2J9UA

2 angstrom x-ray structure of the yeast escrt-i vps28 c-terminus in complex with the nzf-n domain from escrt-ii
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
94
structure length
94
Chain Sequence
FNAKYVAEATGNFITVMDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIVRINKLSIGDTLTETQIRELLFDLELAYKSFYALL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN 28
publication title Structural Insight Into the Escrt-I/-II Link and its Role in Mvb Trafficking.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 39
structure length 94
sequence length 94
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1130 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2j9uA00
2G3KA 2J9WA 2J9UA 2J9VA
chains in the Genus database with same CATH superfamily
3G4ZA 4RD9A 3M4BA 2BL2A 2GAQA 2QY9A 5DQZA 3GWNA 3SYNA 4JTAB 3UMHA 3K7DA 4DBQA 3JRTA 1OW6A 3MYFA 2IOQA 2OEVA 2W4MA 4DBRA 3TOMA 5COGA 2LSEA 1FMVA 2ICWG 4OD4A 5A6AA 5T3TA 2H7BA 2KQ9A 3DWWA 2V3CC 1OCZC 2X51A 3K1IA 4BEJA 3ZTZA 4CX9A 1E2XA 1Z23A 3AJMA 3ABKC 3K66A 2VC9A 4DVZA 1YA9A 1K05A 2KJGA 3K33A 1A41A 3TK0A 2YL7A 4BEMJ 4I3MA 2L81A 1O3UA 1H7IA 2WL8A 1UFBA 4JJFA 4F4BA 3T6JA 3NMIA 2R7XA 2PX3A 4NTAA 4CSAA 1TWCA 3EHNA 2KYHA 4MQ9F 4CS9A 1YZAA 2R7RA 4NQFA 5E3AA 2Y3GA 3E9VA 4MTGA 1HW2A 4MVMA 1K40A 1QKRA 2XS1A 4O6NA 3V5XA 2YL0A 3PHF2 2XXAA 3JT1A 2WB7A 2A69F 2BC5A 3EPVA 3OA1A 2RD9A 1E85A 2OQMA 2VB6A 1HW1A 4AK9A 4HFFB 3RVYA 2ZPAA 4OIRF 4IB4A 2L6GA 2RSEB 1Z63A 1TWHA 1Z5ZA 4J7TA 4EUKB 2HSBA 3C18A 4JEBA 3EZHA 4YL3A 1AEPA 5F5FA 4U9DA 4JJGA 4XPXA 2B0JA 4EHPA 4Z9JA 4O6MA 2PP4A 3Q7GA 5L3VA 3M4CA 5K0IA 4O7GA 3S0XA 3C62A 1WN0A 3FMSA 5E2QA 4BG0A 4KNVA 2R7UA 1D1BA 1LVKA 3K1IC 3KYIA 1H9TA 2PNOA 3ITFA 3JYYA 4E18A 2YL1A 2R25A 3F47A 4R32A 2MWQA 4JC7A 1A7EA 2Q7RA 1Y4CA 1BR4A 1TR2A 3LAYA 3RQFA 1MMNA 3BRJA 1CGNA 5DVWA 3HJCA 2M4EA 5B3SC 1Y6DA 3CAXA 1CPRA 5JSLA 5EHHA 1RXQA 4CS9C 1LE2A 3NMJA 4GYTA 2G3VA 3C7JA 1WGWA 4MVQA 4AE4B 4BPMA 3W2WA 1YDIA 1NSGB 4LERA 2BE5F 2W4BA 1A7VA 1H9GA 2XSEA 3GWLA 3SXZA 3TJ5A 1WOLA 1QSPA 1E86A 3CZ6A 2IXPA 4U5GA 4C7OA 3IEEA 3M79A 1Z7Qc 2YHSA 1AVOB 3LUTB 3V5ZA 3X1OA 2CDQA 2FAPB 2KK1A 3G50A 4J30B 4ZLCA 4ONSA 4NTBA 3N2ZB 2XL4A 1T5OA 5JP7A 5B1AC 2OKUA 3M15A 4NTFA 3IQCA 5DS6A 4WABA 1NBBA 5A6JA 3EQLF 2XLMA 5E3CA 4N06A 5L3QA 2M64A 4AL1A 2H8AA 1OW7A 4I1OB 4XLNF 2J9VA 4YL0A 1TFKB 1Q0DA 4D4XA 4QI2A 1O5HA 1T6IA 1JMWA 1FTSA 3EGDB 2UUHA 2OOCA 1ZHXA 3RVZA 4EBBA 1MMDA 3LEVA 2Q4FA 1G5ZA 2EILC 3FVYA 1NFOA 1M2VB 1MQVA 2AU5A 3BEHA 5KYYB 1RJ9A 1TKNA 3L1MA 2D4UA 4JIOA 2EIKC 4YN0B 1VK5A 2QNLA 4JVSA 2ASRA 2G62A 2P7VA 2WZFA 2XLOA 4MS2A 1D0YA 3V5YA 4MVUA 4OIOF 1TQGA 1LI5A 3RKOF 4AL0A 1SR2A 5BUOA 1LKXA 1T9KA 1S05A 3DJNB 5JRAA 4PR9A 1VLSA 2EIJC 2O9XA 3S29A 4Q5SF 1LI7A 4ER9A 4GEHA 4E0HA 1C17M 3JCUQ 3M1CB 3N0TA 2Q00A 3JYHA 1I4ZA 4X0RA 5E33A 4ZLDA 3Q6MA 3DE9A 1Z3IX 3TOLA 1Q0MA 2EPLX 3GEHA 4K1OA 2XM4A 2J46A 4YK5A 1LS1A 4CS8A 2XS8A 3HNLA 4KC9A 3DAFA 4FX5A 5JVEA 2EPOA 1ZYRF 4W8KA 4JCHA 3CSKA 3UMKA 5AGFA 3GM2A 4IARA 4E17A 2CW0F 2EPMX 5JS5A 5HSWA 4OIPF 1A7DA 1CGOA 4C3EA 2DB4A 3HNKA 4O6YA 3S84A 4DRHB 3R2PA 5L0DA 4CIHA 2XRHA 4DJ9A 2R7SA 1FR0A 1M57C 5KYWB 2MHRA 1E84A 2P0NA 1ORSC 4FWVA 1OR3A 4K7BA 1BDJB 3E70C 3ZG1A 3DM5A 2EINC 4PJLA 2VCAA 3U3FA 5BQGA 3U2MA 4H4KC 2LFFA 2ZD9A 1NG1A 1ZW3A 4UDVA 2R7TA 2OU6A 3QW0A 3U8VA 1U0BB 3FHDA 1J8YF 1MMGA 3Q7LA 2B0HA 2A6EF 3EGXA 2XXAB 1FMWA 2CNWD 2XLEA 3GORA 4PK4A 3W4YA 2G3KA 2EPKX 2J8WA 2GFHA 2CCYA 3PMRA 2A0BA 3UGOA 1NU9C 2NUPA 1B68A 3CQZA 1IW7F 2ZXOA 3SNHA 4PFPA 1D1CA 1V54C 3WODF 3I5QA 4MVRA 3ZWIA 1PD0A 5A6KA 3QZCA 2QTVA 3LLIA 3QMKA 3NRHA 3A9CA 4CS8C 3RF3A 3WAQA 4K0DA 1ZHYA 2LP4A 1ZHTA 2Q3TA 4HFKB 3HLZA 4YT8A 1TWGA 1E83A 4PJNA 2YLIA 2XLVA 4MW3A 3CEXA 2R03A 3AQCA 3EH2A 3MX3A 3AG1C 1T6UA 3Q6NA 4YT2A 3TULA 1Q0FA 2NUTA 2J9WA 1XWJA 3AGUA 3ZSUA 4E7ZA 3A11A 4RBNA 1PCXA 4U5EE 4XLPF 1C03A 2J7PD 2XL8A 4XEFA 4P6IC 3DZAA 1ZU4A 1RKEB 4J32B 1HE9A 2KSFA 1GQAA 2CNWA 3GEIA 3W8IA 4Q4ZF 1OCOC 1ZW2A 4L6RA 3ECSA 3DD7A 1IZMA 1HMOA 2ZXRA 1ORYA 3O55A 2OJQA 4LACB 2P61A 2HJ3A 1WATA 3JSEO 5JUAA 3JSZA 3TD7A 1UG7A 4G78A 1EI7A 1L3PA 4CSAC 4C7OB 1BBHA 2YLDA 3H2VA 2ZXPA 4IWBA 3GANA 3VM6A 1ZHWA 2HV7A 3IPMO 1SYQA 3WHNA 5L0CA 2R7WA 2IYLD 2LK4A 4JEAA 2AP3A 3SXKA 3H2UA 2KC3A 3FAJA 3LS0A 2L6FA 3EFOB 2YKZA 3DAGA 3T9OA 5KYXB 4OIQF 4LDQA 3VRCA 2NPUA 3IHUA 2L6HA 2Q9CA 3TJ6A 3KYJA 1EKYA 1R4TA 4LLEA 2A0UA 1YYJA 1T6QA 3C8GD 1MNDA 4G7OF 2YL3A 1W2WA 2R05A 1LM3B 1ORJA 3GM1A 3HNJA 4ANJA 4E7SA 4YL1A 3FOPA 1VB5A 1OCRC 2HJMA 3B0UX 4JURI 3X2QC 2J7PA 3IQ5A 2IM8A 4AX2A 3S90A 3NYMA 5B1BC 2J0WA 2Y39A 3AOUA 1RJ9B 4PFOA 3ZTMA 2HV6A 3NYLA 4JKVA 5D91A 3S9OA 4EIYA 1HY5A 1MMAA 1S7ZA 1V74B 4HEAJ 2DYRC 2F22A 2EPNA 2OCCC 2P6VA 4DXWA 2VASA 2W9YA 3AG2C 1GGQA 1OCCC 4OD5A 3UR3C 4JCZA 4DRJB 1FFTC 3IQTA 1OR2A 1YVIA 3QTHA 2X0CA 1WWPA 3U8PA 2HS5A 4ULVA 2AWYA 2GA0A 2I8BA 2LCHA 3EHMA 3ZIBA 2L9JA 3W8HA 1OXKA 1QZXA 1ST6A 3LS1A 1I4YA 1VTMP 3MFNA 4A2NB 4U9EA 3KPHA 3U2LA 3EG9A 4XWJA 5KYUB 3F46A 1HE1A 3LNMB 1LS4A 2OJED 3GEEA 3NG1A 3PCVA 4MNDA 1OKKD 2IXNA 2HMZA 4XQ1A 2R9RB 4P9FA 4G7HF 1OXBA 1JRAA 2Y69C 5COMA 2TMVP 4I44A 1G4US 4MW8A 1EA8A 4XPYA 3C8GA 1M6TA 4BJ6A 2MYSA 2YWAA 4YT4A 4NY3A 4MVOA 5F5HA 1OQCA 1QPUA 2Y3BA 4JTDB 4W8PA 5BQIA 1Q0KA 3MYIA 3U9MA 3VAYA 4DOZA 4JE9A 1I5NA 4P9TA 5L0GA 2Z15A 1Z6AA 4IAQA 3ZQVA 2D5RB 4JW1A 2C04A 2NSFA 2Y3HA 1A0BA 1M2VA 2J0XA 3RYLA 3ZDLA 2XLWA 5KYYA 3ZVRA 4N6HA 1R5ID 3LESA 3U0CA 3MBGA 1XZQA 5DQTA 5HV9A 2YEVA 2Y3DA 1SMYF 4A4AA 1FNTc 1XZPA 2P1AA 4WJ0A 5L0IA 1LIHA 1PD1A 1K04A 3NYJA 3QVZA 1D0ZA 4B6IA 256BA 4I1MA 3NDBB 4ULWA 5F28E 4CDVA 1SZIA 1SF8A 2QE9A 3U9JA 3T4RA 1VYKA 1OW8A 3AG4C 4O79A 4Z9HA 3K1HA 2FFHA 3B0VC 1L7CA 1OKKA 1RKCA 1YLMA 3O6XA 4LDKA 1DOWA 3RH3A 3UMIA 2QLAA 2A6HF 2HMQA 4OINF 3W2VA 2Q9AA 3WG7C 5A69A 3J06A 2DGJA 1AUEA 2HKVA 2XM0A 1J8MF 3VF0A 3JRMO 3HNIA 5EGYA 4DVYP 5CIVA 4IGGA 2H7VC 2YQYA 3SXMA 3SEOA 2DI3A 2KW3C 3LJBA 4G0HA 4BJ6C 1ZU5A 4YWQA 5DLJA 1LE4A 2PFDA 2QUPA 5CI9A 3RQGA 4EKWA 1YYXA 1ZHZA 2IBFA 4XEVA 3U3BA 5FCLA 1JAFA 2I15A 3JZ0A 2HZ8A 5KYWA 4LLCA 3UGPA 4GQHA 3G4XA 4MVZA 3S28A 2UUIA 2NUTB 5L0FA 5B3IA 1YAUO 2OEXA 3JTLO 3AGTA 5A6BA 3EJNA 1ZZPA 1NZEA 1KU2A 3KKBA 1JPJA 4U5FE 2OG2A 4NC3A 2IXMA 3DMDA 3NKDA 3DI5A 1JPNA 2LD6A 2A1DD 4Q7CA 4PJJA 4BJ1A 3EZIA 4Z9IA 1G8XA 1N1CA 1Q0GA 2E87A 2GDCA 3O10A 1FAPB 4RDAA 3GM3A 3T6BA 2J9UA 3C63A 4CDAA 3ASNC 2JD3A 2DYSC 3R7CA 2HUJA 4EBJA 3EH1A 2PF4E 3ABMC 4IAOA 2PX0A 4CDYA 2XLHA 1M2OA 5FZTA 2WVNA 2PBEA 2VCBA 5T3WA 3ASOC 1FFHA 2VH3A 1YA7O 5DS4A 1YZCA 2W45A 2KGOA 2KNHA 1WASA 2LFDA 1BR1A 3AQBA 3KL4A 5T1DB 3S27A 3DM9B 4BJ5A 4CIPA 5IY5C 1RMVA 5DS5A 4U5CE 3POVA 1QLEC 1PV3A 3ZQYA 3LEOA 2FGYA 2IXOA 1NLXA 3L8IA 4XTKA 2YLGA 1NFNA 1VLTA 4U5HA 4C3BA 4CJGA 3K6BA 5KYNA 1VYIA 5AC5A 2CGEA 2AWCA 3FOOA 1GS9A 3RFYA 1CGME 5COFA 1EQ1A 5BQHA 2ETSA 4MTFA 4XEKA 3L0IA 2JX0A 4C3DA 4M63A 1D1AA 2CYDA 1QVXA 2HSQA 3AG3C 1VOMA 3O39A 1LPEA 1RKEA 3ATPA 3IQ6A 4JTCB 5CI8A 1T01A 3L34A 2XLDA 2L7AA 5L0JA 4MTOA 4EWCA 3FXHA 4LDRA 2V26A 4FAPB 1U89A 3LNRA 2LQGA 4KNWA 3SXYA 2A68F 1H6GA 3I4UA 4PACA 3T6GB 4AE4A 1CPQA 1BZ4A 1NU7D 1RCPA 2J9BA 2WZLA 3EG9B 3I5PA 1F1MA 1KTMA 2LIGA 4WGYA 3B0PA 3QVYA 4QDLA 2YRFA 3RQEA 3EFOA 5TJ5E 1GM5A 3OWTA 4BJTA 4CBEA 3DXJF 4MVSA 5KYXA 1V55C 4N6CA 3C8GB 3ZC4A 4BJ5C 3HTKC 1U6HA 4YJWA 3KMIA 4EBKA 3B29A 2Q9BA 3DJUB 5EK0A 4J7YA 3V7OA 1YARO 1BR2A 3US6A 3PDMP 1TWAA 1TFOB 1APCA 2VCCA 2YZSA 2ZXWC 3TQOA 4NCQA 2WVOA 2NSGA 3OEOA 1KNYA 2C03A 3L8JA 1C02A 4HE8D 3VYWA 3DKAA 1JR8A 2XL6A 3B71A 4H54A 3DE8A 2R7OA 2EIMC 3FAPB 4WGZA 3RW0A 3SP1A 5AC4A 3FDQA 3LLKA 4YT5A 4FESA 4E0IA 3EGDA 1G4WR 3SZRA 1JOGA 4KI2A 1QQ3A 5D92A 3U5SA 2NG1A 5JT4A 3B9QA 5GPGB 4U5BE 2WZGA 3UNGC 4IRUA 2R02A 3MLGA 2JPUA 4CS7A 4IJJA 4QI0A 5JLIA 2R7VA 1D0XA 3QW1A 4CJOA 2GWWA 4XPWA 3N24A 2WVQA 4JRZA 5A6BD 3C8ZA 2J45A 1YJGA 3NMKA 4N4WA 5L0HA 1HMDA 4G7ZF 5KYUA 4D4NA 2H7OA 1WTYA 3EGXB 1O87A 2R7QA 3RIPA 4DRIB 1ZVZA 2YVKA 3HKKA 1DOVA 1MNEA 1M56C 3GODA 4JZAA 3H65A 2NUPB 1VMAA 1V4AA 4PJMA 3ABLC 2HFIA 4U5DE 3KH2A 4KBLA 2AVKA 3NKEA
chains in the Genus database with same CATH topology
4RD9A 2QY9A 5DQZA 3SYNA 3UMHA 3K7DA 4DBQA 3JRTA 2IOQA 2W4MA 4DBRA 2LSEA 1FMVA 4OD4A 5T3TA 2H7BA 2KQ9A 2V3CC 1OCZC 2X51A 4BEJA 1Z23A 3ABKC 3K66A 4DVZA 2KJGA 3K33A 4I3MA 2L81A 2WL8A 4JJFA 4F4BA 3T6JA 2R7XA 2PX3A 4CSAA 1TWCA 3EHNA 4CS9A 4MQ9F 2R7RA 5E3AA 2Y3GA 3E9VA 4O6NA 3PHF2 2XXAA 3JT1A 2WB7A 2A69F 3EPVA 3OA1A 2VB6A 4AK9A 4HFFB 2ZPAA 4OIRF 1Z63A 1TWHA 1Z5ZA 3EZHA 5F5FA 4JJGA 2B0JA 4O6MA 2PP4A 3Q7GA 5L3VA 4O7GA 3S0XA 5E2QA 4BG0A 4KNVA 2R7UA 1D1BA 1LVKA 3K1IC 3ITFA 3F47A 2MWQA 1BR4A 1TR2A 3LAYA 1MMNA 5DVWA 3HJCA 2M4EA 5B3SC 5EHHA 4CS9C 4GYTA 2G3VA 4AE4B 1WGWA 3W2WA 4LERA 2BE5F 2W4BA 2XSEA 3CZ6A 2IXPA 4U5GA 4C7OA 3IEEA 2YHSA 3X1OA 2CDQA 4J30B 4ZLCA 3N2ZB 2XL4A 5B1AC 5DS6A 3EQLF 5E3CA 4N06A 5L3QA 4I1OB 4XLNF 2J9VA 4QI2A 1O5HA 3EGDB 1FTSA 4EBBA 1ZHXA 1MMDA 3LEVA 3FVYA 2EILC 1M2VB 5KYYB 1RJ9A 1TKNA 2EIKC 4YN0B 1VK5A 4JVSA 2G62A 2P7VA 2WZFA 1D0YA 4OIOF 3RKOF 5BUOA 1LKXA 3DJNB 3S29A 2EIJC 2O9XA 4Q5SF 4GEHA 3JCUQ 3N0TA 3M1CB 3JYHA 4X0RA 5E33A 4ZLDA 3Q6MA 1Z3IX 2J46A 1LS1A 4CS8A 4KC9A 3DAFA 4FX5A 1ZYRF 4W8KA 4JCHA 3CSKA 3UMKA 2CW0F 5HSWA 4OIPF 4C3EA 4O6YA 4CIHA 2XRHA 2R7SA 1M57C 5KYWB 4FWVA 4K7BA 3E70C 3ZG1A 3DM5A 2EINC 4PJLA 4H4KC 1NG1A 2R7TA 3FHDA 1J8YF 1MMGA 3Q7LA 3EGXA 2A6EF 2XXAB 1FMWA 2CNWD 4PK4A 2G3KA 2GFHA 3PMRA 3UGOA 1NU9C 2NUPA 3CQZA 1IW7F 2ZXOA 3SNHA 4PFPA 1D1CA 1V54C 3WODF 3I5QA 1PD0A 3QZCA 2QTVA 3LLIA 3QMKA 3NRHA 4CS8C 4K0DA 1ZHYA 1ZHTA 2Q3TA 4HFKB 3HLZA 4YT8A 1TWGA 4PJNA 3AQCA 3EH2A 3MX3A 3AG1C 3Q6NA 4YT2A 2NUTA 2J9WA 4E7ZA 3ZSUA 4RBNA 1PCXA 4U5EE 4XLPF 2J7PD 4P6IC 3DZAA 1ZU4A 4J32B 3W8IA 4Q4ZF 2CNWA 1OCOC 3ECSA 3DD7A 1IZMA 2ZXRA 4LACB 3JSZA 3TD7A 4CSAC 4C7OB 2ZXPA 4IWBA 3GANA 1ZHWA 2HV7A 2R7WA 2IYLD 3FAJA 3LS0A 3EFOB 3DAGA 5KYXB 4OIQF 2Q9CA 4LLEA 1MNDA 4G7OF 1W2WA 4ANJA 4E7SA 1OCRC 3B0UX 4JURI 3X2QC 2J7PA 4AX2A 3NYMA 5B1BC 2J0WA 2Y39A 1RJ9B 4PFOA 2HV6A 3NYLA 5D91A 1MMAA 4HEAJ 1S7ZA 2DYRC 2P6VA 2OCCC 2VASA 2W9YA 3AG2C 1OCCC 4OD5A 3UR3C 1FFTC 2I8BA 3EHMA 3ZIBA 2L9JA 3W8HA 1QZXA 1ST6A 3LS1A 4A2NB 5KYUB 3EG9A 4XWJA 3F46A 3NG1A 5EGYA 4MNDA 1OKKD 2IXNA 4G7HF 2Y69C 4I44A 4BJ6A 2MYSA 4YT4A 4NY3A 5F5HA 2Y3BA 3VAYA 4DOZA 2Z15A 1Z6AA 2D5RB 4JW1A 2C04A 2Y3HA 1M2VA 2J0XA 3RYLA 5KYYA 3ZVRA 3LESA 5DQTA 2YEVA 2Y3DA 1SMYF 4WJ0A 1PD1A 3NYJA 1D0ZA 4B6IA 4I1MA 3NDBB 4ULWA 1SZIA 1SF8A 3T4RA 1VYKA 4O79A 3AG4C 3K1HA 2FFHA 3B0VC 1OKKA 3RH3A 3O6XA 3W2VA 3UMIA 4OINF 2A6HF 3WG7C 2Q9AA 2DGJA 1J8MF 4DVYP 2H7VC 3SEOA 3LJBA 2KW3C 4G0HA 4BJ6C 4YWQA 1ZU5A 5DLJA 2PFDA 5CI9A 1ZHZA 5FCLA 3UGPA 5KYWA 4LLCA 3S28A 2NUTB 3EJNA 1NZEA 1KU2A 3KKBA 1JPJA 4U5FE 2OG2A 2IXMA 3DMDA 3NKDA 1JPNA 2A1DD 4Q7CA 4PJJA 4BJ1A 3EZIA 1G8XA 1N1CA 2E87A 3T6BA 4RDAA 2J9UA 3ASNC 2JD3A 2DYSC 3EH1A 2PF4E 3ABMC 4IAOA 2PX0A 1M2OA 2WVNA 5T3WA 3ASOC 1FFHA 2VH3A 5DS4A 2W45A 4CBEA 2KGOA 2KNHA 3AQBA 3KL4A 1BR1A 5T1DB 3S27A 4BJ5A 5IY5C 3DM9B 5DS5A 4U5CE 3POVA 1QLEC 2FGYA 2IXOA 4XTKA 4C3BA 4U5HA 3K6BA 5KYNA 1VYIA 2CGEA 3RFYA 3L0IA 4C3DA 4M63A 1D1AA 3AG3C 1VOMA 3O39A 5CI8A 3L34A 4EWCA 2V26A 3LNRA 4KNWA 2A68F 3I4UA 4AE4A 1NU7D 2WZLA 3I5PA 3EG9B 3B0PA 4QDLA 3EFOA 3OWTA 4BJTA 3DXJF 5KYXA 1V55C 3ZC4A 4BJ5C 3HTKC 4YJWA 3KMIA 2Q9BA 3DJUB 3V7OA 1BR2A 1TWAA 2YZSA 2ZXWC 2WVOA 3OEOA 2C03A 4HE8D 3VYWA 2R7OA 2EIMC 3SP1A 3FDQA 3LLKA 4YT5A 4FESA 3EGDA 3SZRA 4KI2A 5D92A 2NG1A 3B9QA 4U5BE 2WZGA 3UNGC 4IRUA 3MLGA 4CS7A 4IJJA 4QI0A 2R7VA 1D0XA 3N24A 2WVQA 2J45A 4G7ZF 5KYUA 2H7OA 3EGXB 1O87A 2R7QA 3RIPA 1MNEA 1M56C 3GODA 4JZAA 3H65A 2NUPB 1VMAA 4PJMA 3ABLC 4U5DE 3KH2A 4KBLA 3NKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G3K A;  2J9W A;  2J9U A;  2J9V A; 
#chains in the Genus database with same CATH topology
 3G4Z A;  4RD9 A;  3M4B A;  2BL2 A;  2GAQ A;  2QY9 A;  5DQZ A;  3GWN A;  3SYN A;  4JTA B;  3UMH A;  3K7D A;  4DBQ A;  3JRT A;  1OW6 A;  3MYF A;  2IOQ A;  2OEV A;  2W4M A;  4DBR A;  3TOM A;  5COG A;  2LSE A;  1FMV A;  2ICW G;  4OD4 A;  5A6A A;  5T3T A;  2H7B A;  2KQ9 A;  3DWW A;  2V3C C;  1OCZ C;  2X51 A;  3K1I A;  4BEJ A;  3ZTZ A;  4CX9 A;  1E2X A;  1Z23 A;  3AJM A;  3ABK C;  3K66 A;  2VC9 A;  4DVZ A;  1YA9 A;  1K05 A;  2KJG A;  3K33 A;  1A41 A;  3TK0 A;  2YL7 A;  4BEM J;  4I3M A;  2L81 A;  1O3U A;  1H7I A;  2WL8 A;  1UFB A;  4JJF A;  4F4B A;  3T6J A;  3NMI A;  2R7X A;  2PX3 A;  4NTA A;  4CSA A;  1TWC A;  3EHN A;  2KYH A;  4MQ9 F;  4CS9 A;  1YZA A;  2R7R A;  4NQF A;  5E3A A;  2Y3G A;  3E9V A;  4MTG A;  1HW2 A;  4MVM A;  1K40 A;  1QKR A;  2XS1 A;  4O6N A;  3V5X A;  2YL0 A;  3PHF 2;  2XXA A;  3JT1 A;  2WB7 A;  2A69 F;  2BC5 A;  3EPV A;  3OA1 A;  2RD9 A;  1E85 A;  2OQM A;  2VB6 A;  1HW1 A;  4AK9 A;  4HFF B;  3RVY A;  2ZPA A;  4OIR F;  4IB4 A;  2L6G A;  2RSE B;  1Z63 A;  1TWH A;  1Z5Z A;  4J7T A;  4EUK B;  2HSB A;  3C18 A;  4JEB A;  3EZH A;  4YL3 A;  1AEP A;  5F5F A;  4U9D A;  4JJG A;  4XPX A;  2B0J A;  4EHP A;  4Z9J A;  4O6M A;  2PP4 A;  3Q7G A;  5L3V A;  3M4C A;  5K0I A;  4O7G A;  3S0X A;  3C62 A;  1WN0 A;  3FMS A;  5E2Q A;  4BG0 A;  4KNV A;  2R7U A;  1D1B A;  1LVK A;  3K1I C;  3KYI A;  1H9T A;  2PNO A;  3ITF A;  3JYY A;  4E18 A;  2YL1 A;  2R25 A;  3F47 A;  4R32 A;  2MWQ A;  4JC7 A;  1A7E A;  2Q7R A;  1Y4C A;  1BR4 A;  1TR2 A;  3LAY A;  3RQF A;  1MMN A;  3BRJ A;  1CGN A;  5DVW A;  3HJC A;  2M4E A;  5B3S C;  1Y6D A;  3CAX A;  1CPR A;  5JSL A;  5EHH A;  1RXQ A;  4CS9 C;  1LE2 A;  3NMJ A;  4GYT A;  2G3V A;  3C7J A;  1WGW A;  4MVQ A;  4AE4 B;  4BPM A;  3W2W A;  1YDI A;  1NSG B;  4LER A;  2BE5 F;  2W4B A;  1A7V A;  1H9G A;  2XSE A;  3GWL A;  3SXZ A;  3TJ5 A;  1WOL A;  1QSP A;  1E86 A;  3CZ6 A;  2IXP A;  4U5G A;  4C7O A;  3IEE A;  3M79 A;  1Z7Q c;  2YHS A;  1AVO B;  3LUT B;  3V5Z A;  3X1O A;  2CDQ A;  2FAP B;  2KK1 A;  3G50 A;  4J30 B;  4ZLC A;  4ONS A;  4NTB A;  3N2Z B;  2XL4 A;  1T5O A;  5JP7 A;  5B1A C;  2OKU A;  3M15 A;  4NTF A;  3IQC A;  5DS6 A;  4WAB A;  1NBB A;  5A6J A;  3EQL F;  2XLM A;  5E3C A;  4N06 A;  5L3Q A;  2M64 A;  4AL1 A;  2H8A A;  1OW7 A;  4I1O B;  4XLN F;  2J9V A;  4YL0 A;  1TFK B;  1Q0D A;  4D4X A;  4QI2 A;  1O5H A;  1T6I A;  1JMW A;  1FTS A;  3EGD B;  2UUH A;  2OOC A;  1ZHX A;  3RVZ A;  4EBB A;  1MMD A;  3LEV A;  2Q4F A;  1G5Z A;  2EIL C;  3FVY A;  1NFO A;  1M2V B;  1MQV A;  2AU5 A;  3BEH A;  5KYY B;  1RJ9 A;  1TKN A;  3L1M A;  2D4U A;  4JIO A;  2EIK C;  4YN0 B;  1VK5 A;  2QNL A;  4JVS A;  2ASR A;  2G62 A;  2P7V A;  2WZF A;  2XLO A;  4MS2 A;  1D0Y A;  3V5Y A;  4MVU A;  4OIO F;  1TQG A;  1LI5 A;  3RKO F;  4AL0 A;  1SR2 A;  5BUO A;  1LKX A;  1T9K A;  1S05 A;  3DJN B;  5JRA A;  4PR9 A;  1VLS A;  2EIJ C;  2O9X A;  3S29 A;  4Q5S F;  1LI7 A;  4ER9 A;  4GEH A;  4E0H A;  1C17 M;  3JCU Q;  3M1C B;  3N0T A;  2Q00 A;  3JYH A;  1I4Z A;  4X0R A;  5E33 A;  4ZLD A;  3Q6M A;  3DE9 A;  1Z3I X;  3TOL A;  1Q0M A;  2EPL X;  3GEH A;  4K1O A;  2XM4 A;  2J46 A;  4YK5 A;  1LS1 A;  4CS8 A;  2XS8 A;  3HNL A;  4KC9 A;  3DAF A;  4FX5 A;  5JVE A;  2EPO A;  1ZYR F;  4W8K A;  4JCH A;  3CSK A;  3UMK A;  5AGF A;  3GM2 A;  4IAR A;  4E17 A;  2CW0 F;  2EPM X;  5JS5 A;  5HSW A;  4OIP F;  1A7D A;  1CGO A;  4C3E A;  2DB4 A;  3HNK A;  4O6Y A;  3S84 A;  4DRH B;  3R2P A;  5L0D A;  4CIH A;  2XRH A;  4DJ9 A;  2R7S A;  1FR0 A;  1M57 C;  5KYW B;  2MHR A;  1E84 A;  2P0N A;  1ORS C;  4FWV A;  1OR3 A;  4K7B A;  1BDJ B;  3E70 C;  3ZG1 A;  3DM5 A;  2EIN C;  4PJL A;  2VCA A;  3U3F A;  5BQG A;  3U2M A;  4H4K C;  2LFF A;  2ZD9 A;  1NG1 A;  1ZW3 A;  4UDV A;  2R7T A;  2OU6 A;  3QW0 A;  3U8V A;  1U0B B;  3FHD A;  1J8Y F;  1MMG A;  3Q7L A;  2B0H A;  2A6E F;  3EGX A;  2XXA B;  1FMW A;  2CNW D;  2XLE A;  3GOR A;  4PK4 A;  3W4Y A;  2G3K A;  2EPK X;  2J8W A;  2GFH A;  2CCY A;  3PMR A;  2A0B A;  3UGO A;  1NU9 C;  2NUP A;  1B68 A;  3CQZ A;  1IW7 F;  2ZXO A;  3SNH A;  4PFP A;  1D1C A;  1V54 C;  3WOD F;  3I5Q A;  4MVR A;  3ZWI A;  1PD0 A;  5A6K A;  3QZC A;  2QTV A;  3LLI A;  3QMK A;  3NRH A;  3A9C A;  4CS8 C;  3RF3 A;  3WAQ A;  4K0D A;  1ZHY A;  2LP4 A;  1ZHT A;  2Q3T A;  4HFK B;  3HLZ A;  4YT8 A;  1TWG A;  1E83 A;  4PJN A;  2YLI A;  2XLV A;  4MW3 A;  3CEX A;  2R03 A;  3AQC A;  3EH2 A;  3MX3 A;  3AG1 C;  1T6U A;  3Q6N A;  4YT2 A;  3TUL A;  1Q0F A;  2NUT A;  2J9W A;  1XWJ A;  3AGU A;  3ZSU A;  4E7Z A;  3A11 A;  4RBN A;  1PCX A;  4U5E E;  4XLP F;  1C03 A;  2J7P D;  2XL8 A;  4XEF A;  4P6I C;  3DZA A;  1ZU4 A;  1RKE B;  4J32 B;  1HE9 A;  2KSF A;  1GQA A;  2CNW A;  3GEI A;  3W8I A;  4Q4Z F;  1OCO C;  1ZW2 A;  4L6R A;  3ECS A;  3DD7 A;  1IZM A;  1HMO A;  2ZXR A;  1ORY A;  3O55 A;  2OJQ A;  4LAC B;  2P61 A;  2HJ3 A;  1WAT A;  3JSE O;  5JUA A;  3JSZ A;  3TD7 A;  1UG7 A;  4G78 A;  1EI7 A;  1L3P A;  4CSA C;  4C7O B;  1BBH A;  2YLD A;  3H2V A;  2ZXP A;  4IWB A;  3GAN A;  3VM6 A;  1ZHW A;  2HV7 A;  3IPM O;  1SYQ A;  3WHN A;  5L0C A;  2R7W A;  2IYL D;  2LK4 A;  4JEA A;  2AP3 A;  3SXK A;  3H2U A;  2KC3 A;  3FAJ A;  3LS0 A;  2L6F A;  3EFO B;  2YKZ A;  3DAG A;  3T9O A;  5KYX B;  4OIQ F;  4LDQ A;  3VRC A;  2NPU A;  3IHU A;  2L6H A;  2Q9C A;  3TJ6 A;  3KYJ A;  1EKY A;  1R4T A;  4LLE A;  2A0U A;  1YYJ A;  1T6Q A;  3C8G D;  1MND A;  4G7O F;  2YL3 A;  1W2W A;  2R05 A;  1LM3 B;  1ORJ A;  3GM1 A;  3HNJ A;  4ANJ A;  4E7S A;  4YL1 A;  3FOP A;  1VB5 A;  1OCR C;  2HJM A;  3B0U X;  4JUR I;  3X2Q C;  2J7P A;  3IQ5 A;  2IM8 A;  4AX2 A;  3S90 A;  3NYM A;  5B1B C;  2J0W A;  2Y39 A;  3AOU A;  1RJ9 B;  4PFO A;  3ZTM A;  2HV6 A;  3NYL A;  4JKV A;  5D91 A;  3S9O A;  4EIY A;  1HY5 A;  1MMA A;  1S7Z A;  1V74 B;  4HEA J;  2DYR C;  2F22 A;  2EPN A;  2OCC C;  2P6V A;  4DXW A;  2VAS A;  2W9Y A;  3AG2 C;  1GGQ A;  1OCC C;  4OD5 A;  3UR3 C;  4JCZ A;  4DRJ B;  1FFT C;  3IQT A;  1OR2 A;  1YVI A;  3QTH A;  2X0C A;  1WWP A;  3U8P A;  2HS5 A;  4ULV A;  2AWY A;  2GA0 A;  2I8B A;  2LCH A;  3EHM A;  3ZIB A;  2L9J A;  3W8H A;  1OXK A;  1QZX A;  1ST6 A;  3LS1 A;  1I4Y A;  1VTM P;  3MFN A;  4A2N B;  4U9E A;  3KPH A;  3U2L A;  3EG9 A;  4XWJ A;  5KYU B;  3F46 A;  1HE1 A;  3LNM B;  1LS4 A;  2OJE D;  3GEE A;  3NG1 A;  3PCV A;  4MND A;  1OKK D;  2IXN A;  2HMZ A;  4XQ1 A;  2R9R B;  4P9F A;  4G7H F;  1OXB A;  1JRA A;  2Y69 C;  5COM A;  2TMV P;  4I44 A;  1G4U S;  4MW8 A;  1EA8 A;  4XPY A;  3C8G A;  1M6T A;  4BJ6 A;  2MYS A;  2YWA A;  4YT4 A;  4NY3 A;  4MVO A;  5F5H A;  1OQC A;  1QPU A;  2Y3B A;  4JTD B;  4W8P A;  5BQI A;  1Q0K A;  3MYI A;  3U9M A;  3VAY A;  4DOZ A;  4JE9 A;  1I5N A;  4P9T A;  5L0G A;  2Z15 A;  1Z6A A;  4IAQ A;  3ZQV A;  2D5R B;  4JW1 A;  2C04 A;  2NSF A;  2Y3H A;  1A0B A;  1M2V A;  2J0X A;  3RYL A;  3ZDL A;  2XLW A;  5KYY A;  3ZVR A;  4N6H A;  1R5I D;  3LES A;  3U0C A;  3MBG A;  1XZQ A;  5DQT A;  5HV9 A;  2YEV A;  2Y3D A;  1SMY F;  4A4A A;  1FNT c;  1XZP A;  2P1A A;  4WJ0 A;  5L0I A;  1LIH A;  1PD1 A;  1K04 A;  3NYJ A;  3QVZ A;  1D0Z A;  4B6I A;  256B A;  4I1M A;  3NDB B;  4ULW A;  5F28 E;  4CDV A;  1SZI A;  1SF8 A;  2QE9 A;  3U9J A;  3T4R A;  1VYK A;  1OW8 A;  3AG4 C;  4O79 A;  4Z9H A;  3K1H A;  2FFH A;  3B0V C;  1L7C A;  1OKK A;  1RKC A;  1YLM A;  3O6X A;  4LDK A;  1DOW A;  3RH3 A;  3UMI A;  2QLA A;  2A6H F;  2HMQ A;  4OIN F;  3W2V A;  2Q9A A;  3WG7 C;  5A69 A;  3J06 A;  2DGJ A;  1AUE A;  2HKV A;  2XM0 A;  1J8M F;  3VF0 A;  3JRM O;  3HNI A;  5EGY A;  4DVY P;  5CIV A;  4IGG A;  2H7V C;  2YQY A;  3SXM A;  3SEO A;  2DI3 A;  2KW3 C;  3LJB A;  4G0H A;  4BJ6 C;  1ZU5 A;  4YWQ A;  5DLJ A;  1LE4 A;  2PFD A;  2QUP A;  5CI9 A;  3RQG A;  4EKW A;  1YYX A;  1ZHZ A;  2IBF A;  4XEV A;  3U3B A;  5FCL A;  1JAF A;  2I15 A;  3JZ0 A;  2HZ8 A;  5KYW A;  4LLC A;  3UGP A;  4GQH A;  3G4X A;  4MVZ A;  3S28 A;  2UUI A;  2NUT B;  5L0F A;  5B3I A;  1YAU O;  2OEX A;  3JTL O;  3AGT A;  5A6B A;  3EJN A;  1ZZP A;  1NZE A;  1KU2 A;  3KKB A;  1JPJ A;  4U5F E;  2OG2 A;  4NC3 A;  2IXM A;  3DMD A;  3NKD A;  3DI5 A;  1JPN A;  2LD6 A;  2A1D D;  4Q7C A;  4PJJ A;  4BJ1 A;  3EZI A;  4Z9I A;  1G8X A;  1N1C A;  1Q0G A;  2E87 A;  2GDC A;  3O10 A;  1FAP B;  4RDA A;  3GM3 A;  3T6B A;  2J9U A;  3C63 A;  4CDA A;  3ASN C;  2JD3 A;  2DYS C;  3R7C A;  2HUJ A;  4EBJ A;  3EH1 A;  2PF4 E;  3ABM C;  4IAO A;  2PX0 A;  4CDY A;  2XLH A;  1M2O A;  5FZT A;  2WVN A;  2PBE A;  2VCB A;  5T3W A;  3ASO C;  1FFH A;  2VH3 A;  1YA7 O;  5DS4 A;  1YZC A;  2W45 A;  2KGO A;  2KNH A;  1WAS A;  2LFD A;  1BR1 A;  3AQB A;  3KL4 A;  5T1D B;  3S27 A;  3DM9 B;  4BJ5 A;  4CIP A;  5IY5 C;  1RMV A;  5DS5 A;  4U5C E;  3POV A;  1QLE C;  1PV3 A;  3ZQY A;  3LEO A;  2FGY A;  2IXO A;  1NLX A;  3L8I A;  4XTK A;  2YLG A;  1NFN A;  1VLT A;  4U5H A;  4C3B A;  4CJG A;  3K6B A;  5KYN A;  1VYI A;  5AC5 A;  2CGE A;  2AWC A;  3FOO A;  1GS9 A;  3RFY A;  1CGM E;  5COF A;  1EQ1 A;  5BQH A;  2ETS A;  4MTF A;  4XEK A;  3L0I A;  2JX0 A;  4C3D A;  4M63 A;  1D1A A;  2CYD A;  1QVX A;  2HSQ A;  3AG3 C;  1VOM A;  3O39 A;  1LPE A;  1RKE A;  3ATP A;  3IQ6 A;  4JTC B;  5CI8 A;  1T01 A;  3L34 A;  2XLD A;  2L7A A;  5L0J A;  4MTO A;  4EWC A;  3FXH A;  4LDR A;  2V26 A;  4FAP B;  1U89 A;  3LNR A;  2LQG A;  4KNW A;  3SXY A;  2A68 F;  1H6G A;  3I4U A;  4PAC A;  3T6G B;  4AE4 A;  1CPQ A;  1BZ4 A;  1NU7 D;  1RCP A;  2J9B A;  2WZL A;  3EG9 B;  3I5P A;  1F1M A;  1KTM A;  2LIG A;  4WGY A;  3B0P A;  3QVY A;  4QDL A;  2YRF A;  3RQE A;  3EFO A;  5TJ5 E;  1GM5 A;  3OWT A;  4BJT A;  4CBE A;  3DXJ F;  4MVS A;  5KYX A;  1V55 C;  4N6C A;  3C8G B;  3ZC4 A;  4BJ5 C;  3HTK C;  1U6H A;  4YJW A;  3KMI A;  4EBK A;  3B29 A;  2Q9B A;  3DJU B;  5EK0 A;  4J7Y A;  3V7O A;  1YAR O;  1BR2 A;  3US6 A;  3PDM P;  1TWA A;  1TFO B;  1APC A;  2VCC A;  2YZS A;  2ZXW C;  3TQO A;  4NCQ A;  2WVO A;  2NSG A;  3OEO A;  1KNY A;  2C03 A;  3L8J A;  1C02 A;  4HE8 D;  3VYW A;  3DKA A;  1JR8 A;  2XL6 A;  3B71 A;  4H54 A;  3DE8 A;  2R7O A;  2EIM C;  3FAP B;  4WGZ A;  3RW0 A;  3SP1 A;  5AC4 A;  3FDQ A;  3LLK A;  4YT5 A;  4FES A;  4E0I A;  3EGD A;  1G4W R;  3SZR A;  1JOG A;  4KI2 A;  1QQ3 A;  5D92 A;  3U5S A;  2NG1 A;  5JT4 A;  3B9Q A;  5GPG B;  4U5B E;  2WZG A;  3UNG C;  4IRU A;  2R02 A;  3MLG A;  2JPU A;  4CS7 A;  4IJJ A;  4QI0 A;  5JLI A;  2R7V A;  1D0X A;  3QW1 A;  4CJO A;  2GWW A;  4XPW A;  3N24 A;  2WVQ A;  4JRZ A;  5A6B D;  3C8Z A;  2J45 A;  1YJG A;  3NMK A;  4N4W A;  5L0H A;  1HMD A;  4G7Z F;  5KYU A;  4D4N A;  2H7O A;  1WTY A;  3EGX B;  1O87 A;  2R7Q A;  3RIP A;  4DRI B;  1ZVZ A;  2YVK A;  3HKK A;  1DOV A;  1MNE A;  1M56 C;  3GOD A;  4JZA A;  3H65 A;  2NUP B;  1VMA A;  1V4A A;  4PJM A;  3ABL C;  2HFI A;  4U5D E;  3KH2 A;  4KBL A;  2AVK A;  3NKE A; 
#chains in the Genus database with same CATH homology
 4RD9 A;  2QY9 A;  5DQZ A;  3SYN A;  3UMH A;  3K7D A;  4DBQ A;  3JRT A;  2IOQ A;  2W4M A;  4DBR A;  2LSE A;  1FMV A;  4OD4 A;  5T3T A;  2H7B A;  2KQ9 A;  2V3C C;  1OCZ C;  2X51 A;  4BEJ A;  1Z23 A;  3ABK C;  3K66 A;  4DVZ A;  2KJG A;  3K33 A;  4I3M A;  2L81 A;  2WL8 A;  4JJF A;  4F4B A;  3T6J A;  2R7X A;  2PX3 A;  4CSA A;  1TWC A;  3EHN A;  4CS9 A;  4MQ9 F;  2R7R A;  5E3A A;  2Y3G A;  3E9V A;  4O6N A;  3PHF 2;  2XXA A;  3JT1 A;  2WB7 A;  2A69 F;  3EPV A;  3OA1 A;  2VB6 A;  4AK9 A;  4HFF B;  2ZPA A;  4OIR F;  1Z63 A;  1TWH A;  1Z5Z A;  3EZH A;  5F5F A;  4JJG A;  2B0J A;  4O6M A;  2PP4 A;  3Q7G A;  5L3V A;  4O7G A;  3S0X A;  5E2Q A;  4BG0 A;  4KNV A;  2R7U A;  1D1B A;  1LVK A;  3K1I C;  3ITF A;  3F47 A;  2MWQ A;  1BR4 A;  1TR2 A;  3LAY A;  1MMN A;  5DVW A;  3HJC A;  2M4E A;  5B3S C;  5EHH A;  4CS9 C;  4GYT A;  2G3V A;  4AE4 B;  1WGW A;  3W2W A;  4LER A;  2BE5 F;  2W4B A;  2XSE A;  3CZ6 A;  2IXP A;  4U5G A;  4C7O A;  3IEE A;  2YHS A;  3X1O A;  2CDQ A;  4J30 B;  4ZLC A;  3N2Z B;  2XL4 A;  5B1A C;  5DS6 A;  3EQL F;  5E3C A;  4N06 A;  5L3Q A;  4I1O B;  4XLN F;  2J9V A;  4QI2 A;  1O5H A;  3EGD B;  1FTS A;  4EBB A;  1ZHX A;  1MMD A;  3LEV A;  3FVY A;  2EIL C;  1M2V B;  5KYY B;  1RJ9 A;  1TKN A;  2EIK C;  4YN0 B;  1VK5 A;  4JVS A;  2G62 A;  2P7V A;  2WZF A;  1D0Y A;  4OIO F;  3RKO F;  5BUO A;  1LKX A;  3DJN B;  3S29 A;  2EIJ C;  2O9X A;  4Q5S F;  4GEH A;  3JCU Q;  3N0T A;  3M1C B;  3JYH A;  4X0R A;  5E33 A;  4ZLD A;  3Q6M A;  1Z3I X;  2J46 A;  1LS1 A;  4CS8 A;  4KC9 A;  3DAF A;  4FX5 A;  1ZYR F;  4W8K A;  4JCH A;  3CSK A;  3UMK A;  2CW0 F;  5HSW A;  4OIP F;  4C3E A;  4O6Y A;  4CIH A;  2XRH A;  2R7S A;  1M57 C;  5KYW B;  4FWV A;  4K7B A;  3E70 C;  3ZG1 A;  3DM5 A;  2EIN C;  4PJL A;  4H4K C;  1NG1 A;  2R7T A;  3FHD A;  1J8Y F;  1MMG A;  3Q7L A;  3EGX A;  2A6E F;  2XXA B;  1FMW A;  2CNW D;  4PK4 A;  2G3K A;  2GFH A;  3PMR A;  3UGO A;  1NU9 C;  2NUP A;  3CQZ A;  1IW7 F;  2ZXO A;  3SNH A;  4PFP A;  1D1C A;  1V54 C;  3WOD F;  3I5Q A;  1PD0 A;  3QZC A;  2QTV A;  3LLI A;  3QMK A;  3NRH A;  4CS8 C;  4K0D A;  1ZHY A;  1ZHT A;  2Q3T A;  4HFK B;  3HLZ A;  4YT8 A;  1TWG A;  4PJN A;  3AQC A;  3EH2 A;  3MX3 A;  3AG1 C;  3Q6N A;  4YT2 A;  2NUT A;  2J9W A;  4E7Z A;  3ZSU A;  4RBN A;  1PCX A;  4U5E E;  4XLP F;  2J7P D;  4P6I C;  3DZA A;  1ZU4 A;  4J32 B;  3W8I A;  4Q4Z F;  2CNW A;  1OCO C;  3ECS A;  3DD7 A;  1IZM A;  2ZXR A;  4LAC B;  3JSZ A;  3TD7 A;  4CSA C;  4C7O B;  2ZXP A;  4IWB A;  3GAN A;  1ZHW A;  2HV7 A;  2R7W A;  2IYL D;  3FAJ A;  3LS0 A;  3EFO B;  3DAG A;  5KYX B;  4OIQ F;  2Q9C A;  4LLE A;  1MND A;  4G7O F;  1W2W A;  4ANJ A;  4E7S A;  1OCR C;  3B0U X;  4JUR I;  3X2Q C;  2J7P A;  4AX2 A;  3NYM A;  5B1B C;  2J0W A;  2Y39 A;  1RJ9 B;  4PFO A;  2HV6 A;  3NYL A;  5D91 A;  1MMA A;  4HEA J;  1S7Z A;  2DYR C;  2P6V A;  2OCC C;  2VAS A;  2W9Y A;  3AG2 C;  1OCC C;  4OD5 A;  3UR3 C;  1FFT C;  2I8B A;  3EHM A;  3ZIB A;  2L9J A;  3W8H A;  1QZX A;  1ST6 A;  3LS1 A;  4A2N B;  5KYU B;  3EG9 A;  4XWJ A;  3F46 A;  3NG1 A;  5EGY A;  4MND A;  1OKK D;  2IXN A;  4G7H F;  2Y69 C;  4I44 A;  4BJ6 A;  2MYS A;  4YT4 A;  4NY3 A;  5F5H A;  2Y3B A;  3VAY A;  4DOZ A;  2Z15 A;  1Z6A A;  2D5R B;  4JW1 A;  2C04 A;  2Y3H A;  1M2V A;  2J0X A;  3RYL A;  5KYY A;  3ZVR A;  3LES A;  5DQT A;  2YEV A;  2Y3D A;  1SMY F;  4WJ0 A;  1PD1 A;  3NYJ A;  1D0Z A;  4B6I A;  4I1M A;  3NDB B;  4ULW A;  1SZI A;  1SF8 A;  3T4R A;  1VYK A;  4O79 A;  3AG4 C;  3K1H A;  2FFH A;  3B0V C;  1OKK A;  3RH3 A;  3O6X A;  3W2V A;  3UMI A;  4OIN F;  2A6H F;  3WG7 C;  2Q9A A;  2DGJ A;  1J8M F;  4DVY P;  2H7V C;  3SEO A;  3LJB A;  2KW3 C;  4G0H A;  4BJ6 C;  4YWQ A;  1ZU5 A;  5DLJ A;  2PFD A;  5CI9 A;  1ZHZ A;  5FCL A;  3UGP A;  5KYW A;  4LLC A;  3S28 A;  2NUT B;  3EJN A;  1NZE A;  1KU2 A;  3KKB A;  1JPJ A;  4U5F E;  2OG2 A;  2IXM A;  3DMD A;  3NKD A;  1JPN A;  2A1D D;  4Q7C A;  4PJJ A;  4BJ1 A;  3EZI A;  1G8X A;  1N1C A;  2E87 A;  3T6B A;  4RDA A;  2J9U A;  3ASN C;  2JD3 A;  2DYS C;  3EH1 A;  2PF4 E;  3ABM C;  4IAO A;  2PX0 A;  1M2O A;  2WVN A;  5T3W A;  3ASO C;  1FFH A;  2VH3 A;  5DS4 A;  2W45 A;  4CBE A;  2KGO A;  2KNH A;  3AQB A;  3KL4 A;  1BR1 A;  5T1D B;  3S27 A;  4BJ5 A;  5IY5 C;  3DM9 B;  5DS5 A;  4U5C E;  3POV A;  1QLE C;  2FGY A;  2IXO A;  4XTK A;  4C3B A;  4U5H A;  3K6B A;  5KYN A;  1VYI A;  2CGE A;  3RFY A;  3L0I A;  4C3D A;  4M63 A;  1D1A A;  3AG3 C;  1VOM A;  3O39 A;  5CI8 A;  3L34 A;  4EWC A;  2V26 A;  3LNR A;  4KNW A;  2A68 F;  3I4U A;  4AE4 A;  1NU7 D;  2WZL A;  3I5P A;  3EG9 B;  3B0P A;  4QDL A;  3EFO A;  3OWT A;  4BJT A;  3DXJ F;  5KYX A;  1V55 C;  3ZC4 A;  4BJ5 C;  3HTK C;  4YJW A;  3KMI A;  2Q9B A;  3DJU B;  3V7O A;  1BR2 A;  1TWA A;  2YZS A;  2ZXW C;  2WVO A;  3OEO A;  2C03 A;  4HE8 D;  3VYW A;  2R7O A;  2EIM C;  3SP1 A;  3FDQ A;  3LLK A;  4YT5 A;  4FES A;  3EGD A;  3SZR A;  4KI2 A;  5D92 A;  2NG1 A;  3B9Q A;  4U5B E;  2WZG A;  3UNG C;  4IRU A;  3MLG A;  4CS7 A;  4IJJ A;  4QI0 A;  2R7V A;  1D0X A;  3N24 A;  2WVQ A;  2J45 A;  4G7Z F;  5KYU A;  2H7O A;  3EGX B;  1O87 A;  2R7Q A;  3RIP A;  1MNE A;  1M56 C;  3GOD A;  4JZA A;  3H65 A;  2NUP B;  1VMA A;  4PJM A;  3ABL C;  4U5D E;  3KH2 A;  4KBL A;  3NKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...