWA 4XZ4A 2D4UA 1LS4A 2CHZA 1E85A 2F22A 4WNGA 3SXKA 2RKKA 3JT1A 1H6OA 4J8YA 5CMWA 4BSZB 3NMJA 3PNLB 5EILA 1A41A 4JJFA 4CBEA 3Q5MA 3ESLA 2MHRA 4CJOA 3U2LA 4HOUA 4OAVB 1H9GA 1JPNA 3CHPA 3KL4A 2P2CP 1SA5A 4JTAB 3FEXA 2HSBA 2XGOA 5KYYB 2PNNA 3UUXA 2V8SE 2YHSA 1Y6DA 2PBEA 3JTLO 1N54A 3V5ZA 3ZEFA 3GM3A 1TNYA 3S7JA 5B1AE 5FIOA 2ZISA 1C03A 4JXTA 3AG1E 4BX8A 2WXJA 4D4XA 5B1BE 2BKKB 4JVSA 5COFA 4G0HA 3CK8A 4MVZA 3EU5A 3G2UA 1H6KA 4B8AA 2O9XA 1KPSB 1VYIA 4F3VA 1JCSA 3TJPA 3NYMA 3DI5A 2OJQA 2WMOA 1TN6A 4GZ6A 3DSSA 3JQ0A 2YINA 3AU5A 5BQGA 3FAPB 4EHMA 3C8GA 4CS7A 3MYVA 3FAJA 4I9EA 3APFA 2KSFA 5E3AA 3G4XA 3NQPA 3KSLA 4LUNU 2X3MA 3DSUA 3MX3A 2XL6A 2R7XA 2XLVA 3SNXA 2GROB 1OQCA 4JCHA 1NFIE 5G04C 2LAIA 3C98A 5ENPD 4UWFA 4F4BA 2V0PA 3J06A 5EN5D 5L0DA 4K0RA 3AQCA 2R7RA 3PREA 2VGXA 3PZ3A 5D2MC 1A7EA 3ITFA 2VASA 3TWWA 2KCVA 4J0UA 2Q00A 2V26A 1YVIA 1NSGB 4Q5SF 1OCZE 2YQYA 2ZIRA 4A4AA 3Q75A 1XWJA 1QSPA 3UI2A 4MVQA 1CGME 3S84A 4BJ6C 5JLIA 2L0TB 4N3CA 2CW0F 5JMND 3U66A 2XS8A 5G55A 2Y1LE 1KT1A 4QI0A 1JPLA 1NL4A 3ZYKA 2KK1A 4CS8C 3PS6A 4AIFA 4KMOA 4ILIA 4ZLDA 2VCAA 3HG0D 4E18A 5D0QD 4XE0A 4JJGA 3ML9A 3M15A 4FU3A 3TOLA 4JL0A 5L0HA 2TMVP 2CNWA 3LYAA 3JSZA 1FVHA 2KQ9A 3QVYA 2QNLA 3U9JA 4Z9HA 5JS5A 3QVZA 1D0YA 4G7OF 1YA9A 3BEHA 3QMKA 1LF8A 1R4TA 3ZC4A 3JYSA 3KEAA 4FLHA 1IHBA 1UJKA 3S0XA 4KXKB 4GYWA 4U7EB 5ANLA 3KYJA 1KLXA 3C8GB 5D91A 2QFCA 1Z5ZA 2XZTG 5BXUA 3IHVA 4U9DA 3EZHA 1RMVA 3EU9A 1MQVA 3ZSUA 4RDAA 4O79A 4NTBA 3LXUX 4U9EA 2MHKA 4JPSA 1TEZA 4I3MA 3T5VA 1ZW2A 1U89A 3FTWA 1S0PA 3OXFA 2YVKA 4ULWA 1OXJA 1D1BA 1TWAA 1M6TA 3W8HA 4WWPA 3FTVA 4PFOA 3EGDA 4I1MA 4UQZA 2BE5F 2X6KA 3ASOC 3E37A 3LVQE 3ZDLA 2WM9A 4BY6A 2IXPA 3V30A 1UG7A 3HXCA 1YJGA 3T8MA 1V55C 5DIZA 3ZYLA 5ITZF 1AEPA 1B68A 4C0EA 2WXFA 1VMAA 5CMYA 3RRMB 4WJ0A 2P7VA 3W2VA 4R32A 1QZXA 2XRHA 2NYJA 2WB7A 3ZGQA 1QVXA 4LERA 3V31A 1LD7A 4WWOA 4YT5A 3VM6A 4GMRA 2UY1B 3RFYA 3RO3A 4AOFA 4F1SA 1NU9C 3OTNA 3ULYA 4JA9A 4NIKA 2I6HA 4GTVA 4WNFA 2VB6A 3GEHA 4N2QA 3I4RB 4NQ0A 3N0TA 4J8EA 4UDVA 1QZ2A 2KXPC 4DXWA 3WXXA 3B9QA 5DQTA 2CDQA 2DB4A 4GTQA 3HTKC 2PZIA 2EIME 2KZTA 4Z68A 2C0MA 1O1TA 3GODA 2QC9A 3FDHA 2GRPB 3RRUA 4IYPA 1KTMA 2J08A 2WPVA 4LNGA 4GCOA 4CSAC 2NSFA 1FCHA 2ZD9A 3NF1A 1ELRA 3LVRE 4N06A 1BU9A 2GW1A 3V5XA 3DWWA 2RG8A 3US6A 3DRAA 1KNYA 3PEUB 3R7QA 1PY1A 2VGYA 2HMQA 1V74B 3RQEA 4HB5A 3U9WA 3PZ4A 3UT8A 4AL0A 3BG0B 2XCCA 3ZW3A 1OR2A 1E8YA 5FZTA 2IBFA 3CHOA 3ATPA 2Y3HA 5AQBA 4CRWA 4N3AA 4GMJA 4HFKB 4PH4B 3ZVRA 4ACKA 3BEEA 4OIRF 4APOA 3X1OA 1BPOA 3PRZA 5BUZA 5KYYA 4U8YD 3RVZA 1XZPA 3L82A 1NA0A 3CVPA 4BEMJ 3VTYA 3QZCA 4F6RD 2HE0A 2BF0X 3NAWA 4GYYA 3RYLA 1YYXA 3RQFA 3CAXA 4CEMA 5G04J 3HNLA 3ASNE 3QKYA 2RFMA 2XQ0A 1R5ID 1SMYF 2XZDG 1UN8A 3ABMC 4BT8A 5DBKA 3ZUVB 3FH7A 2Q7FA 3H2VA 3UM2A 2AWIA 2BEDA 4H4KC 4IRUA 3MBGA 4OD5A 4E7ZA 3EHRA 3K9IA 1EYHA 3L8IA 2V3CC 2DVWA 5EKQD 3K1IC 3EZIA 5FT9A 3LS1A 3AG3C 2IO3C 4DRXE 4GCNA 4U96D 1QBQA 3FWVA 2DYSE 3SD5A 3ASGA 4MW3A 3APDA 4RBNA 1HF8A 3RKVA 4FHJA 3B7SA 3E30A 1DC2A 5B3SC 1E2XA 4PJJA 1IQRA 1N4PA 4AV7A 5BQIA 2HS5A 1I4YA 5CECB 4D10C 3D9PA 4LG6A 4B94A 2QUPA 2EIJE 2VGXB 4URKA 4L23A 4U5EE 5EK0A 5E2QA 1H0AA 3F6QA 4L2LA 4DI3A 3HRAA 2Y3GA 4DX7D 1Y4CA 4I2ZA 3C3RA 1E8WA 4CDNA 1YDIA 1N1CA 4AXHA 3IKOB 4NTAA 1VTMP 4LEUA 3FVYA 3EDTB 4PS8A 1M2OA 4JHJA 1NP7A 1LKXA 1S05A 3D9JA 3Q15A 3L6AA 4DX6D 4XTKA 2FAPB 3HJCA 1FVFA 2XCBA 1AWCB 1GGQA 1OKKD 1D0XA 5AAOA 3PDNA 4EQFA 3S27A 1RKEB 4U0ZA 1PAQA 3IHYA 5FQ4A 4HOSA 1U3CA 1JWGA 4GTOA 4YJWA 1N4QA 5BW8C 4BTBA 1NA3A 2L6BA 3WG7E 3QWWA 2IXNA 4G8LA 2P9PG 2DIWA 3LKUA 3RK6A 1DNPA 3ESKA 1MX6A 3TWQA 1IW7F 2LUHA 2LK4A 3DD7A 2XGMA 1WTYA 4HLLA 5E75A 1ZZPA 5LOZA 3QK0A 4BSXA 2HO1A 1TJFA 4JD2G 4G78A 3FTUA 3CVQA 3QWPA 5CBNA 3BQOA 2GFHA 1ZU2A 4Q69A 4O60A 1H9TA 4ANXA 4HFFB 1VLSA 1HG2A 1JMWA 2Y3BA 1IQUA 5FWQA 4WAFA 4TXRA 5KYXB 4YN0B 1H6GA 5DLJA 4MVSA 5L0FA 1NI1A 2B6CA 3EGDB 5AN8A 1FNTc 2XSEA 4GEHA 1G4WR 4GZ5A 3HKKA 3AG1C 4DX2A 2HR2A 3TXMA 4TXQA 2XXAB 4L6RA 4CDAA 3SHFA 3MYFA 4JB8P 4U5CE 4BWRA 4JCZA 3FUIA 4XEKA 3KSQA 1QPUA 2AVKA 1NZEA 5L0IA 4AE4B 4DVYP 3ECSA 3SI5A 3DKAA 1N52A 3TWUA 3UX4A 3DEOA 3HXDA 2Q9BA 2YLGA 3E70C 1D8EA 4U0UA 4U0SA 1FMVA 3URZA 4I1AA 2Y69C 2FGYA 3MZLB 4WABA 2QTVA 4Z9IA 4PK4A 1QKRA 1AUEA 4H54A 1O5HA 3L9TA 2J07A 3BG1B 2Q9CA 3FTSA 4XI9A 3AGTA 2VTBA 3LEOA 3D9HA 3SZ7A 3B71A 5BQHA 5DS4A 4KT6B 3GM2A 2XM4A 2IYLD 4W8KA 2L6FA 2KC7A 2L6JA 2R5SA 4QQIA 4YNDA 1KU2A 2LIGA 2XM0A 2CFUA 3L1MA 2LAHA 3GANA 1HS6A 1MX2A 1X81A 3ZYQA 1OCRE 1QQEA 3HIZA 5ENRD 3CQGB 3APCA 2J8SD 4JURI 5EYPF 5COGA 1YYHA 3G2VA 3S29A 4HRMB 5BXOA 3CGHA 1K40A 4I9CA 4BG0A 2LFDA 1HU3A 1ZHZA 4ANJA 1N95A 4XWJA 3C18A 4BX9A 3ABKC 4LNBA 3N71A 2OJED 2LFFA 3X2QC 1L3PA 4H7XA 5FINA 2H6HA 4DX1A 4A1SA 3DXMG 2Y4UA 1Z3IX 3P2BA 1U2VG 5BT1A 3F46A 1ZVZA 2DBAA 4BTAA 5ANRA 3CVLA 4DRIB 4B93B 3S7FA 3K1HA 2XLWA 3CHRA 2IOQA 1MZCA 3PEVB 3JSEO 2WXGA 4EWCA 3POVA 3G2SA 1ORJA 2UUIA 3FUEA 2OCCC 2R7QA 3E32A 1JCQA 3ZKJA 3SXMA 4JHRA 2IOSA 4K5CA 5KNGA 4AEZC 3UMKA 4I6GA 4HNAD 3ENEA 3LY7A 3CVXA 4AY6A 1T6UA 2XL4A 1OCRC 4JHKA 3NMIA 2KYHA 3W4YA 2MRIA 3TULA 4FHKA 1M57C 4GQHA 2WXPA 3E34A 3ZXPA 4AP2A 2QY9A 3O10A 3EFOA 3AAAC 1PV3A 1Z3XA 2I2OA 3B0VC 1LE4A 1ZBPA 1BR1A 1E8XA 2Y69E 4JTCB 2R17C 3TWXA 2DZOA 2XEHA 4CDVA 4U5BE 1ZHWA 4CIPA 4K03A 4YDEA 1NU7D 1SVXA 4EBAG 1OR3A 3E9VA 3L34A 4DJ9A 3B7TA 4Y6CA 3U3WA 2J0XA 3FU3A 1C17M 3KS2A 3TL5A 3NKDA 3FUJA 2LD6A 4N2SA 1NFNA 1YCSB 5BV1A 4PJMA 5A6KA 2EINC 3NOGD 2ETAA 3KYIA 1SYQA 2X6HA 3HHMA 1XNFA 1M56C 1LIHA 3QNKA 2EPLX 2C0LA 5AJLA 2V5FA 1JRAA 2NPUA 2EPNA 3AG4C 1KT0A 4KZ0A 3ZIBA 1TWHA 2IXOA 3FHDA 1S70B 3NB2A 4L2YA 3L08A 4J6IA 3I4UA 1OKKA 3K1IA 1MJ0A 1VB5A 5KYNA 3ZQVA 5EIDA 5C1DA 2J9WA 2NSGA 4IWBA 5E33A 2DGJA 2YZSA 1LPEA 1YMPA 3MA5A 4GTSA 4GZDA 1WOLA 2WVOA 2HV7A 3O39A 4NC3A 1WATA 3PMRA 2WXMA 4YDOA 5ENOD 3SFXA 3QARA 4IN3B 2FEZA 2CGEA 4Q96A 3UMIA 4UUCA 1JAFA 5BNWA 2LXMA 4D4NA 3NZUA 3ZN3A 2CG2A 2E2EA 5A6BD 2HJMA 4O6NA 2HKVA 3I4GA 3LESA 3JCKC 4BJ1A 2IXMA 4U07A 3CZ6A 4IAQA 2NUPB 2EPMX 3AG3E 3FFLA 1G3NB 4FX5A 3U5SA 1OWOA 4EBJA 1DOVA 1SA4A 1PC2A 2VSXE 3UM1A 1HFAA 2UWJG 4ACLA 1ZHXA 3ZFWA 5G2NA 3LY8A 1L5JA 1NZNA 3HXEA 2FO1E 3FTXA 4TRQA 2KNHA 1N9AA 3UINC 2OOEA 4U8HA 1O3UA 2OQMA 3ONKA 3SY2A 5KYXA 2NC9A 4IARA 1L7CA 1EKYA 5AGFA 3UTMA 2GDCA 3RKOF 2WQ6A 4MVRA 1OW6A 2R59A 3LDZA 4CT0A 3ABKE 5CEAA 2IY0C 4U63A 2ZXRA 3S28A 1BR4A 1HMDA 1MMGA 3GM1A 4XQ1A 4WNDA 5CERB 1PD1A 4I6EA 1GS9A 4LDKA 2XGSA 2L6HA 1YA0A 3VF0A 1O5MA 4DVZA 2F8XK 3Q4AB 4F7AA 1SZAA 3FUHA 2MWQA 4H7YA 4AL1A 5CRUA 5J08A 3ZPJA 5A69A 5ARGA 4W9RA 3ZXSA 3ASHA 1N94A 3EH1A 4ER9A 3T6BA 2WXKA 3AU4A 5HS0A 1UN9A 1OW7A 2M63A 3C5RA 5LX8A 4ATGA 1MMNA 5L3QA 4ME2A 4FJYA 2KGOA 2XRYA 3SBTB 1TWCA 2R05A 4EKWA 1HH8A 2EIJC 3RU0A 2IEJA 3Q7FA 3NDBB 2KBXA 3CVNA 3O48A 4FESA 2IQCA 4AY5A 3HDXA 5EGYA 5JJTA 4UWHA 3OXLA 4JA7A 3NKEA 1Z3YA 3SFZA 3C7JA 1ELKA 1BR2A 2A69F 1FAPB 4J8SA 2LXLA 4MS2A 1H2UA 3FY4A 2XL8A 4BETA 1PD0A 5T1DB 2OVFA 3SQVA 2OOCA 3LJNA 2IU1A 5EDSA 3RRNB 2PX0A 2UUHA 3K33A 1MYOA 4LCTA 4X8QA 2YHCA 1OUVA 1EF1C 4OIQF 5KJMA 3ZTMA 5CBOA 3I5QA 4G7ZF 2Y3DA 5L0JA 4G24A 4J8FA 2QY7A 4MVMA 1GW6A 4CYMD 4B89A 3HVEB 4RG6A 1O1RA 4N6HA 3BUAA 5FZRA 3HNIA 5AARA 1WASA 1S64A 4IJJA 4P6IC 1U0BB 2CG3A 4NRHB 3V2XA 4GB9A 4UI9C 4LLCA 3ZU7B 4HBDA 1OXBA 4CS9A 4RLYA 4DPRA 4DRHB 3EIQC 4C0MA 3D9LA 3DM9B 5GPGB 3AS4A 3M1CB 2WXRA 3L22A 4J7YA 2V5QC 4ZLCA 2J45A 1E86A 3D9NA 4O6YA 3EFOB 5AQAA 4AM9A 2VJ8A 4O6MA 4I17A 4BJ6A 3VYWA 2VGEA 2R03A 3Q49B 2P0NA 4N5CA 5LFAA 1H2TC 4JRZA 4CS8A 1QLEC 4LLEA 2WVNA 4BJ5C 3W8IA 3PUJA 4KC9A 4GA0A 4GTMA 3Q6MA 2XEEA 3ULEG 1HG5A 2R7UA 1T6IA 3QWVA 5HSWA 3VRCA 1T9KA 2J8WA 2DYRC 5BV0A 2DI3A 4U5DE 4XPYA 3HNJA 3M4CA 1FT2A 2G3VA 2KC3A 3FDQA 3LLKA 3CQZA 2PM6A 4O7GA 4P9TA 3EJNA 4XPXA 4J8DA 5EYLA 2J49A 3C72A 2FULA 4HRNA 4LDQA 3PHF2 3KMIA 3CV0A 4PACA 2WXHA 4YDYA 2VSOE 3KKBA 1H7IA 1Y8MA 3RSEG 1KZPA 4P29A 1N4RA 3LCAA 3CEXA 4K5BA 3KPHA 1Q0MA 4HXIA 4RVBA 3ZVVA 4DK5A 3F47A 2P1AA 2QLAA 2EILE 1ZHYA 3EHMA 3FH8A 2XENA 3ZYMA 2R9RB 3HVEA 4GAAA 4NCQA 4GU5A 4MTFA 2AXUA 3CQCB 3SGHA 5FQ8A 3CHQA 1JCRA 3FTYA 2XLDA 3LAYA 3UIOC 3CVUA 3MCXA 1E7VA 2H8AA 3DM5A 3GEEA 3U3BA 3KD7A 4OAUC 3SYNA 4LNUD 2L7AA 2X6IA 1UW4B 4N3BA 2ZXPA 1FMWA 5L3VA 4EECA 3CEQA 1NG1A 2Y39A 3LS0A 3Q6NA 3IPMO 2P61A 2WXIA 5L0CA 3Q7LA 4ATZD 3JYYA 2JABA 3EG9B 2XPIA 3C8GD 2MYOA 3TK0A 3S2AA 3IEGA 5FQ6A 3A9CA 5AQ9A 1M2VB 2A5UA 3GZ1A 2NUPA 2HZ8A 2YLIA 2YL0A 2EIMC 3FMSA 4JIOA 3IBEA 2LP4A 3RW0A 4C7OA 4DLQA 4FLBA 2VCCA 3TJ5A 4N5QA 4NURA 3RH3A 5A6JA 2AWYA 4OVUA 1TKNA 2OVBA 3MFNA 1O1SA 1VDYA 3RJVA 1BI7B 4JEBA 5EIBE 4PR9A 1YYJA 2P9LG 4XEVA 2GRMA 5ARFA 5A7DB 3Q7GA 4FADA 5B1AC 4C3DA 3AOUA 4HORA 3DXJF 2GA0A 1MNEA 4APFA 2PQRA 3QDNA 4IULA 3NG1A 3CVWA 4IAOA 2YRFA 1OXKA 3UKRG 2YHEA 3UM3A 4YVOA 3CVYA 3D9OA 4ZHBA 3L8JA 3ZWIA 4EPZA 4DOZA 3FUMA 3X2QE 2A68F 1Z23A 3L16A 2F0YA 1YARO 3NYJA 2PX3A 3GWNA 1Z63A 3KAEA 2OV8A 4KNWA 3IV0A 4FWVA 4Q7CA 3GZSA 4PDXA 4TXPA 5KJLA 2ONDA 2Y3AA 2QYJA 5FQ7A 5JT4A 3FUDA 3DAFA 5JJ7A 3U8PA 1ZYRF 4XIFA 4HOQA 3VLEA 1E8ZA 1E84A 3T9OA 2JPUA 1A0BA 3Q7AA 1VK5A 1TNBA 2EINE 1MNDA 3WODF 5JSLA 2IFUA 4LACB 2AXVA 3ZG1A 3JRMO 3DPYA 5CI9A 4MBGA 2LCHA 2J09A 2J7PA 1OCZC 3HNKA 5CCMA 2CHXA 4YWQA 1RKEA 4CIHA 3SP1A 1WN0A 1IKND 5C2YA 4CGWA 4J32B 2JEKA 1LM3B 3MEKA 3DSVA 2J46A 3D9KA 4UWLA 3CKCA 4Y6WA 4KBLA 3S9OA 4GMLA 4GYOA 4XLPF 3B7RL 3CK9A 4GZCA 5LP0A 3G2WA 3UM0A 2KZTB 4A2NB 5JUAA 3MLGA 1PCXA 2JD3A 3M4BA 2R7VA 3TG5A 1N0QA 2VC9A 4ANVA 3NZSA 4XKCA 2KW3C 1FT1A 3FU5A 2WVQA 3AGUA 3JXJA 3ASOE 4AVXA 2X6FA 3W2WA 2BUGA 3TD7A 4AX2A 2I1KA 5CEDB 1E83A 4DBRA 4TUMA 5D66A 2BKGA 5ENQD 3UT7A 1YA7O 4YT2A 3U8VA 4NTFA 4CS9C 3UPVA 3DSWA 3C62A 4G26A 2Q3TA 3Q73A 2WMNA 5DQZA 2W9YA 4B6IA 1FR0A 1J8MF 3JUEA 5FZSA 256BA 1E96B 2MYSA 5KCMA 3WAQA 1FPPA 3CVVA 3PNTB 3UNGC 2LQGA 2VSNA 3PUKA 1ZB1A 1I5NA 4XPWA 2OEXA 5JVEA 5J90A 4K0DA 2Q9AA 5FJYA 4HVBA 2VCBA 1HX8A 1WM5A 1N4SA 2HYZA 4BJ5A 1QQ3A 4AE4A 4CT4A 2Y0BG 5F28E 4BESA 2R7SA 4AK9A 1D8DA 2D5RB 1OT8A 4X0RA 3K66A 2PFDA 1MMAA 4KYOB 3QW1A 5IY5E 2P6VA 4HS2A 1TNUA 2MOWA 4KVMA 2A6HF 5FCLA 3UKUG 4PUCA 1EI7A 2Q4FA 3Q78A 4P9FA 4OIOF 1ORSC 1W2WA 4BJTA 5M72A 3P1UA 3FULA 3LLIA 3SF4A 3EPVA 2WXQA 3FUNA 4Z9JA 1DCEA 3R7RA 4L7TA 3QC1A 1TYQG 2M4EA 4I2WA 4CGVA 4I1OB 4QDLA 4HLEA 2EPOA 2BTDA 3JZ0A 3C3OA 2H7OA 4XKBA 1J8YF 3IQTA 3JQ1A 3PH0C 3ZIMA 4B0ZA 4FC8A 1JWFA 2CFZA 2AW6A 1VLTA 2KCLA 4ANWA 1CPRA 1SZIA 2XPZA 1V55E 2IONA 4A1GA 5DS5A 1G4US 3EGXA 2ZXWE 1HE1A 3DSTA 5G05C 2GRNB 2YEVA 1JUQA 1Q0GA 3GWLA 3LPZA 2H7BA 4GA2A 2ETSA 1LI5A 1T6QA 4MKTA 3UT4A 4RG9A 5E76A 2FFHA 1RW2A 2ILRA 3EUVA 3PE3A 1G5ZA 3GW4A 1ST6A 3ML8A 2IJGX
chains in the Genus database with same CATH topology
3EQLF 2UY1A 5T3RA 4C7OB 3MV2B 2HV6A 3UQ3A 4XX5A 5KYWA 3AG2C 3FU6A 3D3MA 2W45A 4KNVA 3KH2A 5KJNA 3OWTA 2DYSC 3QOUA 5CCLA 2WZFA 1O87A 2AVPA 3HYMB 2WXLA 1TWGA 1WY6A 3WG7C 3FEYA 4HEAJ 4U5HA 2XRZA 4G7HF 2L9BA 3MKQB 3PE4A 4HFGA 2X6JA 3FHEA 3JCUQ 1JPJA 1ELWA 3DJNB 4RD9A 2J9VA 2A4ZA 3EGXB 4AJWA 4NACA 4JZAA 4N39A 2DCPA 2PL2A 2YQ8A 2J7PD 2NUTA 3I5PA 3CSTA 3ABLC 4G2VA 4UWKA 4UWGA 2G3KA 3S7BA 2L0IA 4E6HA 3JYHA 3RO2A 2PP4A 3OEOA 4QFVA 5KYWB 4UI9J 4JEUA 5AIJA 2CHWA 3RIPA 3CLJA 2IF4A 3CHMA 5HI7A 2ZXOA 3T6JA 1TR2A 3K6BA 5EX3A 4JW1A 3QJZA 1VOMA 3MGBA 2WXOA 4M63A 4EBAA 4M3OA 4O6FA 4A3VA 1A17A 5DVWA 4R7LA 2KCKA 5F5HA 3PVLA 3MKQA 1UG3A 2J4DA 2FI7A 4TUUA 4WWNA 5KYUA 3V7OA 3SZRA 2NXPA 3LJ3A 4KZCA 1MMDA 5D0OD 5A6CA 3T4RA 4YT4A 3U64A 2VQ2A 4EZLA 4GYTA 4G11A 2ZXWC 1IZMA 2E0IA 3L54A 4I6JA 1WAO1 1B89A 2J9QA 1HXIA 2NUTB 4OVVA 3ZRHA 2I8BA 2WVIA 4KVOA 3TXNA 3LEWA 4ILGA 4OD4A 3CSFA 2FO7A 4PFPA 1D1CA 3G2TA 1RJ9B 5AJDA 5KJKA 4DBQA 3B13A 4EZJA 4DLOA 3MJWA 4ABNA 3DMDA 5LCWJ 4MQ9F 3K7DA 3NYLA 2X38A 2R7WA 4E7SA 3O4ZA 4JC8A 2EIKC 2ZPAA 3B0PA 1IYGA 1IHGA 2J4BA 2ZU6B 4K7BA 2GRLA 5BUOA 3E4BA 5KYUB 4C3EA 4C9BB 5JHBA 4ILHB 4BFRA 2WZLA 1HO8A 1S7ZA 1FFHA 2V4LA 3UGPA 5T4YA 2EQXA 4B8CB 2R7TA 3NRHA 3JRTA 4UQYA 5JHAA 4NY3A 4I44A 4J30B 3UGOA 3L13A 3DJUB 1OCOC 3D9IA 4A55A 3LNRA 1SF8A 4BT9A 3B7UX 5CHEE 3AQBA 5HQ8A 1W3BA 2VYIA 3TG4A 4GPKA 2KATA 3VTXA 4G1TA 4MLPA 2GGFA 2L81A 3ASDA 4F53A 4L1BA 4PJLA 4QI2A 1HE8A 4U5GA 3FP3A 4HOTA 2A1DD 4CDMA 3ZHEB 3B0UX 3D9MA 5AENA 4UI9K 3N2ZB 4CCAA 4PS7A 1DVPA 4ANUA 2R7OA 1VYKA 1FFTC 4WUYA 4DJAA 4C3BA 4EBBA 1E7UA 4XI0A 2G62A 3FUKA 2A6EF 2NG1A 2XHEA 4V3IA 1QNFA 1ZHTA 4GZ3A 1G8XA 1FTSA 1OWPA 1SZ9A 4MNDA 4KI2A 1EPUA 2LSVA 2E87A 3IEEA 1ZU4A 2WZGA 1OWMA 4PJNA 2WQ7A 2FF4A 4Q94A 2P58C 3OAWA 4UQXA 4LRZA 2I9CA 5JJ6A 1HZ4A 1H2VC 2YNQA 4FJZA 3SNHA 3DAGA 3EH2A 4U5FE 4YVQC 4XLNF 3CHSA 2L9JA 4U04A 1OWNA 4WNEA 3JUIA 4PS3A 2IOLA 3MKRA 4HE8D 1V54C 4OIPF 2H7VC 3FUFA 3HLZA 5FZQA 2PF4E 5E3CA 1H19A 3H65A 2VH3A 2HM8A 2EILC 3ULQA 2FBNA 2XPYA 4CSAA 4FP7A 2WB2A 2NSZA 1OWLA 1UJJA 2XXAA 3O6XA 3CR3A 3LEVA 3OA1A 4G23A 3R9AB 3ASFA 4DI4A 4G25A 5EX0A 4JEHA 2I1JA 2C03A 2Z15A 3CK7A 1LVKA 1P5QA 2X51A 5CI8A 3QAQA 3GZ2A 5ENNA 2VTBB 1E90A 4EZKA 3ONLA 2W4BA 2PM7A 3TAXA 2PQNA 2LSEA 1RJ9A 3FH5A 3CIAA 1Y6IA 3ASNC 5T8IA 4Q4ZF 3VLDA 3CSKA 1D0ZA 5AYWD 2LNIA 4KBQA 4JZYA 4E85A 3L17A 3DBSA 3VAYA 3N24A 2J9UA 1Z6AA 5FTPA 4YT8A 3LY9A 3DZAA 3LJBA 5G05J 5EHHA 2CNWD 3AS5A 1U3DA 3EHNA 5IY5C 1XGWA 3GYZA 2B0JA 5T3WA 3S7DA 2WQHA 4MS6A 4I43A 3SEOA 2C2LA 1ZU5A 4BEJA 1MQSA 4OINF 3FU0A 4A3TA 5DS6A 3VLFA 3UR3C 2RD0A 4CDRA 2JLBA 3U4TA 3RIBA 5B1BC 4TV3A 3EG9A 1EDUA 3ZHEA 1M2VA 2Y4TA 5F5FA 1TJCA 4MRUA 2LSUA 5A23A 4FULA 3MV3B 2WXNA 3UMHA 3CKBA 1SQMA 1D1AA 3FTZA 3QB2A 5BPPA 1Z6TA 2LO6A 3KEZA 1MHQA 3PZDA 3UMVA 2C04A 3L0IA 2WL8A 1OCCC 3OXGA 3T5XA 2KM4A 3LS8A 5D92A 2W4MA 4OYSA 3AS8A 2J0WA 3SBSA 2AXZA 3DPDA 2KJGA 3TGOA 5T3TA 4FA6A 3I3NA 5LCWC 2VSYA 1X5BA 3Q47B 4RSYA 4GA1A 1LS1A 2XEVA 3EIJA 2OG2A 1INZA 1WGWA 4XZ4A 2CHZA 4WNGA 3JT1A 5CMWA 3PNLB 4JJFA 4CBEA 3Q5MA 3ESLA 4HOUA 1JPNA 3CHPA 3KL4A 3FEXA 2XGOA 5KYYB 3UUXA 2V8SE 2YHSA 1N54A 3ZEFA 3S7JA 4JXTA 4BX8A 2WXJA 4JVSA 4G0HA 3CK8A 3G2UA 1H6KA 4B8AA 2O9XA 1VYIA 4F3VA 3TJPA 3NYMA 2WMOA 4GZ6A 3JQ0A 2YINA 3AU5A 4CS7A 3MYVA 3FAJA 4I9EA 3APFA 5E3AA 3NQPA 4LUNU 2X3MA 3MX3A 2R7XA 3SNXA 4JCHA 5G04C 2LAIA 3C98A 4UWFA 4F4BA 2V0PA 4K0RA 3AQCA 2R7RA 3PREA 2VGXA 3ITFA 2VASA 2KCVA 4J0UA 2V26A 4Q5SF 4BJ6C 2L0TB 4N3CA 2CW0F 3U66A 5G55A 1KT1A 4QI0A 1JPLA 3ZYKA 4AIFA 4CS8C 3PS6A 4KMOA 4ILIA 4ZLDA 5D0QD 4XE0A 4JJGA 3ML9A 4FU3A 4JL0A 3LYAA 2CNWA 3JSZA 1FVHA 2KQ9A 1D0YA 4G7OF 3QMKA 3JYSA 1LF8A 3ZC4A 4FLHA 1UJKA 3S0XA 4KXKB 4GYWA 5ANLA 1KLXA 5D91A 2QFCA 1Z5ZA 3IHVA 3EZHA 3ZSUA 4RDAA 4O79A 3LXUX 2MHKA 4JPSA 1TEZA 4I3MA 3T5VA 3FTWA 1S0PA 3OXFA 4ULWA 1D1BA 1TWAA 3W8HA 4WWPA 3FTVA 4PFOA 3EGDA 4I1MA 4UQZA 2BE5F 2X6KA 3ASOC 3LVQE 2WM9A 4BY6A 2IXPA 3ZYLA 3T8MA 1V55C 5DIZA 4C0EA 2WXFA 1VMAA 5CMYA 3RRMB 4WJ0A 2P7VA 3W2VA 1QZXA 2XRHA 2WB7A 3ZGQA 4LERA 4WWOA 4YT5A 2UY1B 3RFYA 3RO3A 4AOFA 4F1SA 1NU9C 3OTNA 4JA9A 2I6HA 4WNFA 2VB6A 4N2QA 3I4RB 4NQ0A 3N0TA 4J8EA 1QZ2A 3WXXA 3B9QA 5DQTA 2CDQA 3HTKC 2PZIA 2KZTA 2C0MA 3GODA 3FDHA 3RRUA 4IYPA 2J08A 2WPVA 4GCOA 4CSAC 1FCHA 3NF1A 1ELRA 3LVRE 4N06A 2GW1A 2RG8A 3PEUB 3R7QA 1PY1A 2VGYA 3U9WA 3UT8A 3BG0B 2XCCA 3ZW3A 1E8YA 3CHOA 2Y3HA 4CRWA 4N3AA 4GMJA 4HFKB 4PH4B 3ZVRA 4ACKA 3BEEA 4OIRF 4APOA 3X1OA 1BPOA 3PRZA 5BUZA 5KYYA 1NA0A 3CVPA 3VTYA 3QZCA 2BF0X 4GYYA 3RYLA 4CEMA 5G04J 3QKYA 2XQ0A 1SMYF 1UN8A 3ABMC 4BT8A 5DBKA 3FH7A 2Q7FA 2AWIA 4H4KC 4IRUA 4OD5A 4E7ZA 3K9IA 1EYHA 2V3CC 5EKQD 3K1IC 3EZIA 5FT9A 3LS1A 3AG3C 4GCNA 3FWVA 3SD5A 3ASGA 3APDA 4RBNA 1HF8A 3RKVA 4FHJA 3B7SA 5B3SC 4PJJA 1IQRA 4AV7A 4D10C 3D9PA 4B94A 2VGXB 4URKA 4L23A 4U5EE 5E2QA 1H0AA 4L2LA 4DI3A 2Y3GA 4I2ZA 1E8WA 4CDNA 1N1CA 4AXHA 3IKOB 4LEUA 4PS8A 3FVYA 3EDTB 1M2OA 4JHJA 1NP7A 1LKXA 3D9JA 3Q15A 3L6AA 4XTKA 3HJCA 1FVFA 2XCBA 1OKKD 1D0XA 3PDNA 4EQFA 3S27A 4U0ZA 1PAQA 3IHYA 5FQ4A 4HOSA 1U3CA 1JWGA 4YJWA 5BW8C 4BTBA 1NA3A 3QWWA 2IXNA 2DIWA 3LKUA 3RK6A 1DNPA 3ESKA 1IW7F 3DD7A 2XGMA 5LOZA 5E75A 3QK0A 4BSXA 2HO1A 1TJFA 3FTUA 3CVQA 3QWPA 2GFHA 1ZU2A 4Q69A 4ANXA 4HFFB 1HG2A 2Y3BA 1IQUA 5FWQA 4WAFA 5KYXB 4YN0B 5DLJA 3EGDB 2XSEA 4GEHA 4GZ5A 3AG1C 2HR2A 3TXMA 2XXAB 3SHFA 4U5CE 4BWRA 3FUIA 1NZEA 4AE4B 4DVYP 3ECSA 3SI5A 1N52A 3UX4A 2Q9BA 3E70C 4U0UA 4U0SA 1FMVA 3URZA 4I1AA 2Y69C 2FGYA 3MZLB 2QTVA 4PK4A 1O5HA 2J07A 3BG1B 2Q9CA 3FTSA 4XI9A 2VTBA 3SZ7A 4KT6B 5DS4A 2IYLD 4W8KA 2KC7A 2L6JA 2R5SA 4YNDA 1KU2A 2CFUA 2LAHA 3GANA 1HS6A 3ZYQA 1QQEA 3HIZA 3CQGB 3APCA 4JURI 3G2VA 3S29A 3CGHA 4I9CA 4BG0A 1HU3A 1ZHZA 4ANJA 4XWJA 4BX9A 3ABKC 3N71A 3X2QC 4H7XA 4A1SA 2Y4UA 1Z3IX 3P2BA 5BT1A 3F46A 2DBAA 4BTAA 5ANRA 3CVLA 3S7FA 3K1HA 3CHRA 2IOQA 3PEVB 2WXGA 4EWCA 3POVA 3G2SA 3FUEA 2OCCC 2R7QA 4JHRA 2IOSA 4AEZC 3UMKA 4I6GA 3ENEA 3LY7A 3CVXA 4AY6A 2XL4A 1OCRC 4JHKA 2MRIA 4FHKA 1M57C 2WXPA 4AP2A 2QY9A 3EFOA 1Z3XA 2I2OA 3B0VC 1ZBPA 1BR1A 1E8XA 2R17C 4U5BE 1ZHWA 4K03A 1NU7D 4EBAG 3E9VA 3L34A 3U3WA 3B7TA 4Y6CA 2J0XA 3FU3A 3KS2A 3TL5A 3NKDA 3FUJA 4N2SA 5BV1A 4PJMA 2EINC 2X6HA 3HHMA 1XNFA 1M56C 3QNKA 2C0LA 5AJLA 2V5FA 3AG4C 1KT0A 4KZ0A 3ZIBA 1TWHA 2IXOA 3FHDA 4L2YA 3L08A 4J6IA 3I4UA 1OKKA 5KYNA 5C1DA 2J9WA 5E33A 4IWBA 2DGJA 2YZSA 3MA5A 4GZDA 2WVOA 2HV7A 3O39A 2WXMA 3PMRA 3QARA 4IN3B 2FEZA 2CGEA 4Q96A 3UMIA 5BNWA 3ZN3A 3NZUA 2CG2A 2E2EA 4O6NA 3I4GA 3LESA 3JCKC 4BJ1A 2IXMA 4U07A 3CZ6A 2NUPB 3FFLA 4FX5A 1OWOA 2VSXE 1PC2A 1HFAA 2UWJG 4ACLA 1ZHXA 3ZFWA 5G2NA 3LY8A 1L5JA 1NZNA 3FTXA 4TRQA 2KNHA 2OOEA 4U8HA 3ONKA 5KYXA 2NC9A 3RKOF 2WQ6A 2R59A 3LDZA 4CT0A 4U63A 2ZXRA 3S28A 1BR4A 1MMGA 4WNDA 1PD1A 4I6EA 2XGSA 1YA0A 4DVZA 3Q4AB 4F7AA 1SZAA 3FUHA 2MWQA 4H7YA 5J08A 3ZPJA 5ARGA 4W9RA 3ZXSA 3ASHA 3EH1A 3T6BA 2WXKA 3AU4A 1UN9A 2M63A 5LX8A 4ATGA 1MMNA 5L3QA 4ME2A 4FJYA 2KGOA 2XRYA 3SBTB 1TWCA 1HH8A 2EIJC 3RU0A 3NDBB 3CVNA 3O48A 4FESA 2IQCA 4AY5A 3HDXA 5EGYA 5JJTA 4UWHA 3OXLA 4JA7A 3NKEA 1Z3YA 3SFZA 1ELKA 1BR2A 2A69F 4J8SA 1H2UA 3FY4A 1PD0A 5T1DB 2OVFA 5EDSA 2IU1A 3RRNB 2PX0A 3K33A 4LCTA 2YHCA 1OUVA 1EF1C 4OIQF 5KJMA 3I5QA 4G7ZF 2Y3DA 4G24A 4J8FA 2QY7A 1GW6A 4B89A 3HVEB 4RG6A 5FZRA 4IJJA 4P6IC 2CG3A 4NRHB 4GB9A 4UI9C 4LLCA 4CS9A 4DPRA 3EIQC 4C0MA 3D9LA 3DM9B 3AS4A 3M1CB 2WXRA 3L22A 4ZLCA 2J45A 3D9NA 4O6YA 3EFOB 4AM9A 2VJ8A 4O6MA 4I17A 4BJ6A 3VYWA 3Q49B 4N5CA 5LFAA 1H2TC 4CS8A 1QLEC 4LLEA 2WVNA 4BJ5C 3W8IA 3PUJA 4KC9A 4GA0A 3Q6MA 1HG5A 2R7UA 3QWVA 5HSWA 2DYRC 5BV0A 4U5DE 2G3VA 3FDQA 3LLKA 3CQZA 2PM6A 4O7GA 3EJNA 4J8DA 2J49A 2FULA 3PHF2 3KMIA 3CV0A 2WXHA 2VSOE 3KKBA 1Y8MA 4P29A 3LCAA 4RVBA 4DK5A 3ZVVA 4HXIA 3F47A 1ZHYA 3EHMA 3FH8A 3ZYMA 3HVEA 4GAAA 4GU5A 2AXUA 3CQCB 3SGHA 5FQ8A 3CHQA 3FTYA 3LAYA 3CVUA 3MCXA 1E7VA 3DM5A 3KD7A 3SYNA 2X6IA 1UW4B 4N3BA 2ZXPA 1FMWA 5L3VA 4EECA 3CEQA 1NG1A 2Y39A 3LS0A 3Q6NA 2WXIA 3Q7LA 3EG9B 2XPIA 3S2AA 3IEGA 5FQ6A 1M2VB 2A5UA 3GZ1A 2NUPA 2EIMC 3IBEA 4C7OA 4DLQA 4FLBA 4NURA 3RH3A 4OVUA 1TKNA 2OVBA 1VDYA 3RJVA 2GRMA 5ARFA 5A7DB 3Q7GA 4FADA 5B1AC 4C3DA 4HORA 3DXJF 1MNEA 4APFA 2PQRA 3QDNA 4IULA 3NG1A 3CVWA 4IAOA 2YHEA 4YVOA 3CVYA 3D9OA 4EPZA 4DOZA 3FUMA 2A68F 1Z23A 3L16A 3NYJA 2PX3A 1Z63A 3KAEA 2OV8A 4KNWA 3IV0A 4FWVA 4Q7CA 3GZSA 4PDXA 5KJLA 2ONDA 2Y3AA 5FQ7A 3FUDA 3DAFA 5JJ7A 1ZYRF 4XIFA 4HOQA 3VLEA 1E8ZA 1VK5A 1MNDA 3WODF 2IFUA 4LACB 2AXVA 3ZG1A 5CI9A 2J09A 2J7PA 1OCZC 5CCMA 2CHXA 4YWQA 4CIHA 3SP1A 5C2YA 4CGWA 4J32B 2JEKA 3MEKA 2J46A 3D9KA 4UWLA 3CKCA 4Y6WA 4KBLA 4GMLA 4GYOA 4XLPF 3B7RL 3CK9A 4GZCA 5LP0A 3G2WA 2KZTB 4A2NB 3MLGA 1PCXA 2JD3A 2R7VA 3TG5A 4ANVA 3NZSA 4XKCA 2KW3C 3FU5A 2WVQA 4AVXA 2X6FA 3W2WA 2BUGA 3TD7A 4AX2A 2I1KA 4DBRA 3UT7A 4YT2A 4CS9C 3UPVA 4G26A 2Q3TA 2WMNA 5DQZA 2W9YA 4B6IA 1J8MF 5FZSA 1E96B 5KCMA 2MYSA 3CVVA 3PNTB 3UNGC 2VSNA 3PUKA 5J90A 4K0DA 2Q9AA 5FJYA 4HVBA 1HX8A 1WM5A 2HYZA 4BJ5A 4AE4A 4CT4A 2R7SA 4AK9A 2D5RB 4X0RA 3K66A 2PFDA 1MMAA 4KYOB 2P6VA 4HS2A 2MOWA 4KVMA 2A6HF 5FCLA 4PUCA 4OIOF 1W2WA 4BJTA 5M72A 3P1UA 3FULA 3LLIA 3SF4A 3EPVA 2WXQA 3FUNA 3R7RA 4L7TA 3QC1A 2M4EA 4I2WA 4CGVA 4I1OB 4QDLA 4HLEA 2BTDA 2H7OA 4XKBA 1J8YF 3JQ1A 3PH0C 3ZIMA 4B0ZA 4FC8A 1JWFA 2CFZA 2AW6A 2KCLA 4ANWA 1SZIA 2XPZA 2IONA 4A1GA 5DS5A 3EGXA 5G05C 2YEVA 1JUQA 3LPZA 2H7BA 4GA2A 4MKTA 3UT4A 4RG9A 5E76A 2FFHA 2ILRA 3PE3A 3GW4A 1ST6A 3ML8A 2IJGX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5P A; 
#chains in the Genus database with same CATH topology
 3U9M A;  3EQL F;  3U0C A;  2UY1 A;  4M7C A;  4C7O B;  5T3R A;  3MV2 B;  1WDY A;  1TQG A;  2HV6 A;  1EQ1 A;  3UQ3 A;  4XX5 A;  5KYW A;  3AG2 C;  3PCV A;  2R02 A;  3FU6 A;  4W8P A;  3D3M A;  2W45 A;  4KNV A;  2ZGG A;  3KH2 A;  5KJN A;  3OWT A;  2DYS C;  2I15 A;  3QOU A;  4HRL A;  5CCL A;  2WZF A;  1O87 A;  2AVP A;  3NOC D;  3HYM B;  3U3F A;  2WXL A;  1TWG A;  1WY6 A;  3WG7 C;  3FEY A;  4HEA J;  3J5Q B;  1RCP A;  4U5H A;  1HW2 A;  4WGY A;  1EA8 A;  3FOO A;  4DUI A;  2XRZ A;  2RD9 A;  4CZ2 D;  4G7H F;  2L9B A;  2HMZ A;  1Q0D A;  3MKQ B;  1YAU O;  3TWR A;  1RZ4 A;  3BRJ A;  3PE4 A;  5L0G A;  4HFG A;  2P9N G;  3DSX A;  2X6J A;  3FHE A;  4K1O A;  3JCU Q;  1JPJ A;  2P9I G;  1ELW A;  3DJN B;  3DXK G;  4RD9 A;  2H6F A;  2J9V A;  3DE8 A;  1N0R A;  2A4Z A;  3G50 A;  3EGX B;  4AJW A;  1A7D A;  3J5P A;  4JC7 A;  4NAC A;  3AG2 E;  1XZQ A;  4JZA A;  3T9K A;  2A0U A;  4N39 A;  3RF3 A;  4DX5 D;  2DCP A;  3UXG A;  2PL2 A;  2YQ8 A;  2J7P D;  2NUT A;  3I5P A;  3CST A;  3ABL C;  4G2V A;  4UWK A;  4UWG A;  1HE9 A;  2G3K A;  1TNO A;  2DWZ A;  3S7B A;  2L0I A;  4E6H A;  4K5A B;  5AC5 A;  1Q0F A;  5ENS D;  3JYH A;  3RO2 A;  2PP4 A;  3OEO A;  4QFV A;  1HW1 A;  4EIY A;  5KYW B;  1OCO E;  1RXQ A;  4UI9 J;  4JEU A;  2QZA A;  1N11 A;  5AIJ A;  2CHW A;  3RIP A;  3CLJ A;  2F8Y A;  2IF4 A;  3CHM A;  5HI7 A;  4BER A;  2ZXO A;  3T6J A;  1CGO A;  3BU8 A;  1TR2 A;  4GPM A;  1BZ4 A;  3K6B A;  5EX3 A;  4JW1 A;  2CYD A;  3QJZ A;  1VOM A;  3MGB A;  4MTG A;  2WXO A;  4M63 A;  4MVU A;  2P9K G;  4C48 B;  4EBA A;  5TJ5 E;  3ZTZ A;  4M3O A;  4O6F A;  4A3V A;  1A17 A;  1A5E A;  5DVW A;  4L9P A;  5CRV A;  4R7L A;  2KCK A;  5F5H A;  3PVL A;  3C63 A;  3MKQ A;  5H7P A;  1NLX A;  2YWA A;  1UG3 A;  2J4D A;  3ZNG A;  2FI7 A;  4TUU A;  4WWN A;  5KYU A;  3V7O A;  2L6G A;  2IO2 C;  3SZR A;  2NXP A;  3LJ3 A;  4KZC A;  1MMD A;  3H2U A;  5D0O D;  4U95 D;  3T4R A;  5A6C A;  4YT4 A;  3U64 A;  2VQ2 A;  4EZL A;  3PDM P;  3LUT B;  2RFA A;  4GYT A;  4G11 A;  2HSQ A;  2ZXW C;  1IZM A;  2E0I A;  4BPM A;  3EHQ A;  3L54 A;  4I6J A;  5K0I A;  1WAO 1;  1B89 A;  2J9Q A;  1HXI A;  1K1A A;  2NUT B;  4OVV A;  2ETC A;  3ZRH A;  2I8B A;  2WVI A;  3HXF A;  2XLM A;  2ZGD A;  4KVO A;  3TXN A;  3LEW A;  4ILG A;  1C02 A;  5ENT D;  4OD4 A;  3CSF A;  1Z7Q c;  2FO7 A;  4PFP A;  1D1C A;  4EBK A;  3G2T A;  2YLD A;  1TR4 A;  1RJ9 B;  5AJD A;  5JRA A;  2QYU A;  5KJK A;  4DBQ A;  3B13 A;  4EZJ A;  5B3I A;  3M79 A;  2XLE A;  2B0O E;  4DLO A;  1K05 A;  3G4Z A;  4YK5 A;  3MJW A;  3DMD A;  4ABN A;  5LCW J;  3RAU A;  4MQ9 F;  2OCC E;  3K7D A;  1JR8 A;  1UFB A;  1K3Z D;  3NYL A;  2X38 A;  2R7W A;  1TN8 A;  1Q2Z A;  4E7S A;  3O4Z A;  2XLH A;  4JC8 A;  1YLM A;  3Q9U C;  2HJ3 A;  2EIK C;  1OCC E;  2ZPA A;  3B0P A;  3ISM C;  1IYG A;  3C3Q A;  1IHG A;  2GRR B;  5KNH D;  4GTT A;  5HKP A;  1CPQ A;  2J4B A;  2ZU6 B;  4K7B A;  3IQ5 A;  5KWD A;  3RVY A;  2GRL A;  5BUO A;  3PZ1 A;  2AWC A;  3E4B A;  5KYU B;  4C3E A;  3WHN A;  5A6B A;  4O1P A;  1V4A A;  2XLO A;  4C9B B;  3TWS A;  4NQF A;  4A63 B;  5JHB A;  4ILH B;  4BFR A;  2WZL A;  1HO8 A;  2AP3 A;  1K8K G;  1S7Z A;  1FFH A;  3GOR A;  2P9U G;  2V4L A;  4YL3 A;  4N4W A;  3UGP A;  1APC A;  2AJA A;  5T4Y A;  2EQX A;  5HV9 A;  1A7V A;  3RQG A;  1V54 E;  4B8C B;  2R7T A;  3NRH A;  3IXE A;  3JRT A;  2BL2 A;  5JA4 D;  4UQY A;  2GAQ A;  5JHA A;  4NY3 A;  1H6P A;  3Q79 A;  4I44 A;  4J30 B;  3UGO A;  3L13 A;  3DJU B;  1OCO C;  3D9I A;  4A55 A;  1LE2 A;  3LNR A;  1SF8 A;  1WG0 A;  4BT9 A;  3B7U X;  4CDY A;  2M64 A;  5KBA A;  2H6I A;  3C8Z A;  5CHE E;  3AQB A;  5HQ8 A;  1W3B A;  2VYI A;  3TG4 A;  4GPK A;  2KAT A;  1OY3 D;  3VTX A;  3B29 A;  4G1T A;  4MLP A;  2ICW G;  2GGF A;  3B7B A;  3AJI A;  2L81 A;  3ASD A;  2GRQ B;  4GTP A;  3O55 A;  4F53 A;  4L1B A;  4PJL A;  4QI2 A;  1HE8 A;  3TWV A;  3A11 A;  4U5G A;  3FP3 A;  4HOT A;  5CIV A;  2PNO A;  2A1D D;  4CDM A;  1CGN A;  3B0U X;  3ZHE B;  3D9M A;  5AEN A;  4UI9 K;  3S90 A;  4JTD B;  3N2Z B;  1UOH A;  2HUJ A;  4CCA A;  3B95 A;  4O1O A;  4JEA A;  4PS7 A;  1DVP A;  4ANU A;  2R7O A;  1VYK A;  1FFT C;  4WUY A;  4DJA A;  4C3B A;  4EBB A;  2H6G A;  1JOG A;  1E7U A;  4XI0 A;  2G62 A;  3FUK A;  5B3S E;  4IGG A;  2A6E F;  2NG1 A;  3ZQY A;  2XHE A;  4V3I A;  1QNF A;  2Q7R A;  2CCY A;  1ZHT A;  3QTH A;  1TFK B;  2J9B A;  3UIP C;  4GZ3 A;  1G8X A;  4IB4 A;  1FTS A;  1OWP A;  4LDR A;  1SZ9 A;  5AC4 A;  4MND A;  5COM A;  1BDJ B;  4KI2 A;  1EPU A;  2LSV A;  3W9G A;  4ONS A;  2E87 A;  2ASR A;  2P9S G;  1ZU4 A;  3IEE A;  2WZG A;  1OWM A;  3TWT A;  4PJN A;  4CX9 A;  2WQ7 A;  3ABM E;  2FF4 A;  3IQ6 A;  4Q94 A;  3W9F A;  2P58 C;  1I4Z A;  1ORY A;  1Q0K A;  3GEI A;  3OAW A;  4UQX A;  4HI9 A;  3TJ6 A;  4LRZ A;  5AQ7 A;  4ZFH A;  1YZC A;  1BD8 A;  2I9C A;  3IQC A;  5JJ6 A;  2R2L A;  1HZ4 A;  1H2V C;  2YNQ A;  4FJZ A;  4BEP A;  3SNH A;  3DAG A;  3EH2 A;  4E17 A;  4U5F E;  2DYR E;  3V5Y A;  1RKC A;  4YVQ C;  4XLN F;  4F1P A;  3CHS A;  1KZO A;  2L9J A;  2YKZ A;  4JKV A;  1OWN A;  4U04 A;  4WNE A;  3JUI A;  4PS3 A;  2IOL A;  3MKR A;  4HE8 D;  2JX0 A;  1V54 C;  4XEF A;  4OIP F;  2H7V C;  1K04 A;  3NMK A;  3FUF A;  3HLZ A;  3U2M A;  5FZQ A;  3SO8 A;  4RQI A;  2PF4 E;  5E3C A;  1Z5S C;  1H19 A;  1GQA A;  1NFO A;  3H65 A;  2VH3 A;  2HM8 A;  2EIL C;  2FBN A;  3ULQ A;  1S63 A;  2OKU A;  2XPY A;  3PZ2 A;  4WGZ A;  3IHU A;  4EHP A;  1DCQ A;  4CSA A;  1HY5 A;  4FP7 A;  3QW0 A;  2WB2 A;  2NSZ A;  1OWL A;  1UJJ A;  2XXA A;  3O6X A;  1LI7 A;  3AJM A;  2EPK X;  3CR3 A;  1SR2 A;  4HI8 A;  3LEV A;  3OA1 A;  4G23 A;  1U6H A;  1GM5 A;  3R9A B;  3ASF A;  4DI4 A;  2YL7 A;  4G25 A;  5EX0 A;  4JEH A;  2A5E A;  2I1J A;  2R25 A;  2C03 A;  2ETB A;  4YL0 A;  2Z15 A;  1TN7 A;  3CK7 A;  1LVK A;  1P5Q A;  2X51 A;  5CI8 A;  3QAQ A;  3R2P A;  3TQO A;  3GZ2 A;  5ENN A;  2VTB B;  5JP7 A;  1K1B A;  1AP7 A;  1WWP A;  4E0I A;  1E90 A;  4EZK A;  2QE9 A;  4LSZ E;  3ONL A;  2W4B A;  2PM7 A;  3T8K A;  3TAX A;  2PQN A;  2LSE A;  1RJ9 A;  3E33 A;  3FH5 A;  4MVO A;  4ULV A;  3CIA A;  1Y6I A;  3ASN C;  5T8I A;  2B0H A;  4Q4Z F;  4J7W A;  3VLD A;  3CSK A;  3R9M A;  2BC5 A;  1D0Z A;  5AYW D;  1BI8 B;  2LNI A;  1DOW A;  4KBQ A;  4J7T A;  4JZY A;  2DZN A;  4E85 A;  3L17 A;  1OW8 A;  3DBS A;  3VAY A;  2XS1 A;  3N24 A;  1SW6 A;  2J9U A;  1Z6A A;  5FTP A;  1QYM A;  3MYI A;  4YT8 A;  4G8K A;  3LY9 A;  3R7C A;  3DZA A;  3ABL E;  3LJB A;  5G05 J;  5EHH A;  2CNW D;  3HXB A;  3AS5 A;  2IM8 A;  2OEW A;  1U3D A;  3EHN A;  5IY5 C;  2OU6 A;  1XGW A;  3GYZ A;  3SXZ A;  2B0J A;  5T3W A;  3T6G B;  3S7D A;  1MX4 A;  2WQH A;  4MS6 A;  4I43 A;  3SEO A;  2HFI A;  2C2L A;  1NBB A;  4GTR A;  1ZU5 A;  4BEJ A;  2RSE B;  3TOM A;  1MQS A;  4OIN F;  3FU0 A;  4A3T A;  5DS6 A;  4CJG A;  1F1M A;  3VLF A;  3UR3 C;  5HRY A;  3V2O A;  2RD0 A;  1LTX A;  3SFY A;  4CDR A;  2JLB A;  4YDW A;  3U4T A;  1LD8 A;  1T5O A;  1AVO B;  3RIB A;  3FOP A;  4U8V D;  1BBH A;  5B1B C;  4TV3 A;  3EG9 A;  5A6A A;  1YZA A;  1EDU A;  2OEV A;  3ZHE A;  1M2V A;  3NBN B;  2Y4T A;  5F5F A;  1TFO B;  1TJC A;  4MRU A;  1ZW3 A;  2LSU A;  3DWL G;  5A23 A;  4FUL A;  3MV3 B;  1D9S A;  2WXN A;  3Q9N C;  3UMH A;  2V4H C;  2AU5 A;  3CKB A;  3FXH A;  1SQM A;  1IXV A;  1D1A A;  1BLX B;  4DRJ B;  3FTZ A;  3QB2 A;  2GWW A;  3LNM B;  5BPP A;  1Z6T A;  2LO6 A;  2X0C A;  4JE9 A;  1T01 A;  3JXI A;  3KEZ A;  1MHQ A;  3PZD A;  3UMV A;  2C04 A;  4YL1 A;  3L0I A;  2WL8 A;  1OCC C;  2EIK E;  3OXG A;  3T5X A;  4HQD A;  1HMO A;  2KM4 A;  2F37 A;  3LS8 A;  5D92 A;  2W4M A;  2YL3 A;  4OYS A;  3V79 K;  3AS8 A;  3SXY A;  2J0W A;  1TNZ A;  3SBS A;  2AXZ A;  3DE9 A;  3DPD A;  3DEP A;  2KJG A;  3AG4 E;  3TGO A;  2A0B A;  5T3T A;  4FA6 A;  3I3N A;  5LCW C;  2VSY A;  1X5B A;  4N6C A;  3Q47 B;  4RSY A;  4GA1 A;  4MW8 A;  1LS1 A;  2XEV A;  2YL1 A;  4FAP B;  4E0H A;  3EIJ A;  2OG2 A;  4EUK B;  4XEI G;  4MTO A;  1INZ A;  1WGW A;  4XZ4 A;  2D4U A;  1LS4 A;  2CHZ A;  1E85 A;  2F22 A;  4WNG A;  3SXK A;  2RKK A;  3JT1 A;  1H6O A;  4J8Y A;  5CMW A;  4BSZ B;  3NMJ A;  3PNL B;  5EIL A;  1A41 A;  4JJF A;  4CBE A;  3Q5M A;  3ESL A;  2MHR A;  4CJO A;  3U2L A;  4HOU A;  4OAV B;  1H9G A;  1JPN A;  3CHP A;  3KL4 A;  2P2C P;  1SA5 A;  4JTA B;  3FEX A;  2HSB A;  2XGO A;  5KYY B;  2PNN A;  3UUX A;  2V8S E;  2YHS A;  1Y6D A;  2PBE A;  3JTL O;  1N54 A;  3V5Z A;  3ZEF A;  3GM3 A;  1TNY A;  3S7J A;  5B1A E;  5FIO A;  2ZIS A;  1C03 A;  4JXT A;  3AG1 E;  4BX8 A;  2WXJ A;  4D4X A;  5B1B E;  2BKK B;  4JVS A;  5COF A;  4G0H A;  3CK8 A;  4MVZ A;  3EU5 A;  3G2U A;  1H6K A;  4B8A A;  2O9X A;  1KPS B;  1VYI A;  4F3V A;  1JCS A;  3TJP A;  3NYM A;  3DI5 A;  2OJQ A;  2WMO A;  1TN6 A;  4GZ6 A;  3DSS A;  3JQ0 A;  2YIN A;  3AU5 A;  5BQG A;  3FAP B;  4EHM A;  3C8G A;  4CS7 A;  3MYV A;  3FAJ A;  4I9E A;  3APF A;  2KSF A;  5E3A A;  3G4X A;  3NQP A;  3KSL A;  4LUN U;  2X3M A;  3DSU A;  3MX3 A;  2XL6 A;  2R7X A;  2XLV A;  3SNX A;  2GRO B;  1OQC A;  4JCH A;  1NFI E;  5G04 C;  2LAI A;  3C98 A;  5ENP D;  4UWF A;  4F4B A;  2V0P A;  3J06 A;  5EN5 D;  5L0D A;  4K0R A;  3AQC A;  2R7R A;  3PRE A;  2VGX A;  3PZ3 A;  5D2M C;  1A7E A;  3ITF A;  2VAS A;  3TWW A;  2KCV A;  4J0U A;  2Q00 A;  2V26 A;  1YVI A;  1NSG B;  4Q5S F;  1OCZ E;  2YQY A;  2ZIR A;  4A4A A;  3Q75 A;  1XWJ A;  1QSP A;  3UI2 A;  4MVQ A;  1CGM E;  3S84 A;  4BJ6 C;  5JLI A;  2L0T B;  4N3C A;  2CW0 F;  5JMN D;  3U66 A;  2XS8 A;  5G55 A;  2Y1L E;  1KT1 A;  4QI0 A;  1JPL A;  1NL4 A;  3ZYK A;  2KK1 A;  4CS8 C;  3PS6 A;  4AIF A;  4KMO A;  4ILI A;  4ZLD A;  2VCA A;  3HG0 D;  4E18 A;  5D0Q D;  4XE0 A;  4JJG A;  3ML9 A;  3M15 A;  4FU3 A;  3TOL A;  4JL0 A;  5L0H A;  2TMV P;  2CNW A;  3LYA A;  3JSZ A;  1FVH A;  2KQ9 A;  3QVY A;  2QNL A;  3U9J A;  4Z9H A;  5JS5 A;  3QVZ A;  1D0Y A;  4G7O F;  1YA9 A;  3BEH A;  3QMK A;  1LF8 A;  1R4T A;  3ZC4 A;  3JYS A;  3KEA A;  4FLH A;  1IHB A;  1UJK A;  3S0X A;  4KXK B;  4GYW A;  4U7E B;  5ANL A;  3KYJ A;  1KLX A;  3C8G B;  5D91 A;  2QFC A;  1Z5Z A;  2XZT G;  5BXU A;  3IHV A;  4U9D A;  3EZH A;  1RMV A;  3EU9 A;  1MQV A;  3ZSU A;  4RDA A;  4O79 A;  4NTB A;  3LXU X;  4U9E A;  2MHK A;  4JPS A;  1TEZ A;  4I3M A;  3T5V A;  1ZW2 A;  1U89 A;  3FTW A;  1S0P A;  3OXF A;  2YVK A;  4ULW A;  1OXJ A;  1D1B A;  1TWA A;  1M6T A;  3W8H A;  4WWP A;  3FTV A;  4PFO A;  3EGD A;  4I1M A;  4UQZ A;  2BE5 F;  2X6K A;  3ASO C;  3E37 A;  3LVQ E;  3ZDL A;  2WM9 A;  4BY6 A;  2IXP A;  3V30 A;  1UG7 A;  3HXC A;  1YJG A;  3T8M A;  1V55 C;  5DIZ A;  3ZYL A;  5ITZ F;  1AEP A;  1B68 A;  4C0E A;  2WXF A;  1VMA A;  5CMY A;  3RRM B;  4WJ0 A;  2P7V A;  3W2V A;  4R32 A;  1QZX A;  2XRH A;  2NYJ A;  2WB7 A;  3ZGQ A;  1QVX A;  4LER A;  3V31 A;  1LD7 A;  4WWO A;  4YT5 A;  3VM6 A;  4GMR A;  2UY1 B;  3RFY A;  3RO3 A;  4AOF A;  4F1S A;  1NU9 C;  3OTN A;  3ULY A;  4JA9 A;  4NIK A;  2I6H A;  4GTV A;  4WNF A;  2VB6 A;  3GEH A;  4N2Q A;  3I4R B;  4NQ0 A;  3N0T A;  4J8E A;  4UDV A;  1QZ2 A;  2KXP C;  4DXW A;  3WXX A;  3B9Q A;  5DQT A;  2CDQ A;  2DB4 A;  4GTQ A;  3HTK C;  2PZI A;  2EIM E;  2KZT A;  4Z68 A;  2C0M A;  1O1T A;  3GOD A;  2QC9 A;  3FDH A;  2GRP B;  3RRU A;  4IYP A;  1KTM A;  2J08 A;  2WPV A;  4LNG A;  4GCO A;  4CSA C;  2NSF A;  1FCH A;  2ZD9 A;  3NF1 A;  1ELR A;  3LVR E;  4N06 A;  1BU9 A;  2GW1 A;  3V5X A;  3DWW A;  2RG8 A;  3US6 A;  3DRA A;  1KNY A;  3PEU B;  3R7Q A;  1PY1 A;  2VGY A;  2HMQ A;  1V74 B;  3RQE A;  4HB5 A;  3U9W A;  3PZ4 A;  3UT8 A;  4AL0 A;  3BG0 B;  2XCC A;  3ZW3 A;  1OR2 A;  1E8Y A;  5FZT A;  2IBF A;  3CHO A;  3ATP A;  2Y3H A;  5AQB A;  4CRW A;  4N3A A;  4GMJ A;  4HFK B;  4PH4 B;  3ZVR A;  4ACK A;  3BEE A;  4OIR F;  4APO A;  3X1O A;  1BPO A;  3PRZ A;  5BUZ A;  5KYY A;  4U8Y D;  3RVZ A;  1XZP A;  3L82 A;  1NA0 A;  3CVP A;  4BEM J;  3VTY A;  3QZC A;  4F6R D;  2HE0 A;  2BF0 X;  3NAW A;  4GYY A;  3RYL A;  1YYX A;  3RQF A;  3CAX A;  4CEM A;  5G04 J;  3HNL A;  3ASN E;  3QKY A;  2RFM A;  2XQ0 A;  1R5I D;  1SMY F;  2XZD G;  1UN8 A;  3ABM C;  4BT8 A;  5DBK A;  3ZUV B;  3FH7 A;  2Q7F A;  3H2V A;  3UM2 A;  2AWI A;  2BED A;  4H4K C;  4IRU A;  3MBG A;  4OD5 A;  4E7Z A;  3EHR A;  3K9I A;  1EYH A;  3L8I A;  2V3C C;  2DVW A;  5EKQ D;  3K1I C;  3EZI A;  5FT9 A;  3LS1 A;  3AG3 C;  2IO3 C;  4DRX E;  4GCN A;  4U96 D;  1QBQ A;  3FWV A;  2DYS E;  3SD5 A;  3ASG A;  4MW3 A;  3APD A;  4RBN A;  1HF8 A;  3RKV A;  4FHJ A;  3B7S A;  3E30 A;  1DC2 A;  5B3S C;  1E2X A;  4PJJ A;  1IQR A;  1N4P A;  4AV7 A;  5BQI A;  2HS5 A;  1I4Y A;  5CEC B;  4D10 C;  3D9P A;  4LG6 A;  4B94 A;  2QUP A;  2EIJ E;  2VGX B;  4URK A;  4L23 A;  4U5E E;  5EK0 A;  5E2Q A;  1H0A A;  3F6Q A;  4L2L A;  4DI3 A;  3HRA A;  2Y3G A;  4DX7 D;  1Y4C A;  4I2Z A;  3C3R A;  1E8W A;  4CDN A;  1YDI A;  1N1C A;  4AXH A;  3IKO B;  4NTA A;  1VTM P;  4LEU A;  3FVY A;  3EDT B;  4PS8 A;  1M2O A;  4JHJ A;  1NP7 A;  1LKX A;  1S05 A;  3D9J A;  3Q15 A;  3L6A A;  4DX6 D;  4XTK A;  2FAP B;  3HJC A;  1FVF A;  2XCB A;  1AWC B;  1GGQ A;  1OKK D;  1D0X A;  5AAO A;  3PDN A;  4EQF A;  3S27 A;  1RKE B;  4U0Z A;  1PAQ A;  3IHY A;  5FQ4 A;  4HOS A;  1U3C A;  1JWG A;  4GTO A;  4YJW A;  1N4Q A;  5BW8 C;  4BTB A;  1NA3 A;  2L6B A;  3WG7 E;  3QWW A;  2IXN A;  4G8L A;  2P9P G;  2DIW A;  3LKU A;  3RK6 A;  1DNP A;  3ESK A;  1MX6 A;  3TWQ A;  1IW7 F;  2LUH A;  2LK4 A;  3DD7 A;  2XGM A;  1WTY A;  4HLL A;  5E75 A;  1ZZP A;  5LOZ A;  3QK0 A;  4BSX A;  2HO1 A;  1TJF A;  4JD2 G;  4G78 A;  3FTU A;  3CVQ A;  3QWP A;  5CBN A;  3BQO A;  2GFH A;  1ZU2 A;  4Q69 A;  4O60 A;  1H9T A;  4ANX A;  4HFF B;  1VLS A;  1HG2 A;  1JMW A;  2Y3B A;  1IQU A;  5FWQ A;  4WAF A;  4TXR A;  5KYX B;  4YN0 B;  1H6G A;  5DLJ A;  4MVS A;  5L0F A;  1NI1 A;  2B6C A;  3EGD B;  5AN8 A;  1FNT c;  2XSE A;  4GEH A;  1G4W R;  4GZ5 A;  3HKK A;  3AG1 C;  4DX2 A;  2HR2 A;  3TXM A;  4TXQ A;  2XXA B;  4L6R A;  4CDA A;  3SHF A;  3MYF A;  4JB8 P;  4U5C E;  4BWR A;  4JCZ A;  3FUI A;  4XEK A;  3KSQ A;  1QPU A;  2AVK A;  1NZE A;  5L0I A;  4AE4 B;  4DVY P;  3ECS A;  3SI5 A;  3DKA A;  1N52 A;  3TWU A;  3UX4 A;  3DEO A;  3HXD A;  2Q9B A;  2YLG A;  3E70 C;  1D8E A;  4U0U A;  4U0S A;  1FMV A;  3URZ A;  4I1A A;  2Y69 C;  2FGY A;  3MZL B;  4WAB A;  2QTV A;  4Z9I A;  4PK4 A;  1QKR A;  1AUE A;  4H54 A;  1O5H A;  3L9T A;  2J07 A;  3BG1 B;  2Q9C A;  3FTS A;  4XI9 A;  3AGT A;  2VTB A;  3LEO A;  3D9H A;  3SZ7 A;  3B71 A;  5BQH A;  5DS4 A;  4KT6 B;  3GM2 A;  2XM4 A;  2IYL D;  4W8K A;  2L6F A;  2KC7 A;  2L6J A;  2R5S A;  4QQI A;  4YND A;  1KU2 A;  2LIG A;  2XM0 A;  2CFU A;  3L1M A;  2LAH A;  3GAN A;  1HS6 A;  1MX2 A;  1X81 A;  3ZYQ A;  1OCR E;  1QQE A;  3HIZ A;  5ENR D;  3CQG B;  3APC A;  2J8S D;  4JUR I;  5EYP F;  5COG A;  1YYH A;  3G2V A;  3S29 A;  4HRM B;  5BXO A;  3CGH A;  1K40 A;  4I9C A;  4BG0 A;  2LFD A;  1HU3 A;  1ZHZ A;  4ANJ A;  1N95 A;  4XWJ A;  3C18 A;  4BX9 A;  3ABK C;  4LNB A;  3N71 A;  2OJE D;  2LFF A;  3X2Q C;  1L3P A;  4H7X A;  5FIN A;  2H6H A;  4DX1 A;  4A1S A;  3DXM G;  2Y4U A;  1Z3I X;  3P2B A;  1U2V G;  5BT1 A;  3F46 A;  1ZVZ A;  2DBA A;  4BTA A;  5ANR A;  3CVL A;  4DRI B;  4B93 B;  3S7F A;  3K1H A;  2XLW A;  3CHR A;  2IOQ A;  1MZC A;  3PEV B;  3JSE O;  2WXG A;  4EWC A;  3POV A;  3G2S A;  1ORJ A;  2UUI A;  3FUE A;  2OCC C;  2R7Q A;  3E32 A;  1JCQ A;  3ZKJ A;  3SXM A;  4JHR A;  2IOS A;  4K5C A;  5KNG A;  4AEZ C;  3UMK A;  4I6G A;  4HNA D;  3ENE A;  3LY7 A;  3CVX A;  4AY6 A;  1T6U A;  2XL4 A;  1OCR C;  4JHK A;  3NMI A;  2KYH A;  3W4Y A;  2MRI A;  3TUL A;  4FHK A;  1M57 C;  4GQH A;  2WXP A;  3E34 A;  3ZXP A;  4AP2 A;  2QY9 A;  3O10 A;  3EFO A;  3AAA C;  1PV3 A;  1Z3X A;  2I2O A;  3B0V C;  1LE4 A;  1ZBP A;  1BR1 A;  1E8X A;  2Y69 E;  4JTC B;  2R17 C;  3TWX A;  2DZO A;  2XEH A;  4CDV A;  4U5B E;  1ZHW A;  4CIP A;  4K03 A;  4YDE A;  1NU7 D;  1SVX A;  4EBA G;  1OR3 A;  3E9V A;  3L34 A;  4DJ9 A;  3B7T A;  4Y6C A;  3U3W A;  2J0X A;  3FU3 A;  1C17 M;  3KS2 A;  3TL5 A;  3NKD A;  3FUJ A;  2LD6 A;  4N2S A;  1NFN A;  1YCS B;  5BV1 A;  4PJM A;  5A6K A;  2EIN C;  3NOG D;  2ETA A;  3KYI A;  1SYQ A;  2X6H A;  3HHM A;  1XNF A;  1M56 C;  1LIH A;  3QNK A;  2EPL X;  2C0L A;  5AJL A;  2V5F A;  1JRA A;  2NPU A;  2EPN A;  3AG4 C;  1KT0 A;  4KZ0 A;  3ZIB A;  1TWH A;  2IXO A;  3FHD A;  1S70 B;  3NB2 A;  4L2Y A;  3L08 A;  4J6I A;  3I4U A;  1OKK A;  3K1I A;  1MJ0 A;  1VB5 A;  5KYN A;  3ZQV A;  5EID A;  5C1D A;  2J9W A;  2NSG A;  4IWB A;  5E33 A;  2DGJ A;  2YZS A;  1LPE A;  1YMP A;  3MA5 A;  4GTS A;  4GZD A;  1WOL A;  2WVO A;  2HV7 A;  3O39 A;  4NC3 A;  1WAT A;  3PMR A;  2WXM A;  4YDO A;  5ENO D;  3SFX A;  3QAR A;  4IN3 B;  2FEZ A;  2CGE A;  4Q96 A;  3UMI A;  4UUC A;  1JAF A;  5BNW A;  2LXM A;  4D4N A;  3NZU A;  3ZN3 A;  2CG2 A;  2E2E A;  5A6B D;  2HJM A;  4O6N A;  2HKV A;  3I4G A;  3LES A;  3JCK C;  4BJ1 A;  2IXM A;  4U07 A;  3CZ6 A;  4IAQ A;  2NUP B;  2EPM X;  3AG3 E;  3FFL A;  1G3N B;  4FX5 A;  3U5S A;  1OWO A;  4EBJ A;  1DOV A;  1SA4 A;  1PC2 A;  2VSX E;  3UM1 A;  1HFA A;  2UWJ G;  4ACL A;  1ZHX A;  3ZFW A;  5G2N A;  3LY8 A;  1L5J A;  1NZN A;  3HXE A;  2FO1 E;  3FTX A;  4TRQ A;  2KNH A;  1N9A A;  3UIN C;  2OOE A;  4U8H A;  1O3U A;  2OQM A;  3ONK A;  3SY2 A;  5KYX A;  2NC9 A;  4IAR A;  1L7C A;  1EKY A;  5AGF A;  3UTM A;  2GDC A;  3RKO F;  2WQ6 A;  4MVR A;  1OW6 A;  2R59 A;  3LDZ A;  4CT0 A;  3ABK E;  5CEA A;  2IY0 C;  4U63 A;  2ZXR A;  3S28 A;  1BR4 A;  1HMD A;  1MMG A;  3GM1 A;  4XQ1 A;  4WND A;  5CER B;  1PD1 A;  4I6E A;  1GS9 A;  4LDK A;  2XGS A;  2L6H A;  1YA0 A;  3VF0 A;  1O5M A;  4DVZ A;  2F8X K;  3Q4A B;  4F7A A;  1SZA A;  3FUH A;  2MWQ A;  4H7Y A;  4AL1 A;  5CRU A;  5J08 A;  3ZPJ A;  5A69 A;  5ARG A;  4W9R A;  3ZXS A;  3ASH A;  1N94 A;  3EH1 A;  4ER9 A;  3T6B A;  2WXK A;  3AU4 A;  5HS0 A;  1UN9 A;  1OW7 A;  2M63 A;  3C5R A;  5LX8 A;  4ATG A;  1MMN A;  5L3Q A;  4ME2 A;  4FJY A;  2KGO A;  2XRY A;  3SBT B;  1TWC A;  2R05 A;  4EKW A;  1HH8 A;  2EIJ C;  3RU0 A;  2IEJ A;  3Q7F A;  3NDB B;  2KBX A;  3CVN A;  3O48 A;  4FES A;  2IQC A;  4AY5 A;  3HDX A;  5EGY A;  5JJT A;  4UWH A;  3OXL A;  4JA7 A;  3NKE A;  1Z3Y A;  3SFZ A;  3C7J A;  1ELK A;  1BR2 A;  2A69 F;  1FAP B;  4J8S A;  2LXL A;  4MS2 A;  1H2U A;  3FY4 A;  2XL8 A;  4BET A;  1PD0 A;  5T1D B;  2OVF A;  3SQV A;  2OOC A;  3LJN A;  2IU1 A;  5EDS A;  3RRN B;  2PX0 A;  2UUH A;  3K33 A;  1MYO A;  4LCT A;  4X8Q A;  2YHC A;  1OUV A;  1EF1 C;  4OIQ F;  5KJM A;  3ZTM A;  5CBO A;  3I5Q A;  4G7Z F;  2Y3D A;  5L0J A;  4G24 A;  4J8F A;  2QY7 A;  4MVM A;  1GW6 A;  4CYM D;  4B89 A;  3HVE B;  4RG6 A;  1O1R A;  4N6H A;  3BUA A;  5FZR A;  3HNI A;  5AAR A;  1WAS A;  1S64 A;  4IJJ A;  4P6I C;  1U0B B;  2CG3 A;  4NRH B;  3V2X A;  4GB9 A;  4UI9 C;  4LLC A;  3ZU7 B;  4HBD A;  1OXB A;  4CS9 A;  4RLY A;  4DPR A;  4DRH B;  3EIQ C;  4C0M A;  3D9L A;  3DM9 B;  5GPG B;  3AS4 A;  3M1C B;  2WXR A;  3L22 A;  4J7Y A;  2V5Q C;  4ZLC A;  2J45 A;  1E86 A;  3D9N A;  4O6Y A;  3EFO B;  5AQA A;  4AM9 A;  2VJ8 A;  4O6M A;  4I17 A;  4BJ6 A;  3VYW A;  2VGE A;  2R03 A;  3Q49 B;  2P0N A;  4N5C A;  5LFA A;  1H2T C;  4JRZ A;  4CS8 A;  1QLE C;  4LLE A;  2WVN A;  4BJ5 C;  3W8I A;  3PUJ A;  4KC9 A;  4GA0 A;  4GTM A;  3Q6M A;  2XEE A;  3ULE G;  1HG5 A;  2R7U A;  1T6I A;  3QWV A;  5HSW A;  3VRC A;  1T9K A;  2J8W A;  2DYR C;  5BV0 A;  2DI3 A;  4U5D E;  4XPY A;  3HNJ A;  3M4C A;  1FT2 A;  2G3V A;  2KC3 A;  3FDQ A;  3LLK A;  3CQZ A;  2PM6 A;  4O7G A;  4P9T A;  3EJN A;  4XPX A;  4J8D A;  5EYL A;  2J49 A;  3C72 A;  2FUL A;  4HRN A;  4LDQ A;  3PHF 2;  3KMI A;  3CV0 A;  4PAC A;  2WXH A;  4YDY A;  2VSO E;  3KKB A;  1H7I A;  1Y8M A;  3RSE G;  1KZP A;  4P29 A;  1N4R A;  3LCA A;  3CEX A;  4K5B A;  3KPH A;  1Q0M A;  4HXI A;  4RVB A;  3ZVV A;  4DK5 A;  3F47 A;  2P1A A;  2QLA A;  2EIL E;  1ZHY A;  3EHM A;  3FH8 A;  2XEN A;  3ZYM A;  2R9R B;  3HVE A;  4GAA A;  4NCQ A;  4GU5 A;  4MTF A;  2AXU A;  3CQC B;  3SGH A;  5FQ8 A;  3CHQ A;  1JCR A;  3FTY A;  2XLD A;  3LAY A;  3UIO C;  3CVU A;  3MCX A;  1E7V A;  2H8A A;  3DM5 A;  3GEE A;  3U3B A;  3KD7 A;  4OAU C;  3SYN A;  4LNU D;  2L7A A;  2X6I A;  1UW4 B;  4N3B A;  2ZXP A;  1FMW A;  5L3V A;  4EEC A;  3CEQ A;  1NG1 A;  2Y39 A;  3LS0 A;  3Q6N A;  3IPM O;  2P61 A;  2WXI A;  5L0C A;  3Q7L A;  4ATZ D;  3JYY A;  2JAB A;  3EG9 B;  2XPI A;  3C8G D;  2MYO A;  3TK0 A;  3S2A A;  3IEG A;  5FQ6 A;  3A9C A;  5AQ9 A;  1M2V B;  2A5U A;  3GZ1 A;  2NUP A;  2HZ8 A;  2YLI A;  2YL0 A;  2EIM C;  3FMS A;  4JIO A;  3IBE A;  2LP4 A;  3RW0 A;  4C7O A;  4DLQ A;  4FLB A;  2VCC A;  3TJ5 A;  4N5Q A;  4NUR A;  3RH3 A;  5A6J A;  2AWY A;  4OVU A;  1TKN A;  2OVB A;  3MFN A;  1O1S A;  1VDY A;  3RJV A;  1BI7 B;  4JEB A;  5EIB E;  4PR9 A;  1YYJ A;  2P9L G;  4XEV A;  2GRM A;  5ARF A;  5A7D B;  3Q7G A;  4FAD A;  5B1A C;  4C3D A;  3AOU A;  4HOR A;  3DXJ F;  2GA0 A;  1MNE A;  4APF A;  2PQR A;  3QDN A;  4IUL A;  3NG1 A;  3CVW A;  4IAO A;  2YRF A;  1OXK A;  3UKR G;  2YHE A;  3UM3 A;  4YVO A;  3CVY A;  3D9O A;  4ZHB A;  3L8J A;  3ZWI A;  4EPZ A;  4DOZ A;  3FUM A;  3X2Q E;  2A68 F;  1Z23 A;  3L16 A;  2F0Y A;  1YAR O;  3NYJ A;  2PX3 A;  3GWN A;  1Z63 A;  3KAE A;  2OV8 A;  4KNW A;  3IV0 A;  4FWV A;  4Q7C A;  3GZS A;  4PDX A;  4TXP A;  5KJL A;  2OND A;  2Y3A A;  2QYJ A;  5FQ7 A;  5JT4 A;  3FUD A;  3DAF A;  5JJ7 A;  3U8P A;  1ZYR F;  4XIF A;  4HOQ A;  3VLE A;  1E8Z A;  1E84 A;  3T9O A;  2JPU A;  1A0B A;  3Q7A A;  1VK5 A;  1TNB A;  2EIN E;  1MND A;  3WOD F;  5JSL A;  2IFU A;  4LAC B;  2AXV A;  3ZG1 A;  3JRM O;  3DPY A;  5CI9 A;  4MBG A;  2LCH A;  2J09 A;  2J7P A;  1OCZ C;  3HNK A;  5CCM A;  2CHX A;  4YWQ A;  1RKE A;  4CIH A;  3SP1 A;  1WN0 A;  1IKN D;  5C2Y A;  4CGW A;  4J32 B;  2JEK A;  1LM3 B;  3MEK A;  3DSV A;  2J46 A;  3D9K A;  4UWL A;  3CKC A;  4Y6W A;  4KBL A;  3S9O A;  4GML A;  4GYO A;  4XLP F;  3B7R L;  3CK9 A;  4GZC A;  5LP0 A;  3G2W A;  3UM0 A;  2KZT B;  4A2N B;  5JUA A;  3MLG A;  1PCX A;  2JD3 A;  3M4B A;  2R7V A;  3TG5 A;  1N0Q A;  2VC9 A;  4ANV A;  3NZS A;  4XKC A;  2KW3 C;  1FT1 A;  3FU5 A;  2WVQ A;  3AGU A;  3JXJ A;  3ASO E;  4AVX A;  2X6F A;  3W2W A;  2BUG A;  3TD7 A;  4AX2 A;  2I1K A;  5CED B;  1E83 A;  4DBR A;  4TUM A;  5D66 A;  2BKG A;  5ENQ D;  3UT7 A;  1YA7 O;  4YT2 A;  3U8V A;  4NTF A;  4CS9 C;  3UPV A;  3DSW A;  3C62 A;  4G26 A;  2Q3T A;  3Q73 A;  2WMN A;  5DQZ A;  2W9Y A;  4B6I A;  1FR0 A;  1J8M F;  3JUE A;  5FZS A;  256B A;  1E96 B;  2MYS A;  5KCM A;  3WAQ A;  1FPP A;  3CVV A;  3PNT B;  3UNG C;  2LQG A;  2VSN A;  3PUK A;  1ZB1 A;  1I5N A;  4XPW A;  2OEX A;  5JVE A;  5J90 A;  4K0D A;  2Q9A A;  5FJY A;  4HVB A;  2VCB A;  1HX8 A;  1WM5 A;  1N4S A;  2HYZ A;  4BJ5 A;  1QQ3 A;  4AE4 A;  4CT4 A;  2Y0B G;  5F28 E;  4BES A;  2R7S A;  4AK9 A;  1D8D A;  2D5R B;  1OT8 A;  4X0R A;  3K66 A;  2PFD A;  1MMA A;  4KYO B;  3QW1 A;  5IY5 E;  2P6V A;  4HS2 A;  1TNU A;  2MOW A;  4KVM A;  2A6H F;  5FCL A;  3UKU G;  4PUC A;  1EI7 A;  2Q4F A;  3Q78 A;  4P9F A;  4OIO F;  1ORS C;  1W2W A;  4BJT A;  5M72 A;  3P1U A;  3FUL A;  3LLI A;  3SF4 A;  3EPV A;  2WXQ A;  3FUN A;  4Z9J A;  1DCE A;  3R7R A;  4L7T A;  3QC1 A;  1TYQ G;  2M4E A;  4I2W A;  4CGV A;  4I1O B;  4QDL A;  4HLE A;  2EPO A;  2BTD A;  3JZ0 A;  3C3O A;  2H7O A;  4XKB A;  1J8Y F;  3IQT A;  3JQ1 A;  3PH0 C;  3ZIM A;  4B0Z A;  4FC8 A;  1JWF A;  2CFZ A;  2AW6 A;  1VLT A;  2KCL A;  4ANW A;  1CPR A;  1SZI A;  2XPZ A;  1V55 E;  2ION A;  4A1G A;  5DS5 A;  1G4U S;  3EGX A;  2ZXW E;  1HE1 A;  3DST A;  5G05 C;  2GRN B;  2YEV A;  1JUQ A;  1Q0G A;  3GWL A;  3LPZ A;  2H7B A;  4GA2 A;  2ETS A;  1LI5 A;  1T6Q A;  4MKT A;  3UT4 A;  4RG9 A;  5E76 A;  2FFH A;  1RW2 A;  2ILR A;  3EUV A;  3PE3 A;  1G5Z A;  3GW4 A;  1ST6 A;  3ML8 A;  2IJG X; 
#chains in the Genus database with same CATH homology
 3EQL F;  2UY1 A;  5T3R A;  4C7O B;  3MV2 B;  2HV6 A;  3UQ3 A;  4XX5 A;  5KYW A;  3AG2 C;  3FU6 A;  3D3M A;  2W45 A;  4KNV A;  3KH2 A;  5KJN A;  3OWT A;  2DYS C;  3QOU A;  5CCL A;  2WZF A;  1O87 A;  2AVP A;  3HYM B;  2WXL A;  1TWG A;  1WY6 A;  3WG7 C;  3FEY A;  4HEA J;  4U5H A;  2XRZ A;  4G7H F;  2L9B A;  3MKQ B;  3PE4 A;  4HFG A;  2X6J A;  3FHE A;  3JCU Q;  1JPJ A;  1ELW A;  3DJN B;  4RD9 A;  2J9V A;  2A4Z A;  3EGX B;  4AJW A;  4NAC A;  4JZA A;  4N39 A;  2DCP A;  2PL2 A;  2YQ8 A;  2J7P D;  2NUT A;  3I5P A;  3CST A;  3ABL C;  4G2V A;  4UWK A;  4UWG A;  2G3K A;  3S7B A;  2L0I A;  4E6H A;  3JYH A;  3RO2 A;  2PP4 A;  3OEO A;  4QFV A;  5KYW B;  4UI9 J;  4JEU A;  5AIJ A;  2CHW A;  3RIP A;  3CLJ A;  2IF4 A;  3CHM A;  5HI7 A;  2ZXO A;  3T6J A;  1TR2 A;  3K6B A;  5EX3 A;  4JW1 A;  3QJZ A;  1VOM A;  3MGB A;  2WXO A;  4M63 A;  4EBA A;  4M3O A;  4O6F A;  4A3V A;  1A17 A;  5DVW A;  4R7L A;  2KCK A;  5F5H A;  3PVL A;  3MKQ A;  1UG3 A;  2J4D A;  2FI7 A;  4TUU A;  4WWN A;  5KYU A;  3V7O A;  3SZR A;  2NXP A;  3LJ3 A;  4KZC A;  1MMD A;  5D0O D;  5A6C A;  3T4R A;  4YT4 A;  3U64 A;  2VQ2 A;  4EZL A;  4GYT A;  4G11 A;  2ZXW C;  1IZM A;  2E0I A;  3L54 A;  4I6J A;  1WAO 1;  1B89 A;  2J9Q A;  1HXI A;  2NUT B;  4OVV A;  3ZRH A;  2I8B A;  2WVI A;  4KVO A;  3TXN A;  3LEW A;  4ILG A;  4OD4 A;  3CSF A;  2FO7 A;  4PFP A;  1D1C A;  3G2T A;  1RJ9 B;  5AJD A;  5KJK A;  4DBQ A;  3B13 A;  4EZJ A;  4DLO A;  3MJW A;  4ABN A;  3DMD A;  5LCW J;  4MQ9 F;  3K7D A;  3NYL A;  2X38 A;  2R7W A;  4E7S A;  3O4Z A;  4JC8 A;  2EIK C;  2ZPA A;  3B0P A;  1IYG A;  1IHG A;  2J4B A;  2ZU6 B;  4K7B A;  2GRL A;  5BUO A;  3E4B A;  5KYU B;  4C3E A;  4C9B B;  5JHB A;  4ILH B;  4BFR A;  2WZL A;  1HO8 A;  1S7Z A;  1FFH A;  2V4L A;  3UGP A;  5T4Y A;  2EQX A;  4B8C B;  2R7T A;  3NRH A;  3JRT A;  4UQY A;  5JHA A;  4NY3 A;  4I44 A;  4J30 B;  3UGO A;  3L13 A;  3DJU B;  1OCO C;  3D9I A;  4A55 A;  3LNR A;  1SF8 A;  4BT9 A;  3B7U X;  5CHE E;  3AQB A;  5HQ8 A;  1W3B A;  2VYI A;  3TG4 A;  4GPK A;  2KAT A;  3VTX A;  4G1T A;  4MLP A;  2GGF A;  2L81 A;  3ASD A;  4F53 A;  4L1B A;  4PJL A;  4QI2 A;  1HE8 A;  4U5G A;  3FP3 A;  4HOT A;  2A1D D;  4CDM A;  3ZHE B;  3B0U X;  3D9M A;  5AEN A;  4UI9 K;  3N2Z B;  4CCA A;  4PS7 A;  1DVP A;  4ANU A;  2R7O A;  1VYK A;  1FFT C;  4WUY A;  4DJA A;  4C3B A;  4EBB A;  1E7U A;  4XI0 A;  2G62 A;  3FUK A;  2A6E F;  2NG1 A;  2XHE A;  4V3I A;  1QNF A;  1ZHT A;  4GZ3 A;  1G8X A;  1FTS A;  1OWP A;  1SZ9 A;  4MND A;  4KI2 A;  1EPU A;  2LSV A;  2E87 A;  3IEE A;  1ZU4 A;  2WZG A;  1OWM A;  4PJN A;  2WQ7 A;  2FF4 A;  4Q94 A;  2P58 C;  3OAW A;  4UQX A;  4LRZ A;  2I9C A;  5JJ6 A;  1HZ4 A;  1H2V C;  2YNQ A;  4FJZ A;  3SNH A;  3DAG A;  3EH2 A;  4U5F E;  4YVQ C;  4XLN F;  3CHS A;  2L9J A;  4U04 A;  1OWN A;  4WNE A;  3JUI A;  4PS3 A;  2IOL A;  3MKR A;  4HE8 D;  1V54 C;  4OIP F;  2H7V C;  3FUF A;  3HLZ A;  5FZQ A;  2PF4 E;  5E3C A;  1H19 A;  3H65 A;  2VH3 A;  2HM8 A;  2EIL C;  3ULQ A;  2FBN A;  2XPY A;  4CSA A;  4FP7 A;  2WB2 A;  2NSZ A;  1OWL A;  1UJJ A;  2XXA A;  3O6X A;  3CR3 A;  3LEV A;  3OA1 A;  4G23 A;  3R9A B;  3ASF A;  4DI4 A;  4G25 A;  5EX0 A;  4JEH A;  2I1J A;  2C03 A;  2Z15 A;  3CK7 A;  1LVK A;  1P5Q A;  2X51 A;  5CI8 A;  3QAQ A;  3GZ2 A;  5ENN A;  2VTB B;  1E90 A;  4EZK A;  3ONL A;  2W4B A;  2PM7 A;  3TAX A;  2PQN A;  2LSE A;  1RJ9 A;  3FH5 A;  3CIA A;  1Y6I A;  3ASN C;  5T8I A;  4Q4Z F;  3VLD A;  3CSK A;  1D0Z A;  5AYW D;  2LNI A;  4KBQ A;  4JZY A;  4E85 A;  3L17 A;  3DBS A;  3VAY A;  3N24 A;  2J9U A;  1Z6A A;  5FTP A;  4YT8 A;  3LY9 A;  3DZA A;  3LJB A;  5G05 J;  5EHH A;  2CNW D;  3AS5 A;  1U3D A;  3EHN A;  5IY5 C;  1XGW A;  3GYZ A;  2B0J A;  5T3W A;  3S7D A;  2WQH A;  4MS6 A;  4I43 A;  3SEO A;  2C2L A;  1ZU5 A;  4BEJ A;  1MQS A;  4OIN F;  3FU0 A;  4A3T A;  5DS6 A;  3VLF A;  3UR3 C;  2RD0 A;  4CDR A;  2JLB A;  3U4T A;  3RIB A;  5B1B C;  4TV3 A;  3EG9 A;  1EDU A;  3ZHE A;  1M2V A;  2Y4T A;  5F5F A;  1TJC A;  4MRU A;  2LSU A;  5A23 A;  4FUL A;  3MV3 B;  2WXN A;  3UMH A;  3CKB A;  1SQM A;  1D1A A;  3FTZ A;  3QB2 A;  5BPP A;  1Z6T A;  2LO6 A;  3KEZ A;  1MHQ A;  3PZD A;  3UMV A;  2C04 A;  3L0I A;  2WL8 A;  1OCC C;  3OXG A;  3T5X A;  2KM4 A;  3LS8 A;  5D92 A;  2W4M A;  4OYS A;  3AS8 A;  2J0W A;  3SBS A;  2AXZ A;  3DPD A;  2KJG A;  3TGO A;  5T3T A;  4FA6 A;  3I3N A;  5LCW C;  2VSY A;  1X5B A;  3Q47 B;  4RSY A;  4GA1 A;  1LS1 A;  2XEV A;  3EIJ A;  2OG2 A;  1INZ A;  1WGW A;  4XZ4 A;  2CHZ A;  4WNG A;  3JT1 A;  5CMW A;  3PNL B;  4JJF A;  4CBE A;  3Q5M A;  3ESL A;  4HOU A;  1JPN A;  3CHP A;  3KL4 A;  3FEX A;  2XGO A;  5KYY B;  3UUX A;  2V8S E;  2YHS A;  1N54 A;  3ZEF A;  3S7J A;  4JXT A;  4BX8 A;  2WXJ A;  4JVS A;  4G0H A;  3CK8 A;  3G2U A;  1H6K A;  4B8A A;  2O9X A;  1VYI A;  4F3V A;  3TJP A;  3NYM A;  2WMO A;  4GZ6 A;  3JQ0 A;  2YIN A;  3AU5 A;  4CS7 A;  3MYV A;  3FAJ A;  4I9E A;  3APF A;  5E3A A;  3NQP A;  4LUN U;  2X3M A;  3MX3 A;  2R7X A;  3SNX A;  4JCH A;  5G04 C;  2LAI A;  3C98 A;  4UWF A;  4F4B A;  2V0P A;  4K0R A;  3AQC A;  2R7R A;  3PRE A;  2VGX A;  3ITF A;  2VAS A;  2KCV A;  4J0U A;  2V26 A;  4Q5S F;  4BJ6 C;  2L0T B;  4N3C A;  2CW0 F;  3U66 A;  5G55 A;  1KT1 A;  4QI0 A;  1JPL A;  3ZYK A;  4AIF A;  4CS8 C;  3PS6 A;  4KMO A;  4ILI A;  4ZLD A;  5D0Q D;  4XE0 A;  4JJG A;  3ML9 A;  4FU3 A;  4JL0 A;  3LYA A;  2CNW A;  3JSZ A;  1FVH A;  2KQ9 A;  1D0Y A;  4G7O F;  3QMK A;  3JYS A;  1LF8 A;  3ZC4 A;  4FLH A;  1UJK A;  3S0X A;  4KXK B;  4GYW A;  5ANL A;  1KLX A;  5D91 A;  2QFC A;  1Z5Z A;  3IHV A;  3EZH A;  3ZSU A;  4RDA A;  4O79 A;  3LXU X;  2MHK A;  4JPS A;  1TEZ A;  4I3M A;  3T5V A;  3FTW A;  1S0P A;  3OXF A;  4ULW A;  1D1B A;  1TWA A;  3W8H A;  4WWP A;  3FTV A;  4PFO A;  3EGD A;  4I1M A;  4UQZ A;  2BE5 F;  2X6K A;  3ASO C;  3LVQ E;  2WM9 A;  4BY6 A;  2IXP A;  3ZYL A;  3T8M A;  1V55 C;  5DIZ A;  4C0E A;  2WXF A;  1VMA A;  5CMY A;  3RRM B;  4WJ0 A;  2P7V A;  3W2V A;  1QZX A;  2XRH A;  2WB7 A;  3ZGQ A;  4LER A;  4WWO A;  4YT5 A;  2UY1 B;  3RFY A;  3RO3 A;  4AOF A;  4F1S A;  1NU9 C;  3OTN A;  4JA9 A;  2I6H A;  4WNF A;  2VB6 A;  4N2Q A;  3I4R B;  4NQ0 A;  3N0T A;  4J8E A;  1QZ2 A;  3WXX A;  3B9Q A;  5DQT A;  2CDQ A;  3HTK C;  2PZI A;  2KZT A;  2C0M A;  3GOD A;  3FDH A;  3RRU A;  4IYP A;  2J08 A;  2WPV A;  4GCO A;  4CSA C;  1FCH A;  3NF1 A;  1ELR A;  3LVR E;  4N06 A;  2GW1 A;  2RG8 A;  3PEU B;  3R7Q A;  1PY1 A;  2VGY A;  3U9W A;  3UT8 A;  3BG0 B;  2XCC A;  3ZW3 A;  1E8Y A;  3CHO A;  2Y3H A;  4CRW A;  4N3A A;  4GMJ A;  4HFK B;  4PH4 B;  3ZVR A;  4ACK A;  3BEE A;  4OIR F;  4APO A;  3X1O A;  1BPO A;  3PRZ A;  5BUZ A;  5KYY A;  1NA0 A;  3CVP A;  3VTY A;  3QZC A;  2BF0 X;  4GYY A;  3RYL A;  4CEM A;  5G04 J;  3QKY A;  2XQ0 A;  1SMY F;  1UN8 A;  3ABM C;  4BT8 A;  5DBK A;  3FH7 A;  2Q7F A;  2AWI A;  4H4K C;  4IRU A;  4OD5 A;  4E7Z A;  3K9I A;  1EYH A;  2V3C C;  5EKQ D;  3K1I C;  3EZI A;  5FT9 A;  3LS1 A;  3AG3 C;  4GCN A;  3FWV A;  3SD5 A;  3ASG A;  3APD A;  4RBN A;  1HF8 A;  3RKV A;  4FHJ A;  3B7S A;  5B3S C;  4PJJ A;  1IQR A;  4AV7 A;  4D10 C;  3D9P A;  4B94 A;  2VGX B;  4URK A;  4L23 A;  4U5E E;  5E2Q A;  1H0A A;  4L2L A;  4DI3 A;  2Y3G A;  4I2Z A;  1E8W A;  4CDN A;  1N1C A;  4AXH A;  3IKO B;  4LEU A;  4PS8 A;  3FVY A;  3EDT B;  1M2O A;  4JHJ A;  1NP7 A;  1LKX A;  3D9J A;  3Q15 A;  3L6A A;  4XTK A;  3HJC A;  1FVF A;  2XCB A;  1OKK D;  1D0X A;  3PDN A;  4EQF A;  3S27 A;  4U0Z A;  1PAQ A;  3IHY A;  5FQ4 A;  4HOS A;  1U3C A;  1JWG A;  4YJW A;  5BW8 C;  4BTB A;  1NA3 A;  3QWW A;  2IXN A;  2DIW A;  3LKU A;  3RK6 A;  1DNP A;  3ESK A;  1IW7 F;  3DD7 A;  2XGM A;  5LOZ A;  5E75 A;  3QK0 A;  4BSX A;  2HO1 A;  1TJF A;  3FTU A;  3CVQ A;  3QWP A;  2GFH A;  1ZU2 A;  4Q69 A;  4ANX A;  4HFF B;  1HG2 A;  2Y3B A;  1IQU A;  5FWQ A;  4WAF A;  5KYX B;  4YN0 B;  5DLJ A;  3EGD B;  2XSE A;  4GEH A;  4GZ5 A;  3AG1 C;  2HR2 A;  3TXM A;  2XXA B;  3SHF A;  4U5C E;  4BWR A;  3FUI A;  1NZE A;  4AE4 B;  4DVY P;  3ECS A;  3SI5 A;  1N52 A;  3UX4 A;  2Q9B A;  3E70 C;  4U0U A;  4U0S A;  1FMV A;  3URZ A;  4I1A A;  2Y69 C;  2FGY A;  3MZL B;  2QTV A;  4PK4 A;  1O5H A;  2J07 A;  3BG1 B;  2Q9C A;  3FTS A;  4XI9 A;  2VTB A;  3SZ7 A;  4KT6 B;  5DS4 A;  2IYL D;  4W8K A;  2KC7 A;  2L6J A;  2R5S A;  4YND A;  1KU2 A;  2CFU A;  2LAH A;  3GAN A;  1HS6 A;  3ZYQ A;  1QQE A;  3HIZ A;  3CQG B;  3APC A;  4JUR I;  3G2V A;  3S29 A;  3CGH A;  4I9C A;  4BG0 A;  1HU3 A;  1ZHZ A;  4ANJ A;  4XWJ A;  4BX9 A;  3ABK C;  3N71 A;  3X2Q C;  4H7X A;  4A1S A;  2Y4U A;  1Z3I X;  3P2B A;  5BT1 A;  3F46 A;  2DBA A;  4BTA A;  5ANR A;  3CVL A;  3S7F A;  3K1H A;  3CHR A;  2IOQ A;  3PEV B;  2WXG A;  4EWC A;  3POV A;  3G2S A;  3FUE A;  2OCC C;  2R7Q A;  4JHR A;  2IOS A;  4AEZ C;  3UMK A;  4I6G A;  3ENE A;  3LY7 A;  3CVX A;  4AY6 A;  2XL4 A;  1OCR C;  4JHK A;  2MRI A;  4FHK A;  1M57 C;  2WXP A;  4AP2 A;  2QY9 A;  3EFO A;  1Z3X A;  2I2O A;  3B0V C;  1ZBP A;  1BR1 A;  1E8X A;  2R17 C;  4U5B E;  1ZHW A;  4K03 A;  1NU7 D;  4EBA G;  3E9V A;  3L34 A;  3U3W A;  3B7T A;  4Y6C A;  2J0X A;  3FU3 A;  3KS2 A;  3TL5 A;  3NKD A;  3FUJ A;  4N2S A;  5BV1 A;  4PJM A;  2EIN C;  2X6H A;  3HHM A;  1XNF A;  1M56 C;  3QNK A;  2C0L A;  5AJL A;  2V5F A;  3AG4 C;  1KT0 A;  4KZ0 A;  3ZIB A;  1TWH A;  2IXO A;  3FHD A;  4L2Y A;  3L08 A;  4J6I A;  3I4U A;  1OKK A;  5KYN A;  5C1D A;  2J9W A;  5E33 A;  4IWB A;  2DGJ A;  2YZS A;  3MA5 A;  4GZD A;  2WVO A;  2HV7 A;  3O39 A;  2WXM A;  3PMR A;  3QAR A;  4IN3 B;  2FEZ A;  2CGE A;  4Q96 A;  3UMI A;  5BNW A;  3ZN3 A;  3NZU A;  2CG2 A;  2E2E A;  4O6N A;  3I4G A;  3LES A;  3JCK C;  4BJ1 A;  2IXM A;  4U07 A;  3CZ6 A;  2NUP B;  3FFL A;  4FX5 A;  1OWO A;  2VSX E;  1PC2 A;  1HFA A;  2UWJ G;  4ACL A;  1ZHX A;  3ZFW A;  5G2N A;  3LY8 A;  1L5J A;  1NZN A;  3FTX A;  4TRQ A;  2KNH A;  2OOE A;  4U8H A;  3ONK A;  5KYX A;  2NC9 A;  3RKO F;  2WQ6 A;  2R59 A;  3LDZ A;  4CT0 A;  4U63 A;  2ZXR A;  3S28 A;  1BR4 A;  1MMG A;  4WND A;  1PD1 A;  4I6E A;  2XGS A;  1YA0 A;  4DVZ A;  3Q4A B;  4F7A A;  1SZA A;  3FUH A;  2MWQ A;  4H7Y A;  5J08 A;  3ZPJ A;  5ARG A;  4W9R A;  3ZXS A;  3ASH A;  3EH1 A;  3T6B A;  2WXK A;  3AU4 A;  1UN9 A;  2M63 A;  5LX8 A;  4ATG A;  1MMN A;  5L3Q A;  4ME2 A;  4FJY A;  2KGO A;  2XRY A;  3SBT B;  1TWC A;  1HH8 A;  2EIJ C;  3RU0 A;  3NDB B;  3CVN A;  3O48 A;  4FES A;  2IQC A;  4AY5 A;  3HDX A;  5EGY A;  5JJT A;  4UWH A;  3OXL A;  4JA7 A;  3NKE A;  1Z3Y A;  3SFZ A;  1ELK A;  1BR2 A;  2A69 F;  4J8S A;  1H2U A;  3FY4 A;  1PD0 A;  5T1D B;  2OVF A;  5EDS A;  2IU1 A;  3RRN B;  2PX0 A;  3K33 A;  4LCT A;  2YHC A;  1OUV A;  1EF1 C;  4OIQ F;  5KJM A;  3I5Q A;  4G7Z F;  2Y3D A;  4G24 A;  4J8F A;  2QY7 A;  1GW6 A;  4B89 A;  3HVE B;  4RG6 A;  5FZR A;  4IJJ A;  4P6I C;  2CG3 A;  4NRH B;  4GB9 A;  4UI9 C;  4LLC A;  4CS9 A;  4DPR A;  3EIQ C;  4C0M A;  3D9L A;  3DM9 B;  3AS4 A;  3M1C B;  2WXR A;  3L22 A;  4ZLC A;  2J45 A;  3D9N A;  4O6Y A;  3EFO B;  4AM9 A;  2VJ8 A;  4O6M A;  4I17 A;  4BJ6 A;  3VYW A;  3Q49 B;  4N5C A;  5LFA A;  1H2T C;  4CS8 A;  1QLE C;  4LLE A;  2WVN A;  4BJ5 C;  3W8I A;  3PUJ A;  4KC9 A;  4GA0 A;  3Q6M A;  1HG5 A;  2R7U A;  3QWV A;  5HSW A;  2DYR C;  5BV0 A;  4U5D E;  2G3V A;  3FDQ A;  3LLK A;  3CQZ A;  2PM6 A;  4O7G A;  3EJN A;  4J8D A;  2J49 A;  2FUL A;  3PHF 2;  3KMI A;  3CV0 A;  2WXH A;  2VSO E;  3KKB A;  1Y8M A;  4P29 A;  3LCA A;  4RVB A;  4DK5 A;  3ZVV A;  4HXI A;  3F47 A;  1ZHY A;  3EHM A;  3FH8 A;  3ZYM A;  3HVE A;  4GAA A;  4GU5 A;  2AXU A;  3CQC B;  3SGH A;  5FQ8 A;  3CHQ A;  3FTY A;  3LAY A;  3CVU A;  3MCX A;  1E7V A;  3DM5 A;  3KD7 A;  3SYN A;  2X6I A;  1UW4 B;  4N3B A;  2ZXP A;  1FMW A;  5L3V A;  4EEC A;  3CEQ A;  1NG1 A;  2Y39 A;  3LS0 A;  3Q6N A;  2WXI A;  3Q7L A;  3EG9 B;  2XPI A;  3S2A A;  3IEG A;  5FQ6 A;  1M2V B;  2A5U A;  3GZ1 A;  2NUP A;  2EIM C;  3IBE A;  4C7O A;  4DLQ A;  4FLB A;  4NUR A;  3RH3 A;  4OVU A;  1TKN A;  2OVB A;  1VDY A;  3RJV A;  2GRM A;  5ARF A;  5A7D B;  3Q7G A;  4FAD A;  5B1A C;  4C3D A;  4HOR A;  3DXJ F;  1MNE A;  4APF A;  2PQR A;  3QDN A;  4IUL A;  3NG1 A;  3CVW A;  4IAO A;  2YHE A;  4YVO A;  3CVY A;  3D9O A;  4EPZ A;  4DOZ A;  3FUM A;  2A68 F;  1Z23 A;  3L16 A;  3NYJ A;  2PX3 A;  1Z63 A;  3KAE A;  2OV8 A;  4KNW A;  3IV0 A;  4FWV A;  4Q7C A;  3GZS A;  4PDX A;  5KJL A;  2OND A;  2Y3A A;  5FQ7 A;  3FUD A;  3DAF A;  5JJ7 A;  1ZYR F;  4XIF A;  4HOQ A;  3VLE A;  1E8Z A;  1VK5 A;  1MND A;  3WOD F;  2IFU A;  4LAC B;  2AXV A;  3ZG1 A;  5CI9 A;  2J09 A;  2J7P A;  1OCZ C;  5CCM A;  2CHX A;  4YWQ A;  4CIH A;  3SP1 A;  5C2Y A;  4CGW A;  4J32 B;  2JEK A;  3MEK A;  2J46 A;  3D9K A;  4UWL A;  3CKC A;  4Y6W A;  4KBL A;  4GML A;  4GYO A;  4XLP F;  3B7R L;  3CK9 A;  4GZC A;  5LP0 A;  3G2W A;  2KZT B;  4A2N B;  3MLG A;  1PCX A;  2JD3 A;  2R7V A;  3TG5 A;  4ANV A;  3NZS A;  4XKC A;  2KW3 C;  3FU5 A;  2WVQ A;  4AVX A;  2X6F A;  3W2W A;  2BUG A;  3TD7 A;  4AX2 A;  2I1K A;  4DBR A;  3UT7 A;  4YT2 A;  4CS9 C;  3UPV A;  4G26 A;  2Q3T A;  2WMN A;  5DQZ A;  2W9Y A;  4B6I A;  1J8M F;  5FZS A;  1E96 B;  5KCM A;  2MYS A;  3CVV A;  3PNT B;  3UNG C;  2VSN A;  3PUK A;  5J90 A;  4K0D A;  2Q9A A;  5FJY A;  4HVB A;  1HX8 A;  1WM5 A;  2HYZ A;  4BJ5 A;  4AE4 A;  4CT4 A;  2R7S A;  4AK9 A;  2D5R B;  4X0R A;  3K66 A;  2PFD A;  1MMA A;  4KYO B;  2P6V A;  4HS2 A;  2MOW A;  4KVM A;  2A6H F;  5FCL A;  4PUC A;  4OIO F;  1W2W A;  4BJT A;  5M72 A;  3P1U A;  3FUL A;  3LLI A;  3SF4 A;  3EPV A;  2WXQ A;  3FUN A;  3R7R A;  4L7T A;  3QC1 A;  2M4E A;  4I2W A;  4CGV A;  4I1O B;  4QDL A;  4HLE A;  2BTD A;  2H7O A;  4XKB A;  1J8Y F;  3JQ1 A;  3PH0 C;  3ZIM A;  4B0Z A;  4FC8 A;  1JWF A;  2CFZ A;  2AW6 A;  2KCL A;  4ANW A;  1SZI A;  2XPZ A;  2ION A;  4A1G A;  5DS5 A;  3EGX A;  5G05 C;  2YEV A;  1JUQ A;  3LPZ A;  2H7B A;  4GA2 A;  4MKT A;  3UT4 A;  4RG9 A;  5E76 A;  2FFH A;  2ILR A;  3PE3 A;  3GW4 A;  1ST6 A;  3ML8 A;  2IJG X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...