2J9UA

2 angstrom x-ray structure of the yeast escrt-i vps28 c-terminus in complex with the nzf-n domain from escrt-ii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
94
structure length
94
Chain Sequence
FNAKYVAEATGNFITVMDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIVRINKLSIGDTLTETQIRELLFDLELAYKSFYALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 28
publication title Structural Insight Into the Escrt-I/-II Link and its Role in Mvb Trafficking.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 39
structure length 94
sequence length 94
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1130 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2j9uA00
2J9WA 2J9UA 2G3KA 2J9VA
chains in the Genus database with same CATH superfamily
4E7ZA 1M2OA 3K1HA 3M1CB 1QQ3A 3CZ6A 2A69F 3JT1A 4P9FA 1NLXA 4OINF 5JVEA 1MQVA 3AJMA 3ZQYA 2R05A 1SZIA 1FFTC 4XEVA 4CJGA 3FVYA 3V5YA 4YN0B 4PFPA 3DWWA 1MMAA 2ICWG 2WB7A 1WGWA 1PD1A 1IW7F 1FTSA 3H2UA 2PX3A 3NKEA 2WZFA 3A11A 3HLZA 4MNDA 4I3MA 4FESA 2KC3A 4MVZA 4PACA 2MYSA 4WJ0A 5D92A 5DVWA 1RJ9B 1PV3A 1HE1A 2BL2A 2VH3A 3NRHA 1Z3IX 4XTKA 3W2VA 5BQIA 4C7OB 2R7RA 2L6FA 1TWCA 2AP3A 2J9WA 3PDMP 3MX3A 3EZHA 1RKEA 1GS9A 4JJFA 5COFA 3ZTZA 4DRHB 4RBNA 5F5FA 4U5GA 3W8HA 5L0HA 3QW1A 4JIOA 1GQAA 1M6TA 2P0NA 3LJBA 1FAPB 3EQLF 1YJGA 4YWQA 4XLPF 3C8GB 5KYXA 5B1BC 2IXMA 1U89A 4ZLDA 2QE9A 4O79A 4FWVA 2A6EF 2LP4A 1LM3B 3WODF 1KU2A 5L0DA 1QVXA 4G78A 1T6QA 4DVYP 3L1MA 2L6HA 2PX0A 3EGXA 1ZZPA 4HFFB 4I44A 4DXWA 3GEEA 1HW2A 3K66A 1G4WR 1UG7A 2XL8A 2HV7A 1RMVA 2XLHA 1VLSA 3G4XA 1FNTc 5DS5A 4NTAA 3UMIA 1JOGA 2HSQA 1SMYF 1MMGA 1LVKA 1WATA 5HV9A 1FR0A 3K1IA 3I4UA 3AGTA 2KGOA 4KBLA 3QZCA 1NU7D 1NZEA 4CS8A 1NG1A 4XEKA 2EPNA 1R5ID 2ZXPA 2H7VC 3EFOB 3K7DA 3MFNA 3OEOA 1I4ZA 3PCVA 2I8BA 2HJ3A 5JT4A 3JRMO 4G7ZF 4BJ6C 4LDRA 1T5OA 2AU5A 1QPUA 4IGGA 2V26A 2Q3TA 4P6IC 3WHNA 2B0HA 1CPQA 1HE9A 3V5XA 1U0BB 1TQGA 2CNWD 4J7TA 1PCXA 3ZQVA 2L81A 1LS1A 3F46A 2IOQA 3DJNB 2H7OA 3VYWA 4CIPA 1MNDA 1M56C 5TJ5E 4PFOA 4GYTA 3RFYA 2HMQA 3MYFA 2VC9A 4JZAA 3RVZA 2R7SA 2ZXRA 2YKZA 3DAFA 4E0HA 3GWNA 1SYQA 3DKAA 2KYHA 5A6KA 4NY3A 1Q0MA 2NSGA 2KQ9A 2WVNA 3I5PA 3SXZA 2KJGA 4G0HA 4OIRF 1XZQA 5A6BD 4O6MA 2P6VA 2UUHA 4MQ9F 2WVQA 2L7AA 3LEOA 4G7OF 3EH2A 2GA0A 3B29A 3L8JA 4JEBA 5E3AA 1KTMA 1AVOB 3TOLA 4DOZA 1D1CA 1UFBA 2J45A 1O5HA 1TWAA 1TKNA 2EINC 2W4MA 3CEXA 4MW3A 3NYMA 1RXQA 2WZLA 3E9VA 1L7CA 4U9DA 3TJ5A 2KSFA 3TOMA 4CX9A 2WL8A 1VYKA 1A41A 2R7VA 4U5BE 4JVSA 4AX2A 1I4YA 3L0IA 3Q6MA 4ULWA 1WWPA 3N2ZB 3U8PA 2P1AA 2VCCA 3QW0A 3UGPA 1GM5A 2DGJA 1OW8A 2J9BA 4HE8D 2R7XA 2ETSA 4CS7A 3TD7A 4B6IA 3GEHA 1RKEB 4JW1A 4OIPF 2J9VA 1A7EA 4K0DA 4M63A 3X2QC 2CDQA 5DLJA 4U5DE 2HS5A 4IJJA 3VF0A 2H7BA 1OKKA 4JJGA 3KYIA 1JRAA 4O6NA 4KI2A 1J8YF 3J06A 5EK0A 3TQOA 3U2MA 1YYJA 1H6GA 1ORSC 5JRAA 1QSPA 5BQHA 1XWJA 4CIHA 3B0VC 2RSEB 2OJED 4JTCB 5CI9A 3HNKA 5KYXB 3LAYA 2IM8A 1G8XA 3JRTA 4X0RA 4FAPB 4CS9A 2R7WA 2YLDA 3B0PA 3V7OA 3T4RA 2KNHA 4XPYA 3G50A 3R2PA 1CGME 2LFFA 3EGXB 3NMKA 4LACB 4CSAC 1MNEA 4WGYA 1ZU4A 3DE9A 4F4BA 1NSGB 1YA7O 5BQGA 2LSEA 3BEHA 3Q7GA 4NC3A 2HUJA 2G3VA 2J0XA 1QZXA 2HSBA 2NUPA 4LLEA 4MW8A 4PJNA 4DBRA 1BR1A 3EGDA 4BJ5A 2V3CC 4J7YA 4BJTA 3ASNC 3KYJA 2XS8A 3GWLA 4EBKA 5AC4A 3PMRA 5L3VA 1R4TA 4C3EA 4H4KC 2HFIA 1NFNA 1OQCA 2IXOA 1T9KA 1VYIA 2Y3DA 4K1OA 1Q0GA 3GANA 1JMWA 3S90A 2PP4A 3GEIA 3ZIBA 1ORYA 3KL4A 4YT5A 1BR2A 2P7VA 2CNWA 1JR8A 3LLKA 4XPWA 3EZIA 4FX5A 1SR2A 1M57C 2OOCA 3O10A 3QMKA 1OCCC 2GFHA 2XL4A 4IAQA 1E2XA 3ZVRA 2XLEA 1Z63A 1BBHA 2O9XA 2QUPA 4BEMJ 1ZHYA 5L3QA 1TFOB 2TMVP 2J8WA 4LLCA 2LCHA 1YYXA 5T3TA 2EIKC 4U5FE 5E2QA 5DS6A 3EG9A 2R7TA 2L9JA 1OR3A 3LESA 5EHHA 3OA1A 1Z23A 1IZMA 1QLEC 4EUKB 3H2VA 3S29A 4YT4A 1VK5A 2FGYA 1WN0A 4WABA 1PD0A 2EPKX 2R9RB 2AWYA 3AQCA 3M79A 2UUIA 4MVMA 2KW3C 4O7GA 3FOPA 4K7BA 2FFHA 1DOVA 1SF8A 2OKUA 2AVKA 2ZD9A 4I1MA 3M4CA 4Q7CA 4WGZA 3S28A 4L6RA 3SZRA 1VMAA 2ZPAA 2R7QA 4XQ1A 4RD9A 3ITFA 1CPRA 3DE8A 2R7OA 1ZVZA 1OCZC 3UR3C 2IYLD 3HNLA 3LUTB 4IB4A 1ZHWA 2JX0A 4JC7A 3HJCA 3LNRA 3O6XA 2ZXOA 3NMIA 1Y6DA 3Q7LA 4LDKA 4MVRA 3UMKA 5FZTA 1LKXA 2XSEA 4JE9A 1XZPA 2J7PA 1EQ1A 2LD6A 2Y3HA 4DJ9A 1VLTA 2XM0A 3L34A 3N0TA 2YHSA 2HZ8A 2Z15A 3IQCA 3K1IC 2GWWA 2EIJC 1BZ4A 2J9UA 3IPMO 3DM5A 3RF3A 2A0UA 3RYLA 1RCPA 2W9YA 2NUTA 4CS8C 3JYYA 1EA8A 4JTAB 2XLWA 1LE4A 1WASA 3GODA 5DQZA 5JUAA 5CI8A 3RKOF 3QVYA 2YL1A 4O6YA 4A2NB 2R7UA 2YL0A 1Z5ZA 3JSZA 3ZG1A 4NTBA 2J46A 5JSLA 1LE2A 4Z9HA 2IXPA 3TJ6A 3E70C 3LS0A 5B1AC 4MVOA 5JP7A 3B71A 2CCYA 3DAGA 2BC5A 5COGA 3W4YA 3CSKA 4QI2A 2XLDA 2XRHA 3V5ZA 4NCQA 1E84A 2EILC 2NUPB 3ECSA 5A6JA 1V74B 2MWQA 3EGDB 5KYUA 3TULA 2OEXA 2FAPB 3TK0A 3NYJA 1JPNA 2EPOA 3UGOA 1LI5A 3H65A 2DB4A 1NU9C 1ZYRF 2RD9A 1O87A 1VB5A 1Y4CA 1Q0DA 3KH2A 2M64A 2R02A 2YL3A 3ATPA 4IWBA 2OCCC 2OG2A 3SXMA 3U2LA 3VM6A 2R25A 3SEOA 1HMOA 1H9TA 1K40A 2YQYA 5AGFA 1D0YA 1E83A 2YZSA 2VASA 4LERA 4EIYA 3GM2A 4XWJA 4DVZA 1T01A 1N1CA 2QTVA 3N24A 4CJOA 2JPUA 3O55A 1LPEA 4MVUA 256BA 2Q9BA 5EGYA 3AG4C 5KYWA 3RQFA 4CBEA 4BEJA 4XLNF 1BDJB 2Q00A 2W45A 1Z7Qc 3KPHA 3S0XA 3S27A 2XXAA 3AG3C 3ABKC 3EJNA 3AOUA 3VAYA 5BUOA 1C02A 2PNOA 3EG9B 3LEVA 1E85A 2B0JA 1C03A 4DRIB 1Q0KA 1A0BA 3ZC4A 4JCHA 2HV6A 4DBQA 1NBBA 4GEHA 4UDVA 2YEVA 5L0GA 2YLIA 4JKVA 3FHDA 4IRUA 3WAQA 1S05A 3FAJA 4IAOA 4E18A 2G62A 3DXJF 4J32B 3AG1C 4MTOA 3C7JA 3FMSA 4N06A 1ZHXA 3HNIA 3JYHA 4EBJA 3JCUQ 4W8KA 2XL6A 3CQZA 4MVSA 3JZ0A 5T3WA 1V4AA 1H7IA 4ANJA 4E7SA 1L3PA 1F1MA 2IXNA 3X1OA 5DQTA 2LK4A 3CAXA 4OD4A 2A0BA 2Q9AA 2NG1A 2WVOA 1K04A 4CS9C 3FDQA 3KKBA 5K0IA 4CDAA 1V55C 2XS1A 2GDCA 2L6GA 1ST6A 5KYYA 2LFDA 4C3DA 4ONSA 2HJMA 1TWGA 2Y39A 3SYNA 4XPXA 4AE4A 1O3UA 1U6HA 4ER9A 5KYNA 2OJQA 1J8MF 3SXKA 4ZLCA 4NTFA 3ASOC 4YL0A 1QKRA 1VOMA 4R32A 4BJ5C 2OQMA 4CDVA 4U5CE 4QI0A 4QDLA 3DM9B 4PR9A 2YWAA 3AG2C 3C62A 3C8GD 3DD7A 5F28E 4YJWA 3US6A 2NUTB 4MTFA 1HY5A 2YRFA 1OXBA 3DI5A 3K33A 4U5HA 1WOLA 1LI7A 2EPLX 4AK9A 1BR4A 3B0UX 4YL3A 4JCZA 1C17M 3QVZA 1GGQA 1YVIA 2I15A 5DS4A 5IY5C 1E86A 2AWCA 4KNWA 3SXYA 3L8IA 2X0CA 1D0XA 2BE5F 3IQ5A 2OU6A 4A4AA 5L0FA 3HKKA 5E33A 2PBEA 5A6BA 3B9QA 3U0CA 1Q0FA 1VTMP 3F47A 4EHPA 4EWCA 3NG1A 1D1BA 4AL1A 1YARO 2NSFA 5L0IA 5CIVA 2F22A 2PF4E 5E3CA 1OR2A 3EHMA 5GPGB 5KYUB 1YZAA 1M2VA 2EIMC 3JSEO 3JTLO 2GAQA 3FXHA 3DJUB 3GM1A 4RDAA 2A1DD 4P9TA 1AUEA 3FOOA 1CGOA 2E87A 1EI7A 2W4BA 4DRJB 2C04A 2VCBA 1OCOC 2CW0F 4HFKB 1JAFA 2Y3GA 3C8ZA 3IEEA 1OKKD 4C3BA 2HMZA 3SP1A 2NPUA 2QLAA 1I5NA 4MS2A 1YA9A 1ZW3A 1ORJA 1MMDA 1B68A 2OEVA 3LLIA 3GM3A 1MMNA 4KNVA 2Q7RA 5B3SC 4Q4ZF 4Q5SF 2Y69C 2ASRA 4AL0A 1RKCA 3NKDA 4OIQF 1JPJA 3RQEA 4Z9IA 5KYWB 1K05A 1YAUO 4OD5A 3EH1A 2XXAB 3MYIA 1OCRC 3KMIA 4BJ1A 2H8AA 2YLGA 4N6HA 1EKYA 1CGNA 3FAPB 3AGUA 4U5EE 4JEAA 4BJ6A 4HEAJ 3DZAA 4YT2A 1APCA 1S7ZA 4D4XA 2QY9A 4J30B 4YT8A 1W2WA 3U9MA 1Z6AA 1D0ZA 3QTHA 3PHF2 5JS5A 2Q4FA 2XLOA 3ABMC 3ZDLA 2D5RB 1RJ9A 4LDQA 5AC5A 3I5QA 4C7OA 2DI3A 4KC9A 3ZSUA 1H9GA 4Z9JA 2Q9CA 2KK1A 2R03A 4D4NA 2XLVA 3IHUA 3W8IA 1DOWA 5L0CA 4OIOF 3SNHA 4JTDB 3R7CA 3RQGA 4E17A 3S9OA 5F5HA 3RW0A 2DYRC 4EKWA 5KYYB 4EBBA 1OW6A 4N6CA 1G4US 3IQTA 3EHNA 4PK4A 4AE4B 3K6BA 5FCLA 2LQGA 4BG0A 1OXKA 3NDBB 2CGEA 2G3KA 3U3FA 2A68F 5A69A 3M15A 3C8GA 4I1OB 1D1AA 4GQHA 1AEPA 1OW7A 2XLMA 3UMHA 1HW1A 1KNYA 1WTYA 2IBFA 2VB6A 4H54A 3RH3A 1FMWA 3LNMB 3POVA 1TFKB 4PJLA 3ABLC 3Q6NA 1FMVA 1HMDA 5D91A 3LS1A 2YL7A 5B3IA 1YDIA 3RIPA 3BRJA 3T6GB 2HKVA 4YL1A 2Y3BA 1A7DA 1FFHA 2CYDA 3MLGA 2J0WA 4JRZA 3NMJA 2A6HF 3UNGC 3WG7C 4CDYA 4XEFA 1LS4A 5COMA 5HSWA 3M4BA 1T6IA 3S84A 2LIGA 2M4EA 2P61A 2PFDA 3T9OA 4N4WA 3A9CA 1A7VA 1V54C 4ULVA 4IARA 2X51A 3MBGA 2ZXWC 3EFOA 5T1DB 1M2VB 3AQBA 1G5ZA 3O39A 1ZHZA 3IQ6A 1ZW2A 2DYSC 2VCAA 2WZGA 4MTGA 3U9JA 2QNLA 2J7PD 4PJJA 5A6AA 3RVYA 3HNJA 3T6JA 1NFOA 1ZU5A 4BPMA 2JD3A 4CSAA 1ZHTA 3OWTA 1T6UA 2YVKA 3EPVA 3U8VA 3ZTMA 2D4UA 1YLMA 4NQFA 1TR2A 2MHRA 1LIHA 4YK5A 4MVQA 2XM4A 1TWHA 5L0JA 3HTKC 4G7HF 5JLIA 3U5SA 4U9EA 3C63A 3C18A 3ZWIA 4JURI 3T6BA 3NYLA 1YZCA 2C03A 3DMDA 4PJMA 3U3BA 3G4ZA 3GORA 2EPMX 4E0IA 3W2WA 4W8PA 3VRCA
chains in the Genus database with same CATH topology
4E7ZA 1M2OA 3K1HA 3M1CB 3CZ6A 2A69F 3JT1A 4OINF 1SZIA 1FFTC 3FVYA 4YN0B 4PFPA 1MMAA 2WB7A 1WGWA 1PD1A 1FTSA 1IW7F 3NKEA 2PX3A 2WZFA 3HLZA 4MNDA 4I3MA 4FESA 2MYSA 4WJ0A 5D92A 5DVWA 1RJ9B 2VH3A 3NRHA 4XTKA 1Z3IX 3W2VA 4C7OB 2R7RA 1TWCA 2J9WA 3MX3A 3EZHA 4JJFA 4RBNA 5F5FA 4U5GA 3W8HA 3LJBA 3EQLF 4YWQA 4XLPF 5KYXA 5B1BC 2IXMA 4ZLDA 4O79A 4FWVA 2A6EF 3WODF 1KU2A 4DVYP 3EGXA 2PX0A 4HFFB 4I44A 3K66A 2HV7A 5DS5A 3UMIA 1SMYF 1MMGA 1LVKA 3I4UA 2KGOA 4KBLA 3QZCA 1NU7D 1NZEA 4CS8A 1NG1A 2ZXPA 2H7VC 3EFOB 3K7DA 3OEOA 2I8BA 4G7ZF 4BJ6C 2V26A 2Q3TA 4P6IC 2CNWD 1PCXA 2L81A 1LS1A 3F46A 2IOQA 3DJNB 2H7OA 3VYWA 1MNDA 1M56C 4PFOA 4GYTA 3RFYA 4JZAA 2R7SA 2ZXRA 3DAFA 4NY3A 2KQ9A 2WVNA 3I5PA 2KJGA 4G0HA 4OIRF 4O6MA 2P6VA 4MQ9F 2WVQA 4G7OF 3EH2A 5E3AA 4DOZA 1D1CA 3RKOF 2J45A 1O5HA 1TWAA 1TKNA 2EINC 2W4MA 4XLNF 3NYMA 2WZLA 3E9VA 2WL8A 1VYKA 2R7VA 4U5BE 4JVSA 4AX2A 3L0IA 3Q6MA 4ULWA 3N2ZB 3UGPA 2DGJA 4HE8D 2R7XA 4CS7A 3TD7A 4B6IA 4OIPF 4JW1A 2J9VA 4K0DA 4M63A 3X2QC 2CDQA 5DLJA 4U5DE 4IJJA 4KI2A 2H7BA 1OKKA 4JJGA 4O6NA 1J8YF 3B0VC 4CIHA 5CI9A 5KYXB 3LAYA 1G8XA 3JRTA 4X0RA 4CS9A 2R7WA 3B0PA 3V7OA 3T4RA 2KNHA 3EGXB 4LACB 4CSAC 1MNEA 1ZU4A 4F4BA 2LSEA 3Q7GA 2G3VA 2J0XA 1QZXA 4LLEA 2NUPA 4PJNA 4DBRA 1BR1A 3EGDA 4BJ5A 2V3CC 4BJTA 3ASNC 3PMRA 5L3VA 4C3EA 4H4KC 2IXOA 1VYIA 2Y3DA 3GANA 2PP4A 3ZIBA 3KL4A 4YT5A 1BR2A 2P7VA 2CNWA 3LLKA 3EZIA 4FX5A 1M57C 3QMKA 1OCCC 2GFHA 2XL4A 3ZVRA 1Z63A 2O9XA 1ZHYA 5L3QA 4LLCA 5T3TA 2EIKC 4U5FE 5E2QA 5DS6A 3EG9A 2R7TA 2L9JA 3LESA 5EHHA 3OA1A 1Z23A 1IZMA 1QLEC 3S29A 4YT4A 1VK5A 2FGYA 1PD0A 3AQCA 2KW3C 4O7GA 4K7BA 2FFHA 1SF8A 4I1MA 4Q7CA 3S28A 3SZRA 1VMAA 2ZPAA 2R7QA 4RD9A 3ITFA 2R7OA 1OCZC 3UR3C 2IYLD 1ZHWA 3HJCA 3LNRA 3O6XA 2ZXOA 3Q7LA 3UMKA 1LKXA 2XSEA 2J7PA 2Y3HA 3L34A 3N0TA 2YHSA 2Z15A 3K1IC 2EIJC 2J9UA 3DM5A 3RYLA 2W9YA 2NUTA 4CS8C 5DQZA 3GODA 5CI8A 4A2NB 4O6YA 2R7UA 1Z5ZA 3JSZA 3ZG1A 2J46A 2IXPA 3E70C 3LS0A 5B1AC 3DAGA 3CSKA 4QI2A 2XRHA 2EILC 2NUPB 3ECSA 2MWQA 3EGDB 5KYUA 3NYJA 1JPNA 3UGOA 3H65A 1NU9C 1ZYRF 3KH2A 1O87A 4IWBA 2OCCC 2OG2A 3SEOA 1D0YA 2YZSA 2VASA 4LERA 4DVZA 4XWJA 1N1CA 2QTVA 3N24A 5EGYA 2Q9BA 5KYWA 3AG4C 4CBEA 4BEJA 2W45A 3S0XA 2XXAA 3S27A 3AG3C 3ABKC 3EJNA 3VAYA 5BUOA 3EG9B 3LEVA 2B0JA 3ZC4A 4JCHA 2HV6A 4DBQA 4GEHA 2YEVA 3FHDA 4IRUA 4IAOA 3FAJA 2G62A 3DXJF 4J32B 3AG1C 4N06A 1ZHXA 3JYHA 3JCUQ 4W8KA 3CQZA 5T3WA 4ANJA 4E7SA 3X1OA 5DQTA 2IXNA 4OD4A 2WVOA 2Q9AA 2NG1A 4CS9C 3FDQA 3KKBA 1V55C 1ST6A 5KYYA 4C3DA 2Y39A 1TWGA 3SYNA 5KYNA 4AE4A 1J8MF 4ZLCA 3ASOC 1VOMA 4BJ5C 4U5CE 4QI0A 4QDLA 3DM9B 3AG2C 3DD7A 4YJWA 2NUTB 4U5HA 3K33A 4AK9A 1BR4A 3B0UX 5DS4A 5IY5C 4KNWA 1D0XA 2BE5F 5E33A 3B9QA 3F47A 4EWCA 3NG1A 1D1BA 2PF4E 5E3CA 3EHMA 5KYUB 1M2VA 2EIMC 3DJUB 4RDAA 2A1DD 2E87A 2W4BA 2C04A 1OCOC 2CW0F 4HFKB 2Y3GA 3IEEA 1OKKD 4C3BA 3SP1A 1MMDA 3LLIA 1MMNA 4KNVA 5B3SC 4Q5SF 4Q4ZF 2Y69C 4OIQF 3NKDA 1JPJA 5KYWB 4OD5A 3EH1A 2XXAB 1OCRC 3KMIA 4BJ1A 4U5EE 4BJ6A 4HEAJ 3DZAA 4YT2A 1S7ZA 2QY9A 4J30B 4YT8A 1W2WA 1Z6AA 1D0ZA 3PHF2 3ABMC 2D5RB 1RJ9A 3I5QA 4C7OA 4KC9A 3ZSUA 2Q9CA 3W8IA 4OIOF 3SNHA 5F5HA 2DYRC 5KYYB 4EBBA 3EHNA 4PK4A 4AE4B 3K6BA 5FCLA 4BG0A 3NDBB 2CGEA 2G3KA 2A68F 4I1OB 1D1AA 3UMHA 2VB6A 3RH3A 1FMWA 3POVA 4PJLA 3ABLC 3Q6NA 1FMVA 5D91A 3LS1A 3RIPA 2Y3BA 1FFHA 3MLGA 2J0WA 3UNGC 2A6HF 3WG7C 5HSWA 2M4EA 2PFDA 1V54C 2X51A 2ZXWC 3EFOA 5T1DB 1M2VB 3AQBA 3O39A 1ZHZA 2DYSC 2WZGA 4PJJA 2J7PD 3T6JA 1ZU5A 4CSAA 2JD3A 1ZHTA 3OWTA 3EPVA 1TR2A 1TWHA 4G7HF 3HTKC 4JURI 3T6BA 3NYLA 2C03A 3DMDA 4PJMA 3W2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J9W A;  2J9U A;  2G3K A;  2J9V A; 
#chains in the Genus database with same CATH topology
 4E7Z A;  1M2O A;  3K1H A;  3M1C B;  1QQ3 A;  3CZ6 A;  2A69 F;  3JT1 A;  4P9F A;  1NLX A;  4OIN F;  5JVE A;  1MQV A;  3AJM A;  3ZQY A;  2R05 A;  1SZI A;  1FFT C;  4XEV A;  4CJG A;  3FVY A;  3V5Y A;  4YN0 B;  4PFP A;  3DWW A;  1MMA A;  2ICW G;  2WB7 A;  1WGW A;  1PD1 A;  1IW7 F;  1FTS A;  3H2U A;  2PX3 A;  3NKE A;  2WZF A;  3A11 A;  3HLZ A;  4MND A;  4I3M A;  4FES A;  2KC3 A;  4MVZ A;  4PAC A;  2MYS A;  4WJ0 A;  5D92 A;  5DVW A;  1RJ9 B;  1PV3 A;  1HE1 A;  2BL2 A;  2VH3 A;  3NRH A;  1Z3I X;  4XTK A;  3W2V A;  5BQI A;  4C7O B;  2R7R A;  2L6F A;  1TWC A;  2AP3 A;  2J9W A;  3PDM P;  3MX3 A;  3EZH A;  1RKE A;  1GS9 A;  4JJF A;  5COF A;  3ZTZ A;  4DRH B;  4RBN A;  5F5F A;  4U5G A;  3W8H A;  5L0H A;  3QW1 A;  4JIO A;  1GQA A;  1M6T A;  2P0N A;  3LJB A;  1FAP B;  3EQL F;  1YJG A;  4YWQ A;  4XLP F;  3C8G B;  5KYX A;  5B1B C;  2IXM A;  1U89 A;  4ZLD A;  2QE9 A;  4O79 A;  4FWV A;  2A6E F;  2LP4 A;  1LM3 B;  3WOD F;  1KU2 A;  5L0D A;  1QVX A;  4G78 A;  1T6Q A;  4DVY P;  3L1M A;  2L6H A;  2PX0 A;  3EGX A;  1ZZP A;  4HFF B;  4I44 A;  4DXW A;  3GEE A;  1HW2 A;  3K66 A;  1G4W R;  1UG7 A;  2XL8 A;  2HV7 A;  1RMV A;  2XLH A;  1VLS A;  3G4X A;  1FNT c;  5DS5 A;  4NTA A;  3UMI A;  1JOG A;  2HSQ A;  1SMY F;  1MMG A;  1LVK A;  1WAT A;  5HV9 A;  1FR0 A;  3K1I A;  3I4U A;  3AGT A;  2KGO A;  4KBL A;  3QZC A;  1NU7 D;  1NZE A;  4CS8 A;  1NG1 A;  4XEK A;  2EPN A;  1R5I D;  2ZXP A;  2H7V C;  3EFO B;  3K7D A;  3MFN A;  3OEO A;  1I4Z A;  3PCV A;  2I8B A;  2HJ3 A;  5JT4 A;  3JRM O;  4G7Z F;  4BJ6 C;  4LDR A;  1T5O A;  2AU5 A;  1QPU A;  4IGG A;  2V26 A;  2Q3T A;  4P6I C;  3WHN A;  2B0H A;  1CPQ A;  1HE9 A;  3V5X A;  1U0B B;  1TQG A;  2CNW D;  4J7T A;  1PCX A;  3ZQV A;  2L81 A;  1LS1 A;  3F46 A;  2IOQ A;  3DJN B;  2H7O A;  3VYW A;  4CIP A;  1MND A;  1M56 C;  5TJ5 E;  4PFO A;  4GYT A;  3RFY A;  2HMQ A;  3MYF A;  2VC9 A;  4JZA A;  3RVZ A;  2R7S A;  2ZXR A;  2YKZ A;  3DAF A;  4E0H A;  3GWN A;  1SYQ A;  3DKA A;  2KYH A;  5A6K A;  4NY3 A;  1Q0M A;  2NSG A;  2KQ9 A;  2WVN A;  3I5P A;  3SXZ A;  2KJG A;  4G0H A;  4OIR F;  1XZQ A;  5A6B D;  4O6M A;  2P6V A;  2UUH A;  4MQ9 F;  2WVQ A;  2L7A A;  3LEO A;  4G7O F;  3EH2 A;  2GA0 A;  3B29 A;  3L8J A;  4JEB A;  5E3A A;  1KTM A;  1AVO B;  3TOL A;  4DOZ A;  1D1C A;  1UFB A;  2J45 A;  1O5H A;  1TWA A;  1TKN A;  2EIN C;  2W4M A;  3CEX A;  4MW3 A;  3NYM A;  1RXQ A;  2WZL A;  3E9V A;  1L7C A;  4U9D A;  3TJ5 A;  2KSF A;  3TOM A;  4CX9 A;  2WL8 A;  1VYK A;  1A41 A;  2R7V A;  4U5B E;  4JVS A;  4AX2 A;  1I4Y A;  3L0I A;  3Q6M A;  4ULW A;  1WWP A;  3N2Z B;  3U8P A;  2P1A A;  2VCC A;  3QW0 A;  3UGP A;  1GM5 A;  2DGJ A;  1OW8 A;  2J9B A;  4HE8 D;  2R7X A;  2ETS A;  4CS7 A;  3TD7 A;  4B6I A;  3GEH A;  1RKE B;  4JW1 A;  4OIP F;  2J9V A;  1A7E A;  4K0D A;  4M63 A;  3X2Q C;  2CDQ A;  5DLJ A;  4U5D E;  2HS5 A;  4IJJ A;  3VF0 A;  2H7B A;  1OKK A;  4JJG A;  3KYI A;  1JRA A;  4O6N A;  4KI2 A;  1J8Y F;  3J06 A;  5EK0 A;  3TQO A;  3U2M A;  1YYJ A;  1H6G A;  1ORS C;  5JRA A;  1QSP A;  5BQH A;  1XWJ A;  4CIH A;  3B0V C;  2RSE B;  2OJE D;  4JTC B;  5CI9 A;  3HNK A;  5KYX B;  3LAY A;  2IM8 A;  1G8X A;  3JRT A;  4X0R A;  4FAP B;  4CS9 A;  2R7W A;  2YLD A;  3B0P A;  3V7O A;  3T4R A;  2KNH A;  4XPY A;  3G50 A;  3R2P A;  1CGM E;  2LFF A;  3EGX B;  3NMK A;  4LAC B;  4CSA C;  1MNE A;  4WGY A;  1ZU4 A;  3DE9 A;  4F4B A;  1NSG B;  1YA7 O;  5BQG A;  2LSE A;  3BEH A;  3Q7G A;  4NC3 A;  2HUJ A;  2G3V A;  2J0X A;  1QZX A;  2HSB A;  2NUP A;  4LLE A;  4MW8 A;  4PJN A;  4DBR A;  1BR1 A;  3EGD A;  4BJ5 A;  2V3C C;  4J7Y A;  4BJT A;  3ASN C;  3KYJ A;  2XS8 A;  3GWL A;  4EBK A;  5AC4 A;  3PMR A;  5L3V A;  1R4T A;  4C3E A;  4H4K C;  2HFI A;  1NFN A;  1OQC A;  2IXO A;  1T9K A;  1VYI A;  2Y3D A;  4K1O A;  1Q0G A;  3GAN A;  1JMW A;  3S90 A;  2PP4 A;  3GEI A;  3ZIB A;  1ORY A;  3KL4 A;  4YT5 A;  1BR2 A;  2P7V A;  2CNW A;  1JR8 A;  3LLK A;  4XPW A;  3EZI A;  4FX5 A;  1SR2 A;  1M57 C;  2OOC A;  3O10 A;  3QMK A;  1OCC C;  2GFH A;  2XL4 A;  4IAQ A;  1E2X A;  3ZVR A;  2XLE A;  1Z63 A;  1BBH A;  2O9X A;  2QUP A;  4BEM J;  1ZHY A;  5L3Q A;  1TFO B;  2TMV P;  2J8W A;  4LLC A;  2LCH A;  1YYX A;  5T3T A;  2EIK C;  4U5F E;  5E2Q A;  5DS6 A;  3EG9 A;  2R7T A;  2L9J A;  1OR3 A;  3LES A;  5EHH A;  3OA1 A;  1Z23 A;  1IZM A;  1QLE C;  4EUK B;  3H2V A;  3S29 A;  4YT4 A;  1VK5 A;  2FGY A;  1WN0 A;  4WAB A;  1PD0 A;  2EPK X;  2R9R B;  2AWY A;  3AQC A;  3M79 A;  2UUI A;  4MVM A;  2KW3 C;  4O7G A;  3FOP A;  4K7B A;  2FFH A;  1DOV A;  1SF8 A;  2OKU A;  2AVK A;  2ZD9 A;  4I1M A;  3M4C A;  4Q7C A;  4WGZ A;  3S28 A;  4L6R A;  3SZR A;  1VMA A;  2ZPA A;  2R7Q A;  4XQ1 A;  4RD9 A;  3ITF A;  1CPR A;  3DE8 A;  2R7O A;  1ZVZ A;  1OCZ C;  3UR3 C;  2IYL D;  3HNL A;  3LUT B;  4IB4 A;  1ZHW A;  2JX0 A;  4JC7 A;  3HJC A;  3LNR A;  3O6X A;  2ZXO A;  3NMI A;  1Y6D A;  3Q7L A;  4LDK A;  4MVR A;  3UMK A;  5FZT A;  1LKX A;  2XSE A;  4JE9 A;  1XZP A;  2J7P A;  1EQ1 A;  2LD6 A;  2Y3H A;  4DJ9 A;  1VLT A;  2XM0 A;  3L34 A;  3N0T A;  2YHS A;  2HZ8 A;  2Z15 A;  3IQC A;  3K1I C;  2GWW A;  2EIJ C;  1BZ4 A;  2J9U A;  3IPM O;  3DM5 A;  3RF3 A;  2A0U A;  3RYL A;  1RCP A;  2W9Y A;  2NUT A;  4CS8 C;  3JYY A;  1EA8 A;  4JTA B;  2XLW A;  1LE4 A;  1WAS A;  3GOD A;  5DQZ A;  5JUA A;  5CI8 A;  3RKO F;  3QVY A;  2YL1 A;  4O6Y A;  4A2N B;  2R7U A;  2YL0 A;  1Z5Z A;  3JSZ A;  3ZG1 A;  4NTB A;  2J46 A;  5JSL A;  1LE2 A;  4Z9H A;  2IXP A;  3TJ6 A;  3E70 C;  3LS0 A;  5B1A C;  4MVO A;  5JP7 A;  3B71 A;  2CCY A;  3DAG A;  2BC5 A;  5COG A;  3W4Y A;  3CSK A;  4QI2 A;  2XLD A;  2XRH A;  3V5Z A;  4NCQ A;  1E84 A;  2EIL C;  2NUP B;  3ECS A;  5A6J A;  1V74 B;  2MWQ A;  3EGD B;  5KYU A;  3TUL A;  2OEX A;  2FAP B;  3TK0 A;  3NYJ A;  1JPN A;  2EPO A;  3UGO A;  1LI5 A;  3H65 A;  2DB4 A;  1NU9 C;  1ZYR F;  2RD9 A;  1O87 A;  1VB5 A;  1Y4C A;  1Q0D A;  3KH2 A;  2M64 A;  2R02 A;  2YL3 A;  3ATP A;  4IWB A;  2OCC C;  2OG2 A;  3SXM A;  3U2L A;  3VM6 A;  2R25 A;  3SEO A;  1HMO A;  1H9T A;  1K40 A;  2YQY A;  5AGF A;  1D0Y A;  1E83 A;  2YZS A;  2VAS A;  4LER A;  4EIY A;  3GM2 A;  4XWJ A;  4DVZ A;  1T01 A;  1N1C A;  2QTV A;  3N24 A;  4CJO A;  2JPU A;  3O55 A;  1LPE A;  4MVU A;  256B A;  2Q9B A;  5EGY A;  3AG4 C;  5KYW A;  3RQF A;  4CBE A;  4BEJ A;  4XLN F;  1BDJ B;  2Q00 A;  2W45 A;  1Z7Q c;  3KPH A;  3S0X A;  3S27 A;  2XXA A;  3AG3 C;  3ABK C;  3EJN A;  3AOU A;  3VAY A;  5BUO A;  1C02 A;  2PNO A;  3EG9 B;  3LEV A;  1E85 A;  2B0J A;  1C03 A;  4DRI B;  1Q0K A;  1A0B A;  3ZC4 A;  4JCH A;  2HV6 A;  4DBQ A;  1NBB A;  4GEH A;  4UDV A;  2YEV A;  5L0G A;  2YLI A;  4JKV A;  3FHD A;  4IRU A;  3WAQ A;  1S05 A;  3FAJ A;  4IAO A;  4E18 A;  2G62 A;  3DXJ F;  4J32 B;  3AG1 C;  4MTO A;  3C7J A;  3FMS A;  4N06 A;  1ZHX A;  3HNI A;  3JYH A;  4EBJ A;  3JCU Q;  4W8K A;  2XL6 A;  3CQZ A;  4MVS A;  3JZ0 A;  5T3W A;  1V4A A;  1H7I A;  4ANJ A;  4E7S A;  1L3P A;  1F1M A;  2IXN A;  3X1O A;  5DQT A;  2LK4 A;  3CAX A;  4OD4 A;  2A0B A;  2Q9A A;  2NG1 A;  2WVO A;  1K04 A;  4CS9 C;  3FDQ A;  3KKB A;  5K0I A;  4CDA A;  1V55 C;  2XS1 A;  2GDC A;  2L6G A;  1ST6 A;  5KYY A;  2LFD A;  4C3D A;  4ONS A;  2HJM A;  1TWG A;  2Y39 A;  3SYN A;  4XPX A;  4AE4 A;  1O3U A;  1U6H A;  4ER9 A;  5KYN A;  2OJQ A;  1J8M F;  3SXK A;  4ZLC A;  4NTF A;  3ASO C;  4YL0 A;  1QKR A;  1VOM A;  4R32 A;  4BJ5 C;  2OQM A;  4CDV A;  4U5C E;  4QI0 A;  4QDL A;  3DM9 B;  4PR9 A;  2YWA A;  3AG2 C;  3C62 A;  3C8G D;  3DD7 A;  5F28 E;  4YJW A;  3US6 A;  2NUT B;  4MTF A;  1HY5 A;  2YRF A;  1OXB A;  3DI5 A;  3K33 A;  4U5H A;  1WOL A;  1LI7 A;  2EPL X;  4AK9 A;  1BR4 A;  3B0U X;  4YL3 A;  4JCZ A;  1C17 M;  3QVZ A;  1GGQ A;  1YVI A;  2I15 A;  5DS4 A;  5IY5 C;  1E86 A;  2AWC A;  4KNW A;  3SXY A;  3L8I A;  2X0C A;  1D0X A;  2BE5 F;  3IQ5 A;  2OU6 A;  4A4A A;  5L0F A;  3HKK A;  5E33 A;  2PBE A;  5A6B A;  3B9Q A;  3U0C A;  1Q0F A;  1VTM P;  3F47 A;  4EHP A;  4EWC A;  3NG1 A;  1D1B A;  4AL1 A;  1YAR O;  2NSF A;  5L0I A;  5CIV A;  2F22 A;  2PF4 E;  5E3C A;  1OR2 A;  3EHM A;  5GPG B;  5KYU B;  1YZA A;  1M2V A;  2EIM C;  3JSE O;  3JTL O;  2GAQ A;  3FXH A;  3DJU B;  3GM1 A;  4RDA A;  2A1D D;  4P9T A;  1AUE A;  3FOO A;  1CGO A;  2E87 A;  1EI7 A;  2W4B A;  4DRJ B;  2C04 A;  2VCB A;  1OCO C;  2CW0 F;  4HFK B;  1JAF A;  2Y3G A;  3C8Z A;  3IEE A;  1OKK D;  4C3B A;  2HMZ A;  3SP1 A;  2NPU A;  2QLA A;  1I5N A;  4MS2 A;  1YA9 A;  1ZW3 A;  1ORJ A;  1MMD A;  1B68 A;  2OEV A;  3LLI A;  3GM3 A;  1MMN A;  4KNV A;  2Q7R A;  5B3S C;  4Q4Z F;  4Q5S F;  2Y69 C;  2ASR A;  4AL0 A;  1RKC A;  3NKD A;  4OIQ F;  1JPJ A;  3RQE A;  4Z9I A;  5KYW B;  1K05 A;  1YAU O;  4OD5 A;  3EH1 A;  2XXA B;  3MYI A;  1OCR C;  3KMI A;  4BJ1 A;  2H8A A;  2YLG A;  4N6H A;  1EKY A;  1CGN A;  3FAP B;  3AGU A;  4U5E E;  4JEA A;  4BJ6 A;  4HEA J;  3DZA A;  4YT2 A;  1APC A;  1S7Z A;  4D4X A;  2QY9 A;  4J30 B;  4YT8 A;  1W2W A;  3U9M A;  1Z6A A;  1D0Z A;  3QTH A;  3PHF 2;  5JS5 A;  2Q4F A;  2XLO A;  3ABM C;  3ZDL A;  2D5R B;  1RJ9 A;  4LDQ A;  5AC5 A;  3I5Q A;  4C7O A;  2DI3 A;  4KC9 A;  3ZSU A;  1H9G A;  4Z9J A;  2Q9C A;  2KK1 A;  2R03 A;  4D4N A;  2XLV A;  3IHU A;  3W8I A;  1DOW A;  5L0C A;  4OIO F;  3SNH A;  4JTD B;  3R7C A;  3RQG A;  4E17 A;  3S9O A;  5F5H A;  3RW0 A;  2DYR C;  4EKW A;  5KYY B;  4EBB A;  1OW6 A;  4N6C A;  1G4U S;  3IQT A;  3EHN A;  4PK4 A;  4AE4 B;  3K6B A;  5FCL A;  2LQG A;  4BG0 A;  1OXK A;  3NDB B;  2CGE A;  2G3K A;  3U3F A;  2A68 F;  5A69 A;  3M15 A;  3C8G A;  4I1O B;  1D1A A;  4GQH A;  1AEP A;  1OW7 A;  2XLM A;  3UMH A;  1HW1 A;  1KNY A;  1WTY A;  2IBF A;  2VB6 A;  4H54 A;  3RH3 A;  1FMW A;  3LNM B;  3POV A;  1TFK B;  4PJL A;  3ABL C;  3Q6N A;  1FMV A;  1HMD A;  5D91 A;  3LS1 A;  2YL7 A;  5B3I A;  1YDI A;  3RIP A;  3BRJ A;  3T6G B;  2HKV A;  4YL1 A;  2Y3B A;  1A7D A;  1FFH A;  2CYD A;  3MLG A;  2J0W A;  4JRZ A;  3NMJ A;  2A6H F;  3UNG C;  3WG7 C;  4CDY A;  4XEF A;  1LS4 A;  5COM A;  5HSW A;  3M4B A;  1T6I A;  3S84 A;  2LIG A;  2M4E A;  2P61 A;  2PFD A;  3T9O A;  4N4W A;  3A9C A;  1A7V A;  1V54 C;  4ULV A;  4IAR A;  2X51 A;  3MBG A;  2ZXW C;  3EFO A;  5T1D B;  1M2V B;  3AQB A;  1G5Z A;  3O39 A;  1ZHZ A;  3IQ6 A;  1ZW2 A;  2DYS C;  2VCA A;  2WZG A;  4MTG A;  3U9J A;  2QNL A;  2J7P D;  4PJJ A;  5A6A A;  3RVY A;  3HNJ A;  3T6J A;  1NFO A;  1ZU5 A;  4BPM A;  2JD3 A;  4CSA A;  1ZHT A;  3OWT A;  1T6U A;  2YVK A;  3EPV A;  3U8V A;  3ZTM A;  2D4U A;  1YLM A;  4NQF A;  1TR2 A;  2MHR A;  1LIH A;  4YK5 A;  4MVQ A;  2XM4 A;  1TWH A;  5L0J A;  3HTK C;  4G7H F;  5JLI A;  3U5S A;  4U9E A;  3C63 A;  3C18 A;  3ZWI A;  4JUR I;  3T6B A;  3NYL A;  1YZC A;  2C03 A;  3DMD A;  4PJM A;  3U3B A;  3G4Z A;  3GOR A;  2EPM X;  4E0I A;  3W2W A;  4W8P A;  3VRC A; 
#chains in the Genus database with same CATH homology
 4E7Z A;  1M2O A;  3K1H A;  3M1C B;  3CZ6 A;  2A69 F;  3JT1 A;  4OIN F;  1SZI A;  1FFT C;  3FVY A;  4YN0 B;  4PFP A;  1MMA A;  2WB7 A;  1WGW A;  1PD1 A;  1FTS A;  1IW7 F;  3NKE A;  2PX3 A;  2WZF A;  3HLZ A;  4MND A;  4I3M A;  4FES A;  2MYS A;  4WJ0 A;  5D92 A;  5DVW A;  1RJ9 B;  2VH3 A;  3NRH A;  4XTK A;  1Z3I X;  3W2V A;  4C7O B;  2R7R A;  1TWC A;  2J9W A;  3MX3 A;  3EZH A;  4JJF A;  4RBN A;  5F5F A;  4U5G A;  3W8H A;  3LJB A;  3EQL F;  4YWQ A;  4XLP F;  5KYX A;  5B1B C;  2IXM A;  4ZLD A;  4O79 A;  4FWV A;  2A6E F;  3WOD F;  1KU2 A;  4DVY P;  3EGX A;  2PX0 A;  4HFF B;  4I44 A;  3K66 A;  2HV7 A;  5DS5 A;  3UMI A;  1SMY F;  1MMG A;  1LVK A;  3I4U A;  2KGO A;  4KBL A;  3QZC A;  1NU7 D;  1NZE A;  4CS8 A;  1NG1 A;  2ZXP A;  2H7V C;  3EFO B;  3K7D A;  3OEO A;  2I8B A;  4G7Z F;  4BJ6 C;  2V26 A;  2Q3T A;  4P6I C;  2CNW D;  1PCX A;  2L81 A;  1LS1 A;  3F46 A;  2IOQ A;  3DJN B;  2H7O A;  3VYW A;  1MND A;  1M56 C;  4PFO A;  4GYT A;  3RFY A;  4JZA A;  2R7S A;  2ZXR A;  3DAF A;  4NY3 A;  2KQ9 A;  2WVN A;  3I5P A;  2KJG A;  4G0H A;  4OIR F;  4O6M A;  2P6V A;  4MQ9 F;  2WVQ A;  4G7O F;  3EH2 A;  5E3A A;  4DOZ A;  1D1C A;  3RKO F;  2J45 A;  1O5H A;  1TWA A;  1TKN A;  2EIN C;  2W4M A;  4XLN F;  3NYM A;  2WZL A;  3E9V A;  2WL8 A;  1VYK A;  2R7V A;  4U5B E;  4JVS A;  4AX2 A;  3L0I A;  3Q6M A;  4ULW A;  3N2Z B;  3UGP A;  2DGJ A;  4HE8 D;  2R7X A;  4CS7 A;  3TD7 A;  4B6I A;  4OIP F;  4JW1 A;  2J9V A;  4K0D A;  4M63 A;  3X2Q C;  2CDQ A;  5DLJ A;  4U5D E;  4IJJ A;  4KI2 A;  2H7B A;  1OKK A;  4JJG A;  4O6N A;  1J8Y F;  3B0V C;  4CIH A;  5CI9 A;  5KYX B;  3LAY A;  1G8X A;  3JRT A;  4X0R A;  4CS9 A;  2R7W A;  3B0P A;  3V7O A;  3T4R A;  2KNH A;  3EGX B;  4LAC B;  4CSA C;  1MNE A;  1ZU4 A;  4F4B A;  2LSE A;  3Q7G A;  2G3V A;  2J0X A;  1QZX A;  4LLE A;  2NUP A;  4PJN A;  4DBR A;  1BR1 A;  3EGD A;  4BJ5 A;  2V3C C;  4BJT A;  3ASN C;  3PMR A;  5L3V A;  4C3E A;  4H4K C;  2IXO A;  1VYI A;  2Y3D A;  3GAN A;  2PP4 A;  3ZIB A;  3KL4 A;  4YT5 A;  1BR2 A;  2P7V A;  2CNW A;  3LLK A;  3EZI A;  4FX5 A;  1M57 C;  3QMK A;  1OCC C;  2GFH A;  2XL4 A;  3ZVR A;  1Z63 A;  2O9X A;  1ZHY A;  5L3Q A;  4LLC A;  5T3T A;  2EIK C;  4U5F E;  5E2Q A;  5DS6 A;  3EG9 A;  2R7T A;  2L9J A;  3LES A;  5EHH A;  3OA1 A;  1Z23 A;  1IZM A;  1QLE C;  3S29 A;  4YT4 A;  1VK5 A;  2FGY A;  1PD0 A;  3AQC A;  2KW3 C;  4O7G A;  4K7B A;  2FFH A;  1SF8 A;  4I1M A;  4Q7C A;  3S28 A;  3SZR A;  1VMA A;  2ZPA A;  2R7Q A;  4RD9 A;  3ITF A;  2R7O A;  1OCZ C;  3UR3 C;  2IYL D;  1ZHW A;  3HJC A;  3LNR A;  3O6X A;  2ZXO A;  3Q7L A;  3UMK A;  1LKX A;  2XSE A;  2J7P A;  2Y3H A;  3L34 A;  3N0T A;  2YHS A;  2Z15 A;  3K1I C;  2EIJ C;  2J9U A;  3DM5 A;  3RYL A;  2W9Y A;  2NUT A;  4CS8 C;  5DQZ A;  3GOD A;  5CI8 A;  4A2N B;  4O6Y A;  2R7U A;  1Z5Z A;  3JSZ A;  3ZG1 A;  2J46 A;  2IXP A;  3E70 C;  3LS0 A;  5B1A C;  3DAG A;  3CSK A;  4QI2 A;  2XRH A;  2EIL C;  2NUP B;  3ECS A;  2MWQ A;  3EGD B;  5KYU A;  3NYJ A;  1JPN A;  3UGO A;  3H65 A;  1NU9 C;  1ZYR F;  3KH2 A;  1O87 A;  4IWB A;  2OCC C;  2OG2 A;  3SEO A;  1D0Y A;  2YZS A;  2VAS A;  4LER A;  4DVZ A;  4XWJ A;  1N1C A;  2QTV A;  3N24 A;  5EGY A;  2Q9B A;  5KYW A;  3AG4 C;  4CBE A;  4BEJ A;  2W45 A;  3S0X A;  2XXA A;  3S27 A;  3AG3 C;  3ABK C;  3EJN A;  3VAY A;  5BUO A;  3EG9 B;  3LEV A;  2B0J A;  3ZC4 A;  4JCH A;  2HV6 A;  4DBQ A;  4GEH A;  2YEV A;  3FHD A;  4IRU A;  4IAO A;  3FAJ A;  2G62 A;  3DXJ F;  4J32 B;  3AG1 C;  4N06 A;  1ZHX A;  3JYH A;  3JCU Q;  4W8K A;  3CQZ A;  5T3W A;  4ANJ A;  4E7S A;  3X1O A;  5DQT A;  2IXN A;  4OD4 A;  2WVO A;  2Q9A A;  2NG1 A;  4CS9 C;  3FDQ A;  3KKB A;  1V55 C;  1ST6 A;  5KYY A;  4C3D A;  2Y39 A;  1TWG A;  3SYN A;  5KYN A;  4AE4 A;  1J8M F;  4ZLC A;  3ASO C;  1VOM A;  4BJ5 C;  4U5C E;  4QI0 A;  4QDL A;  3DM9 B;  3AG2 C;  3DD7 A;  4YJW A;  2NUT B;  4U5H A;  3K33 A;  4AK9 A;  1BR4 A;  3B0U X;  5DS4 A;  5IY5 C;  4KNW A;  1D0X A;  2BE5 F;  5E33 A;  3B9Q A;  3F47 A;  4EWC A;  3NG1 A;  1D1B A;  2PF4 E;  5E3C A;  3EHM A;  5KYU B;  1M2V A;  2EIM C;  3DJU B;  4RDA A;  2A1D D;  2E87 A;  2W4B A;  2C04 A;  1OCO C;  2CW0 F;  4HFK B;  2Y3G A;  3IEE A;  1OKK D;  4C3B A;  3SP1 A;  1MMD A;  3LLI A;  1MMN A;  4KNV A;  5B3S C;  4Q5S F;  4Q4Z F;  2Y69 C;  4OIQ F;  3NKD A;  1JPJ A;  5KYW B;  4OD5 A;  3EH1 A;  2XXA B;  1OCR C;  3KMI A;  4BJ1 A;  4U5E E;  4BJ6 A;  4HEA J;  3DZA A;  4YT2 A;  1S7Z A;  2QY9 A;  4J30 B;  4YT8 A;  1W2W A;  1Z6A A;  1D0Z A;  3PHF 2;  3ABM C;  2D5R B;  1RJ9 A;  3I5Q A;  4C7O A;  4KC9 A;  3ZSU A;  2Q9C A;  3W8I A;  4OIO F;  3SNH A;  5F5H A;  2DYR C;  5KYY B;  4EBB A;  3EHN A;  4PK4 A;  4AE4 B;  3K6B A;  5FCL A;  4BG0 A;  3NDB B;  2CGE A;  2G3K A;  2A68 F;  4I1O B;  1D1A A;  3UMH A;  2VB6 A;  3RH3 A;  1FMW A;  3POV A;  4PJL A;  3ABL C;  3Q6N A;  1FMV A;  5D91 A;  3LS1 A;  3RIP A;  2Y3B A;  1FFH A;  3MLG A;  2J0W A;  3UNG C;  2A6H F;  3WG7 C;  5HSW A;  2M4E A;  2PFD A;  1V54 C;  2X51 A;  2ZXW C;  3EFO A;  5T1D B;  1M2V B;  3AQB A;  3O39 A;  1ZHZ A;  2DYS C;  2WZG A;  4PJJ A;  2J7P D;  3T6J A;  1ZU5 A;  4CSA A;  2JD3 A;  1ZHT A;  3OWT A;  3EPV A;  1TR2 A;  1TWH A;  4G7H F;  3HTK C;  4JUR I;  3T6B A;  3NYL A;  2C03 A;  3DMD A;  4PJM A;  3W2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...