2J9UA

2 angstrom x-ray structure of the yeast escrt-i vps28 c-terminus in complex with the nzf-n domain from escrt-ii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
94
structure length
94
Chain Sequence
FNAKYVAEATGNFITVMDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIVRINKLSIGDTLTETQIRELLFDLELAYKSFYALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 28
publication title Structural Insight Into the Escrt-I/-II Link and its Role in Mvb Trafficking.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 39
structure length 94
sequence length 94
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1130 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2j9uA00
2G3KA 2J9UA 2J9WA 2J9VA
chains in the Genus database with same CATH superfamily
2M64A 4O6MA 1NSGB 4U5HA 3C8GB 1W2WA 3ZG1A 3R7CA 3ITFA 3UMKA 1KNYA 3FHDA 3UR3C 4G7HF 4XPYA 1O87A 1NU7D 4K1OA 3J06A 3MFNA 3HNLA 3K1IA 2B0JA 3RF3A 3W8HA 2YLDA 3IQCA 2Q9AA 4MVOA 3KYIA 3O39A 5BQIA 3NYMA 4N4WA 3SXYA 3SXZA 3W4YA 1XWJA 1ZHWA 5FCLA 4U5EE 4ANJA 1ZW2A 3DKAA 3C63A 5L0DA 3LS1A 1LI5A 4HE8D 4E7SA 1GGQA 3B29A 3JYHA 2J0XA 3EFOB 5TJ5E 3IHUA 4JEBA 3ZIBA 1EQ1A 3FVYA 1E2XA 1S05A 2F22A 4U5FE 1I5NA 2X0CA 4CS9A 5KYXA 2LCHA 1EA8A 3LEVA 4YT2A 2LFDA 1H9TA 1JMWA 1WOLA 1ORJA 3TQOA 256BA 3V5YA 2ZD9A 3R2PA 4DJ9A 5L0HA 2AVKA 2LK4A 3H2VA 1AEPA 4P9FA 3SP1A 3DAGA 1RMVA 2EPLX 1HMOA 4E17A 4Q5SF 3M15A 2A1DD 3UMHA 3WAQA 2XS8A 2R7RA 5BQGA 3U5SA 5A6KA 3FDQA 1HE1A 3LEOA 2J8WA 2LD6A 2R7UA 2YLGA 4I1MA 3M79A 3N24A 5KYYB 2W4BA 2VASA 5JRAA 3KPHA 1LPEA 2XLOA 4OD5A 1M56C 2Y3HA 5JSLA 3T4RA 3ZQVA 2PX0A 3AG2C 1HY5A 4N06A 1LIHA 3AG3C 1FMWA 1I4YA 1D0YA 1YARO 2LFFA 3GEHA 4MVRA 4Z9JA 4X0RA 1NBBA 1HE9A 2HUJA 3U2LA 3JZ0A 5DVWA 2NUPB 4DVZA 3TJ6A 3I4UA 3QTHA 4P9TA 2ZXWC 3FMSA 1QQ3A 2ZPAA 4XPXA 4CX9A 1BBHA 3LNRA 1SZIA 4MVSA 5F5FA 1Q0MA 3C8GD 4YT5A 2XLWA 3FAJA 2TMVP 1U6HA 2G3KA 1M2VB 2WVOA 1LS4A 3LUTB 3H2UA 1K04A 3DZAA 3SEOA 1YVIA 1BR4A 1APCA 1YDIA 3B0PA 2XLEA 2GAQA 1Q0FA 2NUTA 4BEJA 5CI8A 4CS8A 1YA9A 2KQ9A 3B71A 2KC3A 3S29A 3O6XA 1VK5A 4PR9A 3S27A 3B0VC 2QY9A 1AUEA 1WTYA 2A6HF 3L1MA 2QNLA 4JKVA 5EK0A 1MQVA 3I5PA 2Q9CA 2UUHA 3EGXB 4R32A 5BQHA 4YL3A 1RJ9B 4KBLA 5L0FA 2J7PA 2Q3TA 4NQFA 1Y4CA 2R7VA 3FOPA 5KYUB 2J9VA 3FAPB 1A7DA 3FXHA 1GM5A 3OEOA 2FGYA 3M1CB 3M4CA 3EG9B 4MQ9F 2H7OA 2I15A 3QW0A 4MTGA 4N6CA 2YL1A 3DD7A 2RD9A 3LAYA 4YJWA 3NYLA 1ZU4A 4IRUA 2OJED 2L9JA 1HW1A 2AWCA 3ASOC 4JTDB 3EPVA 5JUAA 2GA0A 3O55A 4A2NB 1QLEC 2A0UA 1YLMA 3U3BA 1M57C 2J9BA 1T01A 4J32B 4YL1A 1OKKA 1Z7Qc 5DS4A 2DB4A 5DQTA 5DS5A 1V55C 4AE4B 3POVA 4NTAA 3JCUQ 4DRIB 3Q7LA 1U0BB 2ZXOA 4PFPA 4AL1A 4E0HA 2OJQA 4MW8A 3JRMO 1ZHTA 2R7QA 3ZTZA 2J7PD 1OCZC 3BRJA 4U5CE 1T5OA 4WABA 3RW0A 5EHHA 3S90A 4JC7A 3VYWA 3TOLA 2XL4A 2IXMA 2JX0A 3NRHA 4IAQA 1OCCC 2CNWD 4IB4A 2UUIA 2IXNA 4PK4A 3SYNA 2DGJA 1VB5A 3LJBA 3CSKA 2IOQA 3IPMO 4XEFA 3GEEA 3RH3A 4A4AA 2QUPA 3GM3A 4KNVA 2D4UA 1XZPA 4RBNA 4WGZA 1VYKA 1CPRA 4PJNA 3CAXA 2C03A 2EPOA 3ABMC 3GWNA 5A6JA 1JPNA 4U9DA 1TWGA 1OKKD 2A69F 1BR1A 1OXBA 1Z3IX 2CDQA 1EI7A 2IM8A 2QLAA 2WVQA 1VLSA 2BE5F 4NC3A 5JP7A 4CDAA 3B0UX 3W2VA 4M63A 1BR2A 3W8IA 2YEVA 3DI5A 1E86A 3SXMA 4CBEA 3LLIA 3S9OA 2CYDA 1ORYA 4LACB 2XL8A 4JRZA 2W9YA 4NCQA 1V54C 4MNDA 5JT4A 3RQGA 1NZEA 2YL3A 4CIHA 1NFNA 4FESA 5B1AC 2YQYA 3VF0A 3WG7C 4KI2A 1WATA 4LERA 3KYJA 1MMNA 2OOCA 2Y69C 4BJ5C 3TD7A 5AC4A 2GFHA 5T1DB 2XLHA 3UMIA 2VCBA 2NPUA 3H65A 4MTFA 1VTMP 4I3MA 2BL2A 2DYRC 4C3DA 5L0CA 1E83A 4C7OB 4EBKA 4YN0B 1O5HA 2YL0A 3C18A 3DE8A 2J9UA 1OCRC 3U2MA 4BPMA 2R7OA 3C7JA 4AL0A 1PCXA 4JCZA 1ORSC 2H7VC 3DJUB 4C3EA 4C3BA 4CDVA 1H9GA 4XLNF 1H7IA 1T6IA 1YAUO 3MYIA 3C8GA 3O10A 4IJJA 4JCHA 2PBEA 4HEAJ 3VM6A 1PV3A 4ZLDA 3RFYA 4DOZA 3NKDA 1SF8A 1OR2A 2DYSC 2NSGA 1G5ZA 4P6IC 2RSEB 2H8AA 3ZTMA 3PHF2 4NTBA 2YVKA 4MS2A 1TKNA 4U5BE 2AU5A 1Z23A 4EBJA 1E84A 1T6UA 1G4WR 3T6GB 1WGWA 1FAPB 5KYWB 4QI2A 4JZAA 4U5GA 2W4MA 1ZZPA 3W2WA 1RCPA 3QVYA 4IARA 2HJMA 3F46A 4ULVA 1SMYF 4YWQA 3WODF 1V74B 1TFKB 3EZHA 1KTMA 1E85A 5F28E 1ZHZA 3AQCA 4JURI 3LS0A 1O3UA 1LKXA 1DOWA 2O9XA 3EFOA 5CI9A 2WZLA 4H54A 4J30B 4UDVA 2PNOA 2PFDA 2H7BA 2XSEA 4CSAC 3EGDB 1M6TA 1L3PA 1C02A 1G4US 5A6BD 4BG0A 3K6BA 1RKEB 1VLTA 2PP4A 4LLCA 3AQBA 3FOOA 1J8YF 3G50A 2HV7A 4EKWA 3KMIA 4CJGA 3ECSA 3U9MA 3E70C 2PX3A 2Y3DA 4EUKB 1TR2A 3GANA 4OINF 1C03A 1A0BA 1FR0A 1AVOB 4NTFA 2B0HA 2XM4A 4XTKA 1ZW3A 4OIPF 5KYWA 3KKBA 2MWQA 3L8IA 3Q6NA 4DRJB 2P61A 3TK0A 2IXPA 5KYYA 3ZSUA 2Y39A 2WB7A 4F4BA 5T3WA 4CJOA 1V4AA 1T6QA 3X1OA 2VB6A 2YKZA 2OU6A 3MBGA 3NMKA 3QMKA 1A41A 3PDMP 4O6NA 2KNHA 3T6BA 2NUPA 4FWVA 4PFOA 3EGDA 2R9RB 5COFA 3AOUA 4LLEA 2OKUA 3MX3A 4OIQF 4EHPA 2L6HA 2NG1A 3DAFA 2CNWA 2R25A 1D1AA 2Y3GA 4OIOF 3TOMA 2EIJC 4GEHA 3AGTA 1YA7O 2EIMC 4XWJA 2HZ8A 4I44A 1M2VA 5B3IA 2MYSA 4YK5A 5L0JA 1NU9C 4KC9A 4RD9A 3HNIA 4DXWA 1LE2A 3JYYA 1Z5ZA 1TWCA 2L6GA 3EH1A 1LM3B 5L0GA 1HW2A 5IY5C 4I1OB 5DLJA 3DXJF 1EKYA 4ER9A 4WJ0A 1JOGA 3EGXA 2J0WA 3QW1A 1JRAA 1RJ9A 4CDYA 3RVZA 4IWBA 2FFHA 1YZAA 2L7AA 3G4XA 5KYUA 1IW7F 1OW8A 2MHRA 4O6YA 4PJLA 1D0XA 2I8BA 3K66A 4YT8A 3AG4C 3S28A 4EIYA 3A11A 2ZXPA 3EG9A 3HNKA 2KYHA 4MVUA 3RKOF 2G62A 3S0XA 3PMRA 1G8XA 5L3VA 3L0IA 1OW6A 1SYQA 2GDCA 2LSEA 3V5XA 3M4BA 1GS9A 2AWYA 2X51A 3HJCA 4HFFB 3I5QA 4DVYP 4YL0A 2XS1A 4BJ6C 4FAPB 5K0IA 4ZLCA 2P7VA 1SR2A 2CCYA 1LS1A 1UG7A 4KNWA 1BZ4A 2KW3C 4U9EA 5E3AA 4AE4A 3LNMB 5D92A 4JTCB 3RQEA 2EPKX 4B6IA 3JSZA 5COGA 2YZSA 3KL4A 1PD0A 3U8VA 1N1CA 3UGOA 2HV6A 3HLZA 3NDBB 4OD4A 3NMJA 1RXQA 5B1BC 4BJ5A 2YLIA 4JEAA 2R7XA 1WASA 2HMQA 1Y6DA 1TFOB 1R4TA 2HS5A 2KJGA 1JAFA 4H4KC 2G3VA 4E18A 3U9JA 3DM5A 1A7EA 2HFIA 3JRTA 2HSQA 1D0ZA 1QPUA 4L6RA 2R7WA 3MYFA 1I4ZA 4XPWA 4MW3A 2HJ3A 3HKKA 3RIPA 3VAYA 4BEMJ 1FNTc 1J8MF 5GPGB 3L8JA 5BUOA 2A6EF 3CEXA 3K1HA 4G0HA 3MLGA 4JE9A 3ATPA 5KYXB 2FAPB 1L7CA 3IQ5A 3ZDLA 1JR8A 2JD3A 3NMIA 1RKCA 2OCCC 1A7VA 5A6BA 2ASRA 3RYLA 3JT1A 1QSPA 4O7GA 2XL6A 3F47A 4BJ1A 4ONSA 3X2QC 3GODA 3CQZA 1VMAA 1IZMA 2Q00A 2LIGA 3B9QA 3N2ZB 4DRHB 1FFTC 1LI7A 2WZGA 3ZQYA 4K0DA 1WN0A 2CGEA 4LDQA 2PF4E 4E7ZA 1ZU5A 2IBFA 2KGOA 3L34A 3NYJA 2J9WA 4G7OF 3K1IC 1FMVA 3Q7GA 4XEVA 4Z9HA 4U5DE 4W8PA 3DM9B 2Q7RA 2P6VA 1NG1A 2HMZA 4C7OA 3U3FA 1C17M 1OXKA 2JPUA 4LDKA 2WVNA 2QTVA 1FTSA 2NSFA 4RDAA 4HFKB 3ABLC 2GWWA 4JJGA 5F5HA 5FZTA 5COMA 1LVKA 1YYXA 3EZIA 4QDLA 3DWWA 4K7BA 4CS9C 2IXOA 1CGNA 3N0TA 1Z63A 2XXAB 3GM2A 2KK1A 2LP4A 3E9VA 2L6FA 2NUTB 3ZWIA 1MMGA 3SNHA 4O79A 1YJGA 4EBBA 4G7ZF 3LLKA 3CZ6A 4Z9IA 5A6AA 3US6A 4FX5A 2EIKC 3LESA 3UNGC 3WHNA 4D4XA 1TWAA 1GQAA 2WZFA 4WGYA 4OIRF 1XZQA 2P0NA 1U89A 4NY3A 4YT4A 2L81A 4CIPA 3SZRA 5HSWA 1K05A 1CGME 1Z6AA 1NFOA 3ZVRA 4CS7A 2CW0F 4N6HA 3EQLF 4MVQA 3NG1A 5T3TA 4XEKA 1TWHA 4PJJA 4E0IA 5AGFA 4DBRA 1QVXA 3AGUA 1M2OA 2XXAA 3T9OA 2ZXRA 2M4EA 1ST6A 4GYTA 1D1BA 1RKEA 3EJNA 1MMAA 3IEEA 1QZXA 4LDRA 2OEXA 2P1AA 2VCCA 1KU2A 2OQMA 5JS5A 2BC5A 1YYJA 2HKVA 1HMDA 1PD1A 3EHNA 3HTKC 3KH2A 2KSFA 3NKEA 4ULWA 1LE4A 3HNJA 1H6GA 3JTLO 1Q0KA 2R05A 3UGPA 2R03A 1BDJB 2D5RB 2Q4FA 4EWCA 1ZVZA 3ZC4A 4CS8C 3ABKC 1K40A 3K33A 2YWAA 4AK9A 2E87A 1Q0GA 2R02A 1D1CA 4Q4ZF 2EINC 3GORA 1VYIA 5E33A 2YHSA 4DBQA 4JIOA 3ASNC 3DJNB 1CPQA 4MVMA 4BJTA 4QI0A 1B68A 5L0IA 4GQHA 4CSAA 4IGGA 4MVZA 5E2QA 2XLMA 4BJ6A 3U0CA 1UFBA 3C62A 5D91A 5E3CA 3RVYA 1OQCA 5DS6A 5CIVA 1F1MA 4IAOA 2W45A 3AJMA 3G4ZA 2VCAA 3QZCA 2V3CC 1FFHA 3VRCA 2XM0A 2DI3A 1ZHYA 3JSEO 2A68F 4J7TA 4G78A 3TULA 2EILC 4PJMA 2QE9A 1YZCA 1S7ZA 1DOVA 1OW7A 3IQTA 3SXKA 5HV9A 4XLPF 2V26A 1JPJA 3OWTA 3GM1A 2WL8A 1Q0DA 3AG1C 3BEHA 3C8ZA 3DMDA 2ICWG 1T9KA 2HSBA 4PACA 2AP3A 5JLIA 1QKRA 2VC9A 3A9CA 5JVEA 5L3QA 4JJFA 3RQFA 1ZHXA 3V7OA 2ETSA 1VOMA 1OR3A 1TQGA 3K7DA 4JVSA 1R5ID 3IQ6A 3TJ5A 1MNDA 2IYLD 1ZYRF 1MMDA 2XRHA 2OG2A 1MNEA 2XLVA 2VH3A 2YL7A 4MTOA 2LQGA 4Q7CA 3U8PA 4W8KA 5EGYA 2R7TA 2R7SA 3EH2A 3PCVA 5A69A 2YRFA 2A0BA 2C04A 2Q9BA 2OEVA 2Z15A 2J46A 2EPNA 3OA1A 3GEIA 3GWLA 5KYNA 1CGOA 3Q6MA 2EPMX 3EHMA 5AC5A 4J7YA 4XQ1A 1NLXA 2Y3BA 3V5ZA 3QVZA 4JTAB 5B3SC 5DQZA 3DE9A 3T6JA 2XLDA 4D4NA 4AX2A 3S84A 1OCOC 1WWPA 2J45A 4JW1A
chains in the Genus database with same CATH topology
4O6MA 4U5HA 1W2WA 3ZG1A 3UMKA 3ITFA 3UR3C 3FHDA 4G7HF 1O87A 1NU7D 2B0JA 3W8HA 2Q9AA 3O39A 3NYMA 5FCLA 1ZHWA 4U5EE 4ANJA 3LS1A 4HE8D 4E7SA 3JYHA 2J0XA 3EFOB 3ZIBA 3FVYA 4U5FE 5KYXA 4CS9A 3LEVA 4YT2A 3SP1A 3DAGA 4Q5SF 3UMHA 2A1DD 2R7RA 3FDQA 2R7UA 4I1MA 3N24A 5KYYB 2W4BA 2VASA 4OD5A 1M56C 2Y3HA 3T4RA 2PX0A 3AG2C 4N06A 3AG3C 1FMWA 1D0YA 4CIHA 4OIOF 4X0RA 5DVWA 2NUPB 4DVZA 3I4UA 2ZXWC 2ZPAA 3LNRA 1SZIA 5F5FA 4YT5A 3FAJA 2G3KA 1M2VB 2WVOA 3DZAA 3SEOA 2XXAA 1BR4A 3B0PA 4BEJA 4CS8A 2NUTA 5CI8A 2KQ9A 3S29A 3O6XA 1VK5A 3S27A 3B0VC 2QY9A 2A6HF 3I5PA 2Q9CA 3EGXB 1RJ9B 4KBLA 2J7PA 2Q3TA 2R7VA 5KYUB 2J9VA 3OEOA 2FGYA 3M1CB 4MQ9F 3EG9B 2H7OA 3DD7A 4YJWA 3LAYA 2R7TA 3NYLA 1ZU4A 4IRUA 2L9JA 3ASOC 3EPVA 4A2NB 1QLEC 1M57C 4J32B 1OKKA 5DS4A 5DQTA 5DS5A 1V55C 4AE4B 3JCUQ 3Q7LA 2ZXOA 4PFPA 1ZHTA 2R7QA 2J7PD 1OCZC 4U5CE 5EHHA 3VYWA 2XL4A 2IXMA 3NRHA 1OCCC 2CNWD 2IXNA 4PK4A 3SYNA 2DGJA 3LJBA 3CSKA 2IOQA 3RH3A 4CSAC 4RBNA 4KNVA 1VYKA 4PJNA 2C03A 3ABMC 1JPNA 1TWGA 1OKKD 2A69F 1BR1A 1Z3IX 2CDQA 2WVQA 4Q7CA 4W8KA 2BE5F 3W2VA 4M63A 1BR2A 3W8IA 2YEVA 4CBEA 3LLIA 4LACB 2W9YA 1V54C 4MNDA 1NZEA 4FESA 5B1AC 3WG7C 4KI2A 4LERA 1MMNA 2Y69C 4BJ5C 3TD7A 2GFHA 5T1DB 3UMIA 3H65A 4C7OB 4I3MA 2DYRC 4C3DA 4YN0B 1O5HA 2J9UA 1OCRC 2R7OA 1PCXA 3DJUB 2H7VC 4C3EA 4C3BA 4XLNF 4JCHA 4HEAJ 4ZLDA 3RFYA 4DOZA 3NKDA 1SF8A 2DYSC 4P6IC 3PHF2 1TKNA 4U5BE 1Z23A 1WGWA 5KYWB 4QI2A 4JZAA 4U5GA 2W4MA 3W2WA 4YWQA 3F46A 1SMYF 3WODF 3EZHA 1ZHZA 3AQCA 4JURI 3LS0A 1LKXA 2O9XA 5CI9A 3EFOA 2WZLA 4J30B 2PFDA 2H7BA 2XSEA 3EGDB 4BG0A 3K6BA 4LLCA 2PP4A 3AQBA 1J8YF 2HV7A 3KMIA 3ECSA 3E70C 2PX3A 2Y3DA 1TR2A 3GANA 4OINF 4XTKA 4OIPF 5KYWA 3KKBA 2MWQA 3Q6NA 2IXPA 5KYYA 3ZSUA 2Y39A 2WB7A 4F4BA 5T3WA 3X1OA 2VB6A 3QMKA 4O6NA 2KNHA 3T6BA 2NUPA 4FWVA 4PFOA 3EGDA 4LLEA 3MX3A 4OIQF 2NG1A 3DAFA 2CNWA 1D1AA 2Y3GA 2EIJC 4GEHA 2EIMC 4XWJA 4I44A 1M2VA 2MYSA 1NU9C 4KC9A 4RD9A 1Z5ZA 1TWCA 3EH1A 5IY5C 4I1OB 5DLJA 3DXJF 4WJ0A 3EGXA 2J0WA 1RJ9A 4IWBA 2FFHA 5KYUA 1IW7F 4O6YA 4PJLA 1D0XA 2I8BA 3K66A 4YT8A 3AG4C 3S28A 2ZXPA 3EG9A 3S0XA 3B0UX 3RKOF 2G62A 3PMRA 1G8XA 5L3VA 3L0IA 2LSEA 2X51A 3HJCA 4HFFB 3I5QA 4DVYP 4BJ6C 4ZLCA 2P7VA 1LS1A 4KNWA 2KW3C 5E3AA 4AE4A 5D92A 4B6IA 3JSZA 2YZSA 3KL4A 1PD0A 1N1CA 3UGOA 2HV6A 3HLZA 3NDBB 4OD4A 5B1BC 4BJ5A 2R7XA 2KJGA 4H4KC 2G3VA 3DM5A 3JRTA 1D0ZA 2R7WA 3RIPA 3VAYA 3POVA 1J8MF 5BUOA 2A6EF 3K1HA 4G0HA 3MLGA 5KYXB 2JD3A 2OCCC 3RYLA 3JT1A 4O7GA 4BJ1A 3F47A 3X2QC 3GODA 3CQZA 1VMAA 1IZMA 3B9QA 3N2ZB 1FFTC 2WZGA 4K0DA 2CGEA 2PF4E 4E7ZA 1ZU5A 2KGOA 3L34A 3NYJA 2J9WA 4G7OF 3K1IC 1FMVA 3Q7GA 4U5DE 3DM9B 2P6VA 1NG1A 4C7OA 2WVNA 2QTVA 1FTSA 4RDAA 4HFKB 3ABLC 4JJGA 5F5HA 1LVKA 3EZIA 4QDLA 4K7BA 4CS9C 2IXOA 3N0TA 1Z63A 2XXAB 3E9VA 2NUTB 1MMGA 3SNHA 4O79A 4EBBA 4G7ZF 3LLKA 3CZ6A 4FX5A 2EIKC 3LESA 3UNGC 1TWAA 2WZFA 4OIRF 4NY3A 4YT4A 2L81A 3SZRA 5HSWA 1Z6AA 3ZVRA 4CS7A 2CW0F 3EQLF 3NG1A 5T3TA 1TWHA 4PJJA 4DBRA 1M2OA 2ZXRA 2M4EA 1ST6A 4GYTA 1D1BA 3EJNA 1MMAA 3IEEA 1QZXA 1KU2A 3KH2A 3HTKC 1PD1A 3EHNA 3NKEA 4ULWA 3UGPA 2D5RB 4EWCA 4CS8C 3ZC4A 3ABKC 3K33A 4AK9A 2E87A 1D1CA 4Q4ZF 2EINC 1VYIA 5E33A 2YHSA 4DBQA 3ASNC 3DJNB 4BJTA 4QI0A 4CSAA 5E2QA 4BJ6A 5DS6A 5D91A 5E3CA 4IAOA 2W45A 2V3CC 3QZCA 1FFHA 1ZHYA 2A68F 2EILC 4PJMA 1S7ZA 4XLPF 2V26A 1JPJA 3OWTA 2WL8A 3AG1C 3DMDA 5L3QA 4JJFA 1ZHXA 3V7OA 1VOMA 3K7DA 4JVSA 1MNDA 2IYLD 1ZYRF 1MMDA 2XRHA 2OG2A 1MNEA 2VH3A 5EGYA 2R7SA 3EH2A 2C04A 2Q9BA 2Z15A 2J46A 3OA1A 5KYNA 3Q6MA 3EHMA 2Y3BA 5B3SC 5DQZA 3T6JA 4AX2A 1OCOC 4IJJA 2J45A 4JW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G3K A;  2J9U A;  2J9W A;  2J9V A; 
#chains in the Genus database with same CATH topology
 2M64 A;  4O6M A;  1NSG B;  4U5H A;  3C8G B;  1W2W A;  3ZG1 A;  3R7C A;  3ITF A;  3UMK A;  1KNY A;  3FHD A;  3UR3 C;  4G7H F;  4XPY A;  1O87 A;  1NU7 D;  4K1O A;  3J06 A;  3MFN A;  3HNL A;  3K1I A;  2B0J A;  3RF3 A;  3W8H A;  2YLD A;  3IQC A;  2Q9A A;  4MVO A;  3KYI A;  3O39 A;  5BQI A;  3NYM A;  4N4W A;  3SXY A;  3SXZ A;  3W4Y A;  1XWJ A;  1ZHW A;  5FCL A;  4U5E E;  4ANJ A;  1ZW2 A;  3DKA A;  3C63 A;  5L0D A;  3LS1 A;  1LI5 A;  4HE8 D;  4E7S A;  1GGQ A;  3B29 A;  3JYH A;  2J0X A;  3EFO B;  5TJ5 E;  3IHU A;  4JEB A;  3ZIB A;  1EQ1 A;  3FVY A;  1E2X A;  1S05 A;  2F22 A;  4U5F E;  1I5N A;  2X0C A;  4CS9 A;  5KYX A;  2LCH A;  1EA8 A;  3LEV A;  4YT2 A;  2LFD A;  1H9T A;  1JMW A;  1WOL A;  1ORJ A;  3TQO A;  256B A;  3V5Y A;  2ZD9 A;  3R2P A;  4DJ9 A;  5L0H A;  2AVK A;  2LK4 A;  3H2V A;  1AEP A;  4P9F A;  3SP1 A;  3DAG A;  1RMV A;  2EPL X;  1HMO A;  4E17 A;  4Q5S F;  3M15 A;  2A1D D;  3UMH A;  3WAQ A;  2XS8 A;  2R7R A;  5BQG A;  3U5S A;  5A6K A;  3FDQ A;  1HE1 A;  3LEO A;  2J8W A;  2LD6 A;  2R7U A;  2YLG A;  4I1M A;  3M79 A;  3N24 A;  5KYY B;  2W4B A;  2VAS A;  5JRA A;  3KPH A;  1LPE A;  2XLO A;  4OD5 A;  1M56 C;  2Y3H A;  5JSL A;  3T4R A;  3ZQV A;  2PX0 A;  3AG2 C;  1HY5 A;  4N06 A;  1LIH A;  3AG3 C;  1FMW A;  1I4Y A;  1D0Y A;  1YAR O;  2LFF A;  3GEH A;  4MVR A;  4Z9J A;  4X0R A;  1NBB A;  1HE9 A;  2HUJ A;  3U2L A;  3JZ0 A;  5DVW A;  2NUP B;  4DVZ A;  3TJ6 A;  3I4U A;  3QTH A;  4P9T A;  2ZXW C;  3FMS A;  1QQ3 A;  2ZPA A;  4XPX A;  4CX9 A;  1BBH A;  3LNR A;  1SZI A;  4MVS A;  5F5F A;  1Q0M A;  3C8G D;  4YT5 A;  2XLW A;  3FAJ A;  2TMV P;  1U6H A;  2G3K A;  1M2V B;  2WVO A;  1LS4 A;  3LUT B;  3H2U A;  1K04 A;  3DZA A;  3SEO A;  1YVI A;  1BR4 A;  1APC A;  1YDI A;  3B0P A;  2XLE A;  2GAQ A;  1Q0F A;  2NUT A;  4BEJ A;  5CI8 A;  4CS8 A;  1YA9 A;  2KQ9 A;  3B71 A;  2KC3 A;  3S29 A;  3O6X A;  1VK5 A;  4PR9 A;  3S27 A;  3B0V C;  2QY9 A;  1AUE A;  1WTY A;  2A6H F;  3L1M A;  2QNL A;  4JKV A;  5EK0 A;  1MQV A;  3I5P A;  2Q9C A;  2UUH A;  3EGX B;  4R32 A;  5BQH A;  4YL3 A;  1RJ9 B;  4KBL A;  5L0F A;  2J7P A;  2Q3T A;  4NQF A;  1Y4C A;  2R7V A;  3FOP A;  5KYU B;  2J9V A;  3FAP B;  1A7D A;  3FXH A;  1GM5 A;  3OEO A;  2FGY A;  3M1C B;  3M4C A;  3EG9 B;  4MQ9 F;  2H7O A;  2I15 A;  3QW0 A;  4MTG A;  4N6C A;  2YL1 A;  3DD7 A;  2RD9 A;  3LAY A;  4YJW A;  3NYL A;  1ZU4 A;  4IRU A;  2OJE D;  2L9J A;  1HW1 A;  2AWC A;  3ASO C;  4JTD B;  3EPV A;  5JUA A;  2GA0 A;  3O55 A;  4A2N B;  1QLE C;  2A0U A;  1YLM A;  3U3B A;  1M57 C;  2J9B A;  1T01 A;  4J32 B;  4YL1 A;  1OKK A;  1Z7Q c;  5DS4 A;  2DB4 A;  5DQT A;  5DS5 A;  1V55 C;  4AE4 B;  3POV A;  4NTA A;  3JCU Q;  4DRI B;  3Q7L A;  1U0B B;  2ZXO A;  4PFP A;  4AL1 A;  4E0H A;  2OJQ A;  4MW8 A;  3JRM O;  1ZHT A;  2R7Q A;  3ZTZ A;  2J7P D;  1OCZ C;  3BRJ A;  4U5C E;  1T5O A;  4WAB A;  3RW0 A;  5EHH A;  3S90 A;  4JC7 A;  3VYW A;  3TOL A;  2XL4 A;  2IXM A;  2JX0 A;  3NRH A;  4IAQ A;  1OCC C;  2CNW D;  4IB4 A;  2UUI A;  2IXN A;  4PK4 A;  3SYN A;  2DGJ A;  1VB5 A;  3LJB A;  3CSK A;  2IOQ A;  3IPM O;  4XEF A;  3GEE A;  3RH3 A;  4A4A A;  2QUP A;  3GM3 A;  4KNV A;  2D4U A;  1XZP A;  4RBN A;  4WGZ A;  1VYK A;  1CPR A;  4PJN A;  3CAX A;  2C03 A;  2EPO A;  3ABM C;  3GWN A;  5A6J A;  1JPN A;  4U9D A;  1TWG A;  1OKK D;  2A69 F;  1BR1 A;  1OXB A;  1Z3I X;  2CDQ A;  1EI7 A;  2IM8 A;  2QLA A;  2WVQ A;  1VLS A;  2BE5 F;  4NC3 A;  5JP7 A;  4CDA A;  3B0U X;  3W2V A;  4M63 A;  1BR2 A;  3W8I A;  2YEV A;  3DI5 A;  1E86 A;  3SXM A;  4CBE A;  3LLI A;  3S9O A;  2CYD A;  1ORY A;  4LAC B;  2XL8 A;  4JRZ A;  2W9Y A;  4NCQ A;  1V54 C;  4MND A;  5JT4 A;  3RQG A;  1NZE A;  2YL3 A;  4CIH A;  1NFN A;  4FES A;  5B1A C;  2YQY A;  3VF0 A;  3WG7 C;  4KI2 A;  1WAT A;  4LER A;  3KYJ A;  1MMN A;  2OOC A;  2Y69 C;  4BJ5 C;  3TD7 A;  5AC4 A;  2GFH A;  5T1D B;  2XLH A;  3UMI A;  2VCB A;  2NPU A;  3H65 A;  4MTF A;  1VTM P;  4I3M A;  2BL2 A;  2DYR C;  4C3D A;  5L0C A;  1E83 A;  4C7O B;  4EBK A;  4YN0 B;  1O5H A;  2YL0 A;  3C18 A;  3DE8 A;  2J9U A;  1OCR C;  3U2M A;  4BPM A;  2R7O A;  3C7J A;  4AL0 A;  1PCX A;  4JCZ A;  1ORS C;  2H7V C;  3DJU B;  4C3E A;  4C3B A;  4CDV A;  1H9G A;  4XLN F;  1H7I A;  1T6I A;  1YAU O;  3MYI A;  3C8G A;  3O10 A;  4IJJ A;  4JCH A;  2PBE A;  4HEA J;  3VM6 A;  1PV3 A;  4ZLD A;  3RFY A;  4DOZ A;  3NKD A;  1SF8 A;  1OR2 A;  2DYS C;  2NSG A;  1G5Z A;  4P6I C;  2RSE B;  2H8A A;  3ZTM A;  3PHF 2;  4NTB A;  2YVK A;  4MS2 A;  1TKN A;  4U5B E;  2AU5 A;  1Z23 A;  4EBJ A;  1E84 A;  1T6U A;  1G4W R;  3T6G B;  1WGW A;  1FAP B;  5KYW B;  4QI2 A;  4JZA A;  4U5G A;  2W4M A;  1ZZP A;  3W2W A;  1RCP A;  3QVY A;  4IAR A;  2HJM A;  3F46 A;  4ULV A;  1SMY F;  4YWQ A;  3WOD F;  1V74 B;  1TFK B;  3EZH A;  1KTM A;  1E85 A;  5F28 E;  1ZHZ A;  3AQC A;  4JUR I;  3LS0 A;  1O3U A;  1LKX A;  1DOW A;  2O9X A;  3EFO A;  5CI9 A;  2WZL A;  4H54 A;  4J30 B;  4UDV A;  2PNO A;  2PFD A;  2H7B A;  2XSE A;  4CSA C;  3EGD B;  1M6T A;  1L3P A;  1C02 A;  1G4U S;  5A6B D;  4BG0 A;  3K6B A;  1RKE B;  1VLT A;  2PP4 A;  4LLC A;  3AQB A;  3FOO A;  1J8Y F;  3G50 A;  2HV7 A;  4EKW A;  3KMI A;  4CJG A;  3ECS A;  3U9M A;  3E70 C;  2PX3 A;  2Y3D A;  4EUK B;  1TR2 A;  3GAN A;  4OIN F;  1C03 A;  1A0B A;  1FR0 A;  1AVO B;  4NTF A;  2B0H A;  2XM4 A;  4XTK A;  1ZW3 A;  4OIP F;  5KYW A;  3KKB A;  2MWQ A;  3L8I A;  3Q6N A;  4DRJ B;  2P61 A;  3TK0 A;  2IXP A;  5KYY A;  3ZSU A;  2Y39 A;  2WB7 A;  4F4B A;  5T3W A;  4CJO A;  1V4A A;  1T6Q A;  3X1O A;  2VB6 A;  2YKZ A;  2OU6 A;  3MBG A;  3NMK A;  3QMK A;  1A41 A;  3PDM P;  4O6N A;  2KNH A;  3T6B A;  2NUP A;  4FWV A;  4PFO A;  3EGD A;  2R9R B;  5COF A;  3AOU A;  4LLE A;  2OKU A;  3MX3 A;  4OIQ F;  4EHP A;  2L6H A;  2NG1 A;  3DAF A;  2CNW A;  2R25 A;  1D1A A;  2Y3G A;  4OIO F;  3TOM A;  2EIJ C;  4GEH A;  3AGT A;  1YA7 O;  2EIM C;  4XWJ A;  2HZ8 A;  4I44 A;  1M2V A;  5B3I A;  2MYS A;  4YK5 A;  5L0J A;  1NU9 C;  4KC9 A;  4RD9 A;  3HNI A;  4DXW A;  1LE2 A;  3JYY A;  1Z5Z A;  1TWC A;  2L6G A;  3EH1 A;  1LM3 B;  5L0G A;  1HW2 A;  5IY5 C;  4I1O B;  5DLJ A;  3DXJ F;  1EKY A;  4ER9 A;  4WJ0 A;  1JOG A;  3EGX A;  2J0W A;  3QW1 A;  1JRA A;  1RJ9 A;  4CDY A;  3RVZ A;  4IWB A;  2FFH A;  1YZA A;  2L7A A;  3G4X A;  5KYU A;  1IW7 F;  1OW8 A;  2MHR A;  4O6Y A;  4PJL A;  1D0X A;  2I8B A;  3K66 A;  4YT8 A;  3AG4 C;  3S28 A;  4EIY A;  3A11 A;  2ZXP A;  3EG9 A;  3HNK A;  2KYH A;  4MVU A;  3RKO F;  2G62 A;  3S0X A;  3PMR A;  1G8X A;  5L3V A;  3L0I A;  1OW6 A;  1SYQ A;  2GDC A;  2LSE A;  3V5X A;  3M4B A;  1GS9 A;  2AWY A;  2X51 A;  3HJC A;  4HFF B;  3I5Q A;  4DVY P;  4YL0 A;  2XS1 A;  4BJ6 C;  4FAP B;  5K0I A;  4ZLC A;  2P7V A;  1SR2 A;  2CCY A;  1LS1 A;  1UG7 A;  4KNW A;  1BZ4 A;  2KW3 C;  4U9E A;  5E3A A;  4AE4 A;  3LNM B;  5D92 A;  4JTC B;  3RQE A;  2EPK X;  4B6I A;  3JSZ A;  5COG A;  2YZS A;  3KL4 A;  1PD0 A;  3U8V A;  1N1C A;  3UGO A;  2HV6 A;  3HLZ A;  3NDB B;  4OD4 A;  3NMJ A;  1RXQ A;  5B1B C;  4BJ5 A;  2YLI A;  4JEA A;  2R7X A;  1WAS A;  2HMQ A;  1Y6D A;  1TFO B;  1R4T A;  2HS5 A;  2KJG A;  1JAF A;  4H4K C;  2G3V A;  4E18 A;  3U9J A;  3DM5 A;  1A7E A;  2HFI A;  3JRT A;  2HSQ A;  1D0Z A;  1QPU A;  4L6R A;  2R7W A;  3MYF A;  1I4Z A;  4XPW A;  4MW3 A;  2HJ3 A;  3HKK A;  3RIP A;  3VAY A;  4BEM J;  1FNT c;  1J8M F;  5GPG B;  3L8J A;  5BUO A;  2A6E F;  3CEX A;  3K1H A;  4G0H A;  3MLG A;  4JE9 A;  3ATP A;  5KYX B;  2FAP B;  1L7C A;  3IQ5 A;  3ZDL A;  1JR8 A;  2JD3 A;  3NMI A;  1RKC A;  2OCC C;  1A7V A;  5A6B A;  2ASR A;  3RYL A;  3JT1 A;  1QSP A;  4O7G A;  2XL6 A;  3F47 A;  4BJ1 A;  4ONS A;  3X2Q C;  3GOD A;  3CQZ A;  1VMA A;  1IZM A;  2Q00 A;  2LIG A;  3B9Q A;  3N2Z B;  4DRH B;  1FFT C;  1LI7 A;  2WZG A;  3ZQY A;  4K0D A;  1WN0 A;  2CGE A;  4LDQ A;  2PF4 E;  4E7Z A;  1ZU5 A;  2IBF A;  2KGO A;  3L34 A;  3NYJ A;  2J9W A;  4G7O F;  3K1I C;  1FMV A;  3Q7G A;  4XEV A;  4Z9H A;  4U5D E;  4W8P A;  3DM9 B;  2Q7R A;  2P6V A;  1NG1 A;  2HMZ A;  4C7O A;  3U3F A;  1C17 M;  1OXK A;  2JPU A;  4LDK A;  2WVN A;  2QTV A;  1FTS A;  2NSF A;  4RDA A;  4HFK B;  3ABL C;  2GWW A;  4JJG A;  5F5H A;  5FZT A;  5COM A;  1LVK A;  1YYX A;  3EZI A;  4QDL A;  3DWW A;  4K7B A;  4CS9 C;  2IXO A;  1CGN A;  3N0T A;  1Z63 A;  2XXA B;  3GM2 A;  2KK1 A;  2LP4 A;  3E9V A;  2L6F A;  2NUT B;  3ZWI A;  1MMG A;  3SNH A;  4O79 A;  1YJG A;  4EBB A;  4G7Z F;  3LLK A;  3CZ6 A;  4Z9I A;  5A6A A;  3US6 A;  4FX5 A;  2EIK C;  3LES A;  3UNG C;  3WHN A;  4D4X A;  1TWA A;  1GQA A;  2WZF A;  4WGY A;  4OIR F;  1XZQ A;  2P0N A;  1U89 A;  4NY3 A;  4YT4 A;  2L81 A;  4CIP A;  3SZR A;  5HSW A;  1K05 A;  1CGM E;  1Z6A A;  1NFO A;  3ZVR A;  4CS7 A;  2CW0 F;  4N6H A;  3EQL F;  4MVQ A;  3NG1 A;  5T3T A;  4XEK A;  1TWH A;  4PJJ A;  4E0I A;  5AGF A;  4DBR A;  1QVX A;  3AGU A;  1M2O A;  2XXA A;  3T9O A;  2ZXR A;  2M4E A;  1ST6 A;  4GYT A;  1D1B A;  1RKE A;  3EJN A;  1MMA A;  3IEE A;  1QZX A;  4LDR A;  2OEX A;  2P1A A;  2VCC A;  1KU2 A;  2OQM A;  5JS5 A;  2BC5 A;  1YYJ A;  2HKV A;  1HMD A;  1PD1 A;  3EHN A;  3HTK C;  3KH2 A;  2KSF A;  3NKE A;  4ULW A;  1LE4 A;  3HNJ A;  1H6G A;  3JTL O;  1Q0K A;  2R05 A;  3UGP A;  2R03 A;  1BDJ B;  2D5R B;  2Q4F A;  4EWC A;  1ZVZ A;  3ZC4 A;  4CS8 C;  3ABK C;  1K40 A;  3K33 A;  2YWA A;  4AK9 A;  2E87 A;  1Q0G A;  2R02 A;  1D1C A;  4Q4Z F;  2EIN C;  3GOR A;  1VYI A;  5E33 A;  2YHS A;  4DBQ A;  4JIO A;  3ASN C;  3DJN B;  1CPQ A;  4MVM A;  4BJT A;  4QI0 A;  1B68 A;  5L0I A;  4GQH A;  4CSA A;  4IGG A;  4MVZ A;  5E2Q A;  2XLM A;  4BJ6 A;  3U0C A;  1UFB A;  3C62 A;  5D91 A;  5E3C A;  3RVY A;  1OQC A;  5DS6 A;  5CIV A;  1F1M A;  4IAO A;  2W45 A;  3AJM A;  3G4Z A;  2VCA A;  3QZC A;  2V3C C;  1FFH A;  3VRC A;  2XM0 A;  2DI3 A;  1ZHY A;  3JSE O;  2A68 F;  4J7T A;  4G78 A;  3TUL A;  2EIL C;  4PJM A;  2QE9 A;  1YZC A;  1S7Z A;  1DOV A;  1OW7 A;  3IQT A;  3SXK A;  5HV9 A;  4XLP F;  2V26 A;  1JPJ A;  3OWT A;  3GM1 A;  2WL8 A;  1Q0D A;  3AG1 C;  3BEH A;  3C8Z A;  3DMD A;  2ICW G;  1T9K A;  2HSB A;  4PAC A;  2AP3 A;  5JLI A;  1QKR A;  2VC9 A;  3A9C A;  5JVE A;  5L3Q A;  4JJF A;  3RQF A;  1ZHX A;  3V7O A;  2ETS A;  1VOM A;  1OR3 A;  1TQG A;  3K7D A;  4JVS A;  1R5I D;  3IQ6 A;  3TJ5 A;  1MND A;  2IYL D;  1ZYR F;  1MMD A;  2XRH A;  2OG2 A;  1MNE A;  2XLV A;  2VH3 A;  2YL7 A;  4MTO A;  2LQG A;  4Q7C A;  3U8P A;  4W8K A;  5EGY A;  2R7T A;  2R7S A;  3EH2 A;  3PCV A;  5A69 A;  2YRF A;  2A0B A;  2C04 A;  2Q9B A;  2OEV A;  2Z15 A;  2J46 A;  2EPN A;  3OA1 A;  3GEI A;  3GWL A;  5KYN A;  1CGO A;  3Q6M A;  2EPM X;  3EHM A;  5AC5 A;  4J7Y A;  4XQ1 A;  1NLX A;  2Y3B A;  3V5Z A;  3QVZ A;  4JTA B;  5B3S C;  5DQZ A;  3DE9 A;  3T6J A;  2XLD A;  4D4N A;  4AX2 A;  3S84 A;  1OCO C;  1WWP A;  2J45 A;  4JW1 A; 
#chains in the Genus database with same CATH homology
 4O6M A;  4U5H A;  1W2W A;  3ZG1 A;  3UMK A;  3ITF A;  3UR3 C;  3FHD A;  4G7H F;  1O87 A;  1NU7 D;  2B0J A;  3W8H A;  2Q9A A;  3O39 A;  3NYM A;  5FCL A;  1ZHW A;  4U5E E;  4ANJ A;  3LS1 A;  4HE8 D;  4E7S A;  3JYH A;  2J0X A;  3EFO B;  3ZIB A;  3FVY A;  4U5F E;  5KYX A;  4CS9 A;  3LEV A;  4YT2 A;  3SP1 A;  3DAG A;  4Q5S F;  3UMH A;  2A1D D;  2R7R A;  3FDQ A;  2R7U A;  4I1M A;  3N24 A;  5KYY B;  2W4B A;  2VAS A;  4OD5 A;  1M56 C;  2Y3H A;  3T4R A;  2PX0 A;  3AG2 C;  4N06 A;  3AG3 C;  1FMW A;  1D0Y A;  4CIH A;  4OIO F;  4X0R A;  5DVW A;  2NUP B;  4DVZ A;  3I4U A;  2ZXW C;  2ZPA A;  3LNR A;  1SZI A;  5F5F A;  4YT5 A;  3FAJ A;  2G3K A;  1M2V B;  2WVO A;  3DZA A;  3SEO A;  2XXA A;  1BR4 A;  3B0P A;  4BEJ A;  4CS8 A;  2NUT A;  5CI8 A;  2KQ9 A;  3S29 A;  3O6X A;  1VK5 A;  3S27 A;  3B0V C;  2QY9 A;  2A6H F;  3I5P A;  2Q9C A;  3EGX B;  1RJ9 B;  4KBL A;  2J7P A;  2Q3T A;  2R7V A;  5KYU B;  2J9V A;  3OEO A;  2FGY A;  3M1C B;  4MQ9 F;  3EG9 B;  2H7O A;  3DD7 A;  4YJW A;  3LAY A;  2R7T A;  3NYL A;  1ZU4 A;  4IRU A;  2L9J A;  3ASO C;  3EPV A;  4A2N B;  1QLE C;  1M57 C;  4J32 B;  1OKK A;  5DS4 A;  5DQT A;  5DS5 A;  1V55 C;  4AE4 B;  3JCU Q;  3Q7L A;  2ZXO A;  4PFP A;  1ZHT A;  2R7Q A;  2J7P D;  1OCZ C;  4U5C E;  5EHH A;  3VYW A;  2XL4 A;  2IXM A;  3NRH A;  1OCC C;  2CNW D;  2IXN A;  4PK4 A;  3SYN A;  2DGJ A;  3LJB A;  3CSK A;  2IOQ A;  3RH3 A;  4CSA C;  4RBN A;  4KNV A;  1VYK A;  4PJN A;  2C03 A;  3ABM C;  1JPN A;  1TWG A;  1OKK D;  2A69 F;  1BR1 A;  1Z3I X;  2CDQ A;  2WVQ A;  4Q7C A;  4W8K A;  2BE5 F;  3W2V A;  4M63 A;  1BR2 A;  3W8I A;  2YEV A;  4CBE A;  3LLI A;  4LAC B;  2W9Y A;  1V54 C;  4MND A;  1NZE A;  4FES A;  5B1A C;  3WG7 C;  4KI2 A;  4LER A;  1MMN A;  2Y69 C;  4BJ5 C;  3TD7 A;  2GFH A;  5T1D B;  3UMI A;  3H65 A;  4C7O B;  4I3M A;  2DYR C;  4C3D A;  4YN0 B;  1O5H A;  2J9U A;  1OCR C;  2R7O A;  1PCX A;  3DJU B;  2H7V C;  4C3E A;  4C3B A;  4XLN F;  4JCH A;  4HEA J;  4ZLD A;  3RFY A;  4DOZ A;  3NKD A;  1SF8 A;  2DYS C;  4P6I C;  3PHF 2;  1TKN A;  4U5B E;  1Z23 A;  1WGW A;  5KYW B;  4QI2 A;  4JZA A;  4U5G A;  2W4M A;  3W2W A;  4YWQ A;  3F46 A;  1SMY F;  3WOD F;  3EZH A;  1ZHZ A;  3AQC A;  4JUR I;  3LS0 A;  1LKX A;  2O9X A;  5CI9 A;  3EFO A;  2WZL A;  4J30 B;  2PFD A;  2H7B A;  2XSE A;  3EGD B;  4BG0 A;  3K6B A;  4LLC A;  2PP4 A;  3AQB A;  1J8Y F;  2HV7 A;  3KMI A;  3ECS A;  3E70 C;  2PX3 A;  2Y3D A;  1TR2 A;  3GAN A;  4OIN F;  4XTK A;  4OIP F;  5KYW A;  3KKB A;  2MWQ A;  3Q6N A;  2IXP A;  5KYY A;  3ZSU A;  2Y39 A;  2WB7 A;  4F4B A;  5T3W A;  3X1O A;  2VB6 A;  3QMK A;  4O6N A;  2KNH A;  3T6B A;  2NUP A;  4FWV A;  4PFO A;  3EGD A;  4LLE A;  3MX3 A;  4OIQ F;  2NG1 A;  3DAF A;  2CNW A;  1D1A A;  2Y3G A;  2EIJ C;  4GEH A;  2EIM C;  4XWJ A;  4I44 A;  1M2V A;  2MYS A;  1NU9 C;  4KC9 A;  4RD9 A;  1Z5Z A;  1TWC A;  3EH1 A;  5IY5 C;  4I1O B;  5DLJ A;  3DXJ F;  4WJ0 A;  3EGX A;  2J0W A;  1RJ9 A;  4IWB A;  2FFH A;  5KYU A;  1IW7 F;  4O6Y A;  4PJL A;  1D0X A;  2I8B A;  3K66 A;  4YT8 A;  3AG4 C;  3S28 A;  2ZXP A;  3EG9 A;  3S0X A;  3B0U X;  3RKO F;  2G62 A;  3PMR A;  1G8X A;  5L3V A;  3L0I A;  2LSE A;  2X51 A;  3HJC A;  4HFF B;  3I5Q A;  4DVY P;  4BJ6 C;  4ZLC A;  2P7V A;  1LS1 A;  4KNW A;  2KW3 C;  5E3A A;  4AE4 A;  5D92 A;  4B6I A;  3JSZ A;  2YZS A;  3KL4 A;  1PD0 A;  1N1C A;  3UGO A;  2HV6 A;  3HLZ A;  3NDB B;  4OD4 A;  5B1B C;  4BJ5 A;  2R7X A;  2KJG A;  4H4K C;  2G3V A;  3DM5 A;  3JRT A;  1D0Z A;  2R7W A;  3RIP A;  3VAY A;  3POV A;  1J8M F;  5BUO A;  2A6E F;  3K1H A;  4G0H A;  3MLG A;  5KYX B;  2JD3 A;  2OCC C;  3RYL A;  3JT1 A;  4O7G A;  4BJ1 A;  3F47 A;  3X2Q C;  3GOD A;  3CQZ A;  1VMA A;  1IZM A;  3B9Q A;  3N2Z B;  1FFT C;  2WZG A;  4K0D A;  2CGE A;  2PF4 E;  4E7Z A;  1ZU5 A;  2KGO A;  3L34 A;  3NYJ A;  2J9W A;  4G7O F;  3K1I C;  1FMV A;  3Q7G A;  4U5D E;  3DM9 B;  2P6V A;  1NG1 A;  4C7O A;  2WVN A;  2QTV A;  1FTS A;  4RDA A;  4HFK B;  3ABL C;  4JJG A;  5F5H A;  1LVK A;  3EZI A;  4QDL A;  4K7B A;  4CS9 C;  2IXO A;  3N0T A;  1Z63 A;  2XXA B;  3E9V A;  2NUT B;  1MMG A;  3SNH A;  4O79 A;  4EBB A;  4G7Z F;  3LLK A;  3CZ6 A;  4FX5 A;  2EIK C;  3LES A;  3UNG C;  1TWA A;  2WZF A;  4OIR F;  4NY3 A;  4YT4 A;  2L81 A;  3SZR A;  5HSW A;  1Z6A A;  3ZVR A;  4CS7 A;  2CW0 F;  3EQL F;  3NG1 A;  5T3T A;  1TWH A;  4PJJ A;  4DBR A;  1M2O A;  2ZXR A;  2M4E A;  1ST6 A;  4GYT A;  1D1B A;  3EJN A;  1MMA A;  3IEE A;  1QZX A;  1KU2 A;  3KH2 A;  3HTK C;  1PD1 A;  3EHN A;  3NKE A;  4ULW A;  3UGP A;  2D5R B;  4EWC A;  4CS8 C;  3ZC4 A;  3ABK C;  3K33 A;  4AK9 A;  2E87 A;  1D1C A;  4Q4Z F;  2EIN C;  1VYI A;  5E33 A;  2YHS A;  4DBQ A;  3ASN C;  3DJN B;  4BJT A;  4QI0 A;  4CSA A;  5E2Q A;  4BJ6 A;  5DS6 A;  5D91 A;  5E3C A;  4IAO A;  2W45 A;  2V3C C;  3QZC A;  1FFH A;  1ZHY A;  2A68 F;  2EIL C;  4PJM A;  1S7Z A;  4XLP F;  2V26 A;  1JPJ A;  3OWT A;  2WL8 A;  3AG1 C;  3DMD A;  5L3Q A;  4JJF A;  1ZHX A;  3V7O A;  1VOM A;  3K7D A;  4JVS A;  1MND A;  2IYL D;  1ZYR F;  1MMD A;  2XRH A;  2OG2 A;  1MNE A;  2VH3 A;  5EGY A;  2R7S A;  3EH2 A;  2C04 A;  2Q9B A;  2Z15 A;  2J46 A;  3OA1 A;  5KYN A;  3Q6M A;  3EHM A;  2Y3B A;  5B3S C;  5DQZ A;  3T6J A;  4AX2 A;  1OCO C;  4IJJ A;  2J45 A;  4JW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...