3HKKA

Structure of human leukotriene c4 synthase in complex with glutathione sulfonate
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
145
structure length
145
Chain Sequence
HKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
publication title Pre-steady state kinetics of human Leukotriene C4 synthase
rcsb
source organism Homo sapiens
total genus 61
structure length 145
sequence length 145
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2009-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 3hkkA00
3LEOA 4BPMA 5BQHA 2UUHA 4NTBA 4YL0A 4NTAA 3HKKA 4JCZA 4NTFA 4YK5A 5BQGA 4WABA 3PCVA 3DWWA 2PNOA 2UUIA 4YL1A 5BQIA 4J7TA 4JRZA 5HV9A 2H8AA 4JC7A 3B29A 5K0IA 2Q7RA 4AL1A 4AL0A 4J7YA 4YL3A
chains in the Genus database with same CATH superfamily
1MNDA 1A7VA 3C63A 3M79A 3NYJA 2R7TA 3MBGA 3Q6MA 4HFFB 2HJ3A 4PK4A 1VTMP 1M2VA 3C8GA 4FESA 5AC4A 1YYJA 4KI2A 4GEHA 4PR9A 3W4YA 4NY3A 4H54A 1H9GA 2HKVA 3HNLA 4KNVA 2J8WA 1VB5A 1RKEB 3NKDA 4QDLA 1DOWA 4RD9A 1TWAA 3RQFA 1HW2A 3ECSA 4XEKA 1ZHYA 3DM9B 5CIVA 1NU7D 2OJQA 3M4CA 4P9TA 1D1AA 4JJGA 4YN0B 3DI5A 1YVIA 4OINF 3V5ZA 1UG7A 4JRZA 2W45A 1Z5ZA 5CI9A 1UFBA 3M15A 4E0HA 2HJMA 3JRTA 3UMHA 4A4AA 2PX0A 5CI8A 3ABKC 3JTLO 1GQAA 2Q9CA 4NC3A 1HW1A 4CX9A 1PD1A 4UDVA 4XTKA 4YL3A 2EIJC 4BJ1A 2R7SA 3LEOA 1R4TA 4D4XA 2P1AA 5JT4A 3DD7A 1PD0A 2G62A 2OKUA 3UGPA 2M64A 2KNHA 2Q9BA 3GANA 4HEAJ 3AGUA 2YLIA 2O9XA 2JD3A 1EI7A 2R7XA 3JSZA 5FZTA 1E86A 1I4YA 4WABA 2VCBA 1FR0A 1OW8A 1S05A 3DXJF 3IQCA 3ZQYA 1OR3A 4MW8A 4EKWA 3QZCA 1Y6DA 4JURI 4LERA 2IXPA 3UR3C 1NLXA 2LFFA 1ZW2A 2A0UA 2OEVA 3K33A 4JCHA 3KYIA 4O6YA 2J0WA 5KYNA 2KW3C 3K1HA 2DYRC 5B1BC 1FAPB 2R05A 3VRCA 3M1CB 1JPNA 2B0JA 4AE4B 4BJ6C 5EGYA 1BDJB 1M6TA 1FMVA 1KNYA 3L1MA 2XXAA 3R2PA 3V5XA 3V7OA 4MTOA 3SNHA 3SYNA 2EPLX 3LLIA 2AWYA 5DS5A 5BUOA 1TWHA 2J0XA 2R7OA 4JKVA 1NZEA 2XL8A 3ABLC 2OU6A 2GFHA 2W9YA 1YDIA 3JYHA 1ORSC 3FOOA 4RDAA 4EUKB 2IYLD 5HV9A 4P9FA 3ZTZA 4O79A 1A41A 3B0PA 2BC5A 5COGA 4LLEA 3EPVA 1QQ3A 5JVEA 2XRHA 1J8YF 4C3DA 2I15A 3GODA 5L0DA 2HSBA 4N6HA 1RKEA 4CBEA 3TOLA 4DVYP 4OIPF 1FNTc 3NMKA 4BPMA 3SXYA 4JIOA 1QKRA 3NG1A 2A6EF 3ASNC 1MMGA 2YLGA 3L8JA 2VASA 1Z7Qc 5T3TA 1RJ9B 3B9QA 3VYWA 3UMKA 3RW0A 4N4WA 3HLZA 4DVZA 5A6JA 2LD6A 2A6HF 2LIGA 3R7CA 1OQCA 3U9MA 4C7OB 1FMWA 2PX3A 2V3CC 3U5SA 4MVOA 1OCCC 3G4XA 3SP1A 4EIYA 2XLWA 2FFHA 3DM5A 1TR2A 4DJ9A 2CW0F 3RQEA 1G5ZA 4CSAA 5D92A 2YRFA 3I4UA 3LLKA 1WTYA 1OW7A 2C04A 2IXNA 1JRAA 2XLDA 3ATPA 4PJLA 1HE1A 4JJFA 5COMA 5EHHA 4QI2A 2DYSC 4MVMA 3B0VC 5BQHA 1ZHZA 1JPJA 1HE9A 4KNWA 4YWQA 4JTCB 2NSFA 2YWAA 1U6HA 4ZLCA 2R7WA 4OD4A 5B1AC 4NTFA 4ANJA 2AWCA 2PF4E 4YK5A 3HTKC 3NKEA 4XEVA 2RD9A 2WB7A 3TK0A 5KYYB 1CGNA 1LM3B 5B3SC 2EIMC 3U8VA 3FMSA 4IWBA 3KYJA 1GM5A 1LE2A 3DE9A 4MVUA 1G8XA 3E9VA 3N0TA 1NFNA 4XPXA 3WHNA 4YT2A 1YYXA 4AK9A 3QVZA 5DVWA 2P0NA 2X51A 2HMZA 3RVYA 3ZG1A 3A11A 1E2XA 1AVOB 4ULWA 3SXMA 2HUJA 1ZHTA 2QY9A 3FAPB 1V4AA 2QUPA 3KKBA 1ZU4A 2A68F 3G4ZA 2UUHA 2R7RA 3DMDA 5JSLA 4DOZA 3KPHA 1SYQA 2LK4A 2V26A 4Q7CA 2ZXPA 4K7BA 5E33A 2OG2A 2EPKX 3EJNA 2H7VC 1NG1A 2L6GA 1I4ZA 1R5ID 2XLOA 3EFOB 1XZPA 3I5PA 1Q0KA 3ITFA 5DLJA 3S84A 2NPUA 1QSPA 3GM2A 2HFIA 4P6IC 2XLHA 3DWWA 3K66A 4L6RA 1EA8A 4EBKA 4G7ZF 3JRMO 2H8AA 2ETSA 4LACB 4MNDA 5KYWB 5KYXB 1IZMA 1MMDA 3F47A 3IQ5A 3JSEO 3N24A 3EHMA 3WAQA 1A7DA 1TQGA 2HMQA 3AOUA 1OR2A 4G78A 1RJ9A 2Y3DA 1B68A 3MFNA 3C62A 4R32A 3EGXB 1EKYA 3RVZA 2ZPAA 4PJNA 5EK0A 5HSWA 4AL1A 2IM8A 2XLMA 2XM0A 2Y3HA 4C7OA 1Q0MA 2ZXWC 3GEHA 4EHPA 1TFOB 1NFOA 4DRIB 3MYFA 4GYTA 4JE9A 2IBFA 3T6GB 2Y39A 3LJBA 3U3BA 3FDQA 2IXOA 1AEPA 3HKKA 3JYYA 5K0IA 4IB4A 2WVNA 3LS0A 4BG0A 4CSAC 3EH1A 4HE8D 2AVKA 1V74B 2DI3A 3K1IA 4BEJA 3ABMC 3CAXA 4G7HF 256BA 5E3AA 2OQMA 4PACA 2LSEA 3US6A 1D1CA 4ONSA 1QZXA 2FAPB 4WGYA 3EQLF 2WZLA 3E70C 1FTSA 2QTVA 3GWLA 3KH2A 2GDCA 3IQ6A 1BZ4A 3OEOA 4MQ9F 3U2LA 2EIKC 2J9UA 4U5EE 2Z15A 5JUAA 3VAYA 1TWCA 1CGME 4YT4A 2XS1A 1S7ZA 3C8ZA 2JPUA 4DBRA 1K05A 1JOGA 2NG1A 2Y3BA 4E18A 3LUTB 4CJOA 1OW6A 2X0CA 3S9OA 4IARA 5KYYA 3QW1A 3LS1A 4YL0A 1H9TA 3BRJA 2CDQA 3SZRA 3O39A 2AU5A 3LNRA 3W8IA 4PFOA 1VYIA 4U5GA 3RFYA 3WG7C 2R7QA 2PNOA 3OA1A 3TJ5A 1E83A 1A7EA 2A1DD 1M57C 4J30B 1LIHA 1L7CA 4LDQA 3RKOF 3NDBB 3SXKA 4FX5A 1EQ1A 1ZHWA 2XLVA 2HV6A 3H2UA 3FAJA 3U2MA 3NMIA 1LS1A 1WN0A 3MX3A 3N2ZB 4MVZA 4U9DA 2YL1A 2EPOA 1C02A 2KGOA 3AGTA 3U3FA 3EGDB 3ZC4A 2YKZA 3EFOA 4QI0A 3RF3A 5AGFA 3SXZA 1K40A 5DS4A 4MVSA 2J9BA 2Q4FA 3A9CA 3CQZA 1E84A 4DXWA 2YL7A 3IQTA 1Q0DA 1WWPA 3L34A 4ZLDA 5KYWA 1VMAA 2JX0A 2XLEA 3TOMA 1Y4CA 3T6BA 3GORA 5KYXA 2OOCA 3HJCA 1SMYF 3JCUQ 3L8IA 3S0XA 2YVKA 5KYUB 1TFKB 2WL8A 3F46A 2KSFA 2MWQA 2DB4A 3EGXA 4LDKA 2CYDA 4U5DE 1F1MA 2W4BA 3CSKA 3AQCA 2MHRA 1K04A 2EPNA 3JZ0A 3QMKA 2L7AA 3VM6A 3U0CA 1RMVA 3QW0A 2LQGA 4C3BA 1LI5A 3O10A 4XPWA 4Q4ZF 3FOPA 2VC9A 1O87A 2YL3A 3DJUB 4JVSA 4W8KA 4X0RA 1CPQA 2LCHA 3HNKA 5JS5A 3NYLA 1I5NA 1FFTC 2H7OA 2L6FA 4FWVA 5F5HA 5IY5C 1CPRA 1O5HA 5A6AA 5F28E 1O3UA 2FGYA 4LDRA 5L0GA 5L0FA 1OCRC 4W8PA 3UMIA 4E7SA 3K1IC 4IGGA 4U9EA 3EG9B 2HS5A 3T4RA 4CDAA 4NTAA 3ZDLA 1OXKA 4YT5A 4O7GA 1ZW3A 4I3MA 3QTHA 1LKXA 5B3IA 1HMOA 2DGJA 3GM3A 3AG1C 1LI7A 4YT8A 1VYKA 3NMJA 2B0HA 2Y3GA 1HMDA 4H4KC 1JAFA 2UUIA 1TKNA 2YZSA 5DQZA 1GGQA 1LVKA 4AE4A 2EILC 4IAOA 3HNIA 2WVQA 3OWTA 5JRAA 3G50A 4KBLA 1J8MF 4BJ5C 1RCPA 1LPEA 4XQ1A 2VCCA 2KYHA 3GEIA 4N06A 5A6KA 3SEOA 1OCOC 1QVXA 4NCQA 3U9JA 1JR8A 3B0UX 2IOQA 2PFDA 5A6BD 3NYMA 1AUEA 3FHDA 2GAQA 4MVRA 5L3VA 2L81A 1SF8A 3EZIA 4CJGA 5D91A 1A0BA 2R03A 3NRHA 4K0DA 2RSEB 2YLDA 3DAFA 1JMWA 1M2OA 5BQGA 3DAGA 3TJ6A 2QNLA 4AX2A 4EBBA 3EGDA 3MYIA 2NSGA 3W8HA 3LAYA 2CGEA 1T6QA 3AG2C 1YARO 5JP7A 4CS7A 2A0BA 5A69A 5JLIA 3DJNB 1YLMA 1OKKD 4ULVA 2Q7RA 2BE5F 3ZVRA 4OIRF 4I1MA 5KYUA 3W2VA 2QLAA 4CDYA 1ZZPA 5FCLA 5L0CA 3HNJA 3Q6NA 1QLEC 4Q5SF 3C7JA 4U5BE 4PJJA 1BBHA 2CNWD 3JT1A 3M4BA 2ASRA 4D4NA 4CIPA 2Q9AA 1VOMA 1PCXA 1T6UA 2ZXRA 3B71A 1WATA 1W2WA 4I1OB 1IW7F 4BEMJ 4XPYA 2Q3TA 3RIPA 2GA0A 2I8BA 3GWNA 1V55C 3H65A 3RQGA 4YJWA 3AG4C 1T5OA 4YL1A 3C18A 1ORYA 2XL4A 3POVA 2W4MA 1N1CA 2OJED 3ZWIA 4DRHB 3K7DA 3EG9A 3ZTMA 1Z3IX 2AP3A 4JW1A 2EINC 4MS2A 3EHNA 4XWJA 1HY5A 1MNEA 3DE8A 2VH3A 3IHUA 1FFHA 2J7PD 1BR1A 3KMIA 2L6HA 2R7VA 1M56C 4CS8A 1SZIA 5A6BA 1ZHXA 1E85A 1U89A 1V54C 1T01A 4PJMA 4BJ5A 5L3QA 4OIQF 4WGZA 3Q7GA 2M4EA 4JCZA 3T9OA 1MMAA 1LE4A 3MLGA 1XZQA 1NU9C 4Z9JA 4JZAA 2CCYA 4LLCA 4G0HA 1YJGA 4F4BA 3S29A 2HV7A 4BJTA 2J45A 4G7OF 1VLTA 2NUTB 3AJMA 2H7BA 4E17A 1WASA 3ASOC 4KC9A 3IEEA 2TMVP 1RXQA 3ZIBA 4XLPF 2BL2A 3UNGC 2Q00A 2IXMA 3K6BA 4CS9A 4HFKB 3I5QA 3Q7LA 1OKKA 3WODF 1BR4A 1Z6AA 3KL4A 1ZVZA 3TULA 3H2VA 5E3CA 2R9RB 2A69F 4J7YA 1LS4A 1G4WR 2NUPB 4I44A 4K1OA 4JEBA 3GM1A 3V5YA 3S90A 4OIOF 4MTGA 1XWJA 4NTBA 4WJ0A 2CNWA 3EH2A 3L0IA 3O6XA 1D0ZA 3S27A 4RBNA 5DS6A 1D0YA 4MTFA 3RH3A 3X1OA 2G3VA 1T9KA 2VCAA 3LEVA 4XEFA 5TJ5E 2PP4A 1RKCA 4PFPA 2KQ9A 1CGOA 1SR2A 1Q0FA 2KJGA 4O6NA 1H7IA 2QE9A 3W2WA 1G4US 2P6VA 3O55A 1M2VB 3C8GB 2VB6A 2WZGA 4Z9IA 3TD7A 4J7TA 5BQIA 4CDVA 4EBJA 2MYSA 1NSGB 2YHSA 4A2NB 5T1DB 4JC7A 5L0HA 4DRJB 4J32B 4NQFA 2PBEA 2XL6A 3PDMP 2YQYA 2G3KA 4IAQA 4DBQA 2HZ8A 1VLSA 1YA9A 3AQBA 3DZAA 1YZCA 4AL0A 2J7PA 1TWGA 3CZ6A 3TQOA 3T6JA 4B6IA 5L0IA 1KTMA 2E87A 3C8GD 1H6GA 4E7ZA 3UGOA 1ST6A 4M63A 2HSQA 1Z63A 1BR2A 1MMNA 3PMRA 3J06A 1U0BB 3ZSUA 5F5FA 1C17M 2ICWG 1APCA 2XS8A 2ZD9A 4C3EA 2LP4A 2KK1A 2L9JA 2XM4A 3PCVA 4MW3A 4JEAA 1DOVA 3X2QC 2J9WA 2WVOA 5L0JA 5T3WA 3RYLA 2D5RB 1L3PA 2WZFA 3EZHA 4OD5A 4EWCA 3IPMO 4XLNF 4CS8C 3VF0A 3FVYA 3PHF2 4IJJA 4E0IA 4U5CE 3QVYA 2R02A 3LNMB 4N6CA 1WOLA 1D1BA 2OCCC 3ZQVA 1ORJA 4U5HA 2R7UA 1Z23A 1VK5A 5COFA 2J9VA 2EPMX 1WGWA 1OCZC 1YAUO 2R25A 3CEXA 4IRUA 4JTDB 2F22A 2NUTA 1MQVA 2Y69C 4JTAB 1YA7O 2YL0A 4MVQA 1OXBA 5E2QA 5GPGB 3S28A 3DKAA 3BEHA 4BJ6A 2C03A 5DQTA 1ZYRF 1QPUA 2J46A 3GEEA 1KU2A 2GWWA 2P7VA 4O6MA 4CS9C 3FXHA 4ER9A 2XXAB 4CIHA 1ZU5A 3LESA 1D0XA 4FAPB 1YZAA 1C03A 1Q0GA 2NUPA 1PV3A 3U8PA 3AG3C 1NBBA 5AC5A 2ZXOA 2LFDA 3B29A 2P61A 4GQHA 4Z9HA 2D4UA 2YEVA 4U5FE 1T6IA 2XSEA 2KC3A 2OEXA 1GS9A
chains in the Genus database with same CATH topology
3LEOA 4BPMA 5BQHA 2UUHA 4NTBA 4YL0A 4NTAA 3HKKA 4JCZA 4NTFA 4YK5A 5BQGA 4WABA 3PCVA 3DWWA 2PNOA 2UUIA 4YL1A 5BQIA 4J7TA 4JRZA 5HV9A 2H8AA 4JC7A 3B29A 5K0IA 2Q7RA 4AL1A 4AL0A 4J7YA 4YL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LEO A;  4BPM A;  5BQH A;  2UUH A;  4NTB A;  4YL0 A;  4NTA A;  3HKK A;  4JCZ A;  4NTF A;  4YK5 A;  5BQG A;  4WAB A;  3PCV A;  3DWW A;  2PNO A;  2UUI A;  4YL1 A;  5BQI A;  4J7T A;  4JRZ A;  5HV9 A;  2H8A A;  4JC7 A;  3B29 A;  5K0I A;  2Q7R A;  4AL1 A;  4AL0 A;  4J7Y A;  4YL3 A; 
#chains in the Genus database with same CATH topology
 1MND A;  1A7V A;  3C63 A;  3M79 A;  3NYJ A;  2R7T A;  3MBG A;  3Q6M A;  4HFF B;  2HJ3 A;  4PK4 A;  1VTM P;  1M2V A;  3C8G A;  4FES A;  5AC4 A;  1YYJ A;  4KI2 A;  4GEH A;  4PR9 A;  3W4Y A;  4NY3 A;  4H54 A;  1H9G A;  2HKV A;  3HNL A;  4KNV A;  2J8W A;  1VB5 A;  1RKE B;  3NKD A;  4QDL A;  1DOW A;  4RD9 A;  1TWA A;  3RQF A;  1HW2 A;  3ECS A;  4XEK A;  1ZHY A;  3DM9 B;  5CIV A;  1NU7 D;  2OJQ A;  3M4C A;  4P9T A;  1D1A A;  4JJG A;  4YN0 B;  3DI5 A;  1YVI A;  4OIN F;  3V5Z A;  1UG7 A;  4JRZ A;  2W45 A;  1Z5Z A;  5CI9 A;  1UFB A;  3M15 A;  4E0H A;  2HJM A;  3JRT A;  3UMH A;  4A4A A;  2PX0 A;  5CI8 A;  3ABK C;  3JTL O;  1GQA A;  2Q9C A;  4NC3 A;  1HW1 A;  4CX9 A;  1PD1 A;  4UDV A;  4XTK A;  4YL3 A;  2EIJ C;  4BJ1 A;  2R7S A;  3LEO A;  1R4T A;  4D4X A;  2P1A A;  5JT4 A;  3DD7 A;  1PD0 A;  2G62 A;  2OKU A;  3UGP A;  2M64 A;  2KNH A;  2Q9B A;  3GAN A;  4HEA J;  3AGU A;  2YLI A;  2O9X A;  2JD3 A;  1EI7 A;  2R7X A;  3JSZ A;  5FZT A;  1E86 A;  1I4Y A;  4WAB A;  2VCB A;  1FR0 A;  1OW8 A;  1S05 A;  3DXJ F;  3IQC A;  3ZQY A;  1OR3 A;  4MW8 A;  4EKW A;  3QZC A;  1Y6D A;  4JUR I;  4LER A;  2IXP A;  3UR3 C;  1NLX A;  2LFF A;  1ZW2 A;  2A0U A;  2OEV A;  3K33 A;  4JCH A;  3KYI A;  4O6Y A;  2J0W A;  5KYN A;  2KW3 C;  3K1H A;  2DYR C;  5B1B C;  1FAP B;  2R05 A;  3VRC A;  3M1C B;  1JPN A;  2B0J A;  4AE4 B;  4BJ6 C;  5EGY A;  1BDJ B;  1M6T A;  1FMV A;  1KNY A;  3L1M A;  2XXA A;  3R2P A;  3V5X A;  3V7O A;  4MTO A;  3SNH A;  3SYN A;  2EPL X;  3LLI A;  2AWY A;  5DS5 A;  5BUO A;  1TWH A;  2J0X A;  2R7O A;  4JKV A;  1NZE A;  2XL8 A;  3ABL C;  2OU6 A;  2GFH A;  2W9Y A;  1YDI A;  3JYH A;  1ORS C;  3FOO A;  4RDA A;  4EUK B;  2IYL D;  5HV9 A;  4P9F A;  3ZTZ A;  4O79 A;  1A41 A;  3B0P A;  2BC5 A;  5COG A;  4LLE A;  3EPV A;  1QQ3 A;  5JVE A;  2XRH A;  1J8Y F;  4C3D A;  2I15 A;  3GOD A;  5L0D A;  2HSB A;  4N6H A;  1RKE A;  4CBE A;  3TOL A;  4DVY P;  4OIP F;  1FNT c;  3NMK A;  4BPM A;  3SXY A;  4JIO A;  1QKR A;  3NG1 A;  2A6E F;  3ASN C;  1MMG A;  2YLG A;  3L8J A;  2VAS A;  1Z7Q c;  5T3T A;  1RJ9 B;  3B9Q A;  3VYW A;  3UMK A;  3RW0 A;  4N4W A;  3HLZ A;  4DVZ A;  5A6J A;  2LD6 A;  2A6H F;  2LIG A;  3R7C A;  1OQC A;  3U9M A;  4C7O B;  1FMW A;  2PX3 A;  2V3C C;  3U5S A;  4MVO A;  1OCC C;  3G4X A;  3SP1 A;  4EIY A;  2XLW A;  2FFH A;  3DM5 A;  1TR2 A;  4DJ9 A;  2CW0 F;  3RQE A;  1G5Z A;  4CSA A;  5D92 A;  2YRF A;  3I4U A;  3LLK A;  1WTY A;  1OW7 A;  2C04 A;  2IXN A;  1JRA A;  2XLD A;  3ATP A;  4PJL A;  1HE1 A;  4JJF A;  5COM A;  5EHH A;  4QI2 A;  2DYS C;  4MVM A;  3B0V C;  5BQH A;  1ZHZ A;  1JPJ A;  1HE9 A;  4KNW A;  4YWQ A;  4JTC B;  2NSF A;  2YWA A;  1U6H A;  4ZLC A;  2R7W A;  4OD4 A;  5B1A C;  4NTF A;  4ANJ A;  2AWC A;  2PF4 E;  4YK5 A;  3HTK C;  3NKE A;  4XEV A;  2RD9 A;  2WB7 A;  3TK0 A;  5KYY B;  1CGN A;  1LM3 B;  5B3S C;  2EIM C;  3U8V A;  3FMS A;  4IWB A;  3KYJ A;  1GM5 A;  1LE2 A;  3DE9 A;  4MVU A;  1G8X A;  3E9V A;  3N0T A;  1NFN A;  4XPX A;  3WHN A;  4YT2 A;  1YYX A;  4AK9 A;  3QVZ A;  5DVW A;  2P0N A;  2X51 A;  2HMZ A;  3RVY A;  3ZG1 A;  3A11 A;  1E2X A;  1AVO B;  4ULW A;  3SXM A;  2HUJ A;  1ZHT A;  2QY9 A;  3FAP B;  1V4A A;  2QUP A;  3KKB A;  1ZU4 A;  2A68 F;  3G4Z A;  2UUH A;  2R7R A;  3DMD A;  5JSL A;  4DOZ A;  3KPH A;  1SYQ A;  2LK4 A;  2V26 A;  4Q7C A;  2ZXP A;  4K7B A;  5E33 A;  2OG2 A;  2EPK X;  3EJN A;  2H7V C;  1NG1 A;  2L6G A;  1I4Z A;  1R5I D;  2XLO A;  3EFO B;  1XZP A;  3I5P A;  1Q0K A;  3ITF A;  5DLJ A;  3S84 A;  2NPU A;  1QSP A;  3GM2 A;  2HFI A;  4P6I C;  2XLH A;  3DWW A;  3K66 A;  4L6R A;  1EA8 A;  4EBK A;  4G7Z F;  3JRM O;  2H8A A;  2ETS A;  4LAC B;  4MND A;  5KYW B;  5KYX B;  1IZM A;  1MMD A;  3F47 A;  3IQ5 A;  3JSE O;  3N24 A;  3EHM A;  3WAQ A;  1A7D A;  1TQG A;  2HMQ A;  3AOU A;  1OR2 A;  4G78 A;  1RJ9 A;  2Y3D A;  1B68 A;  3MFN A;  3C62 A;  4R32 A;  3EGX B;  1EKY A;  3RVZ A;  2ZPA A;  4PJN A;  5EK0 A;  5HSW A;  4AL1 A;  2IM8 A;  2XLM A;  2XM0 A;  2Y3H A;  4C7O A;  1Q0M A;  2ZXW C;  3GEH A;  4EHP A;  1TFO B;  1NFO A;  4DRI B;  3MYF A;  4GYT A;  4JE9 A;  2IBF A;  3T6G B;  2Y39 A;  3LJB A;  3U3B A;  3FDQ A;  2IXO A;  1AEP A;  3HKK A;  3JYY A;  5K0I A;  4IB4 A;  2WVN A;  3LS0 A;  4BG0 A;  4CSA C;  3EH1 A;  4HE8 D;  2AVK A;  1V74 B;  2DI3 A;  3K1I A;  4BEJ A;  3ABM C;  3CAX A;  4G7H F;  256B A;  5E3A A;  2OQM A;  4PAC A;  2LSE A;  3US6 A;  1D1C A;  4ONS A;  1QZX A;  2FAP B;  4WGY A;  3EQL F;  2WZL A;  3E70 C;  1FTS A;  2QTV A;  3GWL A;  3KH2 A;  2GDC A;  3IQ6 A;  1BZ4 A;  3OEO A;  4MQ9 F;  3U2L A;  2EIK C;  2J9U A;  4U5E E;  2Z15 A;  5JUA A;  3VAY A;  1TWC A;  1CGM E;  4YT4 A;  2XS1 A;  1S7Z A;  3C8Z A;  2JPU A;  4DBR A;  1K05 A;  1JOG A;  2NG1 A;  2Y3B A;  4E18 A;  3LUT B;  4CJO A;  1OW6 A;  2X0C A;  3S9O A;  4IAR A;  5KYY A;  3QW1 A;  3LS1 A;  4YL0 A;  1H9T A;  3BRJ A;  2CDQ A;  3SZR A;  3O39 A;  2AU5 A;  3LNR A;  3W8I A;  4PFO A;  1VYI A;  4U5G A;  3RFY A;  3WG7 C;  2R7Q A;  2PNO A;  3OA1 A;  3TJ5 A;  1E83 A;  1A7E A;  2A1D D;  1M57 C;  4J30 B;  1LIH A;  1L7C A;  4LDQ A;  3RKO F;  3NDB B;  3SXK A;  4FX5 A;  1EQ1 A;  1ZHW A;  2XLV A;  2HV6 A;  3H2U A;  3FAJ A;  3U2M A;  3NMI A;  1LS1 A;  1WN0 A;  3MX3 A;  3N2Z B;  4MVZ A;  4U9D A;  2YL1 A;  2EPO A;  1C02 A;  2KGO A;  3AGT A;  3U3F A;  3EGD B;  3ZC4 A;  2YKZ A;  3EFO A;  4QI0 A;  3RF3 A;  5AGF A;  3SXZ A;  1K40 A;  5DS4 A;  4MVS A;  2J9B A;  2Q4F A;  3A9C A;  3CQZ A;  1E84 A;  4DXW A;  2YL7 A;  3IQT A;  1Q0D A;  1WWP A;  3L34 A;  4ZLD A;  5KYW A;  1VMA A;  2JX0 A;  2XLE A;  3TOM A;  1Y4C A;  3T6B A;  3GOR A;  5KYX A;  2OOC A;  3HJC A;  1SMY F;  3JCU Q;  3L8I A;  3S0X A;  2YVK A;  5KYU B;  1TFK B;  2WL8 A;  3F46 A;  2KSF A;  2MWQ A;  2DB4 A;  3EGX A;  4LDK A;  2CYD A;  4U5D E;  1F1M A;  2W4B A;  3CSK A;  3AQC A;  2MHR A;  1K04 A;  2EPN A;  3JZ0 A;  3QMK A;  2L7A A;  3VM6 A;  3U0C A;  1RMV A;  3QW0 A;  2LQG A;  4C3B A;  1LI5 A;  3O10 A;  4XPW A;  4Q4Z F;  3FOP A;  2VC9 A;  1O87 A;  2YL3 A;  3DJU B;  4JVS A;  4W8K A;  4X0R A;  1CPQ A;  2LCH A;  3HNK A;  5JS5 A;  3NYL A;  1I5N A;  1FFT C;  2H7O A;  2L6F A;  4FWV A;  5F5H A;  5IY5 C;  1CPR A;  1O5H A;  5A6A A;  5F28 E;  1O3U A;  2FGY A;  4LDR A;  5L0G A;  5L0F A;  1OCR C;  4W8P A;  3UMI A;  4E7S A;  3K1I C;  4IGG A;  4U9E A;  3EG9 B;  2HS5 A;  3T4R A;  4CDA A;  4NTA A;  3ZDL A;  1OXK A;  4YT5 A;  4O7G A;  1ZW3 A;  4I3M A;  3QTH A;  1LKX A;  5B3I A;  1HMO A;  2DGJ A;  3GM3 A;  3AG1 C;  1LI7 A;  4YT8 A;  1VYK A;  3NMJ A;  2B0H A;  2Y3G A;  1HMD A;  4H4K C;  1JAF A;  2UUI A;  1TKN A;  2YZS A;  5DQZ A;  1GGQ A;  1LVK A;  4AE4 A;  2EIL C;  4IAO A;  3HNI A;  2WVQ A;  3OWT A;  5JRA A;  3G50 A;  4KBL A;  1J8M F;  4BJ5 C;  1RCP A;  1LPE A;  4XQ1 A;  2VCC A;  2KYH A;  3GEI A;  4N06 A;  5A6K A;  3SEO A;  1OCO C;  1QVX A;  4NCQ A;  3U9J A;  1JR8 A;  3B0U X;  2IOQ A;  2PFD A;  5A6B D;  3NYM A;  1AUE A;  3FHD A;  2GAQ A;  4MVR A;  5L3V A;  2L81 A;  1SF8 A;  3EZI A;  4CJG A;  5D91 A;  1A0B A;  2R03 A;  3NRH A;  4K0D A;  2RSE B;  2YLD A;  3DAF A;  1JMW A;  1M2O A;  5BQG A;  3DAG A;  3TJ6 A;  2QNL A;  4AX2 A;  4EBB A;  3EGD A;  3MYI A;  2NSG A;  3W8H A;  3LAY A;  2CGE A;  1T6Q A;  3AG2 C;  1YAR O;  5JP7 A;  4CS7 A;  2A0B A;  5A69 A;  5JLI A;  3DJN B;  1YLM A;  1OKK D;  4ULV A;  2Q7R A;  2BE5 F;  3ZVR A;  4OIR F;  4I1M A;  5KYU A;  3W2V A;  2QLA A;  4CDY A;  1ZZP A;  5FCL A;  5L0C A;  3HNJ A;  3Q6N A;  1QLE C;  4Q5S F;  3C7J A;  4U5B E;  4PJJ A;  1BBH A;  2CNW D;  3JT1 A;  3M4B A;  2ASR A;  4D4N A;  4CIP A;  2Q9A A;  1VOM A;  1PCX A;  1T6U A;  2ZXR A;  3B71 A;  1WAT A;  1W2W A;  4I1O B;  1IW7 F;  4BEM J;  4XPY A;  2Q3T A;  3RIP A;  2GA0 A;  2I8B A;  3GWN A;  1V55 C;  3H65 A;  3RQG A;  4YJW A;  3AG4 C;  1T5O A;  4YL1 A;  3C18 A;  1ORY A;  2XL4 A;  3POV A;  2W4M A;  1N1C A;  2OJE D;  3ZWI A;  4DRH B;  3K7D A;  3EG9 A;  3ZTM A;  1Z3I X;  2AP3 A;  4JW1 A;  2EIN C;  4MS2 A;  3EHN A;  4XWJ A;  1HY5 A;  1MNE A;  3DE8 A;  2VH3 A;  3IHU A;  1FFH A;  2J7P D;  1BR1 A;  3KMI A;  2L6H A;  2R7V A;  1M56 C;  4CS8 A;  1SZI A;  5A6B A;  1ZHX A;  1E85 A;  1U89 A;  1V54 C;  1T01 A;  4PJM A;  4BJ5 A;  5L3Q A;  4OIQ F;  4WGZ A;  3Q7G A;  2M4E A;  4JCZ A;  3T9O A;  1MMA A;  1LE4 A;  3MLG A;  1XZQ A;  1NU9 C;  4Z9J A;  4JZA A;  2CCY A;  4LLC A;  4G0H A;  1YJG A;  4F4B A;  3S29 A;  2HV7 A;  4BJT A;  2J45 A;  4G7O F;  1VLT A;  2NUT B;  3AJM A;  2H7B A;  4E17 A;  1WAS A;  3ASO C;  4KC9 A;  3IEE A;  2TMV P;  1RXQ A;  3ZIB A;  4XLP F;  2BL2 A;  3UNG C;  2Q00 A;  2IXM A;  3K6B A;  4CS9 A;  4HFK B;  3I5Q A;  3Q7L A;  1OKK A;  3WOD F;  1BR4 A;  1Z6A A;  3KL4 A;  1ZVZ A;  3TUL A;  3H2V A;  5E3C A;  2R9R B;  2A69 F;  4J7Y A;  1LS4 A;  1G4W R;  2NUP B;  4I44 A;  4K1O A;  4JEB A;  3GM1 A;  3V5Y A;  3S90 A;  4OIO F;  4MTG A;  1XWJ A;  4NTB A;  4WJ0 A;  2CNW A;  3EH2 A;  3L0I A;  3O6X A;  1D0Z A;  3S27 A;  4RBN A;  5DS6 A;  1D0Y A;  4MTF A;  3RH3 A;  3X1O A;  2G3V A;  1T9K A;  2VCA A;  3LEV A;  4XEF A;  5TJ5 E;  2PP4 A;  1RKC A;  4PFP A;  2KQ9 A;  1CGO A;  1SR2 A;  1Q0F A;  2KJG A;  4O6N A;  1H7I A;  2QE9 A;  3W2W A;  1G4U S;  2P6V A;  3O55 A;  1M2V B;  3C8G B;  2VB6 A;  2WZG A;  4Z9I A;  3TD7 A;  4J7T A;  5BQI A;  4CDV A;  4EBJ A;  2MYS A;  1NSG B;  2YHS A;  4A2N B;  5T1D B;  4JC7 A;  5L0H A;  4DRJ B;  4J32 B;  4NQF A;  2PBE A;  2XL6 A;  3PDM P;  2YQY A;  2G3K A;  4IAQ A;  4DBQ A;  2HZ8 A;  1VLS A;  1YA9 A;  3AQB A;  3DZA A;  1YZC A;  4AL0 A;  2J7P A;  1TWG A;  3CZ6 A;  3TQO A;  3T6J A;  4B6I A;  5L0I A;  1KTM A;  2E87 A;  3C8G D;  1H6G A;  4E7Z A;  3UGO A;  1ST6 A;  4M63 A;  2HSQ A;  1Z63 A;  1BR2 A;  1MMN A;  3PMR A;  3J06 A;  1U0B B;  3ZSU A;  5F5F A;  1C17 M;  2ICW G;  1APC A;  2XS8 A;  2ZD9 A;  4C3E A;  2LP4 A;  2KK1 A;  2L9J A;  2XM4 A;  3PCV A;  4MW3 A;  4JEA A;  1DOV A;  3X2Q C;  2J9W A;  2WVO A;  5L0J A;  5T3W A;  3RYL A;  2D5R B;  1L3P A;  2WZF A;  3EZH A;  4OD5 A;  4EWC A;  3IPM O;  4XLN F;  4CS8 C;  3VF0 A;  3FVY A;  3PHF 2;  4IJJ A;  4E0I A;  4U5C E;  3QVY A;  2R02 A;  3LNM B;  4N6C A;  1WOL A;  1D1B A;  2OCC C;  3ZQV A;  1ORJ A;  4U5H A;  2R7U A;  1Z23 A;  1VK5 A;  5COF A;  2J9V A;  2EPM X;  1WGW A;  1OCZ C;  1YAU O;  2R25 A;  3CEX A;  4IRU A;  4JTD B;  2F22 A;  2NUT A;  1MQV A;  2Y69 C;  4JTA B;  1YA7 O;  2YL0 A;  4MVQ A;  1OXB A;  5E2Q A;  5GPG B;  3S28 A;  3DKA A;  3BEH A;  4BJ6 A;  2C03 A;  5DQT A;  1ZYR F;  1QPU A;  2J46 A;  3GEE A;  1KU2 A;  2GWW A;  2P7V A;  4O6M A;  4CS9 C;  3FXH A;  4ER9 A;  2XXA B;  4CIH A;  1ZU5 A;  3LES A;  1D0X A;  4FAP B;  1YZA A;  1C03 A;  1Q0G A;  2NUP A;  1PV3 A;  3U8P A;  3AG3 C;  1NBB A;  5AC5 A;  2ZXO A;  2LFD A;  3B29 A;  2P61 A;  4GQH A;  4Z9H A;  2D4U A;  2YEV A;  4U5F E;  1T6I A;  2XSE A;  2KC3 A;  2OEX A;  1GS9 A; 
#chains in the Genus database with same CATH homology
 3LEO A;  4BPM A;  5BQH A;  2UUH A;  4NTB A;  4YL0 A;  4NTA A;  3HKK A;  4JCZ A;  4NTF A;  4YK5 A;  5BQG A;  4WAB A;  3PCV A;  3DWW A;  2PNO A;  2UUI A;  4YL1 A;  5BQI A;  4J7T A;  4JRZ A;  5HV9 A;  2H8A A;  4JC7 A;  3B29 A;  5K0I A;  2Q7R A;  4AL1 A;  4AL0 A;  4J7Y A;  4YL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...