2HZ8A

Qm/mm structure refined from nmr-structure of a single chain diiron protein
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
115
structure length
115
Chain Sequence
b'MDELRELLKAEQQAIKIYKEVLKKAKEGDEQELARLIQEIVKAEKQAVKVYKEAAEKARNPEKRQVIDKILEDEEKHIEWLKAASKQGNAEQFASLVQQILQDEQRHVEEIEKKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords De novo designed diiron protein
publication title Solution NMR structure of a designed metalloprotein and complementary molecular dynamics refinement.
pubmed doi rcsb
source organism Escherichia coli
molecule tags De novo protein
total genus 49
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.660 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) IL-4 antagonist (De novo design) like domain 2hz8A00
3U8VA 2LFFA 2HZ8A 1Y4CA 2LFDA
chains in the Genus database with same CATH superfamily
3FVYA 4J7YA 3C18A 1GS9A 3RF3A 3M15A 1S7ZA 4CSAC 4OIQF 3V5YA 2R7SA 4YL0A 1IW7F 1WASA 1ZU5A 2I8BA 2KC3A 2QTVA 4BEJA 3CZ6A 1HY5A 4DXWA 1OW7A 3IQ6A 3HTKC 4G7HF 2L6GA 2YRFA 2EPKX 2M4EA 2WL8A 3K33A 3IQTA 4HE8D 4YK5A 1Z6AA 3MYFA 1YYXA 4NTBA 3O55A 5KYNA 4PJMA 1YAUO 3K1IC 3SP1A 4FWVA 2ZXWC 3AQBA 2EIMC 2LP4A 1RKEB 4MVMA 1ZYRF 2H8AA 1OCRC 2XRHA 2NSGA 2YZSA 3AG1C 2C04A 3K66A 3MBGA 2XLDA 3ZWIA 2BL2A 2PX3A 2P0NA 4JJGA 4KNWA 4DVYP 2AWYA 4D4XA 3U2MA 1LI5A 4NQFA 4NCQA 1RXQA 4MW3A 4N06A 1A41A 1NFOA 1BBHA 2HV6A 2P1AA 3CAXA 3M1CB 3U8VA 4M63A 2W45A 3HKKA 4L6RA 1VK5A 1Z7Qc 3DD7A 4MVRA 1PD0A 3C8GB 1D0ZA 1R5ID 2HSBA 1HW1A 4J32B 5E33A 3RQEA 1K04A 1AUEA 3WHNA 2DB4A 3ZTZA 3RVYA 4P9FA 3AGTA 2XS1A 3QVZA 3EHNA 3TOLA 2OG2A 2PBEA 2KJGA 1T6UA 2OQMA 3SXKA 4WGYA 2HJMA 4FAPB 1ZW3A 4YL3A 1CGOA 1RKEA 2HSQA 1FTSA 3U9JA 4FESA 2MYSA 4O6NA 1EA8A 3W2WA 2R05A 3EGXA 4AE4A 5L0JA 4X0RA 2W9YA 1VYIA 1O5HA 2F22A 1LKXA 3NMIA 4ONSA 2VCAA 3EG9B 1MNEA 1OW6A 2WVQA 4N4WA 5A6BA 4QDLA 2MHRA 1JPNA 3S9OA 3ZTMA 3QTHA 5HSWA 4CS8A 2KQ9A 4AL1A 4PFOA 3W8HA 3PMRA 2A69F 5DVWA 3U8PA 1WN0A 2R7OA 2WVNA 3C8GA 3B0PA 3TJ6A 4NTFA 2Y39A 2V3CC 1BR1A 4DBQA 3L8IA 5A6KA 2L9JA 3ITFA 3H2UA 1CPQA 1JAFA 1H9GA 1ZW2A 4CX9A 4H54A 5FCLA 2X0CA 3V5ZA 1Y6DA 1NSGB 3N0TA 1LE4A 1FNTc 5COGA 2D4UA 4MVOA 3T4RA 1O87A 3GEHA 3AOUA 3GEIA 4JURI 2AP3A 2YQYA 4U9EA 4IARA 4LACB 3L0IA 3OA1A 4O6MA 4CS9C 4JVSA 1OW8A 2YLGA 4JCZA 2HS5A 4MVQA 4LERA 1EKYA 2YWAA 4JJFA 3O39A 3JSZA 2XLWA 2EPOA 2J7PA 3B71A 4JE9A 4U5DE 3FAJA 4KBLA 2CDQA 3NMKA 5DLJA 5JT4A 1SF8A 1QKRA 2EPMX 2PF4E 4G7ZF 1WWPA 2ZXOA 3OEOA 1YYJA 1LS1A 3ZSUA 3POVA 4FX5A 4IJJA 5T3WA 4JTCB 2XM0A 2VH3A 1LVKA 2YL3A 3LS1A 4I1OB 1U6HA 4XQ1A 5COMA 5KYXB 2R7UA 3SXMA 5KYUB 1LM3B 1S05A 1VTMP 1VLTA 1V54C 2Q9BA 1YARO 1R4TA 1OXBA 4U5FE 4Z9HA 3ZQYA 4BEMJ 2YVKA 5A6JA 1TWAA 1E83A 4C7OB 3LLIA 1I5NA 4C3DA 2M64A 3HNJA 3I5QA 1HE9A 3EH1A 3RH3A 2H7VC 3ZQVA 1E86A 4P6IC 2KNHA 2RSEB 4IB4A 5EK0A 1YZCA 4JRZA 4LLEA 4MW8A 4XPXA 3PDMP 3NYJA 1U0BB 3TULA 4UDVA 1Q0DA 4U5HA 1RMVA 4WABA 3DJNB 2R7TA 2J9UA 2A6HF 3M4CA 5F5FA 2GDCA 4NY3A 4U5CE 3AJMA 1FMVA 5CIVA 3M4BA 4CBEA 2TMVP 5BQGA 2QUPA 1OR3A 3B29A 3QW1A 4KI2A 5JLIA 5F5HA 1E85A 5KYUA 1RJ9B 5T3TA 5JP7A 4MVZA 1V55C 3ASOC 2Y3DA 5BUOA 1Q0GA 2ZD9A 2EPLX 5L0CA 3GM1A 4C7OA 2EIJC 4LDKA 1G5ZA 1FAPB 2JX0A 3C8ZA 1HMOA 3KMIA 4YL1A 2IXMA 2LFFA 3E9VA 3RW0A 4E18A 2B0JA 3RYLA 3K7DA 1VYKA 1LI7A 2RD9A 3VF0A 2IOQA 1UG7A 3CSKA 4MQ9F 3RQFA 1MMNA 4CJGA 2LCHA 3I4UA 4ER9A 3SEOA 2EPNA 2L81A 1JR8A 4YT4A 1I4YA 1ZHYA 2R25A 2J8WA 2OEVA 1MMAA 2Y69C 1T5OA 3A9CA 4HEAJ 3T6JA 4K7BA 3KH2A 4E7SA 4I3MA 3V5XA 1ZHXA 2CW0F 4XWJA 1FMWA 2KW3C 2XL6A 1RKCA 4U5BE 3ABKC 3JZ0A 1CGNA 1QPUA 2QLAA 3LEOA 3W4YA 2KGOA 1JRAA 3LLKA 4CSAA 2X51A 4BG0A 2A68F 2GA0A 4MTOA 4BJTA 2YL0A 2Q9AA 1Z3IX 2JPUA 2XLMA 1B68A 2OJQA 3DZAA 2VCBA 3K6BA 1KNYA 3B9QA 3O6XA 3EFOB 3JT1A 1TWCA 3GWNA 2B0HA 3LEVA 3GM3A 2OKUA 4MTGA 3SXZA 3MFNA 5F28E 5BQIA 5E2QA 2R7WA 2ZPAA 2LQGA 3IEEA 2OOCA 3NKEA 3VRCA 3QMKA 2NUPB 2XL4A 3K1IA 3HNLA 4JTAB 3V7OA 1OKKA 4EIYA 2P61A 1PV3A 5GPGB 2GAQA 4PJJA 3N24A 3KPHA 4EBKA 2J9WA 1UFBA 3M79A 1TFKB 2LFDA 5DQTA 2PX0A 5IY5C 1DOVA 3JRTA 4MNDA 1YJGA 2VB6A 3DAGA 3S29A 4F4BA 5A6BD 4OIOF 3MX3A 3Q7LA 3L34A 3US6A 1ZVZA 2Q9CA 3ECSA 4GYTA 3SYNA 3T6GB 1KU2A 1Q0FA 3S90A 1Z63A 4DVZA 5JS5A 4PR9A 3B0UX 3EFOA 2D5RB 2WVOA 5K0IA 5KYYB 1TQGA 1GQAA 3W8IA 4JTDB 1L3PA 1QZXA 5JUAA 4JKVA 3LJBA 2ZXPA 3JYHA 3ZC4A 1ORJA 4IAOA 2NUPA 3UR3C 3RIPA 4D4NA 3R2PA 4XLPF 1A7DA 1MMDA 3S84A 1V74B 2G3VA 1WATA 4DRJB 3KYJA 4BJ5C 2NUTB 2HMQA 3J06A 5BQHA 3LAYA 2P7VA 1G8XA 2VASA 3DKAA 4MTFA 4XEVA 4CDAA 1SZIA 4RBNA 3JRMO 2A1DD 1BDJB 3QZCA 2YLIA 4N6HA 4O6YA 5L3VA 2YL7A 3EG9A 4ZLDA 1JPJA 2KSFA 1NBBA 2EILC 5HV9A 1TWGA 3DMDA 3LNMB 5D91A 4W8PA 2IM8A 4EHPA 4DBRA 5L3QA 2A0BA 3G4XA 1C02A 1VLSA 3R7CA 3G50A 1F1MA 5KYYA 3TQOA 2IBFA 2VC9A 1K05A 4QI0A 1OCZC 4DRHB 3UMIA 3ZG1A 3F46A 2H7BA 3EGDB 3C62A 4O79A 1VOMA 2Y3GA 2G62A 3CQZA 1PCXA 2XM4A 2J0WA 3SNHA 3LNRA 1J8YF 4OD4A 5DS5A 3EZHA 4P9TA 2CCYA 1Y4CA 3L8JA 2DYRC 2L6HA 4HFFB 1D1AA 1QVXA 2AU5A 3GODA 3HLZA 4KC9A 2LK4A 3DXJF 1Z23A 4J7TA 3TK0A 4CS9A 2OEXA 4YWQA 4IAQA 1T01A 4PFPA 5D92A 3FAPB 1EI7A 1ST6A 5DQZA 4U9DA 2FFHA 4CDVA 1G4WR 4YT5A 2QNLA 3SZRA 4XEKA 3UGPA 4BJ6C 1VB5A 3NDBB 4Q5SF 4EWCA 2XSEA 3IHUA 4EBBA 3GWLA 1QLEC 3HNIA 2I15A 4LDRA 1LPEA 4YJWA 4LDQA 4AL0A 1U89A 4ZLCA 1E2XA 256BA 5TJ5E 1YA9A 2IXNA 3ABMC 4G78A 2HUJA 5CI8A 5E3CA 3X1OA 3EGDA 1M2VB 2FAPB 3MYIA 5FZTA 2YEVA 3PHF2 1H9TA 3Q6NA 3S27A 4E17A 5CI9A 5KYXA 1A7EA 2HV7A 2EINC 2IYLD 4JCHA 5L0DA 4HFKB 1T9KA 4DRIB 4EBJA 2IXPA 4KNVA 3U0CA 1Q0KA 4EUKB 1NU7D 4IRUA 2XS8A 4AX2A 5JRAA 3TD7A 1H6GA 1OQCA 1OR2A 2J0XA 3C63A 4XLNF 2CYDA 1OKKD 2DYSC 3S28A 4G0HA 2O9XA 1ORSC 3EPVA 3H65A 1XZQA 1WOLA 2QY9A 4JZAA 3EZIA 2CNWA 4PACA 5AC5A 3NMJA 2Q00A 2Q3TA 3SXYA 1I4ZA 4AK9A 3EHMA 3U3FA 3OWTA 4O7GA 3BEHA 3Q7GA 1T6QA 4XTKA 1V4AA 3BRJA 1A7VA 3GORA 4H4KC 5AGFA 4Z9IA 1M2VA 1QQ3A 1SMYF 1T6IA 2R02A 3NKDA 3U5SA 4E7ZA 4MVSA 1RJ9A 4RDAA 3T6BA 5EGYA 2ASRA 2ZXRA 3C8GD 4W8KA 5B3IA 1CPRA 1J8MF 4PJLA 4XPWA 2OCCC 3VAYA 2C03A 4A4AA 3FXHA 3IQ5A 3N2ZB 3KL4A 5EHHA 3EQLF 4ULVA 3EJNA 4I1MA 1O3UA 2DI3A 1M6TA 3O10A 1EQ1A 1TR2A 1DOWA 3G4ZA 3T9OA 4R32A 3AG3C 4E0IA 4IGGA 5AC4A 2OJED 2W4MA 1WTYA 4K1OA 1M57C 2W4BA 5JSLA 5DS6A 1YDIA 4CIPA 2E87A 4OINF 1HW2A 1LS4A 1FFHA 4OD5A 2XL8A 4JW1A 4C3BA 4AE4B 4WJ0A 2J7PD 3EGXB 1Q0MA 3IPMO 2R7RA 1NG1A 1BZ4A 5B1BC 1HE1A 5B3SC 2A6EF 1D0XA 2HZ8A 2XLOA 1NU9C 2L7AA 2FGYA 1SYQA 3FOPA 1AEPA 3ASNC 3JCUQ 3GANA 4GEHA 2HKVA 1ZHZA 5L0FA 3A11A 3L1MA 5B1AC 5L0IA 1IZMA 1LE2A 2LIGA 3NYMA 4JC7A 1JMWA 4CS8C 2BE5F 2GWWA 3DWWA 2PNOA 4I44A 2WZFA 1G4US 2Z15A 1GM5A 2R9RB 3GEEA 4JEBA 3B0VC 2R7QA 5T1DB 3LS0A 1XWJA 2AVKA 1ZZPA 2R03A 2YKZA 1D1CA 2ICWG 1MMGA 1JOGA 3DE8A 4U5EE 3WODF 4BPMA 3UNGC 5JVEA 5L0GA 5E3AA 3C7JA 1APCA 1NLXA 3RQGA 1GGQA 3FHDA 4JEAA 4OIPF 2UUIA 1M56C 2UUHA 3H2VA 3JYYA 3ATPA 4G7OF 1ZHTA 2BC5A 3EH2A 3NRHA 4Q4ZF 1QSPA 2XXAB 1SR2A 2J45A 2Y3HA 2WB7A 4JIOA 4Z9JA 1C03A 4XEFA 3X2QC 5DS4A 2L6FA 4NC3A 3LESA 3QVYA 5COFA 4DOZA 1NFNA 4RD9A 1E84A 1MQVA 4QI2A 4Q7CA 3E70C 2JD3A 3JSEO 3K1HA 4OIRF 5A6AA 2IXOA 3KKBA 2XLHA 3QW0A 1M2OA 2Y3BA 4BJ1A 2PFDA 1Z5ZA 1YA7O 2YHSA 3DAFA 2KYHA 2CNWD 2OU6A 1BR4A 3AG4C 1YVIA 2H7OA 3DM9B 3RVZA 1W2WA 4BJ5A 5KYWB 3JTLO 2ETSA 2HFIA 1PD1A 2P6VA 2NUTA 1TFOB 1MNDA 1N1CA 3NG1A 1CGME 4N6CA 4ANJA 2J9BA 2G3KA 2V26A 4DJ9A 4CIHA 3U2LA 3DM5A 3WAQA 2XXAA 3ZDLA 1KTMA 1OCCC 2AWCA 2VCCA 2J9VA 3ABLC 4CS7A 3FDQA 1D1BA 2KK1A 4XPYA 3S0XA 4YT8A 3VM6A 4EKWA 3AGUA 4GQHA 1HMDA 1YZAA 2LSEA 2Q7RA 1ORYA 3AG2C 2WZGA 1VMAA 3PCVA 3HNKA 3WG7C 2DGJA 4YT2A 2GFHA 5A69A 3DJUB 4MVUA 1L7CA 3F47A 3CEXA 2LD6A 3KYIA 4MS2A 4CDYA 5L0HA 3MLGA 3HJCA 1XZPA 4YN0B 2R7VA 1A0BA 1FFTC 3FMSA 2J46A 3IQCA 1YLMA 2XLVA 4PJNA 3TOMA 3U3BA 4WGZA 3W2VA 5KYWA 4ULWA 3TJ5A 1ZU4A 2NPUA 3UGOA 1OXKA 1WGWA 2WZLA 3NYLA 2Q4FA 4PK4A 3DI5A 3UMHA 2PP4A 1K40A 4A2NB 3Q6MA 3FOOA 3VYWA 1LIHA 2EIKC 1BR2A 3AQCA 4B6IA 4BJ6A 1ZHWA 1D0YA 2HMZA 4U5GA 3ZVRA 4CJOA 2XLEA 3RFYA 2YLDA 2HJ3A 2NG1A 3UMKA 3ZIBA 3LUTB 4LLCA 1H7IA 3RKOF 3GM2A 4E0HA 3U9MA 3I5PA 4NTAA 1C17M 2NSFA 1TKNA 2MWQA 1OCOC 2CGEA 4IWBA 2R7XA 2YL1A 2QE9A 2A0UA 4J30B 1NZEA 1FR0A 4K0DA 3DE9A 1AVOB 1TWHA 1RCPA 4C3EA
chains in the Genus database with same CATH topology
3U8VA 2LFFA 2HZ8A 1Y4CA 2LFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8V A;  2LFF A;  2HZ8 A;  1Y4C A;  2LFD A; 
#chains in the Genus database with same CATH topology
 3FVY A;  4J7Y A;  3C18 A;  1GS9 A;  3RF3 A;  3M15 A;  1S7Z A;  4CSA C;  4OIQ F;  3V5Y A;  2R7S A;  4YL0 A;  1IW7 F;  1WAS A;  1ZU5 A;  2I8B A;  2KC3 A;  2QTV A;  4BEJ A;  3CZ6 A;  1HY5 A;  4DXW A;  1OW7 A;  3IQ6 A;  3HTK C;  4G7H F;  2L6G A;  2YRF A;  2EPK X;  2M4E A;  2WL8 A;  3K33 A;  3IQT A;  4HE8 D;  4YK5 A;  1Z6A A;  3MYF A;  1YYX A;  4NTB A;  3O55 A;  5KYN A;  4PJM A;  1YAU O;  3K1I C;  3SP1 A;  4FWV A;  2ZXW C;  3AQB A;  2EIM C;  2LP4 A;  1RKE B;  4MVM A;  1ZYR F;  2H8A A;  1OCR C;  2XRH A;  2NSG A;  2YZS A;  3AG1 C;  2C04 A;  3K66 A;  3MBG A;  2XLD A;  3ZWI A;  2BL2 A;  2PX3 A;  2P0N A;  4JJG A;  4KNW A;  4DVY P;  2AWY A;  4D4X A;  3U2M A;  1LI5 A;  4NQF A;  4NCQ A;  1RXQ A;  4MW3 A;  4N06 A;  1A41 A;  1NFO A;  1BBH A;  2HV6 A;  2P1A A;  3CAX A;  3M1C B;  3U8V A;  4M63 A;  2W45 A;  3HKK A;  4L6R A;  1VK5 A;  1Z7Q c;  3DD7 A;  4MVR A;  1PD0 A;  3C8G B;  1D0Z A;  1R5I D;  2HSB A;  1HW1 A;  4J32 B;  5E33 A;  3RQE A;  1K04 A;  1AUE A;  3WHN A;  2DB4 A;  3ZTZ A;  3RVY A;  4P9F A;  3AGT A;  2XS1 A;  3QVZ A;  3EHN A;  3TOL A;  2OG2 A;  2PBE A;  2KJG A;  1T6U A;  2OQM A;  3SXK A;  4WGY A;  2HJM A;  4FAP B;  1ZW3 A;  4YL3 A;  1CGO A;  1RKE A;  2HSQ A;  1FTS A;  3U9J A;  4FES A;  2MYS A;  4O6N A;  1EA8 A;  3W2W A;  2R05 A;  3EGX A;  4AE4 A;  5L0J A;  4X0R A;  2W9Y A;  1VYI A;  1O5H A;  2F22 A;  1LKX A;  3NMI A;  4ONS A;  2VCA A;  3EG9 B;  1MNE A;  1OW6 A;  2WVQ A;  4N4W A;  5A6B A;  4QDL A;  2MHR A;  1JPN A;  3S9O A;  3ZTM A;  3QTH A;  5HSW A;  4CS8 A;  2KQ9 A;  4AL1 A;  4PFO A;  3W8H A;  3PMR A;  2A69 F;  5DVW A;  3U8P A;  1WN0 A;  2R7O A;  2WVN A;  3C8G A;  3B0P A;  3TJ6 A;  4NTF A;  2Y39 A;  2V3C C;  1BR1 A;  4DBQ A;  3L8I A;  5A6K A;  2L9J A;  3ITF A;  3H2U A;  1CPQ A;  1JAF A;  1H9G A;  1ZW2 A;  4CX9 A;  4H54 A;  5FCL A;  2X0C A;  3V5Z A;  1Y6D A;  1NSG B;  3N0T A;  1LE4 A;  1FNT c;  5COG A;  2D4U A;  4MVO A;  3T4R A;  1O87 A;  3GEH A;  3AOU A;  3GEI A;  4JUR I;  2AP3 A;  2YQY A;  4U9E A;  4IAR A;  4LAC B;  3L0I A;  3OA1 A;  4O6M A;  4CS9 C;  4JVS A;  1OW8 A;  2YLG A;  4JCZ A;  2HS5 A;  4MVQ A;  4LER A;  1EKY A;  2YWA A;  4JJF A;  3O39 A;  3JSZ A;  2XLW A;  2EPO A;  2J7P A;  3B71 A;  4JE9 A;  4U5D E;  3FAJ A;  4KBL A;  2CDQ A;  3NMK A;  5DLJ A;  5JT4 A;  1SF8 A;  1QKR A;  2EPM X;  2PF4 E;  4G7Z F;  1WWP A;  2ZXO A;  3OEO A;  1YYJ A;  1LS1 A;  3ZSU A;  3POV A;  4FX5 A;  4IJJ A;  5T3W A;  4JTC B;  2XM0 A;  2VH3 A;  1LVK A;  2YL3 A;  3LS1 A;  4I1O B;  1U6H A;  4XQ1 A;  5COM A;  5KYX B;  2R7U A;  3SXM A;  5KYU B;  1LM3 B;  1S05 A;  1VTM P;  1VLT A;  1V54 C;  2Q9B A;  1YAR O;  1R4T A;  1OXB A;  4U5F E;  4Z9H A;  3ZQY A;  4BEM J;  2YVK A;  5A6J A;  1TWA A;  1E83 A;  4C7O B;  3LLI A;  1I5N A;  4C3D A;  2M64 A;  3HNJ A;  3I5Q A;  1HE9 A;  3EH1 A;  3RH3 A;  2H7V C;  3ZQV A;  1E86 A;  4P6I C;  2KNH A;  2RSE B;  4IB4 A;  5EK0 A;  1YZC A;  4JRZ A;  4LLE A;  4MW8 A;  4XPX A;  3PDM P;  3NYJ A;  1U0B B;  3TUL A;  4UDV A;  1Q0D A;  4U5H A;  1RMV A;  4WAB A;  3DJN B;  2R7T A;  2J9U A;  2A6H F;  3M4C A;  5F5F A;  2GDC A;  4NY3 A;  4U5C E;  3AJM A;  1FMV A;  5CIV A;  3M4B A;  4CBE A;  2TMV P;  5BQG A;  2QUP A;  1OR3 A;  3B29 A;  3QW1 A;  4KI2 A;  5JLI A;  5F5H A;  1E85 A;  5KYU A;  1RJ9 B;  5T3T A;  5JP7 A;  4MVZ A;  1V55 C;  3ASO C;  2Y3D A;  5BUO A;  1Q0G A;  2ZD9 A;  2EPL X;  5L0C A;  3GM1 A;  4C7O A;  2EIJ C;  4LDK A;  1G5Z A;  1FAP B;  2JX0 A;  3C8Z A;  1HMO A;  3KMI A;  4YL1 A;  2IXM A;  2LFF A;  3E9V A;  3RW0 A;  4E18 A;  2B0J A;  3RYL A;  3K7D A;  1VYK A;  1LI7 A;  2RD9 A;  3VF0 A;  2IOQ A;  1UG7 A;  3CSK A;  4MQ9 F;  3RQF A;  1MMN A;  4CJG A;  2LCH A;  3I4U A;  4ER9 A;  3SEO A;  2EPN A;  2L81 A;  1JR8 A;  4YT4 A;  1I4Y A;  1ZHY A;  2R25 A;  2J8W A;  2OEV A;  1MMA A;  2Y69 C;  1T5O A;  3A9C A;  4HEA J;  3T6J A;  4K7B A;  3KH2 A;  4E7S A;  4I3M A;  3V5X A;  1ZHX A;  2CW0 F;  4XWJ A;  1FMW A;  2KW3 C;  2XL6 A;  1RKC A;  4U5B E;  3ABK C;  3JZ0 A;  1CGN A;  1QPU A;  2QLA A;  3LEO A;  3W4Y A;  2KGO A;  1JRA A;  3LLK A;  4CSA A;  2X51 A;  4BG0 A;  2A68 F;  2GA0 A;  4MTO A;  4BJT A;  2YL0 A;  2Q9A A;  1Z3I X;  2JPU A;  2XLM A;  1B68 A;  2OJQ A;  3DZA A;  2VCB A;  3K6B A;  1KNY A;  3B9Q A;  3O6X A;  3EFO B;  3JT1 A;  1TWC A;  3GWN A;  2B0H A;  3LEV A;  3GM3 A;  2OKU A;  4MTG A;  3SXZ A;  3MFN A;  5F28 E;  5BQI A;  5E2Q A;  2R7W A;  2ZPA A;  2LQG A;  3IEE A;  2OOC A;  3NKE A;  3VRC A;  3QMK A;  2NUP B;  2XL4 A;  3K1I A;  3HNL A;  4JTA B;  3V7O A;  1OKK A;  4EIY A;  2P61 A;  1PV3 A;  5GPG B;  2GAQ A;  4PJJ A;  3N24 A;  3KPH A;  4EBK A;  2J9W A;  1UFB A;  3M79 A;  1TFK B;  2LFD A;  5DQT A;  2PX0 A;  5IY5 C;  1DOV A;  3JRT A;  4MND A;  1YJG A;  2VB6 A;  3DAG A;  3S29 A;  4F4B A;  5A6B D;  4OIO F;  3MX3 A;  3Q7L A;  3L34 A;  3US6 A;  1ZVZ A;  2Q9C A;  3ECS A;  4GYT A;  3SYN A;  3T6G B;  1KU2 A;  1Q0F A;  3S90 A;  1Z63 A;  4DVZ A;  5JS5 A;  4PR9 A;  3B0U X;  3EFO A;  2D5R B;  2WVO A;  5K0I A;  5KYY B;  1TQG A;  1GQA A;  3W8I A;  4JTD B;  1L3P A;  1QZX A;  5JUA A;  4JKV A;  3LJB A;  2ZXP A;  3JYH A;  3ZC4 A;  1ORJ A;  4IAO A;  2NUP A;  3UR3 C;  3RIP A;  4D4N A;  3R2P A;  4XLP F;  1A7D A;  1MMD A;  3S84 A;  1V74 B;  2G3V A;  1WAT A;  4DRJ B;  3KYJ A;  4BJ5 C;  2NUT B;  2HMQ A;  3J06 A;  5BQH A;  3LAY A;  2P7V A;  1G8X A;  2VAS A;  3DKA A;  4MTF A;  4XEV A;  4CDA A;  1SZI A;  4RBN A;  3JRM O;  2A1D D;  1BDJ B;  3QZC A;  2YLI A;  4N6H A;  4O6Y A;  5L3V A;  2YL7 A;  3EG9 A;  4ZLD A;  1JPJ A;  2KSF A;  1NBB A;  2EIL C;  5HV9 A;  1TWG A;  3DMD A;  3LNM B;  5D91 A;  4W8P A;  2IM8 A;  4EHP A;  4DBR A;  5L3Q A;  2A0B A;  3G4X A;  1C02 A;  1VLS A;  3R7C A;  3G50 A;  1F1M A;  5KYY A;  3TQO A;  2IBF A;  2VC9 A;  1K05 A;  4QI0 A;  1OCZ C;  4DRH B;  3UMI A;  3ZG1 A;  3F46 A;  2H7B A;  3EGD B;  3C62 A;  4O79 A;  1VOM A;  2Y3G A;  2G62 A;  3CQZ A;  1PCX A;  2XM4 A;  2J0W A;  3SNH A;  3LNR A;  1J8Y F;  4OD4 A;  5DS5 A;  3EZH A;  4P9T A;  2CCY A;  1Y4C A;  3L8J A;  2DYR C;  2L6H A;  4HFF B;  1D1A A;  1QVX A;  2AU5 A;  3GOD A;  3HLZ A;  4KC9 A;  2LK4 A;  3DXJ F;  1Z23 A;  4J7T A;  3TK0 A;  4CS9 A;  2OEX A;  4YWQ A;  4IAQ A;  1T01 A;  4PFP A;  5D92 A;  3FAP B;  1EI7 A;  1ST6 A;  5DQZ A;  4U9D A;  2FFH A;  4CDV A;  1G4W R;  4YT5 A;  2QNL A;  3SZR A;  4XEK A;  3UGP A;  4BJ6 C;  1VB5 A;  3NDB B;  4Q5S F;  4EWC A;  2XSE A;  3IHU A;  4EBB A;  3GWL A;  1QLE C;  3HNI A;  2I15 A;  4LDR A;  1LPE A;  4YJW A;  4LDQ A;  4AL0 A;  1U89 A;  4ZLC A;  1E2X A;  256B A;  5TJ5 E;  1YA9 A;  2IXN A;  3ABM C;  4G78 A;  2HUJ A;  5CI8 A;  5E3C A;  3X1O A;  3EGD A;  1M2V B;  2FAP B;  3MYI A;  5FZT A;  2YEV A;  3PHF 2;  1H9T A;  3Q6N A;  3S27 A;  4E17 A;  5CI9 A;  5KYX A;  1A7E A;  2HV7 A;  2EIN C;  2IYL D;  4JCH A;  5L0D A;  4HFK B;  1T9K A;  4DRI B;  4EBJ A;  2IXP A;  4KNV A;  3U0C A;  1Q0K A;  4EUK B;  1NU7 D;  4IRU A;  2XS8 A;  4AX2 A;  5JRA A;  3TD7 A;  1H6G A;  1OQC A;  1OR2 A;  2J0X A;  3C63 A;  4XLN F;  2CYD A;  1OKK D;  2DYS C;  3S28 A;  4G0H A;  2O9X A;  1ORS C;  3EPV A;  3H65 A;  1XZQ A;  1WOL A;  2QY9 A;  4JZA A;  3EZI A;  2CNW A;  4PAC A;  5AC5 A;  3NMJ A;  2Q00 A;  2Q3T A;  3SXY A;  1I4Z A;  4AK9 A;  3EHM A;  3U3F A;  3OWT A;  4O7G A;  3BEH A;  3Q7G A;  1T6Q A;  4XTK A;  1V4A A;  3BRJ A;  1A7V A;  3GOR A;  4H4K C;  5AGF A;  4Z9I A;  1M2V A;  1QQ3 A;  1SMY F;  1T6I A;  2R02 A;  3NKD A;  3U5S A;  4E7Z A;  4MVS A;  1RJ9 A;  4RDA A;  3T6B A;  5EGY A;  2ASR A;  2ZXR A;  3C8G D;  4W8K A;  5B3I A;  1CPR A;  1J8M F;  4PJL A;  4XPW A;  2OCC C;  3VAY A;  2C03 A;  4A4A A;  3FXH A;  3IQ5 A;  3N2Z B;  3KL4 A;  5EHH A;  3EQL F;  4ULV A;  3EJN A;  4I1M A;  1O3U A;  2DI3 A;  1M6T A;  3O10 A;  1EQ1 A;  1TR2 A;  1DOW A;  3G4Z A;  3T9O A;  4R32 A;  3AG3 C;  4E0I A;  4IGG A;  5AC4 A;  2OJE D;  2W4M A;  1WTY A;  4K1O A;  1M57 C;  2W4B A;  5JSL A;  5DS6 A;  1YDI A;  4CIP A;  2E87 A;  4OIN F;  1HW2 A;  1LS4 A;  1FFH A;  4OD5 A;  2XL8 A;  4JW1 A;  4C3B A;  4AE4 B;  4WJ0 A;  2J7P D;  3EGX B;  1Q0M A;  3IPM O;  2R7R A;  1NG1 A;  1BZ4 A;  5B1B C;  1HE1 A;  5B3S C;  2A6E F;  1D0X A;  2HZ8 A;  2XLO A;  1NU9 C;  2L7A A;  2FGY A;  1SYQ A;  3FOP A;  1AEP A;  3ASN C;  3JCU Q;  3GAN A;  4GEH A;  2HKV A;  1ZHZ A;  5L0F A;  3A11 A;  3L1M A;  5B1A C;  5L0I A;  1IZM A;  1LE2 A;  2LIG A;  3NYM A;  4JC7 A;  1JMW A;  4CS8 C;  2BE5 F;  2GWW A;  3DWW A;  2PNO A;  4I44 A;  2WZF A;  1G4U S;  2Z15 A;  1GM5 A;  2R9R B;  3GEE A;  4JEB A;  3B0V C;  2R7Q A;  5T1D B;  3LS0 A;  1XWJ A;  2AVK A;  1ZZP A;  2R03 A;  2YKZ A;  1D1C A;  2ICW G;  1MMG A;  1JOG A;  3DE8 A;  4U5E E;  3WOD F;  4BPM A;  3UNG C;  5JVE A;  5L0G A;  5E3A A;  3C7J A;  1APC A;  1NLX A;  3RQG A;  1GGQ A;  3FHD A;  4JEA A;  4OIP F;  2UUI A;  1M56 C;  2UUH A;  3H2V A;  3JYY A;  3ATP A;  4G7O F;  1ZHT A;  2BC5 A;  3EH2 A;  3NRH A;  4Q4Z F;  1QSP A;  2XXA B;  1SR2 A;  2J45 A;  2Y3H A;  2WB7 A;  4JIO A;  4Z9J A;  1C03 A;  4XEF A;  3X2Q C;  5DS4 A;  2L6F A;  4NC3 A;  3LES A;  3QVY A;  5COF A;  4DOZ A;  1NFN A;  4RD9 A;  1E84 A;  1MQV A;  4QI2 A;  4Q7C A;  3E70 C;  2JD3 A;  3JSE O;  3K1H A;  4OIR F;  5A6A A;  2IXO A;  3KKB A;  2XLH A;  3QW0 A;  1M2O A;  2Y3B A;  4BJ1 A;  2PFD A;  1Z5Z A;  1YA7 O;  2YHS A;  3DAF A;  2KYH A;  2CNW D;  2OU6 A;  1BR4 A;  3AG4 C;  1YVI A;  2H7O A;  3DM9 B;  3RVZ A;  1W2W A;  4BJ5 A;  5KYW B;  3JTL O;  2ETS A;  2HFI A;  1PD1 A;  2P6V A;  2NUT A;  1TFO B;  1MND A;  1N1C A;  3NG1 A;  1CGM E;  4N6C A;  4ANJ A;  2J9B A;  2G3K A;  2V26 A;  4DJ9 A;  4CIH A;  3U2L A;  3DM5 A;  3WAQ A;  2XXA A;  3ZDL A;  1KTM A;  1OCC C;  2AWC A;  2VCC A;  2J9V A;  3ABL C;  4CS7 A;  3FDQ A;  1D1B A;  2KK1 A;  4XPY A;  3S0X A;  4YT8 A;  3VM6 A;  4EKW A;  3AGU A;  4GQH A;  1HMD A;  1YZA A;  2LSE A;  2Q7R A;  1ORY A;  3AG2 C;  2WZG A;  1VMA A;  3PCV A;  3HNK A;  3WG7 C;  2DGJ A;  4YT2 A;  2GFH A;  5A69 A;  3DJU B;  4MVU A;  1L7C A;  3F47 A;  3CEX A;  2LD6 A;  3KYI A;  4MS2 A;  4CDY A;  5L0H A;  3MLG A;  3HJC A;  1XZP A;  4YN0 B;  2R7V A;  1A0B A;  1FFT C;  3FMS A;  2J46 A;  3IQC A;  1YLM A;  2XLV A;  4PJN A;  3TOM A;  3U3B A;  4WGZ A;  3W2V A;  5KYW A;  4ULW A;  3TJ5 A;  1ZU4 A;  2NPU A;  3UGO A;  1OXK A;  1WGW A;  2WZL A;  3NYL A;  2Q4F A;  4PK4 A;  3DI5 A;  3UMH A;  2PP4 A;  1K40 A;  4A2N B;  3Q6M A;  3FOO A;  3VYW A;  1LIH A;  2EIK C;  1BR2 A;  3AQC A;  4B6I A;  4BJ6 A;  1ZHW A;  1D0Y A;  2HMZ A;  4U5G A;  3ZVR A;  4CJO A;  2XLE A;  3RFY A;  2YLD A;  2HJ3 A;  2NG1 A;  3UMK A;  3ZIB A;  3LUT B;  4LLC A;  1H7I A;  3RKO F;  3GM2 A;  4E0H A;  3U9M A;  3I5P A;  4NTA A;  1C17 M;  2NSF A;  1TKN A;  2MWQ A;  1OCO C;  2CGE A;  4IWB A;  2R7X A;  2YL1 A;  2QE9 A;  2A0U A;  4J30 B;  1NZE A;  1FR0 A;  4K0D A;  3DE9 A;  1AVO B;  1TWH A;  1RCP A;  4C3E A; 
#chains in the Genus database with same CATH homology
 3U8V A;  2LFF A;  2HZ8 A;  1Y4C A;  2LFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...