3I5PA

Nup170(aa979-1502), s.cerevisiae
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
503
structure length
449
Chain Sequence
DILGFRAIEHLRRAKEIYDSLNYHLKNATAIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLENDDRKQYYDKRILVYDLVFDTLIKVDLRQKSYEAALKYNDRLFHYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGKISNILWVYYSRRSKFFESAEILYRLATSNFDITLFERIEFLSRANGFCQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQDSEFIFPIFELFPIVCNFFYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSDNSVFNKEMTWLIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Architectural nucleoporins Nup157/170 and Nup133 are structurally related and descend from a second ancestral element.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Nucleoporin NUP170
total genus 145
structure length 449
sequence length 503
ec nomenclature
pdb deposition date 2009-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1880 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3i5pA03
1.25.40.440 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3i5pA02
1.25.40.450 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3i5pA01
3I5PA
chains in the Genus database with same CATH superfamily
3FUJA 3PHF2 5EYPF 5KYYB 4U9EA 1TJCA 5LX8A 2XCBA 4UWHA 1QVXA 3E37A 3FEYA 3WHNA 2IO3C 3V30A 1SR2A 3KYJA 1XGWA 5JJ7A 2VSXE 1O5MA 2R2LA 1HW2A 4FULA 4BT8A 4RBNA 5FTPA 4LLEA 3PDMP 4APFA 1G4US 4F1SA 3GWNA 4HOTA 2PZIA 4GTTA 2J7PA 4IULA 3SXMA 4GYWA 5JA4D 3FUHA 3MYVA 4F6RD 1WG0A 3KMIA 5L3QA 4G8LA 1ZU2A 2WVOA 5AGFA 3ECSA 2P9LG 3CEXA 3ZC4A 1ELWA 1TWGA 2WXHA 3E32A 3OXGA 4W8PA 4DUIA 3SHFA 1E8WA 3FTWA 3DSWA 3RF3A 3J5PA 4ME2A 5FZSA 4KBQA 2X6JA 4D4NA 4WWPA 4H4KC 2WB7A 3RVZA 2P9KG 5ENOD 3PCVA 4JPSA 2H7OA 5D2MC 2NSFA 3O6XA 2AXUA 3CK7A 2VYIA 3VTXA 4AOFA 2ETBA 1B89A 5D92A 3UM2A 3D9PA 2FBNA 5FCLA 4GMLA 3RO3A 5JVEA 2J4BA 3MZLB 1J8MF 4I2WA 5A6CA 3X2QC 2DYRC 3V5XA 2FI7A 4Z9HA 1LS1A 4J7WA 3NYMA 3Q15A 3V2XA 2R05A 3QW1A 5AQ7A 3TAXA 1AUEA 3URZA 3Q49B 4A1GA 3HKKA 2CNWD 2H6HA 1E7VA 2A5EA 1DCQA 4BJTA 1H6GA 4UI9C 4ONSA 5CMWA 4ATGA 3ML9A 1BPOA 2IOLA 2AWIA 3S2AA 2IONA 1IQUA 1I4YA 3ZGQA 4BEJA 1U0BB 2NSGA 3JUEA 1EI7A 3KL4A 1WY6A 4FLBA 2CG2A 2JPUA 2RD9A 3FVYA 4U5BE 2HSBA 2R7QA 3IHYA 4JCZA 3EZHA 3WAQA 3C3RA 4PS8A 3BUAA 1CGNA 2V0PA 3JXJA 1SZAA 3U9WA 4PH4B 4NQFA 5E2QA 2BUGA 4FX5A 2EILC 1O1SA 4BFRA 3HNKA 3S28A 3FWVA 3CVPA 3I4GA 3DMDA 2WM9A 4JJGA 3FTZA 4PJNA 2OOCA 4W8KA 1V54C 4O7GA 4C7OB 1MNEA 4CIHA 5CRVA 4N39A 3HXDA 1UN9A 3TJ6A 3BRJA 2J0XA 2NC9A 2LK4A 3NAWA 2PBEA 3MKRA 1OWNA 1BR2A 4JZYA 4XEIG 3V79K 1WASA 4MTGA 3JRMO 1YYXA 1QLEC 1BZ4A 1Z5SC 4D10C 3SO8A 1SVXA 4F53A 3R7RA 2IF4A 3QARA 5T3WA 4WNDA 2DZOA 3JSZA 1SYQA 5KYWA 1OWPA 2WMOA 1LE2A 5FJYA 3A11A 3M15A 4WGZA 3KEAA 1SMYF 3S90A 4ULWA 4R7LA 4ACLA 4HRLA 2KK1A 1BBHA 1LTXA 4DVZA 1TWCA 2UUIA 2P9PG 2J9UA 2BKGA 5B3IA 2WPVA 3PZ2A 5CI9A 4BTAA 4MTOA 1FR0A 1OCCC 3SP1A 4BJ6A 3V2OA 1K8KG 4IAQA 3JQ0A 3CVYA 3NMJA 3DSTA 1KPSB 3TWWA 5ANLA 3HG0D 4IRUA 3VTYA 2R7RA 1UG7A 3DEOA 2HMQA 2ETCA 3MFNA 3UGOA 2Y4TA 3D9OA 4UWFA 4CCAA 2L6GA 1RW2A 2IEJA 5CECB 5D91A 3QKYA 1E83A 2L9BA 2OQMA 2A69F 1OR3A 2FGYA 2XM4A 5FT9A 2L0TB 1EDUA 4A3TA 3GORA 2A0UA 3DM9B 4ANVA 2DYSE 4DI3A 3IPMO 4MVZA 3HXFA 3U3BA 3QK0A 2ZGDA 3MX3A 5DS4A 2Y0BG 2KBXA 2WQ7A 3NYLA 2I1JA 4I1AA 4GTSA 4L9PA 1JPNA 3DI5A 5DQTA 3ABKE 1HG5A 3UMHA 3D9JA 3HVEB 2LCHA 1PAQA 2WXOA 3FDHA 3ZNGA 1A17A 1YMPA 4HVBA 5FQ8A 3AG3E 2H7BA 1FT2A 4YN0B 3FU6A 2YQ8A 4N5CA 3KEZA 3B71A 3LJNA 2D4UA 4G1TA 3S7DA 2RFMA 2WQ6A 3KYIA 2M63A 1NSGB 4C0MA 1AP7A 4BJ5A 3LS8A 2A6HF 1RZ4A 3LESA 1TEZA 3MYFA 1D8EA 2R25A 4E17A 1EKYA 4CRWA 2J09A 3TD7A 1N52A 3ZVVA 3BG0B 4OAUC 4LACB 4F4BA 3DWLG 3E30A 5DS5A 1Q2ZA 4U9DA 3VF0A 2AWYA 3ISMC 4KZCA 1RKEA 1NBBA 3FUEA 3X2QE 2KCLA 2G3VA 3APDA 1MQVA 1OKKA 1LIHA 1K05A 4FESA 4UQZA 2HUJA 1OCOC 3FMSA 2IYLD 2XRHA 1UW4B 4Q94A 1YJGA 4A63B 2P61A 1C17M 2A4ZA 3TXMA 4WWNA 2P6VA 2LAHA 2G3KA 3TXNA 1ORSC 4L2LA 1HW1A 4A1SA 5M72A 4U5CE 1T6QA 1X81A 4XEFA 2P1AA 4YL3A 2LXLA 4DRJB 4G8KA 2KCVA 2ILRA 4ATZD 1LVKA 4ILGA 1G3NB 5ANRA 4K5BA 3FAJA 5HRYA 4FU3A 4N2SA 3CK9A 4CT4A 5CRUA 2ZPAA 3C8ZA 3IEEA 5D66A 4PFOA 3PMRA 4PFPA 1T6UA 2VASA 5E3AA 2X6KA 1HY5A 3RH3A 2P7VA 5EYLA 4AL0A 4J8EA 2QFCA 3E70C 3K9IA 4ILHB 5BPPA 2XCCA 4RLYA 5A7DB 4U7EB 3UIPC 2AXVA 2AP3A 2X38A 2LAIA 1QZ2A 4OVUA 2M64A 1Z23A 3EU9A 1ELRA 2DB4A 1Z3IX 2C2LA 2GRLA 2R17C 3GW4A 1LM3B 3NYJA 1VLSA 2WVNA 3K33A 3VYWA 1DOVA 5JP7A 3AG2C 3BEHA 3QVZA 4FAPB 4LSZE 3C63A 4G26A 3EZIA 3FUNA 4C0EA 2PF4E 5HKPA 3HIZA 3ENEA 1H7IA 3ASHA 2XLOA 1OXJA 1UN8A 1RXQA 2NSZA 2YEVA 1QKRA 4GB9A 3UM0A 5L0GA 3QW0A 2FAPB 3ZYLA 1FVFA 2HV7A 1HE8A 2V26A 5AQ9A 1H0AA 3P1UA 1E8XA 5KYUA 4EZJA 1A7DA 2CNWA 4CDYA 2JLBA 1OUVA 1BI8B 3EIQC 4ZHBA 4NCQA 2LSEA 1TWAA 3CZ6A 4CJOA 5G05C 5JMND 4K5CA 1GQAA 2KC7A 4FJZA 4DX6D 3JRTA 2YHSA 5ENRD 3NKDA 3Q7AA 3AJIA 4GZDA 4J32B 3Q7FA 1K1BA 3PRZA 4I3MA 3BG1B 3C18A 1BI7B 3PREA 1IHBA 4AE4B 4BY6A 1WTYA 4JTCB 2UY1A 2H7VC 3UUXA 3UT4A 3D9HA 3SFYA 4EBBA 3L9TA 4NRHB 3DBSA 2YWAA 4I2ZA 4U0UA 1E90A 4UUCA 4XEVA 3ZWIA 2XGMA 1JMWA 4WABA 2YLIA 2GDCA 1TNUA 1Y6DA 4DX2A 4LLCA 3CVNA 3DSXA 5D0QD 4C3DA 4YVOA 2LP4A 3J06A 5L0FA 1ZHWA 2GAQA 4IB4A 4UQYA 1H6KA 3UI2A 2OEVA 3CK8A 4XIFA 4FC8A 4UQXA 4TUMA 4BSXA 3W8HA 4E18A 3ZIBA 2H6IA 1JOGA 1YA9A 1N94A 3ZTMA 2VJ8A 1C02A 3ZVRA 5LCWJ 2XGSA 4TXQA 3LNRA 1JWFA 4J8YA 2Y69E 3PEUB 3RRMB 4V3IA 2GROB 3RVYA 3U66A 3E33A 4JHRA 1DC2A 2AWCA 2V4HC 2RSEB 2XM0A 1LE4A 3GEEA 3GZ2A 3MV2B 4M3OA 4LNUD 4MRUA 1IW7F 3AOUA 4OYSA 4EPZA 4KI2A 1FCHA 3Q6MA 2X0CA 2FULA 4FJYA 1TNZA 5C1DA 2V3CC 3ABKC 2YNQA 5CMYA 4K7BA 3LEOA 3ZYKA 5G2NA 4Q5SF 4JTDB 3DD7A 4P29A 5KCMA 4CT0A 3CSFA 3W2VA 5AENA 3WXXA 3FU5A 5G04J 5FQ7A 4MVQA 3R7QA 5T1DB 3DXMG 3RKVA 3T5XA 3CKCA 3LVRE 1OWMA 1OKKD 2HYZA 2WB2A 2VCAA 5EIBE 3UXGA 4YDWA 3L82A 5EX3A 3L8IA 3M79A 3ZQYA 1JPJA 1UJKA 3TOMA 2X6IA 1CGME 3NMKA 3D9IA 1VK5A 5DLJA 3FUKA 1RJ9B 2IQCA 2Y1LE 1Y4CA 2QY7A 4RDAA 4QQIA 4U8VD 3T6BA 3RKOF 5CERB 2B0JA 2LQGA 2Q7RA 1MX6A 3U2MA 4PJJA 2WXKA 4Y6CA 3CVWA 1TN8A 1E84A 3B7SA 5FQ4A 5BXOA 3U5SA 1UJJA 2OG2A 2VSNA 1ZHZA 2IFUA 3CR3A 3DEPA 1L3PA 3MKQB 4MLPA 1OCZE 5KJKA 2R7SA 1QSPA 3C8GD 3DJNB 1YLMA 1IKND 2HMZA 2ZIRA 4RG9A 3SYNA 5T4YA 1BU9A 2I6HA 4O6YA 1QQEA 3EJNA 1Y8MA 3HVEA 4CJGA 4YT2A 3CQZA 5D0OD 2L9JA 4ANJA 1TYQG 3FAPB 2ZD9A 2F8XK 2ZXWC 1XZPA 1NFOA 3HXEA 3RK6A 5HI7A 2GA0A 4DVYP 1LD8A 5AIJA 2XPIA 2Y3GA 4MS6A 1HF8A 2W4MA 4JCHA 2XS8A 3HRAA 3PS6A 3T8KA 4J30B 3APFA 4CBEA 4GTMA 2HZ8A 4O1PA 3GANA 3S7FA 5CBNA 3UM1A 3TJPA 3RW0A 4JEAA 1QPUA 3FUIA 4IWBA 2IXPA 4BX9A 2A6EF 5E76A 2E87A 1V54E 2B6CA 4HXIA 2Y69C 2HKVA 3ASGA 3L34A 2KSFA 4EBJA 4TUUA 3MGBA 3EH2A 3Q7GA 3FOOA 3TWSA 1FAPB 1A41A 3EGXA 5EDSA 3T9KA 5FZQA 3HNJA 5JJTA 3DPYA 5HV9A 3FEXA 3DAFA 3RFYA 4G0HA 4Z9IA 1CPQA 4PK4A 4KXKB 4CIPA 4JHJA 1JCRA 2XEHA 2NUTB 3LDZA 3W9FA 5EN5D 4FLHA 3AG4E 2PL2A 1QQ3A 3ZYQA 3B29A 1JCSA 1S05A 3Q75A 3M4BA 2IXMA 5EGYA 2R7WA 5AC5A 3JTLO 4GYOA 4XQ1A 4MVSA 3QWVA 3SXYA 3HYMB 3V7OA 1KLXA 2Y3DA 2I15A 1O3UA 1QZXA 3AU5A 2L6HA 1S64A 5FZTA 3OXLA 3FHEA 2QYJA 1YCSB 1IQRA 1D1AA 2PP4A 3BEEA 2HR2A 5ENTD 3CVQA 3I4RB 1NFIE 1AWCB 2ZU6B 4N3AA 3SY2A 4DI4A 5L0HA 2Q3TA 4JEHA 4JC8A 3NZUA 3ASDA 4E7ZA 1SZIA 3R2PA 2DBAA 3T9OA 3JQ1A 1XZQA 4U8HA 1GM5A 2ETAA 3UT8A 1S7ZA 5AQAA 3UR3C 2PNOA 4BJ1A 3SBSA 2QUPA 2I8BA 3M4CA 4HRNA 4GA2A 3K1IC 4RQIA 2C03A 1PCXA 2NUPB 3DE8A 4J0UA 3B7UX 2LUHA 3JSEO 1YYHA 3EFOB 5KYWB 3LEWA 4XWJA 5KYNA 3V5ZA 3EQLF 3FH5A 4A3VA 3CVUA 1M6TA 1MMAA 4GZ3A 3V5YA 1OR2A 2GGFA 4KBLA 4GZ5A 1Z7Qc 2NPUA 4O60A 1DNPA 2RD0A 3PUJA 3C8GA 4HLLA 1BR1A 3SNXA 2R7XA 4ZLDA 4AL1A 3ZQVA 2FF4A 3IKOB 1Z3YA 3CHOA 3AG2E 1L5JA 4AK9A 3EGXB 2G62A 3KS2A 2FEZA 1PD0A 2J45A 4B8CB 2BTDA 5LFAA 4E0IA 3U3FA 2Y39A 3L17A 2LSVA 2E2EA 4JW1A 4U96D 4GYYA 1RKEB 3CHRA 1PY1A 1INZA 2Q7FA 1VOMA 2VCCA 2ZXPA 3HLZA 5JJ6A 3W4YA 1ZVZA 5FWQA 2CCYA 3ONKA 5AQBA 3L0IA 2MHKA 3NKEA 3JZ0A 1HS6A 4U63A 4TV3A 3SXKA 3F46A 2EPKX 3E9VA 2GRPB 2P9SG 2KW3C 4DJAA 3RIPA 4L1BA 4CSAA 3LS0A 5KYXA 5IY5E 2XRZA 3LLIA 4TXRA 2J9QA 2AXZA 1DVPA 2UY1B 3S9OA 3EHRA 1HX8A 4GMJA 3FTSA 2ZXRA 4CS8C 2OJED 2L6BA 2MRIA 2WVQA 2ZISA 1WAO1 3AAAC 5DIZA 3J5QB 1GS9A 1N1CA 2DI3A 5K0IA 5B3SE 2WL8A 2H6FA 2P9NG 3SGHA 2PM7A 2PFDA 4UWKA 4BTBA 1SA5A 3PDNA 3TWUA 1KT1A 4GZCA 3N24A 3FULA 3FUDA 4DX7D 3EFOA 2EINC 2VCBA 3LCAA 5AYWD 1MMNA 2OEWA 4DRIB 3Q9NC 1OCRC 1H9TA 4BEPA 3EG9B 2EPLX 3ZDLA 2WVIA 4G7HF 3PZ3A 4WGYA 2L6FA 4G11A 2PQNA 3ZN3A 3LJBA 1S0PA 2R03A 4ANXA 5BV0A 2Y3AA 2YL0A 2YL1A 1YZAA 1C03A 1ZHYA 1G5ZA 3GM3A 3T4RA 3AGTA 3S29A 5BW8C 2JABA 2BC5A 3OWTA 3O4ZA 2Q9AA 4O6MA 5T8IA 4HFFB 4WWOA 3EHNA 4CDVA 3ZUVB 3GM1A 2P2CP 4I9CA 2FO1E 5AAOA 4OIRF 1WGWA 3QWWA 4CDAA 3UINC 2BE5F 3VLDA 3ZEFA 3DSUA 2IBFA 4OINF 5B1AE 2XPZA 4UI9K 4ER9A 4XI9A 4O1OA 4DBRA 4KVMA 2OEXA 4FP7A 2XENA 3QVYA 1JR8A 3GZ1A 5LP0A 1TKNA 3SQVA 3B13A 1NFNA 4IARA 3U2LA 4Q96A 2LD6A 3EH1A 3EGDB 4C3EA 1LI7A 3M1CB 4XZ4A 2Q9CA 4HOQA 1R4TA 3RQGA 3C3QA 4HB5A 4NQ0A 3B0VC 4ILIA 2KZTB 3GYZA 5BT1A 2XL8A 5A6AA 1ZYRF 3GM2A 3TQOA 3QOUA 4JB8P 4I43A 5EILA 4XLNF 2WXIA 3ASFA 4FADA 3X1OA 1MMGA 4MS2A 1FT1A 3AQCA 2DYSC 4U8YD 1ORYA 3DJUB 1N9AA 2HE0A 3ZYMA 4BWRA 1E8ZA 1BR4A 2DGJA 5FZRA 1Q0MA 1APCA 1TFKB 5KNHD 4AVXA 2R7OA 4ULVA 3TGOA 3EG9A 4DXWA 2UWJG 4ABNA 3FU3A 5ENSD 2W9YA 2XL6A 4H7XA 3ZIMA 1OXBA 2IXNA 3TL5A 3KKBA 2F0YA 3PE3A 3OA1A 3ZXSA 3PUKA 4G25A 4NY3A 3DXKG 3FH8A 3HXBA 1N0QA 2LNIA 5B1BC 4XTKA 3MKQA 1Q0DA 1YARO 1QNFA 2Y3BA 3G50A 4I6JA 4HORA 3L1MA 4K0DA 5JS5A 3Q79A 2O9XA 2MYOA 4OD4A 3ML8A 4Q69A 4L23A 3C7JA 4WNFA 5AJDA 4F3VA 4B94A 2VC9A 3QZCA 4URKA 3ZHEA 3GEHA 4W9RA 1TR4A 5KYUB 3IV0A 1VYIA 4HS2A 2YKZA 2PX0A 4MVUA 1K1AA 4B8AA 3IXEA 2CG3A 4AJWA 1NP7A 3H65A 2QY9A 2C0LA 3PE4A 3NQPA 4JTAB 4LCTA 4KVOA 3G2WA 2KATA 4ZFHA 3C98A 2FO7A 3RAUA 4LRZA 4YDOA 4JL0A 1OQCA 2YLDA 3N0TA 2QNLA 1K3ZD 2YZSA 4GTPA 5LCWC 2ZGGA 3ZSUA 4MBGA 5T3RA 3I5PA 3MV3B 4EZLA 3ZG1A 5COMA 4TRQA 1CPRA 4AIFA 4YT4A 4YL1A 4BG0A 4HQDA 4N4WA 3B0UX 2VGXB 3CLJA 4YVQC 2KNHA 4NACA 3SBTB 2XEVA 1W2WA 3CQCB 2IY0C 1BDJB 1N4SA 3G4ZA 1ZU4A 3DSSA 5KJLA 1T5OA 1WOLA 4U0SA 2WZGA 2R9RB 3DZAA 5DQZA 5JT4A 2XZTG 2NUPA 4ANUA 5BQHA 3I4UA 1YA0A 3LY8A 2EIKE 3ABLE 4GTRA 1ZHXA 4YNDA 2PNNA 2J49A 3C5RA 4YDYA 4DBQA 1MYOA 3TWRA 3C62A 3AG3C 3D9NA 5FIOA 4G7OF 4GA0A 3B7TA 2HM8A 1ZW2A 4O6NA 3VRCA 5CIVA 3ESKA 3HNLA 2ONDA 3ONLA 3WG7E 2OCCC 1D8DA 4CSAC 4B93B 4E85A 4GMRA 2P58C 4QDLA 3UQ3A 4I9EA 3E34A 3A9CA 1O5HA 4WAFA 3CSTA 2HFIA 1D9SA 4GCNA 4CX9A 3JCKC 2KM4A 1A5EA 3AGUA 4GQHA 2YLGA 4PJLA 4JVSA 1OT8A 5CHEE 4G24A 1WATA 3JUIA 3JYHA 2D5RB 2WXRA 2PX3A 1LI5A 1O1RA 4O6FA 3UT7A 4B6IA 4EZKA 1LPEA 2VH3A 4CDNA 1H9GA 3ITFA 1NL4A 4GZ6A 1UG3A 1M56C 3SFXA 2XLWA 3MCXA 4C7OA 3VLFA 3CSKA 5G05J 4H7YA 3F47A 3T5VA 3N71A 1H19A 5L0IA 1NLXA 3TWVA 1D1CA 1U6HA 3LS1A 2VSOE 2WXJA 3NB2A 3Q73A 1TFOB 3ULEG 4U5GA 1FMWA 4BX8A 4JKVA 3BU8A 2XSEA 1M2VB 2VB6A 4Y6WA 4NTAA 4HE8D 2J08A 3KAEA 3D9MA 4J8SA 3TJ5A 3UMVA 3DAGA 3FHDA 4CYMD 2LIGA 3GWLA 3B7RL 4MVMA 4R32A 3CEQA 4J6IA 4AXHA 3IQ5A 1YVIA 3V31A 2QZAA 3S84A 4APOA 1Q0KA 1RCPA 4E7SA 2JX0A 1YZCA 3IQ6A 1EA8A 1O87A 2WXFA 3S0XA 3C72A 1EPUA 3CHSA 1N95A 3U9MA 2WXLA 2XLEA 3L6AA 3ESLA 2NG1A 4MNDA 4J8DA 1Z63A 3NZSA 2IO2C 2L0IA 4JA9A 2I9CA 1XNFA 5A6BD 1ST6A 4FWVA 5KYXB 4I44A 3LXUX 2EPNA 4EQFA 4EWCA 4NC3A 3ZW3A 1N54A 1M57C 2PQRA 2KGOA 4BEMJ 2CFUA 2F22A 3DKAA 3NOCD 2QLAA 3L22A 3Q4AB 4OAVB 5A6JA 1ORJA 1SQMA 3RQEA 3RRUA 3QJZA 1F1MA 4JD2G 1OW7A 3CHQA 4JURI 4BETA 4HOSA 2R02A 1MMDA 3FDQA 2J9BA 1JCQA 3TOLA 3O55A 4LUNU 4NTBA 4AV7A 2YQYA 4K03A 2B0HA 4WNGA 1G8XA 2WZFA 2OCCE 2L6JA 4G78A 4OD5A 3KSLA 3LVQE 5ARFA 4QI0A 2BL2A 3S27A 4UI9J 4FHKA 3QDNA 1FPPA 2AJAA 2XZDG 4GAAA 1JUQA 3EGDA 4I6EA 4YJWA 3LAYA 2XPYA 3S7BA 2J4DA 2GWWA 2XHEA 4AEZC 4EBKA 5FQ6A 3TG5A 3QMKA 3NF1A 1G4WR 1W3BA 4GEHA 3FP3A 3IEGA 2YHEA 2XQ0A 3NMIA 5JUAA 2CHZA 1HZ4A 1NI1A 4G23A 3HXCA 3K6BA 1UFBA 2NXPA 4HOUA 4XEKA 1H2TC 2LSUA 1Z6AA 3SF4A 1SZ9A 3HTKC 2H6GA 2W45A 5COFA 4JHKA 1WDYA 4IAOA 2HS5A 1ZB1A 3LPZA 3DWWA 3ULYA 5TJ5E 3CGHA 3B0PA 3OXFA 3D9KA 3G2TA 5A23A 1IXVA 4HFGA 1D0XA 1TQGA 3HJCA 1EQ1A 2OVBA 3U3WA 1AVOB 4CGWA 3U0CA 4BT9A 1LF8A 1H2VC 3OEOA 1N11A 4LEUA 4P9TA 2LFDA 4EUKB 4U95D 4EHMA 4TXPA 2Z15A 2J8WA 5L0JA 4U5HA 4Z68A 4NIKA 2CDQA 3B95A 5BQIA 2HJ3A 3CVVA 2I1KA 4PJMA 4PACA 1OXKA 4E0HA 3ATPA 3LJ3A 2IOSA 2NYJA 3Q9UC 1JRAA 2JEKA 1H6PA 3EU5A 4F1PA 1KU2A 4H54A 4YK5A 1T9KA 3O10A 1FFTC 4F7AA 5IY5C 4GA1A 3AS4A 3L16A 1V55C 1N0RA 2OOEA 2YL7A 5J90A 4LDKA 4P9FA 4MQ9F 5C2YA 4I6GA 2L81A 1Y6IA 4G2VA 4GCOA 3VLEA 3SEOA 1K04A 1TNBA 3SZ7A 4UDVA 2AVPA 1NU7D 2EPMX 4D4XA 3EPVA 3DPDA 1GW6A 5JSLA 4AE4A 3QWPA 1RMVA 4PS7A 4EBAG 1KZPA 4ZLCA 3APCA 2XLHA 2HJMA 4KT6B 2OVFA 3POVA 1NU9C 3EHMA 1V55E 4AY5A 2VTBB 5L0CA 256BA 5AJLA 2VGYA 4DPRA 2F8YA 4C48B 3HNIA 2RG8A 2X6HA 1NZNA 2P9IG 4GU5A 1MX4A 2J9VA 3JT1A 2DZNA 1D1BA 1TNYA 3U9JA 1HMDA 3IHUA 3IQTA 4L6RA 4J8FA 1KT0A 2X51A 1VB5A 2IXOA 2H8AA 3LKUA 1D0ZA 3MLGA 1KZOA 2AU5A 1FMVA 3PH0C 4DJ9A 4L2YA 2J46A 2KCKA 1M2VA 2KQ9A 3PZ4A 3PZ1A 3AS8A 4MVOA 3T6GB 2LXMA 4PR9A 1NG1A 3WODF 3AS5A 5FINA 3AJMA 3RQFA 5BUOA 3KH2A 3UMIA 2EPOA 2HO1A 1H2UA 1OW8A 3FXHA 4HRMB 2R7UA 1BLXB 2KJGA 4GPKA 1QYMA 1TN6A 4CDRA 1HE1A 2Y3HA 4U07A 2CHXA 4G7ZF 2J0WA 1KTMA 5GPGB 4OIOF 4E6HA 2XS1A 3CHPA 2J8SD 1NZEA 2ICWG 1Q0GA 4EECA 3I3NA 1IZMA 2R5SA 1HO8A 4EIYA 2XLDA 2GRRB 2E0IA 1CGOA 4MW3A 3Q47B 4JRZA 3ZU7B 5CEAA 3C8GB 2XXAA 3K1IA 2WQHA 3IQCA 3CQGB 5BUZA 3D9LA 5A6KA 1OCOE 3P2BA 1E8YA 1I4ZA 2JD3A 3L13A 2MWQA 5CI8A 5BV1A 3L08A 5T3TA 5HSWA 3UX4A 5F28E 3FFLA 5DVWA 2GRMA 3CHMA 5A6BA 1HH8A 3FTUA 3RJVA 3K7DA 4MTFA 1L7CA 1MHQA 1DCEA 3AG4C 5KJMA 5BNWA 4Q4ZF 1KNYA 4U04A 2LO6A 4XPYA 2KXPC 4K0RA 4B89A 3QAQA 3FTVA 3RYLA 2W4BA 1I5NA 1HFAA 3RSEG 2I2OA 1B68A 1MX2A 3GODA 1HXIA 1TNOA 1A0BA 1Z5ZA 2FFHA 2QTVA 2Q9BA 2C04A 3EIJA 1OCRE 3U4TA 2L7AA 3UMKA 2KYHA 4DX5D 3LY7A 4HEAJ 4IGGA 5JRAA 2WZLA 3US6A 1PD1A 2WXMA 1TN7A 4JIOA 4K1OA 4C9BB 5HQ8A 4PUCA 3DRAA 4XKCA 3G4XA 5CCLA 3TULA 2RFAA 3O48A 3C3OA 4HNAD 2A1DD 3PZDA 4WUYA 4AY6A 2GRNB 3VM6A 4N06A 1S70B 1OWLA 4FHJA 3RIBA 3R9MA 3RO2A 1VLTA 2R7VA 2ZXWE 4C3BA 2BKKB 2OV8A 3NOGD 3QC1A 2YINA 4JJFA 5KNGA 2UUHA 4U5EE 2VTBA 4CEMA 4DRHB 2R7TA 4CZ2D 3SXZA 3Q6NA 3BQOA 2WXQA 1JWGA 3AU4A 4LDRA 2P9UG 3ZPJA 4WNEA 1FTSA 1TJFA 1LKXA 4J7YA 3SD5A 5G55A 2WXPA 1N4QA 3MYIA 4HBDA 5KJNA 4OVVA 2A68F 3RU0A 2ZXOA 5CCMA 5COGA 3EUVA 3T6JA 1U89A 3ZHEB 4I17A 4IYPA 2WXNA 4BERA 4LG6A 3UNGC 3ZFWA 5E3CA 1YAUO 3I5QA 2J9WA 1OCCE 2CHWA 4N6CA 3DSVA 4EHPA 2DCPA 1YA7O 3O39A 3FUMA 4KNWA 2HV6A 3W2WA 2KC3A 3UKRG 5HS0A 1RKCA 4QFVA 5CBOA 3TK0A 2V5QC 2XL4A 4U0ZA 4CDMA 4N3CA 2CW0F 4XE0A 2TMVP 3UPVA 4M63A 1RJ9A 3U64A 1YDIA 3AQBA 1K40A 1JPLA 4PDXA 4XKBA 4ANWA 4EKWA 4JE9A 3UGPA 2B0OE 4A4AA 1FNTc 1A7EA 2X3MA 5EX0A 3ZKJA 3HDXA 2RKKA 2V5FA 1DOWA 3MEKA 4HLEA 4PS3A 2ASRA 5KWDA 2C0MA 3ASOC 3IHVA 2DWZA 4IJJA 1TR2A 1VYKA 3JYYA 3FOPA 4I1MA 4RVBA 4N6HA 3WG7C 3NDBB 3MBGA 3UTMA 1TWHA 1E85A 1BD8A 4DLQA 3FTXA 1N4PA 4OIQF 3SFZA 3CIAA 4XPWA 2IU1A 3EDTB 1HMOA 4XLPF 3H2VA 4DK5A 1U2VG 3ABLC 2DIWA 3EHQA 4UWLA 1Q0FA 2EQXA 2MOWA 2EILE 4YDEA 5JLIA 4YL0A 3B7BA 2YRFA 3D3MA 5L0DA 4UWGA 3LLKA 2XLVA 4KZ0A 3LUTB 4XPXA 4DX1A 1EF1C 4MW8A 2HSQA 2P0NA 1U3DA 4HI9A 4JC7A 4B0ZA 1LS4A 3R9AB 1V4AA 2A5UA 3KPHA 2EIKC 4AX2A 2YHCA 3QB2A 2WMNA 5EHHA 5KBAA 1ZHTA 3NRHA 2CFZA 5J08A 2DVWA 2XGOA 3ULQA 4LERA 4BESA 1OWOA 4BSZB 4OIPF 3PEVB 3JCUQ 4XX5A 1VMAA 3FUFA 4DOZA 1ZBPA 2GW1A 2MYSA 3KSQA 2QE9A 2NUTA 3QNKA 3E4BA 1NA3A 4GYTA 2R59A 3ASOE 3MJWA 4L7TA 4N2QA 2J7PD 2LFFA 4AM9A 2DYRE 4JXTA 5CEDB 3NBNB 2VQ2A 5AN8A 4GPMA 4X0RA 4N3BA 1NA0A 3FTYA 5F5FA 3SZRA 4XI0A 5H7PA 1FFHA 1OCZC 2QYUA 5E33A 4LNGA 4JA7A 3F6QA 1XWJA 3TWQA 4BJ6C 3DXJF 3SNHA 3L54A 3TWXA 1IHGA 4GTVA 1SA4A 1EYHA 4U5DE 4LDQA 3PVLA 3TG4A 4EBAA 1J8YF 2OU6A 2VSYA 1E2XA 3JYSA 4BPMA 3FU0A 1QBQA 1U3CA 4CS7A 4ACKA 3GEIA 3LYAA 4I1OB 4CS9A 2MHRA 4NTFA 1MQSA 1O1TA 2IJGX 1LD7A 1V74B 1ELKA 2GRQB 2XRYA 3ZXPA 1SF8A 4DLOA 1UOHA 4Q7CA 4CS9C 3SI5A 4RG6A 1WWPA 3NG1A 1VTMP 1H6OA 3MA5A 3ZTZA 4N5QA 5KYYA 3KD7A 3UIOC 3H2UA 5B1BE 2Y4UA 3OAWA 3K1HA 2V8SE 4GTQA 3U8VA 1MNDA 5ENPD 3HHMA 4DRXE 1OY3D 4MVRA 3ABME 3PNTB 1A7VA 5ARGA 4Z9JA 2AW6A 4QI2A 1IYGA 1ZZPA 2EIMC 3FH7A 2CYDA 3AG1E 4P6IC 5JHBA 2XEEA 5F5HA 3N2ZB 4YT5A 1MJ0A 1PV3A 4HI8A 4A55A 4JEBA 1M2OA 4KYOB 3L8JA 5E75A 4M7CA 2Q00A 4CS8A 2EIJC 1E96B 2VGEA 3ASNE 3IBEA 5A69A 2M4EA 5ENQD 1X5BA 4BJ5C 5B1AC 1T6IA 4K5AB 1JAFA 3CV0A 3Q5MA 1HG2A 4KC9A 4JZAA 2BEDA 1S63A 3CAXA 2XXAB 3K66A 1R5ID 3PNLB 1Z6TA 4LNBA 3CVXA 1WN0A 4HFKB 2F37A 5ITZF 1N4RA 1ZU5A 1PC2A 4FA6A 1ZW3A 2QC9A 4U5FE 5EKQD 4J7TA 1GGQA 4WJ0A 1P5QA 3CVLA 2GFHA 3QTHA 3DM5A 3G2VA 3JXIA 2A0BA 1HU3A 3T8MA 2IOQA 5LOZA 5JHAA 1HE9A 2EIJE 3S7JA 4RD9A 4MKTA 3LNMB 3U8PA 1Z3XA 2Q4FA 4O79A 2VGXA 3B9QA 3LY9A 3LEVA 4IN3B 2IM8A 2J07A 4KMOA 3UM3A 2EIME 3UKUG 1SW6A 5DBKA 4CGVA 4NURA 3W9GA 5BQGA 5B3SC 2CGEA 2V4LA 3Q7LA 5L3VA 1MZCA 1T01A 4GTOA 5EIDA 1YYJA 3R7CA 2YVKA 3Q78A 1D0YA 4A2NB 3OTNA 4JEUA 5AC4A 5G04C 3G2SA 2YL3A 1FVHA 2WXGA 1AEPA 2BF0X 3ASNC 2PM6A 3FY4A 2EINE 4KNVA 3DE9A 3G2UA 2OJQA 5AARA 1VDYA 2OKUA 1OW6A 4RSYA 5ENNA 3AG1C 1E86A 4YWQA 3CKBA 3ZRHA 3TWTA 5DS6A 2ETSA 2KZTA 3VAYA 4AP2A 2X6FA 1WM5A 3GZSA 5BXUA 2XLMA 1E7UA 4X8QA 2AVKA 4YT8A 5EK0A 3ABMC 3RRNB 3W8IA
chains in the Genus database with same CATH topology
3FUJA 3PHF2 5KYYB 1TJCA 5LX8A 2XCBA 4UWHA 3FEYA 1XGWA 5JJ7A 2VSXE 4FULA 4BT8A 4RBNA 5FTPA 4LLEA 4APFA 4F1SA 4HOTA 2PZIA 2J7PA 4IULA 4GYWA 3FUHA 3MYVA 3KMIA 5L3QA 1ZU2A 2WVOA 3ECSA 3ZC4A 1ELWA 1TWGA 2WXHA 3OXGA 3SHFA 1E8WA 3FTWA 4ME2A 5FZSA 4KBQA 2X6JA 4WWPA 4H4KC 2WB7A 4JPSA 2H7OA 3O6XA 2AXUA 3CK7A 2VYIA 3VTXA 4AOFA 1B89A 5D92A 3D9PA 2FBNA 5FCLA 4GMLA 3RO3A 2J4BA 3MZLB 1J8MF 4I2WA 5A6CA 3X2QC 2DYRC 2FI7A 1LS1A 3NYMA 3Q15A 3TAXA 3URZA 3Q49B 4A1GA 2CNWD 1E7VA 4BJTA 4UI9C 5CMWA 4ATGA 3ML9A 1BPOA 2IOLA 2AWIA 3S2AA 2IONA 1IQUA 3ZGQA 4BEJA 3KL4A 1WY6A 4FLBA 2CG2A 3FVYA 4U5BE 2R7QA 3IHYA 3EZHA 4PS8A 2V0PA 1SZAA 3U9WA 4PH4B 5E2QA 2BUGA 4FX5A 2EILC 4BFRA 3S28A 3FWVA 3CVPA 3I4GA 3DMDA 2WM9A 4JJGA 3FTZA 4PJNA 4W8KA 1V54C 4O7GA 4C7OB 1MNEA 4CIHA 4N39A 1UN9A 2J0XA 2NC9A 3MKRA 1OWNA 1BR2A 4JZYA 1QLEC 4D10C 4F53A 3R7RA 2IF4A 3QARA 5T3WA 4WNDA 3JSZA 5KYWA 1OWPA 2WMOA 5FJYA 1SMYF 4ULWA 4R7LA 4ACLA 4DVZA 1TWCA 2J9UA 2WPVA 5CI9A 4BTAA 1OCCC 3SP1A 4BJ6A 3JQ0A 3CVYA 5ANLA 4IRUA 3VTYA 2R7RA 3UGOA 2Y4TA 3D9OA 4UWFA 4CCAA 5D91A 3QKYA 2L9BA 2A69F 2FGYA 5FT9A 2L0TB 1EDUA 4A3TA 3DM9B 4ANVA 4DI3A 3QK0A 3MX3A 5DS4A 2WQ7A 3NYLA 2I1JA 4I1AA 1JPNA 5DQTA 1HG5A 3UMHA 3D9JA 3HVEB 1PAQA 2WXOA 3FDHA 1A17A 4HVBA 5FQ8A 2H7BA 4YN0B 3FU6A 2YQ8A 4N5CA 3KEZA 4G1TA 3S7DA 2WQ6A 2M63A 4C0MA 4BJ5A 3LS8A 2A6HF 3LESA 1TEZA 4CRWA 2J09A 3TD7A 1N52A 3ZVVA 3BG0B 4LACB 4F4BA 5DS5A 4KZCA 3FUEA 2KCLA 2G3VA 3APDA 1OKKA 4FESA 4UQZA 1OCOC 2IYLD 2XRHA 1UW4B 4Q94A 2A4ZA 3TXMA 4WWNA 2P6VA 2LAHA 2G3KA 3TXNA 4L2LA 4A1SA 5M72A 4U5CE 2KCVA 2ILRA 1LVKA 4ILGA 5ANRA 3FAJA 4FU3A 4N2SA 3CK9A 4CT4A 2ZPAA 3IEEA 4PFOA 3PMRA 4PFPA 2VASA 5E3AA 2X6KA 3RH3A 2P7VA 4J8EA 2QFCA 3E70C 3K9IA 4ILHB 5BPPA 2XCCA 5A7DB 2AXVA 2X38A 2LAIA 1QZ2A 4OVUA 1Z23A 1ELRA 3GW4A 1Z3IX 2C2LA 2GRLA 2R17C 3NYJA 2WVNA 3K33A 3VYWA 3AG2C 4G26A 3EZIA 3FUNA 4C0EA 2PF4E 3HIZA 3ENEA 3ASHA 1UN8A 2NSZA 2YEVA 4GB9A 3ZYLA 1FVFA 2HV7A 2V26A 1HE8A 1H0AA 3P1UA 1E8XA 5KYUA 4EZJA 2CNWA 2JLBA 1OUVA 3EIQC 2LSEA 1TWAA 3CZ6A 5G05C 2KC7A 4FJZA 3JRTA 2YHSA 3NKDA 4GZDA 4J32B 3PRZA 4I3MA 3BG1B 3PREA 4AE4B 4BY6A 2UY1A 2H7VC 3UUXA 3UT4A 4EBBA 4NRHB 3DBSA 4I2ZA 4U0UA 1E90A 2XGMA 4LLCA 3CVNA 5D0QD 4C3DA 4YVOA 1ZHWA 4UQYA 1H6KA 3CK8A 4XIFA 4FC8A 4UQXA 4BSXA 3W8HA 3ZIBA 2VJ8A 5LCWJ 3ZVRA 2XGSA 3LNRA 1JWFA 3PEUB 3RRMB 4V3IA 3U66A 4JHRA 3GZ2A 3MV2B 4M3OA 4MRUA 1IW7F 4OYSA 4EPZA 4KI2A 1FCHA 3Q6MA 2FULA 4FJYA 5C1DA 2V3CC 3ABKC 2YNQA 5CMYA 4K7BA 3ZYKA 5G2NA 4Q5SF 3DD7A 4P29A 5KCMA 4CT0A 3CSFA 3W2VA 5AENA 3WXXA 3FU5A 5G04J 5FQ7A 3R7QA 5T1DB 3RKVA 3T5XA 3CKCA 3LVRE 1OWMA 1OKKD 2HYZA 2WB2A 5EX3A 1JPJA 1UJKA 2X6IA 3D9IA 1VK5A 5DLJA 3FUKA 1RJ9B 2IQCA 2QY7A 4RDAA 3T6BA 3RKOF 2B0JA 4PJJA 2WXKA 4Y6CA 3CVWA 3B7SA 5FQ4A 1UJJA 2OG2A 2VSNA 1ZHZA 2IFUA 3CR3A 3MKQB 4MLPA 5KJKA 2R7SA 3DJNB 4RG9A 3SYNA 5T4YA 2I6HA 4O6YA 1QQEA 3EJNA 1Y8MA 3HVEA 4YT2A 3CQZA 5D0OD 2L9JA 4ANJA 2ZXWC 3RK6A 5HI7A 4DVYP 5AIJA 2XPIA 2Y3GA 4MS6A 1HF8A 2W4MA 4JCHA 3PS6A 4J30B 3APFA 4CBEA 3GANA 3S7FA 3TJPA 3FUIA 4IWBA 2IXPA 4BX9A 2A6EF 5E76A 2E87A 4HXIA 2Y69C 3ASGA 3L34A 4TUUA 3MGBA 3EH2A 3Q7GA 3EGXA 5EDSA 5FZQA 5JJTA 3FEXA 3DAFA 3RFYA 4G0HA 4PK4A 4KXKB 4JHJA 3LDZA 2NUTB 4FLHA 2PL2A 3ZYQA 2IXMA 5EGYA 2R7WA 4GYOA 3QWVA 3HYMB 3V7OA 2Y3DA 1KLXA 1QZXA 3AU5A 3OXLA 3FHEA 1IQRA 1D1AA 2PP4A 3BEEA 2HR2A 3CVQA 3I4RB 2ZU6B 4N3AA 4DI4A 2Q3TA 4JEHA 4JC8A 3NZUA 3ASDA 4E7ZA 1SZIA 2DBAA 3JQ1A 4U8HA 3UT8A 1S7ZA 3UR3C 4BJ1A 3SBSA 2I8BA 4GA2A 3K1IC 2C03A 1PCXA 2NUPB 4J0UA 3B7UX 3EFOB 5KYWB 3LEWA 4XWJA 5KYNA 3EQLF 3FH5A 4A3VA 3CVUA 1MMAA 4GZ3A 2GGFA 4KBLA 4GZ5A 1DNPA 2RD0A 3PUJA 1BR1A 3SNXA 2R7XA 4ZLDA 2FF4A 3IKOB 1Z3YA 3CHOA 1L5JA 4AK9A 3EGXB 2G62A 3KS2A 2FEZA 1PD0A 2J45A 4B8CB 2BTDA 5LFAA 2Y39A 3L17A 2LSVA 2E2EA 4JW1A 4GYYA 3CHRA 1PY1A 1INZA 2Q7FA 1VOMA 2ZXPA 3HLZA 5JJ6A 5FWQA 3ONKA 3L0IA 2MHKA 3NKEA 1HS6A 4U63A 4TV3A 3F46A 3E9VA 2KW3C 4DJAA 3RIPA 4L1BA 4CSAA 3LS0A 5KYXA 2XRZA 3LLIA 2J9QA 2AXZA 1DVPA 2UY1B 4GMJA 1HX8A 3FTSA 2ZXRA 4CS8C 2MRIA 2WVQA 1WAO1 5DIZA 1N1CA 2WL8A 3SGHA 2PM7A 2PFDA 4UWKA 4BTBA 3PDNA 1KT1A 4GZCA 3N24A 3FULA 3FUDA 3EFOA 2EINC 3LCAA 5AYWD 1MMNA 1OCRC 3EG9B 2WVIA 4G7HF 4G11A 2PQNA 3ZN3A 3LJBA 1S0PA 4ANXA 5BV0A 2Y3AA 1ZHYA 3T4RA 3S29A 5BW8C 3O4ZA 3OWTA 2Q9AA 4O6MA 5T8IA 4HFFB 4WWOA 3EHNA 4I9CA 4OIRF 1WGWA 3QWWA 2BE5F 3VLDA 3ZEFA 4OINF 2XPZA 4UI9K 4XI9A 4DBRA 4KVMA 4FP7A 3GZ1A 5LP0A 1TKNA 3B13A 4Q96A 3EH1A 3EGDB 4C3EA 4XZ4A 3M1CB 2Q9CA 4HOQA 4NQ0A 3B0VC 4ILIA 2KZTB 3GYZA 5BT1A 1ZYRF 3QOUA 4I43A 4XLNF 2WXIA 3ASFA 4FADA 3X1OA 1MMGA 3AQCA 2DYSC 3DJUB 3ZYMA 4BWRA 1E8ZA 1BR4A 2DGJA 5FZRA 4AVXA 2R7OA 3TGOA 3EG9A 2UWJG 4ABNA 3FU3A 2W9YA 4H7XA 3ZIMA 2IXNA 3TL5A 3KKBA 3PE3A 3OA1A 3ZXSA 3PUKA 4G25A 4NY3A 3FH8A 2LNIA 5B1BC 4XTKA 3MKQA 1QNFA 2Y3BA 4I6JA 4HORA 4K0DA 2O9XA 4OD4A 3ML8A 4Q69A 4L23A 4WNFA 5AJDA 4F3VA 4B94A 3QZCA 4URKA 3ZHEA 4W9RA 5KYUB 3IV0A 1VYIA 4HS2A 2PX0A 4B8AA 2CG3A 4AJWA 1NP7A 3H65A 2QY9A 2C0LA 3PE4A 3NQPA 4LCTA 4KVOA 3G2WA 2KATA 3C98A 2FO7A 4LRZA 4JL0A 3N0TA 2YZSA 5LCWC 5T3RA 3ZSUA 3I5PA 3MV3B 4EZLA 3ZG1A 4TRQA 4AIFA 4YT4A 4BG0A 3B0UX 2VGXB 3CLJA 4YVQC 2KNHA 4NACA 3SBTB 2XEVA 1W2WA 3CQCB 1ZU4A 5KJLA 4U0SA 2WZGA 3DZAA 5DQZA 2NUPA 4ANUA 3I4UA 1YA0A 3LY8A 1ZHXA 4YNDA 2J49A 4DBQA 3D9NA 3AG3C 4G7OF 4GA0A 3B7TA 2HM8A 4O6NA 3ESKA 2ONDA 3ONLA 2OCCC 4CSAC 4E85A 2P58C 4QDLA 3UQ3A 4I9EA 1O5HA 4WAFA 3CSTA 4GCNA 3JCKC 2KM4A 4PJLA 4JVSA 5CHEE 4G24A 3JUIA 3JYHA 2D5RB 2WXRA 2PX3A 4O6FA 3UT7A 4B6IA 4EZKA 2VH3A 4CDNA 3ITFA 4GZ6A 1UG3A 1M56C 3MCXA 4C7OA 3VLFA 3CSKA 5G05J 4H7YA 3F47A 3T5VA 3N71A 1H19A 1D1CA 2WXJA 3LS1A 2VSOE 4U5GA 1FMWA 4BX8A 2XSEA 1M2VB 2VB6A 4Y6WA 4HE8D 2J08A 3KAEA 3D9MA 4J8SA 3UMVA 3DAGA 3FHDA 3B7RL 3CEQA 4J6IA 4AXHA 4APOA 4E7SA 1O87A 2WXFA 3S0XA 1EPUA 3CHSA 2WXLA 3L6AA 3ESLA 2NG1A 4MNDA 4J8DA 1Z63A 3NZSA 2L0IA 4JA9A 2I9CA 1XNFA 1ST6A 4FWVA 5KYXB 4I44A 3LXUX 4EQFA 4EWCA 3ZW3A 1N54A 1M57C 2PQRA 2KGOA 2CFUA 3L22A 3Q4AB 1SQMA 3RRUA 3QJZA 3CHQA 4JURI 4HOSA 1MMDA 3FDQA 4LUNU 4AV7A 4K03A 4WNGA 1G8XA 2WZFA 2L6JA 4OD5A 3LVQE 5ARFA 4QI0A 3S27A 4UI9J 4FHKA 3QDNA 4GAAA 1JUQA 3EGDA 4I6EA 4YJWA 3LAYA 2XPYA 3S7BA 2J4DA 2XHEA 4AEZC 5FQ6A 3TG5A 3QMKA 3NF1A 4GEHA 1W3BA 3FP3A 3IEGA 2YHEA 2XQ0A 2CHZA 1HZ4A 4G23A 3K6BA 2NXPA 4HOUA 1H2TC 2LSUA 1Z6AA 3SF4A 1SZ9A 3HTKC 2W45A 4JHKA 4IAOA 3LPZA 3CGHA 3B0PA 3OXFA 3D9KA 3G2TA 5A23A 4HFGA 1D0XA 3HJCA 2OVBA 3U3WA 4CGWA 4BT9A 3OEOA 1H2VC 1LF8A 4LEUA 2Z15A 4U5HA 2CDQA 3CVVA 2I1KA 4PJMA 3LJ3A 2IOSA 2JEKA 1KU2A 1FFTC 4F7AA 5IY5C 4GA1A 3AS4A 3L16A 1V55C 2OOEA 5J90A 5C2YA 4MQ9F 4I6GA 2L81A 1Y6IA 4G2VA 4GCOA 3VLEA 3SEOA 3SZ7A 1NU7D 2AVPA 3EPVA 3DPDA 3QWPA 4AE4A 1GW6A 4PS7A 4EBAG 4ZLCA 3APCA 4KT6B 2OVFA 3POVA 1NU9C 3EHMA 4AY5A 2VTBB 5AJLA 2VGYA 4DPRA 2RG8A 2X6HA 1NZNA 4GU5A 2J9VA 3JT1A 1D1BA 4J8FA 1KT0A 2X51A 2IXOA 3LKUA 1D0ZA 3MLGA 1FMVA 3PH0C 4L2YA 2J46A 2KCKA 1M2VA 2KQ9A 3AS8A 1NG1A 3WODF 3AS5A 5BUOA 3KH2A 3UMIA 2HO1A 1H2UA 4GPKA 2R7UA 2KJGA 4CDRA 2Y3HA 4U07A 2CHXA 4G7ZF 2J0WA 4OIOF 4E6HA 3CHPA 1NZEA 4EECA 3I3NA 1IZMA 2R5SA 1HO8A 2E0IA 3Q47B 2XXAA 2WQHA 3CQGB 5BUZA 3D9LA 3P2BA 1E8YA 3L13A 2JD3A 2MWQA 5CI8A 5BV1A 3L08A 5T3TA 5HSWA 3UX4A 3FFLA 5DVWA 2GRMA 3CHMA 3FTUA 1HH8A 3RJVA 3K7DA 1MHQA 3AG4C 5KJMA 5BNWA 4Q4ZF 4U04A 2LO6A 4K0RA 4B89A 3QAQA 3FTVA 3RYLA 2W4BA 1HFAA 2I2OA 3GODA 1HXIA 1Z5ZA 2FFHA 2QTVA 2Q9BA 2C04A 3EIJA 3U4TA 3UMKA 3LY7A 4HEAJ 2WZLA 1PD1A 2WXMA 4C9BB 5HQ8A 4PUCA 4XKCA 5CCLA 3O48A 2A1DD 3PZDA 4WUYA 4AY6A 4N06A 1OWLA 4FHJA 3RIBA 3RO2A 2R7VA 4C3BA 2OV8A 3QC1A 2YINA 4JJFA 4U5EE 2VTBA 4CEMA 2R7TA 3Q6NA 2WXQA 1JWGA 3AU4A 3ZPJA 4WNEA 1FTSA 1TJFA 1LKXA 3SD5A 5G55A 2WXPA 5KJNA 4OVVA 2A68F 3RU0A 2ZXOA 5CCMA 3T6JA 3ZHEB 4I17A 4IYPA 2WXNA 3UNGC 3ZFWA 5E3CA 3I5QA 2J9WA 2CHWA 2DCPA 3O39A 3FUMA 4KNWA 2HV6A 3W2WA 4QFVA 4U0ZA 4CDMA 2XL4A 4N3CA 2CW0F 4XE0A 3UPVA 4M63A 1RJ9A 3U64A 3AQBA 1JPLA 4ANWA 4PDXA 4XKBA 3UGPA 2X3MA 5EX0A 3HDXA 2V5FA 3MEKA 4HLEA 4PS3A 2C0MA 3ASOC 3IHVA 4IJJA 1TR2A 1VYKA 4I1MA 4RVBA 3WG7C 3NDBB 1TWHA 4DLQA 3FTXA 4OIQF 3SFZA 3CIAA 2IU1A 3EDTB 4XLPF 4DK5A 3ABLC 2DIWA 4UWLA 2EQXA 2MOWA 3D3MA 4UWGA 3LLKA 4KZ0A 1EF1C 1U3DA 4B0ZA 3R9AB 2A5UA 2YHCA 2EIKC 4AX2A 3QB2A 2WMNA 5EHHA 1ZHTA 3NRHA 2CFZA 5J08A 2XGOA 3ULQA 4LERA 1OWOA 4OIPF 3PEVB 3JCUQ 4XX5A 1VMAA 3FUFA 4DOZA 1ZBPA 2GW1A 2MYSA 2NUTA 3QNKA 3E4BA 1NA3A 4GYTA 2R59A 3MJWA 4L7TA 4N2QA 2J7PD 4AM9A 4JXTA 2VQ2A 4X0RA 4N3BA 1NA0A 3FTYA 5F5FA 3SZRA 4XI0A 1FFHA 1OCZC 5E33A 4JA7A 4BJ6C 3DXJF 3SNHA 3L54A 1IHGA 1EYHA 4U5DE 3PVLA 3TG4A 4EBAA 1J8YF 2VSYA 3JYSA 3FU0A 1U3CA 4CS7A 4ACKA 3LYAA 4I1OB 4CS9A 1MQSA 2IJGX 1ELKA 2XRYA 4DLOA 1SF8A 4Q7CA 4CS9C 3SI5A 4RG6A 3NG1A 3MA5A 5KYYA 3KD7A 2Y4UA 3OAWA 3K1HA 2V8SE 1MNDA 3HHMA 3PNTB 5ARGA 2AW6A 4QI2A 1IYGA 2EIMC 3FH7A 4P6IC 5JHBA 5F5HA 3N2ZB 4YT5A 4A55A 1M2OA 4KYOB 5E75A 4CS8A 1E96B 2EIJC 3IBEA 2M4EA 1X5BA 4BJ5C 5B1AC 3CV0A 3Q5MA 1HG2A 4KC9A 4JZAA 2XXAB 3K66A 3PNLB 1Z6TA 3CVXA 4HFKB 1ZU5A 1PC2A 4FA6A 4U5FE 5EKQD 4WJ0A 1P5QA 3CVLA 2GFHA 3DM5A 3G2VA 3T8MA 1HU3A 2IOQA 5LOZA 5JHAA 3S7JA 4RD9A 4MKTA 1Z3XA 4O79A 2VGXA 3B9QA 3LY9A 3LEVA 4IN3B 2J07A 4KMOA 5DBKA 4CGVA 4NURA 5B3SC 2CGEA 2V4LA 3Q7LA 5L3VA 1D0YA 4A2NB 3OTNA 4JEUA 5G04C 3G2SA 2WXGA 1FVHA 2BF0X 3ASNC 3FY4A 2PM6A 4KNVA 3G2UA 1VDYA 5ENNA 4RSYA 3AG1C 3CKBA 4YWQA 3ZRHA 5DS6A 2KZTA 3VAYA 4AP2A 2X6FA 1WM5A 3GZSA 1E7UA 4YT8A 3ABMC 3RRNB 3W8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5P A; 
#chains in the Genus database with same CATH topology
 3FUJ A;  3PHF 2;  5EYP F;  5KYY B;  4U9E A;  1TJC A;  5LX8 A;  2XCB A;  4UWH A;  1QVX A;  3E37 A;  3FEY A;  3WHN A;  2IO3 C;  3V30 A;  1SR2 A;  3KYJ A;  1XGW A;  5JJ7 A;  2VSX E;  1O5M A;  2R2L A;  1HW2 A;  4FUL A;  4BT8 A;  4RBN A;  5FTP A;  4LLE A;  3PDM P;  4APF A;  1G4U S;  4F1S A;  3GWN A;  4HOT A;  2PZI A;  4GTT A;  2J7P A;  4IUL A;  3SXM A;  4GYW A;  5JA4 D;  3FUH A;  3MYV A;  4F6R D;  1WG0 A;  3KMI A;  5L3Q A;  4G8L A;  1ZU2 A;  2WVO A;  5AGF A;  3ECS A;  2P9L G;  3CEX A;  3ZC4 A;  1ELW A;  1TWG A;  2WXH A;  3E32 A;  3OXG A;  4W8P A;  4DUI A;  3SHF A;  1E8W A;  3FTW A;  3DSW A;  3RF3 A;  3J5P A;  4ME2 A;  5FZS A;  4KBQ A;  2X6J A;  4D4N A;  4WWP A;  4H4K C;  2WB7 A;  3RVZ A;  2P9K G;  5ENO D;  3PCV A;  4JPS A;  2H7O A;  5D2M C;  2NSF A;  3O6X A;  2AXU A;  3CK7 A;  2VYI A;  3VTX A;  4AOF A;  2ETB A;  1B89 A;  5D92 A;  3UM2 A;  3D9P A;  2FBN A;  5FCL A;  4GML A;  3RO3 A;  5JVE A;  2J4B A;  3MZL B;  1J8M F;  4I2W A;  5A6C A;  3X2Q C;  2DYR C;  3V5X A;  2FI7 A;  4Z9H A;  1LS1 A;  4J7W A;  3NYM A;  3Q15 A;  3V2X A;  2R05 A;  3QW1 A;  5AQ7 A;  3TAX A;  1AUE A;  3URZ A;  3Q49 B;  4A1G A;  3HKK A;  2CNW D;  2H6H A;  1E7V A;  2A5E A;  1DCQ A;  4BJT A;  1H6G A;  4UI9 C;  4ONS A;  5CMW A;  4ATG A;  3ML9 A;  1BPO A;  2IOL A;  2AWI A;  3S2A A;  2ION A;  1IQU A;  1I4Y A;  3ZGQ A;  4BEJ A;  1U0B B;  2NSG A;  3JUE A;  1EI7 A;  3KL4 A;  1WY6 A;  4FLB A;  2CG2 A;  2JPU A;  2RD9 A;  3FVY A;  4U5B E;  2HSB A;  2R7Q A;  3IHY A;  4JCZ A;  3EZH A;  3WAQ A;  3C3R A;  4PS8 A;  3BUA A;  1CGN A;  2V0P A;  3JXJ A;  1SZA A;  3U9W A;  4PH4 B;  4NQF A;  5E2Q A;  2BUG A;  4FX5 A;  2EIL C;  1O1S A;  4BFR A;  3HNK A;  3S28 A;  3FWV A;  3CVP A;  3I4G A;  3DMD A;  2WM9 A;  4JJG A;  3FTZ A;  4PJN A;  2OOC A;  4W8K A;  1V54 C;  4O7G A;  4C7O B;  1MNE A;  4CIH A;  5CRV A;  4N39 A;  3HXD A;  1UN9 A;  3TJ6 A;  3BRJ A;  2J0X A;  2NC9 A;  2LK4 A;  3NAW A;  2PBE A;  3MKR A;  1OWN A;  1BR2 A;  4JZY A;  4XEI G;  3V79 K;  1WAS A;  4MTG A;  3JRM O;  1YYX A;  1QLE C;  1BZ4 A;  1Z5S C;  4D10 C;  3SO8 A;  1SVX A;  4F53 A;  3R7R A;  2IF4 A;  3QAR A;  5T3W A;  4WND A;  2DZO A;  3JSZ A;  1SYQ A;  5KYW A;  1OWP A;  2WMO A;  1LE2 A;  5FJY A;  3A11 A;  3M15 A;  4WGZ A;  3KEA A;  1SMY F;  3S90 A;  4ULW A;  4R7L A;  4ACL A;  4HRL A;  2KK1 A;  1BBH A;  1LTX A;  4DVZ A;  1TWC A;  2UUI A;  2P9P G;  2J9U A;  2BKG A;  5B3I A;  2WPV A;  3PZ2 A;  5CI9 A;  4BTA A;  4MTO A;  1FR0 A;  1OCC C;  3SP1 A;  4BJ6 A;  3V2O A;  1K8K G;  4IAQ A;  3JQ0 A;  3CVY A;  3NMJ A;  3DST A;  1KPS B;  3TWW A;  5ANL A;  3HG0 D;  4IRU A;  3VTY A;  2R7R A;  1UG7 A;  3DEO A;  2HMQ A;  2ETC A;  3MFN A;  3UGO A;  2Y4T A;  3D9O A;  4UWF A;  4CCA A;  2L6G A;  1RW2 A;  2IEJ A;  5CEC B;  5D91 A;  3QKY A;  1E83 A;  2L9B A;  2OQM A;  2A69 F;  1OR3 A;  2FGY A;  2XM4 A;  5FT9 A;  2L0T B;  1EDU A;  4A3T A;  3GOR A;  2A0U A;  3DM9 B;  4ANV A;  2DYS E;  4DI3 A;  3IPM O;  4MVZ A;  3HXF A;  3U3B A;  3QK0 A;  2ZGD A;  3MX3 A;  5DS4 A;  2Y0B G;  2KBX A;  2WQ7 A;  3NYL A;  2I1J A;  4I1A A;  4GTS A;  4L9P A;  1JPN A;  3DI5 A;  5DQT A;  3ABK E;  1HG5 A;  3UMH A;  3D9J A;  3HVE B;  2LCH A;  1PAQ A;  2WXO A;  3FDH A;  3ZNG A;  1A17 A;  1YMP A;  4HVB A;  5FQ8 A;  3AG3 E;  2H7B A;  1FT2 A;  4YN0 B;  3FU6 A;  2YQ8 A;  4N5C A;  3KEZ A;  3B71 A;  3LJN A;  2D4U A;  4G1T A;  3S7D A;  2RFM A;  2WQ6 A;  3KYI A;  2M63 A;  1NSG B;  4C0M A;  1AP7 A;  4BJ5 A;  3LS8 A;  2A6H F;  1RZ4 A;  3LES A;  1TEZ A;  3MYF A;  1D8E A;  2R25 A;  4E17 A;  1EKY A;  4CRW A;  2J09 A;  3TD7 A;  1N52 A;  3ZVV A;  3BG0 B;  4OAU C;  4LAC B;  4F4B A;  3DWL G;  3E30 A;  5DS5 A;  1Q2Z A;  4U9D A;  3VF0 A;  2AWY A;  3ISM C;  4KZC A;  1RKE A;  1NBB A;  3FUE A;  3X2Q E;  2KCL A;  2G3V A;  3APD A;  1MQV A;  1OKK A;  1LIH A;  1K05 A;  4FES A;  4UQZ A;  2HUJ A;  1OCO C;  3FMS A;  2IYL D;  2XRH A;  1UW4 B;  4Q94 A;  1YJG A;  4A63 B;  2P61 A;  1C17 M;  2A4Z A;  3TXM A;  4WWN A;  2P6V A;  2LAH A;  2G3K A;  3TXN A;  1ORS C;  4L2L A;  1HW1 A;  4A1S A;  5M72 A;  4U5C E;  1T6Q A;  1X81 A;  4XEF A;  2P1A A;  4YL3 A;  2LXL A;  4DRJ B;  4G8K A;  2KCV A;  2ILR A;  4ATZ D;  1LVK A;  4ILG A;  1G3N B;  5ANR A;  4K5B A;  3FAJ A;  5HRY A;  4FU3 A;  4N2S A;  3CK9 A;  4CT4 A;  5CRU A;  2ZPA A;  3C8Z A;  3IEE A;  5D66 A;  4PFO A;  3PMR A;  4PFP A;  1T6U A;  2VAS A;  5E3A A;  2X6K A;  1HY5 A;  3RH3 A;  2P7V A;  5EYL A;  4AL0 A;  4J8E A;  2QFC A;  3E70 C;  3K9I A;  4ILH B;  5BPP A;  2XCC A;  4RLY A;  5A7D B;  4U7E B;  3UIP C;  2AXV A;  2AP3 A;  2X38 A;  2LAI A;  1QZ2 A;  4OVU A;  2M64 A;  1Z23 A;  3EU9 A;  1ELR A;  2DB4 A;  1Z3I X;  2C2L A;  2GRL A;  2R17 C;  3GW4 A;  1LM3 B;  3NYJ A;  1VLS A;  2WVN A;  3K33 A;  3VYW A;  1DOV A;  5JP7 A;  3AG2 C;  3BEH A;  3QVZ A;  4FAP B;  4LSZ E;  3C63 A;  4G26 A;  3EZI A;  3FUN A;  4C0E A;  2PF4 E;  5HKP A;  3HIZ A;  3ENE A;  1H7I A;  3ASH A;  2XLO A;  1OXJ A;  1UN8 A;  1RXQ A;  2NSZ A;  2YEV A;  1QKR A;  4GB9 A;  3UM0 A;  5L0G A;  3QW0 A;  2FAP B;  3ZYL A;  1FVF A;  2HV7 A;  1HE8 A;  2V26 A;  5AQ9 A;  1H0A A;  3P1U A;  1E8X A;  5KYU A;  4EZJ A;  1A7D A;  2CNW A;  4CDY A;  2JLB A;  1OUV A;  1BI8 B;  3EIQ C;  4ZHB A;  4NCQ A;  2LSE A;  1TWA A;  3CZ6 A;  4CJO A;  5G05 C;  5JMN D;  4K5C A;  1GQA A;  2KC7 A;  4FJZ A;  4DX6 D;  3JRT A;  2YHS A;  5ENR D;  3NKD A;  3Q7A A;  3AJI A;  4GZD A;  4J32 B;  3Q7F A;  1K1B A;  3PRZ A;  4I3M A;  3BG1 B;  3C18 A;  1BI7 B;  3PRE A;  1IHB A;  4AE4 B;  4BY6 A;  1WTY A;  4JTC B;  2UY1 A;  2H7V C;  3UUX A;  3UT4 A;  3D9H A;  3SFY A;  4EBB A;  3L9T A;  4NRH B;  3DBS A;  2YWA A;  4I2Z A;  4U0U A;  1E90 A;  4UUC A;  4XEV A;  3ZWI A;  2XGM A;  1JMW A;  4WAB A;  2YLI A;  2GDC A;  1TNU A;  1Y6D A;  4DX2 A;  4LLC A;  3CVN A;  3DSX A;  5D0Q D;  4C3D A;  4YVO A;  2LP4 A;  3J06 A;  5L0F A;  1ZHW A;  2GAQ A;  4IB4 A;  4UQY A;  1H6K A;  3UI2 A;  2OEV A;  3CK8 A;  4XIF A;  4FC8 A;  4UQX A;  4TUM A;  4BSX A;  3W8H A;  4E18 A;  3ZIB A;  2H6I A;  1JOG A;  1YA9 A;  1N94 A;  3ZTM A;  2VJ8 A;  1C02 A;  3ZVR A;  5LCW J;  2XGS A;  4TXQ A;  3LNR A;  1JWF A;  4J8Y A;  2Y69 E;  3PEU B;  3RRM B;  4V3I A;  2GRO B;  3RVY A;  3U66 A;  3E33 A;  4JHR A;  1DC2 A;  2AWC A;  2V4H C;  2RSE B;  2XM0 A;  1LE4 A;  3GEE A;  3GZ2 A;  3MV2 B;  4M3O A;  4LNU D;  4MRU A;  1IW7 F;  3AOU A;  4OYS A;  4EPZ A;  4KI2 A;  1FCH A;  3Q6M A;  2X0C A;  2FUL A;  4FJY A;  1TNZ A;  5C1D A;  2V3C C;  3ABK C;  2YNQ A;  5CMY A;  4K7B A;  3LEO A;  3ZYK A;  5G2N A;  4Q5S F;  4JTD B;  3DD7 A;  4P29 A;  5KCM A;  4CT0 A;  3CSF A;  3W2V A;  5AEN A;  3WXX A;  3FU5 A;  5G04 J;  5FQ7 A;  4MVQ A;  3R7Q A;  5T1D B;  3DXM G;  3RKV A;  3T5X A;  3CKC A;  3LVR E;  1OWM A;  1OKK D;  2HYZ A;  2WB2 A;  2VCA A;  5EIB E;  3UXG A;  4YDW A;  3L82 A;  5EX3 A;  3L8I A;  3M79 A;  3ZQY A;  1JPJ A;  1UJK A;  3TOM A;  2X6I A;  1CGM E;  3NMK A;  3D9I A;  1VK5 A;  5DLJ A;  3FUK A;  1RJ9 B;  2IQC A;  2Y1L E;  1Y4C A;  2QY7 A;  4RDA A;  4QQI A;  4U8V D;  3T6B A;  3RKO F;  5CER B;  2B0J A;  2LQG A;  2Q7R A;  1MX6 A;  3U2M A;  4PJJ A;  2WXK A;  4Y6C A;  3CVW A;  1TN8 A;  1E84 A;  3B7S A;  5FQ4 A;  5BXO A;  3U5S A;  1UJJ A;  2OG2 A;  2VSN A;  1ZHZ A;  2IFU A;  3CR3 A;  3DEP A;  1L3P A;  3MKQ B;  4MLP A;  1OCZ E;  5KJK A;  2R7S A;  1QSP A;  3C8G D;  3DJN B;  1YLM A;  1IKN D;  2HMZ A;  2ZIR A;  4RG9 A;  3SYN A;  5T4Y A;  1BU9 A;  2I6H A;  4O6Y A;  1QQE A;  3EJN A;  1Y8M A;  3HVE A;  4CJG A;  4YT2 A;  3CQZ A;  5D0O D;  2L9J A;  4ANJ A;  1TYQ G;  3FAP B;  2ZD9 A;  2F8X K;  2ZXW C;  1XZP A;  1NFO A;  3HXE A;  3RK6 A;  5HI7 A;  2GA0 A;  4DVY P;  1LD8 A;  5AIJ A;  2XPI A;  2Y3G A;  4MS6 A;  1HF8 A;  2W4M A;  4JCH A;  2XS8 A;  3HRA A;  3PS6 A;  3T8K A;  4J30 B;  3APF A;  4CBE A;  4GTM A;  2HZ8 A;  4O1P A;  3GAN A;  3S7F A;  5CBN A;  3UM1 A;  3TJP A;  3RW0 A;  4JEA A;  1QPU A;  3FUI A;  4IWB A;  2IXP A;  4BX9 A;  2A6E F;  5E76 A;  2E87 A;  1V54 E;  2B6C A;  4HXI A;  2Y69 C;  2HKV A;  3ASG A;  3L34 A;  2KSF A;  4EBJ A;  4TUU A;  3MGB A;  3EH2 A;  3Q7G A;  3FOO A;  3TWS A;  1FAP B;  1A41 A;  3EGX A;  5EDS A;  3T9K A;  5FZQ A;  3HNJ A;  5JJT A;  3DPY A;  5HV9 A;  3FEX A;  3DAF A;  3RFY A;  4G0H A;  4Z9I A;  1CPQ A;  4PK4 A;  4KXK B;  4CIP A;  4JHJ A;  1JCR A;  2XEH A;  2NUT B;  3LDZ A;  3W9F A;  5EN5 D;  4FLH A;  3AG4 E;  2PL2 A;  1QQ3 A;  3ZYQ A;  3B29 A;  1JCS A;  1S05 A;  3Q75 A;  3M4B A;  2IXM A;  5EGY A;  2R7W A;  5AC5 A;  3JTL O;  4GYO A;  4XQ1 A;  4MVS A;  3QWV A;  3SXY A;  3HYM B;  3V7O A;  1KLX A;  2Y3D A;  2I15 A;  1O3U A;  1QZX A;  3AU5 A;  2L6H A;  1S64 A;  5FZT A;  3OXL A;  3FHE A;  2QYJ A;  1YCS B;  1IQR A;  1D1A A;  2PP4 A;  3BEE A;  2HR2 A;  5ENT D;  3CVQ A;  3I4R B;  1NFI E;  1AWC B;  2ZU6 B;  4N3A A;  3SY2 A;  4DI4 A;  5L0H A;  2Q3T A;  4JEH A;  4JC8 A;  3NZU A;  3ASD A;  4E7Z A;  1SZI A;  3R2P A;  2DBA A;  3T9O A;  3JQ1 A;  1XZQ A;  4U8H A;  1GM5 A;  2ETA A;  3UT8 A;  1S7Z A;  5AQA A;  3UR3 C;  2PNO A;  4BJ1 A;  3SBS A;  2QUP A;  2I8B A;  3M4C A;  4HRN A;  4GA2 A;  3K1I C;  4RQI A;  2C03 A;  1PCX A;  2NUP B;  3DE8 A;  4J0U A;  3B7U X;  2LUH A;  3JSE O;  1YYH A;  3EFO B;  5KYW B;  3LEW A;  4XWJ A;  5KYN A;  3V5Z A;  3EQL F;  3FH5 A;  4A3V A;  3CVU A;  1M6T A;  1MMA A;  4GZ3 A;  3V5Y A;  1OR2 A;  2GGF A;  4KBL A;  4GZ5 A;  1Z7Q c;  2NPU A;  4O60 A;  1DNP A;  2RD0 A;  3PUJ A;  3C8G A;  4HLL A;  1BR1 A;  3SNX A;  2R7X A;  4ZLD A;  4AL1 A;  3ZQV A;  2FF4 A;  3IKO B;  1Z3Y A;  3CHO A;  3AG2 E;  1L5J A;  4AK9 A;  3EGX B;  2G62 A;  3KS2 A;  2FEZ A;  1PD0 A;  2J45 A;  4B8C B;  2BTD A;  5LFA A;  4E0I A;  3U3F A;  2Y39 A;  3L17 A;  2LSV A;  2E2E A;  4JW1 A;  4U96 D;  4GYY A;  1RKE B;  3CHR A;  1PY1 A;  1INZ A;  2Q7F A;  1VOM A;  2VCC A;  2ZXP A;  3HLZ A;  5JJ6 A;  3W4Y A;  1ZVZ A;  5FWQ A;  2CCY A;  3ONK A;  5AQB A;  3L0I A;  2MHK A;  3NKE A;  3JZ0 A;  1HS6 A;  4U63 A;  4TV3 A;  3SXK A;  3F46 A;  2EPK X;  3E9V A;  2GRP B;  2P9S G;  2KW3 C;  4DJA A;  3RIP A;  4L1B A;  4CSA A;  3LS0 A;  5KYX A;  5IY5 E;  2XRZ A;  3LLI A;  4TXR A;  2J9Q A;  2AXZ A;  1DVP A;  2UY1 B;  3S9O A;  3EHR A;  1HX8 A;  4GMJ A;  3FTS A;  2ZXR A;  4CS8 C;  2OJE D;  2L6B A;  2MRI A;  2WVQ A;  2ZIS A;  1WAO 1;  3AAA C;  5DIZ A;  3J5Q B;  1GS9 A;  1N1C A;  2DI3 A;  5K0I A;  5B3S E;  2WL8 A;  2H6F A;  2P9N G;  3SGH A;  2PM7 A;  2PFD A;  4UWK A;  4BTB A;  1SA5 A;  3PDN A;  3TWU A;  1KT1 A;  4GZC A;  3N24 A;  3FUL A;  3FUD A;  4DX7 D;  3EFO A;  2EIN C;  2VCB A;  3LCA A;  5AYW D;  1MMN A;  2OEW A;  4DRI B;  3Q9N C;  1OCR C;  1H9T A;  4BEP A;  3EG9 B;  2EPL X;  3ZDL A;  2WVI A;  4G7H F;  3PZ3 A;  4WGY A;  2L6F A;  4G11 A;  2PQN A;  3ZN3 A;  3LJB A;  1S0P A;  2R03 A;  4ANX A;  5BV0 A;  2Y3A A;  2YL0 A;  2YL1 A;  1YZA A;  1C03 A;  1ZHY A;  1G5Z A;  3GM3 A;  3T4R A;  3AGT A;  3S29 A;  5BW8 C;  2JAB A;  2BC5 A;  3OWT A;  3O4Z A;  2Q9A A;  4O6M A;  5T8I A;  4HFF B;  4WWO A;  3EHN A;  4CDV A;  3ZUV B;  3GM1 A;  2P2C P;  4I9C A;  2FO1 E;  5AAO A;  4OIR F;  1WGW A;  3QWW A;  4CDA A;  3UIN C;  2BE5 F;  3VLD A;  3ZEF A;  3DSU A;  2IBF A;  4OIN F;  5B1A E;  2XPZ A;  4UI9 K;  4ER9 A;  4XI9 A;  4O1O A;  4DBR A;  4KVM A;  2OEX A;  4FP7 A;  2XEN A;  3QVY A;  1JR8 A;  3GZ1 A;  5LP0 A;  1TKN A;  3SQV A;  3B13 A;  1NFN A;  4IAR A;  3U2L A;  4Q96 A;  2LD6 A;  3EH1 A;  3EGD B;  4C3E A;  1LI7 A;  3M1C B;  4XZ4 A;  2Q9C A;  4HOQ A;  1R4T A;  3RQG A;  3C3Q A;  4HB5 A;  4NQ0 A;  3B0V C;  4ILI A;  2KZT B;  3GYZ A;  5BT1 A;  2XL8 A;  5A6A A;  1ZYR F;  3GM2 A;  3TQO A;  3QOU A;  4JB8 P;  4I43 A;  5EIL A;  4XLN F;  2WXI A;  3ASF A;  4FAD A;  3X1O A;  1MMG A;  4MS2 A;  1FT1 A;  3AQC A;  2DYS C;  4U8Y D;  1ORY A;  3DJU B;  1N9A A;  2HE0 A;  3ZYM A;  4BWR A;  1E8Z A;  1BR4 A;  2DGJ A;  5FZR A;  1Q0M A;  1APC A;  1TFK B;  5KNH D;  4AVX A;  2R7O A;  4ULV A;  3TGO A;  3EG9 A;  4DXW A;  2UWJ G;  4ABN A;  3FU3 A;  5ENS D;  2W9Y A;  2XL6 A;  4H7X A;  3ZIM A;  1OXB A;  2IXN A;  3TL5 A;  3KKB A;  2F0Y A;  3PE3 A;  3OA1 A;  3ZXS A;  3PUK A;  4G25 A;  4NY3 A;  3DXK G;  3FH8 A;  3HXB A;  1N0Q A;  2LNI A;  5B1B C;  4XTK A;  3MKQ A;  1Q0D A;  1YAR O;  1QNF A;  2Y3B A;  3G50 A;  4I6J A;  4HOR A;  3L1M A;  4K0D A;  5JS5 A;  3Q79 A;  2O9X A;  2MYO A;  4OD4 A;  3ML8 A;  4Q69 A;  4L23 A;  3C7J A;  4WNF A;  5AJD A;  4F3V A;  4B94 A;  2VC9 A;  3QZC A;  4URK A;  3ZHE A;  3GEH A;  4W9R A;  1TR4 A;  5KYU B;  3IV0 A;  1VYI A;  4HS2 A;  2YKZ A;  2PX0 A;  4MVU A;  1K1A A;  4B8A A;  3IXE A;  2CG3 A;  4AJW A;  1NP7 A;  3H65 A;  2QY9 A;  2C0L A;  3PE4 A;  3NQP A;  4JTA B;  4LCT A;  4KVO A;  3G2W A;  2KAT A;  4ZFH A;  3C98 A;  2FO7 A;  3RAU A;  4LRZ A;  4YDO A;  4JL0 A;  1OQC A;  2YLD A;  3N0T A;  2QNL A;  1K3Z D;  2YZS A;  4GTP A;  5LCW C;  2ZGG A;  3ZSU A;  4MBG A;  5T3R A;  3I5P A;  3MV3 B;  4EZL A;  3ZG1 A;  5COM A;  4TRQ A;  1CPR A;  4AIF A;  4YT4 A;  4YL1 A;  4BG0 A;  4HQD A;  4N4W A;  3B0U X;  2VGX B;  3CLJ A;  4YVQ C;  2KNH A;  4NAC A;  3SBT B;  2XEV A;  1W2W A;  3CQC B;  2IY0 C;  1BDJ B;  1N4S A;  3G4Z A;  1ZU4 A;  3DSS A;  5KJL A;  1T5O A;  1WOL A;  4U0S A;  2WZG A;  2R9R B;  3DZA A;  5DQZ A;  5JT4 A;  2XZT G;  2NUP A;  4ANU A;  5BQH A;  3I4U A;  1YA0 A;  3LY8 A;  2EIK E;  3ABL E;  4GTR A;  1ZHX A;  4YND A;  2PNN A;  2J49 A;  3C5R A;  4YDY A;  4DBQ A;  1MYO A;  3TWR A;  3C62 A;  3AG3 C;  3D9N A;  5FIO A;  4G7O F;  4GA0 A;  3B7T A;  2HM8 A;  1ZW2 A;  4O6N A;  3VRC A;  5CIV A;  3ESK A;  3HNL A;  2OND A;  3ONL A;  3WG7 E;  2OCC C;  1D8D A;  4CSA C;  4B93 B;  4E85 A;  4GMR A;  2P58 C;  4QDL A;  3UQ3 A;  4I9E A;  3E34 A;  3A9C A;  1O5H A;  4WAF A;  3CST A;  2HFI A;  1D9S A;  4GCN A;  4CX9 A;  3JCK C;  2KM4 A;  1A5E A;  3AGU A;  4GQH A;  2YLG A;  4PJL A;  4JVS A;  1OT8 A;  5CHE E;  4G24 A;  1WAT A;  3JUI A;  3JYH A;  2D5R B;  2WXR A;  2PX3 A;  1LI5 A;  1O1R A;  4O6F A;  3UT7 A;  4B6I A;  4EZK A;  1LPE A;  2VH3 A;  4CDN A;  1H9G A;  3ITF A;  1NL4 A;  4GZ6 A;  1UG3 A;  1M56 C;  3SFX A;  2XLW A;  3MCX A;  4C7O A;  3VLF A;  3CSK A;  5G05 J;  4H7Y A;  3F47 A;  3T5V A;  3N71 A;  1H19 A;  5L0I A;  1NLX A;  3TWV A;  1D1C A;  1U6H A;  3LS1 A;  2VSO E;  2WXJ A;  3NB2 A;  3Q73 A;  1TFO B;  3ULE G;  4U5G A;  1FMW A;  4BX8 A;  4JKV A;  3BU8 A;  2XSE A;  1M2V B;  2VB6 A;  4Y6W A;  4NTA A;  4HE8 D;  2J08 A;  3KAE A;  3D9M A;  4J8S A;  3TJ5 A;  3UMV A;  3DAG A;  3FHD A;  4CYM D;  2LIG A;  3GWL A;  3B7R L;  4MVM A;  4R32 A;  3CEQ A;  4J6I A;  4AXH A;  3IQ5 A;  1YVI A;  3V31 A;  2QZA A;  3S84 A;  4APO A;  1Q0K A;  1RCP A;  4E7S A;  2JX0 A;  1YZC A;  3IQ6 A;  1EA8 A;  1O87 A;  2WXF A;  3S0X A;  3C72 A;  1EPU A;  3CHS A;  1N95 A;  3U9M A;  2WXL A;  2XLE A;  3L6A A;  3ESL A;  2NG1 A;  4MND A;  4J8D A;  1Z63 A;  3NZS A;  2IO2 C;  2L0I A;  4JA9 A;  2I9C A;  1XNF A;  5A6B D;  1ST6 A;  4FWV A;  5KYX B;  4I44 A;  3LXU X;  2EPN A;  4EQF A;  4EWC A;  4NC3 A;  3ZW3 A;  1N54 A;  1M57 C;  2PQR A;  2KGO A;  4BEM J;  2CFU A;  2F22 A;  3DKA A;  3NOC D;  2QLA A;  3L22 A;  3Q4A B;  4OAV B;  5A6J A;  1ORJ A;  1SQM A;  3RQE A;  3RRU A;  3QJZ A;  1F1M A;  4JD2 G;  1OW7 A;  3CHQ A;  4JUR I;  4BET A;  4HOS A;  2R02 A;  1MMD A;  3FDQ A;  2J9B A;  1JCQ A;  3TOL A;  3O55 A;  4LUN U;  4NTB A;  4AV7 A;  2YQY A;  4K03 A;  2B0H A;  4WNG A;  1G8X A;  2WZF A;  2OCC E;  2L6J A;  4G78 A;  4OD5 A;  3KSL A;  3LVQ E;  5ARF A;  4QI0 A;  2BL2 A;  3S27 A;  4UI9 J;  4FHK A;  3QDN A;  1FPP A;  2AJA A;  2XZD G;  4GAA A;  1JUQ A;  3EGD A;  4I6E A;  4YJW A;  3LAY A;  2XPY A;  3S7B A;  2J4D A;  2GWW A;  2XHE A;  4AEZ C;  4EBK A;  5FQ6 A;  3TG5 A;  3QMK A;  3NF1 A;  1G4W R;  1W3B A;  4GEH A;  3FP3 A;  3IEG A;  2YHE A;  2XQ0 A;  3NMI A;  5JUA A;  2CHZ A;  1HZ4 A;  1NI1 A;  4G23 A;  3HXC A;  3K6B A;  1UFB A;  2NXP A;  4HOU A;  4XEK A;  1H2T C;  2LSU A;  1Z6A A;  3SF4 A;  1SZ9 A;  3HTK C;  2H6G A;  2W45 A;  5COF A;  4JHK A;  1WDY A;  4IAO A;  2HS5 A;  1ZB1 A;  3LPZ A;  3DWW A;  3ULY A;  5TJ5 E;  3CGH A;  3B0P A;  3OXF A;  3D9K A;  3G2T A;  5A23 A;  1IXV A;  4HFG A;  1D0X A;  1TQG A;  3HJC A;  1EQ1 A;  2OVB A;  3U3W A;  1AVO B;  4CGW A;  3U0C A;  4BT9 A;  1LF8 A;  1H2V C;  3OEO A;  1N11 A;  4LEU A;  4P9T A;  2LFD A;  4EUK B;  4U95 D;  4EHM A;  4TXP A;  2Z15 A;  2J8W A;  5L0J A;  4U5H A;  4Z68 A;  4NIK A;  2CDQ A;  3B95 A;  5BQI A;  2HJ3 A;  3CVV A;  2I1K A;  4PJM A;  4PAC A;  1OXK A;  4E0H A;  3ATP A;  3LJ3 A;  2IOS A;  2NYJ A;  3Q9U C;  1JRA A;  2JEK A;  1H6P A;  3EU5 A;  4F1P A;  1KU2 A;  4H54 A;  4YK5 A;  1T9K A;  3O10 A;  1FFT C;  4F7A A;  5IY5 C;  4GA1 A;  3AS4 A;  3L16 A;  1V55 C;  1N0R A;  2OOE A;  2YL7 A;  5J90 A;  4LDK A;  4P9F A;  4MQ9 F;  5C2Y A;  4I6G A;  2L81 A;  1Y6I A;  4G2V A;  4GCO A;  3VLE A;  3SEO A;  1K04 A;  1TNB A;  3SZ7 A;  4UDV A;  2AVP A;  1NU7 D;  2EPM X;  4D4X A;  3EPV A;  3DPD A;  1GW6 A;  5JSL A;  4AE4 A;  3QWP A;  1RMV A;  4PS7 A;  4EBA G;  1KZP A;  4ZLC A;  3APC A;  2XLH A;  2HJM A;  4KT6 B;  2OVF A;  3POV A;  1NU9 C;  3EHM A;  1V55 E;  4AY5 A;  2VTB B;  5L0C A;  256B A;  5AJL A;  2VGY A;  4DPR A;  2F8Y A;  4C48 B;  3HNI A;  2RG8 A;  2X6H A;  1NZN A;  2P9I G;  4GU5 A;  1MX4 A;  2J9V A;  3JT1 A;  2DZN A;  1D1B A;  1TNY A;  3U9J A;  1HMD A;  3IHU A;  3IQT A;  4L6R A;  4J8F A;  1KT0 A;  2X51 A;  1VB5 A;  2IXO A;  2H8A A;  3LKU A;  1D0Z A;  3MLG A;  1KZO A;  2AU5 A;  1FMV A;  3PH0 C;  4DJ9 A;  4L2Y A;  2J46 A;  2KCK A;  1M2V A;  2KQ9 A;  3PZ4 A;  3PZ1 A;  3AS8 A;  4MVO A;  3T6G B;  2LXM A;  4PR9 A;  1NG1 A;  3WOD F;  3AS5 A;  5FIN A;  3AJM A;  3RQF A;  5BUO A;  3KH2 A;  3UMI A;  2EPO A;  2HO1 A;  1H2U A;  1OW8 A;  3FXH A;  4HRM B;  2R7U A;  1BLX B;  2KJG A;  4GPK A;  1QYM A;  1TN6 A;  4CDR A;  1HE1 A;  2Y3H A;  4U07 A;  2CHX A;  4G7Z F;  2J0W A;  1KTM A;  5GPG B;  4OIO F;  4E6H A;  2XS1 A;  3CHP A;  2J8S D;  1NZE A;  2ICW G;  1Q0G A;  4EEC A;  3I3N A;  1IZM A;  2R5S A;  1HO8 A;  4EIY A;  2XLD A;  2GRR B;  2E0I A;  1CGO A;  4MW3 A;  3Q47 B;  4JRZ A;  3ZU7 B;  5CEA A;  3C8G B;  2XXA A;  3K1I A;  2WQH A;  3IQC A;  3CQG B;  5BUZ A;  3D9L A;  5A6K A;  1OCO E;  3P2B A;  1E8Y A;  1I4Z A;  2JD3 A;  3L13 A;  2MWQ A;  5CI8 A;  5BV1 A;  3L08 A;  5T3T A;  5HSW A;  3UX4 A;  5F28 E;  3FFL A;  5DVW A;  2GRM A;  3CHM A;  5A6B A;  1HH8 A;  3FTU A;  3RJV A;  3K7D A;  4MTF A;  1L7C A;  1MHQ A;  1DCE A;  3AG4 C;  5KJM A;  5BNW A;  4Q4Z F;  1KNY A;  4U04 A;  2LO6 A;  4XPY A;  2KXP C;  4K0R A;  4B89 A;  3QAQ A;  3FTV A;  3RYL A;  2W4B A;  1I5N A;  1HFA A;  3RSE G;  2I2O A;  1B68 A;  1MX2 A;  3GOD A;  1HXI A;  1TNO A;  1A0B A;  1Z5Z A;  2FFH A;  2QTV A;  2Q9B A;  2C04 A;  3EIJ A;  1OCR E;  3U4T A;  2L7A A;  3UMK A;  2KYH A;  4DX5 D;  3LY7 A;  4HEA J;  4IGG A;  5JRA A;  2WZL A;  3US6 A;  1PD1 A;  2WXM A;  1TN7 A;  4JIO A;  4K1O A;  4C9B B;  5HQ8 A;  4PUC A;  3DRA A;  4XKC A;  3G4X A;  5CCL A;  3TUL A;  2RFA A;  3O48 A;  3C3O A;  4HNA D;  2A1D D;  3PZD A;  4WUY A;  4AY6 A;  2GRN B;  3VM6 A;  4N06 A;  1S70 B;  1OWL A;  4FHJ A;  3RIB A;  3R9M A;  3RO2 A;  1VLT A;  2R7V A;  2ZXW E;  4C3B A;  2BKK B;  2OV8 A;  3NOG D;  3QC1 A;  2YIN A;  4JJF A;  5KNG A;  2UUH A;  4U5E E;  2VTB A;  4CEM A;  4DRH B;  2R7T A;  4CZ2 D;  3SXZ A;  3Q6N A;  3BQO A;  2WXQ A;  1JWG A;  3AU4 A;  4LDR A;  2P9U G;  3ZPJ A;  4WNE A;  1FTS A;  1TJF A;  1LKX A;  4J7Y A;  3SD5 A;  5G55 A;  2WXP A;  1N4Q A;  3MYI A;  4HBD A;  5KJN A;  4OVV A;  2A68 F;  3RU0 A;  2ZXO A;  5CCM A;  5COG A;  3EUV A;  3T6J A;  1U89 A;  3ZHE B;  4I17 A;  4IYP A;  2WXN A;  4BER A;  4LG6 A;  3UNG C;  3ZFW A;  5E3C A;  1YAU O;  3I5Q A;  2J9W A;  1OCC E;  2CHW A;  4N6C A;  3DSV A;  4EHP A;  2DCP A;  1YA7 O;  3O39 A;  3FUM A;  4KNW A;  2HV6 A;  3W2W A;  2KC3 A;  3UKR G;  5HS0 A;  1RKC A;  4QFV A;  5CBO A;  3TK0 A;  2V5Q C;  2XL4 A;  4U0Z A;  4CDM A;  4N3C A;  2CW0 F;  4XE0 A;  2TMV P;  3UPV A;  4M63 A;  1RJ9 A;  3U64 A;  1YDI A;  3AQB A;  1K40 A;  1JPL A;  4PDX A;  4XKB A;  4ANW A;  4EKW A;  4JE9 A;  3UGP A;  2B0O E;  4A4A A;  1FNT c;  1A7E A;  2X3M A;  5EX0 A;  3ZKJ A;  3HDX A;  2RKK A;  2V5F A;  1DOW A;  3MEK A;  4HLE A;  4PS3 A;  2ASR A;  5KWD A;  2C0M A;  3ASO C;  3IHV A;  2DWZ A;  4IJJ A;  1TR2 A;  1VYK A;  3JYY A;  3FOP A;  4I1M A;  4RVB A;  4N6H A;  3WG7 C;  3NDB B;  3MBG A;  3UTM A;  1TWH A;  1E85 A;  1BD8 A;  4DLQ A;  3FTX A;  1N4P A;  4OIQ F;  3SFZ A;  3CIA A;  4XPW A;  2IU1 A;  3EDT B;  1HMO A;  4XLP F;  3H2V A;  4DK5 A;  1U2V G;  3ABL C;  2DIW A;  3EHQ A;  4UWL A;  1Q0F A;  2EQX A;  2MOW A;  2EIL E;  4YDE A;  5JLI A;  4YL0 A;  3B7B A;  2YRF A;  3D3M A;  5L0D A;  4UWG A;  3LLK A;  2XLV A;  4KZ0 A;  3LUT B;  4XPX A;  4DX1 A;  1EF1 C;  4MW8 A;  2HSQ A;  2P0N A;  1U3D A;  4HI9 A;  4JC7 A;  4B0Z A;  1LS4 A;  3R9A B;  1V4A A;  2A5U A;  3KPH A;  2EIK C;  4AX2 A;  2YHC A;  3QB2 A;  2WMN A;  5EHH A;  5KBA A;  1ZHT A;  3NRH A;  2CFZ A;  5J08 A;  2DVW A;  2XGO A;  3ULQ A;  4LER A;  4BES A;  1OWO A;  4BSZ B;  4OIP F;  3PEV B;  3JCU Q;  4XX5 A;  1VMA A;  3FUF A;  4DOZ A;  1ZBP A;  2GW1 A;  2MYS A;  3KSQ A;  2QE9 A;  2NUT A;  3QNK A;  3E4B A;  1NA3 A;  4GYT A;  2R59 A;  3ASO E;  3MJW A;  4L7T A;  4N2Q A;  2J7P D;  2LFF A;  4AM9 A;  2DYR E;  4JXT A;  5CED B;  3NBN B;  2VQ2 A;  5AN8 A;  4GPM A;  4X0R A;  4N3B A;  1NA0 A;  3FTY A;  5F5F A;  3SZR A;  4XI0 A;  5H7P A;  1FFH A;  1OCZ C;  2QYU A;  5E33 A;  4LNG A;  4JA7 A;  3F6Q A;  1XWJ A;  3TWQ A;  4BJ6 C;  3DXJ F;  3SNH A;  3L54 A;  3TWX A;  1IHG A;  4GTV A;  1SA4 A;  1EYH A;  4U5D E;  4LDQ A;  3PVL A;  3TG4 A;  4EBA A;  1J8Y F;  2OU6 A;  2VSY A;  1E2X A;  3JYS A;  4BPM A;  3FU0 A;  1QBQ A;  1U3C A;  4CS7 A;  4ACK A;  3GEI A;  3LYA A;  4I1O B;  4CS9 A;  2MHR A;  4NTF A;  1MQS A;  1O1T A;  2IJG X;  1LD7 A;  1V74 B;  1ELK A;  2GRQ B;  2XRY A;  3ZXP A;  1SF8 A;  4DLO A;  1UOH A;  4Q7C A;  4CS9 C;  3SI5 A;  4RG6 A;  1WWP A;  3NG1 A;  1VTM P;  1H6O A;  3MA5 A;  3ZTZ A;  4N5Q A;  5KYY A;  3KD7 A;  3UIO C;  3H2U A;  5B1B E;  2Y4U A;  3OAW A;  3K1H A;  2V8S E;  4GTQ A;  3U8V A;  1MND A;  5ENP D;  3HHM A;  4DRX E;  1OY3 D;  4MVR A;  3ABM E;  3PNT B;  1A7V A;  5ARG A;  4Z9J A;  2AW6 A;  4QI2 A;  1IYG A;  1ZZP A;  2EIM C;  3FH7 A;  2CYD A;  3AG1 E;  4P6I C;  5JHB A;  2XEE A;  5F5H A;  3N2Z B;  4YT5 A;  1MJ0 A;  1PV3 A;  4HI8 A;  4A55 A;  4JEB A;  1M2O A;  4KYO B;  3L8J A;  5E75 A;  4M7C A;  2Q00 A;  4CS8 A;  2EIJ C;  1E96 B;  2VGE A;  3ASN E;  3IBE A;  5A69 A;  2M4E A;  5ENQ D;  1X5B A;  4BJ5 C;  5B1A C;  1T6I A;  4K5A B;  1JAF A;  3CV0 A;  3Q5M A;  1HG2 A;  4KC9 A;  4JZA A;  2BED A;  1S63 A;  3CAX A;  2XXA B;  3K66 A;  1R5I D;  3PNL B;  1Z6T A;  4LNB A;  3CVX A;  1WN0 A;  4HFK B;  2F37 A;  5ITZ F;  1N4R A;  1ZU5 A;  1PC2 A;  4FA6 A;  1ZW3 A;  2QC9 A;  4U5F E;  5EKQ D;  4J7T A;  1GGQ A;  4WJ0 A;  1P5Q A;  3CVL A;  2GFH A;  3QTH A;  3DM5 A;  3G2V A;  3JXI A;  2A0B A;  1HU3 A;  3T8M A;  2IOQ A;  5LOZ A;  5JHA A;  1HE9 A;  2EIJ E;  3S7J A;  4RD9 A;  4MKT A;  3LNM B;  3U8P A;  1Z3X A;  2Q4F A;  4O79 A;  2VGX A;  3B9Q A;  3LY9 A;  3LEV A;  4IN3 B;  2IM8 A;  2J07 A;  4KMO A;  3UM3 A;  2EIM E;  3UKU G;  1SW6 A;  5DBK A;  4CGV A;  4NUR A;  3W9G A;  5BQG A;  5B3S C;  2CGE A;  2V4L A;  3Q7L A;  5L3V A;  1MZC A;  1T01 A;  4GTO A;  5EID A;  1YYJ A;  3R7C A;  2YVK A;  3Q78 A;  1D0Y A;  4A2N B;  3OTN A;  4JEU A;  5AC4 A;  5G04 C;  3G2S A;  2YL3 A;  1FVH A;  2WXG A;  1AEP A;  2BF0 X;  3ASN C;  2PM6 A;  3FY4 A;  2EIN E;  4KNV A;  3DE9 A;  3G2U A;  2OJQ A;  5AAR A;  1VDY A;  2OKU A;  1OW6 A;  4RSY A;  5ENN A;  3AG1 C;  1E86 A;  4YWQ A;  3CKB A;  3ZRH A;  3TWT A;  5DS6 A;  2ETS A;  2KZT A;  3VAY A;  4AP2 A;  2X6F A;  1WM5 A;  3GZS A;  5BXU A;  2XLM A;  1E7U A;  4X8Q A;  2AVK A;  4YT8 A;  5EK0 A;  3ABM C;  3RRN B;  3W8I A; 
#chains in the Genus database with same CATH homology
 3FUJ A;  3PHF 2;  5KYY B;  1TJC A;  5LX8 A;  2XCB A;  4UWH A;  3FEY A;  1XGW A;  5JJ7 A;  2VSX E;  4FUL A;  4BT8 A;  4RBN A;  5FTP A;  4LLE A;  4APF A;  4F1S A;  4HOT A;  2PZI A;  2J7P A;  4IUL A;  4GYW A;  3FUH A;  3MYV A;  3KMI A;  5L3Q A;  1ZU2 A;  2WVO A;  3ECS A;  3ZC4 A;  1ELW A;  1TWG A;  2WXH A;  3OXG A;  3SHF A;  1E8W A;  3FTW A;  4ME2 A;  5FZS A;  4KBQ A;  2X6J A;  4WWP A;  4H4K C;  2WB7 A;  4JPS A;  2H7O A;  3O6X A;  2AXU A;  3CK7 A;  2VYI A;  3VTX A;  4AOF A;  1B89 A;  5D92 A;  3D9P A;  2FBN A;  5FCL A;  4GML A;  3RO3 A;  2J4B A;  3MZL B;  1J8M F;  4I2W A;  5A6C A;  3X2Q C;  2DYR C;  2FI7 A;  1LS1 A;  3NYM A;  3Q15 A;  3TAX A;  3URZ A;  3Q49 B;  4A1G A;  2CNW D;  1E7V A;  4BJT A;  4UI9 C;  5CMW A;  4ATG A;  3ML9 A;  1BPO A;  2IOL A;  2AWI A;  3S2A A;  2ION A;  1IQU A;  3ZGQ A;  4BEJ A;  3KL4 A;  1WY6 A;  4FLB A;  2CG2 A;  3FVY A;  4U5B E;  2R7Q A;  3IHY A;  3EZH A;  4PS8 A;  2V0P A;  1SZA A;  3U9W A;  4PH4 B;  5E2Q A;  2BUG A;  4FX5 A;  2EIL C;  4BFR A;  3S28 A;  3FWV A;  3CVP A;  3I4G A;  3DMD A;  2WM9 A;  4JJG A;  3FTZ A;  4PJN A;  4W8K A;  1V54 C;  4O7G A;  4C7O B;  1MNE A;  4CIH A;  4N39 A;  1UN9 A;  2J0X A;  2NC9 A;  3MKR A;  1OWN A;  1BR2 A;  4JZY A;  1QLE C;  4D10 C;  4F53 A;  3R7R A;  2IF4 A;  3QAR A;  5T3W A;  4WND A;  3JSZ A;  5KYW A;  1OWP A;  2WMO A;  5FJY A;  1SMY F;  4ULW A;  4R7L A;  4ACL A;  4DVZ A;  1TWC A;  2J9U A;  2WPV A;  5CI9 A;  4BTA A;  1OCC C;  3SP1 A;  4BJ6 A;  3JQ0 A;  3CVY A;  5ANL A;  4IRU A;  3VTY A;  2R7R A;  3UGO A;  2Y4T A;  3D9O A;  4UWF A;  4CCA A;  5D91 A;  3QKY A;  2L9B A;  2A69 F;  2FGY A;  5FT9 A;  2L0T B;  1EDU A;  4A3T A;  3DM9 B;  4ANV A;  4DI3 A;  3QK0 A;  3MX3 A;  5DS4 A;  2WQ7 A;  3NYL A;  2I1J A;  4I1A A;  1JPN A;  5DQT A;  1HG5 A;  3UMH A;  3D9J A;  3HVE B;  1PAQ A;  2WXO A;  3FDH A;  1A17 A;  4HVB A;  5FQ8 A;  2H7B A;  4YN0 B;  3FU6 A;  2YQ8 A;  4N5C A;  3KEZ A;  4G1T A;  3S7D A;  2WQ6 A;  2M63 A;  4C0M A;  4BJ5 A;  3LS8 A;  2A6H F;  3LES A;  1TEZ A;  4CRW A;  2J09 A;  3TD7 A;  1N52 A;  3ZVV A;  3BG0 B;  4LAC B;  4F4B A;  5DS5 A;  4KZC A;  3FUE A;  2KCL A;  2G3V A;  3APD A;  1OKK A;  4FES A;  4UQZ A;  1OCO C;  2IYL D;  2XRH A;  1UW4 B;  4Q94 A;  2A4Z A;  3TXM A;  4WWN A;  2P6V A;  2LAH A;  2G3K A;  3TXN A;  4L2L A;  4A1S A;  5M72 A;  4U5C E;  2KCV A;  2ILR A;  1LVK A;  4ILG A;  5ANR A;  3FAJ A;  4FU3 A;  4N2S A;  3CK9 A;  4CT4 A;  2ZPA A;  3IEE A;  4PFO A;  3PMR A;  4PFP A;  2VAS A;  5E3A A;  2X6K A;  3RH3 A;  2P7V A;  4J8E A;  2QFC A;  3E70 C;  3K9I A;  4ILH B;  5BPP A;  2XCC A;  5A7D B;  2AXV A;  2X38 A;  2LAI A;  1QZ2 A;  4OVU A;  1Z23 A;  1ELR A;  3GW4 A;  1Z3I X;  2C2L A;  2GRL A;  2R17 C;  3NYJ A;  2WVN A;  3K33 A;  3VYW A;  3AG2 C;  4G26 A;  3EZI A;  3FUN A;  4C0E A;  2PF4 E;  3HIZ A;  3ENE A;  3ASH A;  1UN8 A;  2NSZ A;  2YEV A;  4GB9 A;  3ZYL A;  1FVF A;  2HV7 A;  2V26 A;  1HE8 A;  1H0A A;  3P1U A;  1E8X A;  5KYU A;  4EZJ A;  2CNW A;  2JLB A;  1OUV A;  3EIQ C;  2LSE A;  1TWA A;  3CZ6 A;  5G05 C;  2KC7 A;  4FJZ A;  3JRT A;  2YHS A;  3NKD A;  4GZD A;  4J32 B;  3PRZ A;  4I3M A;  3BG1 B;  3PRE A;  4AE4 B;  4BY6 A;  2UY1 A;  2H7V C;  3UUX A;  3UT4 A;  4EBB A;  4NRH B;  3DBS A;  4I2Z A;  4U0U A;  1E90 A;  2XGM A;  4LLC A;  3CVN A;  5D0Q D;  4C3D A;  4YVO A;  1ZHW A;  4UQY A;  1H6K A;  3CK8 A;  4XIF A;  4FC8 A;  4UQX A;  4BSX A;  3W8H A;  3ZIB A;  2VJ8 A;  5LCW J;  3ZVR A;  2XGS A;  3LNR A;  1JWF A;  3PEU B;  3RRM B;  4V3I A;  3U66 A;  4JHR A;  3GZ2 A;  3MV2 B;  4M3O A;  4MRU A;  1IW7 F;  4OYS A;  4EPZ A;  4KI2 A;  1FCH A;  3Q6M A;  2FUL A;  4FJY A;  5C1D A;  2V3C C;  3ABK C;  2YNQ A;  5CMY A;  4K7B A;  3ZYK A;  5G2N A;  4Q5S F;  3DD7 A;  4P29 A;  5KCM A;  4CT0 A;  3CSF A;  3W2V A;  5AEN A;  3WXX A;  3FU5 A;  5G04 J;  5FQ7 A;  3R7Q A;  5T1D B;  3RKV A;  3T5X A;  3CKC A;  3LVR E;  1OWM A;  1OKK D;  2HYZ A;  2WB2 A;  5EX3 A;  1JPJ A;  1UJK A;  2X6I A;  3D9I A;  1VK5 A;  5DLJ A;  3FUK A;  1RJ9 B;  2IQC A;  2QY7 A;  4RDA A;  3T6B A;  3RKO F;  2B0J A;  4PJJ A;  2WXK A;  4Y6C A;  3CVW A;  3B7S A;  5FQ4 A;  1UJJ A;  2OG2 A;  2VSN A;  1ZHZ A;  2IFU A;  3CR3 A;  3MKQ B;  4MLP A;  5KJK A;  2R7S A;  3DJN B;  4RG9 A;  3SYN A;  5T4Y A;  2I6H A;  4O6Y A;  1QQE A;  3EJN A;  1Y8M A;  3HVE A;  4YT2 A;  3CQZ A;  5D0O D;  2L9J A;  4ANJ A;  2ZXW C;  3RK6 A;  5HI7 A;  4DVY P;  5AIJ A;  2XPI A;  2Y3G A;  4MS6 A;  1HF8 A;  2W4M A;  4JCH A;  3PS6 A;  4J30 B;  3APF A;  4CBE A;  3GAN A;  3S7F A;  3TJP A;  3FUI A;  4IWB A;  2IXP A;  4BX9 A;  2A6E F;  5E76 A;  2E87 A;  4HXI A;  2Y69 C;  3ASG A;  3L34 A;  4TUU A;  3MGB A;  3EH2 A;  3Q7G A;  3EGX A;  5EDS A;  5FZQ A;  5JJT A;  3FEX A;  3DAF A;  3RFY A;  4G0H A;  4PK4 A;  4KXK B;  4JHJ A;  3LDZ A;  2NUT B;  4FLH A;  2PL2 A;  3ZYQ A;  2IXM A;  5EGY A;  2R7W A;  4GYO A;  3QWV A;  3HYM B;  3V7O A;  2Y3D A;  1KLX A;  1QZX A;  3AU5 A;  3OXL A;  3FHE A;  1IQR A;  1D1A A;  2PP4 A;  3BEE A;  2HR2 A;  3CVQ A;  3I4R B;  2ZU6 B;  4N3A A;  4DI4 A;  2Q3T A;  4JEH A;  4JC8 A;  3NZU A;  3ASD A;  4E7Z A;  1SZI A;  2DBA A;  3JQ1 A;  4U8H A;  3UT8 A;  1S7Z A;  3UR3 C;  4BJ1 A;  3SBS A;  2I8B A;  4GA2 A;  3K1I C;  2C03 A;  1PCX A;  2NUP B;  4J0U A;  3B7U X;  3EFO B;  5KYW B;  3LEW A;  4XWJ A;  5KYN A;  3EQL F;  3FH5 A;  4A3V A;  3CVU A;  1MMA A;  4GZ3 A;  2GGF A;  4KBL A;  4GZ5 A;  1DNP A;  2RD0 A;  3PUJ A;  1BR1 A;  3SNX A;  2R7X A;  4ZLD A;  2FF4 A;  3IKO B;  1Z3Y A;  3CHO A;  1L5J A;  4AK9 A;  3EGX B;  2G62 A;  3KS2 A;  2FEZ A;  1PD0 A;  2J45 A;  4B8C B;  2BTD A;  5LFA A;  2Y39 A;  3L17 A;  2LSV A;  2E2E A;  4JW1 A;  4GYY A;  3CHR A;  1PY1 A;  1INZ A;  2Q7F A;  1VOM A;  2ZXP A;  3HLZ A;  5JJ6 A;  5FWQ A;  3ONK A;  3L0I A;  2MHK A;  3NKE A;  1HS6 A;  4U63 A;  4TV3 A;  3F46 A;  3E9V A;  2KW3 C;  4DJA A;  3RIP A;  4L1B A;  4CSA A;  3LS0 A;  5KYX A;  2XRZ A;  3LLI A;  2J9Q A;  2AXZ A;  1DVP A;  2UY1 B;  4GMJ A;  1HX8 A;  3FTS A;  2ZXR A;  4CS8 C;  2MRI A;  2WVQ A;  1WAO 1;  5DIZ A;  1N1C A;  2WL8 A;  3SGH A;  2PM7 A;  2PFD A;  4UWK A;  4BTB A;  3PDN A;  1KT1 A;  4GZC A;  3N24 A;  3FUL A;  3FUD A;  3EFO A;  2EIN C;  3LCA A;  5AYW D;  1MMN A;  1OCR C;  3EG9 B;  2WVI A;  4G7H F;  4G11 A;  2PQN A;  3ZN3 A;  3LJB A;  1S0P A;  4ANX A;  5BV0 A;  2Y3A A;  1ZHY A;  3T4R A;  3S29 A;  5BW8 C;  3O4Z A;  3OWT A;  2Q9A A;  4O6M A;  5T8I A;  4HFF B;  4WWO A;  3EHN A;  4I9C A;  4OIR F;  1WGW A;  3QWW A;  2BE5 F;  3VLD A;  3ZEF A;  4OIN F;  2XPZ A;  4UI9 K;  4XI9 A;  4DBR A;  4KVM A;  4FP7 A;  3GZ1 A;  5LP0 A;  1TKN A;  3B13 A;  4Q96 A;  3EH1 A;  3EGD B;  4C3E A;  4XZ4 A;  3M1C B;  2Q9C A;  4HOQ A;  4NQ0 A;  3B0V C;  4ILI A;  2KZT B;  3GYZ A;  5BT1 A;  1ZYR F;  3QOU A;  4I43 A;  4XLN F;  2WXI A;  3ASF A;  4FAD A;  3X1O A;  1MMG A;  3AQC A;  2DYS C;  3DJU B;  3ZYM A;  4BWR A;  1E8Z A;  1BR4 A;  2DGJ A;  5FZR A;  4AVX A;  2R7O A;  3TGO A;  3EG9 A;  2UWJ G;  4ABN A;  3FU3 A;  2W9Y A;  4H7X A;  3ZIM A;  2IXN A;  3TL5 A;  3KKB A;  3PE3 A;  3OA1 A;  3ZXS A;  3PUK A;  4G25 A;  4NY3 A;  3FH8 A;  2LNI A;  5B1B C;  4XTK A;  3MKQ A;  1QNF A;  2Y3B A;  4I6J A;  4HOR A;  4K0D A;  2O9X A;  4OD4 A;  3ML8 A;  4Q69 A;  4L23 A;  4WNF A;  5AJD A;  4F3V A;  4B94 A;  3QZC A;  4URK A;  3ZHE A;  4W9R A;  5KYU B;  3IV0 A;  1VYI A;  4HS2 A;  2PX0 A;  4B8A A;  2CG3 A;  4AJW A;  1NP7 A;  3H65 A;  2QY9 A;  2C0L A;  3PE4 A;  3NQP A;  4LCT A;  4KVO A;  3G2W A;  2KAT A;  3C98 A;  2FO7 A;  4LRZ A;  4JL0 A;  3N0T A;  2YZS A;  5LCW C;  5T3R A;  3ZSU A;  3I5P A;  3MV3 B;  4EZL A;  3ZG1 A;  4TRQ A;  4AIF A;  4YT4 A;  4BG0 A;  3B0U X;  2VGX B;  3CLJ A;  4YVQ C;  2KNH A;  4NAC A;  3SBT B;  2XEV A;  1W2W A;  3CQC B;  1ZU4 A;  5KJL A;  4U0S A;  2WZG A;  3DZA A;  5DQZ A;  2NUP A;  4ANU A;  3I4U A;  1YA0 A;  3LY8 A;  1ZHX A;  4YND A;  2J49 A;  4DBQ A;  3D9N A;  3AG3 C;  4G7O F;  4GA0 A;  3B7T A;  2HM8 A;  4O6N A;  3ESK A;  2OND A;  3ONL A;  2OCC C;  4CSA C;  4E85 A;  2P58 C;  4QDL A;  3UQ3 A;  4I9E A;  1O5H A;  4WAF A;  3CST A;  4GCN A;  3JCK C;  2KM4 A;  4PJL A;  4JVS A;  5CHE E;  4G24 A;  3JUI A;  3JYH A;  2D5R B;  2WXR A;  2PX3 A;  4O6F A;  3UT7 A;  4B6I A;  4EZK A;  2VH3 A;  4CDN A;  3ITF A;  4GZ6 A;  1UG3 A;  1M56 C;  3MCX A;  4C7O A;  3VLF A;  3CSK A;  5G05 J;  4H7Y A;  3F47 A;  3T5V A;  3N71 A;  1H19 A;  1D1C A;  2WXJ A;  3LS1 A;  2VSO E;  4U5G A;  1FMW A;  4BX8 A;  2XSE A;  1M2V B;  2VB6 A;  4Y6W A;  4HE8 D;  2J08 A;  3KAE A;  3D9M A;  4J8S A;  3UMV A;  3DAG A;  3FHD A;  3B7R L;  3CEQ A;  4J6I A;  4AXH A;  4APO A;  4E7S A;  1O87 A;  2WXF A;  3S0X A;  1EPU A;  3CHS A;  2WXL A;  3L6A A;  3ESL A;  2NG1 A;  4MND A;  4J8D A;  1Z63 A;  3NZS A;  2L0I A;  4JA9 A;  2I9C A;  1XNF A;  1ST6 A;  4FWV A;  5KYX B;  4I44 A;  3LXU X;  4EQF A;  4EWC A;  3ZW3 A;  1N54 A;  1M57 C;  2PQR A;  2KGO A;  2CFU A;  3L22 A;  3Q4A B;  1SQM A;  3RRU A;  3QJZ A;  3CHQ A;  4JUR I;  4HOS A;  1MMD A;  3FDQ A;  4LUN U;  4AV7 A;  4K03 A;  4WNG A;  1G8X A;  2WZF A;  2L6J A;  4OD5 A;  3LVQ E;  5ARF A;  4QI0 A;  3S27 A;  4UI9 J;  4FHK A;  3QDN A;  4GAA A;  1JUQ A;  3EGD A;  4I6E A;  4YJW A;  3LAY A;  2XPY A;  3S7B A;  2J4D A;  2XHE A;  4AEZ C;  5FQ6 A;  3TG5 A;  3QMK A;  3NF1 A;  4GEH A;  1W3B A;  3FP3 A;  3IEG A;  2YHE A;  2XQ0 A;  2CHZ A;  1HZ4 A;  4G23 A;  3K6B A;  2NXP A;  4HOU A;  1H2T C;  2LSU A;  1Z6A A;  3SF4 A;  1SZ9 A;  3HTK C;  2W45 A;  4JHK A;  4IAO A;  3LPZ A;  3CGH A;  3B0P A;  3OXF A;  3D9K A;  3G2T A;  5A23 A;  4HFG A;  1D0X A;  3HJC A;  2OVB A;  3U3W A;  4CGW A;  4BT9 A;  3OEO A;  1H2V C;  1LF8 A;  4LEU A;  2Z15 A;  4U5H A;  2CDQ A;  3CVV A;  2I1K A;  4PJM A;  3LJ3 A;  2IOS A;  2JEK A;  1KU2 A;  1FFT C;  4F7A A;  5IY5 C;  4GA1 A;  3AS4 A;  3L16 A;  1V55 C;  2OOE A;  5J90 A;  5C2Y A;  4MQ9 F;  4I6G A;  2L81 A;  1Y6I A;  4G2V A;  4GCO A;  3VLE A;  3SEO A;  3SZ7 A;  1NU7 D;  2AVP A;  3EPV A;  3DPD A;  3QWP A;  4AE4 A;  1GW6 A;  4PS7 A;  4EBA G;  4ZLC A;  3APC A;  4KT6 B;  2OVF A;  3POV A;  1NU9 C;  3EHM A;  4AY5 A;  2VTB B;  5AJL A;  2VGY A;  4DPR A;  2RG8 A;  2X6H A;  1NZN A;  4GU5 A;  2J9V A;  3JT1 A;  1D1B A;  4J8F A;  1KT0 A;  2X51 A;  2IXO A;  3LKU A;  1D0Z A;  3MLG A;  1FMV A;  3PH0 C;  4L2Y A;  2J46 A;  2KCK A;  1M2V A;  2KQ9 A;  3AS8 A;  1NG1 A;  3WOD F;  3AS5 A;  5BUO A;  3KH2 A;  3UMI A;  2HO1 A;  1H2U A;  4GPK A;  2R7U A;  2KJG A;  4CDR A;  2Y3H A;  4U07 A;  2CHX A;  4G7Z F;  2J0W A;  4OIO F;  4E6H A;  3CHP A;  1NZE A;  4EEC A;  3I3N A;  1IZM A;  2R5S A;  1HO8 A;  2E0I A;  3Q47 B;  2XXA A;  2WQH A;  3CQG B;  5BUZ A;  3D9L A;  3P2B A;  1E8Y A;  3L13 A;  2JD3 A;  2MWQ A;  5CI8 A;  5BV1 A;  3L08 A;  5T3T A;  5HSW A;  3UX4 A;  3FFL A;  5DVW A;  2GRM A;  3CHM A;  3FTU A;  1HH8 A;  3RJV A;  3K7D A;  1MHQ A;  3AG4 C;  5KJM A;  5BNW A;  4Q4Z F;  4U04 A;  2LO6 A;  4K0R A;  4B89 A;  3QAQ A;  3FTV A;  3RYL A;  2W4B A;  1HFA A;  2I2O A;  3GOD A;  1HXI A;  1Z5Z A;  2FFH A;  2QTV A;  2Q9B A;  2C04 A;  3EIJ A;  3U4T A;  3UMK A;  3LY7 A;  4HEA J;  2WZL A;  1PD1 A;  2WXM A;  4C9B B;  5HQ8 A;  4PUC A;  4XKC A;  5CCL A;  3O48 A;  2A1D D;  3PZD A;  4WUY A;  4AY6 A;  4N06 A;  1OWL A;  4FHJ A;  3RIB A;  3RO2 A;  2R7V A;  4C3B A;  2OV8 A;  3QC1 A;  2YIN A;  4JJF A;  4U5E E;  2VTB A;  4CEM A;  2R7T A;  3Q6N A;  2WXQ A;  1JWG A;  3AU4 A;  3ZPJ A;  4WNE A;  1FTS A;  1TJF A;  1LKX A;  3SD5 A;  5G55 A;  2WXP A;  5KJN A;  4OVV A;  2A68 F;  3RU0 A;  2ZXO A;  5CCM A;  3T6J A;  3ZHE B;  4I17 A;  4IYP A;  2WXN A;  3UNG C;  3ZFW A;  5E3C A;  3I5Q A;  2J9W A;  2CHW A;  2DCP A;  3O39 A;  3FUM A;  4KNW A;  2HV6 A;  3W2W A;  4QFV A;  4U0Z A;  4CDM A;  2XL4 A;  4N3C A;  2CW0 F;  4XE0 A;  3UPV A;  4M63 A;  1RJ9 A;  3U64 A;  3AQB A;  1JPL A;  4ANW A;  4PDX A;  4XKB A;  3UGP A;  2X3M A;  5EX0 A;  3HDX A;  2V5F A;  3MEK A;  4HLE A;  4PS3 A;  2C0M A;  3ASO C;  3IHV A;  4IJJ A;  1TR2 A;  1VYK A;  4I1M A;  4RVB A;  3WG7 C;  3NDB B;  1TWH A;  4DLQ A;  3FTX A;  4OIQ F;  3SFZ A;  3CIA A;  2IU1 A;  3EDT B;  4XLP F;  4DK5 A;  3ABL C;  2DIW A;  4UWL A;  2EQX A;  2MOW A;  3D3M A;  4UWG A;  3LLK A;  4KZ0 A;  1EF1 C;  1U3D A;  4B0Z A;  3R9A B;  2A5U A;  2YHC A;  2EIK C;  4AX2 A;  3QB2 A;  2WMN A;  5EHH A;  1ZHT A;  3NRH A;  2CFZ A;  5J08 A;  2XGO A;  3ULQ A;  4LER A;  1OWO A;  4OIP F;  3PEV B;  3JCU Q;  4XX5 A;  1VMA A;  3FUF A;  4DOZ A;  1ZBP A;  2GW1 A;  2MYS A;  2NUT A;  3QNK A;  3E4B A;  1NA3 A;  4GYT A;  2R59 A;  3MJW A;  4L7T A;  4N2Q A;  2J7P D;  4AM9 A;  4JXT A;  2VQ2 A;  4X0R A;  4N3B A;  1NA0 A;  3FTY A;  5F5F A;  3SZR A;  4XI0 A;  1FFH A;  1OCZ C;  5E33 A;  4JA7 A;  4BJ6 C;  3DXJ F;  3SNH A;  3L54 A;  1IHG A;  1EYH A;  4U5D E;  3PVL A;  3TG4 A;  4EBA A;  1J8Y F;  2VSY A;  3JYS A;  3FU0 A;  1U3C A;  4CS7 A;  4ACK A;  3LYA A;  4I1O B;  4CS9 A;  1MQS A;  2IJG X;  1ELK A;  2XRY A;  4DLO A;  1SF8 A;  4Q7C A;  4CS9 C;  3SI5 A;  4RG6 A;  3NG1 A;  3MA5 A;  5KYY A;  3KD7 A;  2Y4U A;  3OAW A;  3K1H A;  2V8S E;  1MND A;  3HHM A;  3PNT B;  5ARG A;  2AW6 A;  4QI2 A;  1IYG A;  2EIM C;  3FH7 A;  4P6I C;  5JHB A;  5F5H A;  3N2Z B;  4YT5 A;  4A55 A;  1M2O A;  4KYO B;  5E75 A;  4CS8 A;  1E96 B;  2EIJ C;  3IBE A;  2M4E A;  1X5B A;  4BJ5 C;  5B1A C;  3CV0 A;  3Q5M A;  1HG2 A;  4KC9 A;  4JZA A;  2XXA B;  3K66 A;  3PNL B;  1Z6T A;  3CVX A;  4HFK B;  1ZU5 A;  1PC2 A;  4FA6 A;  4U5F E;  5EKQ D;  4WJ0 A;  1P5Q A;  3CVL A;  2GFH A;  3DM5 A;  3G2V A;  3T8M A;  1HU3 A;  2IOQ A;  5LOZ A;  5JHA A;  3S7J A;  4RD9 A;  4MKT A;  1Z3X A;  4O79 A;  2VGX A;  3B9Q A;  3LY9 A;  3LEV A;  4IN3 B;  2J07 A;  4KMO A;  5DBK A;  4CGV A;  4NUR A;  5B3S C;  2CGE A;  2V4L A;  3Q7L A;  5L3V A;  1D0Y A;  4A2N B;  3OTN A;  4JEU A;  5G04 C;  3G2S A;  2WXG A;  1FVH A;  2BF0 X;  3ASN C;  3FY4 A;  2PM6 A;  4KNV A;  3G2U A;  1VDY A;  5ENN A;  4RSY A;  3AG1 C;  3CKB A;  4YWQ A;  3ZRH A;  5DS6 A;  2KZT A;  3VAY A;  4AP2 A;  2X6F A;  1WM5 A;  3GZS A;  1E7U A;  4YT8 A;  3ABM C;  3RRN B;  3W8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...