3HKKA

Structure of human leukotriene c4 synthase in complex with glutathione sulfonate
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
145
structure length
145
Chain Sequence
HKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGRLRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Pre-steady state kinetics of human Leukotriene C4 synthase
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 61
structure length 145
sequence length 145
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2009-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 3hkkA00
4YL3A 3HKKA 4YL1A 4AL0A 2H8AA 2PNOA 4YL0A 4J7TA 3B29A 4JC7A 4JCZA 4NTFA 3LEOA 4JRZA 5BQHA 5BQIA 4WABA 4NTAA 2UUHA 4NTBA 4BPMA 5K0IA 2UUIA 4YK5A 3DWWA 3PCVA 5BQGA 2Q7RA 4AL1A 5HV9A 4J7YA
chains in the Genus database with same CATH superfamily
4U5CE 1JMWA 3EQLF 4O6MA 5KYUA 3GORA 1G8XA 1QSPA 4O79A 1KU2A 2VB6A 5GPGB 2EPMX 3ASOC 3LS0A 3B71A 4DBQA 3PDMP 3NDBB 1M56C 4I1OB 4XTKA 1ZHZA 4OIPF 4XEVA 3U8PA 2IOQA 2P7VA 3OWTA 4Z9IA 4E7SA 3QTHA 4XPYA 1ZW3A 3L0IA 4CS9C 3M15A 2AU5A 2LP4A 4RD9A 3U3FA 2R7QA 3EGDB 3GEEA 1WATA 5L0GA 4XQ1A 4MW3A 2BL2A 1GGQA 3RFYA 4WGYA 1SF8A 1W2WA 4U9EA 4IAQA 4DOZA 4E0HA 4UDVA 4IJJA 2L7AA 1OW7A 2CGEA 4DVZA 2R7UA 4C7OA 4RDAA 5F28E 2CNWD 2VCAA 4CDVA 2LFDA 3RVYA 1MMNA 1NLXA 2A0BA 5KYYA 2PFDA 1QLEC 2VCBA 4DXWA 1Z63A 1WGWA 3IPMO 4PJNA 2NUPA 2LD6A 1XZQA 5CI9A 2XM0A 2XRHA 3EGXA 3RKOF 3UMHA 5L0FA 1HW2A 1VYIA 3UGPA 3B29A 3SP1A 3NMJA 4NCQA 1HE1A 1RKEA 3R2PA 3U9JA 2R03A 1JAFA 3PMRA 5JS5A 3NKEA 3PHF2 1WASA 2KK1A 2ZPAA 3UNGC 2EIJC 3TQOA 5L0DA 5JP7A 1E83A 2NSGA 3TOMA 1H7IA 4JCHA 2FFHA 2Y69C 3EZHA 4H4KC 4D4NA 2KSFA 3F47A 2MWQA 3KPHA 4C3DA 2VH3A 3IQTA 4MQ9F 3QZCA 1WN0A 3V5XA 4CDAA 3GODA 4Z9HA 3HJCA 4YL0A 2Q9BA 4N06A 4DVYP 4Q5SF 1OCCC 3FMSA 1VYKA 2VASA 1OKKD 3GM2A 1VB5A 1YVIA 3KMIA 1EA8A 3MYIA 4KNVA 3CAXA 3W4YA 2I8BA 4BJ6A 4JEAA 3HNIA 3LJBA 1A7EA 1G4US 1NFNA 2HMQA 3JSZA 3M4BA 4I3MA 2HZ8A 4K1OA 4K0DA 3AG1C 2NUPB 2WZGA 1LVKA 3EGXB 1B68A 2XLMA 3G4ZA 4NTAA 2HJ3A 4XEFA 3AG3C 3KL4A 1QVXA 2J46A 3ITFA 3KH2A 4A2NB 3JZ0A 4K7BA 5BQGA 1H6GA 1OR2A 2EILC 1A7DA 4J7YA 4JC7A 1O87A 2PX0A 2JPUA 3B0VC 1S7ZA 1PCXA 3U9MA 4IARA 2Q3TA 2OEXA 1YJGA 1RMVA 3HKKA 4N6HA 2CNWA 3N0TA 4O6YA 3JSEO 3T6BA 4XPWA 1LPEA 2OEVA 3K66A 4PR9A 5L0CA 1WOLA 4FESA 4OIOF 2LFFA 3T6JA 4DBRA 4JJFA 3GEIA 2HS5A 2W4BA 1O3UA 1V74B 3OA1A 4W8KA 3EH1A 3LEOA 2NSFA 3HTKC 1K40A 1UFBA 4JW1A 2OG2A 2ZXOA 3UMKA 2XXAA 4WABA 5A69A 2MHRA 1TWCA 4N6CA 1Q0DA 3EHNA 4C3EA 1IW7F 2J45A 2ZXPA 4BJ5C 1WWPA 2XLDA 5D92A 1E86A 5KYXA 1ZZPA 1YARO 2A69F 2WZLA 2O9XA 4CS8C 4IB4A 2MYSA 3L8IA 4U5DE 2CW0F 2HV6A 1R5ID 1JPNA 3DD7A 1U0BB 2EPOA 2WZFA 3O10A 3EGDA 3TJ6A 4DRJB 4XLPF 1T01A 1BBHA 4E0IA 1A7VA 4MVUA 3RVZA 3FDQA 1GQAA 2Q9AA 1OKKA 4PK4A 5L3VA 1OR3A 1QKRA 3HNLA 4MNDA 3C18A 2QUPA 5KYNA 5E3AA 1L7CA 1FNTc 1Z3IX 1NU7D 1EKYA 5A6AA 2VCCA 3LESA 3U8VA 1JOGA 5COMA 3PCVA 3QVYA 1HMDA 3ZG1A 3HNJA 2Q00A 1G5ZA 1BR4A 1LI5A 1ZU5A 2QNLA 3ASNC 2AVKA 2YHSA 3K1IC 1CGNA 1FTSA 2J7PD 1NSGB 2L81A 3IEEA 4LDQA 3ZQVA 4EKWA 3MX3A 4AL0A 3RIPA 2IYLD 4QI0A 1FMWA 1Z23A 1APCA 4HFFB 3S29A 5KYXB 3DE8A 1RJ9A 2XLEA 4CJGA 3C62A 1NBBA 2H7VC 3T4RA 3GWNA 5EK0A 1YLMA 4IAOA 3TK0A 5L0IA 1RXQA 1Z7Qc 3N24A 5A6KA 1UG7A 4O6NA 5CIVA 5HSWA 1K05A 4EHPA 5KYWA 1GS9A 3ABKC 1E85A 5B1AC 1EI7A 4YT5A 3EJNA 1C17M 3KKBA 3JYYA 2OKUA 3ZDLA 1SYQA 4E18A 1ZVZA 2XS8A 4YL3A 2EIKC 3W8IA 1ORJA 2HFIA 2HKVA 2M4EA 3B9QA 3I5QA 5JSLA 2WVQA 3JT1A 1YA7O 1QPUA 3ZVRA 4RBNA 1F1MA 2R7SA 2AWCA 1A0BA 3UMIA 3S0XA 3DAGA 2Y39A 1D0XA 2W4MA 3US6A 2J9VA 4WJ0A 4KNWA 4ONSA 3BEHA 3NYJA 5A6BD 1NZEA 1YAUO 2NG1A 2XL4A 1VLSA 2G3KA 3S84A 1SZIA 3SYNA 2YLDA 1AUEA 1RJ9B 3U5SA 4CJOA 3AOUA 2Y3BA 2UUIA 1CPQA 4JE9A 2YVKA 3LNRA 1Y6DA 4MVRA 3O39A 3V5ZA 3JRTA 2ZD9A 1M57C 4G7OF 1I5NA 4P9TA 5BUOA 3L34A 1NU9C 4F4BA 2C04A 4BJ5A 5KYWB 4KBLA 4A4AA 3EG9A 2A6EF 3FXHA 2NPUA 1S05A 3NMKA 1DOWA 1VLTA 4CS8A 4G7ZF 2YKZA 3ZIBA 2J7PA 4EWCA 2H7BA 1XWJA 4NC3A 4PFOA 1I4YA 1Q0MA 1YYJA 2EINC 3B0PA 4JZAA 4BG0A 2B0JA 1NG1A 5T3TA 4BEJA 1OQCA 3VRCA 1G4WR 1H9GA 2DB4A 1TQGA 2QY9A 1M2OA 1TFKB 2R25A 3F46A 4Z9JA 3VYWA 4EBKA 3EHMA 5B3SC 5BQHA 2YL7A 5COFA 4ER9A 1T6QA 1C02A 3S90A 2KNHA 2WVNA 2CDQA 3DAFA 3K6BA 2XLOA 2L6HA 3SEOA 2WB7A 3LS1A 2EPNA 4PJMA 3TJ5A 2HJMA 3Q7GA 3FOPA 4MTOA 1LS4A 5HV9A 3NYLA 1Q0GA 3JCUQ 3T6GB 2OQMA 1PD1A 3H65A 3V5YA 1Z5ZA 2XS1A 2ETSA 3DI5A 3DMDA 3VF0A 2XLVA 2J8WA 3RQEA 3NG1A 1M6TA 4BJTA 5DVWA 3S27A 2IXPA 1TWGA 256BA 1SMYF 2PNOA 5B3IA 4LACB 1JRAA 3K1IA 4J7TA 1BR1A 4MVZA 1V4AA 2YL3A 4N4WA 5DS6A 4FX5A 4Q4ZF 3O6XA 3MYFA 2EPKX 4JCZA 5A6JA 4GQHA 3EG9B 4R32A 3IQ6A 4IGGA 4BEMJ 2I15A 3E9VA 3LLKA 2A6HF 3M4CA 1MNDA 2HV7A 2HSBA 3N2ZB 4Q7CA 2YEVA 3H2VA 5COGA 1J8MF 1E2XA 3OEOA 2Q4FA 3SXKA 5A6BA 2DYSC 4CS9A 3AGTA 4JEBA 3WAQA 2X51A 3DXJF 5L0HA 2AWYA 4DRHB 2L6FA 3SXYA 4FAPB 1ZHWA 2Y3HA 1Q0KA 3GM3A 4MTFA 3GEHA 3RH3A 1LIHA 1L3PA 3ZWIA 4B6IA 1WTYA 3NMIA 2YZSA 1V55C 1VOMA 1T5OA 2IXOA 1JR8A 2R02A 1YZCA 4LERA 4IRUA 1R4TA 3EH2A 3LLIA 4CDYA 4EBBA 4NTFA 4OINF 3AG2C 1D1AA 2LSEA 2A1DD 2J0XA 3FAJA 1OW8A 4JRZA 2NUTA 3LUTB 1YA9A 4JURI 5L0JA 4YT2A 3MFNA 2G62A 1JPJA 2XLHA 4YN0B 1D1CA 2KJGA 4NTBA 4EIYA 5K0IA 4JTCB 2JD3A 1Z6AA 3IHUA 1I4ZA 5CI8A 4ULWA 2LCHA 2A68F 4U5GA 2Q7RA 3IQ5A 4AL1A 3TULA 3FOOA 3W2WA 3AQBA 1Y4CA 4M63A 5E3CA 4KC9A 1U6HA 3SZRA 3DE9A 2W45A 1KNYA 5D91A 1T6UA 1ZU4A 2AP3A 4OD5A 4CX9A 2DGJA 3KYJA 3QW1A 2XXAB 3C8GD 1ST6A 3G4XA 2HUJA 2J9UA 1OCOC 1FMVA 2HSQA 4HEAJ 4MVQA 1MMDA 1ZHXA 1YDIA 2XM4A 1DOVA 3DZAA 3ABLC 3JTLO 3R7CA 1LI7A 3V7OA 5JUAA 3A11A 2KQ9A 2R05A 4WGZA 5DQTA 1MMAA 4P9FA 3AJMA 4XPXA 3CEXA 2PX3A 3BRJA 2GFHA 1IZMA 5T3WA 1MMGA 3I5PA 4YK5A 4JTAB 3T9OA 3U3BA 2KGOA 3S9OA 4BJ1A 5IY5C 5E2QA 1HY5A 2H7OA 3L1MA 4YWQA 3GWLA 2CCYA 2NUTB 4QDLA 3NYMA 4U5BE 3RW0A 2E87A 5EHHA 3M1CB 2Y3DA 2XL6A 3DJNB 1E84A 2EPLX 4OIQF 5F5FA 1Q0FA 2OJQA 4YT4A 3U0CA 2H8AA 2JX0A 1YZAA 2R7RA 5AGFA 3KYIA 3ABMC 2GWWA 3HLZA 3AG4C 4MW8A 1TFOB 3L8JA 3U2MA 2J0WA 3M79A 4O7GA 4PJJA 4EBJA 4EUKB 4OD4A 1ZW2A 4CSAC 3TOLA 3ATPA 4MVOA 2P0NA 4H54A 4JVSA 5BQIA 3EFOA 3ECSA 4NY3A 3Q6MA 4I44A 3VAYA 5DQZA 4BPMA 2QTVA 3WODF 3JYHA 1N1CA 1VMAA 3MBGA 4JTDB 3RQGA 4LLCA 3GM1A 3K1HA 3DKAA 5DLJA 5E33A 3IQCA 1TWHA 4HE8D 5AC4A 4U9DA 4AK9A 1TKNA 1C03A 3K33A 3E70C 4PJLA 4XWJA 1LS1A 4JJGA 4OIRF 1HMOA 3LEVA 3ZTMA 3NKDA 4J32B 1H9TA 1V54C 4E17A 4MVSA 1ZYRF 4FWVA 3W2VA 3LAYA 4CBEA 3POVA 2HMZA 2XLWA 4QI2A 4MS2A 4CS7A 5JRAA 2RD9A 1D0YA 1FFTC 2C03A 1AEPA 1BDJB 2FAPB 4L6RA 4PFPA 5KYUB 3SNHA 3I4UA 2V3CC 2KW3C 3C8GA 2ZXWC 1LM3B 4HFKB 4W8PA 3O55A 1OCZC 1ORSC 2R7WA 3CSKA 1SR2A 2LK4A 1FAPB 3S28A 3WG7C 4ZLDA 2R7OA 1BZ4A 1LE4A 3J06A 1KTMA 1CPRA 5AC5A 2WVOA 2YWAA 2PF4E 3Q7LA 3LNMB 1ZHTA 2P1AA 3W8HA 1VTMP 1D1BA 5FZTA 3X1OA 2R9RB 1OXKA 2L9JA 1OW6A 2X0CA 3EFOB 4IWBA 2A0UA 2GA0A 3C8ZA 2TMVP 5L3QA 5DS4A 3K7DA 4MTGA 1RCPA 1ZHYA 4XLNF 3ZTZA 4C7OB 4ANJA 1T6IA 2ICWG 2YLGA 3VM6A 2OOCA 3FHDA 2IXMA 1TWAA 3DM5A 2GDCA 2W9YA 2OU6A 3MLGA 2YQYA 2Z15A 1HE9A 2FGYA 5KYYB 3B0UX 2VC9A 4LLEA 1BR2A 2QLAA 1XZPA 1K04A 1M2VA 3UGOA 4XEKA 3AGUA 3SXMA 2B0HA 2D5RB 2OCCC 2YLIA 4U5HA 4D4XA 2WL8A 1EQ1A 3AQCA 2M64A 2R7TA 2R7VA 4AE4A 1RKEB 4P6IC 2IBFA 3C8GB 2BE5F 2PBEA 5T1DB 4DJ9A 4KI2A 2QE9A 3RF3A 1QQ3A 3FAPB 2IM8A 4C3BA 3C63A 2L6GA 3EPVA 1NFOA 4GYTA 4CIPA 4CIHA 1CGOA 4U5FE 2J9WA 1D0ZA 2ASRA 3C7JA 4JIOA 3RYLA 3TD7A 2XL8A 1QZXA 1LE2A 3ZQYA 1PD0A 2YL1A 4DRIB 1J8YF 3EZIA 2BC5A 3RQFA 2DI3A 2Q9CA 3FVYA 3QW0A 4E7ZA 1CGME 1PV3A 2DYRC 2LQGA 4J30B 1ORYA 2V26A 3WHNA 1RKCA 5B1BC 2ZXRA 3X2QC 3ZC4A 3G50A 4CSAA 1VK5A 1TR2A 2Y3GA 5TJ5E 3JRMO 3DM9B 3NRHA 1YYXA 5JT4A 1LKXA 4JKVA 3QVZA 4LDRA 1M2VB 4LDKA 5JVEA 1AVOB 1OXBA 3U2LA 2YL0A 4PACA 4AX2A 1FR0A 3CZ6A 3DJUB 4G78A 2J9BA 2YRFA 4I1MA 4YL1A 4AE4B 1HW1A 4BJ6C 5DS5A 1MQVA 4G0HA 2OJED 3A9CA 4X0RA 2D4UA 4NQFA 1GM5A 4GEHA 3ZSUA 1FFHA 5FCLA 1U89A 4YJWA 3SXZA 1A41A 2IXNA 3HNKA 3CQZA 4ULVA 3H2UA 2R7XA 2KC3A 2G3VA 5F5HA 2UUHA 1O5HA 3Q6NA 2EIMC 1T9KA 3QMKA 4MVMA 4ZLCA 3UR3C 3GANA 1OCRC 2RSEB 3DWWA 2CYDA 2P61A 2F22A 2PP4A 4U5EE 5JLIA 4YT8A 2GAQA 1MNEA 2KYHA 2P6VA 2XSEA 2LIGA 4G7HF 5EGYA
chains in the Genus database with same CATH topology
4YL3A 3HKKA 4YL1A 4AL0A 2H8AA 2PNOA 4YL0A 4J7TA 3B29A 4JC7A 4JCZA 4NTFA 3LEOA 4JRZA 5BQHA 5BQIA 4WABA 4NTAA 2UUHA 4NTBA 4BPMA 5K0IA 2UUIA 4YK5A 3DWWA 3PCVA 5BQGA 2Q7RA 4AL1A 5HV9A 4J7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YL3 A;  3HKK A;  4YL1 A;  4AL0 A;  2H8A A;  2PNO A;  4YL0 A;  4J7T A;  3B29 A;  4JC7 A;  4JCZ A;  4NTF A;  3LEO A;  4JRZ A;  5BQH A;  5BQI A;  4WAB A;  4NTA A;  2UUH A;  4NTB A;  4BPM A;  5K0I A;  2UUI A;  4YK5 A;  3DWW A;  3PCV A;  5BQG A;  2Q7R A;  4AL1 A;  5HV9 A;  4J7Y A; 
#chains in the Genus database with same CATH topology
 4U5C E;  1JMW A;  3EQL F;  4O6M A;  5KYU A;  3GOR A;  1G8X A;  1QSP A;  4O79 A;  1KU2 A;  2VB6 A;  5GPG B;  2EPM X;  3ASO C;  3LS0 A;  3B71 A;  4DBQ A;  3PDM P;  3NDB B;  1M56 C;  4I1O B;  4XTK A;  1ZHZ A;  4OIP F;  4XEV A;  3U8P A;  2IOQ A;  2P7V A;  3OWT A;  4Z9I A;  4E7S A;  3QTH A;  4XPY A;  1ZW3 A;  3L0I A;  4CS9 C;  3M15 A;  2AU5 A;  2LP4 A;  4RD9 A;  3U3F A;  2R7Q A;  3EGD B;  3GEE A;  1WAT A;  5L0G A;  4XQ1 A;  4MW3 A;  2BL2 A;  1GGQ A;  3RFY A;  4WGY A;  1SF8 A;  1W2W A;  4U9E A;  4IAQ A;  4DOZ A;  4E0H A;  4UDV A;  4IJJ A;  2L7A A;  1OW7 A;  2CGE A;  4DVZ A;  2R7U A;  4C7O A;  4RDA A;  5F28 E;  2CNW D;  2VCA A;  4CDV A;  2LFD A;  3RVY A;  1MMN A;  1NLX A;  2A0B A;  5KYY A;  2PFD A;  1QLE C;  2VCB A;  4DXW A;  1Z63 A;  1WGW A;  3IPM O;  4PJN A;  2NUP A;  2LD6 A;  1XZQ A;  5CI9 A;  2XM0 A;  2XRH A;  3EGX A;  3RKO F;  3UMH A;  5L0F A;  1HW2 A;  1VYI A;  3UGP A;  3B29 A;  3SP1 A;  3NMJ A;  4NCQ A;  1HE1 A;  1RKE A;  3R2P A;  3U9J A;  2R03 A;  1JAF A;  3PMR A;  5JS5 A;  3NKE A;  3PHF 2;  1WAS A;  2KK1 A;  2ZPA A;  3UNG C;  2EIJ C;  3TQO A;  5L0D A;  5JP7 A;  1E83 A;  2NSG A;  3TOM A;  1H7I A;  4JCH A;  2FFH A;  2Y69 C;  3EZH A;  4H4K C;  4D4N A;  2KSF A;  3F47 A;  2MWQ A;  3KPH A;  4C3D A;  2VH3 A;  3IQT A;  4MQ9 F;  3QZC A;  1WN0 A;  3V5X A;  4CDA A;  3GOD A;  4Z9H A;  3HJC A;  4YL0 A;  2Q9B A;  4N06 A;  4DVY P;  4Q5S F;  1OCC C;  3FMS A;  1VYK A;  2VAS A;  1OKK D;  3GM2 A;  1VB5 A;  1YVI A;  3KMI A;  1EA8 A;  3MYI A;  4KNV A;  3CAX A;  3W4Y A;  2I8B A;  4BJ6 A;  4JEA A;  3HNI A;  3LJB A;  1A7E A;  1G4U S;  1NFN A;  2HMQ A;  3JSZ A;  3M4B A;  4I3M A;  2HZ8 A;  4K1O A;  4K0D A;  3AG1 C;  2NUP B;  2WZG A;  1LVK A;  3EGX B;  1B68 A;  2XLM A;  3G4Z A;  4NTA A;  2HJ3 A;  4XEF A;  3AG3 C;  3KL4 A;  1QVX A;  2J46 A;  3ITF A;  3KH2 A;  4A2N B;  3JZ0 A;  4K7B A;  5BQG A;  1H6G A;  1OR2 A;  2EIL C;  1A7D A;  4J7Y A;  4JC7 A;  1O87 A;  2PX0 A;  2JPU A;  3B0V C;  1S7Z A;  1PCX A;  3U9M A;  4IAR A;  2Q3T A;  2OEX A;  1YJG A;  1RMV A;  3HKK A;  4N6H A;  2CNW A;  3N0T A;  4O6Y A;  3JSE O;  3T6B A;  4XPW A;  1LPE A;  2OEV A;  3K66 A;  4PR9 A;  5L0C A;  1WOL A;  4FES A;  4OIO F;  2LFF A;  3T6J A;  4DBR A;  4JJF A;  3GEI A;  2HS5 A;  2W4B A;  1O3U A;  1V74 B;  3OA1 A;  4W8K A;  3EH1 A;  3LEO A;  2NSF A;  3HTK C;  1K40 A;  1UFB A;  4JW1 A;  2OG2 A;  2ZXO A;  3UMK A;  2XXA A;  4WAB A;  5A69 A;  2MHR A;  1TWC A;  4N6C A;  1Q0D A;  3EHN A;  4C3E A;  1IW7 F;  2J45 A;  2ZXP A;  4BJ5 C;  1WWP A;  2XLD A;  5D92 A;  1E86 A;  5KYX A;  1ZZP A;  1YAR O;  2A69 F;  2WZL A;  2O9X A;  4CS8 C;  4IB4 A;  2MYS A;  3L8I A;  4U5D E;  2CW0 F;  2HV6 A;  1R5I D;  1JPN A;  3DD7 A;  1U0B B;  2EPO A;  2WZF A;  3O10 A;  3EGD A;  3TJ6 A;  4DRJ B;  4XLP F;  1T01 A;  1BBH A;  4E0I A;  1A7V A;  4MVU A;  3RVZ A;  3FDQ A;  1GQA A;  2Q9A A;  1OKK A;  4PK4 A;  5L3V A;  1OR3 A;  1QKR A;  3HNL A;  4MND A;  3C18 A;  2QUP A;  5KYN A;  5E3A A;  1L7C A;  1FNT c;  1Z3I X;  1NU7 D;  1EKY A;  5A6A A;  2VCC A;  3LES A;  3U8V A;  1JOG A;  5COM A;  3PCV A;  3QVY A;  1HMD A;  3ZG1 A;  3HNJ A;  2Q00 A;  1G5Z A;  1BR4 A;  1LI5 A;  1ZU5 A;  2QNL A;  3ASN C;  2AVK A;  2YHS A;  3K1I C;  1CGN A;  1FTS A;  2J7P D;  1NSG B;  2L81 A;  3IEE A;  4LDQ A;  3ZQV A;  4EKW A;  3MX3 A;  4AL0 A;  3RIP A;  2IYL D;  4QI0 A;  1FMW A;  1Z23 A;  1APC A;  4HFF B;  3S29 A;  5KYX B;  3DE8 A;  1RJ9 A;  2XLE A;  4CJG A;  3C62 A;  1NBB A;  2H7V C;  3T4R A;  3GWN A;  5EK0 A;  1YLM A;  4IAO A;  3TK0 A;  5L0I A;  1RXQ A;  1Z7Q c;  3N24 A;  5A6K A;  1UG7 A;  4O6N A;  5CIV A;  5HSW A;  1K05 A;  4EHP A;  5KYW A;  1GS9 A;  3ABK C;  1E85 A;  5B1A C;  1EI7 A;  4YT5 A;  3EJN A;  1C17 M;  3KKB A;  3JYY A;  2OKU A;  3ZDL A;  1SYQ A;  4E18 A;  1ZVZ A;  2XS8 A;  4YL3 A;  2EIK C;  3W8I A;  1ORJ A;  2HFI A;  2HKV A;  2M4E A;  3B9Q A;  3I5Q A;  5JSL A;  2WVQ A;  3JT1 A;  1YA7 O;  1QPU A;  3ZVR A;  4RBN A;  1F1M A;  2R7S A;  2AWC A;  1A0B A;  3UMI A;  3S0X A;  3DAG A;  2Y39 A;  1D0X A;  2W4M A;  3US6 A;  2J9V A;  4WJ0 A;  4KNW A;  4ONS A;  3BEH A;  3NYJ A;  5A6B D;  1NZE A;  1YAU O;  2NG1 A;  2XL4 A;  1VLS A;  2G3K A;  3S84 A;  1SZI A;  3SYN A;  2YLD A;  1AUE A;  1RJ9 B;  3U5S A;  4CJO A;  3AOU A;  2Y3B A;  2UUI A;  1CPQ A;  4JE9 A;  2YVK A;  3LNR A;  1Y6D A;  4MVR A;  3O39 A;  3V5Z A;  3JRT A;  2ZD9 A;  1M57 C;  4G7O F;  1I5N A;  4P9T A;  5BUO A;  3L34 A;  1NU9 C;  4F4B A;  2C04 A;  4BJ5 A;  5KYW B;  4KBL A;  4A4A A;  3EG9 A;  2A6E F;  3FXH A;  2NPU A;  1S05 A;  3NMK A;  1DOW A;  1VLT A;  4CS8 A;  4G7Z F;  2YKZ A;  3ZIB A;  2J7P A;  4EWC A;  2H7B A;  1XWJ A;  4NC3 A;  4PFO A;  1I4Y A;  1Q0M A;  1YYJ A;  2EIN C;  3B0P A;  4JZA A;  4BG0 A;  2B0J A;  1NG1 A;  5T3T A;  4BEJ A;  1OQC A;  3VRC A;  1G4W R;  1H9G A;  2DB4 A;  1TQG A;  2QY9 A;  1M2O A;  1TFK B;  2R25 A;  3F46 A;  4Z9J A;  3VYW A;  4EBK A;  3EHM A;  5B3S C;  5BQH A;  2YL7 A;  5COF A;  4ER9 A;  1T6Q A;  1C02 A;  3S90 A;  2KNH A;  2WVN A;  2CDQ A;  3DAF A;  3K6B A;  2XLO A;  2L6H A;  3SEO A;  2WB7 A;  3LS1 A;  2EPN A;  4PJM A;  3TJ5 A;  2HJM A;  3Q7G A;  3FOP A;  4MTO A;  1LS4 A;  5HV9 A;  3NYL A;  1Q0G A;  3JCU Q;  3T6G B;  2OQM A;  1PD1 A;  3H65 A;  3V5Y A;  1Z5Z A;  2XS1 A;  2ETS A;  3DI5 A;  3DMD A;  3VF0 A;  2XLV A;  2J8W A;  3RQE A;  3NG1 A;  1M6T A;  4BJT A;  5DVW A;  3S27 A;  2IXP A;  1TWG A;  256B A;  1SMY F;  2PNO A;  5B3I A;  4LAC B;  1JRA A;  3K1I A;  4J7T A;  1BR1 A;  4MVZ A;  1V4A A;  2YL3 A;  4N4W A;  5DS6 A;  4FX5 A;  4Q4Z F;  3O6X A;  3MYF A;  2EPK X;  4JCZ A;  5A6J A;  4GQH A;  3EG9 B;  4R32 A;  3IQ6 A;  4IGG A;  4BEM J;  2I15 A;  3E9V A;  3LLK A;  2A6H F;  3M4C A;  1MND A;  2HV7 A;  2HSB A;  3N2Z B;  4Q7C A;  2YEV A;  3H2V A;  5COG A;  1J8M F;  1E2X A;  3OEO A;  2Q4F A;  3SXK A;  5A6B A;  2DYS C;  4CS9 A;  3AGT A;  4JEB A;  3WAQ A;  2X51 A;  3DXJ F;  5L0H A;  2AWY A;  4DRH B;  2L6F A;  3SXY A;  4FAP B;  1ZHW A;  2Y3H A;  1Q0K A;  3GM3 A;  4MTF A;  3GEH A;  3RH3 A;  1LIH A;  1L3P A;  3ZWI A;  4B6I A;  1WTY A;  3NMI A;  2YZS A;  1V55 C;  1VOM A;  1T5O A;  2IXO A;  1JR8 A;  2R02 A;  1YZC A;  4LER A;  4IRU A;  1R4T A;  3EH2 A;  3LLI A;  4CDY A;  4EBB A;  4NTF A;  4OIN F;  3AG2 C;  1D1A A;  2LSE A;  2A1D D;  2J0X A;  3FAJ A;  1OW8 A;  4JRZ A;  2NUT A;  3LUT B;  1YA9 A;  4JUR I;  5L0J A;  4YT2 A;  3MFN A;  2G62 A;  1JPJ A;  2XLH A;  4YN0 B;  1D1C A;  2KJG A;  4NTB A;  4EIY A;  5K0I A;  4JTC B;  2JD3 A;  1Z6A A;  3IHU A;  1I4Z A;  5CI8 A;  4ULW A;  2LCH A;  2A68 F;  4U5G A;  2Q7R A;  3IQ5 A;  4AL1 A;  3TUL A;  3FOO A;  3W2W A;  3AQB A;  1Y4C A;  4M63 A;  5E3C A;  4KC9 A;  1U6H A;  3SZR A;  3DE9 A;  2W45 A;  1KNY A;  5D91 A;  1T6U A;  1ZU4 A;  2AP3 A;  4OD5 A;  4CX9 A;  2DGJ A;  3KYJ A;  3QW1 A;  2XXA B;  3C8G D;  1ST6 A;  3G4X A;  2HUJ A;  2J9U A;  1OCO C;  1FMV A;  2HSQ A;  4HEA J;  4MVQ A;  1MMD A;  1ZHX A;  1YDI A;  2XM4 A;  1DOV A;  3DZA A;  3ABL C;  3JTL O;  3R7C A;  1LI7 A;  3V7O A;  5JUA A;  3A11 A;  2KQ9 A;  2R05 A;  4WGZ A;  5DQT A;  1MMA A;  4P9F A;  3AJM A;  4XPX A;  3CEX A;  2PX3 A;  3BRJ A;  2GFH A;  1IZM A;  5T3W A;  1MMG A;  3I5P A;  4YK5 A;  4JTA B;  3T9O A;  3U3B A;  2KGO A;  3S9O A;  4BJ1 A;  5IY5 C;  5E2Q A;  1HY5 A;  2H7O A;  3L1M A;  4YWQ A;  3GWL A;  2CCY A;  2NUT B;  4QDL A;  3NYM A;  4U5B E;  3RW0 A;  2E87 A;  5EHH A;  3M1C B;  2Y3D A;  2XL6 A;  3DJN B;  1E84 A;  2EPL X;  4OIQ F;  5F5F A;  1Q0F A;  2OJQ A;  4YT4 A;  3U0C A;  2H8A A;  2JX0 A;  1YZA A;  2R7R A;  5AGF A;  3KYI A;  3ABM C;  2GWW A;  3HLZ A;  3AG4 C;  4MW8 A;  1TFO B;  3L8J A;  3U2M A;  2J0W A;  3M79 A;  4O7G A;  4PJJ A;  4EBJ A;  4EUK B;  4OD4 A;  1ZW2 A;  4CSA C;  3TOL A;  3ATP A;  4MVO A;  2P0N A;  4H54 A;  4JVS A;  5BQI A;  3EFO A;  3ECS A;  4NY3 A;  3Q6M A;  4I44 A;  3VAY A;  5DQZ A;  4BPM A;  2QTV A;  3WOD F;  3JYH A;  1N1C A;  1VMA A;  3MBG A;  4JTD B;  3RQG A;  4LLC A;  3GM1 A;  3K1H A;  3DKA A;  5DLJ A;  5E33 A;  3IQC A;  1TWH A;  4HE8 D;  5AC4 A;  4U9D A;  4AK9 A;  1TKN A;  1C03 A;  3K33 A;  3E70 C;  4PJL A;  4XWJ A;  1LS1 A;  4JJG A;  4OIR F;  1HMO A;  3LEV A;  3ZTM A;  3NKD A;  4J32 B;  1H9T A;  1V54 C;  4E17 A;  4MVS A;  1ZYR F;  4FWV A;  3W2V A;  3LAY A;  4CBE A;  3POV A;  2HMZ A;  2XLW A;  4QI2 A;  4MS2 A;  4CS7 A;  5JRA A;  2RD9 A;  1D0Y A;  1FFT C;  2C03 A;  1AEP A;  1BDJ B;  2FAP B;  4L6R A;  4PFP A;  5KYU B;  3SNH A;  3I4U A;  2V3C C;  2KW3 C;  3C8G A;  2ZXW C;  1LM3 B;  4HFK B;  4W8P A;  3O55 A;  1OCZ C;  1ORS C;  2R7W A;  3CSK A;  1SR2 A;  2LK4 A;  1FAP B;  3S28 A;  3WG7 C;  4ZLD A;  2R7O A;  1BZ4 A;  1LE4 A;  3J06 A;  1KTM A;  1CPR A;  5AC5 A;  2WVO A;  2YWA A;  2PF4 E;  3Q7L A;  3LNM B;  1ZHT A;  2P1A A;  3W8H A;  1VTM P;  1D1B A;  5FZT A;  3X1O A;  2R9R B;  1OXK A;  2L9J A;  1OW6 A;  2X0C A;  3EFO B;  4IWB A;  2A0U A;  2GA0 A;  3C8Z A;  2TMV P;  5L3Q A;  5DS4 A;  3K7D A;  4MTG A;  1RCP A;  1ZHY A;  4XLN F;  3ZTZ A;  4C7O B;  4ANJ A;  1T6I A;  2ICW G;  2YLG A;  3VM6 A;  2OOC A;  3FHD A;  2IXM A;  1TWA A;  3DM5 A;  2GDC A;  2W9Y A;  2OU6 A;  3MLG A;  2YQY A;  2Z15 A;  1HE9 A;  2FGY A;  5KYY B;  3B0U X;  2VC9 A;  4LLE A;  1BR2 A;  2QLA A;  1XZP A;  1K04 A;  1M2V A;  3UGO A;  4XEK A;  3AGU A;  3SXM A;  2B0H A;  2D5R B;  2OCC C;  2YLI A;  4U5H A;  4D4X A;  2WL8 A;  1EQ1 A;  3AQC A;  2M64 A;  2R7T A;  2R7V A;  4AE4 A;  1RKE B;  4P6I C;  2IBF A;  3C8G B;  2BE5 F;  2PBE A;  5T1D B;  4DJ9 A;  4KI2 A;  2QE9 A;  3RF3 A;  1QQ3 A;  3FAP B;  2IM8 A;  4C3B A;  3C63 A;  2L6G A;  3EPV A;  1NFO A;  4GYT A;  4CIP A;  4CIH A;  1CGO A;  4U5F E;  2J9W A;  1D0Z A;  2ASR A;  3C7J A;  4JIO A;  3RYL A;  3TD7 A;  2XL8 A;  1QZX A;  1LE2 A;  3ZQY A;  1PD0 A;  2YL1 A;  4DRI B;  1J8Y F;  3EZI A;  2BC5 A;  3RQF A;  2DI3 A;  2Q9C A;  3FVY A;  3QW0 A;  4E7Z A;  1CGM E;  1PV3 A;  2DYR C;  2LQG A;  4J30 B;  1ORY A;  2V26 A;  3WHN A;  1RKC A;  5B1B C;  2ZXR A;  3X2Q C;  3ZC4 A;  3G50 A;  4CSA A;  1VK5 A;  1TR2 A;  2Y3G A;  5TJ5 E;  3JRM O;  3DM9 B;  3NRH A;  1YYX A;  5JT4 A;  1LKX A;  4JKV A;  3QVZ A;  4LDR A;  1M2V B;  4LDK A;  5JVE A;  1AVO B;  1OXB A;  3U2L A;  2YL0 A;  4PAC A;  4AX2 A;  1FR0 A;  3CZ6 A;  3DJU B;  4G78 A;  2J9B A;  2YRF A;  4I1M A;  4YL1 A;  4AE4 B;  1HW1 A;  4BJ6 C;  5DS5 A;  1MQV A;  4G0H A;  2OJE D;  3A9C A;  4X0R A;  2D4U A;  4NQF A;  1GM5 A;  4GEH A;  3ZSU A;  1FFH A;  5FCL A;  1U89 A;  4YJW A;  3SXZ A;  1A41 A;  2IXN A;  3HNK A;  3CQZ A;  4ULV A;  3H2U A;  2R7X A;  2KC3 A;  2G3V A;  5F5H A;  2UUH A;  1O5H A;  3Q6N A;  2EIM C;  1T9K A;  3QMK A;  4MVM A;  4ZLC A;  3UR3 C;  3GAN A;  1OCR C;  2RSE B;  3DWW A;  2CYD A;  2P61 A;  2F22 A;  2PP4 A;  4U5E E;  5JLI A;  4YT8 A;  2GAQ A;  1MNE A;  2KYH A;  2P6V A;  2XSE A;  2LIG A;  4G7H F;  5EGY A; 
#chains in the Genus database with same CATH homology
 4YL3 A;  3HKK A;  4YL1 A;  4AL0 A;  2H8A A;  2PNO A;  4YL0 A;  4J7T A;  3B29 A;  4JC7 A;  4JCZ A;  4NTF A;  3LEO A;  4JRZ A;  5BQH A;  5BQI A;  4WAB A;  4NTA A;  2UUH A;  4NTB A;  4BPM A;  5K0I A;  2UUI A;  4YK5 A;  3DWW A;  3PCV A;  5BQG A;  2Q7R A;  4AL1 A;  5HV9 A;  4J7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...