2YKZA

Recombinant native cytochrome c prime from alcaligenes xylosoxidans at 0.84 a resolution: restrained refinement
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAVQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2ykzA00
1YYXA 3NMKA 4IB4A 2YLDA 1CGOA 1APCA 3NMIA 3QW0A 3VRCA 3ZQVA 3ZWIA 3HNIA 1QPUA 2CCYA 2XL6A 5JLIA 256BA 5JRAA 1QQ3A 2XLEA 4NC3A 1E86A 1CGNA 1YZCA 5JP7A 1NBBA 4L6RA 3ZTZA 3M79A 1GQAA 1YYJA 4IAQA 5JUAA 1LM3B 3TOMA 2XLOA 5JVEA 2XLHA 4JEAA 3L1MA 2YL1A 1YZAA 2XLMA 3M4CA 3ZQYA 4CIPA 4JE9A 2QLAA 5JSLA 3ZTMA 4CDVA 1EKYA 2YLIA 3IQ6A 2XLDA 2YL0A 3QVZA 4CDYA 4IARA 2YL3A 4N6HA 2XLWA 4CDAA 4D4XA 4EIYA 2YKZA 2XM4A 5JS5A 2XLVA 5B3IA 2YLGA 2XM0A 3C62A 2J8WA 3HNJA 3HNLA 3NMJA 1CPRA 4CJGA 3FOPA 3M4BA 3IQ5A 4JEBA 4U9DA 4ULVA 3FOOA 3C63A 4JKVA 4CX9A 3DE8A 2BC5A 1BBHA 4WGZA 3U8PA 1M6TA 4N4WA 1E84A 4D4NA 4CJOA 5AGFA 1S05A 1JAFA 2XL8A 3QVYA 1RCPA 3QW1A 4WGYA 1CPQA 1A7VA 2J9BA 3M15A 2YL7A 5JT4A 1MQVA 3HNKA 4ER9A 3TOLA 1E85A 4U9EA 3DE9A 1E83A
chains in the Genus database with same CATH superfamily
3QZCA 3V5XA 1YYXA 3EPVA 3NMKA 4IB4A 3NMIA 4GEHA 3VRCA 1R5ID 3ZWIA 3T6BA 4NQFA 4IAOA 1U6HA 2I15A 3JZ0A 4MVUA 2XL6A 1D0XA 1Q0GA 1QVXA 1FNTc 1BZ4A 3EZHA 256BA 2AWYA 5KYXA 2H7OA 4BEJA 2OEXA 4YJWA 1BDJB 1NG1A 3LS0A 2EIJC 4NTFA 2R7WA 3C8GB 3W8HA 2CNWA 2CNWD 4U5EE 1HY5A 4L6RA 3F46A 3DJNB 4G78A 1I5NA 2NPUA 1MMGA 3B0PA 4LLCA 2Q7RA 3M79A 3G50A 2B0HA 3H65A 4EWCA 3S28A 2WZGA 3RF3A 4IAQA 3KYIA 2G3KA 3DM5A 1H9GA 3DAGA 4LDRA 4LDQA 4MTOA 4BJTA 2QE9A 3C8GA 3C8GD 2D4UA 4MVRA 4BJ5A 5JVEA 2ZXRA 4JEAA 5L0DA 2Q00A 2YL1A 1KU2A 2O9XA 2W9YA 3U2MA 2L7AA 2VB6A 3DKAA 3DJUB 5D92A 1WATA 2IXPA 2OCCC 2PNOA 4GQHA 4JW1A 4MQ9F 2L9JA 4CDVA 4AE4B 3RFYA 1EKYA 4HFKB 4NY3A 4OD5A 3I5QA 3RVYA 1SZIA 5KYUB 4XEKA 3T9OA 2KSFA 1ZW3A 1M57C 3DZAA 1OR2A 4N6HA 4FWVA 4I44A 1RKCA 2R9RB 2P7VA 1TQGA 4XWJA 4BEMJ 1FMVA 4O6YA 3K1IA 2A0BA 2WL8A 3EZIA 1DOVA 5JS5A 3LEVA 5A6BA 5A6BD 2XLVA 2IM8A 3JYHA 3GODA 3GM1A 2PX0A 3ITFA 2ICWG 2KQ9A 3GWLA 4JRZA 5T3WA 4AX2A 4DRJB 4PACA 2XS1A 4CIHA 3MYIA 4AL0A 3PHF2 1OKKD 1OKKA 3AG3C 4MW3A 4PJJA 1VLTA 3T6JA 1KTMA 1LE2A 3FOPA 3M4BA 1PV3A 2R7QA 5KYNA 5F5FA 3V5ZA 4MNDA 2FGYA 2HS5A 3SXMA 1Z23A 4JKVA 2MHRA 1OW6A 1YVIA 3EG9B 4Z9HA 3LESA 3V7OA 4CX9A 3AG4C 2IBFA 1WN0A 4WGZA 3DWWA 1NU9C 4DJ9A 5IY5C 3UMIA 3ZDLA 1E84A 2R03A 3TD7A 4CJOA 5CI9A 4KNWA 2J9VA 3I4UA 3LJBA 3IPMO 2J45A 2VC9A 1Q0MA 3EFOB 2DYSC 4QDLA 2C04A 3ECSA 1QKRA 3QW1A 4JTAB 2JD3A 4BJ6C 1CPQA 2HUJA 4MW8A 1A7VA 4DVYP 1QZXA 1CGME 2VH3A 2LD6A 3M15A 3EG9A 1H7IA 4EBBA 2JPUA 1UG7A 1A7DA 2OJQA 3M1CB 1BR2A 1J8MF 3JRMO 1DOWA 1D1CA 1LPEA 2LFDA 2OG2A 3DI5A 1ZHYA 3EGDA 3NYMA 2XL4A 2YLDA 3HLZA 1APCA 4HE8D 1I4YA 4NCQA 3HNIA 3T6GB 1BR1A 5AC4A 3IQTA 1N1CA 3G4XA 2CCYA 4EHPA 5DLJA 1RJ9B 2NUTB 4BPMA 5KYYA 1J8YF 4DVZA 2P6VA 2HMQA 4NC3A 2R7XA 4A4AA 2WZFA 1QSPA 1M2OA 2XSEA 4E7ZA 1D0YA 4FX5A 2NUPB 4CS8C 2R7UA 5CI8A 3C18A 5JP7A 1Z6AA 4XTKA 1O87A 4XPXA 4JTCB 3BRJA 2PF4E 1L7CA 2VCAA 2Y3DA 5AC5A 3VYWA 4CS9A 2P1AA 4MTFA 4DRIB 1OXKA 1GQAA 3KPHA 1IZMA 2R05A 1YYJA 3U9JA 3MFNA 2NSGA 4PFOA 1FTSA 2EILC 1V54C 5TJ5E 2EPNA 1E2XA 3K66A 3N24A 3X1OA 5A6JA 2R7TA 1W2WA 3TOMA 2H8AA 3CQZA 2ASRA 2FAPB 5L0CA 1HW1A 3QMKA 2GAQA 4DBRA 1A41A 3TQOA 2OQMA 3L1MA 1F1MA 3RQFA 5DS4A 1ZYRF 5BQIA 2CDQA 2V3CC 1H6GA 2RSEB 2MYSA 3E9VA 3CEXA 4PK4A 2J9WA 1YA9A 2QLAA 3OEOA 4YL1A 4OINF 3FDQA 1HMDA 1VMAA 3O39A 2XXAB 3NDBB 5B1AC 3U0CA 3ZTMA 1R4TA 3TJ5A 2YLIA 3TJ6A 3S9OA 2UUHA 2GA0A 4CDYA 4QI2A 4IARA 3O55A 3SYNA 4G7HF 1O3UA 1TFKB 3LUTB 4XQ1A 2HV6A 1Z7Qc 3G4ZA 4O6MA 2LFFA 5K0IA 3AJMA 3CAXA 4KI2A 4E7SA 3PDMP 1Z5ZA 2EIKC 2ZPAA 3UR3C 3A11A 2OOCA 2RD9A 2J9UA 2IYLD 2OJED 3K33A 1MMDA 5BQHA 1ZHXA 4I1MA 3LEOA 2YLGA 3GORA 4JJFA 4OD4A 1HE9A 1T6QA 5E33A 2VASA 3TOLA 2Y39A 2J8WA 2Y69C 1RKEB 4CSAA 1HMOA 3RW0A 2A0UA 3W2WA 3WODF 3WG7C 1CPRA 4CJGA 3C7JA 4IWBA 4YL3A 4JEBA 2L6FA 2XS8A 4ANJA 2HZ8A 5L0IA 4OIOF 1OQCA 4J7TA 2Y3HA 3FXHA 3JSZA 1G5ZA 3MBGA 1K05A 2BC5A 2D5RB 3JSEO 4XLNF 1HE1A 1SMYF 1Y6DA 5COMA 2NG1A 2AVKA 1M6TA 1RMVA 5GPGB 4D4NA 3HKKA 1OCRC 3EH2A 4O79A 5AGFA 3MLGA 1XWJA 2WB7A 3GWNA 3KMIA 4KC9A 4X0RA 4YN0B 4K7BA 3EHMA 1JPNA 3W2VA 1EI7A 3RVZA 1C03A 1G4US 1RCPA 2HJMA 2JX0A 2R7SA 2WVOA 1ORJA 2HV7A 2GWWA 2G3VA 4JTDB 1ZHZA 2C03A 3AG2C 1ZW2A 3JCUQ 4WGYA 4Q7CA 3EGXB 3FAPB 5KYUA 4BJ5C 4XPWA 1IW7F 1NFOA 3RYLA 4EBJA 2A1DD 3UGPA 2YWAA 1QLEC 5A69A 3RIPA 3ZC4A 4GYTA 2R25A 3V5YA 3LLKA 1AVOB 1U0BB 1E85A 5EHHA 1OR3A 4U9EA 4EUKB 1Q0FA 3PMRA 3WAQA 2Q9BA 3GANA 1CGOA 2J7PD 2J7PA 2KYHA 1K04A 3QW0A 2NSFA 5COFA 1B68A 3VM6A 2HMZA 3DAFA 1QPUA 3CSKA 4G7OF 4BG0A 1FR0A 3UGOA 3O10A 3LS1A 4E17A 1LE4A 5T1DB 1YA7O 1XZQA 3AG1C 2PP4A 5EGYA 1ZZPA 1SR2A 3LNRA 2LP4A 1T6UA 1QQ3A 4A2NB 4ZLCA 5L3QA 1VTMP 3B9QA 3SXZA 2XLEA 3K1IC 4J7YA 1TR2A 2E87A 4PJMA 4W8KA 2EPMX 3U3FA 3KKBA 1SYQA 1YAUO 2AWCA 4J32B 3EH1A 3E70C 1CGNA 4AL1A 1E86A 4CS7A 1YZCA 3N2ZB 2IOQA 1YARO 5T3TA 4C3EA 4C7OB 4E18A 1VYIA 3LAYA 4YWQA 4YT2A 2DI3A 4OIQF 3L8JA 3AQBA 4JCHA 1M2VB 3O6XA 4PFPA 2F22A 4OIRF 2QUPA 4XLPF 3NYLA 4CBEA 4F4BA 4LLEA 3R2PA 2HSQA 3EFOA 4MTGA 1WOLA 3B29A 3X2QC 2A6HF 4CIPA 4EKWA 4JC7A 2BE5F 2A69F 1V55C 5JUAA 1PD1A 2VCBA 1ORYA 4U5DE 4G7ZF 3KYJA 2XLOA 4IRUA 1ZU4A 3NRHA 3K6BA 4IGGA 4C7OA 1Y4CA 2BL2A 1WASA 1YZAA 2XLMA 1V4AA 2H7VC 3M4CA 2G62A 1M2VA 2DGJA 2GFHA 2EPKX 2KNHA 2X0CA 5CIVA 3RH3A 1Q0KA 3FMSA 4YT5A 1OCCC 1NSGB 1U89A 2R02A 5JSLA 3US6A 3SXKA 3J06A 1FMWA 2CYDA 5D91A 4R32A 1LKXA 1VLSA 3F47A 4NTBA 5EK0A 2XLDA 2YL0A 3ABMC 1O5HA 3EJNA 3Q6NA 3H2UA 2YVKA 3R7CA 1FAPB 4OIPF 2KC3A 4MVOA 1Z3IX 3IHUA 2KJGA 3K7DA 2YL3A 2XLWA 4CDAA 1VK5A 1RJ9A 3FHDA 2NUTA 2Q9CA 1S7ZA 1FFHA 2YKZA 3LNMB 2DB4A 3ZSUA 1JPJA 2LIGA 2HFIA 2I8BA 1UFBA 1RXQA 1JR8A 3ABKC 4LDKA 2NUPA 2P61A 2W4BA 3JT1A 1OW7A 3UNGC 1BR4A 2ETSA 1G4WR 5BQGA 1G8XA 1JOGA 1NLXA 3LLIA 4JZAA 3ATPA 4NTAA 4ZLDA 3C62A 4YT4A 3IEEA 5DVWA 4C3DA 2EINC 5HV9A 3DM9B 1K40A 3K1HA 2R7OA 2ZD9A 2QY9A 5KYXB 3NMJA 4Q4ZF 3SZRA 3S27A 2H7BA 3U2LA 4U9DA 4YL0A 1VYKA 3NKEA 4ULVA 1EQ1A 2KW3C 2WVQA 3Q7GA 2LQGA 2M4EA 2MWQA 3JRTA 1PCXA 4YK5A 2R7VA 4G0HA 2LCHA 3NKDA 2AU5A 3DE8A 2EIMC 1TWGA 3JTLO 1BBHA 2HJ3A 3SNHA 1LI7A 1TKNA 3L8IA 2IXMA 2LSEA 2QTVA 4MVSA 1ST6A 4N4WA 2ZXOA 2Y3GA 4O6NA 4CS9C 1S05A 1JAFA 5A6KA 4PR9A 5HSWA 2XXAA 3KL4A 1TWCA 3MYFA 1EA8A 1D1AA 3JYYA 3RQGA 4J30B 1SF8A 5B1BC 1ORSC 4WABA 2J9BA 5DQZA 2YZSA 4XPYA 1LIHA 1NU7D 2YL7A 4JCZA 5JT4A 2YHSA 3NG1A 3ZG1A 3ZVRA 1T01A 4PJNA 4B6IA 4DBQA 3FVYA 2Q9AA 1D1BA 5B3SC 1AUEA 1A0BA 3U5SA 1PD0A 3U8VA 5L3VA 3DE9A 3HJCA 1E83A 4MS2A 1V74B 1WGWA 2Q4FA 3B0VC 3UMHA 2L6HA 1WWPA 1C02A 1TWAA 1OCOC 3ZQVA 5E3AA 1TFOB 4I3MA 2CW0F 1T6IA 1KNYA 2Z15A 5JLIA 2TMVP 1LVKA 4C3BA 4DOZA 1RKEA 2M64A 1ZVZA 5JRAA 1OXBA 2PX3A 2CGEA 4AE4A 2ZXPA 5DS6A 3GEEA 3GEHA 1GM5A 3CZ6A 4U5HA 3A9CA 1WTYA 4U5BE 4JJGA 4JIOA 2LK4A 2XRHA 3S84A 4YT8A 3TULA 3EQLF 4RBNA 3DXJF 5F5HA 3BEHA 1T9KA 4BJ1A 1NBBA 2HSBA 3AOUA 3MX3A 4MVMA 3EHNA 3U9MA 3ZTZA 1OCZC 2EPOA 3Q6MA 3IQCA 4K0DA 2DYRC 4CSAC 4Q5SF 4W8PA 1YJGA 5DQTA 4P9FA 2Q3TA 4N6CA 1MMAA 4Z9IA 1YDIA 1ZU5A 4RD9A 4XEVA 2PFDA 3SXYA 3U3BA 4BJ6A 3QTHA 1L3PA 4H4KC 1LM3B 4ONSA 2J0WA 3EGXA 4LERA 3ASNC 2X51A 2WZLA 3C8ZA 4JVSA 3GEIA 4WJ0A 3GM2A 4U5GA 1M56C 5E3CA 2P0NA 3AGUA 2OEVA 1GS9A 3ZQYA 2OU6A 4JE9A 4MVZA 5F28E 3UMKA 3ZIBA 4AK9A 4QI0A 3B71A 5KYWB 4KBLA 1MMNA 5L0FA 1I4ZA 2UUIA 5FZTA 4UDVA 3IQ6A 4JURI 1OW8A 4EBKA 3QVZA 1FFTC 3S90A 1H9TA 3HTKC 4U5CE 3NYJA 4I1OB 1ZHWA 2YRFA 4N06A 4D4XA 1VB5A 2R7RA 2V26A 4FESA 3FAJA 4H54A 4EIYA 3T4RA 2A68F 2WVNA 2J0XA 2XM4A 4DRHB 1NFNA 4E0HA 4HFFB 2B0JA 3EGDB 3W8IA 5KYWA 2KK1A 3Q7LA 4DXWA 4CS8A 2YQYA 3AQCA 2PBEA 3L34A 4E0IA 3VF0A 3L0IA 1T5OA 5B3IA 3RQEA 4IJJA 1LI5A 4U5FE 2L81A 3S0XA 2XM0A 5FCLA 4ULWA 1Z63A 4MVQA 3B0UX 5A6AA 2W45A 1XZPA 2EPLX 3GM3A 3HNJA 2GDCA 3HNLA 1TWHA 1AEPA 5L0JA 1JMWA 5BUOA 5KYYB 4P6IC 1MNDA 2IXOA 3DD7A 3IQ5A 2Y3BA 1A7EA 3KH2A 5COGA 3FOOA 3RKOF 1JRAA 5E2QA 3SEOA 5L0HA 3C63A 4P9TA 2YEVA 2OKUA 3SP1A 4PJLA 3AGTA 3I5PA 1MNEA 4LACB 3U8PA 2ZXWC 3W4YA 1Q0DA 4Z9JA 4RDAA 3S29A 2HKVA 2J46A 3VAYA 3H2VA 2XL8A 1YLMA 3ASOC 3TK0A 2QNLA 3QVYA 2A6EF 2FFHA 1VOMA 2L6GA 1D0ZA 4K1OA 4M63A 1HW2A 2W4MA 3N0TA 5DS5A 3OA1A 3OWTA 4XEFA 3ABLC 2KGOA 3PCVA 3WHNA 2AP3A 1MQVA 3HNKA 1LS1A 3DMDA 1LS4A 1NZEA 1GGQA 4FAPB 4ER9A 4HEAJ 3POVA 1C17M 2IXNA 4KNVA 2VCCA 5L0GA 4O7GA 2XLHA 1ZHTA
chains in the Genus database with same CATH topology
1YYXA 3NMKA 4IB4A 2YLDA 1CGOA 1APCA 3NMIA 3QW0A 3VRCA 3ZQVA 3ZWIA 3HNIA 1QPUA 2CCYA 2XL6A 5JLIA 256BA 5JRAA 1QQ3A 2XLEA 4NC3A 1E86A 1CGNA 1YZCA 5JP7A 1NBBA 4L6RA 3ZTZA 3M79A 1GQAA 1YYJA 4IAQA 5JUAA 1LM3B 3TOMA 2XLOA 5JVEA 2XLHA 4JEAA 3L1MA 2YL1A 1YZAA 2XLMA 3M4CA 3ZQYA 4CIPA 4JE9A 2QLAA 5JSLA 3ZTMA 4CDVA 1EKYA 2YLIA 3IQ6A 2XLDA 2YL0A 3QVZA 4CDYA 4IARA 2YL3A 4N6HA 2XLWA 4CDAA 4D4XA 4EIYA 2YKZA 2XM4A 5JS5A 2XLVA 5B3IA 2YLGA 2XM0A 3C62A 2J8WA 3HNJA 3HNLA 3NMJA 1CPRA 4CJGA 3FOPA 3M4BA 3IQ5A 4JEBA 4U9DA 4ULVA 3FOOA 3C63A 4JKVA 4CX9A 3DE8A 2BC5A 1BBHA 4WGZA 3U8PA 1M6TA 4N4WA 1E84A 4D4NA 4CJOA 5AGFA 1S05A 1JAFA 2XL8A 3QVYA 1RCPA 3QW1A 4WGYA 1CPQA 1A7VA 2J9BA 3M15A 2YL7A 5JT4A 1MQVA 3HNKA 4ER9A 3TOLA 1E85A 4U9EA 3DE9A 1E83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYX A;  3NMK A;  4IB4 A;  2YLD A;  1CGO A;  1APC A;  3NMI A;  3QW0 A;  3VRC A;  3ZQV A;  3ZWI A;  3HNI A;  1QPU A;  2CCY A;  2XL6 A;  5JLI A;  256B A;  5JRA A;  1QQ3 A;  2XLE A;  4NC3 A;  1E86 A;  1CGN A;  1YZC A;  5JP7 A;  1NBB A;  4L6R A;  3ZTZ A;  3M79 A;  1GQA A;  1YYJ A;  4IAQ A;  5JUA A;  1LM3 B;  3TOM A;  2XLO A;  5JVE A;  2XLH A;  4JEA A;  3L1M A;  2YL1 A;  1YZA A;  2XLM A;  3M4C A;  3ZQY A;  4CIP A;  4JE9 A;  2QLA A;  5JSL A;  3ZTM A;  4CDV A;  1EKY A;  2YLI A;  3IQ6 A;  2XLD A;  2YL0 A;  3QVZ A;  4CDY A;  4IAR A;  2YL3 A;  4N6H A;  2XLW A;  4CDA A;  4D4X A;  4EIY A;  2YKZ A;  2XM4 A;  5JS5 A;  2XLV A;  5B3I A;  2YLG A;  2XM0 A;  3C62 A;  2J8W A;  3HNJ A;  3HNL A;  3NMJ A;  1CPR A;  4CJG A;  3FOP A;  3M4B A;  3IQ5 A;  4JEB A;  4U9D A;  4ULV A;  3FOO A;  3C63 A;  4JKV A;  4CX9 A;  3DE8 A;  2BC5 A;  1BBH A;  4WGZ A;  3U8P A;  1M6T A;  4N4W A;  1E84 A;  4D4N A;  4CJO A;  5AGF A;  1S05 A;  1JAF A;  2XL8 A;  3QVY A;  1RCP A;  3QW1 A;  4WGY A;  1CPQ A;  1A7V A;  2J9B A;  3M15 A;  2YL7 A;  5JT4 A;  1MQV A;  3HNK A;  4ER9 A;  3TOL A;  1E85 A;  4U9E A;  3DE9 A;  1E83 A; 
#chains in the Genus database with same CATH topology
 3QZC A;  3V5X A;  1YYX A;  3EPV A;  3NMK A;  4IB4 A;  3NMI A;  4GEH A;  3VRC A;  1R5I D;  3ZWI A;  3T6B A;  4NQF A;  4IAO A;  1U6H A;  2I15 A;  3JZ0 A;  4MVU A;  2XL6 A;  1D0X A;  1Q0G A;  1QVX A;  1FNT c;  1BZ4 A;  3EZH A;  256B A;  2AWY A;  5KYX A;  2H7O A;  4BEJ A;  2OEX A;  4YJW A;  1BDJ B;  1NG1 A;  3LS0 A;  2EIJ C;  4NTF A;  2R7W A;  3C8G B;  3W8H A;  2CNW A;  2CNW D;  4U5E E;  1HY5 A;  4L6R A;  3F46 A;  3DJN B;  4G78 A;  1I5N A;  2NPU A;  1MMG A;  3B0P A;  4LLC A;  2Q7R A;  3M79 A;  3G50 A;  2B0H A;  3H65 A;  4EWC A;  3S28 A;  2WZG A;  3RF3 A;  4IAQ A;  3KYI A;  2G3K A;  3DM5 A;  1H9G A;  3DAG A;  4LDR A;  4LDQ A;  4MTO A;  4BJT A;  2QE9 A;  3C8G A;  3C8G D;  2D4U A;  4MVR A;  4BJ5 A;  5JVE A;  2ZXR A;  4JEA A;  5L0D A;  2Q00 A;  2YL1 A;  1KU2 A;  2O9X A;  2W9Y A;  3U2M A;  2L7A A;  2VB6 A;  3DKA A;  3DJU B;  5D92 A;  1WAT A;  2IXP A;  2OCC C;  2PNO A;  4GQH A;  4JW1 A;  4MQ9 F;  2L9J A;  4CDV A;  4AE4 B;  3RFY A;  1EKY A;  4HFK B;  4NY3 A;  4OD5 A;  3I5Q A;  3RVY A;  1SZI A;  5KYU B;  4XEK A;  3T9O A;  2KSF A;  1ZW3 A;  1M57 C;  3DZA A;  1OR2 A;  4N6H A;  4FWV A;  4I44 A;  1RKC A;  2R9R B;  2P7V A;  1TQG A;  4XWJ A;  4BEM J;  1FMV A;  4O6Y A;  3K1I A;  2A0B A;  2WL8 A;  3EZI A;  1DOV A;  5JS5 A;  3LEV A;  5A6B A;  5A6B D;  2XLV A;  2IM8 A;  3JYH A;  3GOD A;  3GM1 A;  2PX0 A;  3ITF A;  2ICW G;  2KQ9 A;  3GWL A;  4JRZ A;  5T3W A;  4AX2 A;  4DRJ B;  4PAC A;  2XS1 A;  4CIH A;  3MYI A;  4AL0 A;  3PHF 2;  1OKK D;  1OKK A;  3AG3 C;  4MW3 A;  4PJJ A;  1VLT A;  3T6J A;  1KTM A;  1LE2 A;  3FOP A;  3M4B A;  1PV3 A;  2R7Q A;  5KYN A;  5F5F A;  3V5Z A;  4MND A;  2FGY A;  2HS5 A;  3SXM A;  1Z23 A;  4JKV A;  2MHR A;  1OW6 A;  1YVI A;  3EG9 B;  4Z9H A;  3LES A;  3V7O A;  4CX9 A;  3AG4 C;  2IBF A;  1WN0 A;  4WGZ A;  3DWW A;  1NU9 C;  4DJ9 A;  5IY5 C;  3UMI A;  3ZDL A;  1E84 A;  2R03 A;  3TD7 A;  4CJO A;  5CI9 A;  4KNW A;  2J9V A;  3I4U A;  3LJB A;  3IPM O;  2J45 A;  2VC9 A;  1Q0M A;  3EFO B;  2DYS C;  4QDL A;  2C04 A;  3ECS A;  1QKR A;  3QW1 A;  4JTA B;  2JD3 A;  4BJ6 C;  1CPQ A;  2HUJ A;  4MW8 A;  1A7V A;  4DVY P;  1QZX A;  1CGM E;  2VH3 A;  2LD6 A;  3M15 A;  3EG9 A;  1H7I A;  4EBB A;  2JPU A;  1UG7 A;  1A7D A;  2OJQ A;  3M1C B;  1BR2 A;  1J8M F;  3JRM O;  1DOW A;  1D1C A;  1LPE A;  2LFD A;  2OG2 A;  3DI5 A;  1ZHY A;  3EGD A;  3NYM A;  2XL4 A;  2YLD A;  3HLZ A;  1APC A;  4HE8 D;  1I4Y A;  4NCQ A;  3HNI A;  3T6G B;  1BR1 A;  5AC4 A;  3IQT A;  1N1C A;  3G4X A;  2CCY A;  4EHP A;  5DLJ A;  1RJ9 B;  2NUT B;  4BPM A;  5KYY A;  1J8Y F;  4DVZ A;  2P6V A;  2HMQ A;  4NC3 A;  2R7X A;  4A4A A;  2WZF A;  1QSP A;  1M2O A;  2XSE A;  4E7Z A;  1D0Y A;  4FX5 A;  2NUP B;  4CS8 C;  2R7U A;  5CI8 A;  3C18 A;  5JP7 A;  1Z6A A;  4XTK A;  1O87 A;  4XPX A;  4JTC B;  3BRJ A;  2PF4 E;  1L7C A;  2VCA A;  2Y3D A;  5AC5 A;  3VYW A;  4CS9 A;  2P1A A;  4MTF A;  4DRI B;  1OXK A;  1GQA A;  3KPH A;  1IZM A;  2R05 A;  1YYJ A;  3U9J A;  3MFN A;  2NSG A;  4PFO A;  1FTS A;  2EIL C;  1V54 C;  5TJ5 E;  2EPN A;  1E2X A;  3K66 A;  3N24 A;  3X1O A;  5A6J A;  2R7T A;  1W2W A;  3TOM A;  2H8A A;  3CQZ A;  2ASR A;  2FAP B;  5L0C A;  1HW1 A;  3QMK A;  2GAQ A;  4DBR A;  1A41 A;  3TQO A;  2OQM A;  3L1M A;  1F1M A;  3RQF A;  5DS4 A;  1ZYR F;  5BQI A;  2CDQ A;  2V3C C;  1H6G A;  2RSE B;  2MYS A;  3E9V A;  3CEX A;  4PK4 A;  2J9W A;  1YA9 A;  2QLA A;  3OEO A;  4YL1 A;  4OIN F;  3FDQ A;  1HMD A;  1VMA A;  3O39 A;  2XXA B;  3NDB B;  5B1A C;  3U0C A;  3ZTM A;  1R4T A;  3TJ5 A;  2YLI A;  3TJ6 A;  3S9O A;  2UUH A;  2GA0 A;  4CDY A;  4QI2 A;  4IAR A;  3O55 A;  3SYN A;  4G7H F;  1O3U A;  1TFK B;  3LUT B;  4XQ1 A;  2HV6 A;  1Z7Q c;  3G4Z A;  4O6M A;  2LFF A;  5K0I A;  3AJM A;  3CAX A;  4KI2 A;  4E7S A;  3PDM P;  1Z5Z A;  2EIK C;  2ZPA A;  3UR3 C;  3A11 A;  2OOC A;  2RD9 A;  2J9U A;  2IYL D;  2OJE D;  3K33 A;  1MMD A;  5BQH A;  1ZHX A;  4I1M A;  3LEO A;  2YLG A;  3GOR A;  4JJF A;  4OD4 A;  1HE9 A;  1T6Q A;  5E33 A;  2VAS A;  3TOL A;  2Y39 A;  2J8W A;  2Y69 C;  1RKE B;  4CSA A;  1HMO A;  3RW0 A;  2A0U A;  3W2W A;  3WOD F;  3WG7 C;  1CPR A;  4CJG A;  3C7J A;  4IWB A;  4YL3 A;  4JEB A;  2L6F A;  2XS8 A;  4ANJ A;  2HZ8 A;  5L0I A;  4OIO F;  1OQC A;  4J7T A;  2Y3H A;  3FXH A;  3JSZ A;  1G5Z A;  3MBG A;  1K05 A;  2BC5 A;  2D5R B;  3JSE O;  4XLN F;  1HE1 A;  1SMY F;  1Y6D A;  5COM A;  2NG1 A;  2AVK A;  1M6T A;  1RMV A;  5GPG B;  4D4N A;  3HKK A;  1OCR C;  3EH2 A;  4O79 A;  5AGF A;  3MLG A;  1XWJ A;  2WB7 A;  3GWN A;  3KMI A;  4KC9 A;  4X0R A;  4YN0 B;  4K7B A;  3EHM A;  1JPN A;  3W2V A;  1EI7 A;  3RVZ A;  1C03 A;  1G4U S;  1RCP A;  2HJM A;  2JX0 A;  2R7S A;  2WVO A;  1ORJ A;  2HV7 A;  2GWW A;  2G3V A;  4JTD B;  1ZHZ A;  2C03 A;  3AG2 C;  1ZW2 A;  3JCU Q;  4WGY A;  4Q7C A;  3EGX B;  3FAP B;  5KYU A;  4BJ5 C;  4XPW A;  1IW7 F;  1NFO A;  3RYL A;  4EBJ A;  2A1D D;  3UGP A;  2YWA A;  1QLE C;  5A69 A;  3RIP A;  3ZC4 A;  4GYT A;  2R25 A;  3V5Y A;  3LLK A;  1AVO B;  1U0B B;  1E85 A;  5EHH A;  1OR3 A;  4U9E A;  4EUK B;  1Q0F A;  3PMR A;  3WAQ A;  2Q9B A;  3GAN A;  1CGO A;  2J7P D;  2J7P A;  2KYH A;  1K04 A;  3QW0 A;  2NSF A;  5COF A;  1B68 A;  3VM6 A;  2HMZ A;  3DAF A;  1QPU A;  3CSK A;  4G7O F;  4BG0 A;  1FR0 A;  3UGO A;  3O10 A;  3LS1 A;  4E17 A;  1LE4 A;  5T1D B;  1YA7 O;  1XZQ A;  3AG1 C;  2PP4 A;  5EGY A;  1ZZP A;  1SR2 A;  3LNR A;  2LP4 A;  1T6U A;  1QQ3 A;  4A2N B;  4ZLC A;  5L3Q A;  1VTM P;  3B9Q A;  3SXZ A;  2XLE A;  3K1I C;  4J7Y A;  1TR2 A;  2E87 A;  4PJM A;  4W8K A;  2EPM X;  3U3F A;  3KKB A;  1SYQ A;  1YAU O;  2AWC A;  4J32 B;  3EH1 A;  3E70 C;  1CGN A;  4AL1 A;  1E86 A;  4CS7 A;  1YZC A;  3N2Z B;  2IOQ A;  1YAR O;  5T3T A;  4C3E A;  4C7O B;  4E18 A;  1VYI A;  3LAY A;  4YWQ A;  4YT2 A;  2DI3 A;  4OIQ F;  3L8J A;  3AQB A;  4JCH A;  1M2V B;  3O6X A;  4PFP A;  2F22 A;  4OIR F;  2QUP A;  4XLP F;  3NYL A;  4CBE A;  4F4B A;  4LLE A;  3R2P A;  2HSQ A;  3EFO A;  4MTG A;  1WOL A;  3B29 A;  3X2Q C;  2A6H F;  4CIP A;  4EKW A;  4JC7 A;  2BE5 F;  2A69 F;  1V55 C;  5JUA A;  1PD1 A;  2VCB A;  1ORY A;  4U5D E;  4G7Z F;  3KYJ A;  2XLO A;  4IRU A;  1ZU4 A;  3NRH A;  3K6B A;  4IGG A;  4C7O A;  1Y4C A;  2BL2 A;  1WAS A;  1YZA A;  2XLM A;  1V4A A;  2H7V C;  3M4C A;  2G62 A;  1M2V A;  2DGJ A;  2GFH A;  2EPK X;  2KNH A;  2X0C A;  5CIV A;  3RH3 A;  1Q0K A;  3FMS A;  4YT5 A;  1OCC C;  1NSG B;  1U89 A;  2R02 A;  5JSL A;  3US6 A;  3SXK A;  3J06 A;  1FMW A;  2CYD A;  5D91 A;  4R32 A;  1LKX A;  1VLS A;  3F47 A;  4NTB A;  5EK0 A;  2XLD A;  2YL0 A;  3ABM C;  1O5H A;  3EJN A;  3Q6N A;  3H2U A;  2YVK A;  3R7C A;  1FAP B;  4OIP F;  2KC3 A;  4MVO A;  1Z3I X;  3IHU A;  2KJG A;  3K7D A;  2YL3 A;  2XLW A;  4CDA A;  1VK5 A;  1RJ9 A;  3FHD A;  2NUT A;  2Q9C A;  1S7Z A;  1FFH A;  2YKZ A;  3LNM B;  2DB4 A;  3ZSU A;  1JPJ A;  2LIG A;  2HFI A;  2I8B A;  1UFB A;  1RXQ A;  1JR8 A;  3ABK C;  4LDK A;  2NUP A;  2P61 A;  2W4B A;  3JT1 A;  1OW7 A;  3UNG C;  1BR4 A;  2ETS A;  1G4W R;  5BQG A;  1G8X A;  1JOG A;  1NLX A;  3LLI A;  4JZA A;  3ATP A;  4NTA A;  4ZLD A;  3C62 A;  4YT4 A;  3IEE A;  5DVW A;  4C3D A;  2EIN C;  5HV9 A;  3DM9 B;  1K40 A;  3K1H A;  2R7O A;  2ZD9 A;  2QY9 A;  5KYX B;  3NMJ A;  4Q4Z F;  3SZR A;  3S27 A;  2H7B A;  3U2L A;  4U9D A;  4YL0 A;  1VYK A;  3NKE A;  4ULV A;  1EQ1 A;  2KW3 C;  2WVQ A;  3Q7G A;  2LQG A;  2M4E A;  2MWQ A;  3JRT A;  1PCX A;  4YK5 A;  2R7V A;  4G0H A;  2LCH A;  3NKD A;  2AU5 A;  3DE8 A;  2EIM C;  1TWG A;  3JTL O;  1BBH A;  2HJ3 A;  3SNH A;  1LI7 A;  1TKN A;  3L8I A;  2IXM A;  2LSE A;  2QTV A;  4MVS A;  1ST6 A;  4N4W A;  2ZXO A;  2Y3G A;  4O6N A;  4CS9 C;  1S05 A;  1JAF A;  5A6K A;  4PR9 A;  5HSW A;  2XXA A;  3KL4 A;  1TWC A;  3MYF A;  1EA8 A;  1D1A A;  3JYY A;  3RQG A;  4J30 B;  1SF8 A;  5B1B C;  1ORS C;  4WAB A;  2J9B A;  5DQZ A;  2YZS A;  4XPY A;  1LIH A;  1NU7 D;  2YL7 A;  4JCZ A;  5JT4 A;  2YHS A;  3NG1 A;  3ZG1 A;  3ZVR A;  1T01 A;  4PJN A;  4B6I A;  4DBQ A;  3FVY A;  2Q9A A;  1D1B A;  5B3S C;  1AUE A;  1A0B A;  3U5S A;  1PD0 A;  3U8V A;  5L3V A;  3DE9 A;  3HJC A;  1E83 A;  4MS2 A;  1V74 B;  1WGW A;  2Q4F A;  3B0V C;  3UMH A;  2L6H A;  1WWP A;  1C02 A;  1TWA A;  1OCO C;  3ZQV A;  5E3A A;  1TFO B;  4I3M A;  2CW0 F;  1T6I A;  1KNY A;  2Z15 A;  5JLI A;  2TMV P;  1LVK A;  4C3B A;  4DOZ A;  1RKE A;  2M64 A;  1ZVZ A;  5JRA A;  1OXB A;  2PX3 A;  2CGE A;  4AE4 A;  2ZXP A;  5DS6 A;  3GEE A;  3GEH A;  1GM5 A;  3CZ6 A;  4U5H A;  3A9C A;  1WTY A;  4U5B E;  4JJG A;  4JIO A;  2LK4 A;  2XRH A;  3S84 A;  4YT8 A;  3TUL A;  3EQL F;  4RBN A;  3DXJ F;  5F5H A;  3BEH A;  1T9K A;  4BJ1 A;  1NBB A;  2HSB A;  3AOU A;  3MX3 A;  4MVM A;  3EHN A;  3U9M A;  3ZTZ A;  1OCZ C;  2EPO A;  3Q6M A;  3IQC A;  4K0D A;  2DYR C;  4CSA C;  4Q5S F;  4W8P A;  1YJG A;  5DQT A;  4P9F A;  2Q3T A;  4N6C A;  1MMA A;  4Z9I A;  1YDI A;  1ZU5 A;  4RD9 A;  4XEV A;  2PFD A;  3SXY A;  3U3B A;  4BJ6 A;  3QTH A;  1L3P A;  4H4K C;  1LM3 B;  4ONS A;  2J0W A;  3EGX A;  4LER A;  3ASN C;  2X51 A;  2WZL A;  3C8Z A;  4JVS A;  3GEI A;  4WJ0 A;  3GM2 A;  4U5G A;  1M56 C;  5E3C A;  2P0N A;  3AGU A;  2OEV A;  1GS9 A;  3ZQY A;  2OU6 A;  4JE9 A;  4MVZ A;  5F28 E;  3UMK A;  3ZIB A;  4AK9 A;  4QI0 A;  3B71 A;  5KYW B;  4KBL A;  1MMN A;  5L0F A;  1I4Z A;  2UUI A;  5FZT A;  4UDV A;  3IQ6 A;  4JUR I;  1OW8 A;  4EBK A;  3QVZ A;  1FFT C;  3S90 A;  1H9T A;  3HTK C;  4U5C E;  3NYJ A;  4I1O B;  1ZHW A;  2YRF A;  4N06 A;  4D4X A;  1VB5 A;  2R7R A;  2V26 A;  4FES A;  3FAJ A;  4H54 A;  4EIY A;  3T4R A;  2A68 F;  2WVN A;  2J0X A;  2XM4 A;  4DRH B;  1NFN A;  4E0H A;  4HFF B;  2B0J A;  3EGD B;  3W8I A;  5KYW A;  2KK1 A;  3Q7L A;  4DXW A;  4CS8 A;  2YQY A;  3AQC A;  2PBE A;  3L34 A;  4E0I A;  3VF0 A;  3L0I A;  1T5O A;  5B3I A;  3RQE A;  4IJJ A;  1LI5 A;  4U5F E;  2L81 A;  3S0X A;  2XM0 A;  5FCL A;  4ULW A;  1Z63 A;  4MVQ A;  3B0U X;  5A6A A;  2W45 A;  1XZP A;  2EPL X;  3GM3 A;  3HNJ A;  2GDC A;  3HNL A;  1TWH A;  1AEP A;  5L0J A;  1JMW A;  5BUO A;  5KYY B;  4P6I C;  1MND A;  2IXO A;  3DD7 A;  3IQ5 A;  2Y3B A;  1A7E A;  3KH2 A;  5COG A;  3FOO A;  3RKO F;  1JRA A;  5E2Q A;  3SEO A;  5L0H A;  3C63 A;  4P9T A;  2YEV A;  2OKU A;  3SP1 A;  4PJL A;  3AGT A;  3I5P A;  1MNE A;  4LAC B;  3U8P A;  2ZXW C;  3W4Y A;  1Q0D A;  4Z9J A;  4RDA A;  3S29 A;  2HKV A;  2J46 A;  3VAY A;  3H2V A;  2XL8 A;  1YLM A;  3ASO C;  3TK0 A;  2QNL A;  3QVY A;  2A6E F;  2FFH A;  1VOM A;  2L6G A;  1D0Z A;  4K1O A;  4M63 A;  1HW2 A;  2W4M A;  3N0T A;  5DS5 A;  3OA1 A;  3OWT A;  4XEF A;  3ABL C;  2KGO A;  3PCV A;  3WHN A;  2AP3 A;  1MQV A;  3HNK A;  1LS1 A;  3DMD A;  1LS4 A;  1NZE A;  1GGQ A;  4FAP B;  4ER9 A;  4HEA J;  3POV A;  1C17 M;  2IXN A;  4KNV A;  2VCC A;  5L0G A;  4O7G A;  2XLH A;  1ZHT A; 
#chains in the Genus database with same CATH homology
 1YYX A;  3NMK A;  4IB4 A;  2YLD A;  1CGO A;  1APC A;  3NMI A;  3QW0 A;  3VRC A;  3ZQV A;  3ZWI A;  3HNI A;  1QPU A;  2CCY A;  2XL6 A;  5JLI A;  256B A;  5JRA A;  1QQ3 A;  2XLE A;  4NC3 A;  1E86 A;  1CGN A;  1YZC A;  5JP7 A;  1NBB A;  4L6R A;  3ZTZ A;  3M79 A;  1GQA A;  1YYJ A;  4IAQ A;  5JUA A;  1LM3 B;  3TOM A;  2XLO A;  5JVE A;  2XLH A;  4JEA A;  3L1M A;  2YL1 A;  1YZA A;  2XLM A;  3M4C A;  3ZQY A;  4CIP A;  4JE9 A;  2QLA A;  5JSL A;  3ZTM A;  4CDV A;  1EKY A;  2YLI A;  3IQ6 A;  2XLD A;  2YL0 A;  3QVZ A;  4CDY A;  4IAR A;  2YL3 A;  4N6H A;  2XLW A;  4CDA A;  4D4X A;  4EIY A;  2YKZ A;  2XM4 A;  5JS5 A;  2XLV A;  5B3I A;  2YLG A;  2XM0 A;  3C62 A;  2J8W A;  3HNJ A;  3HNL A;  3NMJ A;  1CPR A;  4CJG A;  3FOP A;  3M4B A;  3IQ5 A;  4JEB A;  4U9D A;  4ULV A;  3FOO A;  3C63 A;  4JKV A;  4CX9 A;  3DE8 A;  2BC5 A;  1BBH A;  4WGZ A;  3U8P A;  1M6T A;  4N4W A;  1E84 A;  4D4N A;  4CJO A;  5AGF A;  1S05 A;  1JAF A;  2XL8 A;  3QVY A;  1RCP A;  3QW1 A;  4WGY A;  1CPQ A;  1A7V A;  2J9B A;  3M15 A;  2YL7 A;  5JT4 A;  1MQV A;  3HNK A;  4ER9 A;  3TOL A;  1E85 A;  4U9E A;  3DE9 A;  1E83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...