2J9UA

2 angstrom x-ray structure of the yeast escrt-i vps28 c-terminus in complex with the nzf-n domain from escrt-ii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
94
structure length
94
Chain Sequence
FNAKYVAEATGNFITVMDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIVRINKLSIGDTLTETQIRELLFDLELAYKSFYALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insight Into the Escrt-I/-II Link and its Role in Mvb Trafficking.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 28
total genus 39
structure length 94
sequence length 94
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1130 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2j9uA00
2J9VA 2J9WA 2G3KA 2J9UA
chains in the Genus database with same CATH superfamily
4EWCA 4DRIB 2O9XA 4N6CA 3UMIA 4MVUA 4GQHA 3LAYA 3F47A 1I4ZA 4JTAB 2J9BA 1QKRA 4PJNA 4LACB 5TJ5E 3SNHA 3KYIA 1MMNA 4PACA 1HY5A 2ZPAA 1ZHTA 1VYKA 1VMAA 3O55A 5AC4A 3HNIA 4EHPA 1ST6A 1RXQA 2CW0F 3H2UA 2R7OA 3L0IA 1OW8A 4A2NB 3ABKC 5KYUB 2PNOA 4IRUA 3Q7LA 2NUTA 2MHRA 1R4TA 2CNWD 3JT1A 4KI2A 3GWNA 2B0HA 1U89A 4BEMJ 4XPWA 2GAQA 1M2OA 1MMAA 2IXPA 2NSGA 1VB5A 2A6HF 4YN0B 3OWTA 1G4US 1M2VB 1VOMA 4QI0A 3WAQA 1B68A 3LEOA 2VB6A 1NSGB 3V7OA 2XLMA 3C63A 4MVOA 1O3UA 3SZRA 4JE9A 4DJ9A 1LS4A 1XWJA 3T6JA 1OKKD 3EQLF 3KKBA 1SF8A 3C8ZA 1UFBA 3NRHA 4U5EE 5D91A 3U2LA 2OOCA 2OQMA 2VASA 5GPGB 2ZD9A 1BR1A 2Y3GA 3X2QC 2A0BA 4JVSA 1V54C 2NUTB 3DJUB 1M6TA 4PJLA 3TK0A 4J7TA 1WATA 4L6RA 1O87A 2EPOA 2LIGA 4X0RA 3ECSA 5L0JA 1K05A 3BRJA 3VRCA 1LI7A 4O6MA 1M2VA 1XZPA 3UMKA 4EIYA 3C62A 4PFOA 3X1OA 5IY5C 5L3QA 2HFIA 1D1BA 1FMWA 2L81A 4Q7CA 2YL0A 3EHMA 2D5RB 1JPNA 3T4RA 2GDCA 2FGYA 2CCYA 2X51A 3ZQVA 4CBEA 3IPMO 2EPKX 2QLAA 3HTKC 5DQZA 2CYDA 4BJ5C 3AQBA 1KTMA 4JZAA 4D4XA 3BEHA 3W2WA 1ZZPA 1BZ4A 2XLDA 1CGNA 3LUTB 1AUEA 2L6FA 3U8PA 1XZQA 4NTBA 4WGYA 2VCBA 2AU5A 2LSEA 2IBFA 4Z9HA 3GM1A 2NUPA 3RQGA 3UR3C 1OW6A 5T3TA 4C3BA 2OKUA 2WVOA 2EIKC 3M79A 1MMGA 2VCAA 5JT4A 5EHHA 3TJ5A 2XL8A 3CSKA 2DGJA 4BJTA 3EZIA 5KYXB 4M63A 4E17A 1GQAA 3ATPA 4I3MA 3RVYA 3AG3C 3DAFA 3OEOA 4YT8A 4N4WA 3ZTMA 3K33A 3ZVRA 3PHF2 1FMVA 3CAXA 4P9FA 4U5CE 3JSEO 3NMJA 3ZIBA 3HLZA 4O7GA 1Z23A 2OCCC 2HSQA 1APCA 1QPUA 2G3KA 2NPUA 3B0PA 4D4NA 4DBQA 2XLEA 3ABLC 3K7DA 4O6YA 4IJJA 4YT5A 3EH2A 5E3AA 2C03A 3I5QA 2OEXA 3TULA 2A1DD 1HE9A 4BPMA 1C02A 1NU7D 3E70C 1Y6DA 1YYJA 1JAFA 2Y69C 3N2ZB 2WZFA 1YDIA 3I4UA 4IAOA 1YLMA 4EBBA 2PP4A 3NKEA 5CIVA 2BE5F 3UGPA 4JW1A 1NBBA 4JEBA 1L7CA 4KC9A 3U9MA 4OIOF 1ZW2A 2XLVA 5JSLA 2LQGA 5HV9A 3EGXA 2XSEA 1ZU4A 4BJ5A 4CDYA 4YT2A 3L8JA 3FXHA 1T6QA 4FAPB 4NTFA 4FX5A 1A7VA 2XLWA 3S84A 3J06A 4YT4A 1H9TA 2GFHA 4CS8C 4U9DA 1FAPB 1ZHYA 3HNJA 4DOZA 4OIPF 1LIHA 2HKVA 1YZAA 4JJFA 4YK5A 5DS6A 2KYHA 2AVKA 2Q00A 3U9JA 2W4MA 3PDMP 4OD5A 2KC3A 1MQVA 3DXJF 4G7OF 3IQ5A 1JOGA 2DI3A 3PCVA 4W8PA 3F46A 3HNLA 1Z63A 4BJ6C 4AE4A 1RKEA 2HV6A 3A11A 2WZGA 3NG1A 2KNHA 2J9UA 4DXWA 4I1OB 4MQ9F 1WASA 3EFOB 4U5GA 4AL1A 4K0DA 4UDVA 1RJ9B 2R7XA 1WGWA 3MFNA 4CX9A 2IM8A 3QVZA 3L34A 2WL8A 3UNGC 1U6HA 2PBEA 5F28E 1RJ9A 3FHDA 5JUAA 4QI2A 2L6GA 4JURI 3GEEA 4BJ1A 5KYYA 2R7TA 2QY9A 3DM9B 3S90A 3DM5A 3NMIA 2P7VA 2J45A 5KYWB 2IXOA 4P6IC 3QMKA 2LD6A 2LFFA 3NDBB 4EUKB 3V5XA 1EKYA 1JMWA 3W4YA 3L8IA 1VLTA 5B3IA 5L0HA 1QZXA 4JJGA 2F22A 1FTSA 2M64A 4ZLDA 2R9RB 2R05A 1HMOA 4G0HA 3LNMB 4NC3A 2FFHA 2WZLA 4MS2A 1A41A 4K7BA 4J32B 3K66A 1YA9A 2KGOA 2YWAA 3O6XA 5L0CA 1PD1A 2CNWA 3UMHA 2OJQA 4MVSA 2ZXRA 2Y3BA 4KNWA 4DRJB 1Q0FA 2W4BA 3LLKA 1T9KA 2IYLD 4CS9C 1N1CA 1V4AA 4MTOA 2DYSC 3EHNA 5E33A 3ZWIA 3CZ6A 3N0TA 1TR2A 3RQEA 4CJOA 4AK9A 4Q5SF 3OA1A 4GEHA 1IZMA 2WVQA 3PMRA 1JRAA 2RD9A 1Z7Qc 4LERA 4XPYA 4I1MA 4XPXA 3VF0A 1ZVZA 2YL1A 4JTCB 4RDAA 3RVZA 5A6JA 1CGOA 2GWWA 2Y3DA 3B71A 3ZC4A 5JP7A 1ORJA 2Q9AA 3I5PA 3IHUA 1V55C 4RD9A 4WGZA 2VC9A 3RFYA 1H9GA 2XS8A 2Q9CA 3NKDA 5EGYA 1NG1A 1KU2A 3DI5A 4NQFA 4PJJA 5L3VA 1BR2A 1OR2A 4CIPA 5BQGA 3DE8A 4YL3A 2KW3C 3MYIA 3QTHA 1FR0A 3IEEA 2KQ9A 2EINC 5HSWA 1TFKB 3GANA 3SYNA 1MMDA 1PD0A 1JPJA 3WHNA 2R7SA 3ZSUA 4IAQA 4I44A 4ULWA 3W8IA 1C03A 4G78A 4XEVA 1QQ3A 5B3SC 1I4YA 3JYYA 3C18A 5COGA 5DS4A 4J7YA 2V26A 3O10A 2LCHA 2A69F 4MVQA 3MX3A 2LFDA 1G4WR 3LESA 3NYLA 4E0HA 1OCCC 3S0XA 3FVYA 3U0CA 1UG7A 1TQGA 2TMVP 4MVMA 2HS5A 1K40A 1OQCA 3C8GA 256BA 4C3EA 1T6IA 1L3PA 1VTMP 2L6HA 2YZSA 2YVKA 4MTFA 5T1DB 3CQZA 3HKKA 5COFA 2EPMX 4AL0A 2BL2A 2ICWG 1D1AA 2QE9A 2YHSA 3JYHA 1EQ1A 1Y4CA 4O79A 4WJ0A 5B1AC 2R7QA 4J30B 4LDRA 4ONSA 1CGME 4N06A 4KBLA 3RYLA 3SXMA 2IXNA 3FOPA 2QNLA 2UUIA 4IGGA 2EPNA 5EK0A 2Y3HA 1TWHA 2HUJA 2YLGA 3QW1A 5AGFA 4FWVA 1E85A 1QVXA 1ZHWA 4OIQF 3W8HA 1E2XA 5T3WA 4NTAA 3C8GB 1SYQA 4U5FE 5CI8A 4H4KC 1EA8A 3JRTA 3KYJA 4XEKA 4PFPA 4HFFB 2RSEB 1ORYA 4CS7A 3FDQA 3POVA 3IQTA 5A6BA 3HNKA 3AJMA 3DKAA 1W2WA 1ZU5A 1BR4A 3AQCA 4PR9A 2NSFA 3AGTA 5JVEA 1T5OA 2R7UA 3LLIA 3NYJA 2DYRC 4MVZA 1OW7A 1HMDA 4XEFA 3SP1A 1NFOA 2PFDA 2A68F 3ASOC 5FZTA 1CPRA 4ER9A 5F5HA 4A4AA 3T6GB 1D0XA 2V3CC 2YRFA 4MW3A 5BUOA 1I5NA 1A7DA 1PV3A 3MLGA 3QVYA 2R03A 4JRZA 1YA7O 1J8YF 3KL4A 4ULVA 3M4CA 5A69A 1DOWA 5A6BD 2GA0A 3V5YA 1MNEA 3M15A 1TWGA 3DMDA 3R7CA 4LLEA 4CIHA 2MYSA 3W2VA 1WN0A 2JPUA 3AG2C 3E9VA 3EFOA 3MBGA 1YAUO 2UUHA 1AVOB 3B9QA 3DZAA 5COMA 4CJGA 3TOLA 4XQ1A 4AE4B 3G4ZA 2OG2A 2ZXOA 4CSAC 2M4EA 2WVNA 3MYFA 3RIPA 1FFHA 2J8WA 1YYXA 1SR2A 1U0BB 2AWCA 3IQ6A 5L0GA 2X0CA 2Q4FA 5E2QA 1Q0DA 1SZIA 2XM4A 3US6A 5FCLA 4XTKA 5KYNA 1OCZC 2XL4A 2EIJC 1OCOC 1R5ID 3AG4C 1LS1A 2QUPA 2JX0A 1S7ZA 3NYMA 5E3CA 1FFTC 3LS0A 2YLDA 1H6GA 3GEIA 2KK1A 2W45A 4CS8A 2XXAB 1OKKA 3GORA 4BG0A 4JEAA 1K04A 4Z9IA 2A0UA 1ZHZA 4PJMA 3EZHA 1J8MF 2R7RA 2B0JA 1V74B 3GM3A 3N24A 4JTDB 1WWPA 3RF3A 3K1IC 3WG7C 1M56C 3RQFA 3RH3A 3FAJA 4E0IA 1OR3A 2P1AA 1LI5A 1NFNA 1PCXA 1Z6AA 3C7JA 4OD4A 4PK4A 1LE2A 1TWCA 2DB4A 4U5DE 2P0NA 1BBHA 3U8VA 4CS9A 4IARA 1ZYRF 3EH1A 3TOMA 2PX3A 4R32A 1YARO 4C7OA 2J7PA 3EJNA 4LDKA 3VM6A 3G50A 3DAGA 4OINF 4NCQA 3M4BA 3SXZA 1Q0KA 2FAPB 2LK4A 1CPQA 1SMYF 2XLHA 3RW0A 3Q6MA 3S29A 4OIRF 4U9EA 1LE4A 1GGQA 2ETSA 1VLSA 2KJGA 1Z3IX 2H7BA 3G4XA 2IOQA 2CGEA 1TFOB 1YVIA 2CDQA 3KMIA 4U5HA 4W8KA 3U5SA 5BQHA 2OJED 2J9WA 1EI7A 3SEOA 1H7IA 4YJWA 4EBKA 1E83A 4YL0A 1JR8A 4XLNF 1NZEA 4EKWA 4G7ZF 1VK5A 2AWYA 3B0UX 3T6BA 1A0BA 1LVKA 2J0WA 4GYTA 4AX2A 4WABA 1NU9C 2AP3A 4JCHA 2PF4E 2G3VA 2J7PD 1ZHXA 2J46A 2EPLX 3JCUQ 1LKXA 2HSBA 2I8BA 2BC5A 1LPEA 2HMQA 3CEXA 1VYIA 1D0ZA 1HE1A 2Y39A 5DQTA 3DD7A 4E7SA 1HW1A 4DBRA 2ZXWC 4CSAA 4RBNA 3TD7A 3ZDLA 5A6AA 1YZCA 2VH3A 1IW7F 5F5FA 3QZCA 3ZTZA 3AG1C 4JC7A 4HFKB 2H7OA 5KYUA 2PX0A 3EG9B 3GODA 4NY3A 3SXKA 5DLJA 3H2VA 1O5HA 1GM5A 2MWQA 3V5ZA 3LJBA 4P9TA 2YEVA 5DVWA 2YL7A 2XRHA 3NMKA 3H65A 3K1IA 5KYYB 4IWBA 3M1CB 5JRAA 4MW8A 2I15A 3Q6NA 3FMSA 2H8AA 1BDJB 4YL1A 2XM0A 1A7EA 4E18A 1GS9A 1G8XA 3HJCA 3B29A 1C17M 4IB4A 3C8GD 2C04A 1DOVA 5A6KA 2R7VA 4XWJA 2EILC 2OU6A 3DE9A 3UGOA 1ZW3A 3Q7GA 2XL6A 3ABMC 1YJGA 2Q3TA 3JZ0A 3O39A 3RKOF 3ZG1A 4CDVA 1G5ZA 4G7HF 2KSFA 3SXYA 4F4BA 3L1MA 2YKZA 4ZLCA 3EG9A 4MNDA 2JD3A 1OCRC 2WB7A 3AGUA 5BQIA 2L7AA 2QTVA 3EGDB 2A6EF 3VYWA 1MNDA 1WTYA 2J0XA 2NUPB 4FESA 4JCZA 4XLPF 1KNYA 2VCCA 2HJ3A 3S27A 3KPHA 3KH2A 2R02A 1AEPA 2Q9BA 2YLIA 2HZ8A 3WODF 1E84A 2YQYA 1RKEB 2HJMA 5L0IA 3JRMO 2E87A 4N6HA 1TKNA 2HV7A 1S05A 3ITFA 2R7WA 2OEVA 3T9OA 2P61A 3U2MA 1T01A 2G62A 2Z15A 4U5BE 4ANJA 3FOOA 4C3DA 2P6VA 3ZQYA 5AC5A 1M57C 2H7VC 3EPVA 3K1HA 4KNVA 1TWAA 4LLCA 5L0DA 2XLOA 3ASNC 1F1MA 1QLEC 2IXMA 3DWWA 3LEVA 4JIOA 3S9OA 3S28A 2J9VA 4DVZA 1RMVA 4HEAJ 4JKVA 2ZXPA 3VAYA 3GWLA 4EBJA 3TQOA 5DS5A 5CI9A 4BEJA 1FNTc 4MVRA 3JTLO 4B6IA 4Q4ZF 1WOLA 3EGXB 4H54A 3GEHA 5JLIA 3K6BA 3FAPB 3LNRA 4CDAA 4YWQA 5JS5A 3EGDA 2XS1A 5K0IA 3B0VC 4C7OB 2NG1A 3GM2A 1Q0MA 4DRHB 3LS1A 4Z9JA 4K1OA 5L0FA 1QSPA 4DVYP 1Q0GA 3A9CA 2D4UA 1RCPA 2LP4A 3U3FA 1T6UA 5KYXA 2HMZA 3R2PA 1NLXA 3U3BA 2R25A 1Z5ZA 1HW2A 4QDLA 4BJ6A 5KYWA 1OXKA 2YL3A 2ASRA 1E86A 1D1CA 2EIMC 4MTGA 4O6NA 3JSZA 5B1BC 4E7ZA 4HE8D 2XXAA 3AOUA 3IQCA 1OXBA 3TJ6A 1D0YA 4LDQA 1LM3B 5D92A 3DJNB 2Q7RA 2W9YA 3QW0A 1ORSC 1RKCA 2L9JA
chains in the Genus database with same CATH topology
4EWCA 2O9XA 3UMIA 3LAYA 3F47A 4PJNA 4LACB 3SNHA 1MMNA 2ZPAA 1ZHTA 1VYKA 1VMAA 1ST6A 4A2NB 2CW0F 3L0IA 2R7OA 3ABKC 4IRUA 3Q7LA 2NUTA 2CNWD 3JT1A 4KI2A 1M2OA 1MMAA 2IXPA 2A6HF 4YN0B 3OWTA 1M2VB 1VOMA 4QI0A 2VB6A 3V7OA 3SZRA 3T6JA 1OKKD 3EQLF 3KKBA 1SF8A 3NRHA 4U5EE 5D91A 2VASA 3X2QC 1BR1A 2Y3GA 5KYWB 4JVSA 1V54C 2NUTB 3DJUB 4PJLA 1O87A 4X0RA 3ECSA 5KYUB 4O6MA 1M2VA 3UMKA 5IY5C 5L3QA 4PFOA 3X1OA 1D1BA 1FMWA 2L81A 4Q7CA 3EHMA 2D5RB 1JPNA 3T4RA 2FGYA 2X51A 4CBEA 3HTKC 5DQZA 4BJ5C 3AQBA 3W2WA 2LSEA 2NUPA 3UR3C 5T3TA 4C3BA 2WVOA 2EIKC 1MMGA 5EHHA 3CSKA 2DGJA 4BJTA 3EZIA 5KYXB 4M63A 4I3MA 3AG3C 3DAFA 3OEOA 4YT8A 3ZVRA 3K33A 3PHF2 1FMVA 4U5CE 3ZIBA 3HLZA 4O7GA 1Z23A 2OCCC 2G3KA 3B0PA 4DBQA 4O6YA 3ABLC 3K7DA 4YT5A 4IJJA 3EH2A 5E3AA 2C03A 3I5QA 2A1DD 1NU7D 4IAOA 3E70C 2Y69C 3N2ZB 5T3WA 2WZFA 4EBBA 3I4UA 2PP4A 3NKEA 2BE5F 3UGPA 4JW1A 4KC9A 4OIOF 3EGXA 2XSEA 1ZU4A 4BJ5A 4YT2A 4FX5A 4YT4A 2GFHA 4CS8C 1ZHYA 4DOZA 4OIPF 4JJFA 5DS6A 2W4MA 4OD5A 3DXJF 4G7OF 3F46A 1Z63A 4BJ6C 4AE4A 2HV6A 2WZGA 3NG1A 2KNHA 2J9UA 4I1OB 4MQ9F 3EFOB 4U5GA 4K0DA 2R7XA 1RJ9B 1WGWA 3L34A 2WL8A 1RJ9A 3FHDA 4QI2A 4JURI 4BJ1A 5KYYA 2R7TA 2QY9A 3DM9B 3DM5A 2P7VA 2J45A 2IXOA 4P6IC 3QMKA 3NDBB 1QZXA 4JJGA 1FTSA 4ZLDA 4G0HA 2FFHA 2WZLA 4K7BA 4J32B 3K66A 2KGOA 3O6XA 1PD1A 2CNWA 3UMHA 2ZXRA 2Y3BA 4KNWA 2W4BA 3LLKA 2IYLD 4CS9C 1N1CA 2DYSC 3EHNA 5E33A 3CZ6A 3N0TA 1TR2A 4AK9A 4Q5SF 3OA1A 4GEHA 1IZMA 2WVQA 3PMRA 4LERA 4I1MA 4RDAA 2Y3DA 2Q9AA 3I5PA 4RD9A 1V55C 3RFYA 2Q9CA 3NKDA 5EGYA 1NG1A 1KU2A 4PJJA 5L3VA 1BR2A 2KW3C 3IEEA 2KQ9A 2EINC 5HSWA 3GANA 3SYNA 1MMDA 1PD0A 1JPJA 2R7SA 3ZSUA 4I44A 4ULWA 3W8IA 5B3SC 5DS4A 2V26A 2A69F 3MX3A 3LESA 3NYLA 1OCCC 3S0XA 3FVYA 4C3EA 2YZSA 3CQZA 1D1AA 2YHSA 4O79A 4WJ0A 5B1AC 2R7QA 4J30B 4N06A 4KBLA 3RYLA 2IXNA 2Y3HA 1TWHA 4OIQF 4FWVA 1ZHWA 4U5FE 5CI8A 4H4KC 3JRTA 3POVA 4PFPA 4HFFB 4CS7A 3FDQA 1W2WA 1ZU5A 1BR4A 3AQCA 2R7UA 3LLIA 3NYJA 2DYRC 3SP1A 2PFDA 2A68F 3ASOC 5F5HA 1D0XA 5BUOA 3MLGA 1J8YF 3KL4A 1MNEA 1TWGA 3DMDA 4LLEA 4CIHA 2MYSA 3W2VA 3AG2C 3E9VA 3EFOA 3B9QA 3DZAA 4AE4B 2OG2A 2ZXOA 4CSAC 2M4EA 2WVNA 3RIPA 1FFHA 5E2QA 1SZIA 5FCLA 4XTKA 5KYNA 1OCZC 2XL4A 2EIJC 1OCOC 3AG4C 1LS1A 1S7ZA 3NYMA 5E3CA 1FFTC 3LS0A 2W45A 4CS8A 2XXAB 1OKKA 4BG0A 1ZHZA 4PJMA 3EZHA 1J8MF 2R7RA 2B0JA 3N24A 3K1IC 3WG7C 1M56C 3RH3A 3FAJA 3UNGC 3ZC4A 1Z6AA 1PCXA 4OD4A 4PK4A 4U5DE 4CS9A 1TWCA 1ZYRF 3EH1A 4C7OA 2PX3A 2J7PA 3EJNA 3DAGA 4OINF 1SMYF 3S29A 3Q6MA 4OIRF 2H7BA 4JZAA 1Z3IX 2KJGA 5T1DB 3W8HA 2CGEA 2IOQA 2CDQA 3KMIA 4U5HA 4W8KA 4ZLCA 2J9WA 3SEOA 4YJWA 4XLNF 4G7ZF 1NZEA 1VK5A 3B0UX 3T6BA 1LVKA 2J0WA 4GYTA 4AX2A 1NU9C 4JCHA 2PF4E 2G3VA 2J7PD 1ZHXA 2J46A 3JCUQ 1LKXA 2I8BA 1VYIA 1D0ZA 2Y39A 5DQTA 3DD7A 4E7SA 4DBRA 2ZXWC 4CSAA 4RBNA 3TD7A 5F5FA 2VH3A 1IW7F 3QZCA 3AG1C 4HFKB 2H7OA 5KYUA 2PX0A 3EG9B 3GODA 4NY3A 5DLJA 1O5HA 2MWQA 3LJBA 2YEVA 5DVWA 2XRHA 3H65A 5KYYB 4IWBA 3M1CB 3Q6NA 1G8XA 3HJCA 2C04A 2R7VA 4XWJA 2EILC 3UGOA 3Q7GA 3ABMC 3O39A 2V3CC 2Q3TA 3ZG1A 4G7HF 3RKOF 4F4BA 3EG9A 4MNDA 2JD3A 1OCRC 2WB7A 2QTVA 3EGDB 2A6EF 3VYWA 1MNDA 2J0XA 2NUPB 4FESA 4XLPF 3S27A 3KH2A 2Q9BA 3WODF 2E87A 1TKNA 2HV7A 3ITFA 2R7WA 2G62A 2Z15A 4U5BE 4ANJA 4C3DA 2P6VA 1M57C 2H7VC 3EPVA 3K1HA 4KNVA 1TWAA 4LLCA 3ASNC 1QLEC 2IXMA 3LEVA 3S28A 2J9VA 4DVZA 4HEAJ 2ZXPA 3VAYA 5DS5A 5CI9A 4BEJA 4B6IA 4Q4ZF 3EGXB 3K6BA 3LNRA 4YWQA 3EGDA 3B0VC 4C7OB 2NG1A 3LS1A 4DVYP 5KYXA 1Z5ZA 4QDLA 4BJ6A 5KYWA 1D1CA 2EIMC 4O6NA 3JSZA 5B1BC 4E7ZA 4HE8D 2XXAA 1D0YA 5D92A 3DJNB 2W9YA 3JYHA 2L9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9V A;  2J9W A;  2G3K A;  2J9U A; 
#chains in the Genus database with same CATH topology
 4EWC A;  4DRI B;  2O9X A;  4N6C A;  3UMI A;  4MVU A;  4GQH A;  3LAY A;  3F47 A;  1I4Z A;  4JTA B;  2J9B A;  1QKR A;  4PJN A;  4LAC B;  5TJ5 E;  3SNH A;  3KYI A;  1MMN A;  4PAC A;  1HY5 A;  2ZPA A;  1ZHT A;  1VYK A;  1VMA A;  3O55 A;  5AC4 A;  3HNI A;  4EHP A;  1ST6 A;  1RXQ A;  2CW0 F;  3H2U A;  2R7O A;  3L0I A;  1OW8 A;  4A2N B;  3ABK C;  5KYU B;  2PNO A;  4IRU A;  3Q7L A;  2NUT A;  2MHR A;  1R4T A;  2CNW D;  3JT1 A;  4KI2 A;  3GWN A;  2B0H A;  1U89 A;  4BEM J;  4XPW A;  2GAQ A;  1M2O A;  1MMA A;  2IXP A;  2NSG A;  1VB5 A;  2A6H F;  4YN0 B;  3OWT A;  1G4U S;  1M2V B;  1VOM A;  4QI0 A;  3WAQ A;  1B68 A;  3LEO A;  2VB6 A;  1NSG B;  3V7O A;  2XLM A;  3C63 A;  4MVO A;  1O3U A;  3SZR A;  4JE9 A;  4DJ9 A;  1LS4 A;  1XWJ A;  3T6J A;  1OKK D;  3EQL F;  3KKB A;  1SF8 A;  3C8Z A;  1UFB A;  3NRH A;  4U5E E;  5D91 A;  3U2L A;  2OOC A;  2OQM A;  2VAS A;  5GPG B;  2ZD9 A;  1BR1 A;  2Y3G A;  3X2Q C;  2A0B A;  4JVS A;  1V54 C;  2NUT B;  3DJU B;  1M6T A;  4PJL A;  3TK0 A;  4J7T A;  1WAT A;  4L6R A;  1O87 A;  2EPO A;  2LIG A;  4X0R A;  3ECS A;  5L0J A;  1K05 A;  3BRJ A;  3VRC A;  1LI7 A;  4O6M A;  1M2V A;  1XZP A;  3UMK A;  4EIY A;  3C62 A;  4PFO A;  3X1O A;  5IY5 C;  5L3Q A;  2HFI A;  1D1B A;  1FMW A;  2L81 A;  4Q7C A;  2YL0 A;  3EHM A;  2D5R B;  1JPN A;  3T4R A;  2GDC A;  2FGY A;  2CCY A;  2X51 A;  3ZQV A;  4CBE A;  3IPM O;  2EPK X;  2QLA A;  3HTK C;  5DQZ A;  2CYD A;  4BJ5 C;  3AQB A;  1KTM A;  4JZA A;  4D4X A;  3BEH A;  3W2W A;  1ZZP A;  1BZ4 A;  2XLD A;  1CGN A;  3LUT B;  1AUE A;  2L6F A;  3U8P A;  1XZQ A;  4NTB A;  4WGY A;  2VCB A;  2AU5 A;  2LSE A;  2IBF A;  4Z9H A;  3GM1 A;  2NUP A;  3RQG A;  3UR3 C;  1OW6 A;  5T3T A;  4C3B A;  2OKU A;  2WVO A;  2EIK C;  3M79 A;  1MMG A;  2VCA A;  5JT4 A;  5EHH A;  3TJ5 A;  2XL8 A;  3CSK A;  2DGJ A;  4BJT A;  3EZI A;  5KYX B;  4M63 A;  4E17 A;  1GQA A;  3ATP A;  4I3M A;  3RVY A;  3AG3 C;  3DAF A;  3OEO A;  4YT8 A;  4N4W A;  3ZTM A;  3K33 A;  3ZVR A;  3PHF 2;  1FMV A;  3CAX A;  4P9F A;  4U5C E;  3JSE O;  3NMJ A;  3ZIB A;  3HLZ A;  4O7G A;  1Z23 A;  2OCC C;  2HSQ A;  1APC A;  1QPU A;  2G3K A;  2NPU A;  3B0P A;  4D4N A;  4DBQ A;  2XLE A;  3ABL C;  3K7D A;  4O6Y A;  4IJJ A;  4YT5 A;  3EH2 A;  5E3A A;  2C03 A;  3I5Q A;  2OEX A;  3TUL A;  2A1D D;  1HE9 A;  4BPM A;  1C02 A;  1NU7 D;  3E70 C;  1Y6D A;  1YYJ A;  1JAF A;  2Y69 C;  3N2Z B;  2WZF A;  1YDI A;  3I4U A;  4IAO A;  1YLM A;  4EBB A;  2PP4 A;  3NKE A;  5CIV A;  2BE5 F;  3UGP A;  4JW1 A;  1NBB A;  4JEB A;  1L7C A;  4KC9 A;  3U9M A;  4OIO F;  1ZW2 A;  2XLV A;  5JSL A;  2LQG A;  5HV9 A;  3EGX A;  2XSE A;  1ZU4 A;  4BJ5 A;  4CDY A;  4YT2 A;  3L8J A;  3FXH A;  1T6Q A;  4FAP B;  4NTF A;  4FX5 A;  1A7V A;  2XLW A;  3S84 A;  3J06 A;  4YT4 A;  1H9T A;  2GFH A;  4CS8 C;  4U9D A;  1FAP B;  1ZHY A;  3HNJ A;  4DOZ A;  4OIP F;  1LIH A;  2HKV A;  1YZA A;  4JJF A;  4YK5 A;  5DS6 A;  2KYH A;  2AVK A;  2Q00 A;  3U9J A;  2W4M A;  3PDM P;  4OD5 A;  2KC3 A;  1MQV A;  3DXJ F;  4G7O F;  3IQ5 A;  1JOG A;  2DI3 A;  3PCV A;  4W8P A;  3F46 A;  3HNL A;  1Z63 A;  4BJ6 C;  4AE4 A;  1RKE A;  2HV6 A;  3A11 A;  2WZG A;  3NG1 A;  2KNH A;  2J9U A;  4DXW A;  4I1O B;  4MQ9 F;  1WAS A;  3EFO B;  4U5G A;  4AL1 A;  4K0D A;  4UDV A;  1RJ9 B;  2R7X A;  1WGW A;  3MFN A;  4CX9 A;  2IM8 A;  3QVZ A;  3L34 A;  2WL8 A;  3UNG C;  1U6H A;  2PBE A;  5F28 E;  1RJ9 A;  3FHD A;  5JUA A;  4QI2 A;  2L6G A;  4JUR I;  3GEE A;  4BJ1 A;  5KYY A;  2R7T A;  2QY9 A;  3DM9 B;  3S90 A;  3DM5 A;  3NMI A;  2P7V A;  2J45 A;  5KYW B;  2IXO A;  4P6I C;  3QMK A;  2LD6 A;  2LFF A;  3NDB B;  4EUK B;  3V5X A;  1EKY A;  1JMW A;  3W4Y A;  3L8I A;  1VLT A;  5B3I A;  5L0H A;  1QZX A;  4JJG A;  2F22 A;  1FTS A;  2M64 A;  4ZLD A;  2R9R B;  2R05 A;  1HMO A;  4G0H A;  3LNM B;  4NC3 A;  2FFH A;  2WZL A;  4MS2 A;  1A41 A;  4K7B A;  4J32 B;  3K66 A;  1YA9 A;  2KGO A;  2YWA A;  3O6X A;  5L0C A;  1PD1 A;  2CNW A;  3UMH A;  2OJQ A;  4MVS A;  2ZXR A;  2Y3B A;  4KNW A;  4DRJ B;  1Q0F A;  2W4B A;  3LLK A;  1T9K A;  2IYL D;  4CS9 C;  1N1C A;  1V4A A;  4MTO A;  2DYS C;  3EHN A;  5E33 A;  3ZWI A;  3CZ6 A;  3N0T A;  1TR2 A;  3RQE A;  4CJO A;  4AK9 A;  4Q5S F;  3OA1 A;  4GEH A;  1IZM A;  2WVQ A;  3PMR A;  1JRA A;  2RD9 A;  1Z7Q c;  4LER A;  4XPY A;  4I1M A;  4XPX A;  3VF0 A;  1ZVZ A;  2YL1 A;  4JTC B;  4RDA A;  3RVZ A;  5A6J A;  1CGO A;  2GWW A;  2Y3D A;  3B71 A;  3ZC4 A;  5JP7 A;  1ORJ A;  2Q9A A;  3I5P A;  3IHU A;  1V55 C;  4RD9 A;  4WGZ A;  2VC9 A;  3RFY A;  1H9G A;  2XS8 A;  2Q9C A;  3NKD A;  5EGY A;  1NG1 A;  1KU2 A;  3DI5 A;  4NQF A;  4PJJ A;  5L3V A;  1BR2 A;  1OR2 A;  4CIP A;  5BQG A;  3DE8 A;  4YL3 A;  2KW3 C;  3MYI A;  3QTH A;  1FR0 A;  3IEE A;  2KQ9 A;  2EIN C;  5HSW A;  1TFK B;  3GAN A;  3SYN A;  1MMD A;  1PD0 A;  1JPJ A;  3WHN A;  2R7S A;  3ZSU A;  4IAQ A;  4I44 A;  4ULW A;  3W8I A;  1C03 A;  4G78 A;  4XEV A;  1QQ3 A;  5B3S C;  1I4Y A;  3JYY A;  3C18 A;  5COG A;  5DS4 A;  4J7Y A;  2V26 A;  3O10 A;  2LCH A;  2A69 F;  4MVQ A;  3MX3 A;  2LFD A;  1G4W R;  3LES A;  3NYL A;  4E0H A;  1OCC C;  3S0X A;  3FVY A;  3U0C A;  1UG7 A;  1TQG A;  2TMV P;  4MVM A;  2HS5 A;  1K40 A;  1OQC A;  3C8G A;  256B A;  4C3E A;  1T6I A;  1L3P A;  1VTM P;  2L6H A;  2YZS A;  2YVK A;  4MTF A;  5T1D B;  3CQZ A;  3HKK A;  5COF A;  2EPM X;  4AL0 A;  2BL2 A;  2ICW G;  1D1A A;  2QE9 A;  2YHS A;  3JYH A;  1EQ1 A;  1Y4C A;  4O79 A;  4WJ0 A;  5B1A C;  2R7Q A;  4J30 B;  4LDR A;  4ONS A;  1CGM E;  4N06 A;  4KBL A;  3RYL A;  3SXM A;  2IXN A;  3FOP A;  2QNL A;  2UUI A;  4IGG A;  2EPN A;  5EK0 A;  2Y3H A;  1TWH A;  2HUJ A;  2YLG A;  3QW1 A;  5AGF A;  4FWV A;  1E85 A;  1QVX A;  1ZHW A;  4OIQ F;  3W8H A;  1E2X A;  5T3W A;  4NTA A;  3C8G B;  1SYQ A;  4U5F E;  5CI8 A;  4H4K C;  1EA8 A;  3JRT A;  3KYJ A;  4XEK A;  4PFP A;  4HFF B;  2RSE B;  1ORY A;  4CS7 A;  3FDQ A;  3POV A;  3IQT A;  5A6B A;  3HNK A;  3AJM A;  3DKA A;  1W2W A;  1ZU5 A;  1BR4 A;  3AQC A;  4PR9 A;  2NSF A;  3AGT A;  5JVE A;  1T5O A;  2R7U A;  3LLI A;  3NYJ A;  2DYR C;  4MVZ A;  1OW7 A;  1HMD A;  4XEF A;  3SP1 A;  1NFO A;  2PFD A;  2A68 F;  3ASO C;  5FZT A;  1CPR A;  4ER9 A;  5F5H A;  4A4A A;  3T6G B;  1D0X A;  2V3C C;  2YRF A;  4MW3 A;  5BUO A;  1I5N A;  1A7D A;  1PV3 A;  3MLG A;  3QVY A;  2R03 A;  4JRZ A;  1YA7 O;  1J8Y F;  3KL4 A;  4ULV A;  3M4C A;  5A69 A;  1DOW A;  5A6B D;  2GA0 A;  3V5Y A;  1MNE A;  3M15 A;  1TWG A;  3DMD A;  3R7C A;  4LLE A;  4CIH A;  2MYS A;  3W2V A;  1WN0 A;  2JPU A;  3AG2 C;  3E9V A;  3EFO A;  3MBG A;  1YAU O;  2UUH A;  1AVO B;  3B9Q A;  3DZA A;  5COM A;  4CJG A;  3TOL A;  4XQ1 A;  4AE4 B;  3G4Z A;  2OG2 A;  2ZXO A;  4CSA C;  2M4E A;  2WVN A;  3MYF A;  3RIP A;  1FFH A;  2J8W A;  1YYX A;  1SR2 A;  1U0B B;  2AWC A;  3IQ6 A;  5L0G A;  2X0C A;  2Q4F A;  5E2Q A;  1Q0D A;  1SZI A;  2XM4 A;  3US6 A;  5FCL A;  4XTK A;  5KYN A;  1OCZ C;  2XL4 A;  2EIJ C;  1OCO C;  1R5I D;  3AG4 C;  1LS1 A;  2QUP A;  2JX0 A;  1S7Z A;  3NYM A;  5E3C A;  1FFT C;  3LS0 A;  2YLD A;  1H6G A;  3GEI A;  2KK1 A;  2W45 A;  4CS8 A;  2XXA B;  1OKK A;  3GOR A;  4BG0 A;  4JEA A;  1K04 A;  4Z9I A;  2A0U A;  1ZHZ A;  4PJM A;  3EZH A;  1J8M F;  2R7R A;  2B0J A;  1V74 B;  3GM3 A;  3N24 A;  4JTD B;  1WWP A;  3RF3 A;  3K1I C;  3WG7 C;  1M56 C;  3RQF A;  3RH3 A;  3FAJ A;  4E0I A;  1OR3 A;  2P1A A;  1LI5 A;  1NFN A;  1PCX A;  1Z6A A;  3C7J A;  4OD4 A;  4PK4 A;  1LE2 A;  1TWC A;  2DB4 A;  4U5D E;  2P0N A;  1BBH A;  3U8V A;  4CS9 A;  4IAR A;  1ZYR F;  3EH1 A;  3TOM A;  2PX3 A;  4R32 A;  1YAR O;  4C7O A;  2J7P A;  3EJN A;  4LDK A;  3VM6 A;  3G50 A;  3DAG A;  4OIN F;  4NCQ A;  3M4B A;  3SXZ A;  1Q0K A;  2FAP B;  2LK4 A;  1CPQ A;  1SMY F;  2XLH A;  3RW0 A;  3Q6M A;  3S29 A;  4OIR F;  4U9E A;  1LE4 A;  1GGQ A;  2ETS A;  1VLS A;  2KJG A;  1Z3I X;  2H7B A;  3G4X A;  2IOQ A;  2CGE A;  1TFO B;  1YVI A;  2CDQ A;  3KMI A;  4U5H A;  4W8K A;  3U5S A;  5BQH A;  2OJE D;  2J9W A;  1EI7 A;  3SEO A;  1H7I A;  4YJW A;  4EBK A;  1E83 A;  4YL0 A;  1JR8 A;  4XLN F;  1NZE A;  4EKW A;  4G7Z F;  1VK5 A;  2AWY A;  3B0U X;  3T6B A;  1A0B A;  1LVK A;  2J0W A;  4GYT A;  4AX2 A;  4WAB A;  1NU9 C;  2AP3 A;  4JCH A;  2PF4 E;  2G3V A;  2J7P D;  1ZHX A;  2J46 A;  2EPL X;  3JCU Q;  1LKX A;  2HSB A;  2I8B A;  2BC5 A;  1LPE A;  2HMQ A;  3CEX A;  1VYI A;  1D0Z A;  1HE1 A;  2Y39 A;  5DQT A;  3DD7 A;  4E7S A;  1HW1 A;  4DBR A;  2ZXW C;  4CSA A;  4RBN A;  3TD7 A;  3ZDL A;  5A6A A;  1YZC A;  2VH3 A;  1IW7 F;  5F5F A;  3QZC A;  3ZTZ A;  3AG1 C;  4JC7 A;  4HFK B;  2H7O A;  5KYU A;  2PX0 A;  3EG9 B;  3GOD A;  4NY3 A;  3SXK A;  5DLJ A;  3H2V A;  1O5H A;  1GM5 A;  2MWQ A;  3V5Z A;  3LJB A;  4P9T A;  2YEV A;  5DVW A;  2YL7 A;  2XRH A;  3NMK A;  3H65 A;  3K1I A;  5KYY B;  4IWB A;  3M1C B;  5JRA A;  4MW8 A;  2I15 A;  3Q6N A;  3FMS A;  2H8A A;  1BDJ B;  4YL1 A;  2XM0 A;  1A7E A;  4E18 A;  1GS9 A;  1G8X A;  3HJC A;  3B29 A;  1C17 M;  4IB4 A;  3C8G D;  2C04 A;  1DOV A;  5A6K A;  2R7V A;  4XWJ A;  2EIL C;  2OU6 A;  3DE9 A;  3UGO A;  1ZW3 A;  3Q7G A;  2XL6 A;  3ABM C;  1YJG A;  2Q3T A;  3JZ0 A;  3O39 A;  3RKO F;  3ZG1 A;  4CDV A;  1G5Z A;  4G7H F;  2KSF A;  3SXY A;  4F4B A;  3L1M A;  2YKZ A;  4ZLC A;  3EG9 A;  4MND A;  2JD3 A;  1OCR C;  2WB7 A;  3AGU A;  5BQI A;  2L7A A;  2QTV A;  3EGD B;  2A6E F;  3VYW A;  1MND A;  1WTY A;  2J0X A;  2NUP B;  4FES A;  4JCZ A;  4XLP F;  1KNY A;  2VCC A;  2HJ3 A;  3S27 A;  3KPH A;  3KH2 A;  2R02 A;  1AEP A;  2Q9B A;  2YLI A;  2HZ8 A;  3WOD F;  1E84 A;  2YQY A;  1RKE B;  2HJM A;  5L0I A;  3JRM O;  2E87 A;  4N6H A;  1TKN A;  2HV7 A;  1S05 A;  3ITF A;  2R7W A;  2OEV A;  3T9O A;  2P61 A;  3U2M A;  1T01 A;  2G62 A;  2Z15 A;  4U5B E;  4ANJ A;  3FOO A;  4C3D A;  2P6V A;  3ZQY A;  5AC5 A;  1M57 C;  2H7V C;  3EPV A;  3K1H A;  4KNV A;  1TWA A;  4LLC A;  5L0D A;  2XLO A;  3ASN C;  1F1M A;  1QLE C;  2IXM A;  3DWW A;  3LEV A;  4JIO A;  3S9O A;  3S28 A;  2J9V A;  4DVZ A;  1RMV A;  4HEA J;  4JKV A;  2ZXP A;  3VAY A;  3GWL A;  4EBJ A;  3TQO A;  5DS5 A;  5CI9 A;  4BEJ A;  1FNT c;  4MVR A;  3JTL O;  4B6I A;  4Q4Z F;  1WOL A;  3EGX B;  4H54 A;  3GEH A;  5JLI A;  3K6B A;  3FAP B;  3LNR A;  4CDA A;  4YWQ A;  5JS5 A;  3EGD A;  2XS1 A;  5K0I A;  3B0V C;  4C7O B;  2NG1 A;  3GM2 A;  1Q0M A;  4DRH B;  3LS1 A;  4Z9J A;  4K1O A;  5L0F A;  1QSP A;  4DVY P;  1Q0G A;  3A9C A;  2D4U A;  1RCP A;  2LP4 A;  3U3F A;  1T6U A;  5KYX A;  2HMZ A;  3R2P A;  1NLX A;  3U3B A;  2R25 A;  1Z5Z A;  1HW2 A;  4QDL A;  4BJ6 A;  5KYW A;  1OXK A;  2YL3 A;  2ASR A;  1E86 A;  1D1C A;  2EIM C;  4MTG A;  4O6N A;  3JSZ A;  5B1B C;  4E7Z A;  4HE8 D;  2XXA A;  3AOU A;  3IQC A;  1OXB A;  3TJ6 A;  1D0Y A;  4LDQ A;  1LM3 B;  5D92 A;  3DJN B;  2Q7R A;  2W9Y A;  3QW0 A;  1ORS C;  1RKC A;  2L9J A; 
#chains in the Genus database with same CATH homology
 4EWC A;  2O9X A;  3UMI A;  3LAY A;  3F47 A;  4PJN A;  4LAC B;  3SNH A;  1MMN A;  2ZPA A;  1ZHT A;  1VYK A;  1VMA A;  1ST6 A;  4A2N B;  2CW0 F;  3L0I A;  2R7O A;  3ABK C;  4IRU A;  3Q7L A;  2NUT A;  2CNW D;  3JT1 A;  4KI2 A;  1M2O A;  1MMA A;  2IXP A;  2A6H F;  4YN0 B;  3OWT A;  1M2V B;  1VOM A;  4QI0 A;  2VB6 A;  3V7O A;  3SZR A;  3T6J A;  1OKK D;  3EQL F;  3KKB A;  1SF8 A;  3NRH A;  4U5E E;  5D91 A;  2VAS A;  3X2Q C;  1BR1 A;  2Y3G A;  5KYW B;  4JVS A;  1V54 C;  2NUT B;  3DJU B;  4PJL A;  1O87 A;  4X0R A;  3ECS A;  5KYU B;  4O6M A;  1M2V A;  3UMK A;  5IY5 C;  5L3Q A;  4PFO A;  3X1O A;  1D1B A;  1FMW A;  2L81 A;  4Q7C A;  3EHM A;  2D5R B;  1JPN A;  3T4R A;  2FGY A;  2X51 A;  4CBE A;  3HTK C;  5DQZ A;  4BJ5 C;  3AQB A;  3W2W A;  2LSE A;  2NUP A;  3UR3 C;  5T3T A;  4C3B A;  2WVO A;  2EIK C;  1MMG A;  5EHH A;  3CSK A;  2DGJ A;  4BJT A;  3EZI A;  5KYX B;  4M63 A;  4I3M A;  3AG3 C;  3DAF A;  3OEO A;  4YT8 A;  3ZVR A;  3K33 A;  3PHF 2;  1FMV A;  4U5C E;  3ZIB A;  3HLZ A;  4O7G A;  1Z23 A;  2OCC C;  2G3K A;  3B0P A;  4DBQ A;  4O6Y A;  3ABL C;  3K7D A;  4YT5 A;  4IJJ A;  3EH2 A;  5E3A A;  2C03 A;  3I5Q A;  2A1D D;  1NU7 D;  4IAO A;  3E70 C;  2Y69 C;  3N2Z B;  5T3W A;  2WZF A;  4EBB A;  3I4U A;  2PP4 A;  3NKE A;  2BE5 F;  3UGP A;  4JW1 A;  4KC9 A;  4OIO F;  3EGX A;  2XSE A;  1ZU4 A;  4BJ5 A;  4YT2 A;  4FX5 A;  4YT4 A;  2GFH A;  4CS8 C;  1ZHY A;  4DOZ A;  4OIP F;  4JJF A;  5DS6 A;  2W4M A;  4OD5 A;  3DXJ F;  4G7O F;  3F46 A;  1Z63 A;  4BJ6 C;  4AE4 A;  2HV6 A;  2WZG A;  3NG1 A;  2KNH A;  2J9U A;  4I1O B;  4MQ9 F;  3EFO B;  4U5G A;  4K0D A;  2R7X A;  1RJ9 B;  1WGW A;  3L34 A;  2WL8 A;  1RJ9 A;  3FHD A;  4QI2 A;  4JUR I;  4BJ1 A;  5KYY A;  2R7T A;  2QY9 A;  3DM9 B;  3DM5 A;  2P7V A;  2J45 A;  2IXO A;  4P6I C;  3QMK A;  3NDB B;  1QZX A;  4JJG A;  1FTS A;  4ZLD A;  4G0H A;  2FFH A;  2WZL A;  4K7B A;  4J32 B;  3K66 A;  2KGO A;  3O6X A;  1PD1 A;  2CNW A;  3UMH A;  2ZXR A;  2Y3B A;  4KNW A;  2W4B A;  3LLK A;  2IYL D;  4CS9 C;  1N1C A;  2DYS C;  3EHN A;  5E33 A;  3CZ6 A;  3N0T A;  1TR2 A;  4AK9 A;  4Q5S F;  3OA1 A;  4GEH A;  1IZM A;  2WVQ A;  3PMR A;  4LER A;  4I1M A;  4RDA A;  2Y3D A;  2Q9A A;  3I5P A;  4RD9 A;  1V55 C;  3RFY A;  2Q9C A;  3NKD A;  5EGY A;  1NG1 A;  1KU2 A;  4PJJ A;  5L3V A;  1BR2 A;  2KW3 C;  3IEE A;  2KQ9 A;  2EIN C;  5HSW A;  3GAN A;  3SYN A;  1MMD A;  1PD0 A;  1JPJ A;  2R7S A;  3ZSU A;  4I44 A;  4ULW A;  3W8I A;  5B3S C;  5DS4 A;  2V26 A;  2A69 F;  3MX3 A;  3LES A;  3NYL A;  1OCC C;  3S0X A;  3FVY A;  4C3E A;  2YZS A;  3CQZ A;  1D1A A;  2YHS A;  4O79 A;  4WJ0 A;  5B1A C;  2R7Q A;  4J30 B;  4N06 A;  4KBL A;  3RYL A;  2IXN A;  2Y3H A;  1TWH A;  4OIQ F;  4FWV A;  1ZHW A;  4U5F E;  5CI8 A;  4H4K C;  3JRT A;  3POV A;  4PFP A;  4HFF B;  4CS7 A;  3FDQ A;  1W2W A;  1ZU5 A;  1BR4 A;  3AQC A;  2R7U A;  3LLI A;  3NYJ A;  2DYR C;  3SP1 A;  2PFD A;  2A68 F;  3ASO C;  5F5H A;  1D0X A;  5BUO A;  3MLG A;  1J8Y F;  3KL4 A;  1MNE A;  1TWG A;  3DMD A;  4LLE A;  4CIH A;  2MYS A;  3W2V A;  3AG2 C;  3E9V A;  3EFO A;  3B9Q A;  3DZA A;  4AE4 B;  2OG2 A;  2ZXO A;  4CSA C;  2M4E A;  2WVN A;  3RIP A;  1FFH A;  5E2Q A;  1SZI A;  5FCL A;  4XTK A;  5KYN A;  1OCZ C;  2XL4 A;  2EIJ C;  1OCO C;  3AG4 C;  1LS1 A;  1S7Z A;  3NYM A;  5E3C A;  1FFT C;  3LS0 A;  2W45 A;  4CS8 A;  2XXA B;  1OKK A;  4BG0 A;  1ZHZ A;  4PJM A;  3EZH A;  1J8M F;  2R7R A;  2B0J A;  3N24 A;  3K1I C;  3WG7 C;  1M56 C;  3RH3 A;  3FAJ A;  3UNG C;  3ZC4 A;  1Z6A A;  1PCX A;  4OD4 A;  4PK4 A;  4U5D E;  4CS9 A;  1TWC A;  1ZYR F;  3EH1 A;  4C7O A;  2PX3 A;  2J7P A;  3EJN A;  3DAG A;  4OIN F;  1SMY F;  3S29 A;  3Q6M A;  4OIR F;  2H7B A;  4JZA A;  1Z3I X;  2KJG A;  5T1D B;  3W8H A;  2CGE A;  2IOQ A;  2CDQ A;  3KMI A;  4U5H A;  4W8K A;  4ZLC A;  2J9W A;  3SEO A;  4YJW A;  4XLN F;  4G7Z F;  1NZE A;  1VK5 A;  3B0U X;  3T6B A;  1LVK A;  2J0W A;  4GYT A;  4AX2 A;  1NU9 C;  4JCH A;  2PF4 E;  2G3V A;  2J7P D;  1ZHX A;  2J46 A;  3JCU Q;  1LKX A;  2I8B A;  1VYI A;  1D0Z A;  2Y39 A;  5DQT A;  3DD7 A;  4E7S A;  4DBR A;  2ZXW C;  4CSA A;  4RBN A;  3TD7 A;  5F5F A;  2VH3 A;  1IW7 F;  3QZC A;  3AG1 C;  4HFK B;  2H7O A;  5KYU A;  2PX0 A;  3EG9 B;  3GOD A;  4NY3 A;  5DLJ A;  1O5H A;  2MWQ A;  3LJB A;  2YEV A;  5DVW A;  2XRH A;  3H65 A;  5KYY B;  4IWB A;  3M1C B;  3Q6N A;  1G8X A;  3HJC A;  2C04 A;  2R7V A;  4XWJ A;  2EIL C;  3UGO A;  3Q7G A;  3ABM C;  3O39 A;  2V3C C;  2Q3T A;  3ZG1 A;  4G7H F;  3RKO F;  4F4B A;  3EG9 A;  4MND A;  2JD3 A;  1OCR C;  2WB7 A;  2QTV A;  3EGD B;  2A6E F;  3VYW A;  1MND A;  2J0X A;  2NUP B;  4FES A;  4XLP F;  3S27 A;  3KH2 A;  2Q9B A;  3WOD F;  2E87 A;  1TKN A;  2HV7 A;  3ITF A;  2R7W A;  2G62 A;  2Z15 A;  4U5B E;  4ANJ A;  4C3D A;  2P6V A;  1M57 C;  2H7V C;  3EPV A;  3K1H A;  4KNV A;  1TWA A;  4LLC A;  3ASN C;  1QLE C;  2IXM A;  3LEV A;  3S28 A;  2J9V A;  4DVZ A;  4HEA J;  2ZXP A;  3VAY A;  5DS5 A;  5CI9 A;  4BEJ A;  4B6I A;  4Q4Z F;  3EGX B;  3K6B A;  3LNR A;  4YWQ A;  3EGD A;  3B0V C;  4C7O B;  2NG1 A;  3LS1 A;  4DVY P;  5KYX A;  1Z5Z A;  4QDL A;  4BJ6 A;  5KYW A;  1D1C A;  2EIM C;  4O6N A;  3JSZ A;  5B1B C;  4E7Z A;  4HE8 D;  2XXA A;  1D0Y A;  5D92 A;  3DJN B;  2W9Y A;  3JYH A;  2L9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...