2YKZA

Recombinant native cytochrome c prime from alcaligenes xylosoxidans at 0.84 a resolution: restrained refinement
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
b'EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAVQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2ykzA00
3IQ6A 1EKYA 2XM4A 1BBHA 5AGFA 3M4CA 3DE9A 4L6RA 4JKVA 5JUAA 1YYJA 3U8PA 3L1MA 4U9EA 4CDVA 4N4WA 3QW1A 3ZQYA 3NMIA 3M15A 2XLHA 2YL1A 3M79A 1YYXA 4U9DA 1CGOA 1GQAA 3QVYA 4D4NA 5JVEA 2XLOA 1E85A 4JE9A 2YL3A 2XL6A 3C62A 4CIPA 4ER9A 2CCYA 4WGYA 5JT4A 4D4XA 3TOLA 3IQ5A 2XLVA 2YLIA 4CDYA 3FOOA 1CGNA 2YKZA 2XL8A 3HNLA 5B3IA 2YLDA 1MQVA 2XLDA 5JP7A 2YL7A 1E83A 3TOMA 4N6HA 4EIYA 2XLEA 4CDAA 2YL0A 3C63A 2J9BA 256BA 4CJOA 4JEAA 1A7VA 5JS5A 1QPUA 3ZWIA 1APCA 3ZTZA 4IB4A 3ZQVA 4WGZA 3FOPA 1QQ3A 1YZCA 2BC5A 1E84A 3QVZA 3NMJA 1JAFA 3HNKA 3NMKA 2XM0A 2QLAA 1LM3B 1RCPA 1S05A 3DE8A 1YZAA 4ULVA 3VRCA 1M6TA 1NBBA 5JSLA 3HNJA 4JEBA 3ZTMA 3M4BA 3HNIA 5JLIA 1CPQA 5JRAA 2XLWA 3QW0A 4NC3A 4CJGA 2YLGA 1CPRA 2J8WA 2XLMA 4IAQA 1E86A 4IARA 4CX9A
chains in the Genus database with same CATH superfamily
2I15A 2XL4A 4EBJA 3EH2A 3U0CA 4JCZA 2XM4A 2HJ3A 2R7OA 3O6XA 5AGFA 1T6IA 2VB6A 3M4CA 4Z9JA 1ZW3A 1Z5ZA 3C8GB 5T3WA 3W2VA 3LLKA 3EZIA 2Q9AA 3L1MA 1T01A 3MYFA 4PR9A 1ZW2A 5KYWB 1T6QA 3AGTA 3FAJA 5KYXA 4YL1A 1G4WR 3TQOA 3AG4C 3NMIA 4AX2A 3M15A 1ZHTA 5AC4A 5JVEA 3GANA 4BJ1A 1TKNA 1E84A 4PJLA 4U9DA 2EPMX 1LIHA 3V5ZA 2EIKC 5A6JA 3CQZA 4XQ1A 4G7ZF 1TWAA 3DAFA 2OG2A 1E85A 1OW6A 2J9UA 2YL3A 3S90A 2PNOA 4HEAJ 2XL6A 4JJFA 2R7QA 3NG1A 3EFOB 1MMNA 3CAXA 3N0TA 3V7OA 4A2NB 3FVYA 2TMVP 1Q0GA 3EG9A 4I44A 4MQ9F 4P9TA 4IJJA 4NCQA 4OIQF 3RKOF 1BR2A 1U6HA 4LLCA 3FMSA 1NFOA 3ABLC 3IQ5A 5L0IA 2MYSA 4JURI 1J8MF 4KBLA 1LI7A 1CGNA 1ZHYA 1VMAA 1HW2A 1LE2A 3HLZA 3C18A 5K0IA 3GM2A 4OIOF 2A1DD 4BJ5C 3HNLA 4EHPA 5B3IA 4KI2A 2Y69C 4CS9A 5JP7A 1FTSA 2WZGA 2YL7A 4J32B 1E83A 4YT8A 4GEHA 4N6HA 5DLJA 3UMKA 3AG2C 2WL8A 4MVMA 3TJ5A 4CDAA 2YL0A 1RJ9B 3AQCA 2WZLA 2OJQA 1I5NA 3U8VA 5L0FA 2PFDA 4CS9C 3A11A 3ECSA 2EIMC 3RVZA 3WAQA 2J45A 1A7EA 1A7VA 2FAPB 1QPUA 2B0JA 3GM3A 1KNYA 4ZLCA 4G78A 3JYHA 4IB4A 3DKAA 1O87A 3ZQVA 3SNHA 2LQGA 3GORA 2G62A 2R05A 1QLEC 1QQ3A 1WGWA 3K66A 5FZTA 1YZCA 1YAUO 2Y39A 2FGYA 2NPUA 3AQBA 3O39A 3RQFA 3H2VA 4EWCA 2ZXRA 1JAFA 2IXPA 3C8ZA 3SYNA 2D4UA 2DYSC 2L81A 3LEVA 3LESA 1GM5A 5DQZA 3J06A 3EHNA 3LUTB 1MMGA 3PMRA 3ZC4A 4E17A 3MLGA 1EI7A 4RD9A 3KPHA 4KNWA 3GWLA 4B6IA 4YN0B 2XM0A 5KYYA 1RCPA 1BZ4A 2WZFA 2GDCA 4OD5A 5DS5A 4K0DA 4XTKA 2ETSA 2AWCA 3TULA 3PHF2 3AGUA 4WABA 4ULVA 1V54C 3ASOC 3DJUB 5COMA 1M6TA 3KMIA 4U5DE 1SZIA 1BR1A 2JX0A 1BR4A 4I1OB 2XXAB 3K7DA 2LP4A 2O9XA 2Y3DA 3HNJA 3WHNA 3TK0A 4BJTA 3ZTMA 1HE9A 1AVOB 1IW7F 1PV3A 1WN0A 2W9YA 1SR2A 1ZHXA 2Q00A 5JRAA 2LCHA 3DZAA 2HZ8A 2R9RB 2XLWA 5KYXB 1EA8A 3DD7A 5IY5C 1CPRA 2B0HA 4QI0A 2Y3BA 4PK4A 3H65A 1I4ZA 2XLMA 4E7ZA 1OCZC 2YWAA 1E86A 4KC9A 4BPMA 2P0NA 2W45A 1WATA 4DRJB 3L8IA 2EPNA 2MHRA 2RD9A 1IZMA 4AE4B 3W2WA 4H54A 4L6RA 4ZLDA 1Z3IX 3LS0A 1YYJA 4ANJA 1HMOA 3LS1A 2UUHA 4J7TA 4FX5A 4C3BA 1I4YA 4YWQA 4N4WA 3K6BA 4LDQA 4PACA 3KL4A 3EJNA 2EIJC 2Y3HA 4CBEA 3QW1A 3B0VC 3T6BA 1XWJA 5L0GA 1A7DA 3ATPA 2HS5A 3AJMA 2CNWA 4AL0A 3EGDB 2YL1A 1OXKA 2YZSA 3S28A 1CGOA 3NRHA 1GQAA 4LDKA 2JD3A 1JMWA 2R25A 1VK5A 4KNVA 3ZVRA 1VLSA 4JIOA 2EILC 3X1OA 1L3PA 1D0YA 1M2VB 3M1CB 3CEXA 3S0XA 2Q3TA 3SXZA 3ZDLA 1PD1A 3A9CA 3LNRA 4FWVA 5HSWA 4G7OF 4ER9A 1E2XA 3BEHA 3QMKA 1Q0MA 3C7JA 1NSGB 3JRTA 3KH2A 2OEXA 2XXAA 3UNGC 1D0ZA 2Q4FA 3TJ6A 2HMQA 1OCOC 2GAQA 3GEIA 2L6FA 3RIPA 4D4XA 5JT4A 2HJMA 1NU9C 1C03A 3HJCA 3JSZA 4CIHA 2QNLA 3GEHA 3FHDA 4Q5SF 2CGEA 4M63A 1OW7A 2L6HA 4JRZA 2FFHA 3DWWA 2VCBA 2H7OA 2XL8A 2DI3A 1OCCC 4JCHA 2Y3GA 4YT4A 3OEOA 5E2QA 1ZYRF 2KK1A 1HMDA 1A41A 2WVNA 2KJGA 3TOMA 4BEJA 3GODA 2M64A 2OKUA 1V74B 1H9GA 5F5HA 4AE4A 2P1AA 3K33A 2IXOA 1N1CA 1YLMA 1SMYF 2DB4A 1OKKD 3GEEA 5CIVA 2P7VA 3SP1A 1NG1A 2J7PD 4JEAA 2L7AA 3AOUA 5KYYB 3EGXA 5L3VA 3ABKC 3ZTZA 3UMHA 3C8GD 4MVUA 4CS8A 4CSAA 1FMWA 1LPEA 3FOPA 4XPXA 2VC9A 3EGDA 3UGOA 2NSFA 2LSEA 1FR0A 1RKEB 1TR2A 4OD4A 4C3DA 3KYIA 1NU7D 3RQEA 1WWPA 1U89A 2HUJA 4I1MA 3U2MA 4CS8C 5L0CA 4CSAC 3NMKA 1M2VA 3S84A 2R7WA 2KYHA 1ZZPA 1LS1A 2BL2A 2G3VA 1S7ZA 1D0XA 2QLAA 3LLIA 5FCLA 3Q7GA 2M4EA 1YA9A 2NG1A 2H7BA 3VRCA 2A0BA 2R7RA 2ASRA 4J7YA 3O10A 3DMDA 5E3CA 1KTMA 4O6NA 4OIRF 4LACB 1OCRC 2AU5A 2Z15A 3VAYA 2LD6A 5A6AA 3DAGA 3I5QA 2EPLX 4DVYP 4E7SA 1H7IA 1LS4A 4DBRA 3Q6MA 3WG7C 1QKRA 2WVOA 3MYIA 4JC7A 5A6BD 3T6GB 3QW0A 1MMAA 2YVKA 3JZ0A 1G4US 3JYYA 2LFFA 3LJBA 4LLEA 2XS1A 3Q6NA 2Q9BA 1UG7A 1G8XA 1VTMP 2YQYA 3K1IA 1EQ1A 4IRUA 5E3AA 2Q7RA 4U5HA 3WODF 2X0CA 4DJ9A 4DBQA 3POVA 3IQ6A 4J30B 1BBHA 4H4KC 5A69A 2P6VA 2ICWG 2HV6A 5L0HA 4F4BA 2EPKX 2XRHA 3G4ZA 4JKVA 5JUAA 1VYKA 2H8AA 1RXQA 3U8PA 1TWGA 5F5FA 3K1IC 2GWWA 1YARO 4G7HF 4U9EA 4U5FE 2ZXOA 2NUPA 3HTKC 4GYTA 3VF0A 1RKEA 2R7VA 2G3KA 2VH3A 4C3EA 2LK4A 1G5ZA 1T6UA 3U2LA 2PP4A 1UFBA 2XLHA 2LIGA 5E33A 2PF4E 3I5PA 1OXBA 3M79A 4XPWA 2PX3A 5AC5A 3UGPA 1B68A 3ZG1A 3JCUQ 4NTAA 4EBBA 3QVYA 4CS7A 3R2PA 5D91A 3G4XA 2DGJA 3SEOA 3SXMA 2VCAA 2XSEA 1ORYA 2UUIA 4JE9A 3RVYA 2WB7A 4PJNA 4XEKA 1Q0KA 1BDJB 5L3QA 3SXKA 4MVSA 2GA0A 3W8HA 3C62A 1XZPA 5DS4A 5EHHA 1Z23A 2CYDA 1JPNA 4DOZA 1FFHA 4IWBA 3JSEO 4FAPB 4XEVA 2A68F 5B3SC 2AVKA 2W4BA 4MS2A 4MNDA 4E18A 3TOLA 3DJNB 2XLVA 3X2QC 1GGQA 4XLNF 2IXMA 3SZRA 4CDYA 4IAOA 4JTAB 3EGXB 4O79A 2R03A 2YEVA 4EKWA 3IQCA 2HSBA 2YKZA 2PX0A 2AWYA 4BJ6A 3BRJA 5D92A 3H2UA 2J9VA 2KSFA 2X51A 2OQMA 4W8PA 5L0JA 1MQVA 1WOLA 4R32A 1O3UA 5HV9A 2I8BA 1TWHA 3F46A 1YA7O 4JZAA 3ZSUA 2V3CC 4BJ6C 2R7UA 1F1MA 3EZHA 3HKKA 3OWTA 3T4RA 3AG1C 4NQFA 1PCXA 1O5HA 4WJ0A 5DVWA 4Q4ZF 4QI2A 4DRIB 1MNDA 3ZIBA 4OIPF 4U5CE 3PCVA 1M56C 4O6YA 256BA 4CJOA 2QE9A 3NYJA 3S27A 5JS5A 4MW8A 4N6CA 5KYUB 3ZWIA 1NZEA 1OW8A 5B1BC 1APCA 5F28E 3JT1A 2HFIA 4WGZA 1HE1A 2IXNA 4DVZA 4I3MA 5EGYA 1SYQA 3PDMP 2A0UA 1QZXA 2OEVA 4U5GA 3W4YA 1WASA 1Z6AA 2J46A 3NMJA 1Z63A 1XZQA 1K40A 3HNKA 4XEFA 3DM9B 1YDIA 3US6A 4YT2A 4LERA 1GS9A 2AP3A 3IPMO 2C03A 4OINF 2QTVA 4JJGA 2F22A 2V26A 5A6KA 3V5YA 1OR3A 1TFKB 1YVIA 1Z7Qc 2JPUA 2KGOA 3VYWA 3DI5A 1H9TA 4K1OA 3DE8A 2KW3C 2R7TA 1L7CA 2YHSA 1OR2A 1ZHZA 2NSGA 3B71A 1NBBA 4E0IA 1LI5A 1J8YF 5JSLA 1D1BA 4EBKA 3NDBB 2KNHA 4O7GA 4U5EE 4JEBA 3L34A 3LEOA 2PBEA 4XLPF 3DM5A 3M4BA 5JLIA 2IBFA 2HKVA 4LDRA 1CPQA 1MMDA 1C02A 3B29A 4P6IC 2NUPB 3B0UX 1FMVA 1VYIA 4PFOA 1DOWA 2HMZA 4NC3A 4Z9HA 3FAPB 2YLGA 1HY5A 2J8WA 3V5XA 5BQIA 1LKXA 1JR8A 4C7OA 4IAQA 3U3FA 4RBNA 2ZXPA 4JW1A 3RQGA 1LVKA 4IARA 2J9WA 2OOCA 1TFOB 2OJED 3B9QA 3NYLA 5KYUA 1EKYA 3U5SA 4A4AA 1PD0A 2OU6A 3Q7LA 4BG0A 3QTHA 3DE9A 1JRAA 5COFA 1QSPA 3CZ6A 4BJ5A 4DXWA 3DXJF 1Q0DA 3GM1A 3U9JA 3QZCA 4E0HA 4MTFA 4YJWA 4MVZA 4U5BE 5T3TA 1AUEA 3T6JA 1ORJA 4Z9IA 1T9KA 1ZU5A 3IEEA 3ZQYA 2NUTB 3K1HA 3NKEA 2ZPAA 5GPGB 4AL1A 1ZHWA 1YYXA 2CW0F 2E87A 1OKKA 3S9OA 1ORSC 2HV7A 3T9OA 1ST6A 2J7PA 4D4NA 1CGME 3I4UA 2XLOA 4XWJA 2ZD9A 2D5RB 4MVQA 3F47A 3RW0A 4PJMA 3TD7A 4CIPA 3C8GA 4P9FA 5BQGA 5DQTA 2CCYA 4WGYA 1VOMA 5EK0A 2VCCA 5KYWA 2A6HF 2HSQA 4EUKB 1ZU4A 3E70C 2YLIA 1K05A 4JTDB 3UR3C 1HW1A 1ZVZA 3FOOA 1QVXA 2EINC 3ASNC 1OQCA 3MX3A 3GWNA 4MW3A 5CI8A 4HE8D 3UMIA 2YLDA 2XS8A 1KU2A 1D1AA 3N2ZB 4RDAA 2WVQA 2XLDA 1VLTA 1MNEA 2ZXWC 3B0PA 4PJJA 5CI9A 5COGA 3EFOA 2BE5F 4HFFB 3RFYA 3S29A 2XLEA 4XPYA 4EIYA 3IHUA 4GQHA 2CNWD 1YJGA 2KC3A 2R02A 2J0XA 3NYMA 4O6MA 4X0RA 4YL0A 1RKCA 1FNTc 3KKBA 3C63A 4ULWA 2J9BA 4G0HA 1V4AA 4ONSA 1AEPA 1K04A 4MVOA 1FAPB 5T1DB 1VB5A 1C17M 2LFDA 4YK5A 4DRHB 4MTOA 1Y4CA 5A6BA 4HFKB 4W8KA 4K7BA 2NUTA 4QDLA 2IYLD 2RSEB 3IQTA 3FXHA 1W2WA 2BC5A 2DYRC 1T5OA 2J0WA 2YRFA 3MFNA 4YT5A 3RF3A 1SF8A 3U9MA 3ABMC 1V55C 2L6GA 3QVZA 5BQHA 1Q0FA 3L8JA 1NLXA 1H6GA 2CDQA 1LE4A 2IOQA 3N24A 1RJ9A 4MVRA 4Q7CA 3KYJA 4JTCB 2H7VC 2L9JA 4MTGA 1JOGA 3RYLA 3VM6A 2KQ9A 1RMVA 3EQLF 3EH1A 4NTBA 3G50A 2OCCC 2W4MA 1R4TA 1NFNA 3NKDA 4C7OB 1LM3B 4YL3A 1S05A 1JPJA 1WTYA 4FESA 3U3BA 2A69F 2A6EF 2R7SA 3EHMA 1YZAA 2Q9CA 3E9VA 1D1CA 1DOVA 2QUPA 3MBGA 2IM8A 5B1AC 1M57C 3JRMO 4PFPA 3EG9B 2VASA 4BEMJ 5DS6A 1M2OA 3RH3A 1R5ID 4UDVA 1Y6DA 4N06A 3OA1A 4NTFA 4IGGA 1FFTC 5BUOA 1U0BB 3HNIA 5L0DA 2GFHA 3L0IA 3R7CA 1A0BA 5TJ5E 3CSKA 2R7XA 2MWQA 3FDQA 3LNMB 3O55A 3W8IA 3SXYA 4CJGA 2QY9A 2P61A 4NY3A 5KYNA 4JVSA 1TWCA 3EPVA 2C04A 3AG3C 3ITFA 1TQGA 3JTLO 2EPOA 3LAYA 4AK9A 4CDVA 4CX9A
chains in the Genus database with same CATH topology
3IQ6A 1EKYA 2XM4A 1BBHA 5AGFA 3M4CA 3DE9A 4L6RA 4JKVA 5JUAA 1YYJA 3U8PA 3L1MA 4U9EA 4CDVA 4N4WA 3QW1A 3ZQYA 3NMIA 3M15A 2XLHA 2YL1A 3M79A 1YYXA 4U9DA 1CGOA 1GQAA 3QVYA 4D4NA 5JVEA 2XLOA 1E85A 4JE9A 2YL3A 2XL6A 3C62A 4CIPA 4ER9A 2CCYA 4WGYA 5JT4A 4D4XA 3TOLA 3IQ5A 2XLVA 2YLIA 4CDYA 3FOOA 1CGNA 2YKZA 2XL8A 3HNLA 5B3IA 2YLDA 1MQVA 2XLDA 5JP7A 2YL7A 1E83A 3TOMA 4N6HA 4EIYA 2XLEA 4CDAA 2YL0A 3C63A 2J9BA 256BA 4CJOA 4JEAA 1A7VA 5JS5A 1QPUA 3ZWIA 1APCA 3ZTZA 4IB4A 3ZQVA 4WGZA 3FOPA 1QQ3A 1YZCA 2BC5A 1E84A 3QVZA 3NMJA 1JAFA 3HNKA 3NMKA 2XM0A 2QLAA 1LM3B 1RCPA 1S05A 3DE8A 1YZAA 4ULVA 3VRCA 1M6TA 1NBBA 5JSLA 3HNJA 4JEBA 3ZTMA 3M4BA 3HNIA 5JLIA 1CPQA 5JRAA 2XLWA 3QW0A 4NC3A 4CJGA 2YLGA 1CPRA 2J8WA 2XLMA 4IAQA 1E86A 4IARA 4CX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IQ6 A;  1EKY A;  2XM4 A;  1BBH A;  5AGF A;  3M4C A;  3DE9 A;  4L6R A;  4JKV A;  5JUA A;  1YYJ A;  3U8P A;  3L1M A;  4U9E A;  4CDV A;  4N4W A;  3QW1 A;  3ZQY A;  3NMI A;  3M15 A;  2XLH A;  2YL1 A;  3M79 A;  1YYX A;  4U9D A;  1CGO A;  1GQA A;  3QVY A;  4D4N A;  5JVE A;  2XLO A;  1E85 A;  4JE9 A;  2YL3 A;  2XL6 A;  3C62 A;  4CIP A;  4ER9 A;  2CCY A;  4WGY A;  5JT4 A;  4D4X A;  3TOL A;  3IQ5 A;  2XLV A;  2YLI A;  4CDY A;  3FOO A;  1CGN A;  2YKZ A;  2XL8 A;  3HNL A;  5B3I A;  2YLD A;  1MQV A;  2XLD A;  5JP7 A;  2YL7 A;  1E83 A;  3TOM A;  4N6H A;  4EIY A;  2XLE A;  4CDA A;  2YL0 A;  3C63 A;  2J9B A;  256B A;  4CJO A;  4JEA A;  1A7V A;  5JS5 A;  1QPU A;  3ZWI A;  1APC A;  3ZTZ A;  4IB4 A;  3ZQV A;  4WGZ A;  3FOP A;  1QQ3 A;  1YZC A;  2BC5 A;  1E84 A;  3QVZ A;  3NMJ A;  1JAF A;  3HNK A;  3NMK A;  2XM0 A;  2QLA A;  1LM3 B;  1RCP A;  1S05 A;  3DE8 A;  1YZA A;  4ULV A;  3VRC A;  1M6T A;  1NBB A;  5JSL A;  3HNJ A;  4JEB A;  3ZTM A;  3M4B A;  3HNI A;  5JLI A;  1CPQ A;  5JRA A;  2XLW A;  3QW0 A;  4NC3 A;  4CJG A;  2YLG A;  1CPR A;  2J8W A;  2XLM A;  4IAQ A;  1E86 A;  4IAR A;  4CX9 A; 
#chains in the Genus database with same CATH topology
 2I15 A;  2XL4 A;  4EBJ A;  3EH2 A;  3U0C A;  4JCZ A;  2XM4 A;  2HJ3 A;  2R7O A;  3O6X A;  5AGF A;  1T6I A;  2VB6 A;  3M4C A;  4Z9J A;  1ZW3 A;  1Z5Z A;  3C8G B;  5T3W A;  3W2V A;  3LLK A;  3EZI A;  2Q9A A;  3L1M A;  1T01 A;  3MYF A;  4PR9 A;  1ZW2 A;  5KYW B;  1T6Q A;  3AGT A;  3FAJ A;  5KYX A;  4YL1 A;  1G4W R;  3TQO A;  3AG4 C;  3NMI A;  4AX2 A;  3M15 A;  1ZHT A;  5AC4 A;  5JVE A;  3GAN A;  4BJ1 A;  1TKN A;  1E84 A;  4PJL A;  4U9D A;  2EPM X;  1LIH A;  3V5Z A;  2EIK C;  5A6J A;  3CQZ A;  4XQ1 A;  4G7Z F;  1TWA A;  3DAF A;  2OG2 A;  1E85 A;  1OW6 A;  2J9U A;  2YL3 A;  3S90 A;  2PNO A;  4HEA J;  2XL6 A;  4JJF A;  2R7Q A;  3NG1 A;  3EFO B;  1MMN A;  3CAX A;  3N0T A;  3V7O A;  4A2N B;  3FVY A;  2TMV P;  1Q0G A;  3EG9 A;  4I44 A;  4MQ9 F;  4P9T A;  4IJJ A;  4NCQ A;  4OIQ F;  3RKO F;  1BR2 A;  1U6H A;  4LLC A;  3FMS A;  1NFO A;  3ABL C;  3IQ5 A;  5L0I A;  2MYS A;  4JUR I;  1J8M F;  4KBL A;  1LI7 A;  1CGN A;  1ZHY A;  1VMA A;  1HW2 A;  1LE2 A;  3HLZ A;  3C18 A;  5K0I A;  3GM2 A;  4OIO F;  2A1D D;  4BJ5 C;  3HNL A;  4EHP A;  5B3I A;  4KI2 A;  2Y69 C;  4CS9 A;  5JP7 A;  1FTS A;  2WZG A;  2YL7 A;  4J32 B;  1E83 A;  4YT8 A;  4GEH A;  4N6H A;  5DLJ A;  3UMK A;  3AG2 C;  2WL8 A;  4MVM A;  3TJ5 A;  4CDA A;  2YL0 A;  1RJ9 B;  3AQC A;  2WZL A;  2OJQ A;  1I5N A;  3U8V A;  5L0F A;  2PFD A;  4CS9 C;  3A11 A;  3ECS A;  2EIM C;  3RVZ A;  3WAQ A;  2J45 A;  1A7E A;  1A7V A;  2FAP B;  1QPU A;  2B0J A;  3GM3 A;  1KNY A;  4ZLC A;  4G78 A;  3JYH A;  4IB4 A;  3DKA A;  1O87 A;  3ZQV A;  3SNH A;  2LQG A;  3GOR A;  2G62 A;  2R05 A;  1QLE C;  1QQ3 A;  1WGW A;  3K66 A;  5FZT A;  1YZC A;  1YAU O;  2Y39 A;  2FGY A;  2NPU A;  3AQB A;  3O39 A;  3RQF A;  3H2V A;  4EWC A;  2ZXR A;  1JAF A;  2IXP A;  3C8Z A;  3SYN A;  2D4U A;  2DYS C;  2L81 A;  3LEV A;  3LES A;  1GM5 A;  5DQZ A;  3J06 A;  3EHN A;  3LUT B;  1MMG A;  3PMR A;  3ZC4 A;  4E17 A;  3MLG A;  1EI7 A;  4RD9 A;  3KPH A;  4KNW A;  3GWL A;  4B6I A;  4YN0 B;  2XM0 A;  5KYY A;  1RCP A;  1BZ4 A;  2WZF A;  2GDC A;  4OD5 A;  5DS5 A;  4K0D A;  4XTK A;  2ETS A;  2AWC A;  3TUL A;  3PHF 2;  3AGU A;  4WAB A;  4ULV A;  1V54 C;  3ASO C;  3DJU B;  5COM A;  1M6T A;  3KMI A;  4U5D E;  1SZI A;  1BR1 A;  2JX0 A;  1BR4 A;  4I1O B;  2XXA B;  3K7D A;  2LP4 A;  2O9X A;  2Y3D A;  3HNJ A;  3WHN A;  3TK0 A;  4BJT A;  3ZTM A;  1HE9 A;  1AVO B;  1IW7 F;  1PV3 A;  1WN0 A;  2W9Y A;  1SR2 A;  1ZHX A;  2Q00 A;  5JRA A;  2LCH A;  3DZA A;  2HZ8 A;  2R9R B;  2XLW A;  5KYX B;  1EA8 A;  3DD7 A;  5IY5 C;  1CPR A;  2B0H A;  4QI0 A;  2Y3B A;  4PK4 A;  3H65 A;  1I4Z A;  2XLM A;  4E7Z A;  1OCZ C;  2YWA A;  1E86 A;  4KC9 A;  4BPM A;  2P0N A;  2W45 A;  1WAT A;  4DRJ B;  3L8I A;  2EPN A;  2MHR A;  2RD9 A;  1IZM A;  4AE4 B;  3W2W A;  4H54 A;  4L6R A;  4ZLD A;  1Z3I X;  3LS0 A;  1YYJ A;  4ANJ A;  1HMO A;  3LS1 A;  2UUH A;  4J7T A;  4FX5 A;  4C3B A;  1I4Y A;  4YWQ A;  4N4W A;  3K6B A;  4LDQ A;  4PAC A;  3KL4 A;  3EJN A;  2EIJ C;  2Y3H A;  4CBE A;  3QW1 A;  3B0V C;  3T6B A;  1XWJ A;  5L0G A;  1A7D A;  3ATP A;  2HS5 A;  3AJM A;  2CNW A;  4AL0 A;  3EGD B;  2YL1 A;  1OXK A;  2YZS A;  3S28 A;  1CGO A;  3NRH A;  1GQA A;  4LDK A;  2JD3 A;  1JMW A;  2R25 A;  1VK5 A;  4KNV A;  3ZVR A;  1VLS A;  4JIO A;  2EIL C;  3X1O A;  1L3P A;  1D0Y A;  1M2V B;  3M1C B;  3CEX A;  3S0X A;  2Q3T A;  3SXZ A;  3ZDL A;  1PD1 A;  3A9C A;  3LNR A;  4FWV A;  5HSW A;  4G7O F;  4ER9 A;  1E2X A;  3BEH A;  3QMK A;  1Q0M A;  3C7J A;  1NSG B;  3JRT A;  3KH2 A;  2OEX A;  2XXA A;  3UNG C;  1D0Z A;  2Q4F A;  3TJ6 A;  2HMQ A;  1OCO C;  2GAQ A;  3GEI A;  2L6F A;  3RIP A;  4D4X A;  5JT4 A;  2HJM A;  1NU9 C;  1C03 A;  3HJC A;  3JSZ A;  4CIH A;  2QNL A;  3GEH A;  3FHD A;  4Q5S F;  2CGE A;  4M63 A;  1OW7 A;  2L6H A;  4JRZ A;  2FFH A;  3DWW A;  2VCB A;  2H7O A;  2XL8 A;  2DI3 A;  1OCC C;  4JCH A;  2Y3G A;  4YT4 A;  3OEO A;  5E2Q A;  1ZYR F;  2KK1 A;  1HMD A;  1A41 A;  2WVN A;  2KJG A;  3TOM A;  4BEJ A;  3GOD A;  2M64 A;  2OKU A;  1V74 B;  1H9G A;  5F5H A;  4AE4 A;  2P1A A;  3K33 A;  2IXO A;  1N1C A;  1YLM A;  1SMY F;  2DB4 A;  1OKK D;  3GEE A;  5CIV A;  2P7V A;  3SP1 A;  1NG1 A;  2J7P D;  4JEA A;  2L7A A;  3AOU A;  5KYY B;  3EGX A;  5L3V A;  3ABK C;  3ZTZ A;  3UMH A;  3C8G D;  4MVU A;  4CS8 A;  4CSA A;  1FMW A;  1LPE A;  3FOP A;  4XPX A;  2VC9 A;  3EGD A;  3UGO A;  2NSF A;  2LSE A;  1FR0 A;  1RKE B;  1TR2 A;  4OD4 A;  4C3D A;  3KYI A;  1NU7 D;  3RQE A;  1WWP A;  1U89 A;  2HUJ A;  4I1M A;  3U2M A;  4CS8 C;  5L0C A;  4CSA C;  3NMK A;  1M2V A;  3S84 A;  2R7W A;  2KYH A;  1ZZP A;  1LS1 A;  2BL2 A;  2G3V A;  1S7Z A;  1D0X A;  2QLA A;  3LLI A;  5FCL A;  3Q7G A;  2M4E A;  1YA9 A;  2NG1 A;  2H7B A;  3VRC A;  2A0B A;  2R7R A;  2ASR A;  4J7Y A;  3O10 A;  3DMD A;  5E3C A;  1KTM A;  4O6N A;  4OIR F;  4LAC B;  1OCR C;  2AU5 A;  2Z15 A;  3VAY A;  2LD6 A;  5A6A A;  3DAG A;  3I5Q A;  2EPL X;  4DVY P;  4E7S A;  1H7I A;  1LS4 A;  4DBR A;  3Q6M A;  3WG7 C;  1QKR A;  2WVO A;  3MYI A;  4JC7 A;  5A6B D;  3T6G B;  3QW0 A;  1MMA A;  2YVK A;  3JZ0 A;  1G4U S;  3JYY A;  2LFF A;  3LJB A;  4LLE A;  2XS1 A;  3Q6N A;  2Q9B A;  1UG7 A;  1G8X A;  1VTM P;  2YQY A;  3K1I A;  1EQ1 A;  4IRU A;  5E3A A;  2Q7R A;  4U5H A;  3WOD F;  2X0C A;  4DJ9 A;  4DBQ A;  3POV A;  3IQ6 A;  4J30 B;  1BBH A;  4H4K C;  5A69 A;  2P6V A;  2ICW G;  2HV6 A;  5L0H A;  4F4B A;  2EPK X;  2XRH A;  3G4Z A;  4JKV A;  5JUA A;  1VYK A;  2H8A A;  1RXQ A;  3U8P A;  1TWG A;  5F5F A;  3K1I C;  2GWW A;  1YAR O;  4G7H F;  4U9E A;  4U5F E;  2ZXO A;  2NUP A;  3HTK C;  4GYT A;  3VF0 A;  1RKE A;  2R7V A;  2G3K A;  2VH3 A;  4C3E A;  2LK4 A;  1G5Z A;  1T6U A;  3U2L A;  2PP4 A;  1UFB A;  2XLH A;  2LIG A;  5E33 A;  2PF4 E;  3I5P A;  1OXB A;  3M79 A;  4XPW A;  2PX3 A;  5AC5 A;  3UGP A;  1B68 A;  3ZG1 A;  3JCU Q;  4NTA A;  4EBB A;  3QVY A;  4CS7 A;  3R2P A;  5D91 A;  3G4X A;  2DGJ A;  3SEO A;  3SXM A;  2VCA A;  2XSE A;  1ORY A;  2UUI A;  4JE9 A;  3RVY A;  2WB7 A;  4PJN A;  4XEK A;  1Q0K A;  1BDJ B;  5L3Q A;  3SXK A;  4MVS A;  2GA0 A;  3W8H A;  3C62 A;  1XZP A;  5DS4 A;  5EHH A;  1Z23 A;  2CYD A;  1JPN A;  4DOZ A;  1FFH A;  4IWB A;  3JSE O;  4FAP B;  4XEV A;  2A68 F;  5B3S C;  2AVK A;  2W4B A;  4MS2 A;  4MND A;  4E18 A;  3TOL A;  3DJN B;  2XLV A;  3X2Q C;  1GGQ A;  4XLN F;  2IXM A;  3SZR A;  4CDY A;  4IAO A;  4JTA B;  3EGX B;  4O79 A;  2R03 A;  2YEV A;  4EKW A;  3IQC A;  2HSB A;  2YKZ A;  2PX0 A;  2AWY A;  4BJ6 A;  3BRJ A;  5D92 A;  3H2U A;  2J9V A;  2KSF A;  2X51 A;  2OQM A;  4W8P A;  5L0J A;  1MQV A;  1WOL A;  4R32 A;  1O3U A;  5HV9 A;  2I8B A;  1TWH A;  3F46 A;  1YA7 O;  4JZA A;  3ZSU A;  2V3C C;  4BJ6 C;  2R7U A;  1F1M A;  3EZH A;  3HKK A;  3OWT A;  3T4R A;  3AG1 C;  4NQF A;  1PCX A;  1O5H A;  4WJ0 A;  5DVW A;  4Q4Z F;  4QI2 A;  4DRI B;  1MND A;  3ZIB A;  4OIP F;  4U5C E;  3PCV A;  1M56 C;  4O6Y A;  256B A;  4CJO A;  2QE9 A;  3NYJ A;  3S27 A;  5JS5 A;  4MW8 A;  4N6C A;  5KYU B;  3ZWI A;  1NZE A;  1OW8 A;  5B1B C;  1APC A;  5F28 E;  3JT1 A;  2HFI A;  4WGZ A;  1HE1 A;  2IXN A;  4DVZ A;  4I3M A;  5EGY A;  1SYQ A;  3PDM P;  2A0U A;  1QZX A;  2OEV A;  4U5G A;  3W4Y A;  1WAS A;  1Z6A A;  2J46 A;  3NMJ A;  1Z63 A;  1XZQ A;  1K40 A;  3HNK A;  4XEF A;  3DM9 B;  1YDI A;  3US6 A;  4YT2 A;  4LER A;  1GS9 A;  2AP3 A;  3IPM O;  2C03 A;  4OIN F;  2QTV A;  4JJG A;  2F22 A;  2V26 A;  5A6K A;  3V5Y A;  1OR3 A;  1TFK B;  1YVI A;  1Z7Q c;  2JPU A;  2KGO A;  3VYW A;  3DI5 A;  1H9T A;  4K1O A;  3DE8 A;  2KW3 C;  2R7T A;  1L7C A;  2YHS A;  1OR2 A;  1ZHZ A;  2NSG A;  3B71 A;  1NBB A;  4E0I A;  1LI5 A;  1J8Y F;  5JSL A;  1D1B A;  4EBK A;  3NDB B;  2KNH A;  4O7G A;  4U5E E;  4JEB A;  3L34 A;  3LEO A;  2PBE A;  4XLP F;  3DM5 A;  3M4B A;  5JLI A;  2IBF A;  2HKV A;  4LDR A;  1CPQ A;  1MMD A;  1C02 A;  3B29 A;  4P6I C;  2NUP B;  3B0U X;  1FMV A;  1VYI A;  4PFO A;  1DOW A;  2HMZ A;  4NC3 A;  4Z9H A;  3FAP B;  2YLG A;  1HY5 A;  2J8W A;  3V5X A;  5BQI A;  1LKX A;  1JR8 A;  4C7O A;  4IAQ A;  3U3F A;  4RBN A;  2ZXP A;  4JW1 A;  3RQG A;  1LVK A;  4IAR A;  2J9W A;  2OOC A;  1TFO B;  2OJE D;  3B9Q A;  3NYL A;  5KYU A;  1EKY A;  3U5S A;  4A4A A;  1PD0 A;  2OU6 A;  3Q7L A;  4BG0 A;  3QTH A;  3DE9 A;  1JRA A;  5COF A;  1QSP A;  3CZ6 A;  4BJ5 A;  4DXW A;  3DXJ F;  1Q0D A;  3GM1 A;  3U9J A;  3QZC A;  4E0H A;  4MTF A;  4YJW A;  4MVZ A;  4U5B E;  5T3T A;  1AUE A;  3T6J A;  1ORJ A;  4Z9I A;  1T9K A;  1ZU5 A;  3IEE A;  3ZQY A;  2NUT B;  3K1H A;  3NKE A;  2ZPA A;  5GPG B;  4AL1 A;  1ZHW A;  1YYX A;  2CW0 F;  2E87 A;  1OKK A;  3S9O A;  1ORS C;  2HV7 A;  3T9O A;  1ST6 A;  2J7P A;  4D4N A;  1CGM E;  3I4U A;  2XLO A;  4XWJ A;  2ZD9 A;  2D5R B;  4MVQ A;  3F47 A;  3RW0 A;  4PJM A;  3TD7 A;  4CIP A;  3C8G A;  4P9F A;  5BQG A;  5DQT A;  2CCY A;  4WGY A;  1VOM A;  5EK0 A;  2VCC A;  5KYW A;  2A6H F;  2HSQ A;  4EUK B;  1ZU4 A;  3E70 C;  2YLI A;  1K05 A;  4JTD B;  3UR3 C;  1HW1 A;  1ZVZ A;  3FOO A;  1QVX A;  2EIN C;  3ASN C;  1OQC A;  3MX3 A;  3GWN A;  4MW3 A;  5CI8 A;  4HE8 D;  3UMI A;  2YLD A;  2XS8 A;  1KU2 A;  1D1A A;  3N2Z B;  4RDA A;  2WVQ A;  2XLD A;  1VLT A;  1MNE A;  2ZXW C;  3B0P A;  4PJJ A;  5CI9 A;  5COG A;  3EFO A;  2BE5 F;  4HFF B;  3RFY A;  3S29 A;  2XLE A;  4XPY A;  4EIY A;  3IHU A;  4GQH A;  2CNW D;  1YJG A;  2KC3 A;  2R02 A;  2J0X A;  3NYM A;  4O6M A;  4X0R A;  4YL0 A;  1RKC A;  1FNT c;  3KKB A;  3C63 A;  4ULW A;  2J9B A;  4G0H A;  1V4A A;  4ONS A;  1AEP A;  1K04 A;  4MVO A;  1FAP B;  5T1D B;  1VB5 A;  1C17 M;  2LFD A;  4YK5 A;  4DRH B;  4MTO A;  1Y4C A;  5A6B A;  4HFK B;  4W8K A;  4K7B A;  2NUT A;  4QDL A;  2IYL D;  2RSE B;  3IQT A;  3FXH A;  1W2W A;  2BC5 A;  2DYR C;  1T5O A;  2J0W A;  2YRF A;  3MFN A;  4YT5 A;  3RF3 A;  1SF8 A;  3U9M A;  3ABM C;  1V55 C;  2L6G A;  3QVZ A;  5BQH A;  1Q0F A;  3L8J A;  1NLX A;  1H6G A;  2CDQ A;  1LE4 A;  2IOQ A;  3N24 A;  1RJ9 A;  4MVR A;  4Q7C A;  3KYJ A;  4JTC B;  2H7V C;  2L9J A;  4MTG A;  1JOG A;  3RYL A;  3VM6 A;  2KQ9 A;  1RMV A;  3EQL F;  3EH1 A;  4NTB A;  3G50 A;  2OCC C;  2W4M A;  1R4T A;  1NFN A;  3NKD A;  4C7O B;  1LM3 B;  4YL3 A;  1S05 A;  1JPJ A;  1WTY A;  4FES A;  3U3B A;  2A69 F;  2A6E F;  2R7S A;  3EHM A;  1YZA A;  2Q9C A;  3E9V A;  1D1C A;  1DOV A;  2QUP A;  3MBG A;  2IM8 A;  5B1A C;  1M57 C;  3JRM O;  4PFP A;  3EG9 B;  2VAS A;  4BEM J;  5DS6 A;  1M2O A;  3RH3 A;  1R5I D;  4UDV A;  1Y6D A;  4N06 A;  3OA1 A;  4NTF A;  4IGG A;  1FFT C;  5BUO A;  1U0B B;  3HNI A;  5L0D A;  2GFH A;  3L0I A;  3R7C A;  1A0B A;  5TJ5 E;  3CSK A;  2R7X A;  2MWQ A;  3FDQ A;  3LNM B;  3O55 A;  3W8I A;  3SXY A;  4CJG A;  2QY9 A;  2P61 A;  4NY3 A;  5KYN A;  4JVS A;  1TWC A;  3EPV A;  2C04 A;  3AG3 C;  3ITF A;  1TQG A;  3JTL O;  2EPO A;  3LAY A;  4AK9 A;  4CDV A;  4CX9 A; 
#chains in the Genus database with same CATH homology
 3IQ6 A;  1EKY A;  2XM4 A;  1BBH A;  5AGF A;  3M4C A;  3DE9 A;  4L6R A;  4JKV A;  5JUA A;  1YYJ A;  3U8P A;  3L1M A;  4U9E A;  4CDV A;  4N4W A;  3QW1 A;  3ZQY A;  3NMI A;  3M15 A;  2XLH A;  2YL1 A;  3M79 A;  1YYX A;  4U9D A;  1CGO A;  1GQA A;  3QVY A;  4D4N A;  5JVE A;  2XLO A;  1E85 A;  4JE9 A;  2YL3 A;  2XL6 A;  3C62 A;  4CIP A;  4ER9 A;  2CCY A;  4WGY A;  5JT4 A;  4D4X A;  3TOL A;  3IQ5 A;  2XLV A;  2YLI A;  4CDY A;  3FOO A;  1CGN A;  2YKZ A;  2XL8 A;  3HNL A;  5B3I A;  2YLD A;  1MQV A;  2XLD A;  5JP7 A;  2YL7 A;  1E83 A;  3TOM A;  4N6H A;  4EIY A;  2XLE A;  4CDA A;  2YL0 A;  3C63 A;  2J9B A;  256B A;  4CJO A;  4JEA A;  1A7V A;  5JS5 A;  1QPU A;  3ZWI A;  1APC A;  3ZTZ A;  4IB4 A;  3ZQV A;  4WGZ A;  3FOP A;  1QQ3 A;  1YZC A;  2BC5 A;  1E84 A;  3QVZ A;  3NMJ A;  1JAF A;  3HNK A;  3NMK A;  2XM0 A;  2QLA A;  1LM3 B;  1RCP A;  1S05 A;  3DE8 A;  1YZA A;  4ULV A;  3VRC A;  1M6T A;  1NBB A;  5JSL A;  3HNJ A;  4JEB A;  3ZTM A;  3M4B A;  3HNI A;  5JLI A;  1CPQ A;  5JRA A;  2XLW A;  3QW0 A;  4NC3 A;  4CJG A;  2YLG A;  1CPR A;  2J8W A;  2XLM A;  4IAQ A;  1E86 A;  4IAR A;  4CX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...