3I5PA

Nup170(aa979-1502), s.cerevisiae
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
503
structure length
449
Chain Sequence
DILGFRAIEHLRRAKEIYDSLNYHLKNATAIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLENDDRKQYYDKRILVYDLVFDTLIKVDLRQKSYEAALKYNDRLFHYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGKISNILWVYYSRRSKFFESAEILYRLATSNFDITLFERIEFLSRANGFCQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQDSEFIFPIFELFPIVCNFFYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSDNSVFNKEMTWLIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nucleoporin NUP170
publication title Architectural nucleoporins Nup157/170 and Nup133 are structurally related and descend from a second ancestral element.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 145
structure length 449
sequence length 503
ec nomenclature
pdb deposition date 2009-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1880 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3i5pA03
1.25.40.440 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3i5pA02
1.25.40.450 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3i5pA01
3I5PA
chains in the Genus database with same CATH superfamily
3GM1A 3NYLA 3ML9A 4LLCA 3FUDA 1BR2A 1D1CA 3S9OA 2J07A 1LVKA 3ZTMA 3PVLA 4BEPA 1PD0A 3DSVA 4XLNF 2BF0X 5D2MC 3QVZA 2PQRA 1EI7A 1YA9A 4BEJA 2ZISA 3Q4AB 3ZXSA 5DLJA 1L7CA 3EH2A 5CI8A 1OT8A 4ILGA 2I1KA 2UUHA 4U8YD 1A5EA 4YL0A 3PNTB 3PCVA 3ZHEB 5FINA 1JPJA 2H7BA 1TN8A 4Q96A 3VAYA 4HI8A 4ER9A 1KZPA 2RD0A 3FTYA 3FUJA 3TJ5A 3RJVA 5CCMA 3EGDA 3ZXPA 5JHBA 5D66A 4HQDA 4Y6CA 3CVYA 3C3RA 3PZ2A 4OIPF 5KYXA 4LNGA 5M72A 4HOTA 4G11A 2XEEA 1H7IA 3PZ1A 4X8QA 4MS6A 3RK6A 3TG4A 3LVRE 5AAOA 3K1IA 2YLDA 5COGA 5DQZA 4HI9A 2P9KG 3QDNA 5AARA 4XI9A 1NLXA 4FAPB 3LJNA 1O1RA 3WHNA 3NDBB 2GWWA 3E37A 2HZ8A 4U63A 3W9FA 4JHRA 1E83A 5KYXB 1H19A 1E2XA 4JIOA 3BG1B 2I15A 4UDVA 4CDAA 5EGYA 1LD7A 2RSEB 3ZGQA 2ZGDA 4KC9A 1TN6A 3IBEA 2A5UA 1Q0DA 4FWVA 3IQ5A 3NMKA 3ABME 4JURI 4HOQA 3ONKA 1NBBA 3W4YA 4J8EA 4ZHBA 3LLKA 4Q69A 2LAHA 4ULVA 2BEDA 5CHEE 3LYAA 4E18A 1HH8A 3P1UA 1FFHA 1OCRE 2ZPAA 1H0AA 1QVXA 4AXHA 1XZPA 1KT0A 4AY5A 2FFHA 2OOCA 1B89A 2XPYA 5DS4A 4P9TA 4EBKA 4HLEA 4U5CE 1PD1A 1M57C 2EPKX 2XXAB 1SA5A 5BXOA 4TUUA 3SP1A 5KJNA 4A1GA 2XM4A 1VK5A 3F47A 3M1CB 1HW1A 4N3BA 3E70C 3HJCA 2NPUA 4GZDA 4IAOA 1YJGA 3ZVVA 5EX3A 3MYFA 5D0QD 3HXFA 4PDXA 2ILRA 5DBKA 2KSFA 1HE1A 1LD8A 2LNIA 2J9UA 2J0WA 2IY0C 4MRUA 3NMJA 3Q6MA 3ZDLA 3DSXA 3EG9B 1TR2A 4O6MA 4DLOA 4MKTA 4JEAA 3D9IA 1N0RA 3CHQA 3T8KA 1Z5ZA 4E7ZA 2MHRA 4N5CA 4M63A 3GWNA 3ABMC 2P61A 2GRMA 1EDUA 5AQ9A 4ANJA 5LFAA 3Q75A 3UMKA 1UFBA 2FF4A 4GPMA 5A6AA 2HE0A 4OAVB 4HEAJ 1PC2A 1HFAA 2HFIA 2XL8A 4ZLDA 3DPYA 3OXFA 2XPZA 1MHQA 2GROB 3P2BA 1T6QA 1OWNA 3ASDA 3BUAA 2WXOA 1TFKB 4RVBA 2RG8A 1WM5A 3B13A 4PS3A 3IHYA 2KQ9A 3LDZA 4J8DA 3SI5A 3C3OA 4YL1A 2GRLA 2BUGA 4LEUA 5T3RA 1UJJA 1ELRA 2UY1B 5BQHA 3UM0A 2CNWD 4JCHA 2P9PG 3ECSA 1XZQA 1MMAA 4WAFA 1Z3YA 1VDYA 4AM9A 3AG2E 3SXZA 3UT4A 3JQ0A 3SBTB 2KATA 5LOZA 3V2XA 3LLIA 4JXTA 3U8VA 1YZAA 2Q9CA 4G1TA 4K03A 5CRUA 2X51A 5CMYA 2VASA 4JTCB 3PEVB 3FWVA 3HNLA 4FP7A 2EPMX 4JJGA 2NUTB 2WVQA 2Q00A 2BKKB 2XCBA 3I4RB 2DZOA 1MMDA 2PZIA 3ZU7B 3DM9B 3KEZA 2FO1E 1WGWA 5ITZF 2ZGGA 2Q9BA 5L0GA 5ENTD 2J4BA 3G2UA 1X5BA 5EN5D 2VTBA 2WXGA 2B0JA 3UPVA 5EDSA 4DX6D 5AC4A 3JT1A 3EUVA 4KBLA 3E32A 3ZN3A 2KYHA 1NI1A 2XPIA 1YDIA 5CI9A 3QWPA 4WWPA 1RJ9B 1N9AA 3G2TA 2VSNA 1G3NB 4FADA 2XGOA 1NU9C 2GRPB 3AG2C 2R7UA 3W9GA 4BY6A 2Y39A 1H9TA 3ITFA 2GFHA 3HXDA 1Y4CA 3ZIBA 3C5RA 2CFZA 2P9NG 4DBQA 1HZ4A 1P5QA 3AS4A 1VOMA 4CJOA 3U66A 3LJBA 2OU6A 3UT7A 1A41A 1Z3XA 4UWFA 4LLEA 3S7FA 3PEUB 3EPVA 1YCSB 1JWGA 5DS5A 3RAUA 2JLBA 2PQNA 1NU7D 4FC8A 1OKKD 2F37A 3ABKC 2QTVA 2XLMA 2W4MA 1LTXA 3FU3A 5G2NA 1OWOA 4G25A 3C7JA 1Q0GA 4H4KC 1OWLA 4DOZA 3CHPA 3Q49B 5E3AA 2LIGA 4U8HA 1VYIA 1V54E 4BEMJ 3L22A 2XS1A 5JUAA 4RG9A 4MVSA 3UIPC 1U2VG 1DCQA 4CIPA 2KC7A 4EHPA 5EHHA 4G24A 1JMWA 4GU5A 5D91A 1NZNA 2J46A 2VGEA 4WJ0A 4YDYA 1T9KA 1N52A 1FVHA 5D92A 5F5FA 1C03A 3CVLA 4KYOB 2HS5A 3C8GB 1QSPA 4GYTA 4FLHA 2J7PA 2L0IA 3APFA 4IYPA 2J45A 3SNHA 3NYMA 3PZDA 3NZUA 2WB2A 1JPLA 2NUPB 4AL0A 1TNZA 4OIOF 2DGJA 3ESLA 1VYKA 5E2QA 2HYZA 1MX6A 3WG7E 1JOGA 1YMPA 3FUIA 1H6PA 3POVA 1FT1A 2G62A 4HNAD 1WG0A 1MYOA 1TNUA 3J5QB 3CVPA 4APFA 4B93B 4PR9A 1UG7A 1WDYA 1ZU2A 3B95A 4I6GA 3LEOA 3K1HA 1UN8A 2F8YA 4HE8D 4ME2A 5ARFA 1TWHA 2J49A 2DB4A 2LD6A 4C7OB 1V54C 2XCCA 4B0ZA 4AL1A 3EIQC 3DPDA 3EHRA 3OAWA 3L1MA 4NQFA 4DX2A 2WXQA 3AGUA 3DZAA 4LACB 4FX5A 4RQIA 4CYMD 4F1SA 1FNTc 4A63B 4GAAA 4DJ9A 3U9MA 2IO2C 4PJNA 3TAXA 3GEHA 4Z9HA 3G2SA 1SQMA 3RW0A 1E85A 1T6IA 2KGOA 3JZ0A 1OW8A 1Z3IX 4A4AA 3NOGD 2VJ8A 3TWSA 2DBAA 4FHJA 5HI7A 2WXLA 1DCEA 1B68A 1D0XA 1S05A 5KNHD 3ZRHA 5JT4A 2FO7A 4OAUC 3WG7C 3W8HA 2W4BA 3NG1A 5A23A 3CZ6A 2D5RB 5JMND 1OCCC 4F6RD 4L23A 4MVRA 3EQLF 4PUCA 1K40A 3FEXA 1QLEC 4LUNU 3APDA 3AJIA 4BTBA 5E33A 2BTDA 3HVEB 4O6NA 1HG2A 3CR3A 3Q6NA 3AOUA 1TQGA 2Z15A 5FQ4A 5JLIA 1ZVZA 2HM8A 2ETCA 1NFNA 1TEZA 1LM3B 3EFOA 1MQSA 3B7UX 4UQYA 3O10A 4E17A 1NZEA 5CBNA 2XZDG 2H7OA 3A11A 3PUKA 4KNWA 1VTMP 4U5GA 2R7XA 3PHF2 4DLQA 3GEIA 1Z23A 3U3WA 4A55A 1ZW3A 4DRIB 5TJ5E 3ZPJA 1HMOA 2KC3A 256BA 3DXKG 3HNKA 2VGYA 1G5ZA 1OW6A 1TFOB 3HYMB 4JC8A 3OXGA 3AU5A 4ILIA 3GWLA 5G05J 4M7CA 4BT9A 3HXBA 4UQXA 4YT8A 4J6IA 3L8JA 3EIJA 1M2VA 3F46A 3FOOA 5ENPD 2ZXPA 3JQ1A 3QWWA 2PX0A 2MOWA 2GW1A 4ABNA 2D4UA 4CDYA 3DSUA 4Z9JA 1JCRA 4XKCA 2EINE 3M79A 4IULA 3US6A 4WWOA 4FU3A 3UGPA 4U95D 3CLJA 2ZD9A 4TXQA 3CEXA 3LEVA 2V3CC 2P0NA 3SXMA 1SA4A 2KZTA 1W2WA 3HRAA 3DRAA 3TGOA 3RO3A 5JHAA 3GZSA 2PBEA 2XLDA 3QOUA 2A0BA 1HG5A 3WXXA 2BE5F 1KU2A 1WATA 4XWJA 5T4YA 4LNBA 4B8AA 1RKEA 2PX3A 4R32A 1T5OA 3CHMA 5A7DB 3ESKA 2VGXB 1HX8A 3B9QA 5BNWA 3CVWA 2P1AA 3KYIA 4UWGA 4AEZC 2X6JA 1KZOA 1BU9A 2GRRB 2XM0A 2KZTB 4ATZD 2I1JA 1HMDA 5GPGB 4CBEA 5HQ8A 4J30B 2Q4FA 4BTAA 3WAQA 3FAJA 2OEWA 1QZXA 5A6KA 1BI8B 3TJPA 1VLSA 3FUFA 3ML8A 2WXRA 4X0RA 1K04A 2YQYA 3D9KA 1HE8A 4Y6WA 2XHEA 5DVWA 2OKUA 3I4UA 3TJ6A 2W45A 1Q0KA 2W9YA 5G05C 2HO1A 3UI2A 4M3OA 5C1DA 3DKAA 3K1IC 3RYLA 2WQ7A 4ZLCA 3CIAA 4PS7A 4KI2A 2WVOA 1OW7A 1YVIA 3FFLA 3BU8A 3LAYA 4ANVA 4XZ4A 4BWRA 3DXJF 1FT2A 4BJ6A 2Q9AA 5FZSA 4KZCA 4AV7A 3J5PA 4DUIA 1U89A 2R7WA 1LE4A 4CS8C 2PP4A 3S84A 3LESA 3D9LA 4TXPA 4O6YA 2R7VA 3Q47B 2GGFA 4NIKA 3B7TA 2OOEA 1SMYF 1NA0A 2C2LA 1MQVA 1SYQA 3FUNA 2PNNA 5T3TA 2XZTG 4MW8A 1OXKA 1SW6A 4O1OA 3MEKA 4IN3B 1CGME 1TWCA 3CVNA 2X0CA 3U9JA 2Y3DA 1A7VA 4BFRA 3TK0A 4AK9A 3ZFWA 2P9SG 2LFDA 2IF4A 4MVUA 1N4PA 4JZYA 4BJ5C 1JWFA 1H6GA 4GTPA 3R9MA 5A6BD 4GMLA 4QFVA 2A6HF 3CK8A 2O9XA 1ZHTA 2P58C 2ZXRA 1YA0A 3LS8A 4ATGA 1YZCA 3PNLB 1TNBA 2AW6A 1ZHZA 4EBBA 2AWCA 3PMRA 1QZ2A 4W9RA 3TWQA 4AIFA 3HTKC 2J9QA 3L34A 4L2LA 3JCKC 2V4HC 3FH8A 1H6KA 3S28A 2ONDA 1LIHA 5A69A 3NB2A 4YNDA 2CW0F 1TJCA 3ASNE 4LDKA 4N06A 4YT2A 5J90A 3EGDB 1YAUO 4LCTA 4APOA 3FEYA 2CNWA 2L6JA 3DWWA 2ETBA 2YHCA 5FZRA 4RLYA 4U0SA 4CS8A 2QZAA 3FHDA 4DX7D 3GANA 1NSGB 1NL4A 2A4ZA 4I43A 4O7GA 3RF3A 2YLIA 1J8YF 1LPEA 4U5EE 3BG0B 4UUCA 5CIVA 4U9DA 2Q7FA 2XLEA 4GEHA 3V5XA 3JTLO 4BJTA 3UM2A 2Y4UA 3GORA 1NA3A 5KJLA 1JCQA 3U5SA 3TG5A 3T9OA 4R7LA 4KNVA 3ASOE 4N39A 4IJJA 3FHEA 3C72A 3L17A 5AENA 4QI2A 3RRUA 4HVBA 2XGMA 4J7YA 3QW1A 3PH0C 2E0IA 4YWQA 3DSWA 4BSZB 4GTTA 4BJ5A 2A5EA 5KCMA 1OCZE 3G2WA 3CKCA 3KKBA 3UNGC 4E85A 3JSEO 1SZAA 2IM8A 2YKZA 1ELKA 3RU0A 4MVZA 4XIFA 2RFMA 1G8XA 3LNMB 2L9BA 3ASNC 2AXUA 1YARO 2XSEA 2V26A 3SEOA 1A17A 4CDNA 1ZU5A 2WQ6A 2JX0A 2ZXOA 2JABA 3AAAC 5AQBA 3FDQA 4N6HA 1FCHA 4J8FA 3Q7LA 3OTNA 3PUJA 4EIYA 4UWHA 4GTSA 4RSYA 2R25A 4MQ9F 5EYPF 4AJWA 4C9BB 1ZW2A 3H2VA 1H6OA 2VSYA 3Q73A 3PS6A 1TR4A 2YZSA 3GZ1A 3ZTZA 4PFPA 2XGSA 4GZ3A 4EBAA 1EPUA 2XS8A 2H7VC 5BPPA 3GODA 2NYJA 3ASOC 3FUKA 3K9IA 1NFIE 3L54A 3V2OA 3IPMO 4EZLA 5FWQA 2A6EF 3IV0A 1GQAA 2EILE 3PRZA 3EGXA 1EQ1A 1JCSA 4GPKA 1OCZC 2GRNB 3NBNB 1LI7A 3FXHA 1WY6A 3RIPA 2KNHA 2H6GA 1D9SA 2XL4A 4NC3A 2FEZA 3MZLB 4IWBA 2L81A 2R7OA 1T01A 5E3CA 2CGEA 3MYIA 3MA5A 2YVKA 3KSLA 4WNEA 3L08A 1OUVA 4FHKA 1Z6TA 3T5VA 3C8ZA 3EGXB 3ZYQA 3RKVA 3PZ4A 2KBXA 3TOLA 2DIWA 3D9MA 4ANUA 2WZFA 3U2LA 1DOWA 3SO8A 5LX8A 1S63A 5JRAA 2V4LA 5A6CA 4DPRA 3N2ZB 5EK0A 4HFGA 4CGWA 5BV0A 3TQOA 3ABKE 2MRIA 3QZCA 1N4QA 5COMA 5LP0A 5BUOA 3SBSA 3OEOA 4E7SA 5CECB 4JZAA 2L0TB 1JPNA 2NC9A 2R05A 5BXUA 3ZKJA 4ZFHA 2F22A 4EUKB 2VH3A 1LKXA 2EILC 2BL2A 5BW8C 4JCZA 2WM9A 2PF4E 4JTAB 5AQAA 2IBFA 4JTDB 3ZQVA 3L9TA 1HS6A 3O48A 2I9CA 1N1CA 4CGVA 1IW7F 2OCCC 4LERA 1E8ZA 1JUQA 3BRJA 4YVQC 3V7OA 2H6IA 4JEBA 1U3DA 2G3KA 3HNJA 2PL2A 1OWMA 4B8CB 1G4WR 3FTWA 3ZVRA 3JUIA 4GMRA 2VTBB 3UGOA 3DSSA 3EU5A 1YLMA 4J8SA 3S0XA 5F28E 4K5BA 2QY9A 4JE9A 4XPYA 1UN9A 2HMQA 2WXJA 1OQCA 2AXVA 3ZW3A 2YL3A 4C3BA 3GW4A 1LS1A 2UUIA 4H54A 3EZIA 4P9FA 5A6JA 5KYUA 1ZBPA 1AUEA 2AXZA 5JJ6A 1A0BA 2WZGA 3FUHA 4CS9C 3L6AA 1W3BA 3ZYLA 1I4YA 3TWRA 3T6JA 3EH1A 3CSTA 1BZ4A 3NZSA 5E76A 3JYHA 5AYWD 3KSQA 2IQCA 3VTXA 4JW1A 4HXIA 2LP4A 2KCLA 3UMIA 2EIKC 4N2SA 4GTRA 3UIOC 3U8PA 3U4TA 3LS1A 3KS2A 1FMWA 2HKVA 3R2PA 3JXIA 3C98A 2NSGA 5KYUB 3EDTB 4LDRA 2J8SD 3KH2A 3W8IA 5FQ6A 5B3IA 1OR3A 2NG1A 5KJMA 1HW2A 4JL0A 1D8DA 5C2YA 5CRVA 4CJGA 4FULA 3TOMA 1KLXA 2R2LA 3CVUA 4KXKB 5T1DB 4AX2A 1UJKA 5T8IA 3Q9NC 2L6HA 5LCWJ 2AWYA 3ATPA 2R5SA 4XEKA 3FU5A 1OR2A 3EHQA 4DK5A 4PFOA 3SZ7A 3ASFA 1SZIA 2OJQA 4HBDA 2YL7A 4LNUD 4KBQA 2CYDA 4A3VA 3TWXA 1OCCE 3ULYA 5H7PA 1E8YA 3QNKA 5EX0A 4E6HA 4OIRF 4J32B 1HU3A 5FZQA 4B6IA 2XEHA 3CAXA 2DWZA 2YHEA 4H7YA 2P9UG 5T3WA 4P29A 5FT9A 4CS9A 2CHXA 2JD3A 2YL1A 3CV0A 1YYHA 5HSWA 5ANRA 2E87A 2J0XA 2WPVA 3Q9UC 2C0MA 3IKOB 3CK7A 3V5YA 4GA2A 5BQIA 2QLAA 3UQ3A 2V0PA 3VLDA 4TV3A 3TWWA 1M2OA 4J0UA 1IXVA 2MYOA 4U96D 2KW3C 4N4WA 4I44A 3FAPB 1FMVA 2VQ2A 1ZU4A 4U5DE 3SGHA 3CSKA 4DX5D 4JHKA 1PAQA 3LCAA 4K5CA 2MHKA 4EWCA 1SVXA 3IHUA 5KNGA 2G3VA 4RD9A 2FI7A 2P6VA 4I3MA 4O1PA 3GZ2A 4U5HA 3AG4E 4LSZE 1IKND 1R4TA 3I4GA 3S2AA 4GYYA 1K05A 3TWUA 2WQHA 3DBSA 4EZKA 1VMAA 4DRXE 3HIZA 2EPLX 1V55C 1TN7A 4ULWA 2CG3A 2WXMA 5EKQD 4ANXA 1V74B 4C48B 2NSFA 5FTPA 4XTKA 4WUYA 3BEHA 3R7RA 2YWAA 5ARGA 3DE8A 4E0HA 1KNYA 3ASGA 1R5ID 1T6UA 4FJYA 1H2VC 4CCAA 5ENRD 1V4AA 1H2TC 2XENA 1LI5A 3C8GD 1CGNA 2KCVA 3BEEA 2CHWA 3TULA 4JKVA 4KMOA 3UX4A 1X81A 5B3SE 1H2UA 4PJJA 2PM6A 3V31A 4G8KA 3WODF 2WL8A 3M4BA 3EFOB 1WAO1 2ZIRA 4YT5A 4O60A 1RMVA 3MV3B 4XI0A 5CMWA 4JA7A 2DCPA 2VCAA 2E2EA 3LY8A 4U07A 3ZNGA 4DI4A 4BESA 2J7PD 1ZB1A 3LY9A 3PDNA 3JCUQ 3AG4C 1BR1A 3GEEA 2J09A 1TKNA 3D3MA 3SYNA 3LVQE 3LJ3A 3L8IA 3Q5MA 4MBGA 3U64A 3U3FA 2B6CA 2Y69C 4U8VD 3RFYA 4D10C 1O87A 1BD8A 1HF8A 4GA1A 1U6HA 1TNOA 2XRZA 4B94A 3S7DA 1M2VB 2R7RA 3L13A 3O6XA 4PJLA 4LRZA 3I5PA 3SQVA 3RIBA 4BJ6C 2A0UA 4G7OF 3TXMA 4CEMA 3RH3A 2L6FA 3MCXA 3IQTA 4GCNA 4J7TA 3NAWA 4G8LA 2R7QA 3FTSA 5IY5E 1LS4A 4WGYA 2YLGA 1K1BA 1AP7A 1Z7Qc 5EIDA 1RCPA 4ANWA 2A68F 1INZA 1N0QA 4XX5A 4HRNA 2LK4A 3C63A 1IHGA 4CT4A 1Z6AA 5B3SC 1NFOA 2OVFA 2NSZA 2M4EA 4UI9K 4XQ1A 5G04J 4BERA 2P2CP 2WMOA 2P7VA 4IB4A 2F8XK 1ST6A 1EA8A 2J9BA 2PFDA 4JEHA 2V5FA 1ZHYA 3JRTA 1RKEB 4PS8A 2ZXWE 1E84A 3TWTA 3RQGA 5L0DA 5B1BC 2YEVA 3D9NA 4U7EB 2AP3A 3UUXA 4OD5A 2IOLA 3W2WA 1QKRA 4NTAA 3MV2B 2HSQA 4U5FE 2FBNA 2RFAA 3TL5A 1EKYA 3QWVA 3SFXA 4GCOA 4OIQF 2J08A 3E4BA 2QC9A 4MW3A 5FZTA 5DS6A 1Q2ZA 1ZYRF 2QY7A 2X3MA 5JVEA 3HDXA 4U04A 3LY7A 2X6IA 5IY5C 1RW2A 5ENOD 2HUJA 1OXJA 3Q7GA 4WNGA 4I17A 4K7BA 3SY2A 2MYSA 2X6HA 1WWPA 1DVPA 2Y1LE 3JUEA 3CKBA 4Q4ZF 1JR8A 3ULEG 4G0HA 1HO8A 3ZYMA 1N94A 3UMVA 4K0RA 2J9VA 1I4ZA 2R17C 2A69F 4G78A 1QQEA 3CVXA 3VTYA 3AU4A 2ZXWC 4N2QA 4GB9A 1N11A 4BX8A 1Z5SC 2AWIA 4DVYP 2KCKA 4FESA 3QVYA 4JHJA 3D9HA 2HJMA 1GM5A 3D9OA 2EIME 5D0OD 3ZHEA 1JRAA 4N6CA 4YDWA 3FMSA 3CQZA 4I2WA 4NURA 3SNXA 3UM3A 3NQPA 4WNFA 3NRHA 2GA0A 3DE9A 4BX9A 3RQEA 2Y0BG 4I1OB 2XQ0A 3CVQA 5G04C 3MYVA 3TD7A 5CEAA 3KPHA 1CPQA 3Q15A 1EF1C 4O79A 2IJGX 4Z9IA 3CQGB 3FTZA 2RKKA 3HKKA 4CIHA 2DZNA 4HLLA 1APCA 3PDMP 2EQXA 1O1TA 1YYXA 1PCXA 1L3PA 4C3DA 3D9PA 5FQ7A 2IU1A 2B0HA 4HFFB 2Q3TA 3CQCB 3MX3A 3GYZA 2C04A 3QK0A 4EZJA 3SZRA 1BR4A 4PH4B 3NMIA 2H8AA 3OA1A 3RO2A 3G4ZA 1ORYA 1E90A 1N95A 5AGFA 1GGQA 2LQGA 2XLOA 1XGWA 4NQ0A 3MBGA 1UW4B 3AQBA 3EHNA 1U3CA 3U2MA 1ELWA 5ENSD 2QE9A 3PE4A 4YVOA 2L6BA 5L0HA 2NXPA 3T5XA 2EIMC 4Q7CA 3T8MA 4MVOA 2IXPA 4CDMA 3EZHA 1ORJA 5AJDA 4G26A 3H2UA 3CGHA 2IXNA 3M15A 3KAEA 2IOSA 1MNDA 5FJYA 1PY1A 3DMDA 2EPNA 4FA6A 2FGYA 3KD7A 3T6GB 3QMKA 4F1PA 2CCYA 3VYWA 2XXAA 1QPUA 4Q94A 3TXNA 4RBNA 4BPMA 3JSZA 3L0IA 3U9WA 3ZG1A 3RRMB 2OEXA 5KYWA 3PE3A 4K0DA 2OQMA 5K0IA 4GTVA 2B0OE 3H65A 1NP7A 4U0UA 4JA9A 3SF4A 2WXHA 3IHVA 2P9LG 1FFTC 2WXKA 3X2QE 3RQFA 3FU0A 2OEVA 3EG9A 1YA7O 2WXPA 1E7VA 3FTXA 3VRCA 4L9PA 5HKPA 4YT4A 2BC5A 3VM6A 2XLWA 2RD9A 3NYJA 3UMHA 4O6FA 4H7XA 3DWLG 4EHMA 4URKA 5KYWB 1U0BB 2XLVA 2OG2A 2LXMA 4TRQA 1D1AA 1I5NA 3R7QA 3S7BA 1BBHA 2A1DD 4Q5SF 3DD7A 3QB2A 3T4RA 4F4BA 1Z63A 2YHSA 2YINA 3JRMO 4GMJA 1QNFA 1A7EA 3CVVA 3ISMC 5EILA 4AP2A 1KTMA 2I8BA 3VF0A 4D4XA 1O5MA 1S0PA 2HV6A 2BKGA 4HRMB 1OKKA 3SXYA 5AN8A 2WVNA 3O4ZA 2R03A 1UOHA 1KT1A 2WXFA 3DJNB 4G7ZF 1E86A 4IRUA 2EPOA 4K1OA 4ILHB 1G4US 5JJ7A 1AVOB 4L6RA 1ZHXA 4U5BE 1O5HA 4OINF 1K8KG 5KYNA 1K3ZD 2UY1A 3AG1E 1OCRC 5JP7A 2OCCE 2Y3AA 2J9WA 2HR2A 2LCHA 3NOCD 2J4DA 3DI5A 1WN0A 1GW6A 1TYQG 5CEDB 3U3BA 3N24A 2VYIA 3UXGA 1IQRA 3L82A 3X2QC 5JA4D 1VLTA 1YYJA 4GTQA 2CDQA 2VSXE 3DAGA 3IEEA 1MZCA 3CHSA 2M64A 2QNLA 2L7AA 4MTOA 2LFFA 4C0EA 3IQ6A 3QC1A 2CG2A 3F6QA 4GA0A 4A3TA 3G2VA 3QW0A 4WGZA 3FU6A 1IHBA 2XRYA 4G2VA 5EIBE 2NUTA 3SFYA 2IO3C 1RZ4A 3HXEA 4G23A 3QJZA 4E0IA 2LUHA 4NCQA 3DEPA 3TWVA 4C3EA 4Z68A 3G4XA 4PACA 1MMGA 2Y4TA 1C02A 2HV7A 1HY5A 5FCLA 4YJWA 1ZZPA 4HB5A 4WNDA 1D8EA 2FAPB 3VLEA 2R7SA 2R7TA 2EIKE 3EHMA 1CGOA 2H6FA 3CEQA 3CHOA 2TMVP 2LSEA 3PREA 1Y6IA 1N54A 5J08A 5JS5A 3ZUVB 3URZA 4EBAG 3G50A 2OVBA 1RJ9A 1AEPA 3AG1C 2IOQA 4GTOA 3ZYKA 4HS2A 2IYLD 4F7AA 5BV1A 3N71A 3UTMA 5DIZA 3K66A 4A2NB 4XLPF 4C0MA 5B1AE 3N0TA 4MTGA 1PV3A 2MWQA 4BSXA 3K7DA 4XPXA 1H9GA 2LAIA 4UWLA 5FQ8A 4D4NA 2HMZA 2IXMA 5COFA 2F0YA 3V5ZA 4RDAA 2DYSE 4MVMA 2AU5A 1Q0FA 2KJGA 4I1MA 1J8MF 4QI0A 1L5JA 1MMNA 5AJLA 2J8WA 1N4SA 3B7BA 4N3AA 1NG1A 4YN0B 2KK1A 3ZC4A 4WABA 2WMNA 3KL4A 5CCLA 2QYJA 5CERB 3AS5A 2QUPA 1FTSA 4CRWA 3E33A 2EIJE 3O55A 4L1BA 1CPRA 4NACA 2V8SE 4NRHB 2PM7A 1M6TA 3K33A 4ONSA 3M4CA 4YL3A 5CBOA 3UINC 4DRHB 4OYSA 5E75A 5BUZA 3FOPA 4JRZA 5JSLA 1E96B 1EYHA 4GYOA 1DOVA 3W2VA 4DVZA 1D1BA 3B29A 4AVXA 3DXMG 4IAQA 1FVFA 1E8WA 2XL6A 3FULA 4GZ6A 3HG0D 1DC2A 3ASHA 3C8GA 1JAFA 5B1AC 4IGGA 2AJAA 2QYUA 2YRFA 1BLXB 3T9KA 3KYJA 3MLGA 3ULQA 3LS0A 2NUPA 3SD5A 5KWDA 2ZU6B 2WXNA 2ETSA 2IXOA 3JYSA 2CHZA 2X38A 2DYSC 3DEOA 3FH5A 3R7CA 3SFZA 1XNFA 4JB8P 3FUEA 2IEJA 3RSEG 2JPUA 1IYGA 1RXQA 5L0CA 4PJMA 4YK5A 4XPWA 4JC7A 2WZLA 1HXIA 2C03A 1ZHWA 3HXCA 1V55E 3MGBA 2EIJC 4C7OA 1ORSC 3HLZA 4OVUA 1SR2A 4ACKA 4HOUA 2JEKA 4TUMA 4EECA 2PNOA 4RG6A 2Y3HA 3KEAA 4FJZA 5HRYA 3E30A 3AQCA 3RRNB 4DXWA 2Q7RA 3ONLA 3Q78A 4NTBA 4CT0A 2V5QC 5FIOA 2YQ8A 1RKCA 3LXUX 5DQTA 3B71A 2LSUA 1D0YA 1E7UA 1QBQA 3IEGA 3FVYA 2DYRE 2AVPA 3IQCA 3HHMA 4YDOA 2VCCA 1S70B 2L6GA 4I6EA 1BDJB 4W8PA 4QQIA 4CDVA 3B7RL 3AGTA 2I6HA 4DX1A 5L0IA 3KMIA 2R59A 4LDQA 3UT8A 3OXLA 5KBAA 1SZ9A 1F1MA 4MNDA 1IZMA 1FPPA 4I1AA 3L16A 3B0UX 3E9VA 2AVKA 3RKOF 3ENEA 3FUMA 3MKQA 1BPOA 4GTMA 2XLHA 1OWPA 3DSTA 3DAFA 4JJFA 3HVEA 3NKEA 4L7TA 1XWJA 1UG3A 4GZ5A 4AY6A 4XE0A 3ZEFA 4HOSA 2Y69E 3Q7AA 3ZSUA 3PZ3A 5LCWC 4TXRA 2OJED 4F53A 5L3VA 4KVMA 3SHFA 4G7HF 2Y3BA 3X1OA 4JEUA 4ACLA 2LSVA 2WXIA 4GYWA 4UWKA 3MJWA 2P9IG 3NF1A 3J06A 3JYYA 5L0JA 2LO6A 2YNQA 1OCOE 4B89A 4I9EA 1WOLA 2FULA 3MKQB 1IQUA 3I3NA 4U0ZA 4YDEA 4JVSA 3CSFA 5ENQD 2OV8A 4BETA 2R9RB 2UWJG 2GAQA 4XKBA 3ABLE 4UI9J 2YL0A 4EPZA 4EBJA 2DYRC 4I9CA 3LNRA 2DVWA 1LE2A 3UKUG 1DNPA 3T6BA 4KZ0A 3UR3C 3CHRA 1TJFA 3S7JA 2KXPC 3B0VC 2VSOE 1BI7B 1OXBA 1S7ZA 4N3CA 2IONA 4DBRA 4BG0A 4XEFA 4AE4A 5L0FA 4I6JA 3AJMA 3C18A 3Q7FA 3MKRA 5KYYA 5ENNA 5B1BE 4EQFA 3E34A 4HFKB 2QFCA 1K1AA 1MJ0A 2KM4A 3C3QA 1VB5A 4CX9A 1O3UA 4L2YA 1C17M 5F5HA 5EYLA 3FTVA 2H6HA 3S29A 1OY3D 1Y8MA 3A9CA 5JJTA 5AIJA 3UKRG 2ICWG 2WB7A 4AE4B 4HORA 5KYYB 3JXJA 1Q0MA 3QARA 3GM3A 5A6BA 3UM1A 2ETAA 2Y3GA 1OCOC 3V79K 3V30A 4GQHA 2VB6A 3QTHA 4MLPA 1MX2A 2VGXA 3ZWIA 4CSAC 4F3VA 3DM5A 3O39A 2CFUA 2DI3A 4LG6A 3ZQYA 3FY4A 4HRLA 3ABLC 2VC9A 2R02A 1M56C 3S90A 1A7DA 3LUTB 4MS2A 2WVIA 3LEWA 4J7WA 4KVOA 3C62A 3AG3E 4I2ZA 4A1SA 3FTUA 4XEVA 4DRJB 3U0CA 5BQGA 4K5AB 3QKYA 5G55A 1SF8A 4OD4A 5BT1A 3OWTA 2XRHA 4DJAA 3RVZA 2I2OA 4QDLA 1MNEA 2ASRA 1E8XA 1O1SA 3AS8A 1HE9A 5AC5A 1WASA 3GM2A 3LPZA 1Y6DA 3FDHA 3R9AB 1WTYA 3SXKA 1TWAA 4UI9C 4N5QA 3DJUB 3Q79A 3B7SA 3CK9A 1FAPB 4KT6B 3FH7A 4JPSA 1D0ZA 3B0PA 4BJ1A 4JD2G 2X6FA 1GS9A 3IXEA 3QAQA 4IARA 2GRQB 4W8KA 1TNYA 3RVYA 2XEVA 3MFNA 2IFUA 5L3QA 5ANLA 2EINC 5AQ7A 4FLBA 1TWGA 4CS7A 4XEIG 3VLFA 5KJKA 4BT8A 1AWCB 2M63A 1KPSB 4J8YA 1N4RA 4NTFA 2L9JA 2X6KA 2HJ3A 4AOFA 4OVVA 3K6BA 3D9JA 4EKWA 4CSAA 3EU9A 4CDRA 1FR0A 4UQZA 2HSBA 1MX4A 3FP3A 3S27A 2VCBA 1QYMA 4NY3A 3AG3C 5HS0A 4MVQA 4CZ2D 2LXLA 3ZIMA 2C0LA 4DI3A 2GDCA 3LKUA 3NKDA 3I5QA 1S64A 4GZCA 3EJNA 4PK4A 4P6IC 5HV9A 3APCA 4V3IA 1QQ3A 4MTFA 4U9EA 1LF8A 4WWNA 3BQOA 3HNIA
chains in the Genus database with same CATH topology
3NYLA 3ML9A 4LLCA 3FUDA 1BR2A 1D1CA 2J07A 1LVKA 3PVLA 1PD0A 4XLNF 2BF0X 2PQRA 4BEJA 3Q4AB 3ZXSA 5DLJA 3EH2A 5CI8A 4ILGA 2I1KA 3PNTB 3ZHEB 1JPJA 2H7BA 4Q96A 3VAYA 2RD0A 3FTYA 3FUJA 3RJVA 5CCMA 3EGDA 5JHBA 4Y6CA 3CVYA 4OIPF 5KYXA 5M72A 4HOTA 4G11A 4MS6A 3RK6A 3TG4A 3LVRE 5DQZA 3QDNA 4XI9A 3NDBB 4U63A 4JHRA 5KYXB 1H19A 3BG1B 5EGYA 3ZGQA 4KC9A 3IBEA 2A5UA 4FWVA 4JURI 4HOQA 3ONKA 4J8EA 3LLKA 4Q69A 2LAHA 5CHEE 3LYAA 1HH8A 3P1UA 1FFHA 2ZPAA 1H0AA 4AXHA 1KT0A 4AY5A 2FFHA 1B89A 2XPYA 5DS4A 4HLEA 4U5CE 1PD1A 1M57C 2XXAB 4TUUA 3SP1A 5KJNA 4A1GA 1VK5A 3F47A 3M1CB 4N3BA 3E70C 3HJCA 4GZDA 4IAOA 3ZVVA 5EX3A 5D0QD 4PDXA 2ILRA 5DBKA 2LNIA 2J9UA 2J0WA 4MRUA 3Q6MA 3EG9B 1TR2A 4O6MA 4DLOA 4MKTA 3D9IA 3CHQA 1Z5ZA 4E7ZA 4N5CA 4M63A 3ABMC 2GRMA 1EDUA 4ANJA 5LFAA 3UMKA 2FF4A 4HEAJ 1PC2A 1HFAA 4ZLDA 3OXFA 2XPZA 1MHQA 3P2BA 1OWNA 3ASDA 2WXOA 4RVBA 2RG8A 1WM5A 3B13A 4PS3A 3IHYA 2KQ9A 3LDZA 4J8DA 3SI5A 2GRLA 2BUGA 4LEUA 5T3RA 1UJJA 1ELRA 2UY1B 2CNWD 4JCHA 3ECSA 1MMAA 4WAFA 1Z3YA 1VDYA 4AM9A 3UT4A 3JQ0A 3SBTB 2KATA 5LOZA 3LLIA 4JXTA 2Q9CA 4G1TA 4K03A 2X51A 5CMYA 2VASA 3PEVB 3FWVA 4FP7A 4JJGA 3I4RB 2NUTB 2WVQA 2XCBA 1MMDA 2PZIA 3DM9B 3KEZA 1WGWA 2Q9BA 2J4BA 3G2UA 1X5BA 2VTBA 2WXGA 2B0JA 3UPVA 5EDSA 3JT1A 4KBLA 3ZN3A 2XPIA 5CI9A 3QWPA 4WWPA 1RJ9B 3G2TA 2VSNA 4FADA 2XGOA 1NU9C 3AG2C 2R7UA 4BY6A 2Y39A 3ITFA 2GFHA 3ZIBA 2CFZA 4DBQA 1HZ4A 1P5QA 3AS4A 1VOMA 3U66A 3LJBA 3UT7A 1Z3XA 4UWFA 4LLEA 3S7FA 3PEUB 3EPVA 1JWGA 5DS5A 2JLBA 2PQNA 1NU7D 4FC8A 1OKKD 3ABKC 2QTVA 2W4MA 3FU3A 5G2NA 1OWOA 4G25A 4H4KC 1OWLA 4DOZA 3CHPA 3Q49B 5E3AA 4U8HA 1VYIA 3L22A 4RG9A 2KC7A 5EHHA 4G24A 4GU5A 5D91A 1NZNA 2J46A 4WJ0A 1N52A 1FVHA 5D92A 5F5FA 3CVLA 4KYOB 4GYTA 4FLHA 2J7PA 2L0IA 3APFA 4IYPA 2J45A 3SNHA 3NYMA 3PZDA 3NZUA 2WB2A 1JPLA 2NUPB 4OIOF 2DGJA 3ESLA 1VYKA 5E2QA 2HYZA 3FUIA 3POVA 2G62A 3CVPA 4APFA 1ZU2A 4I6GA 3K1HA 1UN8A 4HE8D 4ME2A 5ARFA 1TWHA 2J49A 4C7OB 1V54C 2XCCA 4B0ZA 3EIQC 3DPDA 3OAWA 2WXQA 3DZAA 4LACB 4FX5A 4F1SA 4GAAA 4PJNA 3TAXA 3G2SA 1SQMA 2KGOA 1Z3IX 2VJ8A 2DBAA 4FHJA 5HI7A 2WXLA 1D0XA 3ZRHA 2FO7A 3WG7C 3W8HA 2W4BA 3NG1A 5A23A 3CZ6A 2D5RB 1OCCC 4L23A 3EQLF 4PUCA 3FEXA 1QLEC 4LUNU 3APDA 4BTBA 5E33A 2BTDA 3HVEB 4O6NA 1HG2A 3CR3A 3Q6NA 2Z15A 5FQ4A 2HM8A 1TEZA 3EFOA 1MQSA 3B7UX 4UQYA 1NZEA 2H7OA 3PUKA 4KNWA 4U5GA 2R7XA 3PHF2 4DLQA 1Z23A 3U3WA 4A55A 3ZPJA 2VGYA 3HYMB 4JC8A 3OXGA 3AU5A 4ILIA 5G05J 4BT9A 4UQXA 4YT8A 4J6IA 3EIJA 1M2VA 3F46A 2ZXPA 3JQ1A 3QWWA 2PX0A 2MOWA 2GW1A 4ABNA 4XKCA 4IULA 4WWOA 4FU3A 3UGPA 3CLJA 3LEVA 2V3CC 2KZTA 1W2WA 3TGOA 3RO3A 5JHAA 3GZSA 3QOUA 1HG5A 3WXXA 2BE5F 1KU2A 4XWJA 5T4YA 4B8AA 2PX3A 3CHMA 5A7DB 3ESKA 2VGXB 1HX8A 3B9QA 5BNWA 3CVWA 4UWGA 4AEZC 2X6JA 2KZTB 2I1JA 4CBEA 5HQ8A 4J30B 4BTAA 3FAJA 1QZXA 3TJPA 3FUFA 3ML8A 2WXRA 4X0RA 3D9KA 1HE8A 4Y6WA 2XHEA 5DVWA 3I4UA 2W45A 2W9YA 5G05C 2HO1A 4M3OA 5C1DA 3K1IC 3RYLA 2WQ7A 4ZLCA 3CIAA 4PS7A 4KI2A 2WVOA 3FFLA 3LAYA 4ANVA 4XZ4A 4BWRA 3DXJF 4BJ6A 2Q9AA 5FZSA 4KZCA 4AV7A 2R7WA 4CS8C 2PP4A 3LESA 3D9LA 4O6YA 2R7VA 3Q47B 2GGFA 3B7TA 2OOEA 1SMYF 1NA0A 2C2LA 3FUNA 5T3TA 3MEKA 4IN3B 1TWCA 3CVNA 2Y3DA 4BFRA 4AK9A 3ZFWA 2IF4A 4JZYA 4BJ5C 1JWFA 4GMLA 4QFVA 2A6HF 3CK8A 2O9XA 1ZHTA 2P58C 2ZXRA 1YA0A 3LS8A 4ATGA 3PNLB 2AW6A 1ZHZA 4EBBA 3PMRA 1QZ2A 4W9RA 4AIFA 3HTKC 2J9QA 3L34A 4L2LA 3JCKC 3FH8A 1H6KA 3S28A 2ONDA 4YNDA 2CW0F 1TJCA 4N06A 4YT2A 5J90A 3EGDB 4LCTA 4APOA 3FEYA 2CNWA 2L6JA 2YHCA 5FZRA 4U0SA 4CS8A 3FHDA 3GANA 2A4ZA 4I43A 4O7GA 1J8YF 4U5EE 3BG0B 2Q7FA 4GEHA 4BJTA 2Y4UA 1NA3A 5KJLA 3TG5A 4R7LA 4KNVA 4N39A 4IJJA 3FHEA 3L17A 5AENA 4QI2A 3RRUA 4HVBA 2XGMA 3PH0C 2E0IA 4YWQA 4BJ5A 5KCMA 3G2WA 3CKCA 3KKBA 3UNGC 4E85A 1SZAA 1ELKA 3RU0A 4XIFA 1G8XA 2L9BA 3ASNC 2AXUA 2XSEA 2V26A 3SEOA 1A17A 4CDNA 1ZU5A 2WQ6A 2ZXOA 3FDQA 1FCHA 4J8FA 3Q7LA 3OTNA 3PUJA 4UWHA 4RSYA 4MQ9F 4AJWA 4C9BB 2VSYA 3PS6A 2YZSA 3GZ1A 4PFPA 2XGSA 4GZ3A 4EBAA 1EPUA 2H7VC 5BPPA 3GODA 3ASOC 3FUKA 3K9IA 3L54A 4EZLA 5FWQA 2A6EF 3IV0A 3PRZA 3EGXA 4GPKA 1OCZC 1WY6A 3RIPA 2KNHA 2XL4A 2FEZA 3MZLB 4IWBA 2L81A 2R7OA 5E3CA 2CGEA 3MA5A 4WNEA 3L08A 1OUVA 4FHKA 1Z6TA 3T5VA 3EGXB 3ZYQA 3RKVA 2DIWA 3D9MA 4ANUA 2WZFA 5LX8A 2V4LA 5A6CA 4DPRA 3N2ZB 4HFGA 4CGWA 5BV0A 2MRIA 3QZCA 5LP0A 5BUOA 3SBSA 3OEOA 4E7SA 4JZAA 2L0TB 1JPNA 2NC9A 2VH3A 1LKXA 2EILC 5BW8C 2WM9A 2PF4E 1HS6A 3O48A 2I9CA 1N1CA 4CGVA 1IW7F 2OCCC 4LERA 1E8ZA 1JUQA 4YVQC 3V7OA 1U3DA 2G3KA 2PL2A 1OWMA 4B8CB 3FTWA 3ZVRA 3JUIA 2VTBB 3UGOA 4J8SA 3S0XA 2QY9A 1UN9A 2WXJA 2AXVA 3ZW3A 4C3BA 3GW4A 1LS1A 3EZIA 5KYUA 1ZBPA 2AXZA 5JJ6A 2WZGA 3FUHA 4CS9C 3L6AA 1W3BA 3ZYLA 3T6JA 3EH1A 3CSTA 3NZSA 5E76A 3JYHA 5AYWD 3VTXA 2IQCA 4JW1A 4HXIA 2KCLA 3UMIA 2EIKC 4N2SA 3U4TA 3LS1A 3KS2A 1FMWA 3C98A 5KYUB 3EDTB 3KH2A 3W8IA 5FQ6A 2NG1A 5KJMA 4JL0A 5C2YA 4FULA 1KLXA 3CVUA 4KXKB 5T1DB 4AX2A 1UJKA 5T8IA 5LCWJ 2R5SA 3FU5A 4DK5A 4PFOA 3SZ7A 3ASFA 1SZIA 4KBQA 4A3VA 1E8YA 3QNKA 5EX0A 4E6HA 4OIRF 4J32B 1HU3A 5FZQA 4B6IA 2YHEA 4H7YA 5T3WA 4P29A 5FT9A 4CS9A 2CHXA 2JD3A 3CV0A 5HSWA 5ANRA 2E87A 2J0XA 2WPVA 2C0MA 3IKOB 3CK7A 4GA2A 3UQ3A 2V0PA 3VLDA 4TV3A 1M2OA 4J0UA 2KW3C 4I44A 1FMVA 2VQ2A 1ZU4A 4U5DE 3SGHA 3CSKA 4JHKA 1PAQA 3LCAA 2MHKA 4EWCA 2G3VA 4RD9A 2FI7A 2P6VA 4I3MA 3GZ2A 4U5HA 3I4GA 3S2AA 4GYYA 2WQHA 3DBSA 4EZKA 1VMAA 3HIZA 1V55C 4ULWA 2CG3A 2WXMA 5EKQD 4ANXA 5FTPA 4XTKA 4WUYA 3R7RA 5ARGA 3ASGA 4FJYA 1H2VC 4CCAA 1H2TC 2KCVA 3BEEA 2CHWA 4KMOA 3UX4A 1H2UA 4PJJA 2PM6A 3WODF 2WL8A 3EFOB 1WAO1 4YT5A 3MV3B 4XI0A 5CMWA 4JA7A 2DCPA 2E2EA 3LY8A 4U07A 4DI4A 2J7PD 3LY9A 3PDNA 3JCUQ 3AG4C 1BR1A 2J09A 1TKNA 3D3MA 3SYNA 3LVQE 3LJ3A 3Q5MA 3U64A 2Y69C 3RFYA 4D10C 1O87A 1HF8A 4GA1A 2XRZA 4B94A 3S7DA 1M2VB 2R7RA 3L13A 3O6XA 4PJLA 4LRZA 3I5PA 3RIBA 4BJ6C 4G7OF 3TXMA 4CEMA 3RH3A 3MCXA 4GCNA 2R7QA 3FTSA 4ANWA 2A68F 1INZA 4XX5A 1IHGA 4CT4A 1Z6AA 5B3SC 2OVFA 2NSZA 2M4EA 4UI9K 5G04J 2WMOA 2P7VA 1ST6A 2PFDA 4JEHA 2V5FA 1ZHYA 3JRTA 4PS8A 5B1BC 2YEVA 3D9NA 3UUXA 4OD5A 2IOLA 3W2WA 3MV2B 4U5FE 2FBNA 3TL5A 3QWVA 4GCOA 4OIQF 2J08A 3E4BA 5DS6A 1ZYRF 2QY7A 2X3MA 3HDXA 4U04A 3LY7A 2X6IA 5IY5C 3Q7GA 4WNGA 4I17A 4K7BA 2MYSA 2X6HA 1DVPA 3CKBA 4Q4ZF 4G0HA 1HO8A 3ZYMA 3UMVA 4K0RA 2J9VA 2R17C 2A69F 1QQEA 3CVXA 3VTYA 3AU4A 2ZXWC 4N2QA 4GB9A 4BX8A 2AWIA 4DVYP 2KCKA 4FESA 4JHJA 5D0OD 3ZHEA 3D9OA 3CQZA 4I2WA 4NURA 3SNXA 3NQPA 4WNFA 3NRHA 4BX9A 4I1OB 2XQ0A 3CVQA 5G04C 3MYVA 3TD7A 3Q15A 1EF1C 4O79A 2IJGX 3CQGB 3FTZA 4CIHA 2EQXA 1PCXA 4C3DA 5FQ7A 2IU1A 4HFFB 2Q3TA 3CQCB 3MX3A 3GYZA 2C04A 3QK0A 4EZJA 3SZRA 1BR4A 4PH4B 3OA1A 3RO2A 1E90A 1XGWA 4NQ0A 1UW4B 3AQBA 3EHNA 1U3CA 1ELWA 3PE4A 4YVOA 3T5XA 2NXPA 2EIMC 4Q7CA 3T8MA 2IXPA 4CDMA 3EZHA 5AJDA 4G26A 3CGHA 2IXNA 3KAEA 2IOSA 1MNDA 5FJYA 1PY1A 3DMDA 4FA6A 2FGYA 3KD7A 3QMKA 3VYWA 2XXAA 4Q94A 3TXNA 4RBNA 3JSZA 3L0IA 3U9WA 3ZG1A 3RRMB 5KYWA 3PE3A 4K0DA 3H65A 1NP7A 4U0UA 4JA9A 3SF4A 2WXHA 3IHVA 1FFTC 2WXKA 3FU0A 3EG9A 2WXPA 1E7VA 3FTXA 4YT4A 3NYJA 3UMHA 4O6FA 4H7XA 4URKA 5KYWB 2OG2A 4TRQA 1D1AA 3R7QA 3S7BA 2A1DD 4Q5SF 3DD7A 3QB2A 3T4RA 4GMJA 4F4BA 2YHSA 1Z63A 2YINA 1QNFA 3CVVA 4AP2A 2I8BA 1S0PA 2HV6A 1OKKA 2WVNA 3O4ZA 1KT1A 2WXFA 3DJNB 4G7ZF 4IRUA 4ILHB 5JJ7A 1ZHXA 4U5BE 1O5HA 4OINF 5KYNA 2UY1A 1OCRC 2Y3AA 2J9WA 2HR2A 2J4DA 1GW6A 3N24A 2VYIA 1IQRA 3X2QC 2CDQA 2VSXE 3DAGA 3IEEA 3CHSA 4C0EA 3QC1A 2CG2A 4GA0A 4A3TA 3G2VA 3FU6A 2XRYA 4G2VA 2NUTA 4G23A 3QJZA 4C3EA 1MMGA 2Y4TA 2HV7A 5FCLA 4YJWA 4WNDA 3VLEA 2R7SA 2R7TA 3EHMA 3CEQA 3CHOA 2LSEA 3PREA 1Y6IA 1N54A 5J08A 3URZA 4EBAG 2OVBA 1RJ9A 3AG1C 2IOQA 3ZYKA 4HS2A 2IYLD 4F7AA 5BV1A 3N71A 5DIZA 3K66A 4A2NB 4XLPF 4C0MA 3N0TA 2MWQA 4BSXA 3K7DA 2LAIA 4UWLA 5FQ8A 2IXMA 4RDAA 2KJGA 4I1MA 4QI0A 1J8MF 1L5JA 1MMNA 5AJLA 4N3AA 1NG1A 4YN0B 3ZC4A 2WMNA 3KL4A 5CCLA 3AS5A 1FTSA 4CRWA 4L1BA 4NACA 2V8SE 4NRHB 2PM7A 3K33A 4OYSA 5E75A 5BUZA 1E96B 1EYHA 4GYOA 3W2VA 4DVZA 1D1BA 4AVXA 1FVFA 1E8WA 3FULA 4GZ6A 3ASHA 5B1AC 3MLGA 3ULQA 3LS0A 2NUPA 3SD5A 2ZU6B 2WXNA 2IXOA 3JYSA 2CHZA 2X38A 2DYSC 3FH5A 3SFZA 1XNFA 3FUEA 1IYGA 4PJMA 2WZLA 1HXIA 2C03A 1ZHWA 3MGBA 2EIJC 4C7OA 3HLZA 4OVUA 4ACKA 4HOUA 2JEKA 4EECA 4RG6A 2Y3HA 4FJZA 3AQCA 3RRNB 3ONLA 4CT0A 2YQ8A 3LXUX 5DQTA 2LSUA 1D0YA 1E7UA 3IEGA 3FVYA 2AVPA 3HHMA 4I6EA 3B7RL 2I6HA 3KMIA 2R59A 3UT8A 3OXLA 1SZ9A 4MNDA 1IZMA 4I1AA 3L16A 3B0UX 3E9VA 3RKOF 3ENEA 3FUMA 3MKQA 1BPOA 1OWPA 3DAFA 4JJFA 3HVEA 3NKEA 4L7TA 4GZ5A 1UG3A 4AY6A 4XE0A 3ZEFA 4HOSA 5LCWC 3ZSUA 4F53A 5L3VA 4KVMA 3SHFA 4G7HF 2Y3BA 3X1OA 4JEUA 4ACLA 2LSVA 2WXIA 4GYWA 4UWKA 3MJWA 3NF1A 2LO6A 2YNQA 4B89A 4I9EA 2FULA 3MKQB 1IQUA 3I3NA 4U0ZA 4JVSA 3CSFA 2OV8A 2UWJG 4XKBA 4UI9J 4EPZA 2DYRC 4I9CA 3LNRA 1DNPA 3T6BA 4KZ0A 3UR3C 3CHRA 1TJFA 3S7JA 3B0VC 2VSOE 1S7ZA 4N3CA 2IONA 4DBRA 4BG0A 4I6JA 4AE4A 3MKRA 5KYYA 5ENNA 4EQFA 4HFKB 2QFCA 2KM4A 4L2YA 5F5HA 3FTVA 3S29A 1Y8MA 5JJTA 5AIJA 2WB7A 4AE4B 4HORA 5KYYB 3QARA 2Y3GA 1OCOC 2VB6A 4MLPA 2VGXA 4CSAC 4F3VA 3DM5A 3O39A 2CFUA 3FY4A 3ABLC 1M56C 2WVIA 3LEWA 4KVOA 4I2ZA 4A1SA 3FTUA 3QKYA 5G55A 1SF8A 4OD4A 5BT1A 3OWTA 2XRHA 4DJAA 2I2OA 4QDLA 1MNEA 1E8XA 3LPZA 3AS8A 3FDHA 3R9AB 1TWAA 4UI9C 3DJUB 3B7SA 3CK9A 4KT6B 3FH7A 4JPSA 1D0ZA 3B0PA 4BJ1A 2X6FA 3QAQA 4W8KA 2XEVA 2IFUA 5L3QA 5ANLA 2EINC 4FLBA 1TWGA 4CS7A 3VLFA 5KJKA 4BT8A 2M63A 2L9JA 2X6KA 4AOFA 4OVVA 3K6BA 3D9JA 4CSAA 4CDRA 4UQZA 3FP3A 3S27A 4NY3A 3AG3C 3ZIMA 2C0LA 4DI3A 3LKUA 3NKDA 3I5QA 4GZCA 3EJNA 4PK4A 4P6IC 3APCA 4V3IA 1LF8A 4WWNA 3D9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5P A; 
#chains in the Genus database with same CATH topology
 3GM1 A;  3NYL A;  3ML9 A;  4LLC A;  3FUD A;  1BR2 A;  1D1C A;  3S9O A;  2J07 A;  1LVK A;  3ZTM A;  3PVL A;  4BEP A;  1PD0 A;  3DSV A;  4XLN F;  2BF0 X;  5D2M C;  3QVZ A;  2PQR A;  1EI7 A;  1YA9 A;  4BEJ A;  2ZIS A;  3Q4A B;  3ZXS A;  5DLJ A;  1L7C A;  3EH2 A;  5CI8 A;  1OT8 A;  4ILG A;  2I1K A;  2UUH A;  4U8Y D;  1A5E A;  4YL0 A;  3PNT B;  3PCV A;  3ZHE B;  5FIN A;  1JPJ A;  2H7B A;  1TN8 A;  4Q96 A;  3VAY A;  4HI8 A;  4ER9 A;  1KZP A;  2RD0 A;  3FTY A;  3FUJ A;  3TJ5 A;  3RJV A;  5CCM A;  3EGD A;  3ZXP A;  5JHB A;  5D66 A;  4HQD A;  4Y6C A;  3CVY A;  3C3R A;  3PZ2 A;  4OIP F;  5KYX A;  4LNG A;  5M72 A;  4HOT A;  4G11 A;  2XEE A;  1H7I A;  3PZ1 A;  4X8Q A;  4MS6 A;  3RK6 A;  3TG4 A;  3LVR E;  5AAO A;  3K1I A;  2YLD A;  5COG A;  5DQZ A;  4HI9 A;  2P9K G;  3QDN A;  5AAR A;  4XI9 A;  1NLX A;  4FAP B;  3LJN A;  1O1R A;  3WHN A;  3NDB B;  2GWW A;  3E37 A;  2HZ8 A;  4U63 A;  3W9F A;  4JHR A;  1E83 A;  5KYX B;  1H19 A;  1E2X A;  4JIO A;  3BG1 B;  2I15 A;  4UDV A;  4CDA A;  5EGY A;  1LD7 A;  2RSE B;  3ZGQ A;  2ZGD A;  4KC9 A;  1TN6 A;  3IBE A;  2A5U A;  1Q0D A;  4FWV A;  3IQ5 A;  3NMK A;  3ABM E;  4JUR I;  4HOQ A;  3ONK A;  1NBB A;  3W4Y A;  4J8E A;  4ZHB A;  3LLK A;  4Q69 A;  2LAH A;  4ULV A;  2BED A;  5CHE E;  3LYA A;  4E18 A;  1HH8 A;  3P1U A;  1FFH A;  1OCR E;  2ZPA A;  1H0A A;  1QVX A;  4AXH A;  1XZP A;  1KT0 A;  4AY5 A;  2FFH A;  2OOC A;  1B89 A;  2XPY A;  5DS4 A;  4P9T A;  4EBK A;  4HLE A;  4U5C E;  1PD1 A;  1M57 C;  2EPK X;  2XXA B;  1SA5 A;  5BXO A;  4TUU A;  3SP1 A;  5KJN A;  4A1G A;  2XM4 A;  1VK5 A;  3F47 A;  3M1C B;  1HW1 A;  4N3B A;  3E70 C;  3HJC A;  2NPU A;  4GZD A;  4IAO A;  1YJG A;  3ZVV A;  5EX3 A;  3MYF A;  5D0Q D;  3HXF A;  4PDX A;  2ILR A;  5DBK A;  2KSF A;  1HE1 A;  1LD8 A;  2LNI A;  2J9U A;  2J0W A;  2IY0 C;  4MRU A;  3NMJ A;  3Q6M A;  3ZDL A;  3DSX A;  3EG9 B;  1TR2 A;  4O6M A;  4DLO A;  4MKT A;  4JEA A;  3D9I A;  1N0R A;  3CHQ A;  3T8K A;  1Z5Z A;  4E7Z A;  2MHR A;  4N5C A;  4M63 A;  3GWN A;  3ABM C;  2P61 A;  2GRM A;  1EDU A;  5AQ9 A;  4ANJ A;  5LFA A;  3Q75 A;  3UMK A;  1UFB A;  2FF4 A;  4GPM A;  5A6A A;  2HE0 A;  4OAV B;  4HEA J;  1PC2 A;  1HFA A;  2HFI A;  2XL8 A;  4ZLD A;  3DPY A;  3OXF A;  2XPZ A;  1MHQ A;  2GRO B;  3P2B A;  1T6Q A;  1OWN A;  3ASD A;  3BUA A;  2WXO A;  1TFK B;  4RVB A;  2RG8 A;  1WM5 A;  3B13 A;  4PS3 A;  3IHY A;  2KQ9 A;  3LDZ A;  4J8D A;  3SI5 A;  3C3O A;  4YL1 A;  2GRL A;  2BUG A;  4LEU A;  5T3R A;  1UJJ A;  1ELR A;  2UY1 B;  5BQH A;  3UM0 A;  2CNW D;  4JCH A;  2P9P G;  3ECS A;  1XZQ A;  1MMA A;  4WAF A;  1Z3Y A;  1VDY A;  4AM9 A;  3AG2 E;  3SXZ A;  3UT4 A;  3JQ0 A;  3SBT B;  2KAT A;  5LOZ A;  3V2X A;  3LLI A;  4JXT A;  3U8V A;  1YZA A;  2Q9C A;  4G1T A;  4K03 A;  5CRU A;  2X51 A;  5CMY A;  2VAS A;  4JTC B;  3PEV B;  3FWV A;  3HNL A;  4FP7 A;  2EPM X;  4JJG A;  2NUT B;  2WVQ A;  2Q00 A;  2BKK B;  2XCB A;  3I4R B;  2DZO A;  1MMD A;  2PZI A;  3ZU7 B;  3DM9 B;  3KEZ A;  2FO1 E;  1WGW A;  5ITZ F;  2ZGG A;  2Q9B A;  5L0G A;  5ENT D;  2J4B A;  3G2U A;  1X5B A;  5EN5 D;  2VTB A;  2WXG A;  2B0J A;  3UPV A;  5EDS A;  4DX6 D;  5AC4 A;  3JT1 A;  3EUV A;  4KBL A;  3E32 A;  3ZN3 A;  2KYH A;  1NI1 A;  2XPI A;  1YDI A;  5CI9 A;  3QWP A;  4WWP A;  1RJ9 B;  1N9A A;  3G2T A;  2VSN A;  1G3N B;  4FAD A;  2XGO A;  1NU9 C;  2GRP B;  3AG2 C;  2R7U A;  3W9G A;  4BY6 A;  2Y39 A;  1H9T A;  3ITF A;  2GFH A;  3HXD A;  1Y4C A;  3ZIB A;  3C5R A;  2CFZ A;  2P9N G;  4DBQ A;  1HZ4 A;  1P5Q A;  3AS4 A;  1VOM A;  4CJO A;  3U66 A;  3LJB A;  2OU6 A;  3UT7 A;  1A41 A;  1Z3X A;  4UWF A;  4LLE A;  3S7F A;  3PEU B;  3EPV A;  1YCS B;  1JWG A;  5DS5 A;  3RAU A;  2JLB A;  2PQN A;  1NU7 D;  4FC8 A;  1OKK D;  2F37 A;  3ABK C;  2QTV A;  2XLM A;  2W4M A;  1LTX A;  3FU3 A;  5G2N A;  1OWO A;  4G25 A;  3C7J A;  1Q0G A;  4H4K C;  1OWL A;  4DOZ A;  3CHP A;  3Q49 B;  5E3A A;  2LIG A;  4U8H A;  1VYI A;  1V54 E;  4BEM J;  3L22 A;  2XS1 A;  5JUA A;  4RG9 A;  4MVS A;  3UIP C;  1U2V G;  1DCQ A;  4CIP A;  2KC7 A;  4EHP A;  5EHH A;  4G24 A;  1JMW A;  4GU5 A;  5D91 A;  1NZN A;  2J46 A;  2VGE A;  4WJ0 A;  4YDY A;  1T9K A;  1N52 A;  1FVH A;  5D92 A;  5F5F A;  1C03 A;  3CVL A;  4KYO B;  2HS5 A;  3C8G B;  1QSP A;  4GYT A;  4FLH A;  2J7P A;  2L0I A;  3APF A;  4IYP A;  2J45 A;  3SNH A;  3NYM A;  3PZD A;  3NZU A;  2WB2 A;  1JPL A;  2NUP B;  4AL0 A;  1TNZ A;  4OIO F;  2DGJ A;  3ESL A;  1VYK A;  5E2Q A;  2HYZ A;  1MX6 A;  3WG7 E;  1JOG A;  1YMP A;  3FUI A;  1H6P A;  3POV A;  1FT1 A;  2G62 A;  4HNA D;  1WG0 A;  1MYO A;  1TNU A;  3J5Q B;  3CVP A;  4APF A;  4B93 B;  4PR9 A;  1UG7 A;  1WDY A;  1ZU2 A;  3B95 A;  4I6G A;  3LEO A;  3K1H A;  1UN8 A;  2F8Y A;  4HE8 D;  4ME2 A;  5ARF A;  1TWH A;  2J49 A;  2DB4 A;  2LD6 A;  4C7O B;  1V54 C;  2XCC A;  4B0Z A;  4AL1 A;  3EIQ C;  3DPD A;  3EHR A;  3OAW A;  3L1M A;  4NQF A;  4DX2 A;  2WXQ A;  3AGU A;  3DZA A;  4LAC B;  4FX5 A;  4RQI A;  4CYM D;  4F1S A;  1FNT c;  4A63 B;  4GAA A;  4DJ9 A;  3U9M A;  2IO2 C;  4PJN A;  3TAX A;  3GEH A;  4Z9H A;  3G2S A;  1SQM A;  3RW0 A;  1E85 A;  1T6I A;  2KGO A;  3JZ0 A;  1OW8 A;  1Z3I X;  4A4A A;  3NOG D;  2VJ8 A;  3TWS A;  2DBA A;  4FHJ A;  5HI7 A;  2WXL A;  1DCE A;  1B68 A;  1D0X A;  1S05 A;  5KNH D;  3ZRH A;  5JT4 A;  2FO7 A;  4OAU C;  3WG7 C;  3W8H A;  2W4B A;  3NG1 A;  5A23 A;  3CZ6 A;  2D5R B;  5JMN D;  1OCC C;  4F6R D;  4L23 A;  4MVR A;  3EQL F;  4PUC A;  1K40 A;  3FEX A;  1QLE C;  4LUN U;  3APD A;  3AJI A;  4BTB A;  5E33 A;  2BTD A;  3HVE B;  4O6N A;  1HG2 A;  3CR3 A;  3Q6N A;  3AOU A;  1TQG A;  2Z15 A;  5FQ4 A;  5JLI A;  1ZVZ A;  2HM8 A;  2ETC A;  1NFN A;  1TEZ A;  1LM3 B;  3EFO A;  1MQS A;  3B7U X;  4UQY A;  3O10 A;  4E17 A;  1NZE A;  5CBN A;  2XZD G;  2H7O A;  3A11 A;  3PUK A;  4KNW A;  1VTM P;  4U5G A;  2R7X A;  3PHF 2;  4DLQ A;  3GEI A;  1Z23 A;  3U3W A;  4A55 A;  1ZW3 A;  4DRI B;  5TJ5 E;  3ZPJ A;  1HMO A;  2KC3 A;  256B A;  3DXK G;  3HNK A;  2VGY A;  1G5Z A;  1OW6 A;  1TFO B;  3HYM B;  4JC8 A;  3OXG A;  3AU5 A;  4ILI A;  3GWL A;  5G05 J;  4M7C A;  4BT9 A;  3HXB A;  4UQX A;  4YT8 A;  4J6I A;  3L8J A;  3EIJ A;  1M2V A;  3F46 A;  3FOO A;  5ENP D;  2ZXP A;  3JQ1 A;  3QWW A;  2PX0 A;  2MOW A;  2GW1 A;  4ABN A;  2D4U A;  4CDY A;  3DSU A;  4Z9J A;  1JCR A;  4XKC A;  2EIN E;  3M79 A;  4IUL A;  3US6 A;  4WWO A;  4FU3 A;  3UGP A;  4U95 D;  3CLJ A;  2ZD9 A;  4TXQ A;  3CEX A;  3LEV A;  2V3C C;  2P0N A;  3SXM A;  1SA4 A;  2KZT A;  1W2W A;  3HRA A;  3DRA A;  3TGO A;  3RO3 A;  5JHA A;  3GZS A;  2PBE A;  2XLD A;  3QOU A;  2A0B A;  1HG5 A;  3WXX A;  2BE5 F;  1KU2 A;  1WAT A;  4XWJ A;  5T4Y A;  4LNB A;  4B8A A;  1RKE A;  2PX3 A;  4R32 A;  1T5O A;  3CHM A;  5A7D B;  3ESK A;  2VGX B;  1HX8 A;  3B9Q A;  5BNW A;  3CVW A;  2P1A A;  3KYI A;  4UWG A;  4AEZ C;  2X6J A;  1KZO A;  1BU9 A;  2GRR B;  2XM0 A;  2KZT B;  4ATZ D;  2I1J A;  1HMD A;  5GPG B;  4CBE A;  5HQ8 A;  4J30 B;  2Q4F A;  4BTA A;  3WAQ A;  3FAJ A;  2OEW A;  1QZX A;  5A6K A;  1BI8 B;  3TJP A;  1VLS A;  3FUF A;  3ML8 A;  2WXR A;  4X0R A;  1K04 A;  2YQY A;  3D9K A;  1HE8 A;  4Y6W A;  2XHE A;  5DVW A;  2OKU A;  3I4U A;  3TJ6 A;  2W45 A;  1Q0K A;  2W9Y A;  5G05 C;  2HO1 A;  3UI2 A;  4M3O A;  5C1D A;  3DKA A;  3K1I C;  3RYL A;  2WQ7 A;  4ZLC A;  3CIA A;  4PS7 A;  4KI2 A;  2WVO A;  1OW7 A;  1YVI A;  3FFL A;  3BU8 A;  3LAY A;  4ANV A;  4XZ4 A;  4BWR A;  3DXJ F;  1FT2 A;  4BJ6 A;  2Q9A A;  5FZS A;  4KZC A;  4AV7 A;  3J5P A;  4DUI A;  1U89 A;  2R7W A;  1LE4 A;  4CS8 C;  2PP4 A;  3S84 A;  3LES A;  3D9L A;  4TXP A;  4O6Y A;  2R7V A;  3Q47 B;  2GGF A;  4NIK A;  3B7T A;  2OOE A;  1SMY F;  1NA0 A;  2C2L A;  1MQV A;  1SYQ A;  3FUN A;  2PNN A;  5T3T A;  2XZT G;  4MW8 A;  1OXK A;  1SW6 A;  4O1O A;  3MEK A;  4IN3 B;  1CGM E;  1TWC A;  3CVN A;  2X0C A;  3U9J A;  2Y3D A;  1A7V A;  4BFR A;  3TK0 A;  4AK9 A;  3ZFW A;  2P9S G;  2LFD A;  2IF4 A;  4MVU A;  1N4P A;  4JZY A;  4BJ5 C;  1JWF A;  1H6G A;  4GTP A;  3R9M A;  5A6B D;  4GML A;  4QFV A;  2A6H F;  3CK8 A;  2O9X A;  1ZHT A;  2P58 C;  2ZXR A;  1YA0 A;  3LS8 A;  4ATG A;  1YZC A;  3PNL B;  1TNB A;  2AW6 A;  1ZHZ A;  4EBB A;  2AWC A;  3PMR A;  1QZ2 A;  4W9R A;  3TWQ A;  4AIF A;  3HTK C;  2J9Q A;  3L34 A;  4L2L A;  3JCK C;  2V4H C;  3FH8 A;  1H6K A;  3S28 A;  2OND A;  1LIH A;  5A69 A;  3NB2 A;  4YND A;  2CW0 F;  1TJC A;  3ASN E;  4LDK A;  4N06 A;  4YT2 A;  5J90 A;  3EGD B;  1YAU O;  4LCT A;  4APO A;  3FEY A;  2CNW A;  2L6J A;  3DWW A;  2ETB A;  2YHC A;  5FZR A;  4RLY A;  4U0S A;  4CS8 A;  2QZA A;  3FHD A;  4DX7 D;  3GAN A;  1NSG B;  1NL4 A;  2A4Z A;  4I43 A;  4O7G A;  3RF3 A;  2YLI A;  1J8Y F;  1LPE A;  4U5E E;  3BG0 B;  4UUC A;  5CIV A;  4U9D A;  2Q7F A;  2XLE A;  4GEH A;  3V5X A;  3JTL O;  4BJT A;  3UM2 A;  2Y4U A;  3GOR A;  1NA3 A;  5KJL A;  1JCQ A;  3U5S A;  3TG5 A;  3T9O A;  4R7L A;  4KNV A;  3ASO E;  4N39 A;  4IJJ A;  3FHE A;  3C72 A;  3L17 A;  5AEN A;  4QI2 A;  3RRU A;  4HVB A;  2XGM A;  4J7Y A;  3QW1 A;  3PH0 C;  2E0I A;  4YWQ A;  3DSW A;  4BSZ B;  4GTT A;  4BJ5 A;  2A5E A;  5KCM A;  1OCZ E;  3G2W A;  3CKC A;  3KKB A;  3UNG C;  4E85 A;  3JSE O;  1SZA A;  2IM8 A;  2YKZ A;  1ELK A;  3RU0 A;  4MVZ A;  4XIF A;  2RFM A;  1G8X A;  3LNM B;  2L9B A;  3ASN C;  2AXU A;  1YAR O;  2XSE A;  2V26 A;  3SEO A;  1A17 A;  4CDN A;  1ZU5 A;  2WQ6 A;  2JX0 A;  2ZXO A;  2JAB A;  3AAA C;  5AQB A;  3FDQ A;  4N6H A;  1FCH A;  4J8F A;  3Q7L A;  3OTN A;  3PUJ A;  4EIY A;  4UWH A;  4GTS A;  4RSY A;  2R25 A;  4MQ9 F;  5EYP F;  4AJW A;  4C9B B;  1ZW2 A;  3H2V A;  1H6O A;  2VSY A;  3Q73 A;  3PS6 A;  1TR4 A;  2YZS A;  3GZ1 A;  3ZTZ A;  4PFP A;  2XGS A;  4GZ3 A;  4EBA A;  1EPU A;  2XS8 A;  2H7V C;  5BPP A;  3GOD A;  2NYJ A;  3ASO C;  3FUK A;  3K9I A;  1NFI E;  3L54 A;  3V2O A;  3IPM O;  4EZL A;  5FWQ A;  2A6E F;  3IV0 A;  1GQA A;  2EIL E;  3PRZ A;  3EGX A;  1EQ1 A;  1JCS A;  4GPK A;  1OCZ C;  2GRN B;  3NBN B;  1LI7 A;  3FXH A;  1WY6 A;  3RIP A;  2KNH A;  2H6G A;  1D9S A;  2XL4 A;  4NC3 A;  2FEZ A;  3MZL B;  4IWB A;  2L81 A;  2R7O A;  1T01 A;  5E3C A;  2CGE A;  3MYI A;  3MA5 A;  2YVK A;  3KSL A;  4WNE A;  3L08 A;  1OUV A;  4FHK A;  1Z6T A;  3T5V A;  3C8Z A;  3EGX B;  3ZYQ A;  3RKV A;  3PZ4 A;  2KBX A;  3TOL A;  2DIW A;  3D9M A;  4ANU A;  2WZF A;  3U2L A;  1DOW A;  3SO8 A;  5LX8 A;  1S63 A;  5JRA A;  2V4L A;  5A6C A;  4DPR A;  3N2Z B;  5EK0 A;  4HFG A;  4CGW A;  5BV0 A;  3TQO A;  3ABK E;  2MRI A;  3QZC A;  1N4Q A;  5COM A;  5LP0 A;  5BUO A;  3SBS A;  3OEO A;  4E7S A;  5CEC B;  4JZA A;  2L0T B;  1JPN A;  2NC9 A;  2R05 A;  5BXU A;  3ZKJ A;  4ZFH A;  2F22 A;  4EUK B;  2VH3 A;  1LKX A;  2EIL C;  2BL2 A;  5BW8 C;  4JCZ A;  2WM9 A;  2PF4 E;  4JTA B;  5AQA A;  2IBF A;  4JTD B;  3ZQV A;  3L9T A;  1HS6 A;  3O48 A;  2I9C A;  1N1C A;  4CGV A;  1IW7 F;  2OCC C;  4LER A;  1E8Z A;  1JUQ A;  3BRJ A;  4YVQ C;  3V7O A;  2H6I A;  4JEB A;  1U3D A;  2G3K A;  3HNJ A;  2PL2 A;  1OWM A;  4B8C B;  1G4W R;  3FTW A;  3ZVR A;  3JUI A;  4GMR A;  2VTB B;  3UGO A;  3DSS A;  3EU5 A;  1YLM A;  4J8S A;  3S0X A;  5F28 E;  4K5B A;  2QY9 A;  4JE9 A;  4XPY A;  1UN9 A;  2HMQ A;  2WXJ A;  1OQC A;  2AXV A;  3ZW3 A;  2YL3 A;  4C3B A;  3GW4 A;  1LS1 A;  2UUI A;  4H54 A;  3EZI A;  4P9F A;  5A6J A;  5KYU A;  1ZBP A;  1AUE A;  2AXZ A;  5JJ6 A;  1A0B A;  2WZG A;  3FUH A;  4CS9 C;  3L6A A;  1W3B A;  3ZYL A;  1I4Y A;  3TWR A;  3T6J A;  3EH1 A;  3CST A;  1BZ4 A;  3NZS A;  5E76 A;  3JYH A;  5AYW D;  3KSQ A;  2IQC A;  3VTX A;  4JW1 A;  4HXI A;  2LP4 A;  2KCL A;  3UMI A;  2EIK C;  4N2S A;  4GTR A;  3UIO C;  3U8P A;  3U4T A;  3LS1 A;  3KS2 A;  1FMW A;  2HKV A;  3R2P A;  3JXI A;  3C98 A;  2NSG A;  5KYU B;  3EDT B;  4LDR A;  2J8S D;  3KH2 A;  3W8I A;  5FQ6 A;  5B3I A;  1OR3 A;  2NG1 A;  5KJM A;  1HW2 A;  4JL0 A;  1D8D A;  5C2Y A;  5CRV A;  4CJG A;  4FUL A;  3TOM A;  1KLX A;  2R2L A;  3CVU A;  4KXK B;  5T1D B;  4AX2 A;  1UJK A;  5T8I A;  3Q9N C;  2L6H A;  5LCW J;  2AWY A;  3ATP A;  2R5S A;  4XEK A;  3FU5 A;  1OR2 A;  3EHQ A;  4DK5 A;  4PFO A;  3SZ7 A;  3ASF A;  1SZI A;  2OJQ A;  4HBD A;  2YL7 A;  4LNU D;  4KBQ A;  2CYD A;  4A3V A;  3TWX A;  1OCC E;  3ULY A;  5H7P A;  1E8Y A;  3QNK A;  5EX0 A;  4E6H A;  4OIR F;  4J32 B;  1HU3 A;  5FZQ A;  4B6I A;  2XEH A;  3CAX A;  2DWZ A;  2YHE A;  4H7Y A;  2P9U G;  5T3W A;  4P29 A;  5FT9 A;  4CS9 A;  2CHX A;  2JD3 A;  2YL1 A;  3CV0 A;  1YYH A;  5HSW A;  5ANR A;  2E87 A;  2J0X A;  2WPV A;  3Q9U C;  2C0M A;  3IKO B;  3CK7 A;  3V5Y A;  4GA2 A;  5BQI A;  2QLA A;  3UQ3 A;  2V0P A;  3VLD A;  4TV3 A;  3TWW A;  1M2O A;  4J0U A;  1IXV A;  2MYO A;  4U96 D;  2KW3 C;  4N4W A;  4I44 A;  3FAP B;  1FMV A;  2VQ2 A;  1ZU4 A;  4U5D E;  3SGH A;  3CSK A;  4DX5 D;  4JHK A;  1PAQ A;  3LCA A;  4K5C A;  2MHK A;  4EWC A;  1SVX A;  3IHU A;  5KNG A;  2G3V A;  4RD9 A;  2FI7 A;  2P6V A;  4I3M A;  4O1P A;  3GZ2 A;  4U5H A;  3AG4 E;  4LSZ E;  1IKN D;  1R4T A;  3I4G A;  3S2A A;  4GYY A;  1K05 A;  3TWU A;  2WQH A;  3DBS A;  4EZK A;  1VMA A;  4DRX E;  3HIZ A;  2EPL X;  1V55 C;  1TN7 A;  4ULW A;  2CG3 A;  2WXM A;  5EKQ D;  4ANX A;  1V74 B;  4C48 B;  2NSF A;  5FTP A;  4XTK A;  4WUY A;  3BEH A;  3R7R A;  2YWA A;  5ARG A;  3DE8 A;  4E0H A;  1KNY A;  3ASG A;  1R5I D;  1T6U A;  4FJY A;  1H2V C;  4CCA A;  5ENR D;  1V4A A;  1H2T C;  2XEN A;  1LI5 A;  3C8G D;  1CGN A;  2KCV A;  3BEE A;  2CHW A;  3TUL A;  4JKV A;  4KMO A;  3UX4 A;  1X81 A;  5B3S E;  1H2U A;  4PJJ A;  2PM6 A;  3V31 A;  4G8K A;  3WOD F;  2WL8 A;  3M4B A;  3EFO B;  1WAO 1;  2ZIR A;  4YT5 A;  4O60 A;  1RMV A;  3MV3 B;  4XI0 A;  5CMW A;  4JA7 A;  2DCP A;  2VCA A;  2E2E A;  3LY8 A;  4U07 A;  3ZNG A;  4DI4 A;  4BES A;  2J7P D;  1ZB1 A;  3LY9 A;  3PDN A;  3JCU Q;  3AG4 C;  1BR1 A;  3GEE A;  2J09 A;  1TKN A;  3D3M A;  3SYN A;  3LVQ E;  3LJ3 A;  3L8I A;  3Q5M A;  4MBG A;  3U64 A;  3U3F A;  2B6C A;  2Y69 C;  4U8V D;  3RFY A;  4D10 C;  1O87 A;  1BD8 A;  1HF8 A;  4GA1 A;  1U6H A;  1TNO A;  2XRZ A;  4B94 A;  3S7D A;  1M2V B;  2R7R A;  3L13 A;  3O6X A;  4PJL A;  4LRZ A;  3I5P A;  3SQV A;  3RIB A;  4BJ6 C;  2A0U A;  4G7O F;  3TXM A;  4CEM A;  3RH3 A;  2L6F A;  3MCX A;  3IQT A;  4GCN A;  4J7T A;  3NAW A;  4G8L A;  2R7Q A;  3FTS A;  5IY5 E;  1LS4 A;  4WGY A;  2YLG A;  1K1B A;  1AP7 A;  1Z7Q c;  5EID A;  1RCP A;  4ANW A;  2A68 F;  1INZ A;  1N0Q A;  4XX5 A;  4HRN A;  2LK4 A;  3C63 A;  1IHG A;  4CT4 A;  1Z6A A;  5B3S C;  1NFO A;  2OVF A;  2NSZ A;  2M4E A;  4UI9 K;  4XQ1 A;  5G04 J;  4BER A;  2P2C P;  2WMO A;  2P7V A;  4IB4 A;  2F8X K;  1ST6 A;  1EA8 A;  2J9B A;  2PFD A;  4JEH A;  2V5F A;  1ZHY A;  3JRT A;  1RKE B;  4PS8 A;  2ZXW E;  1E84 A;  3TWT A;  3RQG A;  5L0D A;  5B1B C;  2YEV A;  3D9N A;  4U7E B;  2AP3 A;  3UUX A;  4OD5 A;  2IOL A;  3W2W A;  1QKR A;  4NTA A;  3MV2 B;  2HSQ A;  4U5F E;  2FBN A;  2RFA A;  3TL5 A;  1EKY A;  3QWV A;  3SFX A;  4GCO A;  4OIQ F;  2J08 A;  3E4B A;  2QC9 A;  4MW3 A;  5FZT A;  5DS6 A;  1Q2Z A;  1ZYR F;  2QY7 A;  2X3M A;  5JVE A;  3HDX A;  4U04 A;  3LY7 A;  2X6I A;  5IY5 C;  1RW2 A;  5ENO D;  2HUJ A;  1OXJ A;  3Q7G A;  4WNG A;  4I17 A;  4K7B A;  3SY2 A;  2MYS A;  2X6H A;  1WWP A;  1DVP A;  2Y1L E;  3JUE A;  3CKB A;  4Q4Z F;  1JR8 A;  3ULE G;  4G0H A;  1HO8 A;  3ZYM A;  1N94 A;  3UMV A;  4K0R A;  2J9V A;  1I4Z A;  2R17 C;  2A69 F;  4G78 A;  1QQE A;  3CVX A;  3VTY A;  3AU4 A;  2ZXW C;  4N2Q A;  4GB9 A;  1N11 A;  4BX8 A;  1Z5S C;  2AWI A;  4DVY P;  2KCK A;  4FES A;  3QVY A;  4JHJ A;  3D9H A;  2HJM A;  1GM5 A;  3D9O A;  2EIM E;  5D0O D;  3ZHE A;  1JRA A;  4N6C A;  4YDW A;  3FMS A;  3CQZ A;  4I2W A;  4NUR A;  3SNX A;  3UM3 A;  3NQP A;  4WNF A;  3NRH A;  2GA0 A;  3DE9 A;  4BX9 A;  3RQE A;  2Y0B G;  4I1O B;  2XQ0 A;  3CVQ A;  5G04 C;  3MYV A;  3TD7 A;  5CEA A;  3KPH A;  1CPQ A;  3Q15 A;  1EF1 C;  4O79 A;  2IJG X;  4Z9I A;  3CQG B;  3FTZ A;  2RKK A;  3HKK A;  4CIH A;  2DZN A;  4HLL A;  1APC A;  3PDM P;  2EQX A;  1O1T A;  1YYX A;  1PCX A;  1L3P A;  4C3D A;  3D9P A;  5FQ7 A;  2IU1 A;  2B0H A;  4HFF B;  2Q3T A;  3CQC B;  3MX3 A;  3GYZ A;  2C04 A;  3QK0 A;  4EZJ A;  3SZR A;  1BR4 A;  4PH4 B;  3NMI A;  2H8A A;  3OA1 A;  3RO2 A;  3G4Z A;  1ORY A;  1E90 A;  1N95 A;  5AGF A;  1GGQ A;  2LQG A;  2XLO A;  1XGW A;  4NQ0 A;  3MBG A;  1UW4 B;  3AQB A;  3EHN A;  1U3C A;  3U2M A;  1ELW A;  5ENS D;  2QE9 A;  3PE4 A;  4YVO A;  2L6B A;  5L0H A;  2NXP A;  3T5X A;  2EIM C;  4Q7C A;  3T8M A;  4MVO A;  2IXP A;  4CDM A;  3EZH A;  1ORJ A;  5AJD A;  4G26 A;  3H2U A;  3CGH A;  2IXN A;  3M15 A;  3KAE A;  2IOS A;  1MND A;  5FJY A;  1PY1 A;  3DMD A;  2EPN A;  4FA6 A;  2FGY A;  3KD7 A;  3T6G B;  3QMK A;  4F1P A;  2CCY A;  3VYW A;  2XXA A;  1QPU A;  4Q94 A;  3TXN A;  4RBN A;  4BPM A;  3JSZ A;  3L0I A;  3U9W A;  3ZG1 A;  3RRM B;  2OEX A;  5KYW A;  3PE3 A;  4K0D A;  2OQM A;  5K0I A;  4GTV A;  2B0O E;  3H65 A;  1NP7 A;  4U0U A;  4JA9 A;  3SF4 A;  2WXH A;  3IHV A;  2P9L G;  1FFT C;  2WXK A;  3X2Q E;  3RQF A;  3FU0 A;  2OEV A;  3EG9 A;  1YA7 O;  2WXP A;  1E7V A;  3FTX A;  3VRC A;  4L9P A;  5HKP A;  4YT4 A;  2BC5 A;  3VM6 A;  2XLW A;  2RD9 A;  3NYJ A;  3UMH A;  4O6F A;  4H7X A;  3DWL G;  4EHM A;  4URK A;  5KYW B;  1U0B B;  2XLV A;  2OG2 A;  2LXM A;  4TRQ A;  1D1A A;  1I5N A;  3R7Q A;  3S7B A;  1BBH A;  2A1D D;  4Q5S F;  3DD7 A;  3QB2 A;  3T4R A;  4F4B A;  1Z63 A;  2YHS A;  2YIN A;  3JRM O;  4GMJ A;  1QNF A;  1A7E A;  3CVV A;  3ISM C;  5EIL A;  4AP2 A;  1KTM A;  2I8B A;  3VF0 A;  4D4X A;  1O5M A;  1S0P A;  2HV6 A;  2BKG A;  4HRM B;  1OKK A;  3SXY A;  5AN8 A;  2WVN A;  3O4Z A;  2R03 A;  1UOH A;  1KT1 A;  2WXF A;  3DJN B;  4G7Z F;  1E86 A;  4IRU A;  2EPO A;  4K1O A;  4ILH B;  1G4U S;  5JJ7 A;  1AVO B;  4L6R A;  1ZHX A;  4U5B E;  1O5H A;  4OIN F;  1K8K G;  5KYN A;  1K3Z D;  2UY1 A;  3AG1 E;  1OCR C;  5JP7 A;  2OCC E;  2Y3A A;  2J9W A;  2HR2 A;  2LCH A;  3NOC D;  2J4D A;  3DI5 A;  1WN0 A;  1GW6 A;  1TYQ G;  5CED B;  3U3B A;  3N24 A;  2VYI A;  3UXG A;  1IQR A;  3L82 A;  3X2Q C;  5JA4 D;  1VLT A;  1YYJ A;  4GTQ A;  2CDQ A;  2VSX E;  3DAG A;  3IEE A;  1MZC A;  3CHS A;  2M64 A;  2QNL A;  2L7A A;  4MTO A;  2LFF A;  4C0E A;  3IQ6 A;  3QC1 A;  2CG2 A;  3F6Q A;  4GA0 A;  4A3T A;  3G2V A;  3QW0 A;  4WGZ A;  3FU6 A;  1IHB A;  2XRY A;  4G2V A;  5EIB E;  2NUT A;  3SFY A;  2IO3 C;  1RZ4 A;  3HXE A;  4G23 A;  3QJZ A;  4E0I A;  2LUH A;  4NCQ A;  3DEP A;  3TWV A;  4C3E A;  4Z68 A;  3G4X A;  4PAC A;  1MMG A;  2Y4T A;  1C02 A;  2HV7 A;  1HY5 A;  5FCL A;  4YJW A;  1ZZP A;  4HB5 A;  4WND A;  1D8E A;  2FAP B;  3VLE A;  2R7S A;  2R7T A;  2EIK E;  3EHM A;  1CGO A;  2H6F A;  3CEQ A;  3CHO A;  2TMV P;  2LSE A;  3PRE A;  1Y6I A;  1N54 A;  5J08 A;  5JS5 A;  3ZUV B;  3URZ A;  4EBA G;  3G50 A;  2OVB A;  1RJ9 A;  1AEP A;  3AG1 C;  2IOQ A;  4GTO A;  3ZYK A;  4HS2 A;  2IYL D;  4F7A A;  5BV1 A;  3N71 A;  3UTM A;  5DIZ A;  3K66 A;  4A2N B;  4XLP F;  4C0M A;  5B1A E;  3N0T A;  4MTG A;  1PV3 A;  2MWQ A;  4BSX A;  3K7D A;  4XPX A;  1H9G A;  2LAI A;  4UWL A;  5FQ8 A;  4D4N A;  2HMZ A;  2IXM A;  5COF A;  2F0Y A;  3V5Z A;  4RDA A;  2DYS E;  4MVM A;  2AU5 A;  1Q0F A;  2KJG A;  4I1M A;  1J8M F;  4QI0 A;  1L5J A;  1MMN A;  5AJL A;  2J8W A;  1N4S A;  3B7B A;  4N3A A;  1NG1 A;  4YN0 B;  2KK1 A;  3ZC4 A;  4WAB A;  2WMN A;  3KL4 A;  5CCL A;  2QYJ A;  5CER B;  3AS5 A;  2QUP A;  1FTS A;  4CRW A;  3E33 A;  2EIJ E;  3O55 A;  4L1B A;  1CPR A;  4NAC A;  2V8S E;  4NRH B;  2PM7 A;  1M6T A;  3K33 A;  4ONS A;  3M4C A;  4YL3 A;  5CBO A;  3UIN C;  4DRH B;  4OYS A;  5E75 A;  5BUZ A;  3FOP A;  4JRZ A;  5JSL A;  1E96 B;  1EYH A;  4GYO A;  1DOV A;  3W2V A;  4DVZ A;  1D1B A;  3B29 A;  4AVX A;  3DXM G;  4IAQ A;  1FVF A;  1E8W A;  2XL6 A;  3FUL A;  4GZ6 A;  3HG0 D;  1DC2 A;  3ASH A;  3C8G A;  1JAF A;  5B1A C;  4IGG A;  2AJA A;  2QYU A;  2YRF A;  1BLX B;  3T9K A;  3KYJ A;  3MLG A;  3ULQ A;  3LS0 A;  2NUP A;  3SD5 A;  5KWD A;  2ZU6 B;  2WXN A;  2ETS A;  2IXO A;  3JYS A;  2CHZ A;  2X38 A;  2DYS C;  3DEO A;  3FH5 A;  3R7C A;  3SFZ A;  1XNF A;  4JB8 P;  3FUE A;  2IEJ A;  3RSE G;  2JPU A;  1IYG A;  1RXQ A;  5L0C A;  4PJM A;  4YK5 A;  4XPW A;  4JC7 A;  2WZL A;  1HXI A;  2C03 A;  1ZHW A;  3HXC A;  1V55 E;  3MGB A;  2EIJ C;  4C7O A;  1ORS C;  3HLZ A;  4OVU A;  1SR2 A;  4ACK A;  4HOU A;  2JEK A;  4TUM A;  4EEC A;  2PNO A;  4RG6 A;  2Y3H A;  3KEA A;  4FJZ A;  5HRY A;  3E30 A;  3AQC A;  3RRN B;  4DXW A;  2Q7R A;  3ONL A;  3Q78 A;  4NTB A;  4CT0 A;  2V5Q C;  5FIO A;  2YQ8 A;  1RKC A;  3LXU X;  5DQT A;  3B71 A;  2LSU A;  1D0Y A;  1E7U A;  1QBQ A;  3IEG A;  3FVY A;  2DYR E;  2AVP A;  3IQC A;  3HHM A;  4YDO A;  2VCC A;  1S70 B;  2L6G A;  4I6E A;  1BDJ B;  4W8P A;  4QQI A;  4CDV A;  3B7R L;  3AGT A;  2I6H A;  4DX1 A;  5L0I A;  3KMI A;  2R59 A;  4LDQ A;  3UT8 A;  3OXL A;  5KBA A;  1SZ9 A;  1F1M A;  4MND A;  1IZM A;  1FPP A;  4I1A A;  3L16 A;  3B0U X;  3E9V A;  2AVK A;  3RKO F;  3ENE A;  3FUM A;  3MKQ A;  1BPO A;  4GTM A;  2XLH A;  1OWP A;  3DST A;  3DAF A;  4JJF A;  3HVE A;  3NKE A;  4L7T A;  1XWJ A;  1UG3 A;  4GZ5 A;  4AY6 A;  4XE0 A;  3ZEF A;  4HOS A;  2Y69 E;  3Q7A A;  3ZSU A;  3PZ3 A;  5LCW C;  4TXR A;  2OJE D;  4F53 A;  5L3V A;  4KVM A;  3SHF A;  4G7H F;  2Y3B A;  3X1O A;  4JEU A;  4ACL A;  2LSV A;  2WXI A;  4GYW A;  4UWK A;  3MJW A;  2P9I G;  3NF1 A;  3J06 A;  3JYY A;  5L0J A;  2LO6 A;  2YNQ A;  1OCO E;  4B89 A;  4I9E A;  1WOL A;  2FUL A;  3MKQ B;  1IQU A;  3I3N A;  4U0Z A;  4YDE A;  4JVS A;  3CSF A;  5ENQ D;  2OV8 A;  4BET A;  2R9R B;  2UWJ G;  2GAQ A;  4XKB A;  3ABL E;  4UI9 J;  2YL0 A;  4EPZ A;  4EBJ A;  2DYR C;  4I9C A;  3LNR A;  2DVW A;  1LE2 A;  3UKU G;  1DNP A;  3T6B A;  4KZ0 A;  3UR3 C;  3CHR A;  1TJF A;  3S7J A;  2KXP C;  3B0V C;  2VSO E;  1BI7 B;  1OXB A;  1S7Z A;  4N3C A;  2ION A;  4DBR A;  4BG0 A;  4XEF A;  4AE4 A;  5L0F A;  4I6J A;  3AJM A;  3C18 A;  3Q7F A;  3MKR A;  5KYY A;  5ENN A;  5B1B E;  4EQF A;  3E34 A;  4HFK B;  2QFC A;  1K1A A;  1MJ0 A;  2KM4 A;  3C3Q A;  1VB5 A;  4CX9 A;  1O3U A;  4L2Y A;  1C17 M;  5F5H A;  5EYL A;  3FTV A;  2H6H A;  3S29 A;  1OY3 D;  1Y8M A;  3A9C A;  5JJT A;  5AIJ A;  3UKR G;  2ICW G;  2WB7 A;  4AE4 B;  4HOR A;  5KYY B;  3JXJ A;  1Q0M A;  3QAR A;  3GM3 A;  5A6B A;  3UM1 A;  2ETA A;  2Y3G A;  1OCO C;  3V79 K;  3V30 A;  4GQH A;  2VB6 A;  3QTH A;  4MLP A;  1MX2 A;  2VGX A;  3ZWI A;  4CSA C;  4F3V A;  3DM5 A;  3O39 A;  2CFU A;  2DI3 A;  4LG6 A;  3ZQY A;  3FY4 A;  4HRL A;  3ABL C;  2VC9 A;  2R02 A;  1M56 C;  3S90 A;  1A7D A;  3LUT B;  4MS2 A;  2WVI A;  3LEW A;  4J7W A;  4KVO A;  3C62 A;  3AG3 E;  4I2Z A;  4A1S A;  3FTU A;  4XEV A;  4DRJ B;  3U0C A;  5BQG A;  4K5A B;  3QKY A;  5G55 A;  1SF8 A;  4OD4 A;  5BT1 A;  3OWT A;  2XRH A;  4DJA A;  3RVZ A;  2I2O A;  4QDL A;  1MNE A;  2ASR A;  1E8X A;  1O1S A;  3AS8 A;  1HE9 A;  5AC5 A;  1WAS A;  3GM2 A;  3LPZ A;  1Y6D A;  3FDH A;  3R9A B;  1WTY A;  3SXK A;  1TWA A;  4UI9 C;  4N5Q A;  3DJU B;  3Q79 A;  3B7S A;  3CK9 A;  1FAP B;  4KT6 B;  3FH7 A;  4JPS A;  1D0Z A;  3B0P A;  4BJ1 A;  4JD2 G;  2X6F A;  1GS9 A;  3IXE A;  3QAQ A;  4IAR A;  2GRQ B;  4W8K A;  1TNY A;  3RVY A;  2XEV A;  3MFN A;  2IFU A;  5L3Q A;  5ANL A;  2EIN C;  5AQ7 A;  4FLB A;  1TWG A;  4CS7 A;  4XEI G;  3VLF A;  5KJK A;  4BT8 A;  1AWC B;  2M63 A;  1KPS B;  4J8Y A;  1N4R A;  4NTF A;  2L9J A;  2X6K A;  2HJ3 A;  4AOF A;  4OVV A;  3K6B A;  3D9J A;  4EKW A;  4CSA A;  3EU9 A;  4CDR A;  1FR0 A;  4UQZ A;  2HSB A;  1MX4 A;  3FP3 A;  3S27 A;  2VCB A;  1QYM A;  4NY3 A;  3AG3 C;  5HS0 A;  4MVQ A;  4CZ2 D;  2LXL A;  3ZIM A;  2C0L A;  4DI3 A;  2GDC A;  3LKU A;  3NKD A;  3I5Q A;  1S64 A;  4GZC A;  3EJN A;  4PK4 A;  4P6I C;  5HV9 A;  3APC A;  4V3I A;  1QQ3 A;  4MTF A;  4U9E A;  1LF8 A;  4WWN A;  3BQO A;  3HNI A; 
#chains in the Genus database with same CATH homology
 3NYL A;  3ML9 A;  4LLC A;  3FUD A;  1BR2 A;  1D1C A;  2J07 A;  1LVK A;  3PVL A;  1PD0 A;  4XLN F;  2BF0 X;  2PQR A;  4BEJ A;  3Q4A B;  3ZXS A;  5DLJ A;  3EH2 A;  5CI8 A;  4ILG A;  2I1K A;  3PNT B;  3ZHE B;  1JPJ A;  2H7B A;  4Q96 A;  3VAY A;  2RD0 A;  3FTY A;  3FUJ A;  3RJV A;  5CCM A;  3EGD A;  5JHB A;  4Y6C A;  3CVY A;  4OIP F;  5KYX A;  5M72 A;  4HOT A;  4G11 A;  4MS6 A;  3RK6 A;  3TG4 A;  3LVR E;  5DQZ A;  3QDN A;  4XI9 A;  3NDB B;  4U63 A;  4JHR A;  5KYX B;  1H19 A;  3BG1 B;  5EGY A;  3ZGQ A;  4KC9 A;  3IBE A;  2A5U A;  4FWV A;  4JUR I;  4HOQ A;  3ONK A;  4J8E A;  3LLK A;  4Q69 A;  2LAH A;  5CHE E;  3LYA A;  1HH8 A;  3P1U A;  1FFH A;  2ZPA A;  1H0A A;  4AXH A;  1KT0 A;  4AY5 A;  2FFH A;  1B89 A;  2XPY A;  5DS4 A;  4HLE A;  4U5C E;  1PD1 A;  1M57 C;  2XXA B;  4TUU A;  3SP1 A;  5KJN A;  4A1G A;  1VK5 A;  3F47 A;  3M1C B;  4N3B A;  3E70 C;  3HJC A;  4GZD A;  4IAO A;  3ZVV A;  5EX3 A;  5D0Q D;  4PDX A;  2ILR A;  5DBK A;  2LNI A;  2J9U A;  2J0W A;  4MRU A;  3Q6M A;  3EG9 B;  1TR2 A;  4O6M A;  4DLO A;  4MKT A;  3D9I A;  3CHQ A;  1Z5Z A;  4E7Z A;  4N5C A;  4M63 A;  3ABM C;  2GRM A;  1EDU A;  4ANJ A;  5LFA A;  3UMK A;  2FF4 A;  4HEA J;  1PC2 A;  1HFA A;  4ZLD A;  3OXF A;  2XPZ A;  1MHQ A;  3P2B A;  1OWN A;  3ASD A;  2WXO A;  4RVB A;  2RG8 A;  1WM5 A;  3B13 A;  4PS3 A;  3IHY A;  2KQ9 A;  3LDZ A;  4J8D A;  3SI5 A;  2GRL A;  2BUG A;  4LEU A;  5T3R A;  1UJJ A;  1ELR A;  2UY1 B;  2CNW D;  4JCH A;  3ECS A;  1MMA A;  4WAF A;  1Z3Y A;  1VDY A;  4AM9 A;  3UT4 A;  3JQ0 A;  3SBT B;  2KAT A;  5LOZ A;  3LLI A;  4JXT A;  2Q9C A;  4G1T A;  4K03 A;  2X51 A;  5CMY A;  2VAS A;  3PEV B;  3FWV A;  4FP7 A;  4JJG A;  3I4R B;  2NUT B;  2WVQ A;  2XCB A;  1MMD A;  2PZI A;  3DM9 B;  3KEZ A;  1WGW A;  2Q9B A;  2J4B A;  3G2U A;  1X5B A;  2VTB A;  2WXG A;  2B0J A;  3UPV A;  5EDS A;  3JT1 A;  4KBL A;  3ZN3 A;  2XPI A;  5CI9 A;  3QWP A;  4WWP A;  1RJ9 B;  3G2T A;  2VSN A;  4FAD A;  2XGO A;  1NU9 C;  3AG2 C;  2R7U A;  4BY6 A;  2Y39 A;  3ITF A;  2GFH A;  3ZIB A;  2CFZ A;  4DBQ A;  1HZ4 A;  1P5Q A;  3AS4 A;  1VOM A;  3U66 A;  3LJB A;  3UT7 A;  1Z3X A;  4UWF A;  4LLE A;  3S7F A;  3PEU B;  3EPV A;  1JWG A;  5DS5 A;  2JLB A;  2PQN A;  1NU7 D;  4FC8 A;  1OKK D;  3ABK C;  2QTV A;  2W4M A;  3FU3 A;  5G2N A;  1OWO A;  4G25 A;  4H4K C;  1OWL A;  4DOZ A;  3CHP A;  3Q49 B;  5E3A A;  4U8H A;  1VYI A;  3L22 A;  4RG9 A;  2KC7 A;  5EHH A;  4G24 A;  4GU5 A;  5D91 A;  1NZN A;  2J46 A;  4WJ0 A;  1N52 A;  1FVH A;  5D92 A;  5F5F A;  3CVL A;  4KYO B;  4GYT A;  4FLH A;  2J7P A;  2L0I A;  3APF A;  4IYP A;  2J45 A;  3SNH A;  3NYM A;  3PZD A;  3NZU A;  2WB2 A;  1JPL A;  2NUP B;  4OIO F;  2DGJ A;  3ESL A;  1VYK A;  5E2Q A;  2HYZ A;  3FUI A;  3POV A;  2G62 A;  3CVP A;  4APF A;  1ZU2 A;  4I6G A;  3K1H A;  1UN8 A;  4HE8 D;  4ME2 A;  5ARF A;  1TWH A;  2J49 A;  4C7O B;  1V54 C;  2XCC A;  4B0Z A;  3EIQ C;  3DPD A;  3OAW A;  2WXQ A;  3DZA A;  4LAC B;  4FX5 A;  4F1S A;  4GAA A;  4PJN A;  3TAX A;  3G2S A;  1SQM A;  2KGO A;  1Z3I X;  2VJ8 A;  2DBA A;  4FHJ A;  5HI7 A;  2WXL A;  1D0X A;  3ZRH A;  2FO7 A;  3WG7 C;  3W8H A;  2W4B A;  3NG1 A;  5A23 A;  3CZ6 A;  2D5R B;  1OCC C;  4L23 A;  3EQL F;  4PUC A;  3FEX A;  1QLE C;  4LUN U;  3APD A;  4BTB A;  5E33 A;  2BTD A;  3HVE B;  4O6N A;  1HG2 A;  3CR3 A;  3Q6N A;  2Z15 A;  5FQ4 A;  2HM8 A;  1TEZ A;  3EFO A;  1MQS A;  3B7U X;  4UQY A;  1NZE A;  2H7O A;  3PUK A;  4KNW A;  4U5G A;  2R7X A;  3PHF 2;  4DLQ A;  1Z23 A;  3U3W A;  4A55 A;  3ZPJ A;  2VGY A;  3HYM B;  4JC8 A;  3OXG A;  3AU5 A;  4ILI A;  5G05 J;  4BT9 A;  4UQX A;  4YT8 A;  4J6I A;  3EIJ A;  1M2V A;  3F46 A;  2ZXP A;  3JQ1 A;  3QWW A;  2PX0 A;  2MOW A;  2GW1 A;  4ABN A;  4XKC A;  4IUL A;  4WWO A;  4FU3 A;  3UGP A;  3CLJ A;  3LEV A;  2V3C C;  2KZT A;  1W2W A;  3TGO A;  3RO3 A;  5JHA A;  3GZS A;  3QOU A;  1HG5 A;  3WXX A;  2BE5 F;  1KU2 A;  4XWJ A;  5T4Y A;  4B8A A;  2PX3 A;  3CHM A;  5A7D B;  3ESK A;  2VGX B;  1HX8 A;  3B9Q A;  5BNW A;  3CVW A;  4UWG A;  4AEZ C;  2X6J A;  2KZT B;  2I1J A;  4CBE A;  5HQ8 A;  4J30 B;  4BTA A;  3FAJ A;  1QZX A;  3TJP A;  3FUF A;  3ML8 A;  2WXR A;  4X0R A;  3D9K A;  1HE8 A;  4Y6W A;  2XHE A;  5DVW A;  3I4U A;  2W45 A;  2W9Y A;  5G05 C;  2HO1 A;  4M3O A;  5C1D A;  3K1I C;  3RYL A;  2WQ7 A;  4ZLC A;  3CIA A;  4PS7 A;  4KI2 A;  2WVO A;  3FFL A;  3LAY A;  4ANV A;  4XZ4 A;  4BWR A;  3DXJ F;  4BJ6 A;  2Q9A A;  5FZS A;  4KZC A;  4AV7 A;  2R7W A;  4CS8 C;  2PP4 A;  3LES A;  3D9L A;  4O6Y A;  2R7V A;  3Q47 B;  2GGF A;  3B7T A;  2OOE A;  1SMY F;  1NA0 A;  2C2L A;  3FUN A;  5T3T A;  3MEK A;  4IN3 B;  1TWC A;  3CVN A;  2Y3D A;  4BFR A;  4AK9 A;  3ZFW A;  2IF4 A;  4JZY A;  4BJ5 C;  1JWF A;  4GML A;  4QFV A;  2A6H F;  3CK8 A;  2O9X A;  1ZHT A;  2P58 C;  2ZXR A;  1YA0 A;  3LS8 A;  4ATG A;  3PNL B;  2AW6 A;  1ZHZ A;  4EBB A;  3PMR A;  1QZ2 A;  4W9R A;  4AIF A;  3HTK C;  2J9Q A;  3L34 A;  4L2L A;  3JCK C;  3FH8 A;  1H6K A;  3S28 A;  2OND A;  4YND A;  2CW0 F;  1TJC A;  4N06 A;  4YT2 A;  5J90 A;  3EGD B;  4LCT A;  4APO A;  3FEY A;  2CNW A;  2L6J A;  2YHC A;  5FZR A;  4U0S A;  4CS8 A;  3FHD A;  3GAN A;  2A4Z A;  4I43 A;  4O7G A;  1J8Y F;  4U5E E;  3BG0 B;  2Q7F A;  4GEH A;  4BJT A;  2Y4U A;  1NA3 A;  5KJL A;  3TG5 A;  4R7L A;  4KNV A;  4N39 A;  4IJJ A;  3FHE A;  3L17 A;  5AEN A;  4QI2 A;  3RRU A;  4HVB A;  2XGM A;  3PH0 C;  2E0I A;  4YWQ A;  4BJ5 A;  5KCM A;  3G2W A;  3CKC A;  3KKB A;  3UNG C;  4E85 A;  1SZA A;  1ELK A;  3RU0 A;  4XIF A;  1G8X A;  2L9B A;  3ASN C;  2AXU A;  2XSE A;  2V26 A;  3SEO A;  1A17 A;  4CDN A;  1ZU5 A;  2WQ6 A;  2ZXO A;  3FDQ A;  1FCH A;  4J8F A;  3Q7L A;  3OTN A;  3PUJ A;  4UWH A;  4RSY A;  4MQ9 F;  4AJW A;  4C9B B;  2VSY A;  3PS6 A;  2YZS A;  3GZ1 A;  4PFP A;  2XGS A;  4GZ3 A;  4EBA A;  1EPU A;  2H7V C;  5BPP A;  3GOD A;  3ASO C;  3FUK A;  3K9I A;  3L54 A;  4EZL A;  5FWQ A;  2A6E F;  3IV0 A;  3PRZ A;  3EGX A;  4GPK A;  1OCZ C;  1WY6 A;  3RIP A;  2KNH A;  2XL4 A;  2FEZ A;  3MZL B;  4IWB A;  2L81 A;  2R7O A;  5E3C A;  2CGE A;  3MA5 A;  4WNE A;  3L08 A;  1OUV A;  4FHK A;  1Z6T A;  3T5V A;  3EGX B;  3ZYQ A;  3RKV A;  2DIW A;  3D9M A;  4ANU A;  2WZF A;  5LX8 A;  2V4L A;  5A6C A;  4DPR A;  3N2Z B;  4HFG A;  4CGW A;  5BV0 A;  2MRI A;  3QZC A;  5LP0 A;  5BUO A;  3SBS A;  3OEO A;  4E7S A;  4JZA A;  2L0T B;  1JPN A;  2NC9 A;  2VH3 A;  1LKX A;  2EIL C;  5BW8 C;  2WM9 A;  2PF4 E;  1HS6 A;  3O48 A;  2I9C A;  1N1C A;  4CGV A;  1IW7 F;  2OCC C;  4LER A;  1E8Z A;  1JUQ A;  4YVQ C;  3V7O A;  1U3D A;  2G3K A;  2PL2 A;  1OWM A;  4B8C B;  3FTW A;  3ZVR A;  3JUI A;  2VTB B;  3UGO A;  4J8S A;  3S0X A;  2QY9 A;  1UN9 A;  2WXJ A;  2AXV A;  3ZW3 A;  4C3B A;  3GW4 A;  1LS1 A;  3EZI A;  5KYU A;  1ZBP A;  2AXZ A;  5JJ6 A;  2WZG A;  3FUH A;  4CS9 C;  3L6A A;  1W3B A;  3ZYL A;  3T6J A;  3EH1 A;  3CST A;  3NZS A;  5E76 A;  3JYH A;  5AYW D;  3VTX A;  2IQC A;  4JW1 A;  4HXI A;  2KCL A;  3UMI A;  2EIK C;  4N2S A;  3U4T A;  3LS1 A;  3KS2 A;  1FMW A;  3C98 A;  5KYU B;  3EDT B;  3KH2 A;  3W8I A;  5FQ6 A;  2NG1 A;  5KJM A;  4JL0 A;  5C2Y A;  4FUL A;  1KLX A;  3CVU A;  4KXK B;  5T1D B;  4AX2 A;  1UJK A;  5T8I A;  5LCW J;  2R5S A;  3FU5 A;  4DK5 A;  4PFO A;  3SZ7 A;  3ASF A;  1SZI A;  4KBQ A;  4A3V A;  1E8Y A;  3QNK A;  5EX0 A;  4E6H A;  4OIR F;  4J32 B;  1HU3 A;  5FZQ A;  4B6I A;  2YHE A;  4H7Y A;  5T3W A;  4P29 A;  5FT9 A;  4CS9 A;  2CHX A;  2JD3 A;  3CV0 A;  5HSW A;  5ANR A;  2E87 A;  2J0X A;  2WPV A;  2C0M A;  3IKO B;  3CK7 A;  4GA2 A;  3UQ3 A;  2V0P A;  3VLD A;  4TV3 A;  1M2O A;  4J0U A;  2KW3 C;  4I44 A;  1FMV A;  2VQ2 A;  1ZU4 A;  4U5D E;  3SGH A;  3CSK A;  4JHK A;  1PAQ A;  3LCA A;  2MHK A;  4EWC A;  2G3V A;  4RD9 A;  2FI7 A;  2P6V A;  4I3M A;  3GZ2 A;  4U5H A;  3I4G A;  3S2A A;  4GYY A;  2WQH A;  3DBS A;  4EZK A;  1VMA A;  3HIZ A;  1V55 C;  4ULW A;  2CG3 A;  2WXM A;  5EKQ D;  4ANX A;  5FTP A;  4XTK A;  4WUY A;  3R7R A;  5ARG A;  3ASG A;  4FJY A;  1H2V C;  4CCA A;  1H2T C;  2KCV A;  3BEE A;  2CHW A;  4KMO A;  3UX4 A;  1H2U A;  4PJJ A;  2PM6 A;  3WOD F;  2WL8 A;  3EFO B;  1WAO 1;  4YT5 A;  3MV3 B;  4XI0 A;  5CMW A;  4JA7 A;  2DCP A;  2E2E A;  3LY8 A;  4U07 A;  4DI4 A;  2J7P D;  3LY9 A;  3PDN A;  3JCU Q;  3AG4 C;  1BR1 A;  2J09 A;  1TKN A;  3D3M A;  3SYN A;  3LVQ E;  3LJ3 A;  3Q5M A;  3U64 A;  2Y69 C;  3RFY A;  4D10 C;  1O87 A;  1HF8 A;  4GA1 A;  2XRZ A;  4B94 A;  3S7D A;  1M2V B;  2R7R A;  3L13 A;  3O6X A;  4PJL A;  4LRZ A;  3I5P A;  3RIB A;  4BJ6 C;  4G7O F;  3TXM A;  4CEM A;  3RH3 A;  3MCX A;  4GCN A;  2R7Q A;  3FTS A;  4ANW A;  2A68 F;  1INZ A;  4XX5 A;  1IHG A;  4CT4 A;  1Z6A A;  5B3S C;  2OVF A;  2NSZ A;  2M4E A;  4UI9 K;  5G04 J;  2WMO A;  2P7V A;  1ST6 A;  2PFD A;  4JEH A;  2V5F A;  1ZHY A;  3JRT A;  4PS8 A;  5B1B C;  2YEV A;  3D9N A;  3UUX A;  4OD5 A;  2IOL A;  3W2W A;  3MV2 B;  4U5F E;  2FBN A;  3TL5 A;  3QWV A;  4GCO A;  4OIQ F;  2J08 A;  3E4B A;  5DS6 A;  1ZYR F;  2QY7 A;  2X3M A;  3HDX A;  4U04 A;  3LY7 A;  2X6I A;  5IY5 C;  3Q7G A;  4WNG A;  4I17 A;  4K7B A;  2MYS A;  2X6H A;  1DVP A;  3CKB A;  4Q4Z F;  4G0H A;  1HO8 A;  3ZYM A;  3UMV A;  4K0R A;  2J9V A;  2R17 C;  2A69 F;  1QQE A;  3CVX A;  3VTY A;  3AU4 A;  2ZXW C;  4N2Q A;  4GB9 A;  4BX8 A;  2AWI A;  4DVY P;  2KCK A;  4FES A;  4JHJ A;  5D0O D;  3ZHE A;  3D9O A;  3CQZ A;  4I2W A;  4NUR A;  3SNX A;  3NQP A;  4WNF A;  3NRH A;  4BX9 A;  4I1O B;  2XQ0 A;  3CVQ A;  5G04 C;  3MYV A;  3TD7 A;  3Q15 A;  1EF1 C;  4O79 A;  2IJG X;  3CQG B;  3FTZ A;  4CIH A;  2EQX A;  1PCX A;  4C3D A;  5FQ7 A;  2IU1 A;  4HFF B;  2Q3T A;  3CQC B;  3MX3 A;  3GYZ A;  2C04 A;  3QK0 A;  4EZJ A;  3SZR A;  1BR4 A;  4PH4 B;  3OA1 A;  3RO2 A;  1E90 A;  1XGW A;  4NQ0 A;  1UW4 B;  3AQB A;  3EHN A;  1U3C A;  1ELW A;  3PE4 A;  4YVO A;  3T5X A;  2NXP A;  2EIM C;  4Q7C A;  3T8M A;  2IXP A;  4CDM A;  3EZH A;  5AJD A;  4G26 A;  3CGH A;  2IXN A;  3KAE A;  2IOS A;  1MND A;  5FJY A;  1PY1 A;  3DMD A;  4FA6 A;  2FGY A;  3KD7 A;  3QMK A;  3VYW A;  2XXA A;  4Q94 A;  3TXN A;  4RBN A;  3JSZ A;  3L0I A;  3U9W A;  3ZG1 A;  3RRM B;  5KYW A;  3PE3 A;  4K0D A;  3H65 A;  1NP7 A;  4U0U A;  4JA9 A;  3SF4 A;  2WXH A;  3IHV A;  1FFT C;  2WXK A;  3FU0 A;  3EG9 A;  2WXP A;  1E7V A;  3FTX A;  4YT4 A;  3NYJ A;  3UMH A;  4O6F A;  4H7X A;  4URK A;  5KYW B;  2OG2 A;  4TRQ A;  1D1A A;  3R7Q A;  3S7B A;  2A1D D;  4Q5S F;  3DD7 A;  3QB2 A;  3T4R A;  4GMJ A;  4F4B A;  2YHS A;  1Z63 A;  2YIN A;  1QNF A;  3CVV A;  4AP2 A;  2I8B A;  1S0P A;  2HV6 A;  1OKK A;  2WVN A;  3O4Z A;  1KT1 A;  2WXF A;  3DJN B;  4G7Z F;  4IRU A;  4ILH B;  5JJ7 A;  1ZHX A;  4U5B E;  1O5H A;  4OIN F;  5KYN A;  2UY1 A;  1OCR C;  2Y3A A;  2J9W A;  2HR2 A;  2J4D A;  1GW6 A;  3N24 A;  2VYI A;  1IQR A;  3X2Q C;  2CDQ A;  2VSX E;  3DAG A;  3IEE A;  3CHS A;  4C0E A;  3QC1 A;  2CG2 A;  4GA0 A;  4A3T A;  3G2V A;  3FU6 A;  2XRY A;  4G2V A;  2NUT A;  4G23 A;  3QJZ A;  4C3E A;  1MMG A;  2Y4T A;  2HV7 A;  5FCL A;  4YJW A;  4WND A;  3VLE A;  2R7S A;  2R7T A;  3EHM A;  3CEQ A;  3CHO A;  2LSE A;  3PRE A;  1Y6I A;  1N54 A;  5J08 A;  3URZ A;  4EBA G;  2OVB A;  1RJ9 A;  3AG1 C;  2IOQ A;  3ZYK A;  4HS2 A;  2IYL D;  4F7A A;  5BV1 A;  3N71 A;  5DIZ A;  3K66 A;  4A2N B;  4XLP F;  4C0M A;  3N0T A;  2MWQ A;  4BSX A;  3K7D A;  2LAI A;  4UWL A;  5FQ8 A;  2IXM A;  4RDA A;  2KJG A;  4I1M A;  4QI0 A;  1J8M F;  1L5J A;  1MMN A;  5AJL A;  4N3A A;  1NG1 A;  4YN0 B;  3ZC4 A;  2WMN A;  3KL4 A;  5CCL A;  3AS5 A;  1FTS A;  4CRW A;  4L1B A;  4NAC A;  2V8S E;  4NRH B;  2PM7 A;  3K33 A;  4OYS A;  5E75 A;  5BUZ A;  1E96 B;  1EYH A;  4GYO A;  3W2V A;  4DVZ A;  1D1B A;  4AVX A;  1FVF A;  1E8W A;  3FUL A;  4GZ6 A;  3ASH A;  5B1A C;  3MLG A;  3ULQ A;  3LS0 A;  2NUP A;  3SD5 A;  2ZU6 B;  2WXN A;  2IXO A;  3JYS A;  2CHZ A;  2X38 A;  2DYS C;  3FH5 A;  3SFZ A;  1XNF A;  3FUE A;  1IYG A;  4PJM A;  2WZL A;  1HXI A;  2C03 A;  1ZHW A;  3MGB A;  2EIJ C;  4C7O A;  3HLZ A;  4OVU A;  4ACK A;  4HOU A;  2JEK A;  4EEC A;  4RG6 A;  2Y3H A;  4FJZ A;  3AQC A;  3RRN B;  3ONL A;  4CT0 A;  2YQ8 A;  3LXU X;  5DQT A;  2LSU A;  1D0Y A;  1E7U A;  3IEG A;  3FVY A;  2AVP A;  3HHM A;  4I6E A;  3B7R L;  2I6H A;  3KMI A;  2R59 A;  3UT8 A;  3OXL A;  1SZ9 A;  4MND A;  1IZM A;  4I1A A;  3L16 A;  3B0U X;  3E9V A;  3RKO F;  3ENE A;  3FUM A;  3MKQ A;  1BPO A;  1OWP A;  3DAF A;  4JJF A;  3HVE A;  3NKE A;  4L7T A;  4GZ5 A;  1UG3 A;  4AY6 A;  4XE0 A;  3ZEF A;  4HOS A;  5LCW C;  3ZSU A;  4F53 A;  5L3V A;  4KVM A;  3SHF A;  4G7H F;  2Y3B A;  3X1O A;  4JEU A;  4ACL A;  2LSV A;  2WXI A;  4GYW A;  4UWK A;  3MJW A;  3NF1 A;  2LO6 A;  2YNQ A;  4B89 A;  4I9E A;  2FUL A;  3MKQ B;  1IQU A;  3I3N A;  4U0Z A;  4JVS A;  3CSF A;  2OV8 A;  2UWJ G;  4XKB A;  4UI9 J;  4EPZ A;  2DYR C;  4I9C A;  3LNR A;  1DNP A;  3T6B A;  4KZ0 A;  3UR3 C;  3CHR A;  1TJF A;  3S7J A;  3B0V C;  2VSO E;  1S7Z A;  4N3C A;  2ION A;  4DBR A;  4BG0 A;  4I6J A;  4AE4 A;  3MKR A;  5KYY A;  5ENN A;  4EQF A;  4HFK B;  2QFC A;  2KM4 A;  4L2Y A;  5F5H A;  3FTV A;  3S29 A;  1Y8M A;  5JJT A;  5AIJ A;  2WB7 A;  4AE4 B;  4HOR A;  5KYY B;  3QAR A;  2Y3G A;  1OCO C;  2VB6 A;  4MLP A;  2VGX A;  4CSA C;  4F3V A;  3DM5 A;  3O39 A;  2CFU A;  3FY4 A;  3ABL C;  1M56 C;  2WVI A;  3LEW A;  4KVO A;  4I2Z A;  4A1S A;  3FTU A;  3QKY A;  5G55 A;  1SF8 A;  4OD4 A;  5BT1 A;  3OWT A;  2XRH A;  4DJA A;  2I2O A;  4QDL A;  1MNE A;  1E8X A;  3LPZ A;  3AS8 A;  3FDH A;  3R9A B;  1TWA A;  4UI9 C;  3DJU B;  3B7S A;  3CK9 A;  4KT6 B;  3FH7 A;  4JPS A;  1D0Z A;  3B0P A;  4BJ1 A;  2X6F A;  3QAQ A;  4W8K A;  2XEV A;  2IFU A;  5L3Q A;  5ANL A;  2EIN C;  4FLB A;  1TWG A;  4CS7 A;  3VLF A;  5KJK A;  4BT8 A;  2M63 A;  2L9J A;  2X6K A;  4AOF A;  4OVV A;  3K6B A;  3D9J A;  4CSA A;  4CDR A;  4UQZ A;  3FP3 A;  3S27 A;  4NY3 A;  3AG3 C;  3ZIM A;  2C0L A;  4DI3 A;  3LKU A;  3NKD A;  3I5Q A;  4GZC A;  3EJN A;  4PK4 A;  4P6I C;  3APC A;  4V3I A;  1LF8 A;  4WWN A;  3D9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...