1Q0KA

Crystal structure of ni-containing superoxide dismutase with ni-ligation corresponding to the thiosulfate-reduced state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
117
structure length
117
Chain Sequence
HCDLPCGVYDPAQARIEAESVKAIQEKMAANDDLHFQIRATVIKEQRAELAKHHLDVLWSDYFKPPHFESYPELHTLVNEAVKALSAAKASTDPATGQKALDYIAQIDKIFWETKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Ni]
publication title Crystal structure of nickel-containing superoxide dismutase reveals another type of active site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 51
structure length 117
sequence length 117
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.400 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nickel-containing superoxide dismutase 1q0kA00
1Q0KA 1Q0MA 1T6UA 1T6IA 4NCQA 1Q0GA 1Q0DA 3G4XA 3G4ZA 1T6QA 3G50A 1Q0FA
chains in the Genus database with same CATH superfamily
1ST6A 3KYJA 1Z6AA 5DVWA 4IAQA 2P7VA 2YVKA 4CS8A 3DZAA 4U9DA 1T9KA 2AWYA 1GQAA 1CPRA 5A6AA 3SXYA 3RQGA 2DYRC 4ER9A 1CPQA 4JZAA 4CSAC 1RXQA 1WGWA 2Q3TA 4YL3A 3B71A 1HMDA 4PK4A 2J9VA 4CDYA 2L6GA 2CNWA 2XS8A 3KPHA 1DOWA 3PDMP 2R7VA 4JJFA 3RH3A 1RKCA 4O6YA 2IM8A 1LS1A 4C3EA 4L6RA 4YT4A 1V55C 2OEVA 1APCA 3E70C 1A0BA 2LD6A 1BZ4A 4MNDA 3CEXA 4XQ1A 5DQZA 4A4AA 3ABKC 4O6MA 3L8JA 4XPYA 3O55A 1WN0A 2YLGA 2KC3A 3JTLO 3NMKA 2W4MA 3ZQVA 4J30B 2HZ8A 3JZ0A 4DVZA 1YYXA 3UNGC 1EI7A 2AVKA 3EZIA 3LS0A 5B3SC 1R4TA 4I44A 1I5NA 3ATPA 3HNIA 1ORJA 2IXMA 3NMIA 5COFA 3IHUA 2XLOA 3FDQA 4C7OA 1HW1A 1RJ9A 4MVUA 3GM1A 1Q0GA 4AL1A 4CS9C 5B3IA 5DLJA 5KYUB 1VYKA 1O3UA 4MVQA 1YYJA 2C03A 4MVOA 1OQCA 1M6TA 5KYWA 1D1CA 2H8AA 4YN0B 3EZHA 2XLDA 1OR2A 4OINF 3VF0A 3OWTA 4EBBA 1HMOA 3I4UA 1T5OA 3WHNA 4JKVA 1YAUO 3NYJA 1M2OA 2IYLD 3AG2C 3A11A 4JEAA 3FHDA 3N24A 4XEKA 3T6BA 3X2QC 4ANJA 4IAOA 4EHPA 5B1AC 3X1OA 3QMKA 1KTMA 1Z23A 4QI0A 4YJWA 4I1OB 5EHHA 5JS5A 2LFFA 5JUAA 1FNTc 1LI7A 5JRAA 2J7PD 4EIYA 4WJ0A 3GANA 4J7TA 5TJ5E 2HFIA 3V5XA 2LK4A 2R03A 3KL4A 4O7GA 3HNLA 1TFKB 2HSQA 1ORYA 1JMWA 1YARO 1ZHWA 3K6BA 4O6NA 3U8PA 3KMIA 4JTCB 1MNDA 5KYYA 1ZHZA 4B6IA 3U2MA 5L0CA 1VYIA 1WTYA 1CGNA 4HFKB 3DE8A 2ZD9A 3EPVA 3L1MA 1UFBA 2PX3A 4GQHA 4N6CA 1RJ9B 4U5EE 2G3KA 2X51A 4JURI 1JPJA 3U5SA 5DS4A 1H6GA 4OIRF 2YHSA 4OIQF 2CDQA 3RF3A 5BQHA 3J06A 2XLVA 1EQ1A 4IRUA 3B0UX 5L3VA 3M15A 1OKKD 1A7EA 1FMWA 1YLMA 2MWQA 4JCHA 4JVSA 1QVXA 2P6VA 1BBHA 2KYHA 1AVOB 3U3BA 1JRAA 4XLPF 4U5BE 2G62A 2IOQA 4E17A 1VLTA 5L0GA 3U9MA 3HNJA 3K1IC 1V74B 2A6HF 1SF8A 1SZIA 4CIHA 4CS7A 3KKBA 1HW2A 1VK5A 1SMYF 2GAQA 3ASNC 4KC9A 1Q0FA 2XSEA 3VYWA 3C62A 3IQ6A 2NUTA 2EPNA 5JLIA 4PJMA 2R7UA 1D0XA 2AWCA 1NBBA 1T6QA 4BEMJ 2R02A 3L34A 4MVSA 4A2NB 3C63A 3EH2A 2CYDA 4MVMA 5GPGB 3FVYA 5A6JA 4IJJA 4YWQA 2HV7A 3G4XA 1OCOC 2ETSA 3I5PA 1PV3A 1J8MF 1TWGA 1C17M 2A0UA 2VCCA 3NRHA 1QZXA 4ZLDA 3EJNA 3ZTMA 2HMZA 3HNKA 1LS4A 4XPXA 2EPMX 2J9WA 3MX3A 4IWBA 4JCZA 3FOOA 4NQFA 2AU5A 4MW8A 1XZPA 5JP7A 2WZFA 5DS6A 5L3QA 5KYYB 1SR2A 2O9XA 1H9TA 3NKEA 1LI5A 3TD7A 4P9FA 2R7OA 1ZW3A 2WVOA 1SYQA 1D0ZA 2FGYA 1A7DA 1W2WA 4JW1A 4I3MA 3JYYA 3NYMA 2L9JA 2ZXPA 2Q7RA 3B0PA 3IQ5A 3KYIA 4E7SA 3SEOA 3K1HA 3GORA 2DI3A 2NUPA 4CSAA 3SXZA 4EBJA 2XLWA 2L6FA 1A7VA 4YT2A 5A6BD 2I8BA 2Q9AA 4P6IC 3C8GA 2BL2A 4Q4ZF 5F5HA 4ULWA 1FFHA 3M4CA 4PJLA 4XTKA 1YZAA 5COGA 5F5FA 1J8YF 4U5CE 2PF4E 4E18A 2EPOA 4DRJB 3QW1A 1QSPA 2LIGA 3L0IA 1LPEA 2W4BA 3IQCA 4KNWA 1JAFA 1K40A 2PFDA 1IZMA 5DS5A 2GWWA 2Q9BA 5K0IA 2W45A 4N6HA 3IPMO 4WGYA 4DOZA 1ZW2A 4BJ1A 1ZZPA 3GEIA 2Y69C 3LEVA 1YZCA 1JR8A 3LEOA 3L8IA 4G0HA 4FWVA 1YA9A 5D91A 1LE4A 1UG7A 3G4ZA 4E0IA 1E86A 1MMDA 2JD3A 2P1AA 2YL7A 2BC5A 2HJMA 2ZXWC 1NSGB 2J8WA 5T3TA 1OCCC 2OEXA 3JRMO 1TKNA 3ABLC 1NG1A 2UUHA 4GYTA 3QVZA 2QLAA 3ZIBA 2IXOA 4CS9A 4CJOA 4U5HA 2OKUA 3ECSA 1Y4CA 1GGQA 1ZVZA 2ZXRA 4NCQA 5EGYA 1YA7O 4CBEA 5AC4A 3W4YA 3RQEA 1NU9C 1ZHXA 2P61A 3AG1C 2R7QA 3DE9A 3WG7C 3UMIA 4AX2A 5L0DA 1U0BB 3SXKA 1C02A 1ZHYA 3CSKA 3H2UA 4F4BA 3T6JA 1G8XA 2EIMC 2RD9A 3T6GB 3W2WA 4DJ9A 2YLIA 2Y39A 2JPUA 1E2XA 1Z7Qc 2IXNA 4G7HF 2QE9A 5CI9A 1D1BA 1S05A 3UGPA 4BPMA 4XEFA 1TWHA 3US6A 3ITFA 3V5YA 4AL0A 4EUKB 2YL0A 2KGOA 2YQYA 3U0CA 2YRFA 2A1DD 4M63A 5JT4A 2OJED 4W8KA 4XLNF 1M2VA 4MVRA 2VH3A 5L0JA 2OJQA 1E83A 1Q0KA 4Z9HA 3TULA 4G7OF 3VRCA 3ZQYA 4CX9A 3EG9A 1MMAA 3GEHA 5FCLA 1LVKA 3EGDA 4HFFB 1DOVA 2ASRA 2NPUA 4MTOA 4OD5A 4MW3A 4KI2A 1H9GA 3JSEO 3ZC4A 3H65A 2LCHA 2Y3BA 3WAQA 5DQTA 4P9TA 2IXPA 3MFNA 4BJ5A 2HV6A 3W2VA 3H2VA 5BUOA 2VCBA 2L7AA 1OW6A 4MS2A 4FESA 1BR4A 4H4KC 2QTVA 3DD7A 4BG0A 1LIHA 1ZU4A 2CCYA 1MQVA 3C7JA 3EGXA 2EILC 2YLDA 4G78A 1WATA 3ZWIA 3HTKC 2V26A 3RVZA 5A6BA 3S9OA 1FR0A 2KQ9A 3RVYA 1RKEA 5E3CA 4LACB 1NU7D 3LLKA 5KYWB 2CNWD 4RBNA 4XEVA 5L0HA 4JEBA 4U9EA 5A69A 3AOUA 1A41A 3DAGA 5EK0A 3CAXA 4NC3A 1GS9A 3KH2A 2B0JA 3NG1A 2CW0F 2MYSA 1KU2A 1TFOB 3NMJA 2YWAA 2WL8A 4U5GA 3WODF 2B0HA 1LE2A 1L7CA 3ZVRA 4ONSA 1OXBA 4XWJA 4D4XA 4E7ZA 2AP3A 2ZXOA 4NTFA 4NTAA 4CJGA 2PBEA 2A6EF 4JTAB 4LDKA 4NTBA 1B68A 5T3WA 3RIPA 3UMKA 5KYNA 3VM6A 2DGJA 1MNEA 1ZU5A 2LP4A 3POVA 1T6UA 4J7YA 4WGZA 3JT1A 3EG9B 5CIVA 3DJNB 3DKAA 3A9CA 4OIOF 4YT5A 4IARA 3RQFA 2RSEB 3ASOC 1HE1A 3DMDA 2PX0A 3T9OA 4DBRA 1HY5A 4RDAA 4PFOA 1KNYA 2H7OA 3R7CA 2QUPA 2KK1A 2Q4FA 3GM3A 4PJJA 1V4AA 2OU6A 2D5RB 1V54C 1WWPA 5COMA 5A6KA 2F22A 2BE5F 2LFDA 3BEHA 3IEEA 3B29A 3LAYA 3U8VA 5JSLA 4G7ZF 1C03A 2R25A 2Q9CA 2J9UA 256BA 3TOLA 2Q00A 3O39A 1U89A 3HKKA 3I5QA 1OR3A 2EIKC 4RD9A 3LUTB 1FAPB 1S7ZA 2L6HA 1YJGA 1OCZC 1ORSC 3GODA 3GWLA 1M56C 4LLCA 4IGGA 1D0YA 3VAYA 2XM0A 1PD0A 3GWNA 1I4YA 1AEPA 5KYXA 3HJCA 3M1CB 4JTDB 3OA1A 1BR1A 1N1CA 3SP1A 3JYHA 1FFTC 1F1MA 2KJGA 4BJ6C 1CGOA 1LKXA 3EQLF 3MLGA 2YKZA 3EFOA 4D4NA 1RMVA 3EH1A 3W8HA 3TK0A 2XLHA 1I4ZA 1O87A 2NSFA 4LERA 1GM5A 2D4UA 4DXWA 2XXAA 1TR2A 2J46A 1OW8A 2J7PA 5B1BC 3U3FA 2NUTB 3ZG1A 3B9QA 3C8ZA 1Q0DA 1ZHTA 3E9VA 3F47A 3MYIA 4PR9A 3DM9B 5CI8A 3ZDLA 3FMSA 3ZSUA 1JOGA 3NYLA 3JRTA 3K33A 3Q6MA 4KNVA 4BEJA 1EA8A 4K0DA 4LDRA 3LNMB 2ICWG 2M4EA 3N2ZB 2VB6A 3DWWA 4K1OA 4IB4A 2EPKX 4N4WA 3Q6NA 3LS1A 3MBGA 1WASA 3RW0A 1H7IA 3U2LA 4C3DA 5HV9A 2MHRA 4I1MA 3DXJF 4Q7CA 4QDLA 4C3BA 1M57C 4CS8C 4YL0A 1R5ID 1OKKA 4JIOA 4O79A 2XL4A 1T6IA 1QKRA 4EBKA 2GDCA 2NSGA 3LESA 3TOMA 2IBFA 1O5HA 1PD1A 1QLEC 4H54A 1VTMP 4GEHA 1QPUA 3LNRA 4MTFA 3N0TA 2XRHA 3GM2A 1VMAA 4DRHB 1OW7A 2Y3GA 4LLEA 1YDIA 2R7TA 4XPWA 4AE4A 4ULVA 2L81A 5KYXB 2HSBA 2NG1A 3EHMA 1EKYA 5E3AA 2DYSC 2NUPB 4CDVA 2V3CC 2LQGA 4KBLA 5IY5C 1D1AA 1FTSA 4CIPA 3S90A 4U5DE 2H7BA 3EFOB 3C8GB 3PMRA 4HE8D 5L0IA 2DB4A 2FAPB 2XL8A 3C18A 3LJBA 3HLZA 2YL1A 5D92A 5E33A 3RKOF 3TJ5A 4DBQA 2XL6A 3B0VC 2XXAB 1T01A 4FX5A 4C7OB 5HSWA 2EINC 2PP4A 1Z63A 2YL3A 4K7BA 4EWCA 5JVEA 3ABMC 4R32A 3AQBA 4JE9A 4DVYP 2OG2A 3IQTA 4HEAJ 4JRZA 3FXHA 5BQIA 3AGTA 2OQMA 4CDAA 3QW0A 2X0CA 3AG3C 1G4WR 1BDJB 3GEEA 3S29A 1HE9A 3AJMA 2WB7A 4JJGA 5AGFA 2WZLA 1K04A 2XLMA 2G3VA 3OEOA 4MVZA 2HS5A 3TJ6A 3S84A 2JX0A 2R7XA 3M79A 2PNOA 4E0HA 3U9JA 1NZEA 4YT8A 1CGME 1VLSA 3FAJA 2E87A 2P0NA 3C8GD 1E84A 5AC5A 3UMHA 2VASA 1U6HA 4DRIB 1NLXA 1BR2A 1L3PA 3SYNA 2R7RA 1MMGA 3K1IA 4AE4B 5F28E 4MQ9F 3S0XA 3CZ6A 3QVYA 2HMQA 4BJTA 4FAPB 1Y6DA 2OCCC 2Y3HA 3O6XA 2YZSA 1TQGA 2LSEA 1Z5ZA 3M4BA 2R05A 3Q7GA 4U5FE 4N06A 2Y3DA 4Z9IA 1QQ3A 5T1DB 1AUEA 1WOLA 3NKDA 2VC9A 3O10A 1OCRC 2WVNA 3QZCA 4BJ5C 4PFPA 2I15A 1M2VB 2CGEA 2W9YA 2J0WA 4J32B 1Q0MA 2J45A 2EPLX 3FAPB 3S28A 3EHNA 3DAFA 2QY9A 1XZQA 3NDBB 2J9BA 4NY3A 1NFOA 1VB5A 3EGDB 1E85A 2XM4A 2A69F 2XLEA 2GFHA 2KW3C 4W8PA 4Q5SF 4AK9A 3AQCA 1XWJA 1JPNA 4UDVA 1G4US 4ZLCA 3TQOA 3R2PA 3LLIA 3AGUA 2H7VC 1OXKA 3RFYA 2WVQA 1VOMA 3RYLA 3PCVA 2HKVA 3UGOA 2KNHA 1G5ZA 2QNLA 4OD4A 1PCXA 3EGXB 1K05A 1LM3B 2FFHA 2M64A 5BQGA 4OIPF 2A68F 1MMNA 3SNHA 4PACA 3MYFA 2C04A 3JSZA 4LDQA 5E2QA 4BJ6A 1NFNA 1RKEB 2UUIA 3T4RA 3SXMA 3DM5A 2VCAA 2OOCA 2J0XA 1TWAA 2EIJC 4YK5A 4X0RA 3CQZA 4YL1A 1ZYRF 2ZPAA 3UR3C 2XS1A 2HUJA 3BRJA 4JC7A 2A0BA 1RCPA 2HJ3A 3S27A 2TMVP 5L0FA 1YVIA 2WZGA 4Z9JA 2Z15A 2R9RB 3V7OA 4EKWA 1FMVA 4QI2A 3F46A 4PJNA 2YEVA 3DI5A 3W8IA 3PHF2 3JCUQ 4MTGA 3K7DA 2KSFA 4WABA 1TWCA 1IW7F 3SZRA 3V5ZA 5KYUA 2R7SA 1Z3IX 3AG4C 3K66A 3Q7LA 3ZTZA 2GA0A 2R7WA 5FZTA 3QTHA 3DJUB 3G50A 3FOPA
chains in the Genus database with same CATH topology
1Q0KA 1Q0MA 1T6UA 1T6IA 4NCQA 1Q0GA 1Q0DA 3G4XA 3G4ZA 1T6QA 3G50A 1Q0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0K A;  1Q0M A;  1T6U A;  1T6I A;  4NCQ A;  1Q0G A;  1Q0D A;  3G4X A;  3G4Z A;  1T6Q A;  3G50 A;  1Q0F A; 
#chains in the Genus database with same CATH topology
 1ST6 A;  3KYJ A;  1Z6A A;  5DVW A;  4IAQ A;  2P7V A;  2YVK A;  4CS8 A;  3DZA A;  4U9D A;  1T9K A;  2AWY A;  1GQA A;  1CPR A;  5A6A A;  3SXY A;  3RQG A;  2DYR C;  4ER9 A;  1CPQ A;  4JZA A;  4CSA C;  1RXQ A;  1WGW A;  2Q3T A;  4YL3 A;  3B71 A;  1HMD A;  4PK4 A;  2J9V A;  4CDY A;  2L6G A;  2CNW A;  2XS8 A;  3KPH A;  1DOW A;  3PDM P;  2R7V A;  4JJF A;  3RH3 A;  1RKC A;  4O6Y A;  2IM8 A;  1LS1 A;  4C3E A;  4L6R A;  4YT4 A;  1V55 C;  2OEV A;  1APC A;  3E70 C;  1A0B A;  2LD6 A;  1BZ4 A;  4MND A;  3CEX A;  4XQ1 A;  5DQZ A;  4A4A A;  3ABK C;  4O6M A;  3L8J A;  4XPY A;  3O55 A;  1WN0 A;  2YLG A;  2KC3 A;  3JTL O;  3NMK A;  2W4M A;  3ZQV A;  4J30 B;  2HZ8 A;  3JZ0 A;  4DVZ A;  1YYX A;  3UNG C;  1EI7 A;  2AVK A;  3EZI A;  3LS0 A;  5B3S C;  1R4T A;  4I44 A;  1I5N A;  3ATP A;  3HNI A;  1ORJ A;  2IXM A;  3NMI A;  5COF A;  3IHU A;  2XLO A;  3FDQ A;  4C7O A;  1HW1 A;  1RJ9 A;  4MVU A;  3GM1 A;  1Q0G A;  4AL1 A;  4CS9 C;  5B3I A;  5DLJ A;  5KYU B;  1VYK A;  1O3U A;  4MVQ A;  1YYJ A;  2C03 A;  4MVO A;  1OQC A;  1M6T A;  5KYW A;  1D1C A;  2H8A A;  4YN0 B;  3EZH A;  2XLD A;  1OR2 A;  4OIN F;  3VF0 A;  3OWT A;  4EBB A;  1HMO A;  3I4U A;  1T5O A;  3WHN A;  4JKV A;  1YAU O;  3NYJ A;  1M2O A;  2IYL D;  3AG2 C;  3A11 A;  4JEA A;  3FHD A;  3N24 A;  4XEK A;  3T6B A;  3X2Q C;  4ANJ A;  4IAO A;  4EHP A;  5B1A C;  3X1O A;  3QMK A;  1KTM A;  1Z23 A;  4QI0 A;  4YJW A;  4I1O B;  5EHH A;  5JS5 A;  2LFF A;  5JUA A;  1FNT c;  1LI7 A;  5JRA A;  2J7P D;  4EIY A;  4WJ0 A;  3GAN A;  4J7T A;  5TJ5 E;  2HFI A;  3V5X A;  2LK4 A;  2R03 A;  3KL4 A;  4O7G A;  3HNL A;  1TFK B;  2HSQ A;  1ORY A;  1JMW A;  1YAR O;  1ZHW A;  3K6B A;  4O6N A;  3U8P A;  3KMI A;  4JTC B;  1MND A;  5KYY A;  1ZHZ A;  4B6I A;  3U2M A;  5L0C A;  1VYI A;  1WTY A;  1CGN A;  4HFK B;  3DE8 A;  2ZD9 A;  3EPV A;  3L1M A;  1UFB A;  2PX3 A;  4GQH A;  4N6C A;  1RJ9 B;  4U5E E;  2G3K A;  2X51 A;  4JUR I;  1JPJ A;  3U5S A;  5DS4 A;  1H6G A;  4OIR F;  2YHS A;  4OIQ F;  2CDQ A;  3RF3 A;  5BQH A;  3J06 A;  2XLV A;  1EQ1 A;  4IRU A;  3B0U X;  5L3V A;  3M15 A;  1OKK D;  1A7E A;  1FMW A;  1YLM A;  2MWQ A;  4JCH A;  4JVS A;  1QVX A;  2P6V A;  1BBH A;  2KYH A;  1AVO B;  3U3B A;  1JRA A;  4XLP F;  4U5B E;  2G62 A;  2IOQ A;  4E17 A;  1VLT A;  5L0G A;  3U9M A;  3HNJ A;  3K1I C;  1V74 B;  2A6H F;  1SF8 A;  1SZI A;  4CIH A;  4CS7 A;  3KKB A;  1HW2 A;  1VK5 A;  1SMY F;  2GAQ A;  3ASN C;  4KC9 A;  1Q0F A;  2XSE A;  3VYW A;  3C62 A;  3IQ6 A;  2NUT A;  2EPN A;  5JLI A;  4PJM A;  2R7U A;  1D0X A;  2AWC A;  1NBB A;  1T6Q A;  4BEM J;  2R02 A;  3L34 A;  4MVS A;  4A2N B;  3C63 A;  3EH2 A;  2CYD A;  4MVM A;  5GPG B;  3FVY A;  5A6J A;  4IJJ A;  4YWQ A;  2HV7 A;  3G4X A;  1OCO C;  2ETS A;  3I5P A;  1PV3 A;  1J8M F;  1TWG A;  1C17 M;  2A0U A;  2VCC A;  3NRH A;  1QZX A;  4ZLD A;  3EJN A;  3ZTM A;  2HMZ A;  3HNK A;  1LS4 A;  4XPX A;  2EPM X;  2J9W A;  3MX3 A;  4IWB A;  4JCZ A;  3FOO A;  4NQF A;  2AU5 A;  4MW8 A;  1XZP A;  5JP7 A;  2WZF A;  5DS6 A;  5L3Q A;  5KYY B;  1SR2 A;  2O9X A;  1H9T A;  3NKE A;  1LI5 A;  3TD7 A;  4P9F A;  2R7O A;  1ZW3 A;  2WVO A;  1SYQ A;  1D0Z A;  2FGY A;  1A7D A;  1W2W A;  4JW1 A;  4I3M A;  3JYY A;  3NYM A;  2L9J A;  2ZXP A;  2Q7R A;  3B0P A;  3IQ5 A;  3KYI A;  4E7S A;  3SEO A;  3K1H A;  3GOR A;  2DI3 A;  2NUP A;  4CSA A;  3SXZ A;  4EBJ A;  2XLW A;  2L6F A;  1A7V A;  4YT2 A;  5A6B D;  2I8B A;  2Q9A A;  4P6I C;  3C8G A;  2BL2 A;  4Q4Z F;  5F5H A;  4ULW A;  1FFH A;  3M4C A;  4PJL A;  4XTK A;  1YZA A;  5COG A;  5F5F A;  1J8Y F;  4U5C E;  2PF4 E;  4E18 A;  2EPO A;  4DRJ B;  3QW1 A;  1QSP A;  2LIG A;  3L0I A;  1LPE A;  2W4B A;  3IQC A;  4KNW A;  1JAF A;  1K40 A;  2PFD A;  1IZM A;  5DS5 A;  2GWW A;  2Q9B A;  5K0I A;  2W45 A;  4N6H A;  3IPM O;  4WGY A;  4DOZ A;  1ZW2 A;  4BJ1 A;  1ZZP A;  3GEI A;  2Y69 C;  3LEV A;  1YZC A;  1JR8 A;  3LEO A;  3L8I A;  4G0H A;  4FWV A;  1YA9 A;  5D91 A;  1LE4 A;  1UG7 A;  3G4Z A;  4E0I A;  1E86 A;  1MMD A;  2JD3 A;  2P1A A;  2YL7 A;  2BC5 A;  2HJM A;  2ZXW C;  1NSG B;  2J8W A;  5T3T A;  1OCC C;  2OEX A;  3JRM O;  1TKN A;  3ABL C;  1NG1 A;  2UUH A;  4GYT A;  3QVZ A;  2QLA A;  3ZIB A;  2IXO A;  4CS9 A;  4CJO A;  4U5H A;  2OKU A;  3ECS A;  1Y4C A;  1GGQ A;  1ZVZ A;  2ZXR A;  4NCQ A;  5EGY A;  1YA7 O;  4CBE A;  5AC4 A;  3W4Y A;  3RQE A;  1NU9 C;  1ZHX A;  2P61 A;  3AG1 C;  2R7Q A;  3DE9 A;  3WG7 C;  3UMI A;  4AX2 A;  5L0D A;  1U0B B;  3SXK A;  1C02 A;  1ZHY A;  3CSK A;  3H2U A;  4F4B A;  3T6J A;  1G8X A;  2EIM C;  2RD9 A;  3T6G B;  3W2W A;  4DJ9 A;  2YLI A;  2Y39 A;  2JPU A;  1E2X A;  1Z7Q c;  2IXN A;  4G7H F;  2QE9 A;  5CI9 A;  1D1B A;  1S05 A;  3UGP A;  4BPM A;  4XEF A;  1TWH A;  3US6 A;  3ITF A;  3V5Y A;  4AL0 A;  4EUK B;  2YL0 A;  2KGO A;  2YQY A;  3U0C A;  2YRF A;  2A1D D;  4M63 A;  5JT4 A;  2OJE D;  4W8K A;  4XLN F;  1M2V A;  4MVR A;  2VH3 A;  5L0J A;  2OJQ A;  1E83 A;  1Q0K A;  4Z9H A;  3TUL A;  4G7O F;  3VRC A;  3ZQY A;  4CX9 A;  3EG9 A;  1MMA A;  3GEH A;  5FCL A;  1LVK A;  3EGD A;  4HFF B;  1DOV A;  2ASR A;  2NPU A;  4MTO A;  4OD5 A;  4MW3 A;  4KI2 A;  1H9G A;  3JSE O;  3ZC4 A;  3H65 A;  2LCH A;  2Y3B A;  3WAQ A;  5DQT A;  4P9T A;  2IXP A;  3MFN A;  4BJ5 A;  2HV6 A;  3W2V A;  3H2V A;  5BUO A;  2VCB A;  2L7A A;  1OW6 A;  4MS2 A;  4FES A;  1BR4 A;  4H4K C;  2QTV A;  3DD7 A;  4BG0 A;  1LIH A;  1ZU4 A;  2CCY A;  1MQV A;  3C7J A;  3EGX A;  2EIL C;  2YLD A;  4G78 A;  1WAT A;  3ZWI A;  3HTK C;  2V26 A;  3RVZ A;  5A6B A;  3S9O A;  1FR0 A;  2KQ9 A;  3RVY A;  1RKE A;  5E3C A;  4LAC B;  1NU7 D;  3LLK A;  5KYW B;  2CNW D;  4RBN A;  4XEV A;  5L0H A;  4JEB A;  4U9E A;  5A69 A;  3AOU A;  1A41 A;  3DAG A;  5EK0 A;  3CAX A;  4NC3 A;  1GS9 A;  3KH2 A;  2B0J A;  3NG1 A;  2CW0 F;  2MYS A;  1KU2 A;  1TFO B;  3NMJ A;  2YWA A;  2WL8 A;  4U5G A;  3WOD F;  2B0H A;  1LE2 A;  1L7C A;  3ZVR A;  4ONS A;  1OXB A;  4XWJ A;  4D4X A;  4E7Z A;  2AP3 A;  2ZXO A;  4NTF A;  4NTA A;  4CJG A;  2PBE A;  2A6E F;  4JTA B;  4LDK A;  4NTB A;  1B68 A;  5T3W A;  3RIP A;  3UMK A;  5KYN A;  3VM6 A;  2DGJ A;  1MNE A;  1ZU5 A;  2LP4 A;  3POV A;  1T6U A;  4J7Y A;  4WGZ A;  3JT1 A;  3EG9 B;  5CIV A;  3DJN B;  3DKA A;  3A9C A;  4OIO F;  4YT5 A;  4IAR A;  3RQF A;  2RSE B;  3ASO C;  1HE1 A;  3DMD A;  2PX0 A;  3T9O A;  4DBR A;  1HY5 A;  4RDA A;  4PFO A;  1KNY A;  2H7O A;  3R7C A;  2QUP A;  2KK1 A;  2Q4F A;  3GM3 A;  4PJJ A;  1V4A A;  2OU6 A;  2D5R B;  1V54 C;  1WWP A;  5COM A;  5A6K A;  2F22 A;  2BE5 F;  2LFD A;  3BEH A;  3IEE A;  3B29 A;  3LAY A;  3U8V A;  5JSL A;  4G7Z F;  1C03 A;  2R25 A;  2Q9C A;  2J9U A;  256B A;  3TOL A;  2Q00 A;  3O39 A;  1U89 A;  3HKK A;  3I5Q A;  1OR3 A;  2EIK C;  4RD9 A;  3LUT B;  1FAP B;  1S7Z A;  2L6H A;  1YJG A;  1OCZ C;  1ORS C;  3GOD A;  3GWL A;  1M56 C;  4LLC A;  4IGG A;  1D0Y A;  3VAY A;  2XM0 A;  1PD0 A;  3GWN A;  1I4Y A;  1AEP A;  5KYX A;  3HJC A;  3M1C B;  4JTD B;  3OA1 A;  1BR1 A;  1N1C A;  3SP1 A;  3JYH A;  1FFT C;  1F1M A;  2KJG A;  4BJ6 C;  1CGO A;  1LKX A;  3EQL F;  3MLG A;  2YKZ A;  3EFO A;  4D4N A;  1RMV A;  3EH1 A;  3W8H A;  3TK0 A;  2XLH A;  1I4Z A;  1O87 A;  2NSF A;  4LER A;  1GM5 A;  2D4U A;  4DXW A;  2XXA A;  1TR2 A;  2J46 A;  1OW8 A;  2J7P A;  5B1B C;  3U3F A;  2NUT B;  3ZG1 A;  3B9Q A;  3C8Z A;  1Q0D A;  1ZHT A;  3E9V A;  3F47 A;  3MYI A;  4PR9 A;  3DM9 B;  5CI8 A;  3ZDL A;  3FMS A;  3ZSU A;  1JOG A;  3NYL A;  3JRT A;  3K33 A;  3Q6M A;  4KNV A;  4BEJ A;  1EA8 A;  4K0D A;  4LDR A;  3LNM B;  2ICW G;  2M4E A;  3N2Z B;  2VB6 A;  3DWW A;  4K1O A;  4IB4 A;  2EPK X;  4N4W A;  3Q6N A;  3LS1 A;  3MBG A;  1WAS A;  3RW0 A;  1H7I A;  3U2L A;  4C3D A;  5HV9 A;  2MHR A;  4I1M A;  3DXJ F;  4Q7C A;  4QDL A;  4C3B A;  1M57 C;  4CS8 C;  4YL0 A;  1R5I D;  1OKK A;  4JIO A;  4O79 A;  2XL4 A;  1T6I A;  1QKR A;  4EBK A;  2GDC A;  2NSG A;  3LES A;  3TOM A;  2IBF A;  1O5H A;  1PD1 A;  1QLE C;  4H54 A;  1VTM P;  4GEH A;  1QPU A;  3LNR A;  4MTF A;  3N0T A;  2XRH A;  3GM2 A;  1VMA A;  4DRH B;  1OW7 A;  2Y3G A;  4LLE A;  1YDI A;  2R7T A;  4XPW A;  4AE4 A;  4ULV A;  2L81 A;  5KYX B;  2HSB A;  2NG1 A;  3EHM A;  1EKY A;  5E3A A;  2DYS C;  2NUP B;  4CDV A;  2V3C C;  2LQG A;  4KBL A;  5IY5 C;  1D1A A;  1FTS A;  4CIP A;  3S90 A;  4U5D E;  2H7B A;  3EFO B;  3C8G B;  3PMR A;  4HE8 D;  5L0I A;  2DB4 A;  2FAP B;  2XL8 A;  3C18 A;  3LJB A;  3HLZ A;  2YL1 A;  5D92 A;  5E33 A;  3RKO F;  3TJ5 A;  4DBQ A;  2XL6 A;  3B0V C;  2XXA B;  1T01 A;  4FX5 A;  4C7O B;  5HSW A;  2EIN C;  2PP4 A;  1Z63 A;  2YL3 A;  4K7B A;  4EWC A;  5JVE A;  3ABM C;  4R32 A;  3AQB A;  4JE9 A;  4DVY P;  2OG2 A;  3IQT A;  4HEA J;  4JRZ A;  3FXH A;  5BQI A;  3AGT A;  2OQM A;  4CDA A;  3QW0 A;  2X0C A;  3AG3 C;  1G4W R;  1BDJ B;  3GEE A;  3S29 A;  1HE9 A;  3AJM A;  2WB7 A;  4JJG A;  5AGF A;  2WZL A;  1K04 A;  2XLM A;  2G3V A;  3OEO A;  4MVZ A;  2HS5 A;  3TJ6 A;  3S84 A;  2JX0 A;  2R7X A;  3M79 A;  2PNO A;  4E0H A;  3U9J A;  1NZE A;  4YT8 A;  1CGM E;  1VLS A;  3FAJ A;  2E87 A;  2P0N A;  3C8G D;  1E84 A;  5AC5 A;  3UMH A;  2VAS A;  1U6H A;  4DRI B;  1NLX A;  1BR2 A;  1L3P A;  3SYN A;  2R7R A;  1MMG A;  3K1I A;  4AE4 B;  5F28 E;  4MQ9 F;  3S0X A;  3CZ6 A;  3QVY A;  2HMQ A;  4BJT A;  4FAP B;  1Y6D A;  2OCC C;  2Y3H A;  3O6X A;  2YZS A;  1TQG A;  2LSE A;  1Z5Z A;  3M4B A;  2R05 A;  3Q7G A;  4U5F E;  4N06 A;  2Y3D A;  4Z9I A;  1QQ3 A;  5T1D B;  1AUE A;  1WOL A;  3NKD A;  2VC9 A;  3O10 A;  1OCR C;  2WVN A;  3QZC A;  4BJ5 C;  4PFP A;  2I15 A;  1M2V B;  2CGE A;  2W9Y A;  2J0W A;  4J32 B;  1Q0M A;  2J45 A;  2EPL X;  3FAP B;  3S28 A;  3EHN A;  3DAF A;  2QY9 A;  1XZQ A;  3NDB B;  2J9B A;  4NY3 A;  1NFO A;  1VB5 A;  3EGD B;  1E85 A;  2XM4 A;  2A69 F;  2XLE A;  2GFH A;  2KW3 C;  4W8P A;  4Q5S F;  4AK9 A;  3AQC A;  1XWJ A;  1JPN A;  4UDV A;  1G4U S;  4ZLC A;  3TQO A;  3R2P A;  3LLI A;  3AGU A;  2H7V C;  1OXK A;  3RFY A;  2WVQ A;  1VOM A;  3RYL A;  3PCV A;  2HKV A;  3UGO A;  2KNH A;  1G5Z A;  2QNL A;  4OD4 A;  1PCX A;  3EGX B;  1K05 A;  1LM3 B;  2FFH A;  2M64 A;  5BQG A;  4OIP F;  2A68 F;  1MMN A;  3SNH A;  4PAC A;  3MYF A;  2C04 A;  3JSZ A;  4LDQ A;  5E2Q A;  4BJ6 A;  1NFN A;  1RKE B;  2UUI A;  3T4R A;  3SXM A;  3DM5 A;  2VCA A;  2OOC A;  2J0X A;  1TWA A;  2EIJ C;  4YK5 A;  4X0R A;  3CQZ A;  4YL1 A;  1ZYR F;  2ZPA A;  3UR3 C;  2XS1 A;  2HUJ A;  3BRJ A;  4JC7 A;  2A0B A;  1RCP A;  2HJ3 A;  3S27 A;  2TMV P;  5L0F A;  1YVI A;  2WZG A;  4Z9J A;  2Z15 A;  2R9R B;  3V7O A;  4EKW A;  1FMV A;  4QI2 A;  3F46 A;  4PJN A;  2YEV A;  3DI5 A;  3W8I A;  3PHF 2;  3JCU Q;  4MTG A;  3K7D A;  2KSF A;  4WAB A;  1TWC A;  1IW7 F;  3SZR A;  3V5Z A;  5KYU A;  2R7S A;  1Z3I X;  3AG4 C;  3K66 A;  3Q7L A;  3ZTZ A;  2GA0 A;  2R7W A;  5FZT A;  3QTH A;  3DJU B;  3G50 A;  3FOP A; 
#chains in the Genus database with same CATH homology
 1Q0K A;  1Q0M A;  1T6U A;  1T6I A;  4NCQ A;  1Q0G A;  1Q0D A;  3G4X A;  3G4Z A;  1T6Q A;  3G50 A;  1Q0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...