2YKZA

Recombinant native cytochrome c prime from alcaligenes xylosoxidans at 0.84 a resolution: restrained refinement
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAVQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 50
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2ykzA00
3HNJA 1E86A 4CDVA 2YLIA 5B3IA 3U8PA 4JE9A 1LM3B 1M6TA 4IB4A 3NMKA 4WGYA 2YL7A 1CPRA 3IQ6A 1CGOA 4NC3A 1BBHA 2YLGA 2YL1A 4CJOA 5JS5A 2QLAA 3HNKA 5AGFA 4N6HA 4CDAA 2XLDA 3NMIA 1S05A 4JEAA 1MQVA 3QW1A 4N4WA 3M4CA 2XM0A 3M15A 5JRAA 2YL0A 3C63A 3C62A 1E85A 2YKZA 1E84A 4L6RA 5JT4A 3ZTZA 3TOMA 4ULVA 4U9EA 3ZQYA 3ZQVA 3HNIA 2XL8A 3M4BA 1YZCA 1YYJA 2YLDA 3ZWIA 2J9BA 4IAQA 1GQAA 3M79A 1APCA 4D4NA 1QQ3A 4CX9A 3HNLA 4WGZA 2XL6A 2XLWA 3TOLA 3ZTMA 3QVYA 1QPUA 3FOPA 1CPQA 2XM4A 5JLIA 1JAFA 4D4XA 5JUAA 3DE8A 5JP7A 4EIYA 4IARA 4JKVA 1EKYA 3QW0A 1E83A 2XLMA 256BA 4JEBA 2XLEA 3QVZA 2CCYA 3NMJA 1NBBA 2XLVA 1CGNA 2XLHA 2XLOA 4CDYA 4CIPA 3FOOA 2J8WA 2BC5A 1RCPA 1YYXA 5JSLA 1A7VA 3IQ5A 1YZAA 3VRCA 4U9DA 3DE9A 4CJGA 4ER9A 3L1MA 5JVEA 2YL3A
chains in the Genus database with same CATH superfamily
3HNJA 4BG0A 1OCOC 2A0UA 4AE4A 1E86A 1A7DA 2HKVA 2YLIA 3LS1A 4U5DE 4Q5SF 3EZIA 1H9TA 2GDCA 3WG7C 2XS1A 1NLXA 1NFNA 3JYHA 4IB4A 1FFHA 4PJJA 4X0RA 3T6GB 3PCVA 4U5BE 3CQZA 3E70C 4EBJA 4Z9HA 4KBLA 3RVYA 2OQMA 2RSEB 2V26A 1CPRA 1WN0A 1D1AA 1Q0FA 3ABKC 2YLGA 3RKOF 1D1BA 5K0IA 2W45A 2I15A 3K1IA 4RDAA 4CS9C 2Y3GA 1Q0MA 1XZPA 4JRZA 3HNKA 4JCZA 1Z7Qc 1LE2A 5T1DB 3K33A 2IOQA 5BUOA 2ZXOA 4ZLCA 3C8GB 1AVOB 1TWCA 1FMWA 3ABMC 2EINC 4IGGA 4XLPF 5T3TA 3K1HA 5L0FA 4PR9A 4E0HA 3NMIA 3O39A 3OA1A 2XXAB 1S05A 5FZTA 3RYLA 4C3DA 4N4WA 2NSGA 3GEIA 4Z9IA 4OINF 1BDJB 3SZRA 5KYWA 2YL0A 3C8GA 4KI2A 1IZMA 1LPEA 4MTGA 4U5CE 2DYSC 2HMZA 2P6VA 5DS4A 1ZYRF 5DLJA 1KU2A 2Q00A 2RD9A 1VLSA 3EG9A 4GQHA 1JOGA 2KGOA 3ZC4A 3LJBA 3UGPA 4AK9A 3K66A 3POVA 4HFKB 3QZCA 3AG3C 4RBNA 3K6BA 3B71A 5FCLA 1YARO 3BRJA 4BJ6C 1MMAA 2L7AA 4B6IA 4ULVA 1C03A 5E2QA 1G4US 2VC9A 2X0CA 4DXWA 4DVYP 2H7OA 1JR8A 3L8JA 3AOUA 1CGME 4P6IC 2M4EA 2XSEA 1YZCA 1MMDA 1YYJA 1U0BB 3FAPB 4E17A 3JSZA 2J0WA 1NU7D 3IQCA 1NSGB 1W2WA 3K7DA 3M1CB 3UMKA 1GQAA 2R9RB 1F1MA 2C03A 4OIRF 2X51A 4J30B 5DQTA 4J7YA 1QQ3A 4H4KC 2LIGA 4H54A 1XZQA 1OW6A 3U2MA 4F4BA 1R4TA 3AGUA 4O79A 3A9CA 4O6YA 2B0HA 5DS6A 1AEPA 1LVKA 1T6UA 3KMIA 3LLIA 5EK0A 5B3SC 4LLCA 3DWWA 3EFOB 4J32B 4QI0A 5JUAA 1Q0DA 3IQTA 2G3VA 3DI5A 2ZXWC 4IARA 3BEHA 3DAFA 4XEFA 4EIYA 2L9JA 5L0HA 4Z9JA 4JKVA 3ZG1A 3RH3A 4ANJA 1VK5A 3FDQA 1YA9A 2HSBA 3GANA 2WZFA 4K1OA 4LACB 4XTKA 3C8ZA 1G4WR 3U9MA 1MMGA 5F5FA 2UUHA 1T6IA 4JEBA 2MWQA 3QVZA 3LESA 3I4UA 3ZDLA 4A4AA 3KPHA 4YL0A 4CS8C 2R7WA 1HW2A 1NBBA 3H2VA 2XLVA 3N2ZB 4I3MA 5DVWA 2GFHA 2KK1A 2XLHA 5A69A 2NUPB 2D5RB 3LNRA 1M2VB 2IXPA 4CIPA 3FOOA 3F46A 2LFDA 3EH1A 2J45A 2QNLA 2VB6A 4DVZA 5EGYA 4YK5A 1SYQA 2KJGA 3TD7A 2LP4A 2Y69C 4U9DA 3AG2C 4MVZA 1VYKA 4CJGA 3LEOA 4BJ6A 1BR1A 3U3BA 3AG4C 3L1MA 1C17M 1WASA 2IBFA 1M2VA 2HSQA 3B0PA 4EBBA 2PBEA 2YWAA 3ABLC 2YL3A 3G50A 4DRHB 1WTYA 4EWCA 5E33A 4CSAC 1Z23A 4CDVA 3TJ5A 5DQZA 1H9GA 3U3FA 4P9FA 1QZXA 2A68F 4JE9A 4DBRA 1M6TA 1VYIA 3GWNA 5EHHA 4U5GA 2CYDA 3NMKA 2OG2A 4DJ9A 3KL4A 4BJTA 4MNDA 4MTFA 2ETSA 2PNOA 2J0XA 3GM1A 3JSEO 2IM8A 2R02A 3EJNA 2HUJA 3ATPA 4IWBA 5AC4A 2QE9A 4ZLDA 3GM3A 4CJOA 2GAQA 3KYIA 3I5PA 1FFTC 3TJ6A 3W2WA 4BEMJ 4BJ1A 2R03A 3MX3A 5AGFA 5AC5A 4CIHA 4O6NA 4IAOA 4OD4A 1ZHZA 4U5HA 4OIOF 1ORJA 2J9UA 1JPNA 3NKDA 1KNYA 2XS8A 3CSKA 1WOLA 1YLMA 3DJUB 3EH2A 4CDAA 3S28A 3SNHA 2H7VC 2IXNA 3T6JA 1SR2A 4JVSA 5A6BD 3EGXB 4MVSA 2L81A 4XEKA 3U9JA 1VTMP 2AWYA 1VB5A 2XL4A 3M4CA 4CS8A 3W8HA 2WL8A 2YEVA 3H2UA 5L0CA 2MHRA 2ZD9A 1JMWA 2P0NA 3RQEA 4O7GA 3ZVRA 2Q4FA 2JPUA 3S0XA 4MW8A 4DBQA 1ZVZA 2R7QA 1OXKA 1TQGA 5L3VA 3EGXA 1S7ZA 4XLNF 3B0VC 3DKAA 1I4ZA 3Q7LA 5A6KA 5COGA 3GORA 3ZTZA 1Q0KA 1H7IA 1RKEB 2Q9BA 3DMDA 2KC3A 2JX0A 3LUTB 2GA0A 4ONSA 4WABA 3U2LA 4E18A 2Q9AA 3JCUQ 3WAQA 5KYNA 2NUTB 2NSFA 1R5ID 2EPNA 3M4BA 4HEAJ 4CSAA 3HJCA 4G7OF 1WWPA 1SMYF 2CDQA 3OWTA 4G7HF 3JZ0A 1RXQA 1RKEA 2J9BA 4IAQA 2Z15A 3FMSA 4UDVA 2L6GA 3A11A 2I8BA 3V5YA 1ZHXA 4CX9A 4ULWA 2XLWA 3TOLA 3WHNA 4EUKB 3VM6A 2CNWD 4N06A 2R7TA 4IJJA 2EPMX 1PD1A 4XPWA 1V54C 3MFNA 4G7ZF 2YVKA 2XXAA 2OU6A 2OEXA 1LS1A 1SZIA 2ASRA 4WJ0A 2HJ3A 2C04A 3GODA 1D1CA 3MYFA 4QDLA 3Q7GA 4XWJA 1IW7F 2A6HF 3RFYA 1I4YA 4I1MA 4NTAA 1PV3A 3DM9B 3IHUA 4GYTA 2FGYA 2XLMA 2CW0F 4LERA 3ZIBA 1E83A 1T5OA 1A7EA 2NG1A 2VCBA 5L0JA 3NRHA 4YT4A 3JRMO 4C3BA 5HV9A 1DOWA 2CCYA 2E87A 1LIHA 3NMJA 4GEHA 4JURI 2CGEA 1V74B 4C7OB 2F22A 2J7PD 2KSFA 2ZXRA 2EIKC 5BQGA 2EPKX 1H6GA 1ORSC 3KKBA 3LAYA 3DM5A 3LNMB 5JSLA 4FESA 1OR2A 1OR3A 1VOMA 2OCCC 3EHMA 1WATA 3JTLO 4HFFB 3Q6MA 2HV7A 3DXJF 2KW3C 1YAUO 1K05A 3TQOA 4C7OA 3DZAA 4BJ5C 4BEJA 5KYYB 3UMHA 5JVEA 2R7UA 1JRAA 1N1CA 1HW1A 2G62A 3JYYA 1VMAA 3U8PA 4OIPF 3EFOA 1T9KA 2OOCA 1LM3B 5E3CA 1B68A 2KQ9A 3C7JA 2CNWA 3ASNC 2WZLA 1FMVA 1G8XA 2PFDA 3SP1A 3US6A 4EBKA 1E2XA 3G4ZA 4PJNA 4E7SA 1GM5A 4WGYA 2YL7A 1ZHWA 3IQ6A 1CGOA 2A6EF 1BBHA 1TFOB 2Q3TA 2ZXPA 3UR3C 3U0CA 4OIQF 1OKKD 4LDQA 5CI9A 3RQGA 5TJ5E 2PX3A 3RW0A 2B0JA 2VASA 1RKCA 2YRFA 3W4YA 3PDMP 2R7RA 2QLAA 2YQYA 3X2QC 2LQGA 3NG1A 3AQBA 2PP4A 3AJMA 3R2PA 4N6HA 4NQFA 3S84A 2J46A 3VYWA 4YJWA 2NUPA 3OEOA 1QVXA 1TWHA 1LKXA 2XLDA 2LFFA 2O9XA 4RD9A 4JJGA 2J7PA 2OJED 1J8YF 4JEAA 2LD6A 1MQVA 2OEVA 3FVYA 2M64A 3FXHA 2AWCA 2XM0A 3M15A 3RVZA 4E0IA 5B1AC 1BR4A 4YWQA 3C62A 2H8AA 2P7VA 5DS5A 3SXYA 1Z6AA 1E84A 1QSPA 4L6RA 1QLEC 1YDIA 3E9VA 5JT4A 3SYNA 3JRTA 5T3WA 1ZU4A 4YN0B 1TKNA 4PK4A 3V5XA 2KNHA 2FAPB 1NZEA 3IPMO 4U9EA 3TOMA 5KYXB 4BJ5A 3ZQYA 3HNIA 2XL8A 2VH3A 3QTHA 4JTAB 4MVRA 3LLKA 5BQHA 2PF4E 1PCXA 1UFBA 4G0HA 1SF8A 3HKKA 4LDRA 1LI7A 1OCCC 1RJ9B 1OCZC 2WVNA 2YLDA 2R7OA 2HMQA 3NYLA 2OJQA 1ZHTA 3JT1A 3SXZA 4AX2A 3UGOA 2WVOA 4JC7A 5F5HA 1HMOA 2Q9CA 2XRHA 1APCA 3M79A 3B0UX 1OKKA 2QY9A 2J9VA 4YT5A 3SXMA 4W8KA 2EPLX 2G3KA 1JPJA 3EPVA 3RIPA 3HTKC 1VLTA 4KNVA 1RJ9A 4I1OB 3ZTMA 1A0BA 3FOPA 2Y3HA 1HY5A 3EGDB 4AE4B 1Y4CA 1T01A 2XM4A 2R05A 3U8VA 1JAFA 3NYMA 4D4XA 4K7BA 5JP7A 3W2VA 1ORYA 2P61A 3S27A 4DRIB 4FAPB 5CI8A 3RQFA 4C3EA 1MNEA 3EGDA 4MTOA 1YVIA 1L7CA 2GWWA 3ITFA 2W4MA 4CBEA 2KYHA 1PD0A 2R7SA 1GS9A 2XLEA 2EILC 3J06A 4PJMA 2HZ8A 4AL1A 2Y3DA 4PFOA 2EIJC 3O10A 4YL1A 3SXKA 4MS2A 2AU5A 5E3AA 1CGNA 1UG7A 1WGWA 3V5ZA 1ZZPA 4PJLA 2NUTA 3U5SA 4CDYA 1DOVA 3O6XA 1MMNA 2LSEA 4U5FE 2J8WA 2BC5A 4J7TA 1RCPA 1YYXA 1U89A 1A7VA 2IXOA 3IQ5A 1M56C 4LLEA 3VRCA 3W8IA 3NYJA 3FHDA 1LI5A 2Y3BA 2Y39A 1Z63A 1TWAA 3NKEA 1FAPB 3AGTA 2ZPAA 4KNWA 3V7OA 3L8IA 3B9QA 4JTDB 5KYWB 4E7ZA 5A6BA 1EQ1A 1K04A 3NDBB 2HFIA 4MVOA 5COFA 4Q4ZF 3EG9B 4BPMA 2R7XA 5B3IA 1FTSA 1ZU5A 3DD7A 1RMVA 1G5ZA 4FWVA 5IY5C 4MW3A 1KTMA 3ECSA 4DRJB 4NY3A 3TULA 4NTBA 2R7VA 5L0DA 4NC3A 4DOZA 3I5QA 1TR2A 2YL1A 5D92A 4EKWA 1O87A 2UUIA 5A6JA 4NCQA 1T6QA 2DB4A 5JS5A 2A69F 3GEHA 4XPXA 4QI2A 2FFHA 5CIVA 3AQCA 2IYLD 1FNTc 1V55C 4R32A 3SEOA 2WVQA 2WB7A 1Q0GA 4PFPA 3N24A 3IEEA 2EIMC 3H65A 3CAXA 2V3CC 1NU9C 3ASOC 4AL0A 2YHSA 1Z3IX 2LCHA 1EA8A 4FX5A 4JCHA 2L6FA 3QW1A 1K40A 4JIOA 4YT2A 3MLGA 4JJFA 5JRAA 2W9YA 1J8MF 3ZSUA 3N0TA 3L0IA 3C63A 4OD5A 2Q7RA 5KYYA 2EPOA 1BR2A 1YA7O 3VAYA 3WODF 1E85A 2YKZA 2VCAA 4K0DA 1I5NA 2MYSA 4JZAA 1HE1A 4CS9A 3B29A 5L0IA 1D0XA 1ZW2A 2HJMA 4O6MA 2L6HA 1LS4A 3T6BA 5L0GA 4NTFA 2AP3A 1LE4A 3LS0A 2AVKA 3KYJA 2WZGA 1D0YA 3FAJA 4KC9A 1M57C 1ZHYA 4PACA 3ZQVA 2H7BA 2OKUA 2IXMA 5HSWA 4M63A 4Q7CA 1OXBA 1TFKB 2P1AA 1NFOA 3ZWIA 1OQCA 2HS5A 1YJGA 4MQ9F 3LEVA 3T9OA 3PMRA 1BZ4A 3UMIA 1D0ZA 1OW7A 2LK4A 4D4NA 3CEXA 3QMKA 1C02A 3HNLA 4W8PA 2XL6A 1XWJA 4G78A 2ICWG 4WGZA 1O3UA 1QPUA 1L3PA 2BL2A 3QVYA 5L3QA 1CPQA 3CZ6A 5D91A 2HV6A 2QUPA 4YT8A 1M2OA 4JTCB 4JW1A 4I44A 3GWLA 5JLIA 3AG1C 3K1IC 4CS7A 2DYRC 1Y6DA 5KYUB 1EI7A 3DE8A 3T4RA 2A1DD 4XEVA 4LDKA 1EKYA 3QW0A 4MVMA 3GEEA 4HE8D 2W4BA 1QKRA 1ST6A 1Z5ZA 1MNDA 1TWGA 2VCCA 3G4XA 4A2NB 3HLZA 5KYUA 256BA 3R7CA 5F28E 2YZSA 1NG1A 3S9OA 3VF0A 1U6HA 4MVQA 1GGQA 1V4AA 1ZW3A 4P9TA 3DJNB 4MVUA 3GM2A 4U5EE 3F47A 4XPYA 2TMVP 2PX0A 5KYXA 2QTVA 4YL3A 2XLOA 2D4UA 3S29A 1OCRC 3Q6NA 4IRUA 4N6CA 5GPGB 3TK0A 2JD3A 3MBGA 1HE9A 1A41A 3L34A 3EZHA 3DAGA 1AUEA 5A6AA 2R25A 3C8GD 3EHNA 3RF3A 1HMDA 1YZAA 2BE5F 4EHPA 3DE9A 3S90A 5BQIA 2DGJA 4ER9A 3X1OA 2NPUA 2A0BA 3EQLF 5B1BC 3UNGC 3PHF2 3C18A 1OW8A 4XQ1A 1O5HA 3O55A 3MYIA 1FR0A 3KH2A 5COMA 2DI3A 2J9WA
chains in the Genus database with same CATH topology
3HNJA 1E86A 4CDVA 2YLIA 5B3IA 3U8PA 4JE9A 1LM3B 1M6TA 4IB4A 3NMKA 4WGYA 2YL7A 1CPRA 3IQ6A 1CGOA 4NC3A 1BBHA 2YLGA 2YL1A 4CJOA 5JS5A 2QLAA 3HNKA 5AGFA 4N6HA 4CDAA 2XLDA 3NMIA 1S05A 4JEAA 1MQVA 3QW1A 4N4WA 3M4CA 2XM0A 3M15A 5JRAA 2YL0A 3C63A 3C62A 1E85A 2YKZA 1E84A 4L6RA 5JT4A 3ZTZA 3TOMA 4ULVA 4U9EA 3ZQYA 3ZQVA 3HNIA 2XL8A 3M4BA 1YZCA 1YYJA 2YLDA 3ZWIA 2J9BA 4IAQA 1GQAA 3M79A 1APCA 4D4NA 1QQ3A 4CX9A 3HNLA 4WGZA 2XL6A 2XLWA 3TOLA 3ZTMA 3QVYA 1QPUA 3FOPA 1CPQA 2XM4A 5JLIA 1JAFA 4D4XA 5JUAA 3DE8A 5JP7A 4EIYA 4IARA 4JKVA 1EKYA 3QW0A 1E83A 2XLMA 256BA 4JEBA 2XLEA 3QVZA 2CCYA 3NMJA 1NBBA 2XLVA 1CGNA 2XLHA 2XLOA 4CDYA 4CIPA 3FOOA 2J8WA 2BC5A 1RCPA 1YYXA 5JSLA 1A7VA 3IQ5A 1YZAA 3VRCA 4U9DA 3DE9A 4CJGA 4ER9A 3L1MA 5JVEA 2YL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HNJ A;  1E86 A;  4CDV A;  2YLI A;  5B3I A;  3U8P A;  4JE9 A;  1LM3 B;  1M6T A;  4IB4 A;  3NMK A;  4WGY A;  2YL7 A;  1CPR A;  3IQ6 A;  1CGO A;  4NC3 A;  1BBH A;  2YLG A;  2YL1 A;  4CJO A;  5JS5 A;  2QLA A;  3HNK A;  5AGF A;  4N6H A;  4CDA A;  2XLD A;  3NMI A;  1S05 A;  4JEA A;  1MQV A;  3QW1 A;  4N4W A;  3M4C A;  2XM0 A;  3M15 A;  5JRA A;  2YL0 A;  3C63 A;  3C62 A;  1E85 A;  2YKZ A;  1E84 A;  4L6R A;  5JT4 A;  3ZTZ A;  3TOM A;  4ULV A;  4U9E A;  3ZQY A;  3ZQV A;  3HNI A;  2XL8 A;  3M4B A;  1YZC A;  1YYJ A;  2YLD A;  3ZWI A;  2J9B A;  4IAQ A;  1GQA A;  3M79 A;  1APC A;  4D4N A;  1QQ3 A;  4CX9 A;  3HNL A;  4WGZ A;  2XL6 A;  2XLW A;  3TOL A;  3ZTM A;  3QVY A;  1QPU A;  3FOP A;  1CPQ A;  2XM4 A;  5JLI A;  1JAF A;  4D4X A;  5JUA A;  3DE8 A;  5JP7 A;  4EIY A;  4IAR A;  4JKV A;  1EKY A;  3QW0 A;  1E83 A;  2XLM A;  256B A;  4JEB A;  2XLE A;  3QVZ A;  2CCY A;  3NMJ A;  1NBB A;  2XLV A;  1CGN A;  2XLH A;  2XLO A;  4CDY A;  4CIP A;  3FOO A;  2J8W A;  2BC5 A;  1RCP A;  1YYX A;  5JSL A;  1A7V A;  3IQ5 A;  1YZA A;  3VRC A;  4U9D A;  3DE9 A;  4CJG A;  4ER9 A;  3L1M A;  5JVE A;  2YL3 A; 
#chains in the Genus database with same CATH topology
 3HNJ A;  4BG0 A;  1OCO C;  2A0U A;  4AE4 A;  1E86 A;  1A7D A;  2HKV A;  2YLI A;  3LS1 A;  4U5D E;  4Q5S F;  3EZI A;  1H9T A;  2GDC A;  3WG7 C;  2XS1 A;  1NLX A;  1NFN A;  3JYH A;  4IB4 A;  1FFH A;  4PJJ A;  4X0R A;  3T6G B;  3PCV A;  4U5B E;  3CQZ A;  3E70 C;  4EBJ A;  4Z9H A;  4KBL A;  3RVY A;  2OQM A;  2RSE B;  2V26 A;  1CPR A;  1WN0 A;  1D1A A;  1Q0F A;  3ABK C;  2YLG A;  3RKO F;  1D1B A;  5K0I A;  2W45 A;  2I15 A;  3K1I A;  4RDA A;  4CS9 C;  2Y3G A;  1Q0M A;  1XZP A;  4JRZ A;  3HNK A;  4JCZ A;  1Z7Q c;  1LE2 A;  5T1D B;  3K33 A;  2IOQ A;  5BUO A;  2ZXO A;  4ZLC A;  3C8G B;  1AVO B;  1TWC A;  1FMW A;  3ABM C;  2EIN C;  4IGG A;  4XLP F;  5T3T A;  3K1H A;  5L0F A;  4PR9 A;  4E0H A;  3NMI A;  3O39 A;  3OA1 A;  2XXA B;  1S05 A;  5FZT A;  3RYL A;  4C3D A;  4N4W A;  2NSG A;  3GEI A;  4Z9I A;  4OIN F;  1BDJ B;  3SZR A;  5KYW A;  2YL0 A;  3C8G A;  4KI2 A;  1IZM A;  1LPE A;  4MTG A;  4U5C E;  2DYS C;  2HMZ A;  2P6V A;  5DS4 A;  1ZYR F;  5DLJ A;  1KU2 A;  2Q00 A;  2RD9 A;  1VLS A;  3EG9 A;  4GQH A;  1JOG A;  2KGO A;  3ZC4 A;  3LJB A;  3UGP A;  4AK9 A;  3K66 A;  3POV A;  4HFK B;  3QZC A;  3AG3 C;  4RBN A;  3K6B A;  3B71 A;  5FCL A;  1YAR O;  3BRJ A;  4BJ6 C;  1MMA A;  2L7A A;  4B6I A;  4ULV A;  1C03 A;  5E2Q A;  1G4U S;  2VC9 A;  2X0C A;  4DXW A;  4DVY P;  2H7O A;  1JR8 A;  3L8J A;  3AOU A;  1CGM E;  4P6I C;  2M4E A;  2XSE A;  1YZC A;  1MMD A;  1YYJ A;  1U0B B;  3FAP B;  4E17 A;  3JSZ A;  2J0W A;  1NU7 D;  3IQC A;  1NSG B;  1W2W A;  3K7D A;  3M1C B;  3UMK A;  1GQA A;  2R9R B;  1F1M A;  2C03 A;  4OIR F;  2X51 A;  4J30 B;  5DQT A;  4J7Y A;  1QQ3 A;  4H4K C;  2LIG A;  4H54 A;  1XZQ A;  1OW6 A;  3U2M A;  4F4B A;  1R4T A;  3AGU A;  4O79 A;  3A9C A;  4O6Y A;  2B0H A;  5DS6 A;  1AEP A;  1LVK A;  1T6U A;  3KMI A;  3LLI A;  5EK0 A;  5B3S C;  4LLC A;  3DWW A;  3EFO B;  4J32 B;  4QI0 A;  5JUA A;  1Q0D A;  3IQT A;  2G3V A;  3DI5 A;  2ZXW C;  4IAR A;  3BEH A;  3DAF A;  4XEF A;  4EIY A;  2L9J A;  5L0H A;  4Z9J A;  4JKV A;  3ZG1 A;  3RH3 A;  4ANJ A;  1VK5 A;  3FDQ A;  1YA9 A;  2HSB A;  3GAN A;  2WZF A;  4K1O A;  4LAC B;  4XTK A;  3C8Z A;  1G4W R;  3U9M A;  1MMG A;  5F5F A;  2UUH A;  1T6I A;  4JEB A;  2MWQ A;  3QVZ A;  3LES A;  3I4U A;  3ZDL A;  4A4A A;  3KPH A;  4YL0 A;  4CS8 C;  2R7W A;  1HW2 A;  1NBB A;  3H2V A;  2XLV A;  3N2Z B;  4I3M A;  5DVW A;  2GFH A;  2KK1 A;  2XLH A;  5A69 A;  2NUP B;  2D5R B;  3LNR A;  1M2V B;  2IXP A;  4CIP A;  3FOO A;  3F46 A;  2LFD A;  3EH1 A;  2J45 A;  2QNL A;  2VB6 A;  4DVZ A;  5EGY A;  4YK5 A;  1SYQ A;  2KJG A;  3TD7 A;  2LP4 A;  2Y69 C;  4U9D A;  3AG2 C;  4MVZ A;  1VYK A;  4CJG A;  3LEO A;  4BJ6 A;  1BR1 A;  3U3B A;  3AG4 C;  3L1M A;  1C17 M;  1WAS A;  2IBF A;  1M2V A;  2HSQ A;  3B0P A;  4EBB A;  2PBE A;  2YWA A;  3ABL C;  2YL3 A;  3G50 A;  4DRH B;  1WTY A;  4EWC A;  5E33 A;  4CSA C;  1Z23 A;  4CDV A;  3TJ5 A;  5DQZ A;  1H9G A;  3U3F A;  4P9F A;  1QZX A;  2A68 F;  4JE9 A;  4DBR A;  1M6T A;  1VYI A;  3GWN A;  5EHH A;  4U5G A;  2CYD A;  3NMK A;  2OG2 A;  4DJ9 A;  3KL4 A;  4BJT A;  4MND A;  4MTF A;  2ETS A;  2PNO A;  2J0X A;  3GM1 A;  3JSE O;  2IM8 A;  2R02 A;  3EJN A;  2HUJ A;  3ATP A;  4IWB A;  5AC4 A;  2QE9 A;  4ZLD A;  3GM3 A;  4CJO A;  2GAQ A;  3KYI A;  3I5P A;  1FFT C;  3TJ6 A;  3W2W A;  4BEM J;  4BJ1 A;  2R03 A;  3MX3 A;  5AGF A;  5AC5 A;  4CIH A;  4O6N A;  4IAO A;  4OD4 A;  1ZHZ A;  4U5H A;  4OIO F;  1ORJ A;  2J9U A;  1JPN A;  3NKD A;  1KNY A;  2XS8 A;  3CSK A;  1WOL A;  1YLM A;  3DJU B;  3EH2 A;  4CDA A;  3S28 A;  3SNH A;  2H7V C;  2IXN A;  3T6J A;  1SR2 A;  4JVS A;  5A6B D;  3EGX B;  4MVS A;  2L81 A;  4XEK A;  3U9J A;  1VTM P;  2AWY A;  1VB5 A;  2XL4 A;  3M4C A;  4CS8 A;  3W8H A;  2WL8 A;  2YEV A;  3H2U A;  5L0C A;  2MHR A;  2ZD9 A;  1JMW A;  2P0N A;  3RQE A;  4O7G A;  3ZVR A;  2Q4F A;  2JPU A;  3S0X A;  4MW8 A;  4DBQ A;  1ZVZ A;  2R7Q A;  1OXK A;  1TQG A;  5L3V A;  3EGX A;  1S7Z A;  4XLN F;  3B0V C;  3DKA A;  1I4Z A;  3Q7L A;  5A6K A;  5COG A;  3GOR A;  3ZTZ A;  1Q0K A;  1H7I A;  1RKE B;  2Q9B A;  3DMD A;  2KC3 A;  2JX0 A;  3LUT B;  2GA0 A;  4ONS A;  4WAB A;  3U2L A;  4E18 A;  2Q9A A;  3JCU Q;  3WAQ A;  5KYN A;  2NUT B;  2NSF A;  1R5I D;  2EPN A;  3M4B A;  4HEA J;  4CSA A;  3HJC A;  4G7O F;  1WWP A;  1SMY F;  2CDQ A;  3OWT A;  4G7H F;  3JZ0 A;  1RXQ A;  1RKE A;  2J9B A;  4IAQ A;  2Z15 A;  3FMS A;  4UDV A;  2L6G A;  3A11 A;  2I8B A;  3V5Y A;  1ZHX A;  4CX9 A;  4ULW A;  2XLW A;  3TOL A;  3WHN A;  4EUK B;  3VM6 A;  2CNW D;  4N06 A;  2R7T A;  4IJJ A;  2EPM X;  1PD1 A;  4XPW A;  1V54 C;  3MFN A;  4G7Z F;  2YVK A;  2XXA A;  2OU6 A;  2OEX A;  1LS1 A;  1SZI A;  2ASR A;  4WJ0 A;  2HJ3 A;  2C04 A;  3GOD A;  1D1C A;  3MYF A;  4QDL A;  3Q7G A;  4XWJ A;  1IW7 F;  2A6H F;  3RFY A;  1I4Y A;  4I1M A;  4NTA A;  1PV3 A;  3DM9 B;  3IHU A;  4GYT A;  2FGY A;  2XLM A;  2CW0 F;  4LER A;  3ZIB A;  1E83 A;  1T5O A;  1A7E A;  2NG1 A;  2VCB A;  5L0J A;  3NRH A;  4YT4 A;  3JRM O;  4C3B A;  5HV9 A;  1DOW A;  2CCY A;  2E87 A;  1LIH A;  3NMJ A;  4GEH A;  4JUR I;  2CGE A;  1V74 B;  4C7O B;  2F22 A;  2J7P D;  2KSF A;  2ZXR A;  2EIK C;  5BQG A;  2EPK X;  1H6G A;  1ORS C;  3KKB A;  3LAY A;  3DM5 A;  3LNM B;  5JSL A;  4FES A;  1OR2 A;  1OR3 A;  1VOM A;  2OCC C;  3EHM A;  1WAT A;  3JTL O;  4HFF B;  3Q6M A;  2HV7 A;  3DXJ F;  2KW3 C;  1YAU O;  1K05 A;  3TQO A;  4C7O A;  3DZA A;  4BJ5 C;  4BEJ A;  5KYY B;  3UMH A;  5JVE A;  2R7U A;  1JRA A;  1N1C A;  1HW1 A;  2G62 A;  3JYY A;  1VMA A;  3U8P A;  4OIP F;  3EFO A;  1T9K A;  2OOC A;  1LM3 B;  5E3C A;  1B68 A;  2KQ9 A;  3C7J A;  2CNW A;  3ASN C;  2WZL A;  1FMV A;  1G8X A;  2PFD A;  3SP1 A;  3US6 A;  4EBK A;  1E2X A;  3G4Z A;  4PJN A;  4E7S A;  1GM5 A;  4WGY A;  2YL7 A;  1ZHW A;  3IQ6 A;  1CGO A;  2A6E F;  1BBH A;  1TFO B;  2Q3T A;  2ZXP A;  3UR3 C;  3U0C A;  4OIQ F;  1OKK D;  4LDQ A;  5CI9 A;  3RQG A;  5TJ5 E;  2PX3 A;  3RW0 A;  2B0J A;  2VAS A;  1RKC A;  2YRF A;  3W4Y A;  3PDM P;  2R7R A;  2QLA A;  2YQY A;  3X2Q C;  2LQG A;  3NG1 A;  3AQB A;  2PP4 A;  3AJM A;  3R2P A;  4N6H A;  4NQF A;  3S84 A;  2J46 A;  3VYW A;  4YJW A;  2NUP A;  3OEO A;  1QVX A;  1TWH A;  1LKX A;  2XLD A;  2LFF A;  2O9X A;  4RD9 A;  4JJG A;  2J7P A;  2OJE D;  1J8Y F;  4JEA A;  2LD6 A;  1MQV A;  2OEV A;  3FVY A;  2M64 A;  3FXH A;  2AWC A;  2XM0 A;  3M15 A;  3RVZ A;  4E0I A;  5B1A C;  1BR4 A;  4YWQ A;  3C62 A;  2H8A A;  2P7V A;  5DS5 A;  3SXY A;  1Z6A A;  1E84 A;  1QSP A;  4L6R A;  1QLE C;  1YDI A;  3E9V A;  5JT4 A;  3SYN A;  3JRT A;  5T3W A;  1ZU4 A;  4YN0 B;  1TKN A;  4PK4 A;  3V5X A;  2KNH A;  2FAP B;  1NZE A;  3IPM O;  4U9E A;  3TOM A;  5KYX B;  4BJ5 A;  3ZQY A;  3HNI A;  2XL8 A;  2VH3 A;  3QTH A;  4JTA B;  4MVR A;  3LLK A;  5BQH A;  2PF4 E;  1PCX A;  1UFB A;  4G0H A;  1SF8 A;  3HKK A;  4LDR A;  1LI7 A;  1OCC C;  1RJ9 B;  1OCZ C;  2WVN A;  2YLD A;  2R7O A;  2HMQ A;  3NYL A;  2OJQ A;  1ZHT A;  3JT1 A;  3SXZ A;  4AX2 A;  3UGO A;  2WVO A;  4JC7 A;  5F5H A;  1HMO A;  2Q9C A;  2XRH A;  1APC A;  3M79 A;  3B0U X;  1OKK A;  2QY9 A;  2J9V A;  4YT5 A;  3SXM A;  4W8K A;  2EPL X;  2G3K A;  1JPJ A;  3EPV A;  3RIP A;  3HTK C;  1VLT A;  4KNV A;  1RJ9 A;  4I1O B;  3ZTM A;  1A0B A;  3FOP A;  2Y3H A;  1HY5 A;  3EGD B;  4AE4 B;  1Y4C A;  1T01 A;  2XM4 A;  2R05 A;  3U8V A;  1JAF A;  3NYM A;  4D4X A;  4K7B A;  5JP7 A;  3W2V A;  1ORY A;  2P61 A;  3S27 A;  4DRI B;  4FAP B;  5CI8 A;  3RQF A;  4C3E A;  1MNE A;  3EGD A;  4MTO A;  1YVI A;  1L7C A;  2GWW A;  3ITF A;  2W4M A;  4CBE A;  2KYH A;  1PD0 A;  2R7S A;  1GS9 A;  2XLE A;  2EIL C;  3J06 A;  4PJM A;  2HZ8 A;  4AL1 A;  2Y3D A;  4PFO A;  2EIJ C;  3O10 A;  4YL1 A;  3SXK A;  4MS2 A;  2AU5 A;  5E3A A;  1CGN A;  1UG7 A;  1WGW A;  3V5Z A;  1ZZP A;  4PJL A;  2NUT A;  3U5S A;  4CDY A;  1DOV A;  3O6X A;  1MMN A;  2LSE A;  4U5F E;  2J8W A;  2BC5 A;  4J7T A;  1RCP A;  1YYX A;  1U89 A;  1A7V A;  2IXO A;  3IQ5 A;  1M56 C;  4LLE A;  3VRC A;  3W8I A;  3NYJ A;  3FHD A;  1LI5 A;  2Y3B A;  2Y39 A;  1Z63 A;  1TWA A;  3NKE A;  1FAP B;  3AGT A;  2ZPA A;  4KNW A;  3V7O A;  3L8I A;  3B9Q A;  4JTD B;  5KYW B;  4E7Z A;  5A6B A;  1EQ1 A;  1K04 A;  3NDB B;  2HFI A;  4MVO A;  5COF A;  4Q4Z F;  3EG9 B;  4BPM A;  2R7X A;  5B3I A;  1FTS A;  1ZU5 A;  3DD7 A;  1RMV A;  1G5Z A;  4FWV A;  5IY5 C;  4MW3 A;  1KTM A;  3ECS A;  4DRJ B;  4NY3 A;  3TUL A;  4NTB A;  2R7V A;  5L0D A;  4NC3 A;  4DOZ A;  3I5Q A;  1TR2 A;  2YL1 A;  5D92 A;  4EKW A;  1O87 A;  2UUI A;  5A6J A;  4NCQ A;  1T6Q A;  2DB4 A;  5JS5 A;  2A69 F;  3GEH A;  4XPX A;  4QI2 A;  2FFH A;  5CIV A;  3AQC A;  2IYL D;  1FNT c;  1V55 C;  4R32 A;  3SEO A;  2WVQ A;  2WB7 A;  1Q0G A;  4PFP A;  3N24 A;  3IEE A;  2EIM C;  3H65 A;  3CAX A;  2V3C C;  1NU9 C;  3ASO C;  4AL0 A;  2YHS A;  1Z3I X;  2LCH A;  1EA8 A;  4FX5 A;  4JCH A;  2L6F A;  3QW1 A;  1K40 A;  4JIO A;  4YT2 A;  3MLG A;  4JJF A;  5JRA A;  2W9Y A;  1J8M F;  3ZSU A;  3N0T A;  3L0I A;  3C63 A;  4OD5 A;  2Q7R A;  5KYY A;  2EPO A;  1BR2 A;  1YA7 O;  3VAY A;  3WOD F;  1E85 A;  2YKZ A;  2VCA A;  4K0D A;  1I5N A;  2MYS A;  4JZA A;  1HE1 A;  4CS9 A;  3B29 A;  5L0I A;  1D0X A;  1ZW2 A;  2HJM A;  4O6M A;  2L6H A;  1LS4 A;  3T6B A;  5L0G A;  4NTF A;  2AP3 A;  1LE4 A;  3LS0 A;  2AVK A;  3KYJ A;  2WZG A;  1D0Y A;  3FAJ A;  4KC9 A;  1M57 C;  1ZHY A;  4PAC A;  3ZQV A;  2H7B A;  2OKU A;  2IXM A;  5HSW A;  4M63 A;  4Q7C A;  1OXB A;  1TFK B;  2P1A A;  1NFO A;  3ZWI A;  1OQC A;  2HS5 A;  1YJG A;  4MQ9 F;  3LEV A;  3T9O A;  3PMR A;  1BZ4 A;  3UMI A;  1D0Z A;  1OW7 A;  2LK4 A;  4D4N A;  3CEX A;  3QMK A;  1C02 A;  3HNL A;  4W8P A;  2XL6 A;  1XWJ A;  4G78 A;  2ICW G;  4WGZ A;  1O3U A;  1QPU A;  1L3P A;  2BL2 A;  3QVY A;  5L3Q A;  1CPQ A;  3CZ6 A;  5D91 A;  2HV6 A;  2QUP A;  4YT8 A;  1M2O A;  4JTC B;  4JW1 A;  4I44 A;  3GWL A;  5JLI A;  3AG1 C;  3K1I C;  4CS7 A;  2DYR C;  1Y6D A;  5KYU B;  1EI7 A;  3DE8 A;  3T4R A;  2A1D D;  4XEV A;  4LDK A;  1EKY A;  3QW0 A;  4MVM A;  3GEE A;  4HE8 D;  2W4B A;  1QKR A;  1ST6 A;  1Z5Z A;  1MND A;  1TWG A;  2VCC A;  3G4X A;  4A2N B;  3HLZ A;  5KYU A;  256B A;  3R7C A;  5F28 E;  2YZS A;  1NG1 A;  3S9O A;  3VF0 A;  1U6H A;  4MVQ A;  1GGQ A;  1V4A A;  1ZW3 A;  4P9T A;  3DJN B;  4MVU A;  3GM2 A;  4U5E E;  3F47 A;  4XPY A;  2TMV P;  2PX0 A;  5KYX A;  2QTV A;  4YL3 A;  2XLO A;  2D4U A;  3S29 A;  1OCR C;  3Q6N A;  4IRU A;  4N6C A;  5GPG B;  3TK0 A;  2JD3 A;  3MBG A;  1HE9 A;  1A41 A;  3L34 A;  3EZH A;  3DAG A;  1AUE A;  5A6A A;  2R25 A;  3C8G D;  3EHN A;  3RF3 A;  1HMD A;  1YZA A;  2BE5 F;  4EHP A;  3DE9 A;  3S90 A;  5BQI A;  2DGJ A;  4ER9 A;  3X1O A;  2NPU A;  2A0B A;  3EQL F;  5B1B C;  3UNG C;  3PHF 2;  3C18 A;  1OW8 A;  4XQ1 A;  1O5H A;  3O55 A;  3MYI A;  1FR0 A;  3KH2 A;  5COM A;  2DI3 A;  2J9W A; 
#chains in the Genus database with same CATH homology
 3HNJ A;  1E86 A;  4CDV A;  2YLI A;  5B3I A;  3U8P A;  4JE9 A;  1LM3 B;  1M6T A;  4IB4 A;  3NMK A;  4WGY A;  2YL7 A;  1CPR A;  3IQ6 A;  1CGO A;  4NC3 A;  1BBH A;  2YLG A;  2YL1 A;  4CJO A;  5JS5 A;  2QLA A;  3HNK A;  5AGF A;  4N6H A;  4CDA A;  2XLD A;  3NMI A;  1S05 A;  4JEA A;  1MQV A;  3QW1 A;  4N4W A;  3M4C A;  2XM0 A;  3M15 A;  5JRA A;  2YL0 A;  3C63 A;  3C62 A;  1E85 A;  2YKZ A;  1E84 A;  4L6R A;  5JT4 A;  3ZTZ A;  3TOM A;  4ULV A;  4U9E A;  3ZQY A;  3ZQV A;  3HNI A;  2XL8 A;  3M4B A;  1YZC A;  1YYJ A;  2YLD A;  3ZWI A;  2J9B A;  4IAQ A;  1GQA A;  3M79 A;  1APC A;  4D4N A;  1QQ3 A;  4CX9 A;  3HNL A;  4WGZ A;  2XL6 A;  2XLW A;  3TOL A;  3ZTM A;  3QVY A;  1QPU A;  3FOP A;  1CPQ A;  2XM4 A;  5JLI A;  1JAF A;  4D4X A;  5JUA A;  3DE8 A;  5JP7 A;  4EIY A;  4IAR A;  4JKV A;  1EKY A;  3QW0 A;  1E83 A;  2XLM A;  256B A;  4JEB A;  2XLE A;  3QVZ A;  2CCY A;  3NMJ A;  1NBB A;  2XLV A;  1CGN A;  2XLH A;  2XLO A;  4CDY A;  4CIP A;  3FOO A;  2J8W A;  2BC5 A;  1RCP A;  1YYX A;  5JSL A;  1A7V A;  3IQ5 A;  1YZA A;  3VRC A;  4U9D A;  3DE9 A;  4CJG A;  4ER9 A;  3L1M A;  5JVE A;  2YL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...