5L3VA

Structure of the crenarchaeal srp54 gtpase bound to gdp
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
291
structure length
291
Chain Sequence
ENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Conserved Regulation and Adaptation of the Signal Recognition Particle Targeting Complex.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Protein transport
molecule keywords Signal recognition particle 54 kDa protein
total genus 105
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5l3vA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5l3vA02
3I8SA 1M34E 3W9YA 2C98A 3KJHA 3THWA 1OXTA 2QPTA 1U8YA 221PA 1N6PA 2ZJ2A 1QHYA 3BB4A 5CM8B 3R9XA 5E4FA 4XVUA 4HZUB 5EJEA 2G0NA 3LH5A 3PUVA 4NTZA 2W58A 2DFLA 1ZD9A 3ND8A 4G5GA 2HUPA 3R7WA 2A7QA 4E07A 3ADBA 1KNQA 4OI0A 1CKEA 2ZIAA 1XEXA 2DHRA 4ZCLA 5IK2A 2D7CA 2O0JA 1CF4A 2PBRA 3N70A 2QAGA 1S9DA 3C14C 5FBVB 3LD9A 1Z0IA 3VU9B 2YYZA 2ZRGA 4DBLC 4DLVA 3EA0A 3SBEA 3WMGA 4LV8B 3W34A 1ZVQA 2NTYC 1W2HA 4EPYA 1XCMA 2J9RA 1NMZA 2A5DA 1KKLA 3GLGE 1YU9A 3FFBA 5K8TA 5H1YA 4MKGA 3WRYC 1A1VA 2VP6A 2ZRAA 4IEEA 4B34A 1AK2A 1VG1A 5EE0A 2IXFA 5DIFA 1OF1A 5KNCA 2X2FA 1VDZA 1KI8A 2W2VA 4DLYA 5KO2A 4QM7A 4DLZA 4ZI3A 2NGRA 2XEXA 4XSGA 3T34A 421PA 2C9CA 4JLDA 5CLLA 2RGGA 4DLUA 4O25A 3SJZA 1CU1A 1YZGA 4AKIA 4C0HA 1ZYUA 2VP0A 4EDHA 1DBSA 3C41J 1KO5A 4TMTA 1U90A 4YXWA 2QM7A 5L3QB 3T12A 3CPJB 4Q1AA 2UVQA 1P7CA 2FGKA 4GSYA 2IS4A 1E4YA 1EX6A 2GCOB 4DCUA 1E1QD 4YQFA 1Z3IX 3PJRA 2ZYVX 1QDEA 4CF7A 3KTAA 2ZSDA 1BYUA 3C15C 1KYIA 2A2ZA 2IBMA 3FKSA 3KUCA 4MGKR 3TSZA 3VKGA 1A7JA 2Z5FA 2LKDA 2WVJA 1Z83A 4LC0A 3K9GA 1GSIA 1ZM2A 3GEIA 2YKGA 2G3YA 3QPVA 1JJVA 2BKEA 1O87A 1KKMA 3SFVA 2VH5R 5AJWA 4EAQA 1U8AA 4CIDA 1U0LA 5FL3A 1GVNB 1NLZA 2FSFA 4L9SA 5L3VA 2RGDA 3EASA 5F9FA 3G82C 3GFTA 3TW8B 1RE0A 3WYFA 2AK2A 1U81A 2C78A 1U98A 1FX0B 2REXB 5BQ5A 4B3CA 4P33A 1BH2A 4B47A 1IJEA 2HYIC 4TMWA 1D2MA 1UEIA 4PC3A 4TMXA 3BORA 2GJ8A 2VEDA 2ZYTX 2F1HA 1P2UA 3ZVRA 3UANA 4PQYA 3ADCA 2QMOA 3ECCA 4QHTA 3UK6A 4RY2A 4AI6A 1IOZA 2ZSAA 5HCIA 3BFKA 1OE0A 2ORVA 2ZRFA 4NCNA 1G7CA 4B35A 3WBJA 1XZPA 2XB2A 4DDUA 2QBYA 1NBMA 2O8CA 3P20A 3IDQA 2Q3HA 1RIFA 1NSTA 4ZPXA 1UEJA 2PT7A 4PAQA 2JLWA 3FFAA 3L0OA 1NJGA 4DIEA 5B64A 2OO7A 1GKUB 4AY2A 5FR1A 4AWXA 4LRWA 3QOFA 4A2WA 1OXXK 3SYNA 2BVNA 4Q1DA 3W3ZB 2G6BA 5J5CA 4URZR 1Z6GA 2GVZC 3EC2A 1KI7A 3ZLJA 1Z0KA 1JNYA 2ORIA 3AF3A 4A92A 3BS4A 2R44A 3BH7A 3AVTA 3AVPA 4UNPA 2QROA 2N1BA 2UZIR 2V4ZA 3A37A 4LZZA 4ZKDA 1ZIPA 2ZRNA 1E98A 3DL0A 1H8HD 1Z22A 2IYSA 5FOVA 2Q3FA 1OJLA 5GJVC 1E9AA 5CIQA 1PVOA 4A0FA 2C03A 5BXQC 2ZJAA 2P67A 2D74A 3T61A 1F2UA 3MG9A 2AFHE 5BWMA 2ZRJA 3FKSD 2O8EA 2ZRPA 1IJFA 2WHXA 1IY2A 1OH7A 4MDFA 2PLFA 1P75A 5TDHA 2JLUA 3LNCA 5DI9A 3AF0A 1G64A 1AQUA 2X2EA 3TUZC 4OJKA 1XTSA 3CRVA 3C4JA 1Z0AA 4NZYA 1KDRA 2IYZA 4TTPA 4JL5A 3AP1A 3MJHA 4V0LA 3O8RA 4MGIR 3LBNA 3MCAA 4Q02A 1E9FA 3GJ6A 1Y63A 3I72A 1HH4A 2OEPA 1E9BA 1MABB 4TN1A 4MGYR 3SYKA 1B23P 1ELOA 3HDTA 3TAUA 3ASYA 2QSZA 3QXXA 4KSBA 4B2LA 2N42A 2D2FA 4PC1A 3Q7QA 1G5PA 2WWIA 4F91B 4XTRA 4DEYA 3VR4A 1E2EA 2PH1A 2PEYA 4Q5IA 4EJSA 2VP4A 4ZDJA 3ZD6A 4IEIA 3GLHE 4JBWA 1NG1A 1PLLA 3IPXA 5EP1A 1XMSA 521PA 1XPOA 2R6GA 2F9MA 5DYGA 2DFNA 4TLDA 3VTKA 4TYPA 5UKDA 3QG5A 3VR2A 5KDLA 4MA4A 4WZAE 3B9PA 4B6EA 2YNMA 3C7KA 3H1TA 4LJAA 1Q3TA 3O47A 1KAGA 3GJXC 5HKKD 1MKYA 1NI3A 1W4CA 4BEJA 1EWQA 3DO6A 4NHOA 1F5NA 3RS2A 3BERA 2XGJA 3J81k 3B1XA 2HV8A 3W90A 2PL3A 4LK2A 3QNUA 3CB4A 1RJ9A 4V0NA 4ESHA 1NVUQ 3OIYA 2ZI9A 5BYKA 1W4BA 2QMEA 4CEJA 3CZPA 4HUTA 3LAWA 4CZ2A 4KYIB 4OQLA 4OK3A 3EARA 2W6JA 2KSQA 4PZLA 2J41A 4QJ5A 3NBYC 5JFGA 2EW1A 4LBZA 4Q4HB 3BD9A 3VHLB 1MO6A 5F9HA 3ZVMA 1FP7A 1CRQA 1E2DA 4JLJA 5AUNB 3IBYA 2GRJA 4TSFA 2AX4A 1MO3A 2V9PA 3R20A 1BMFD 3U7GA 1VCNA 1T3LA 1QBKC 4OHZA 4BLPA 3KB1A 1ZAKA 5JSZB 4EQ6B 5KPDA 4M1WA 1NMXA 1QG2A 3NC1C 3MWJA 5EE5B 5JWOA 5KSPA 2O5VA 4HB3A 2V7QA 3K0AB 3KXLA 2WJJA 3C16C 5DI3B 5J4HA 2WJGA 1QRAA 4WBSA 4KVGA 2WIBA 2HT6A 1SXJD 4O3MA 3KFVA 4IKEA 5G41A 1ZCAA 4C9BA 4MGZR 1ETUA 5FPSA 2FMXA 1NP6A 4ARZB 4DDTA 4HAVA 5BN3A 4XWOA 2JGNA 2WOOA 1KOFA 3OEHD 4PR0A 4XD7D 1P4SA 2ZRLA 1Z0JA 3P1JA 3TIFA 3MD0A 1VG0B 1PV4A 5CITA 1KMHA 1S3GA 1W46A 4RZ2A 5HZKA 2IX3A 1Q44A 3GLHA 4TZ0A 2AFIE 1OKKA 1LTQA 3NEJA 1ANKA 2YVUA 2IWRA 3T1VA 1CEEA 1RRPA 4X8MA 2QORA 4EPVA 4M1OA 2K5UA 3EZFA 4A2QA 5JRZA 3TMKA 4FWIB 3C5CA 1CLUA 1DAFA 1KSFX 2VP9A 2J0SA 1FQKA 2PJRA 2B92A 4I1VA 4R7ZA 3BGWA 1Z08A 4B6FA 4EPTA 3WP1B 2R6AA 1IHUA 1DG1G 2CE7A 2HLDA 2PZEA 4RD1A 2Q9CA 3W3AA 3DEFA 4NU0A 4NYJQ 5E95A 1FUKA 2JLSA 1BOFA 4KVAA 3DPUA 3KKOA 1SVLA 1G7RA 1HQYE 4MYUA 3FVQA 1N25A 2WWHA 1KJZA 1SVIA 2H1LA 3W5IA 5KSYA 4DCNA 3V9PA 1JR6A 2VSOA 4NYMR 2BCJQ 2ZVPX 2ECKA 2AN9A 3CPHA 3C8UA 5LDDC 1II0A 4QJ4A 5SZJA 4BFSA 1IN5A 1OSNA 1AIPA 2QM8A 2HYDA 3TRFA 1E1RD 2P0EA 1YZKA 4IJMA 2BOVA 8OHMA 2HCBA 2WWXA 2AKYA 4TMKA 4P0TA 2GCPA 2ZM5A 4RD3A 1OIWA 2OILA 2IUTA 2W2XA 5FTMA 3MGCA 1S9HA 1XMIA 2RAPA 2QG6A 1P3JA 1RKBA 1QHHA 3BJIC 3CRQA 1N0UA 3T06B 5KU1A 4DLTA 1EFCA 2NIPA 1P2VA 3N5CA 2LCFA 4BFUA 3SN6A 2HLDD 1XFAA 4QBIA 4Q7LA 3MAAC 4TWZA 4PFSA 2VTKA 4D4KA 2WOJA 3WRXC 3UPUA 1P72A 2ZI5A 4ACBA 2YOGA 3PQCA 1DG3A 4US1R 4W5HA 3R9IA 3CW2A 1CJVC 1XB2A 3QKRA 2O8FB 3WHLA 4OQFA 3F3YA 3NH9A 3CPEA 2IEYA 3ICQB 4DSNA 4BE7B 3L8YA 3PEUA 2J3EA 3ZQJA 2YWEA 2XAUA 4NCHA 4A4DA 4FWTA 1KI6B 4M9ZA 3RSLA 2RH5A 1AS2A 1XRJA 3RSOA 1ZUHA 3TLXA 2ZRMA 1E2FA 3TUIC 1J2JA 3SJAA 2P6RA 2ZJZA 3ZYCA 1XEWY 2WPDA 3R8FA 5GJCA 1CRPA 2UZ3A 1LVGA 4TQAA 3DKPA 3CUEF 3B78A 2QE7D 1XJQA 3AEZA 2ODEA 2ZJ8A 3HR8A 4LY6A 1G8GA 4MITA 5EE3A 3MJRA 1CJUC 3DMNA 4OYHA 4EQ6A 4C2TA 2GJSA 3OZXA 4JS0A 4A36A 4GL2A 1KJWA 4FN5A 2F1IA 3AVVA 2AD5A 3FOZA 4A6PA 2ZVQX 4V0ME 4MYCA 3ZZ0A 3A36A 2CJWB 2CJWA 1VCIA 3QKTA 1MRNA 4E09A 1P5ZB 1Q57A 5LB4A 3IEUA 4M21A 2EVWX 4IDOA 4Q4JA 2BCGY 1UDXA 4LJ9A 5DISB 1TAGA 1P9WA 2H7VA 4QL3A 4LJ7A 1YKSA 1YR7A 5KSOA 1IQPA 1JECA 1GRNA 1II9A 2HF9A 3K0AA 3VFDA 3FB4A 4IVQA 2EQBA 5FL7A 4BLTA 3B1VA 4I81A 4CGZA 1I4DD 2DBYA 3ONWA 1KI4A 1DAHA 2ZI6A 3AVOA 2G77B 4CW7A 1D6JA 3SBDA 2J59A 1OH6A 3HYRA 1D2EA 4I1OA 1B0UA 3UATA 2ZS8A 2C99A 1EESA 4Z1MD 1E9DA 2EYQA 3QQ5A 2QPAA 2C9YA 1XNJA 2JJ1D 4DXAA 2NO1A 1L7VC 3I92A 2GK6A 1HY3A 2A9KA 5IF9A 1E2PA 1M1YE 1M8PA 4JLOA 3UKDA 5CIWA 1NJFA 1GITA 4D0NA 4XTCS 1Z6TA 4ZO4A 3TKLA 2V55B 1JXMA 5B30A 2IW3A 4ON9A 1E2HA 1SKYB 3LXRA 1DVRA 5L3QA 4WXRA 4M4SA 1SZPA 3RS0A 4CEJB 4L16A 4UKDA 4LHZA 1FUUA 4EJSB 3QBVA 2GESA 2YV5A 4L8GA 3QPUA 4V0OA 1XXHE 1E6CA 1GAJA 4US0R 1YR6A 4G5QA 1PUJA 1MABA 1TQ4A 4QC2A 4WVFA 2H5EA 3D8BA 2IL1A 2J7PA 2W6ID 4AC9A 4BLSA 1EFTA 1F48A 2P5SA 4KSCA 3CO5A 4N0DA 1XPUA 2EFEB 2F55A 4YDHB 4DDVA 5L3SB 4HDQB 5IK2D 3THYA 1JB1A 1OV4A 3CONA 3ZH9B 2IS2A 2AXNA 3B60A 2PX0A 2PZGA 4HZIA 4YONB 4EPWA 3W6NA 1I4TD 3PUWA 3QF4A 3U3JA 5C18A 4LHXA 2J0VA 1KJYA 3DZDA 1GNQA 2HT1A 3QF7A 2ZI7A 3ZQ6A 2RKOA 3TE6A 2ZETA 3M4YA 1A82A 4A1FA 3PXGA 2VHJA 1WQ1R 2BBTA 3IGFA 1ZM3A 2F43A 2G1JA 3VAAA 3A1VA 1JXOA 2JIZD 5LD2C 1XPRA 1GZSA 5TB5A 4RD4A 2IT1A 4URUR 4NCJA 5D3QA 5HR5A 2EYUA 1HA3A 2QQEA 3SJCA 4EFLA 1W36D 2ZRHA 2GZHA 3ZS9A 4IXNA 5EXSA 1DELA 3P26A 1GUAA 2P65A 3BK7A 4GP6A 4NYMQ 3MFYA 5B57C 1TX4B 4U00A 1OHHD 4OHXA 1DAIA 2HXSA 3RLFA 4LCBA 3P4YA 2VBCA 3A1WA 1W7AA 4GFDA 3H84A 1OIXA 2FFAA 3OFND 721PA 1T5LA 4AYXA 3ZJYA 4URYR 4HATA 4BLOA 2NO6A 2PJZA 4F7WA 5CB8A 4GRAA 5JSZA 1UPTA 2PCJA 4CRWB 2QBYB 4XSHA 4Q1FA 1JAIA 1ZM7A 4C30A 2GTPA 5G3ZA 2Q6TA 4ILEA 2FPLA 4YMUA 4Q1BA 2O8BA 4DCSA 5TY0A 2ERYA 3A4LA 5FOTA 3K0EA 4WAUA 4JLNA 4LWZA 4C0SA 5DI3A 3BH0A 2GNOA 2Z0MA 4Q1CA 3CRMA 1XTKA 3LO5A 1GKIA 4UNQA 3OEED 3UWOA 5JHGB 2F7SA 2QAGC 1QHGA 4ABYA 2EWVA 1MRSA 2RMKA 3QXCA 1MH1A 1E2QA 1Z06A 5IRCD 2X8AA 1S96A 2CNWA 1KK3A 1P2TA 3GJ7A 4BFYA 2QN6A 1N6HA 4BLQA 2P5TB 1G9XA 3SJBA 2O8BB 1RPZA 3SC3A 3BFVA 3Q5EA 2OBLA 3PUXA 2X19A 3AB3A 3RS5A 2IUSA 5HE9A 121PA 2FFBA 3I5XA 3EPLA 2EWWA 5KDOA 1QF9A 5C4GB 5H8WA 4NE2A 3IILA 1QVAA 4B2PA 4WZBE 5LPNA 3VNUA 3EZ9A 4RVCA 4IVPA 1AN0A 3KTAB 3KQNA 2FZLA 2BMEA 2CLSA 1FMLA 4Q7KA 2GCOA 2GJAA 3EPHA 4B2IA 1WA5A 3ICEA 1UKEA 5FUXA 2O8EB 5KPJA 1E9EA 1RJ9B 3LX5A 4G3XA 2OXCA 1A5TA 3QY0A 2F9LA 4B3DA 3NBZC 1KDOA 2VHQA 4Q1EA 3B1YA 4TT3A 1YRAA 3CX8A 4PAOA 2CL0X 2NG1A 1XJ0A 1IAQA 3U61B 1GNPA 2OAQ1 2OFXA 2WMOB 2ZRCA 4HSEA 1PZNA 3DOEA 4AKEA 1OFUX 3U6KA 2CEAA 5AJZA 3THYB 2W83A 3OESA 4NPHA 4Q48A 1TPZA 4WA7A 5E7IA 4JLMA 3A4NA 2BM0A 4LYAA 2OLJA 1HYQA 1JEEA 3ZVLA 3GPLA 1JPJA 2BM1A 3FYHA 1DS6A 5HKKA 4O2RA 2G1KA 1CR1A 1GL9B 1GFIA 3RANA 1R0YA 3AF4A 2J0UB 5FTJA 2WJIA 3WMFA 2C96A 4PPQA 3SHWA 3S1AB 4ZDIA 1J7KA 2J45A 2QT1A 5J47A 2ZS7A 4QOSA 4F4JA 1G8HA 3PVSA 3EPJA 5FUYA 2FFHA 3K70C 3B7GA 1H8ED 3T5DA 2J7KA 2BV3A 3RHFA 5TMPA 1XCPA 3E5HA 3EIHA 3LVRE 2RGBA 2XXAB 1R5BA 4UNNA 3X1YA 1HUQA 3GLFB 2ZROA 1XF9A 5AJVB 1KAOA 4BQSA 2DFTA 1Z29A 1JBKA 2ZJBA 4V0MA 2FDCA 1TF5A 1Z28A 4JSYA 3JVUA 1US8B 2FH5B 2HXYA 2ZE6A 3AVYA 2I4IA 2Z6VA 1CXZA 4GPTA 4KHZA 4QGAA 4A0HA 3OE7D 2XZOA 3C5HA 5LB2A 1GDDA 1U9IC 2IYUA 2W0SA 3AUXA 5AR1A 3K70D 4RSGA 1TUIA 3L0PA 2Q21A 5CK5A 5EE9A 1VCMA 4TZ6A 4OI1A 4HAUA 3U7HB 2GVDC 3ZVNA 1OXSC 1AGRA 3CX7A 3QG1A 4LJ5A 3ZIAD 4IDNA 1GG2A 1ZNZA 2MMGA 4W5WA 4TQ9A 3LDAA 4ITRC 1R5OA 5EXPA 2YINC 3V4FA 1Z2CA 3VR3A 3W8RA 2C2HA 2O8CB 2KBFA 3JZAA 2REOA 5KOYA 2GK7A 5FI1B 1LFDB 1NIPA 4DVGA 2FWRA 2QNRA 4DLWA 1T3SA 1JAHA 1E2KA 3WY9A 4C0KA 4Z8XA 1HT1E 3N2EA 1N3BA 4JSTA 1ZMXA 4C0QC 3AF1A 4PSAA 1LF0A 3QXSA 4TYYA 3B1WA 2NO9A 4OK6A 4KV9A 2JEOA 2QAJA 3L82B 5KHOC 5JS8A 4DEXA 4HLUA 4NL4H 3I1FA 1NN1A 1TQ6A 2VIIA 5H70A 1ZIOA 3DM9B 1UKZA 3PG5A 1KO7A 3I4LA 4MUBA 3U7EB 1WP9A 4AG6A 5GADl 1NVWQ 2NPIA 1GOTA 2ZSFA 4C7OB 2IXGA 4LHWA 4C0AC 4M9QA 1OFIA 4Q4JB 5JEDA 3IIKA 3WNDA 1VKJA 4TL8A 1KSGA 3L2OB 3MMPA 2P2LA 2ZS9A 3OAAA 3CM0A 4HLQB 2CHQA 2GBLC 3WNCA 4BRUA 4PQRA 4F93B 3IEVA 3RC3A 5FH9A 1JEDA 3IIMA 1S8FA 1MT0A 1OKKD 1HEIA 1VTKA 4MKIA 4AKHA 1R6BX 4PZZA 5JJIA 4M1MA 1CR2A 1M6NA 3THXB 1IXZA 3TVDA 1NMYA 3RNLA 1ZD1A 2V8OA 3QVUA 1OH5A 2VLIA 1YVDA 2ZUBA 4B44A 1R2QA 3WP0A 3GLFE 3TK1A 4D6PA 5JZVA 3GJ5A 3VKWA 1CTQA 4M1YA 4JVSB 4URXR 2RB4A 4JYBA 2KI5A 3EA5A 5KUTA 2N46A 1GL6A 2WWWA 3UIEA 1M7GA 1JQLB 1QHNA 2QP9X 3FDIA 3L0IB 2GILA 5CM9C 4WW0A 1W49A 1J90A 4JBYA 3IUYA 1G17A 3KQHA 3U5ZB 3NG1A 2L0XA 2R6FA 2BKUA 1UJ2A 5J4VA 4M1TA 1II8A 4LV5B 4YMSA 3NDBB 2G9NA 3TGPA 4CVNA 2QY9A 2CCJA 1D9XA 2XJ9A 2Z4SA 4M9SA 4PPGA 4WIAA 4LX0A 3U3OA 3MRSA 4XWKA 2XTNA 1DADA 1VYTA 4A0RA 2V1XA 2CNWD 4HUQA 4DDWA 4P4UA 2OCBA 1QHXA 2IK8A 2XNDA 4LI0A 4KLZA 1G7TA 4PQFA 5FUWA 4IDHA 3KQUA 1MO4A 5BW8A 4JJKA 1SXJC 1XP8A 4ZCIA 1VIYA 2XJ4A 3LRPA 4R2IA 1GM5A 2IUUA 4B32A 4TYQA 2F1RA 3VR6A 5A5GA 1W0KD 4LHYA 1C4OA 1FNMA 1SVMA 4Q03A 2NPFA 4IOMA 1KMHB 2ZJ5A 1F2TB 3GCGA 4HDCA 4I4LA 1DARA 3LVQE 3U3MA 3U3RA 4LDJA 4RJLA 4DJTA 3HU1A 1KK1A 4FW9A 2AD1A 3RC8A 4FXPA 1AJEA 2BJWA 3E1SA 1E2LA 1FZQA 2CE2X 1ZC3A 3OAAD 4JMPA 2R8RA 2AWNA 1J8MF 5CK4A 1OFHA 2VO1A 3Q8XB 5TVKA 2MMCA 5L8VA 1X8JA 1VHTA 1AA9A 4FCWA 3VR1A 1G3MA 2ASEA 2JCSA 4OKSA 4QJ3A 2CVFA 5DN6D 1U9IA 5SZIA 4MRPA 4GDFA 4NDZA 1DO0A 4HZUA 4Z51A 1EGAA 1PLKA 4D4LA 4CEHA 4PC7A 3HPRA 1A4RA 1E0KA 4BEBA 4KXFB 4L9WA 3AVWA 5DHFA 4LYJA 4XVRA 2QZ4A 2DB3A 1WB9A 2FPMA 5FOUA 2ZAMA 1ZBDA 3MLEA 4D25A 2HJGA 1CJMA 1VYVA 3W6PA 3HYTA 3OIWA 2WSSA 1T3HA 3B13B 2WSSD 5G40A 3RRYA 3WBKA 3H0KA 1T4GA 1TEXA 1NVXQ 2QGNA 3B6EA 1H8HA 1ESNA 1FTNA 1FMJA 2HCJB 3BBPA 2RGAA 3GLIB 4ESVA 1DOAA 2ZI3A 2ONKA 2RGNC 4EFNA 4FD2A 4HB4A 4RD0A 2YOFA 4DSOA 1SXJB 3TQFA 3PCRB 5EE1A 4EFMA 3CNOA 2FZ4A 4KU4A 3T15A 2BEKA 2QT0A 4HB0A 1AGPA 2D06A 1HE1C 2EFDB 1EWRA 4JJZA 4D80A 4RZXA 2IYTA 2VP2A 2QI9C 1CR4A 2FJUA 4Q9HA 4Z8YA 3K0CA 4W5JA 2GZAA 2OXRA 3MWLA 5KNBA 3BB3A 4AG5A 4POAA 3CWZA 3NKVA 5A4JA 3CIOA 1RZ3A 3W8NA 3SE0A 4AKGA 1ZD8A 4XJXA 3P27A 2F3TA 2GXSA 2DCUA 3AH8A 4RFVA 5JMTA 1N5IA 2D3WA 4UXIA 1G4AE 3UMRA 1TU3A 5BN4A 2AWOA 2R6CA 1F2TA 3BWDD 2C8VA 4G0NA 4Q4HA 4DIDA 2V3CC 4DRZA 1A2BA 3WYAA 1ZU4A 2VF7A 5JJLA 1L4UA 1T0HB 3GD7A 2JDIA 2FG5A 1WE2A 4TT3D 1R0XA 2GEUA 3EG5A 1JI0A 2DWPA 2JLRA 2GXQA 4H9GA 3M0EA 1W0JA 1YE8A 5TARA 1BMFA 4AYTA 4TTRA 4KCGA 3O8CA 1YHNA 5FL7D 4BZQA 1S4QA 3EW9A 3QENA 1RC8A 3TJZA 2B6HA 1S2MA 4K46A 1UDWA 1P61B 4XIGS 4FCTA 4Q18A 4XVQA 2ODBA 2QTHA 1M7HA 1N2CE 1TEVA 2VSXA 3FMFA 2FFQA 4ZIRA 3PENA 4DLRA 1Q1BA 2GBLA 3CWQA 2XXAA 2JLXA 4GP7A 4XH9B 1XDBA 4NBSA 4KI0A 3OEEA 1Q0UA 4QNMA 4F4CA 3K9LA 1C9KA 1E1QA 1T8TA 3NHBA 3M6AA 2BMFA 5CLQA 1OPXA 3ASZA 2NZ8A 5JWRA 3WNBA 1OB5A 2QAGB 2W6JD 2IA5A 1U99A 3NC0C 1Z0DA 4KYUA 4DB2A 4EIWA 2JASA 4JLBA 2ZRIA 3FPAA 2CBZA 4GT1A 1FQJA 2NQ2C 2AL7A 4PX9A 4EPXA 4R71A 3H86A 4WXPA 4YDSA 5DGXA 2A5GA 3ZDQA 2C9OA 2RHMA 2OLKA 4DLXA 3GJ8A 2FEOA 2QE7A 4AD8A 1HV8A 1UKYA 2QPOA 5IHPA 1N0WA 2VL7A 3THWB 1G3RA 1N0VC 2FPKA 4ARZA 3IBGA 2IWHA 4QHYA 4HI0E 2GWHA 1RRCA 2RHDA 2WJHA 1MO5A 5P21A 3KX2A 1NLFA 3IQWA 1NVVR 3CNLA 3DZ8A 3PEVA 3LX8A 5FBRB 1TL7C 3D7MA 2SHKA 2XOKA 4D81A 3I5YA 1SHZA 4HEJA 3IO3A 4LGMA 1UAAA 3BOSA 1X1RA 3IPYA 3SHFA 3QKUA 2PMKA 1LS6A 1K5GA 4II7A 4TLCA 5G53C 4MYTA 3KXIA 1CR0A 3AKEA 3LQRA 4KO8A 3D3QA 3F8TA 1CS4C 3T1OA 3K0FB 2XNSA 1FFHA 3TH5A 5JS7A 4F38A 1R5NA 2JLYA 3MSXA 5K8IA 4ZDWA 4JT2A 5ELXA 3T1TA 2H92A 3L43A 1CBUA 3SU8A 4RZ3A 1T6NA 4F92B 3KJIA 3AUYA 5FPYA 1IN8A 1TNDA 2XX3A 2OCAA 4TQUS 2ZQ5A 3BB1A 3OHMA 4G5SA 1XTRA 3EXAA 2OFWA 3LLUA 1TU4A 3K09C 3EZ2A 1QHIA 5FBQB 4UNSA 1GRRA 3R9WA 2W6IA 1UBFA 4G1UC 5AUPB 4G5OA 2WBLC 4IHQA 4RCYA 4ERNA 2J0UA 3LFUA 4A6XA 1IONA 3VX4A 2XOKD 4QGHA 4TLEA 2CXXA 2KE5A 1KGDA 3FWYA 1E99A 4URWR 3PUZA 1JR3E 4UNRA 3B2EA 4GZLA 1E9SA 3EC1A 4CYMA 4LJ8A 4W7SA 5HCNA 4KITB 2C5LA 3R8CA 2ZREA 1H8EA 3FE2A 4RCZA 1SVOA 5AJYA 4FMCF 2YWGA 2CLCX 2WTUA 2PT5A 3QVVA 4K81B 4LJYA 3K8YA 5E7MA 3B9QA 2OFOA 1NBMD 3I3SR 3RS7A 3QBTA 1ZJ6A 3WHKA 2YC4C 4OQNA 2H16A 2H8KA 1KI2A 3FMPB 1XXHB 1KO1A 1DAKA 1G3UA 1U2RA 1YR9A 2OCPA 1AZTA 3K0CC 3N2IA 4A8JA 3HU2A 1SQ5A 2ODNA 3AKYA 2W0MA 3EPKA 3DKVA 2QU8A 4MQBA 4BFXA 3H2YA 5BN5A 2YHSA 4QRHA 3OIUA 1IM2A 2WAXA 4NYIQ 1RYHA 2QMHA 4IRUB 2B7BA 4Z1MA 1V43A 3D6TB 4YMTA 2A30A 3VX3A 2F3RA 3KB2A 1VMAA 3V4RA 1EFUA 4LBWA 1ZM9A 3U2QA 2JLZA 2E87A 3SS8A 4JKIA 4PHHA 3TR0A 3PITA 2WV9A 4LYFA 2P6NA 5K8LA 3GEEA 3FHTA 2QTFA 1K8RA 4FMCB 4TL7A 1KK2A 2FGJA 3QKSA 3K0SA 4B3FX 1S1CA 3GJ3A 3K9NA 2Q9AA 2ZEJA 3LW7A 2O52A 2ZUCA 3AGPA 3TAHA 4BASA 1Q1EA 3NTUA 4Q9JA 4LV6A 1LW7A 4HAZA 1JQJC 4GMXA 3BIFA 2DWOA 2YWFA 1N6IA 5M04A 3CH5A 4QGFA 1RW4A 4TLBA 4OQXA 2EU8A 4A8JC 1ZRHA 1E4VA 2ATXA 4R9UC 4M1KA 1BIFA 4V03A 1MOZA 3RRNA 4DSUA 1W36B 1ODFA 2G83A 3VU9A 2JAQA 5JRJA 2BC9A 1LV7A 4B48A 1Q21A 4IDPA 2FEMA 5FPTA 2KWIA 2IS1A 2OBMA 4DC9A 4LJ6A 4M8NE 2GKSA 1P73A 5FI0B 1JR3A 4HDOB 4DKXA 4B43A 4MDEA 2CVHA 1G5RA 2RCNA 1GKYA 2UKDA 3GLHB 1S0UA 3FMOB 1KK0A 1D9ZA 3B85A 3CR7A 4C0BA 4JLAA 1Z47A 3HP1A 1N6KA 2HF8A 2AKAB 3BRWD 3PUYA 5EP4A 1KI3A 4PPFA 5EXXA 1W44A 1UFQA 1H65A 1W2GA 2GZDA 1X8KA 2OUKA 4TMVA 1NVVQ 1KY3A 3LY5A 1LB1B 5JEEA 4JLKA 3GLIA 3QPWA 5D3MB 4Q21A 2DR3A 1G19A 2QSYA 4JT4A 2A5YB 3QSYA 3U60B 3GLGB 4BWYA 1N6NA 4DWJA 5AUOB 5A0FA 3HR7A 1GIAA 1DAMA 1XTJA 1UKVY 4NKRA 2VHCA 3SI7A 2AK3A 3OFNA 3KQKA 3PEWA 3B82A 2CCGA 3KKQA 2ZITA 2TMKA 3QEOA 2GAAA 4HYYA 2GXAA 1C1YA 1EXMA 4ACAA 1E2JA 3AVQA 2KB0A 1E0SA 4BRWA 1A2KC 3FGNA 3L0SA 2O8DB 3KDSE 3VKHA 1XTIA 4H1UA 3IO5A 3U44B 1YJ5A 2CL7X 1J99A 1G18A 4LBYA 1KZ7B 1GP2A 5L3SA 1E79A 4L15A 1VG9B 5CDFE 621PA 3GJ0A 2GF0A 4GOJA 2JIZA 3X1DA 4KLNA 2RGNA 3T35A 3Q7PA 4CEIB 2AR7A 3G5UA 2QRZA 4PHFA 1Z2AA 4JLVA 2PEZA 4KJZA 1G21E 1WRBA 4ASUA 2BEJA 2FSHA 1Q12A 3QKSB 4BECA 2BBOA 3CZQA 1UF9A 3TSWA 1E2IA 1BYIA 5J4KA 1N5JA 1ZNYA 4LHVA 3RS4A 3HPQA 2GEVA 4BFZA 3PR1A 1K5DA 4LPKA 4LYHA 2XZPA 1F3OA 3A6PC 1T8UA 4MRSA 5LBIA 1G8YA 1AZSC 4D82A 1COWD 5CYPA 3LLMA 3FKQA 1TADA 1XEWX 2ZANA 1SVKA 4NP6A 1YZQA 4Q7JB 4MKFA 1GRQA 2ONJA 1OIVA 5TXGA 3RDPA 4RD2A 3KJGA 4Q19A 1II8B 2OT3B 3PFIA 4B3GA 1OYWA 2QUZA 4FMBB 3VQTA 1XD2B 4I1SA 3SDZA 1IXSB 1NLYA 1ZINA 3CF6R 1YQTA 2JJ2A 1ZW6A 3NH6A 1YRBA 1Z5ZA 1HE8B 2JJ8A 2LWIA 4HAWA 3QI2A 1N6LA 4Q01A 2PMDA 2CL6X 3BH6A 1Z6XA 2IYXA 4L4UA 1IN6A 3FTQA 3RYTC 3SNHA 3VR5A 5EUMA 4BFVA 1W47A 5DNYB 4OK5A 1NSFA 4DT1A 2NOAA 3DVLA 1T9HA 1QVRA 3BXZA 2E9SA 1KDTA 4FIDA 2ZE8A 4NYIR 5EP3A 1D2NA 2HEIA 3U4QB 3O8DA 4PO1A 1GWNA 3NVAA 4A8JB 2NO0A 4RKEA 3EWSA 3LBIA 1Z07A 1KI1A 2I1QA 4FINA 1ZNXA 4IXMA 4P4SB 4D0GA 5F98A 1Z63A 2JATA 2WAYA 3Q5DA 2Q0HA 4ZDKA 2GAOA 1OYYA 2FSIA 5CYOA 5FBLB 3V00A 1KIMA 4PC2A 1XD8A 4PPNA 4Q9LA 3UMFA 2WICA 1TUEA 2JJ1A 4NCKA 5HZHA 4MYHA 821PA 1X1SA 1EK0A 2RGCA 3GFOA 4OI2A 4QNRA 4OI4A 4D26A 4TMZA 5HE8A 5AJXA 2R2AA 3ZZUA 4NMMA 1NNEA 4Q47A 4RD6A 4GBMA 2GETA 4PC6A 3UG6A 1WXQA 2IC5A 1D8TA 2DYKA 2Q3MA 1OLOA 2ZU6A 1ZP6A 3DHWC 4HB2A 3A58B 5EP2A 4B74A 4MRVA 1GL7A 5FTNA 2O0KA 2ZRDA 4Q66C 3NHAA 4Y0AA 1N6RA 1IY0A 2ZPTX 3CRW1 1G4UR 2H17A 2BIFA 3H4MA 4C7OA 2FU5C 2F6RA 2XITA 2ZSBA 1G291 2R62A 2ZSEA 4G01B 1ZNWA 1P6XA 5EUQB 1Q3HA 3A1SA 3DDCA 5J40A 3QIAA 2ZR9A 4QKQA 4RFSB 1KMQA 1TMKA 2CK3D 4KFSA 4MRRA 2QMUA 1P60A 2IYRA 4GZMA 3HJNA 4JVNA 4XWAA 2VF8A 5EZ6B 1Z6YA 4NONA 5FUVA 3AP3A 2H18A 2R9VA 3Q72A 1LS1A 1NF3A 4UJ5A 5C4MA 2GEDA 2A3RA 2FSGA 4QHSA 4P31A 1LF5A 3AVXA 4ZI2A 1R7RA 5C2JB 1E69A 3EZ6A 5FTLA 1PUIA 4DB4A 3FHOA 1W5TA 4JZKA 2WPDD 3QEJA 4X8HA 2BWJA 2IYVA 2GJ9A 1Z8FA 5EQTA 1BS1A 3K53A 2OBNA 4NH0A 2DPXA 1QZXA 1E94E 3K09A 5JI2E 1S1MA 1DO2A 2REBA 1O3YA 5FOSA 2V6IA 2ZR0A 4BGDA 2LKCA 4B76A 4R2HA 2JA1A 1W0KA 2XNDD 4M0LA 4OQMA 1JR3D 3UG7A 4A9AA 1XJCA 5JCPA 1KSJA 3B1ZA 4TLAA 1S3SA 5E3HA 2X1VA 4EPRA 3DMDA 2H57A 2ZYUX 4QBGB 4ZV4A 3RVBA 2B7CA 4HUQB 3S1AA 4B33A 1SKQA 1G41A 1XD9A 4IFEA 5JBQA 1KTVA 2WWFA 3KQLA 2GF9A 2QTVB 5HTKA 4Q9IA 1L2TA 4Y0VA 3MUFA 3W5JA 4EKDA 2XZLA 2QA5A 1ZUNB 1NG9A 1J8YF 3E70C 1OXVA 2W00A 3X2SA 2BDTA 1E3MA 4Q00A 5JJKA 4LJ4A 3QKRB 4PSKA 6Q21A 4G5RA 1ZUIA 1Q1QA 2JLQA 2GHIA 2FF7A 1Q22A 2ZYWX 3CRRA 3OIVA 4QGGA 2WM9B 1W1WA 4PANA 5IDVA 1RRFA 1U0JA 4KAXA 4J0QA 2KJQA 4DT1B 5JECA 2WZQA 3LQQA 5KYKA 1JPNA 5FFMA 3ZD7A 3EWAA 1SULA 1VCOA 1FP6A 2JDID 1M74A 2RGEA 1P9NA 1XD2A 3QE0A 4Q9KA 2ZXUA 1HTWA 3ZGXA 2ZE5A 3QUSA 2IEZA 2YJTD 3VHXA 4DSTA 2WWYA 3DM5A 3RABA 3EAQA 4C3ZA 3SFZA 1E0AA 3SR0A 1EFRA 3GMTA 3RWOA 3NBXX 2FE4A 3X1WA 4CT5A 1WF3A 4LSGA 1Q20A 3NDPA 5FR2A 1WMSA 2IYYA 3TUJC 2PX3A 2FNAA 5DE3A 1DAGA 4PXAA 5C46F 1F60A 2D62A 4KBGA 2DY1A 2YC2C 4HAYA 1M2OB 1R10A 4H1VA 5JCZA 1E9RA 3UXMA 3RRZA 3VNVA 2OCYC 1XEXB 5J4YA 1P9RA 3I61A 1X6VA 2OSBA 2VHUA 4QBFA 2P6UA 1K6MA 4V02A 5JHHB 3U6BA 3P4XA 2EFGA 2FN4A 4R98A 4A82A 2C95A 4CT4B 4DCVA 1KO4A 4HLCA 1AKEA 2FA9A 3U44A 4KFTA 1G16A 4P32A 3AKDA 4PAMA 1SXJA 3OEHA 4UQOA 4XD7A 4M22A 2QRNA 2CDNA 1OFTA 3AVUA 5B2ZA 4IW3B 3GJ4A 2IXEA 5L3RA 1KHTA 3CX6A 2BBWA 4GOXA 4PTLA 4B73A 1COWA 4BFTA 1EFHA 3KUDA 4RFSA 1YZTA 4D4JA 1JALA 1GNRA 3WYGA 2XB4A 4E22A 2ORWA 2C77A 2B8TA 5LD2B 2GCNA 3ZIAA 4ZKEA 3G0HA 4AYWA 2ZU0C 5K8UA 2HJVA 4Q7MB 1YZUA 3GQBA 3KJEA 2F1JA 4ASUD 1T0JB 1KSHA 1IY1A 4TYWA 1AQYA 3NIBA 1TQDA 2MSCB 2ZTSA 1U94A 2I1VB 3MWKA 1QG4A 3IHWA 4Q4AA 3SZRA 1T91A 5H68A 4CDGA 4UJ3A 1CULC 5FTKA 1E0JA 4MRNA 1XWIA 4U02A 1CJKC 3REGA 2O8FA 4B3XA 1TQ2A 4M2LA 4E03A 4B3BA 4C0LA 1G6OA 1KI9A 1NRJB 2WSMA 4X8OA 5EXTA 2FOLA 3X1ZA 3EIQA 4YXWD 3QF4B 3U3KA 3SQWA 3X1XA 4MUAA 4QG7A 2P3SA 2J0QA 2CHGA 4C4PA 1YZNA 1NBME 2GXUA 3LBHA 1VG8A 1QHHB 2OZEA 3IKJA 1US8A 2WWGA 5FBWB 2NO7A 1G8FA 4P4SA 3EZ7A 2GA8A 4YC7A 4CEHB 4D4MA 1HQCA 4TTQA 1OW3B 1E32A 2PZFA 2IYLD 3LXXA 2RGXA 4IOLA 1U8ZA 1P62B 3TR5A 2ZJOA 2YZ2A 4PO8A 1XXHA 3ADKA 4FMDB 2D7DA 1XEFA 1I2MA 3I32A 1F2UB 1VECA 3NEYA 2EFHB 5CB6A 3CLVA 4O2LA 2QP4A 3AV0B 3ZZTA 4TYNA 5JLJA 3JZMA 3NWJA 3RWMB 1X86B 3PV0A 1SXJE 3NXSA 3TNFA 4RKFA 3TSOA 4OJQA 2F43B 2ZRBA 3UWKA 4LOAA 2XSZA 2VPPA 2ANCA 2VP5A 5HPYB 2R65A 1VIAA 1QHSA 2FV8A 2IF2A 2X77A 1P2SA 1RFLA 3R7WB 5KTYA 3U4QA 3UMSA 1Y3AA 2O0HA 4BZXA 1XMVA 4JVLA 1W36C 3AM1A 1KY2A 2VSFA 3OF5A 5GJWC 2OG2A 1G1MA 2MSEB 3KFXA 3BAFA 4FI3C 4DCTA 4X8LA 1XTQA 1NY5A 2B8WA 1G20E 3PIRA 1E1RA 4B75A 4A15A 3TBKA 3LV8A 5FOXA 4DHEA 1XBTA 4IFBA 4AIIA 2BMJA 4QFMA 1G7SA 1G5TA 1W0JD 1W4RA 3VMFA 3QJYA 1N5LA 4FCVA 2CLDX 3AP2A 3THXA 4KFRA 5B58C 5KSZA 1X3SA 5AWFC 3D31A 2QL6A 3QXHA 5DLQC 4JL8A 2Z83A 1AM4D 2QGZA 2ODWA 3K0FA 2J5XA 1WDTA 3F0TA 3A1UA 3BC1A 2WKPA 4M53A 1UADA 1NKSA 2Z4RA 1KZGB 3BE4A 4P4TA 1N6OA 4O0MA 2CCKA 1F6BA 1W5SA 2ZE7A 1I4LD 1SVSA 1KDPA 1SGWA 2BMDA 3ADDA 1G6HA 5C1BA 2OV2A 2WMNB 3F5FA 3GLGA 1OB2A 3GLIE 1EG7A 3T1QA 1FPMA 1BO6A 5DYIA 4D2IA 4NCIA 4JVMA 1TF2A 1UBEA 3WXMA 3Q3JB 1NKTA 1NIJA 3K1JA 3QXJA 5DH9A 3T5GA 2BHRA 4V0KA 1CJTC 3FHCB 1VPLA 5TV2A 4BFWA 1NL3A 4OBEA 3REFA 1YR8A 1OHHA 2CHVA 4IOKA 4KBFA 4PHTA 1WBDA 1IN4A 1XX6A 2WKRA 3RS3A 2ZR7A 2J1LA 2VYFA 2Y8EA 2A78A 2OESA 1WCV1 5F2EA 5KNDA 2QP3A 3GP8A 1DAEA 1YZLA 1E79D 2QEQA 3HU3A 4KODA 3ZS8A 4BLRA 4YLGA 2VQSA 3BFXA 4HAXA 2DWQA 3RAPR 2OE2A 1FX0A 4TSFD 4DZZA 2XTZA 1MV5A 5CDFA 3KXKA 2WJYA 2Z43A 2ZUDA 2YWHA 5EZ5A 4A2PA 5DO9A 1Z0FA 1FOEB 1FW6A 1ESMA 1FL9A 4N1AA 1DEKA 1RYFA 4PSVA 1NN5A 4NYJR 2FX3A 2V54A 1LNZA 1W4AA 4GI7A 2XTMA 4US2R 1U0HC 3B8HA 5AK0A 3L8ZA 2OHFA 4PZYA 3EX7C 3SQXA 1EX7A 2A5FA 2VA8A 3THOA 4YMVA 3AF2A 3CH4B 3KL4A 3LW8A 4MKHA 1L4YA 4UXHA 5FOWA 2QQ0A 2DFKB 5GJBA 1HT2E 4E5UA 4GOKA 2OM2A 4ZIRB 2YOHA 2WKQA 1SVWA 4QM6A 4U7DA 5DSZA 3DOFA 2D4HA 1DE0A 4EJSC 4LC1A 5SZKB 1E2NA 1PLJA 1IXRC 3IHLA 4XOIA 1VHLA 4JIMA 4D0LB 2IS6A 1AS3A 2BJVA 2G88A 4AK9A 2NZJA 1RRGA 1DTSA 1ZCBA 1M7BA 2ATVA 1HURA 2ZAOA 1DPFA 3GEHA 3IIJA 1NY6A 1ZU5A 3ETLA 4DUGD 4I1UA 1IBRA 2EFCB 1AKYA 5SZHB 3AQ4A 2ANBA 4AURA 4WOPA 1KI6A 2R6DA 2E1RA 3EIEA 1X8LA 1OXUA 4PO9A 5G3YA 5F3WB 3A4MA 1TTTA 3SEAA 4JLPA 4JKYA 5GVRA 2IHYA 2J87A 2BBSA 3I8XA 1J70A 1NN0A 2CK3A 4N3NA 4PHGA 4TL6A 1FNNA 4Q4LA 1G3IA 4JL6A 4UXJA 2IYWA 2V6JA 3Q85A 3AGQA 4L5BA 5ANRB 4BPBA 2V1UA 4JYCA 5GVSA 3CNNA 2V7QD 3KZ1E 3SYLA 4GNKA 2ZJYA 1KO8A 1IN7A 1L8QA 4B71A 4BUJA 4U5XA 4QXAA 4N0EA 4Z54A 4DLSA 1AS0A 3B5JA 2D2EA 3CBQA 3HWSA 1E2GA 3Q9LA 2IHBA 3AKCA 4GMDA 5CJ2A 1R8QA 1E96A 4HLDA 1CIPA 2CMKA 3IQXA 4S2EA 1OT3A 1G8PA 3KKNA 2A5JA 4IDQA 1E9CA 1Q1ZA 4YMWA 4MH0R 3I73A 4FMDF 2IYQA 2WJVA 3GFPA 1XU4A 4A0GA 2W2TA 3WMEA 2PLRA 5FPHA 1XZQA 3OE7A 3NBFA 1XCGB 1FTSA 4BZPA 1N5KA 1SHKA 3A1TA 3U7FB 3K70B 1UBGA 2QENA 4F4IA 5E7JA 3CF2A 1NN3A 2G0TA 4LUCA 2ERXA 4C0JA 1I2DA 4JBXA 3LWNA 3TQCA 5CJPA 5DN6A 4KFUA 4Q4AB 1CP2A 2OAP1 3KKMA 1D5CA 3ND9A 4TL9A 2NMVA 5D3MA 2VRWA 1UBCA 4OHWA 2J7PD 3I62A 3PEYA 4P3YA 3M1IA 3FMIA 1JJ7A 2C04A 1RVDA 2GJKA 3P32A 1ZM4A 5JI3E 1PJRA 3A8TA 3CR8A 4WZ6A 1GTVA 5IT5A 3RRMA 5FPKA 4URVR 4RZUA 2Q9BA 1R8SA 1MR3F 4QBHA 2VHTA 1VYUA 2WIAA 5J4LA 1ZC4A 3W6OA 4ZCMA 2JJ2D 4S35A 2PCLA 3TW4A 1SKYE 1E2MA 3MWYW 2ZRKA 4IVRA 2MSDB 4K8OA 1EFRD 4OL0A 4W9MC 4CEIA 1ONBA 4OHVA 4DUGA 2I3BA 2J46A 1WBBA 3E2IA 5AUQA 3K9HA 3JVVA 4LPSA 2O8DA 3O8BA 5DHAA 4C2UA 2GDJA 2HDNB 4M1SA 4IOJA 4LBVA 3LA6A 2AXPA 2IF0A 1R0ZA 1KNXA 3CKLA 1V5WA 1W48A 5KDDA 2ZI4A 2AHOA 4M9XA 1BKDR 1R0WA 1XMJA 4I99A 1OH8A 1T5IA 1GILA 5JWHA 1R4AA 3KKPA 5BYJA 4OHYA 1Z6AA 1G3QA 3GLFA 1UM8A 1TF7A 3CF0A 2JLVA 4EUNA 1LY1A 2B21A 3SOPA 4HLUC 2XSZD 1WGWA 2KBEA 3TVTA
chains in the Genus database with same CATH superfamily
4LF8B 4BQFA 3H6KA 3KJHA 5AHXA 3L6BA 2QPTA 2DH6A 4QBKA 4HWRA 4U9IS 1U8YA 1XN4A 2W42A 1KYWA 3W4JA 3H8JA 5CM8B 3R9XA 3I0MA 5LP6B 1TM2A 2ZM6B 5CTJA 2I7CA 3LH5A 1DL5A 4NTZA 2B4TO 1F0KA 3ND8A 4G5GA 1QRUA 3R7WA 4MO2A 2ALJA 3F4BA 4RY0A 2KLHA 3DZKA 4Q7EA 1U7ZA 5EQJB 2EZ8A 3OZDA 4LYYA 4ZCLA 5IK2A 4ZO7A 2H4YA 2YKZA 2GPTA 2YNMC 2GR9A 4YUZA 4BX0A 3C43A 3HXTA 4B3SB 1C3JA 1YQ9A 4XX0A 4GZ3A 2HA5A 3C14C 3I76A 3UMBA 3HRHA 5FBVB 3ER9A 4M9CA 2A0YA 3CB2A 3SBEA 1QJCA 1B8VA 2HJHA 3G2HA 3W34A 4R84A 3SYTA 5G0SA 1ZVQA 1YB5A 3BE8A 1W2HA 1E4OA 1N7GA 1A4IA 3N76A 4RDIA 4S1WA 1C9MA 2A5DA 2PMEA 4MQFB 5ECDA 5BSEA 1YU9A 2JFNA 4UARA 1BZYA 5K8TA 4CMIA 2XMRA 3BWMA 4MKGA 1X38A 5H1YA 4X1IA 4MVJM 1JYFA 1SHJA 3DG9A 3AHIA 4FLFA 5DIFA 1VDZA 1Z34A 4XKJA 4U0KA 2W2VA 5SV2A 4DLYA 1SIOA 3STUA 3WMXA 4GE0A 1XRSB 3E2PA 4J0CA 2D1SA 4A1OA 2XEXA 3T34A 4L7QA 4FONA 3H13A 4DZRA 2I6QA 421PA 4FILA 1VGQA 2Y1EA 1F4PA 2V26A 256BA 1ABFA 4ZOQI 2RGGA 4F2PA 2ICWG 4DLUA 3AONB 4O25A 4TROA 5EZSA 2E7ZA 4I4CA 4AKIA 2BFNA 4C0HA 1ZYUA 1CJBA 1RRKA 4JVSA 1Y42X 3DNPA 3HFJA 4LQ4A 4CIBA 2I91A 3C41J 1KO5A 2XE4A 4HL6A 5JFTA 1GFZA 1WNFA 3ROKA 3CBGA 2Y4OA 4JA0A 4CDVA 1N2SA 2FGKA 4F1WA 2IS4A 3GEDA 3TMYA 5CD1A 1OZHA 2FZVA 3RFCA 3AZQA 1YNOA 3DW1X 5IDWA 3KTAA 4IARA 3OJEA 3D4PA 4UU1A 1CIVA 1KEWA 1CE8B 1L7AA 1XDWA 2IBMA 2QX6A 4MGKR 4D46A 4EHJA 1JN0A 4NCXA 4WBNF 1A7JA 2O3UA 2LKDA 2Z5FA 1LSSA 4FGZA 2IP1A 4OHRA 1P19A 5D3ZA 3OOYA 2G82A 3ITNA 4I8IA 2YQ4A 3GEIA 4B6GA 2YKGA 3GNTA 3QPVA 2HHJA 5IULC 1V41E 4CM6A 2VH5R 3IS3A 2WIFA 4CIDA 4E5VA 1C4KA 2YS6A 2FSFA 1M34A 2RGDA 3EASA 5LJIA 3KYIA 2DTEA 3GFTA 4H7EA 2C7PA 5F9FA 4DXDA 3D5TA 3KPUA 4KP7A 3Q4GA 1RE0A 1ORHA 2RIRA 3WWZA 3C7JA 3WYFA 2WZGA 2Y69C 1D2HA 2DG2A 3RBXA 2UZAA 1FX0B 3H5LA 5BQ5A 5KNLA 4KR3A 1Y7TA 4NPAA 1PS0A 5FIUA 5J58A 2X9QA 2VK4A 4U2FA 4QVKA 2P5UA 2I34A 4PC3A 4RUKA 3BORA 5F52A 4AJOA 4NWIA 1WB4A 3H5TA 3UW1A 1Z15A 3UANA 4ARAA 2JD2A 3KQVA 4PQYA 4HQRA 4J2TA 1Y9DA 4QHTA 2CFSA 3EZNA 2BD0A 3GJYA 3L7CA 3NHSA 3VU0A 4EHBA 4Z9FA 5C81A 5HXAA 4AI6A 1E20A 4L07A 1JFVA 1RKCA 2X42A 3NEPX 4ENUA 3V46A 4NCNA 1F7UA 4BBPA 3NIDB 1RLMA 4MEBA 4C7BA 2XB2A 3IP7A 2Y71A 2IV3A 4DDUA 2WU8A 2L6HA 3AXSA 2O2IA 3P20A 5FTWA 1JAFA 1NSTA 3RYCA 4B17A 2PT7A 3WLHA 4EBKA 4GKJB 5D92A 1UZUA 4ED9A 4WXYB 5F1PA 4WOJA 2QRPA 3L0OA 1NJGA 1PWHA 5B64A 3GW8A 1SEVA 5I7SA 2FFRA 1NRWA 4A16A 1Z26A 2PS3A 5FBZA 1EHIA 2YNMD 3VR5H 5AM5A 1JSCA 5JLIA 1ORTA 5KVQA 1ECGA 4WT7A 1EQAA 3WBBA 4HVTA 3NYQA 4HAOA 1PN3A 4UREA 5AOAA 2PO5A 1OXXK 2XCIA 3WYNA 5IVKA 4XQ9A 4FYHA 3DB2A 4Q1DA 3U19A 3E4CA 1MOPA 5DF1A 3OD5A 1JB9A 2L18A 1V8BA 3K6JA 2ZJ4A 3BWEA 4W6QA 1JWAB 3T1NA 2BFFB 3ESQA 4N7RA 4NG5A 4ZV7A 3OCCA 1EZ4A 3HP7A 3IKMB 2R44A 2A8YA 4HY3A 1ND6A 4G0OA 3DE6X 4JBHA 3RUPA 1AG9A 4R7TA 3V4VB 1CPRA 1KZ1A 1LWOA 3LLIA 1KQ3A 2IEGA 3H8VA 3MT7A 4NZOA 4X64B 4AG3A 5GIOE 1U28C 4DR4B 3OKAA 1B1CA 1SBQA 3JALB 1WB6A 4D4XA 3L7DA 2IYSA 1WXGA 3N8DA 1I2BA 1F9AA 4R3NA 1EHYA 4F86A 5DLEA 1I7QB 3CPSA 3NTXA 4S04A 1EWYA 3UJHA 3OLXA 4PR9A 1T2FA 5CIQA 4A0FA 5C7LO 3VI4B 1PVOA 3IQ5A 4EPYA 3T61A 1X2BA 1F2UA 2KPOA 3B6MA 2PMBA 1V8ZA 3D0QA 3MG9A 1O57A 4Q1VA 3MOSA 2DI3A 4FCCA 3TOZA 3C6XA 5BR8B 1L4NA 4AJIA 5B7GA 1P75A 2C9ZA 3M34A 4FEGA 1L8XA 3PQDA 4LRXA 4EHAA 2E82A 5C8ZA 3DF7A 1M2NA 3GU3A 4IIJF 2Z5VA 3AY0A 2JRLA 4TTPA 3UY4A 4JL5A 1KJQA 3OMWA 1I80A 2ISCA 1IJKA 1KZ9A 1FB5A 1LPBB 1TPYA 1U2DA 2IJGX 2JGDB 1JILA 2PV0A 2YWDA 5DB4A 4B7AA 1E3QA 1HH4A 2OO3A 4OMDA 2JC3A 4TN1A 3K6SA 2VASA 4ZT4A 3KALA 3IXMA 1B23P 1ELOA 1PNQA 4H77A 1C3LA 3BFPA 4FYPA 3QXXA 4YYEA 3H2JA 4ZCQA 1TVKB 5F1KA 2GN1A 3WK5A 4B2LA 2D2FA 4ZYLA 4OU4A 2IPOA 2WWIA 4F91B 4XTRA 2ASRA 4IR7A 4Q5IA 3DBIA 4JTCB 2D8AA 3LZCA 3GLHE 3I2GA 2IY8A 4KE7A 1NG1A 4OSPA 3IPXA 2XODA 1CY8A 1XMSA 4CLOA 2XKKA 1BVHA 2CYDA 1NVBA 2Q1WA 4MR7B 3ZJ5A 4EW6A 2Z30A 1YAHA 4B6EA 2PUDA 3FBTA 2YNMA 1S05A 4BO4A 3LFHA 3KQYA 3HCOA 2XUJA 1MXHA 3EPPA 1IW7F 4BEJA 3W6ZA 1FNTc 2POQX 3DO6A 3HM2A 3WFIA 3RS2A 5FWNA 3H3JA 4LW8A 5HIKA 1OR8A 3BERA 4Q93A 1D1TA 5GGYA 5CAEB 3DCYA 1DBRA 2RI0A 2TMYA 3QVWA 1BHJA 3IULA 4ZVNA 4D9GA 4V0NA 4Q3CA 2ZI9A 3OJXA 1W4BA 4QOHA 3ICOA 1I0LA 2GPSA 2ISSD 3PUJA 5B12A 4HUTA 4YY3B 1PU2A 4J9UE 4U7HA 1WUIS 4QTYA 1QKRA 3LAWA 1FFEA 2QQ5A 3AINA 3PFCA 3VVLA 2P7IA 4S12A 2XQJA 4L6IA 4JC7A 3W7AA 4G1EB 4KR0A 4PZLA 4LGVA 2OCDA 3RC1A 3SMQA 1NVMB 1IM8A 3NBYC 4P86A 2NLOA 2ETSA 3HL4A 4LBZA 4XWTA 5AKKA 3SVLA 4E33A 4JROA 1SOMA 4BJ5C 1PVVA 1ST2A 3A28A 3DDOA 1BJRE 3EZXA 5F9HA 5IXYA 3FUTA 4R41A 2GFHA 4O4HA 2B5VA 4DRIB 1DJLA 2R7LA 3LP8A 5AUNB 3AHEA 1MO3A 3L0YA 2I7TA 2GTIA 4BBZA 3IT0A 5CBPB 4D97A 2Z6UA 2XBUA 2V7XA 3HYNA 5C5CA 1JIUA 2QL5A 1GQQA 4QA9A 3EULA 3KB1A 4BJ3A 4K2AA 5KPDA 1QKJA 4FK8A 5TMDA 1NMXA 1HOTA 4TRMA 1QG0A 3TOLA 1V1JA 1LDEA 3MWJA 3SR3A 3CVXA 2PUGA 4JB2A 3K0AB 4ZQIA 2IGTA 1XPJA 5DI3B 5DRTA 3VNAA 4WBSA 4R5HA 4KVGA 5AKHA 2HT6A 4O3MA 3DBVO 3RUAA 1FK8A 4IKEA 2B1GA 2OQMA 5C5EA 4UZSA 2XF2A 2FMXA 1NP6A 2BTOA 4RO0A 4N12A 3T7TA 1G63A 1NPYA 5BN3A 3HADA 1E3SA 1OBHA 3E3MA 3U09A 3LKVA 3DGFC 4E7ZA 2O1XA 3F5QA 1KOFA 3OEHD 3PSAA 4GMHA 4XD7D 4G5XA 2FRDA 1QE5A 1Z0JA 2WSLA 1Z4PX 3HO8A 3QQPA 4O6VA 1NQXA 4ZEWA 4D3DA 4EB8A 4Z9AA 1IFXA 2IVZA 2WT4A 2AFIE 3WQHA 2JFGA 4R0VA 4PJLA 2YVUA 3T1VA 2H00A 4JC0A 1KKUA 3AJ8A 3FMGA 3ZSUA 1CEEA 4D5GA 4X8MA 2Q4RA 2IITA 3FPJA 3OZSA 4EKNB 3LIIA 1S3FA 3NHWA 2F17A 2PGNA 2QORA 3T9CA 5JT1A 1NASA 3KQOA 1DMSA 3G6WA 4QLAA 4QTZA 3EZFA 4XSVA 4ZOLB 4A2QA 1T36A 3UUFA 4FWIB 4PLCA 5I9IA 1OTHA 1DTWA 3GLQA 3Q7EA 1CJSA 2QRQA 3UUGA 1YIAA 2C4VA 1RMVA 4KAAA 1KSFX 1ZHZA 1VJCA 3TQHA 2WYOA 3ORFA 2HWWA 1Z68A 2PJRA 1T3GA 1RXSA 3THSA 1VLTA 2ZSKA 1GGKA 1N57A 3EOBI 4EPTA 2R6AA 3INGA 5IJWA 4Z9HA 3IQEA 4NV3A 4CIWA 3EIXA 3AG3C 2Q9CA 1IE3A 4NU0A 5E95A 2C07A 4RV9A 1N8SA 2W45A 1EA5A 2GYUA 3ZY4A 5KB3A 3WSTA 4MKRA 2JLSA 1BOFA 1KR5A 1SXPA 1SVLA 1FLVA 2DCMA 4MYUA 3IAM6 5AW7A 1N25A 5AW9A 1R6TA 3TM4A 3QKIA 4BQEA 1KJZA 1SVIA 3HEAA 4XLLA 2PZKA 5KSYA 4YASA 1U4OA 1H6BA 3RQFA 4DCNA 1L4KA 1Y1QA 2ZWVA 3B1JA 4NYMR 3ZCXA 4AE4B 4Z3KA 3D7SA 4RK1A 3H83A 1QKKA 2JVKA 5EAIA 1II0A 4BFSA 1E7YA 1G8KA 1OSNA 2O50A 3IJ5A 3LQ2A 3OZEA 2PXHA 3C45A 1PQPA 4FFRA 4KQ9A 2P0EA 2PIDA 3G89A 3R3YA 3T7AA 3UCEA 4IJMA 2ADFA 3JCZA 2FG6C 2HCBA 1MC4A 3KLOA 5JARA 1FYWA 1RPNA 1EVLA 2CL5A 1BXRB 4ENWA 4P0TA 1YVEI 4OFWA 4R31A 5DBHX 5JY1A 5CPBA 1Y8RB 3KIPA 2OILA 2OY0A 4WY2A 3CNHA 4M99A 4ULWA 2W2XA 4G1MB 4RF4A 5IXSA 3H75A 4D3FA 4C6TB 4Q4ZF 3RVQA 3PBKA 1GZ3A 2RAPA 3D4LA 1L4GA 1P3JA 2FWJA 4IFIA 1D3AA 3CRQA 4U5FE 1P5RA 5CR9A 3N5CA 1MX9A 2LCFA 2HLDD 4TXNA 4CIPA 4X7RA 1X9HA 3PRKE 1R6VA 4LCJA 3WDSA 4TWZA 4Y6OA 5IKEA 2X41A 2NZVG 1A5BB 2HIHA 3SC4A 2ZI5A 1E89A 2PRKA 1DG3A 3N8NA 2AUMA 3WHNA 3R9IA 1U3DA 3CW2A 2O2XA 1XB2A 4Y1RA 1HMYA 3RM3A 3V8MA 4DJEC 3AOUA 3F3YA 3H2SA 1E2UA 2RG7A 3CPEA 2I8BA 2CHEA 3AG6A 4DSNA 2G8NA 4J6EA 2PUTA 1YJQA 1LE4A 4IIFA 1BR1A 3QLUA 4ZEOA 2PH5A 1H0KA 2A0WA 4FWTA 3ENKA 1IRXA 1P4AA 1U6IA 2R5WA 3A2NA 3ICPA 3O2JA 4N82A 1C41A 4P22A 1ISIA 2VJMB 5L4NA 1M5RA 1ZCJA 1ZK2A 2QN7A 3S6JA 4MW3A 3SM3A 4C1BA 3FAJA 3PXDA 3FTNA 2ZJZA 2X14A 3B38A 3DD5A 4ZVSA 2UZ3A 2BFBB 4TQAA 2BYTA 5E9QA 2H54A 2WKWA 3F1LA 4IJKA 5K4AA 2Q3EA 3QBEA 1XJQA 1V7PC 3JCUQ 2OENG 4GR5A 3TLZA 1G2OA 4LY6A 5A62A 1ECPA 1O9GA 3VR4D 4W5RA 4KAFA 3DE9A 1JPUA 4G6ZA 2PD6A 3G4XA 1HYBA 1Y4UA 2JFFA 2DQSA 1TJ3A 4EQ6A 4A36A 4D4IA 1HZZC 4C1NA 2JW5A 2ZWIA 5ILOA 4DA4A 1IZ9A 4FN5A 4KX5A 1YZHA 2AD5A 5AVXA 3WGUA 1U3WA 3HVRA 1BWSA 5E4YA 4RLFA 4LJRA 4EY7A 3FYSA 5JOQA 2NSYA 4V0ME 4KPFC 4CBVA 5E0KB 1CNMA 5KIAA 4CQLA 1Q0PA 3QKTA 2E49A 3ND6A 1P5ZB 4XJSA 1U63A 2GAQA 1MAUA 2MJLA 1QANA 2EVWX 2EX1A 2WJ3A 3G9QA 1T8SA 4D45A 2IZ1A 3GVPA 4ZGBA 4YP9A 5AM2A 4C2AA 2WJZB 3R74A 4CR8A 4ETNA 2H3HA 4BMPB 2PX2A 1IQPA 5TC4A 2E1PA 3FUVA 1II9A 4WJLA 2VHEA 4DGSA 2UZ4A 3ECSA 2GI4A 2WTMA 4CGZA 3AHCA 4F4FA 3IJPA 4IMPA 3SZMA 1XAIA 3F2VA 4JC5A 2J5QA 2BSXA 4TKVB 2WYIA 8ABPA 5I7VA 3C62A 2XECA 4YDRA 1YFJA 1SD5A 4YL1A 1LLFA 2P3LA 3RG8A 4F1JA 1DIAA 4ZV9A 4X90A 1BROA 2C99A 4XYGA 3UATA 1E9DA 2Q9UA 5GAJA 3QQ5A 1QC5B 1BBHA 2QPAA 2C9YA 3RQSA 4V1CB 5D5HA 4MP3A 2XCQA 1DI0A 2CJYA 1TVCA 1BX1A 4NAVA 5BR7A 4YROA 2IZ7A 4MROA 4Q7CA 1IH8A 4KN5A 1M1YE 4BNMA 4G8CA 2OJED 2X4DA 5K6RA 2C92A 4LY0A 1GITA 2WE7A 2YY6A 3ONNA 4YUAA 3U48A 2O59A 4B0PA 3K20A 4XTCS 3TNDA 3ZZNA 5LCXA 3I42A 5B30A 4ON9A 5LUAA 5AM0A 2RBEA 1RYEA 3WBFA 1I4EB 5L3QA 4LOHA 4WXRA 1YB4A 3RS0A 2I2DA 3ZYZA 3RQEA 4YQEA 4L16A 4ENQA 1XVUA 1CPQA 2NVWA 3C24A 3G3EA 2X4LA 3AETA 1NVDA 4I0WB 4YJKA 5B53A 3PD1A 4C89A 3I64A 4D99A 4WGFA 4PYNA 3CW9A 3N7AA 5AKYA 1E6CA 2H1HA 2XMBA 3F8WA 3L1KA 1RYDA 3L46A 3BMNA 4R8RA 2OV4A 1RKVA 1MABA 2Q4TA 2XKAA 1A97A 2H5EA 3H5RA 1U8UA 4AC9A 4NF2A 4Q82A 1ZKDA 4I9FA 4ZMSA 4CDAA 3C3MA 4HP8A 5EMLA 3DHNA 1AXGA 1U2TA 3CO5A 5FORA 3OQVA 3P9YA 5IBPA 3L0BA 3QTHA 1Q6YA 4TWBA 4HDQB 3MOIA 2HFIA 4ZQHA 5KVCA 5L3SB 3ZWAA 4K7BA 4G5YA 1OV4A 2PWAA 1POWA 3CONA 1ILEA 4DBRA 4JKOA 4G23A 4HNHA 1PEAA 3EGVA 3OLWA 3OWHA 4FU0A 4IX1A 3HJAA 1N1GA 3GJQA 4HZIA 4HDKA 1SOWA 4WOCA 3CLRD 4XCXA 3W6NA 3GRFA 4BJ6A 4EJ2A 1I3OA 1SAYA 3QF4A 1R0RE 4G1BA 5LQMA 1LX6A 4LHXA 1QP8A 3U44A 2NZWA 2PFGA 4Q16A 4TQGA 4EJ6A 5D84A 6NULA 3FN4A 1G8MA 3QF7A 4Z7NB 2HT1A 3KOWA 2OP0A 3IAM1 4FGLA 1B74A 2Q7RA 4E51A 2CYCA 2ZXFA 4Z4FA 3M4YA 5JY6A 3C1AA 1JR8A 3FDQA 1RP7A 1AHHA 3ETGA 5LU8A 3IGFA 3VAAA 4X66B 2OLEA 3A1VA 4NCJA 1W36D 1XA3A 4A5OA 4EFLA 4FM9A 5EERA 4F85A 4IKPA 1SC3A 4BC1A 3G5LA 3FPBA 3C3DA 3V4ZA 3P26A 2IYNA 1GU7A 3O4JA 3EJNA 1MJGM 1UBNA 4GP6A 4QBTA 2EQ5A 1EK5A 2R25A 3MFYA 4NYMQ 5KC8A 4X45A 1BR4A 5CG2A 1QPZA 5TEWA 3VRHA 4EWCA 2NSGA 4L85A 3JTEA 3T54A 4EGSA 3KU1A 4OHXA 1DAIA 3BREA 2VTBB 2Y3BA 1JNXX 3A1WA 4E7OA 3H2UA 1AVOB 2XLWA 2CN1A 3OFND 3PC2A 4GFDA 1QHEA 1WXWA 5BWNA 1P18A 3GVXA 2ATEA 4OA8A 3S55A 4AYXA 2ZXEA 4HATA 2NO6A 2PJZA 3SJ7A 3R4VA 3W78A 5JSZA 4CRWB 2QBYB 4P6VF 3VR6D 1RXYA 4I9UA 3U7QA 4IZOA 1U7UA 1JAIA 1R8YA 1XU9A 1ZM7A 1SO8A 1WMDA 2CVZA 2RAUA 4H0CA 4LYGA 1NA5A 4C30A 1GZ7A 2W9XA 1ZJWA 1Y4AE 3W2FA 4RABA 2PRYA 2OQIA 2JGJA 2O8BA 3TD2A 1BH6A 4PF1A 5AKZA 4Y9SA 1UK9A 1I3MA 3K0EA 2RH8A 3K8ZA 4TZTA 3TCXB 2GNOA 1T9AA 3N8HA 4AY3A 4HDAA 1JHRA 4MTLA 1XTKA 4W8OA 3VSEA 4UD2A 4DADA 5A9SB 3M89A 5HF8A 1GT91 2FZWA 1CVLA 4FJ2A 3LAYA 1GZ4A 1UBMS 4QWWA 5EWMA 3U2LA 2RMKA 4OSEA 2R1TA 3ZWIA 1EU1A 1S96A 3STVA 4BLQA 3PX7A 3D5QA 4CLEA 2P5TB 1DEOA 4O02B 2ZXWC 3CAXA 2E18A 4KTVE 4DIOA 4DC0A 1F4LA 4LRTB 4N5LA 1YTUA 4HDSB 1GVHA 2Y68A 1JT2A 4DNFA 3AB3A 4ESEA 3KVOA 4BNDA 1QTRA 2UXBB 3FYUB 2FGYA 1NFQA 3CUTA 2ZJ1A 3JQBA 1L7BA 4Q3AA 4ZAXA 5U1PA 4CUZA 3WB2A 1JSZA 4CKBB 1QF9A 4CIXA 3URMA 1PJSA 2AFHA 5JQGA 1PG0A 1E1CA 4WZBE 4RLQA 3TM5A 2Q8PA 2O8NA 4DR5B 3KTAB 3EIUA 2FZLA 2V7UA 3CNEA 2G36A 3ZKAA 5I4KA 2Q4OA 3CX3A 2A1DD 3V8VA 3Q88A 1YULA 2GJAA 2HSGA 1FRVA 2IPAB 5HDQA 3B2QA 3KEGA 1U65A 4B2IA 4FP9A 5AC5A 1LEHA 2HXGA 1U2QA 2HL6A 1H94A 2J85A 2YXNA 4QPDA 4A82A 1WA5A 5LIPA 3ICEA 1UKEA 2BHTA 1TW2A 3G79A 3MLBA 3HA3A 5KKCA 5M7EA 1KJJA 2YX1A 3JZIA 1Q3KA 2XMZA 1A5TA 4E21A 5IN4A 3LESA 4DBLE 3N28A 3LDHA 1VLJA 2IFTA 1GR0A 1V6AA 3Q7SA 3R40A 4G9BA 2OAQ1 3DLPX 3CEJA 3OTGA 2PD3A 1RQPA 3DOEA 1OFUX 1QYCA 3SF8B 1UUFA 4OAOA 4L0CA 4LXXA 5EJ5A 1NX6A 3THYB 2IH4A 3HYCA 4FDVA 4C7XA 1GCOA 5B1AC 3DMYA 1YQDA 5IFLA 3AOEC 2QTRA 4INPA 1JTFA 2OLJA 1Z0ZA 3X44A 3CE9A 4O4LA 3GPLA 1JPJA 4DJ5X 3KEQA 3ZG6A 3FYHA 5MN5A 1K6EA 2MR6A 5HKKA 1Y7PA 4JUCA 3GFRA 5JBIA 1GFIA 3KAKA 3NYIA 1WMAA 3L0IA 3UXYA 1R0YA 3AF4A 2IEIA 4X1KA 1NFOA 1J4AA 1L1QA 2C96A 2ODTX 1MC5A 1ZHTA 1J7KA 1A8QA 2VNJA 2JI9A 3H0CA 5IJXA 1YB6A 1R8JA 2YWBA 1JLLB 3BAZA 4FYXA 4JSRA 1Y3CE 3KB8A 4QASA 3U0BA 5L0FA 2CB0A 1XIVA 3F8SA 1NBHA 1KVSA 2EJUA 3T5DA 3CUYA 4WDRA 3V4LA 4BKQA 3E5HA 4DSAA 4C87A 1TOAA 4FOTA 4I9NA 2XRHA 5KQRA 3LVRE 5C1OA 1F1JA 2VNIA 3ERCA 1R5BA 4MVUA 4CF4A 4UNNA 4KBLA 1H0SA 1HUQA 1P8JA 5JSFA 5IT9A 4JUDX 2FMIA 3BQNB 3D3WB 4LOIA 2DFTA 2BFEA 2Q00A 4YWHA 2MSLA 2ZJBA 4LISA 1JYSA 2KSFA 3JVUA 2H0AA 3H11B 4KQHA 1ZRSA 4OIOF 3SSNA 1W1UA 3IB3A 4QGAA 1HTBA 1YQEA 3BA6A 4A0HA 3EF1A 1L5QA 4D3YA 3VNSA 4ZN6A 2HM7A 2DBZA 4FFPA 3B9BA 5C7IO 2BFPA 2Z3WA 4EG6A 1ZXLA 5LB2A 2W0SA 3H2KA 3LRTA 1W93A 1SMKA 3JYPA 1G6Q1 3PA8A 3PXBA 3UBMA 3K70D 2FSVC 4P98A 3WGQA 4C03A 4BGEA 4XUEA 1FUYB 2GVDC 2CLOB 1B8UA 2HY7A 1F6DA 3LT1A 3ZVNA 4F97A 3BZBA 1CY0A 2AEEA 3F98A 3DMTC 2B0JA 1TTHA 1X7DA 4IDNA 3ROZA 1XCJA 4TQ9A 2HZ8A 3PK0A 1PJ2A 1INLA 2GPWA 3LECA 4ITRC 4LSWA 3UH0A 3YASA 3ZIBA 4DA6A 4ENPA 3TTWA 3S2ZA 4MRMB 1Z2CA 3W8RA 5EIOA 2HZ7A 3O73A 5KTNA 4RGVA 2IDJA 3E05A 1KE1A 1SN7A 2KBFA 2O3QA 4WCFB 3TGLA 3JZAA 1QS0B 4GRDA 2EIMC 1ZQ1A 3T5BA 3V8QA 1LFDB 3WRYA 1NIPA 2R8ZA 3WWEA 4DLWA 1T3SA 1JAHA 4ZRMA 3M1LA 2HDOA 1ZQ9A 4QAQA 3GCWA 1X2EA 4GUAA 4RIFA 2VQEB 5D91A 2C2MA 3AF1A 3ROXA 3WL6A 1MB4A 3AJ9A 5B7QA 2CVPA 1T0PA 1XNRB 4AP5A 3KB6A 5K3FA 4N0MA 5JXIA 4HN2A 2PRJA 2GN9A 2Y05A 2H2HA 2QAJA 3ZLBA 4EYQA 4E94A 1MPXA 4J16C 3ZTMA 3WK4A 4DEXA 1ST6A 4ULVA 2O7NA 4NL4H 2IGBA 4JHLA 3WLFA 4N18A 4ZFNA 2WWRA 3B3GA 5H70A 1UKZA 4BBAA 4AJ4A 3AR8A 2BF4A 4AG6A 3HLKA 3RUIA 1HFJA 4IV8A 2LIPA 2NPIA 1GOTA 3WLIA 3MAJA 2ZSFA 5DXJA 2H7XA 1H2RS 4C0AC 4M9QA 4UAVA 1A9RA 2G9VA 3MS7A 1K9VF 1SG9A 2HBRA 4S1NA 4MUHA 1KSGA 3TIIA 3SS9X 2OCXA 1P7WA 2O3TA 3FVTA 4PQRA 3IEVA 3LYLA 4K9SA 2WJWA 4HMPA 5ECGC 2O2DA 3CLKA 2XQVA 5HP4A 1W4ZA 4BMCA 1HEIA 3PI6A 2C9BA 3PYXA 1LNSA 1R6BX 2NSLA 1RBZA 4RVDA 2VAPA 4DCOA 1YDFA 5JJIA 5I8WA 1M6NA 3THXB 1C50A 1IXZA 1PW5A 1QIHA 4UCFA 3QVUA 3QV2A 1OR3A 2VLIA 1FLDA 4RPHA 2DE0X 1ZKMA 2ZUBA 5JZOA 3H5WA 1TLFA 3T7RA 3WP0A 3KYIB 2OYSA 5FPQA 2R6JA 1LPNA 1DJNA 8ATCA 1J8VA 3HB5X 1T1SA 3ZDRA 4JVSB 2Q07A 1DBPA 3VA7A 2KI5A 3V5YA 3GODA 3DEKA 3EAFA 1JQLB 2I9KA 3FDIA 3HBLA 3L0IB 1M6VB 4YUVA 4KXQA 1OCRC 4JBYA 3IQGX 1GCUA 1UDCA 4FDTA 4K6KA 5K3EA 3LUTB 1G17A 2IIVA 3DXZA 1LW6E 5HNKA 3KQHA 3NG1A 4H4DA 2NX2A 4ID9A 2FOIA 3TIXB 4IMRA 3EF3A 3T7DA 4HS9A 3MNFA 3K96A 4LV5B 4ZO8A 3HNIA 1LSUA 2P40A 4ITVA 4K05A 1WD7A 2B36A 2IQIA 3TGPA 3Q3GE 2Y6UA 4KXMA 4O2AF 2QY9A 2CCJA 5KNDH 1XRRA 2VXYA 2AA3A 4LX0A 2PIAA 3ADPA 4V3CA 4CHTA 3UNXA 4AUNA 4ZGGA 3JQEA 3NOVA 4DNQA 4WGZA 4DDWA 5ERXA 1NBWB 1VE1A 2GBIA 2J5BA 2OCBA 3RRJA 1P1BA 2IK8A 5JZSA 4LI0A 2QR5A 3REOA 1G7TA 2BGUA 4QU8A 4MQLA 2QRKA 3ZDAA 1E18A 1SXJC 3GBSA 3A04A 4C6TA 3GRCA 2AJLI 4G84A 2WL8A 5ESXA 2OPHA 5JD5A 1GFSA 3LKBA 1UAGA 5AK3A 2JCGA 4Z0NA 4C78A 5CDYA 2J8ZA 2F1RA 1DC8A 3G9UA 4TXMA 4COOA 1QX4A 1N2IA 1E7SA 1N2HA 4GOMD 2XI4A 1JIXA 4LHYA 4Q03A 4RENA 4PYMA 2JD3A 2Z1MA 3UAXA 1TGYA 1KMHB 1F2TB 3ASNC 4HDCA 3MIZA 4NEQA 4D8YA 4LDJA 4RJLA 4DJTA 1BW9A 4YYZA 1Y89A 1O97C 1YL5A 1GY8A 1RHKA 1TCAA 2A9FA 1LPEA 2I67A 4CMHA 4B1FA 3CJTA 4CT0A 3JXEA 1FS6A 1FZQA 3K31A 1GZHB 4BNNA 1LVUA 1YV9A 5KDOA 3ABKC 4TM7A 3FIJA 4AN4A 4JMPA 4R1LA 1A9QA 2AWNA 2UYYA 4CKYA 5LIRA 1UJ6A 3ABIA 1HQKA 3JQ9C 5B1EA 4BEWA 2DF8A 1G3MA 5EJ4A 1Z5NA 1ZJZA 4ZOEA 1U9IA 4FX2A 2O4UX 1L0BA 4MVZA 4NDZA 3AUKA 4HZUA 1UFOA 1YZFA 4CEHA 3QTTA 4GXQA 4OQDA 4A8HA 1E0KA 1H2WA 4BEBA 4KXFB 4O2BA 4Z53A 5DHFA 2J3LA 3P52A 2X8JA 1MA3A 1MENA 1ESCA 2ZDHA 2ZKLA 2BEWA 4NBWA 4YPFA 3QP9A 5FOUA 2B82A 1LNQA 2QXYA 1K0FA 1CJMA 3FWNA 5AYVA 3I9OA 1WCIA 2X9VA 3B71A 2YVKA 3HYTA 3OIWA 4Q5SF 2NXNA 3FGNA 3KBBA 3L0CA 3ST7A 3W2EA 3KSAC 1T3HA 3AFOA 1Z45A 1PSWA 2IXAA 2DUNA 5G40A 1NYQA 3WBKA 1TEXA 2Z5GA 4F2WA 1NW4A 2VTBA 4M9RA 1ESNA 1FTNA 1MCZA 1X3LA 4XWKA 4ZVLA 2HCJB 2QG9A 2QUIA 4ENTA 2C1XA 2XNCA 1U7DA 3CKKA 4P7JA 5EG5A 2Y3IA 3E8MA 1ODLA 2ONKA 1M1NB 1HE2A 2H6EA 2RGNC 3OM8A 4EFNA 1V54C 2G5CA 2VPWA 3HVKA 4ERXA 2OQRA 4PFJA 1NJ5A 3P7MA 3EVEA 1I2ZA 1XNQB 5AH0A 2FZ4A 2IW1A 2JZOA 2C29D 2C5FA 2HGSA 4F2GA 1L1RA 5DBGA 5MN6A 3PX2A 2O9XA 1TK9A 4H27A 4X61A 2EFDB 3FAPB 3L1VA 2VWGA 1XRLA 3B6KA 1CR4A 3NM6B 4DQUA 4Q9HA 1P0PA 1ORVA 2FJPA 4ZYUA 3CZCA 5EMMA 2I6XA 3K1AB 4B8YA 2AYZA 2NW6A 2GZAA 3JQ8A 3ZZ1A 3E3NA 5KNBA 3L6DA 2H1IA 3SXUB 3NKVA 5J5VA 1T01A 1L5SA 5ICGA 1ZW3A 2GSDA 3HYSA 4WNCA 2YJZA 3SE0A 5IMSA 4XJXA 1SOAA 2I71A 4YTEA 4BJ1A 2XDWA 5K51A 4PNZA 4ARIA 1Z7GA 5TQ0A 1HMPA 3AH8A 4W8PA 1G66A 1FVFA 2SKDA 4UDNA 5CT9A 1MD9A 4LRYA 5BUSA 2QPLA 1TDJA 2JARA 3CF4G 4LJSA 2F3UA 2R6CA 3PNKA 3BWDD 3NHFA 4DIDA 4BUZA 1KBOA 1RQRA 1F3LA 1U1EA 2OOCA 3PR3A 5DKFA 1CG6A 1KGSA 2E0IA 4J1QA 4R2XA 1C9DB 1Z75A 1T4MA 2XCLA 3EEBA 1R4MA 3EDMA 3GD7A 3INTA 5J2TB 3U9MA 1H4TA 1QIFA 2RD2A 4ZVKA 3CMMA 3Q15C 3EG5A 2JD0A 3D43A 3D6MA 3EZGA 3KE8A 5HEKA 1ISGA 1T9CA 5DLYA 3JSZA 3ROPA 1WUKS 3FNIA 3M0EA 1YE8A 1BDJB 2CV2A 3ACBA 3NYRA 4K40A 5EJGA 4ZTUB 1K8QA 2RAFA 4KCGA 4F96A 3E9EA 2B25A 1NJ2A 4NNJA 4LMBA 1JG3A 1RC8A 1XE3A 1NXWA 1LKZA 3RV3A 4IRUA 1CDOA 1S2MA 3UAWA 4BY9E 5DT2A 4CM5A 4XIGS 1X0XA 3TOSA 3OH8A 1TCVA 5CGQB 2KGOA 1Y1LA 4FBMA 4ZIRA 5LA6B 1WXIA 3MS2A 4H08A 4ZT3A 1XWWA 4AWAA 1ZN2A 3CWQA 3N1UA 2WW8A 4CODB 4U2KA 3J81A 4YIKA 1SYQA 5E6RA 3GAFA 4KO2S 2IDZA 2UZ1A 1M1XB 1DAOA 4UDOA 4LF5B 4ICIA 4AB1A 3OEEA 1CUAA 5IP5A 3K9LA 1C9KA 1W85A 1LPSA 2ZVJA 1L7CA 1FVHA 2PVPA 2VCEA 2V6GA 4OLHA 3A3KA 5IC5A 4Y9UA 3X1JA 2A5LA 1N9ZA 2J9WA 4JJAA 2NZ8A 4N39A 4F3KA 2D0DA 4GOOD 4XGNA 3WNBA 3X2QC 5P8WA 2XE7A 2QAGB 1FPQA 5HFNA 2H2WA 4C3EA 1J09A 4Q9NA 1U99A 3KYCA 4QPPA 5CDSA 1VKZA 2IXMA 2VYQA 2C5AA 4HSGA 1Z5PA 1TJPB 1Y48E 1G42A 3CZMA 1CUZA 2H1VA 3SYMA 2RI6A 2WEKA 4YREA 2CBZA 4B5KA 4BTVA 1FQJA 4F6RB 4WV3A 5FJIA 2M64A 4KX3A 3HJTA 3VSAA 5KNCH 3IDFA 4EPXA 1VA4A 3QWHA 3GC6A 2A5GA 3Q2IA 2R7VA 4M49A 2D7JA 1JFRA 2RHMA 1VSBA 2V5UA 4N47A 2PR7A 4G36A 2BM9A 3DZAA 2FEOA 2NVOA 4WOKA 4D7AA 1E59A 3NAMA 1Y80A 1PE0A 2PA3A 1HV8A 5A4IS 4BNDB 4DQLA 5KX5A 4BVGA 5BN3B 1N0VC 2FPKA 4UU0A 5IXJA 1KH1A 4GBJA 1RRCA 3F67A 2HJWA 2OYRA 5TMBA 3SLRA 3TX6A 1U2ZA 2WJHA 4P81A 1MO5A 1P44A 2H2FA 4RJKA 3GPIA 2QLMA 1XG5A 2VPQA 4J0FA 1S3IA 4JNCA 1ECBA 4PNEA 4R1PA 1VMDA 3L84A 4OHFA 3Q1KA 3EDOA 5H3CA 1TTQB 2SHKA 4D81A 3I5YA 3D4OA 4HEJA 1I7PA 1LRLA 3EF0A 4AXBA 1I30A 3QLJA 5F9MA 3FVRA 1W94A 3EGXB 1QBGA 2MYPA 4TMFA 4UHEA 1DJMA 2H7BA