2HZ8A

Qm/mm structure refined from nmr-structure of a single chain diiron protein
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
115
structure length
115
Chain Sequence
MDELRELLKAEQQAIKIYKEVLKKAKEGDEQELARLIQEIVKAEKQAVKVYKEAAEKARNPEKRQVIDKILEDEEKHIEWLKAASKQGNAEQFASLVQQILQDEQRHVEEIEKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords De novo designed diiron protein
publication title Solution NMR structure of a designed metalloprotein and complementary molecular dynamics refinement.
pubmed doi rcsb
source organism Escherichia coli
total genus 49
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.660 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) IL-4 antagonist (De novo design) like domain 2hz8A00
1Y4CA 2LFDA 3U8VA 2HZ8A 2LFFA
chains in the Genus database with same CATH superfamily
1XWJA 2WVQA 2YL3A 1MNEA 1PD1A 1SR2A 5A6BA 4XTKA 4B6IA 2Y3BA 5L0IA 3VF0A 3JYHA 5COGA 3ZVRA 1EA8A 2NUTB 4Q7CA 4XEKA 2XS1A 3S9OA 3U8PA 1WN0A 2BL2A 2XRHA 4L6RA 4ULVA 4XPWA 5BQIA 2NUPA 1H9TA 1OKKD 2D5RB 2M64A 1LS4A 4RD9A 1J8MF 1Z3IX 3NG1A 4C3EA 1D0ZA 2XLOA 1YDIA 3RFYA 3C8GD 1IW7F 1VMAA 3EG9B 5KYYB 2TMVP 3HKKA 1JPNA 3ZQVA 4CSAC 4R32A 4I1MA 1T9KA 1LS1A 2WZFA 4MVUA 1TQGA 2OJQA 3NYLA 1W2WA 3NYMA 3TJ6A 4CJGA 1K05A 1D0YA 4O79A 1H6GA 4JURI 3U3BA 4J32B 2EPOA 4MNDA 3TULA 2J0WA 3EHNA 3ZTMA 3AJMA 4Z9JA 3SXMA 3US6A 3EZIA 2R25A 1K40A 3AG3C 4CDAA 3DKAA 1ZHYA 2J0XA 4MVSA 3ZQYA 1ZHTA 3U2MA 4IGGA 3RVZA 5EHHA 1T6QA 2XM4A 3KMIA 2OOCA 1Z6AA 3GEHA 4CS8A 3PMRA 1YAUO 4JCZA 2YL7A 5AC5A 3OA1A 5B3SC 5DS6A 4ANJA 3ABKC 1U6HA 1LVKA 2XLWA 2W4MA 3B0PA 4OIOF 3L34A 4U5GA 2XXAB 1G4US 4PJLA 3U3FA 3ABLC 4YT4A 1LI5A 3O55A 4WABA 3O6XA 2CYDA 2VCAA 1NLXA 3AQBA 2L6GA 4QI0A 2ZPAA 3HNIA 5AGFA 2H7VC 4JJGA 3GORA 2W4BA 3MYIA 1NU7D 1V55C 1FR0A 1JRAA 2HMZA 1UG7A 4YT5A 3Q7LA 2HS5A 1K04A 5B3IA 3DZAA 2HMQA 1APCA 4KC9A 3U9JA 3SNHA 4CX9A 5FZTA 2B0JA 2J9VA 2J46A 2RD9A 2RSEB 4P9TA 4DXWA 4E18A 3TJ5A 5A6AA 3V5YA 1QSPA 1LE4A 2AWYA 3JRMO 4K7BA 2Q9AA 2L6FA 4DVZA 4G7HF 4YL1A 3RQFA 3VM6A 3ZWIA 2VH3A 4N4WA 3K1IC 1FMVA 1OW7A 4YK5A 2W9YA 3T6GB 1Y6DA 2G3KA 1BBHA 3PHF2 1BR4A 1XZQA 2VCBA 2YL0A 3AGTA 1LPEA 4MTGA 1CPQA 3RH3A 3SYNA 4BJ6C 3DWWA 2KC3A 2KYHA 4GYTA 1U0BB 2KNHA 4MQ9F 5A6JA 3UR3C 4K0DA 5K0IA 1S7ZA 3I4UA 4O6MA 4BJ1A 2MYSA 1I5NA 2V3CC 3HTKC 2EIKC 3OWTA 1H7IA 1T01A 1T6UA 2J9UA 3MX3A 4NC3A 3LLIA 1TFOB 4PFPA 5KYXB 1VYKA 2Q3TA 2XL4A 3QZCA 3NMKA 4Q5SF 3E70C 2ZXWC 4CDYA 3SP1A 3QW0A 1LIHA 2M4EA 1V74B 1I4ZA 4U9DA 5E3CA 3G50A 5L0FA 3NKDA 1A7DA 3R7CA 3G4XA 3KH2A 1TWHA 5A69A 3TOLA 3MYFA 3Q7GA 4J7YA 3W4YA 2XM0A 1AEPA 2J7PA 4XEFA 2NG1A 2KQ9A 2DYRC 3N24A 1R5ID 4U5EE 4XLPF 1NFNA 3ASNC 4IB4A 4G78A 3L0IA 5GPGB 1WOLA 5CI9A 3ZIBA 3NKEA 1L3PA 2XLEA 1NFOA 1OXBA 5HSWA 5D92A 2P7VA 2OQMA 3DAFA 1TKNA 1JPJA 3K6BA 3W2VA 5L0JA 2LFDA 5JSLA 4KI2A 3QVYA 2EPMX 4YL3A 3WHNA 3FDQA 4YJWA 3DJNB 2ETSA 3RW0A 3N0TA 5JT4A 3T4RA 2ZD9A 3RKOF 3V5ZA 2H7OA 1VOMA 3FXHA 3TK0A 1DOVA 4CS9A 4ZLCA 3FHDA 4KBLA 1ZHWA 3RIPA 2LK4A 5DQTA 4IAOA 2J8WA 5T3TA 3JT1A 5KYWB 3K33A 4C7OA 4QI2A 3LS1A 1ORJA 3S29A 5A6BD 5JS5A 2JX0A 1GGQA 2R7UA 1SZIA 2EPKX 2GA0A 3C63A 1HE9A 3HJCA 3B0VC 2H7BA 1WASA 4DBQA 1VLSA 2L6HA 3EGXB 3I5PA 3JSZA 3T6BA 2P1AA 3GEIA 3LNRA 4BG0A 1LI7A 2ICWG 1RJ9B 2CW0F 3DJUB 1HMOA 2KJGA 1ZU5A 5JUAA 2IM8A 4JE9A 4P9FA 1YZCA 2DYSC 2OKUA 2J9WA 1V54C 4J7TA 2LCHA 3RVYA 4G0HA 4JTAB 3AG1C 2QUPA 3EQLF 2ZXOA 2Q4FA 4N6CA 2XLDA 4JVSA 2Q9BA 2R05A 1Q0DA 2CNWD 4HFFB 3LJBA 1F1MA 4Z9IA 1BR1A 1CGOA 1WWPA 3SEOA 2JPUA 5A6KA 3CSKA 3H65A 4NTAA 1I4YA 4PR9A 4D4NA 3FAPB 5KYXA 3M79A 4MVQA 1IZMA 4RDAA 1JAFA 3W8IA 3TD7A 3WG7C 5F5HA 4G7ZF 2KW3C 1TWAA 3FOPA 2GFHA 2DGJA 2Y3DA 3FOOA 4X0RA 1E85A 1Y4CA 4OD5A 3M4BA 3V7OA 1Z23A 4CDVA 1OW6A 3NMIA 4LLCA 2YLGA 2IBFA 3EH2A 4JW1A 2VCCA 1OCRC 3LNMB 5EK0A 4BEMJ 1Q0MA 1SF8A 2LD6A 2YRFA 2WZGA 1PD0A 2AWCA 4XPYA 2PF4E 3UGOA 4YL0A 1VTMP 2IOQA 3ZSUA 4CIHA 4RBNA 1A7EA 1OCZC 2HSBA 1EQ1A 2A1DD 3K7DA 3NMJA 1RMVA 3U9MA 5DS4A 2IXPA 2J9BA 2W45A 1AVOB 3EGDA 4ZLDA 3C8GA 1DOWA 1E86A 4JTDB 1RXQA 4O6YA 4YN0B 2JD3A 4I44A 5BQHA 2X0CA 1LE2A 5HV9A 2R7VA 5E3AA 2LP4A 1NG1A 1KNYA 3IPMO 4BJ5A 3U0CA 2X51A 4OIQF 3U2LA 2CGEA 2LSEA 1H9GA 3HNLA 2A6EF 4W8KA 3H2UA 3C62A 2J45A 4U5FE 5T3WA 3C8ZA 2Y39A 4CJOA 1OXKA 3MFNA 3EFOA 1Q0KA 4IJJA 3VYWA 5FCLA 3N2ZB 5DS5A 3OEOA 1ZHZA 1Q0GA 1S05A 2VASA 1RKEB 2ZXPA 3LLKA 3Q6MA 2GWWA 4O7GA 3UMHA 3GODA 3M15A 2LQGA 2NUTA 4BEJA 5L0CA 1C17M 1JMWA 1L7CA 4CS9C 3DM9B 3C7JA 4AE4B 1R4TA 5AC4A 2YQYA 2HFIA 2Y3HA 4DRHB 3S90A 2YLDA 3CQZA 4FWVA 3ZG1A 3GWLA 4PJNA 4ER9A 1O3UA 4JRZA 1B68A 1GQAA 3MLGA 2DB4A 3EG9A 5KYYA 5JP7A 2HJMA 3UGPA 1CPRA 3IHUA 4PK4A 2EINC 4CSAA 2C03A 2I8BA 3MBGA 3NDBB 1D1BA 3X2QC 1JOGA 2R03A 2XLHA 3WAQA 1RCPA 3PCVA 2YHSA 2R7TA 2P0NA 2IXOA 4FX5A 2EIMC 3U5SA 1QPUA 1M6TA 2FAPB 2WVOA 3TQOA 3M4CA 3GANA 1E84A 5JVEA 4MVOA 4H4KC 2EPLX 3NYJA 2YVKA 3NRHA 3AOUA 3KKBA 4NTFA 4NY3A 2R7RA 3VRCA 4IWBA 4XLNF 2XXAA 5F5FA 3GWNA 1VLTA 3W8HA 2BC5A 5IY5C 1TWGA 1GM5A 1A41A 3F46A 4FESA 4OIRF 1JR8A 1QQ3A 2KSFA 3BRJA 2R7OA 1KU2A 3GM3A 4E17A 4FAPB 5JLIA 3B0UX 4MW8A 2OU6A 2HSQA 3ECSA 3IQTA 3HLZA 2R02A 1FMWA 2AVKA 4KNVA 2VB6A 2UUHA 2UUIA 4CS8C 1E2XA 3X1OA 4DRJB 4YT2A 3S84A 1TR2A 3HNJA 3EZHA 3L8IA 4JJFA 5DQZA 4EBBA 1FAPB 1KTMA 3ITFA 1FFTC 2HUJA 2P6VA 4LLEA 3UMIA 3CEXA 4MVRA 3ZTZA 1PCXA 3C18A 4JC7A 4LACB 4AL0A 4E0IA 3ASOC 2PNOA 1YARO 2PX0A 5L3VA 3DAGA 3DE9A 1LKXA 3GEEA 4E0HA 4A2NB 3JSEO 1OCOC 5KYUB 2Q9CA 3SXKA 2FFHA 5E2QA 1V4AA 4WGYA 5COMA 3HNKA 4MW3A 2XS8A 4LDRA 2PP4A 1A0BA 4O6NA 4XWJA 2HJ3A 3JCUQ 4AX2A 4U9EA 1ZYRF 1T5OA 3JYYA 3IQCA 2LFFA 1G8XA 2Q00A 2XLVA 4JEAA 4JKVA 3M1CB 1D1CA 2L7AA 1E83A 1ZVZA 1M2OA 2OEXA 3BEHA 3EHMA 3Q6NA 1MMNA 2QLAA 4U5DE 4JTCB 1QVXA 4A4AA 4BPMA 1BDJB 1WATA 3H2VA 1G5ZA 1EKYA 2G3VA 3SXYA 2I15A 4I1OB 3UMKA 2NSFA 4ONSA 2B0HA 4KNWA 1HW1A 3LEVA 1YZAA 2R7XA 4NCQA 3RQEA 4WJ0A 4U5CE 2YL1A 3SZRA 2R7QA 1YYXA 4LDQA 1OR3A 3S27A 5DLJA 1C03A 1NZEA 4U5BE 2VC9A 1D1AA 3CZ6A 3AG2C 2EILC 3QTHA 3L1MA 5L0DA 1CGNA 2HKVA 5E33A 4G7OF 4DRIB 2PBEA 3AQCA 1WTYA 1ZHXA 4GQHA 1RKCA 2A6HF 1GS9A 2MHRA 2OG2A 4Z9HA 1OKKA 4HFKB 1NSGB 2HV6A 3QMKA 4AK9A 1YA9A 2WZLA 2CNWA 1YA7O 3ATPA 3F47A 3IQ6A 4JZAA 4EWCA 3B71A 3I5QA 4ULWA 1T6IA 2Y3GA 2YZSA 3G4ZA 4C3BA 1AUEA 2GDCA 1BR2A 2CDQA 3DM5A 4JIOA 1FTSA 1M56C 2G62A 3B9QA 1ZW3A 4DJ9A 1J8YF 3LUTB 3AGUA 4YWQA 4IARA 2O9XA 2R7SA 5KYWA 3RF3A 5L0GA 1HW2A 2PFDA 1SMYF 3T6JA 3VAYA 4UDVA 2KK1A 4NQFA 1MMGA 2NSGA 2GAQA 3EPVA 4N6HA 1Z7Qc 3EGXA 3RQGA 2XL8A 3V5XA 2BE5F 3JTLO 4K1OA 5KYUA 3POVA 4D4XA 1M2VB 1RJ9A 2CCYA 3QVZA 1N1CA 5BUOA 2Q7RA 4I3MA 2A68F 3TOMA 2QE9A 3DE8A 4XQ1A 2C04A 2QTVA 1ZU4A 3DD7A 1YLMA 3K66A 3KPHA 2WB7A 3A9CA 4HE8D 3FMSA 4XEVA 1FNTc 4EBKA 3O39A 2MWQA 4PACA 4IRUA 4C7OB 2V26A 5TJ5E 1VYIA 1TWCA 4M63A 1BZ4A 1OW8A 2Z15A 1SYQA 4XPXA 5EGYA 4EUKB 1U89A 4W8PA 3U8VA 2H8AA 3EH1A 1PV3A 1QZXA 1VK5A 2ZXRA 5COFA 3FVYA 3ZC4A 1QLEC 2Y69C 1ST6A 3GM1A 3IQ5A 3L8JA 4MS2A 2ASRA 4PFOA 1LM3B 5F28E 2F22A 2J7PD 2R9RB 3R2PA 4OIPF 2WL8A 4Q4ZF 1Z5ZA 2YWAA 3LEOA 5L0HA 4NTBA 2L9JA 4H54A 4BJTA 4EHPA 2OCCC 2PX3A 1OCCC 3QW1A 2NUPB 4QDLA 3T9OA 4C3DA 4J30B 2FGYA 3LESA 4CIPA 1CGME 1A7VA 1OQCA 1Q0FA 1XZPA 4LERA 2EIJC 1G4WR 1YJGA 4PJMA 4F4BA 2E87A 1O5HA 3DXJF 4HEAJ 2R7WA 3K1HA 4GEHA 1QKRA 3EJNA 3KL4A 4MVMA 3RYLA 4E7SA 1M57C 256BA 4JEBA 4AL1A 2WVNA 4JCHA 3UNGC 4EIYA 2YKZA 3KYIA 4CS7A 3ABMC 3O10A 4OINF 4OD4A 1NU9C 1OR2A 2AP3A 2OEVA 3IEEA 4DOZA 4MTOA 3PDMP 1HY5A 1ORYA 1D0XA 4DVYP 2YEVA 3SXZA 3AG4C 3DMDA 2HZ8A 1NBBA 2AU5A 3J06A 3DI5A 1HMDA 2NPUA 2IXMA 3KYJA 3LAYA 4U5HA 2DI3A 4WGZA 5DVWA 2IYLD 4PJJA 5BQGA 1UFBA 5T1DB 1ZZPA 1FFHA 5JRAA 5B1AC 4E7ZA 5L3QA 1MMDA 2IXNA 4EKWA 3W2WA 1M2VA 2HV7A 1RKEA 2OJED 1MNDA 2QY9A 1MQVA 3C8GB 3EGDB 3A11A 3K1IA 4IAQA 1EI7A 2YLIA 1C02A 4BJ5C 2XSEA 1O87A 1ZW2A 2P61A 4LDKA 4MVZA 3ZDLA 4EBJA 4P6IC 4AE4A 3B29A 5CIVA 5B1BC 5KYNA 1YYJA 3JZ0A 4BJ6A 3WODF 1VB5A 2QNLA 2KGOA 3FAJA 1MMAA 2D4UA 2EPNA 5D91A 2A69F 5CI8A 2XLMA 1WGWA 4MTFA 1Z63A 2LIGA 3S28A 4CBEA 2L81A 1HE1A 1TFKB 3CAXA 3E9VA 4YT8A 4N06A 3EFOB 3S0XA 2A0BA 3JRTA 4DBRA 2XL6A 1ORSC 3LS0A 2A0UA 3GM2A 1YVIA
chains in the Genus database with same CATH topology
1Y4CA 2LFDA 3U8VA 2HZ8A 2LFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y4C A;  2LFD A;  3U8V A;  2HZ8 A;  2LFF A; 
#chains in the Genus database with same CATH topology
 1XWJ A;  2WVQ A;  2YL3 A;  1MNE A;  1PD1 A;  1SR2 A;  5A6B A;  4XTK A;  4B6I A;  2Y3B A;  5L0I A;  3VF0 A;  3JYH A;  5COG A;  3ZVR A;  1EA8 A;  2NUT B;  4Q7C A;  4XEK A;  2XS1 A;  3S9O A;  3U8P A;  1WN0 A;  2BL2 A;  2XRH A;  4L6R A;  4ULV A;  4XPW A;  5BQI A;  2NUP A;  1H9T A;  1OKK D;  2D5R B;  2M64 A;  1LS4 A;  4RD9 A;  1J8M F;  1Z3I X;  3NG1 A;  4C3E A;  1D0Z A;  2XLO A;  1YDI A;  3RFY A;  3C8G D;  1IW7 F;  1VMA A;  3EG9 B;  5KYY B;  2TMV P;  3HKK A;  1JPN A;  3ZQV A;  4CSA C;  4R32 A;  4I1M A;  1T9K A;  1LS1 A;  2WZF A;  4MVU A;  1TQG A;  2OJQ A;  3NYL A;  1W2W A;  3NYM A;  3TJ6 A;  4CJG A;  1K05 A;  1D0Y A;  4O79 A;  1H6G A;  4JUR I;  3U3B A;  4J32 B;  2EPO A;  4MND A;  3TUL A;  2J0W A;  3EHN A;  3ZTM A;  3AJM A;  4Z9J A;  3SXM A;  3US6 A;  3EZI A;  2R25 A;  1K40 A;  3AG3 C;  4CDA A;  3DKA A;  1ZHY A;  2J0X A;  4MVS A;  3ZQY A;  1ZHT A;  3U2M A;  4IGG A;  3RVZ A;  5EHH A;  1T6Q A;  2XM4 A;  3KMI A;  2OOC A;  1Z6A A;  3GEH A;  4CS8 A;  3PMR A;  1YAU O;  4JCZ A;  2YL7 A;  5AC5 A;  3OA1 A;  5B3S C;  5DS6 A;  4ANJ A;  3ABK C;  1U6H A;  1LVK A;  2XLW A;  2W4M A;  3B0P A;  4OIO F;  3L34 A;  4U5G A;  2XXA B;  1G4U S;  4PJL A;  3U3F A;  3ABL C;  4YT4 A;  1LI5 A;  3O55 A;  4WAB A;  3O6X A;  2CYD A;  2VCA A;  1NLX A;  3AQB A;  2L6G A;  4QI0 A;  2ZPA A;  3HNI A;  5AGF A;  2H7V C;  4JJG A;  3GOR A;  2W4B A;  3MYI A;  1NU7 D;  1V55 C;  1FR0 A;  1JRA A;  2HMZ A;  1UG7 A;  4YT5 A;  3Q7L A;  2HS5 A;  1K04 A;  5B3I A;  3DZA A;  2HMQ A;  1APC A;  4KC9 A;  3U9J A;  3SNH A;  4CX9 A;  5FZT A;  2B0J A;  2J9V A;  2J46 A;  2RD9 A;  2RSE B;  4P9T A;  4DXW A;  4E18 A;  3TJ5 A;  5A6A A;  3V5Y A;  1QSP A;  1LE4 A;  2AWY A;  3JRM O;  4K7B A;  2Q9A A;  2L6F A;  4DVZ A;  4G7H F;  4YL1 A;  3RQF A;  3VM6 A;  3ZWI A;  2VH3 A;  4N4W A;  3K1I C;  1FMV A;  1OW7 A;  4YK5 A;  2W9Y A;  3T6G B;  1Y6D A;  2G3K A;  1BBH A;  3PHF 2;  1BR4 A;  1XZQ A;  2VCB A;  2YL0 A;  3AGT A;  1LPE A;  4MTG A;  1CPQ A;  3RH3 A;  3SYN A;  4BJ6 C;  3DWW A;  2KC3 A;  2KYH A;  4GYT A;  1U0B B;  2KNH A;  4MQ9 F;  5A6J A;  3UR3 C;  4K0D A;  5K0I A;  1S7Z A;  3I4U A;  4O6M A;  4BJ1 A;  2MYS A;  1I5N A;  2V3C C;  3HTK C;  2EIK C;  3OWT A;  1H7I A;  1T01 A;  1T6U A;  2J9U A;  3MX3 A;  4NC3 A;  3LLI A;  1TFO B;  4PFP A;  5KYX B;  1VYK A;  2Q3T A;  2XL4 A;  3QZC A;  3NMK A;  4Q5S F;  3E70 C;  2ZXW C;  4CDY A;  3SP1 A;  3QW0 A;  1LIH A;  2M4E A;  1V74 B;  1I4Z A;  4U9D A;  5E3C A;  3G50 A;  5L0F A;  3NKD A;  1A7D A;  3R7C A;  3G4X A;  3KH2 A;  1TWH A;  5A69 A;  3TOL A;  3MYF A;  3Q7G A;  4J7Y A;  3W4Y A;  2XM0 A;  1AEP A;  2J7P A;  4XEF A;  2NG1 A;  2KQ9 A;  2DYR C;  3N24 A;  1R5I D;  4U5E E;  4XLP F;  1NFN A;  3ASN C;  4IB4 A;  4G78 A;  3L0I A;  5GPG B;  1WOL A;  5CI9 A;  3ZIB A;  3NKE A;  1L3P A;  2XLE A;  1NFO A;  1OXB A;  5HSW A;  5D92 A;  2P7V A;  2OQM A;  3DAF A;  1TKN A;  1JPJ A;  3K6B A;  3W2V A;  5L0J A;  2LFD A;  5JSL A;  4KI2 A;  3QVY A;  2EPM X;  4YL3 A;  3WHN A;  3FDQ A;  4YJW A;  3DJN B;  2ETS A;  3RW0 A;  3N0T A;  5JT4 A;  3T4R A;  2ZD9 A;  3RKO F;  3V5Z A;  2H7O A;  1VOM A;  3FXH A;  3TK0 A;  1DOV A;  4CS9 A;  4ZLC A;  3FHD A;  4KBL A;  1ZHW A;  3RIP A;  2LK4 A;  5DQT A;  4IAO A;  2J8W A;  5T3T A;  3JT1 A;  5KYW B;  3K33 A;  4C7O A;  4QI2 A;  3LS1 A;  1ORJ A;  3S29 A;  5A6B D;  5JS5 A;  2JX0 A;  1GGQ A;  2R7U A;  1SZI A;  2EPK X;  2GA0 A;  3C63 A;  1HE9 A;  3HJC A;  3B0V C;  2H7B A;  1WAS A;  4DBQ A;  1VLS A;  2L6H A;  3EGX B;  3I5P A;  3JSZ A;  3T6B A;  2P1A A;  3GEI A;  3LNR A;  4BG0 A;  1LI7 A;  2ICW G;  1RJ9 B;  2CW0 F;  3DJU B;  1HMO A;  2KJG A;  1ZU5 A;  5JUA A;  2IM8 A;  4JE9 A;  4P9F A;  1YZC A;  2DYS C;  2OKU A;  2J9W A;  1V54 C;  4J7T A;  2LCH A;  3RVY A;  4G0H A;  4JTA B;  3AG1 C;  2QUP A;  3EQL F;  2ZXO A;  2Q4F A;  4N6C A;  2XLD A;  4JVS A;  2Q9B A;  2R05 A;  1Q0D A;  2CNW D;  4HFF B;  3LJB A;  1F1M A;  4Z9I A;  1BR1 A;  1CGO A;  1WWP A;  3SEO A;  2JPU A;  5A6K A;  3CSK A;  3H65 A;  4NTA A;  1I4Y A;  4PR9 A;  4D4N A;  3FAP B;  5KYX A;  3M79 A;  4MVQ A;  1IZM A;  4RDA A;  1JAF A;  3W8I A;  3TD7 A;  3WG7 C;  5F5H A;  4G7Z F;  2KW3 C;  1TWA A;  3FOP A;  2GFH A;  2DGJ A;  2Y3D A;  3FOO A;  4X0R A;  1E85 A;  1Y4C A;  4OD5 A;  3M4B A;  3V7O A;  1Z23 A;  4CDV A;  1OW6 A;  3NMI A;  4LLC A;  2YLG A;  2IBF A;  3EH2 A;  4JW1 A;  2VCC A;  1OCR C;  3LNM B;  5EK0 A;  4BEM J;  1Q0M A;  1SF8 A;  2LD6 A;  2YRF A;  2WZG A;  1PD0 A;  2AWC A;  4XPY A;  2PF4 E;  3UGO A;  4YL0 A;  1VTM P;  2IOQ A;  3ZSU A;  4CIH A;  4RBN A;  1A7E A;  1OCZ C;  2HSB A;  1EQ1 A;  2A1D D;  3K7D A;  3NMJ A;  1RMV A;  3U9M A;  5DS4 A;  2IXP A;  2J9B A;  2W45 A;  1AVO B;  3EGD A;  4ZLD A;  3C8G A;  1DOW A;  1E86 A;  4JTD B;  1RXQ A;  4O6Y A;  4YN0 B;  2JD3 A;  4I44 A;  5BQH A;  2X0C A;  1LE2 A;  5HV9 A;  2R7V A;  5E3A A;  2LP4 A;  1NG1 A;  1KNY A;  3IPM O;  4BJ5 A;  3U0C A;  2X51 A;  4OIQ F;  3U2L A;  2CGE A;  2LSE A;  1H9G A;  3HNL A;  2A6E F;  4W8K A;  3H2U A;  3C62 A;  2J45 A;  4U5F E;  5T3W A;  3C8Z A;  2Y39 A;  4CJO A;  1OXK A;  3MFN A;  3EFO A;  1Q0K A;  4IJJ A;  3VYW A;  5FCL A;  3N2Z B;  5DS5 A;  3OEO A;  1ZHZ A;  1Q0G A;  1S05 A;  2VAS A;  1RKE B;  2ZXP A;  3LLK A;  3Q6M A;  2GWW A;  4O7G A;  3UMH A;  3GOD A;  3M15 A;  2LQG A;  2NUT A;  4BEJ A;  5L0C A;  1C17 M;  1JMW A;  1L7C A;  4CS9 C;  3DM9 B;  3C7J A;  4AE4 B;  1R4T A;  5AC4 A;  2YQY A;  2HFI A;  2Y3H A;  4DRH B;  3S90 A;  2YLD A;  3CQZ A;  4FWV A;  3ZG1 A;  3GWL A;  4PJN A;  4ER9 A;  1O3U A;  4JRZ A;  1B68 A;  1GQA A;  3MLG A;  2DB4 A;  3EG9 A;  5KYY A;  5JP7 A;  2HJM A;  3UGP A;  1CPR A;  3IHU A;  4PK4 A;  2EIN C;  4CSA A;  2C03 A;  2I8B A;  3MBG A;  3NDB B;  1D1B A;  3X2Q C;  1JOG A;  2R03 A;  2XLH A;  3WAQ A;  1RCP A;  3PCV A;  2YHS A;  2R7T A;  2P0N A;  2IXO A;  4FX5 A;  2EIM C;  3U5S A;  1QPU A;  1M6T A;  2FAP B;  2WVO A;  3TQO A;  3M4C A;  3GAN A;  1E84 A;  5JVE A;  4MVO A;  4H4K C;  2EPL X;  3NYJ A;  2YVK A;  3NRH A;  3AOU A;  3KKB A;  4NTF A;  4NY3 A;  2R7R A;  3VRC A;  4IWB A;  4XLN F;  2XXA A;  5F5F A;  3GWN A;  1VLT A;  3W8H A;  2BC5 A;  5IY5 C;  1TWG A;  1GM5 A;  1A41 A;  3F46 A;  4FES A;  4OIR F;  1JR8 A;  1QQ3 A;  2KSF A;  3BRJ A;  2R7O A;  1KU2 A;  3GM3 A;  4E17 A;  4FAP B;  5JLI A;  3B0U X;  4MW8 A;  2OU6 A;  2HSQ A;  3ECS A;  3IQT A;  3HLZ A;  2R02 A;  1FMW A;  2AVK A;  4KNV A;  2VB6 A;  2UUH A;  2UUI A;  4CS8 C;  1E2X A;  3X1O A;  4DRJ B;  4YT2 A;  3S84 A;  1TR2 A;  3HNJ A;  3EZH A;  3L8I A;  4JJF A;  5DQZ A;  4EBB A;  1FAP B;  1KTM A;  3ITF A;  1FFT C;  2HUJ A;  2P6V A;  4LLE A;  3UMI A;  3CEX A;  4MVR A;  3ZTZ A;  1PCX A;  3C18 A;  4JC7 A;  4LAC B;  4AL0 A;  4E0I A;  3ASO C;  2PNO A;  1YAR O;  2PX0 A;  5L3V A;  3DAG A;  3DE9 A;  1LKX A;  3GEE A;  4E0H A;  4A2N B;  3JSE O;  1OCO C;  5KYU B;  2Q9C A;  3SXK A;  2FFH A;  5E2Q A;  1V4A A;  4WGY A;  5COM A;  3HNK A;  4MW3 A;  2XS8 A;  4LDR A;  2PP4 A;  1A0B A;  4O6N A;  4XWJ A;  2HJ3 A;  3JCU Q;  4AX2 A;  4U9E A;  1ZYR F;  1T5O A;  3JYY A;  3IQC A;  2LFF A;  1G8X A;  2Q00 A;  2XLV A;  4JEA A;  4JKV A;  3M1C B;  1D1C A;  2L7A A;  1E83 A;  1ZVZ A;  1M2O A;  2OEX A;  3BEH A;  3EHM A;  3Q6N A;  1MMN A;  2QLA A;  4U5D E;  4JTC B;  1QVX A;  4A4A A;  4BPM A;  1BDJ B;  1WAT A;  3H2V A;  1G5Z A;  1EKY A;  2G3V A;  3SXY A;  2I15 A;  4I1O B;  3UMK A;  2NSF A;  4ONS A;  2B0H A;  4KNW A;  1HW1 A;  3LEV A;  1YZA A;  2R7X A;  4NCQ A;  3RQE A;  4WJ0 A;  4U5C E;  2YL1 A;  3SZR A;  2R7Q A;  1YYX A;  4LDQ A;  1OR3 A;  3S27 A;  5DLJ A;  1C03 A;  1NZE A;  4U5B E;  2VC9 A;  1D1A A;  3CZ6 A;  3AG2 C;  2EIL C;  3QTH A;  3L1M A;  5L0D A;  1CGN A;  2HKV A;  5E33 A;  4G7O F;  4DRI B;  2PBE A;  3AQC A;  1WTY A;  1ZHX A;  4GQH A;  1RKC A;  2A6H F;  1GS9 A;  2MHR A;  2OG2 A;  4Z9H A;  1OKK A;  4HFK B;  1NSG B;  2HV6 A;  3QMK A;  4AK9 A;  1YA9 A;  2WZL A;  2CNW A;  1YA7 O;  3ATP A;  3F47 A;  3IQ6 A;  4JZA A;  4EWC A;  3B71 A;  3I5Q A;  4ULW A;  1T6I A;  2Y3G A;  2YZS A;  3G4Z A;  4C3B A;  1AUE A;  2GDC A;  1BR2 A;  2CDQ A;  3DM5 A;  4JIO A;  1FTS A;  1M56 C;  2G62 A;  3B9Q A;  1ZW3 A;  4DJ9 A;  1J8Y F;  3LUT B;  3AGU A;  4YWQ A;  4IAR A;  2O9X A;  2R7S A;  5KYW A;  3RF3 A;  5L0G A;  1HW2 A;  2PFD A;  1SMY F;  3T6J A;  3VAY A;  4UDV A;  2KK1 A;  4NQF A;  1MMG A;  2NSG A;  2GAQ A;  3EPV A;  4N6H A;  1Z7Q c;  3EGX A;  3RQG A;  2XL8 A;  3V5X A;  2BE5 F;  3JTL O;  4K1O A;  5KYU A;  3POV A;  4D4X A;  1M2V B;  1RJ9 A;  2CCY A;  3QVZ A;  1N1C A;  5BUO A;  2Q7R A;  4I3M A;  2A68 F;  3TOM A;  2QE9 A;  3DE8 A;  4XQ1 A;  2C04 A;  2QTV A;  1ZU4 A;  3DD7 A;  1YLM A;  3K66 A;  3KPH A;  2WB7 A;  3A9C A;  4HE8 D;  3FMS A;  4XEV A;  1FNT c;  4EBK A;  3O39 A;  2MWQ A;  4PAC A;  4IRU A;  4C7O B;  2V26 A;  5TJ5 E;  1VYI A;  1TWC A;  4M63 A;  1BZ4 A;  1OW8 A;  2Z15 A;  1SYQ A;  4XPX A;  5EGY A;  4EUK B;  1U89 A;  4W8P A;  3U8V A;  2H8A A;  3EH1 A;  1PV3 A;  1QZX A;  1VK5 A;  2ZXR A;  5COF A;  3FVY A;  3ZC4 A;  1QLE C;  2Y69 C;  1ST6 A;  3GM1 A;  3IQ5 A;  3L8J A;  4MS2 A;  2ASR A;  4PFO A;  1LM3 B;  5F28 E;  2F22 A;  2J7P D;  2R9R B;  3R2P A;  4OIP F;  2WL8 A;  4Q4Z F;  1Z5Z A;  2YWA A;  3LEO A;  5L0H A;  4NTB A;  2L9J A;  4H54 A;  4BJT A;  4EHP A;  2OCC C;  2PX3 A;  1OCC C;  3QW1 A;  2NUP B;  4QDL A;  3T9O A;  4C3D A;  4J30 B;  2FGY A;  3LES A;  4CIP A;  1CGM E;  1A7V A;  1OQC A;  1Q0F A;  1XZP A;  4LER A;  2EIJ C;  1G4W R;  1YJG A;  4PJM A;  4F4B A;  2E87 A;  1O5H A;  3DXJ F;  4HEA J;  2R7W A;  3K1H A;  4GEH A;  1QKR A;  3EJN A;  3KL4 A;  4MVM A;  3RYL A;  4E7S A;  1M57 C;  256B A;  4JEB A;  4AL1 A;  2WVN A;  4JCH A;  3UNG C;  4EIY A;  2YKZ A;  3KYI A;  4CS7 A;  3ABM C;  3O10 A;  4OIN F;  4OD4 A;  1NU9 C;  1OR2 A;  2AP3 A;  2OEV A;  3IEE A;  4DOZ A;  4MTO A;  3PDM P;  1HY5 A;  1ORY A;  1D0X A;  4DVY P;  2YEV A;  3SXZ A;  3AG4 C;  3DMD A;  2HZ8 A;  1NBB A;  2AU5 A;  3J06 A;  3DI5 A;  1HMD A;  2NPU A;  2IXM A;  3KYJ A;  3LAY A;  4U5H A;  2DI3 A;  4WGZ A;  5DVW A;  2IYL D;  4PJJ A;  5BQG A;  1UFB A;  5T1D B;  1ZZP A;  1FFH A;  5JRA A;  5B1A C;  4E7Z A;  5L3Q A;  1MMD A;  2IXN A;  4EKW A;  3W2W A;  1M2V A;  2HV7 A;  1RKE A;  2OJE D;  1MND A;  2QY9 A;  1MQV A;  3C8G B;  3EGD B;  3A11 A;  3K1I A;  4IAQ A;  1EI7 A;  2YLI A;  1C02 A;  4BJ5 C;  2XSE A;  1O87 A;  1ZW2 A;  2P61 A;  4LDK A;  4MVZ A;  3ZDL A;  4EBJ A;  4P6I C;  4AE4 A;  3B29 A;  5CIV A;  5B1B C;  5KYN A;  1YYJ A;  3JZ0 A;  4BJ6 A;  3WOD F;  1VB5 A;  2QNL A;  2KGO A;  3FAJ A;  1MMA A;  2D4U A;  2EPN A;  5D91 A;  2A69 F;  5CI8 A;  2XLM A;  1WGW A;  4MTF A;  1Z63 A;  2LIG A;  3S28 A;  4CBE A;  2L81 A;  1HE1 A;  1TFK B;  3CAX A;  3E9V A;  4YT8 A;  4N06 A;  3EFO B;  3S0X A;  2A0B A;  3JRT A;  4DBR A;  2XL6 A;  1ORS C;  3LS0 A;  2A0U A;  3GM2 A;  1YVI A; 
#chains in the Genus database with same CATH homology
 1Y4C A;  2LFD A;  3U8V A;  2HZ8 A;  2LFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...