5L3VA

Structure of the crenarchaeal srp54 gtpase bound to gdp
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
291
structure length
291
Chain Sequence
ENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Signal recognition particle 54 kDa protein
publication title Structural Basis for Conserved Regulation and Adaptation of the Signal Recognition Particle Targeting Complex.
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 105
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5l3vA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5l3vA02
3UWOA 3WNBA 4FMDF 4WZBE 4NONA 1E9AA 1KJYA 1XD2B 1T0HB 4KVGA 4KFSA 2R9VA 3GD7A 4AG6A 1FTSA 1ZNYA 1D9ZA 2GESA 2CJWA 4P4SB 3GJ0A 3AUXA 3HPQA 4AWXA 1Q1QA 2ZEJA 3ASZA 1AA9A 1JR3D 1XEFA 3SQWA 3NDPA 5A4JA 3AGQA 1VG0B 4Q7JB 5DI3A 2HYIC 1SVWA 3SNHA 4B32A 1X8LA 3ZS8A 1E2GA 1MR3F 2VHTA 2CCKA 1UJ2A 2RGNC 3DPUA 2JDIA 3CX7A 4LV8B 3TUJC 3ASYA 1TEXA 1ZUNB 4JL6A 2C98A 4PFSA 3FKQA 1N5LA 5CJ2A 3PIRA 4YDHB 4A36A 3P26A 1Z07A 2JATA 2RGXA 3QPWA 4AG5A 5KSOA 3IIJA 2MSEB 2CEAA 1CR2A 4HDQB 5A0FA 1XRJA 1YZGA 1FZQA 1ZNWA 3QENA 1TQ6A 2GEUA 4HDCA 1R7RA 3FTQA 1TPZA 2C99A 2EWWA 2IYRA 2P5TB 4MRPA 2QP9X 2YJTD 3B85A 3QEJA 5KSPA 3SZRA 2JGNA 4QKQA 5FOVA 1NN0A 4MQBA 5EE3A 2J7PD 2GJAA 2ZI3A 3CF6R 3PXGA 1W4RA 5L3VA 2J0SA 4X8LA 2NIPA 3IQWA 3SBEA 5DHAA 2JCSA 2FWRA 1IHUA 1W48A 4NP6A 3W5IA 4Q9JA 3VTKA 4E5UA 3EWSA 4Q7KA 2Z4SA 4K46A 5J4KA 1EWQA 3FMIA 1UDXA 3B9PA 3U44B 4FCTA 1FNNA 3SJBA 5IRCD 2JLYA 2QMUA 4D0GA 1J8YF 4KBGA 1DG3A 4V02A 1FQJA 2GAOA 5GVRA 2GZDA 4HI0E 4TL7A 5AWFC 1NSFA 1DBSA 4U00A 5AUNB 3PITA 3SE0A 3KQLA 4JJKA 3IHLA 2CNWA 2JJ1A 1B0UA 1GTVA 1GUAA 4B6FA 4MDFA 3BD9A 2BVNA 3H2YA 1RKBA 2A5YB 1E1RD 1YZUA 2V54A 4H1VA 1M74A 2YC2C 2A5DA 4KFUA 5EZ6B 4KLZA 4ACAA 5KDLA 3Q85A 1IY1A 4OKSA 2KBEA 4OK5A 4V0LA 5C46F 2VP9A 3EZ2A 4M4SA 1Z22A 1P9RA 2Z4RA 3B6EA 4UXHA 5FTKA 4DKXA 4N1AA 4OI4A 3O8CA 3RVBA 2ZE5A 3LBIA 4V03A 3CF2A 2BBSA 4BLRA 4DJTA 2O5VA 1WXQA 1X1RA 2A7QA 4FMBB 1DS6A 4LOAA 5JJLA 2ZSBA 1W46A 3O8BA 2GCPA 1KI9A 4RZ3A 2UZIR 1E79A 2QE7D 2VIIA 3QJYA 2GEDA 1SVIA 5KO2A 5CITA 2NZ8A 2VP2A 1MT0A 2R6AA 2WSSD 3OAAA 4LBVA 4OI1A 1OIVA 5TV2A 1SVMA 1JAIA 3MMPA 1AZSC 1AGRA 4ASUD 3T34A 5CM8B 4OHVA 1GOTA 2J0QA 3A1TA 2R2AA 3G5UA 1XWIA 3B1VA 3EG5A 3GLFE 4ZIRB 2H1LA 2DB3A 2IS4A 1L4UA 3GLGE 4TMZA 2PCJA 3K0EA 4RD1A 4S35A 2R6FA 2IUSA 2QMOA 4UQOA 4HDOB 1QG2A 1UKEA 1JXMA 1T5LA 2W6ID 3CPEA 4QHSA 4D80A 4F4JA 3ADKA 1C4OA 2AK2A 1LVGA 4DCNA 4OBEA 3U3RA 1DAFA 1YZNA 2ZROA 4NCIA 4JYBA 4UJ5A 3IQXA 1QHSA 3AF4A 3ZS9A 3JVUA 3L82B 3NKVA 1S3SA 4ZI3A 4C0JA 1E0JA 4TWZA 3U7HB 2PLRA 1E2NA 3HYTA 1PZNA 2QG6A 4Q9HA 1OXTA 1V43A 2V4ZA 2YWEA 3KTAA 1VMAA 2YV5A 4BUJA 5JWHA 1O87A 1A5TA 3BRWD 4CEIA 5AUPB 3LBHA 4NPHA 2ZSFA 4QBHA 1VCMA 1WB9A 1PJRA 3P32A 1VCIA 2EYUA 2Q0HA 2ZTSA 1XTIA 3UPUA 3C41J 4TSFA 5BN3A 3OFND 4ABYA 4TL9A 4E07A 3A4MA 1NRJB 1YKSA 4QNRA 3VAAA 1CEEA 4PR0A 1LF5A 4A8JB 1HE1C 3NBXX 2WKRA 1EFUA 2F3TA 4UJ3A 5EP3A 2NO1A 3GJ4A 4GI7A 4QM7A 4R71A 2EW1A 1ZM4A 2NPIA 2ODEA 5DN6A 3EPJA 2REBA 2FPLA 3LQRA 4O2LA 5IK2D 2XSZD 2IYVA 1A4RA 1W2GA 1QDEA 2HJGA 4Q9KA 1NVUQ 4QL3A 4NDZA 5JZVA 2EVWX 1S4QA 3EIQA 4ZDKA 1IM2A 5CB8A 1HV8A 1P9WA 4IXMA 4LDJA 4GT1A 2KI5A 3ZVMA 4K8OA 2P65A 1KDRA 2PH1A 3IGFA 1QHHA 1W44A 2HF8A 3U4QB 5EJEA 4PTLA 1ODFA 2FSGA 4HLQB 4PSKA 1MV5A 5JRJA 3FMPB 4PAMA 2ZI7A 4TMTA 1QHIA 3FB4A 5C4GB 4L5BA 4UNSA 1AN0A 4PC1A 1U98A 1XCPA 2C78A 2R44A 2V6JA 2GTPA 4JSYA 4OJQA 1U2RA 3B82A 3GFTA 1VYTA 2GXSA 2R6CA 2GWHA 4LYAA 3ZIAA 4B76A 5H70A 4KSBA 2RGDA 4Q66C 1OJLA 2X2EA 3QXHA 5BXQC 3ICEA 1OLOA 2ZRIA 2L0XA 1XMVA 2VTKA 3THWB 1ZUHA 5CDFE 2C77A 3R20A 4KCGA 4LHXA 5B57C 2QBYB 1VHTA 3ADCA 1OXSC 3W3AA 3ZH9B 4C7OA 3DM5A 2CVFA 5EE5B 1BS1A 1JI0A 1EG7A 1P73A 2FGKA 4Q1CA 2GK7A 1KI7A 1WDTA 3O8RA 4XVRA 1XCMA 1TQDA 4Q1EA 1OFHA 2FFAA 1Z0DA 5CYOA 3K0FA 3PVSA 1KI6A 1JAHA 1EFCA 1NL3A 3AKEA 3RS0A 4BFUA 1Z29A 2QRNA 3GCGA 3KJGA 1U99A 3DKVA 1ZAKA 2J7KA 4Z8YA 4OHYA 1N2CE 2WMOB 4WVFA 4A9AA 4MDEA 4GL2A 3PEYA 4URWR 2GZHA 2FNAA 4XOIA 5B2ZA 1M6NA 4XWKA 3BS4A 2YZ2A 4DSNA 3K1JA 4LJ7A 1KMQA 4B34A 4IDHA 4GOKA 2C5LA 4P3YA 4M1MA 2GEVA 4RY2A 221PA 1RW4A 1TADA 3GJXC 1Z28A 2V8OA 1Z0AA 2GVZC 1JPJA 4LJAA 3I8SA 3TGPA 2ZAMA 4XSHA 1VG1A 5K8TA 3SQXA 3K0AA 4M1YA 3LRPA 2WPDD 4AKGA 1XEXA 1GAJA 2WJHA 3EXAA 4QG7A 3WHLA 2JLSA 4LJ6A 2QAJA 1CRPA 5B58C 2BMJA 1S9DA 3IPXA 2HT6A 1RRGA 2FPMA 3PUXA 1XXHE 4NYIR 5F9HA 4LZZA 4US1R 3WRYC 1XTQA 3RDPA 1P6XA 2KB0A 3X1XA 2FOLA 1ZP6A 2IXGA 3TRFA 4Z1MA 3VU9B 3KQKA 2JLXA 2P67A 1F2UA 2BMEA 4II7A 4TT3A 4I99A 1G1MA 1OF1A 2QT1A 3BB1A 3T5GA 1A1VA 3C15C 4JZKA 2ZYWX 4RKFA 1T4GA 4Q4HA 2GNOA 3I4LA 3ZD6A 1HT2E 1QG4A 1LNZA 4BFYA 4IOMA 1Q1ZA 4YXWD 1G19A 3GJ8A 2H92A 1GL7A 3EC1A 3K9NA 4ACBA 2HT1A 1CXZA 2IYYA 2WKQA 2CE7A 3PEWA 2W83A 2O8CB 3D7MA 4W9MC 1CJKC 3UG7A 3AP2A 3OEEA 3R7WA 1YZKA 2OE2A 4S2EA 4CEHA 1G8HA 1GRRA 3AEZA 4FWTA 4Q02A 4A4DA 2ZJZA 2HLDD 2XTNA 2C9CA 2ZRKA 1ESNA 3EW9A 2IYZA 1G18A 1ZM9A 2QPAA 1KMHB 2W0MA 2WWHA 2WZQA 3M0EA 1SHZA 5GJVC 5AK0A 5C4MA 1J99A 4HZUB 3TSZA 1DELA 2ZE7A 1WE2A 3K9LA 4ZDIA 3QG1A 3AKCA 5K8LA 1BIFA 3AF3A 2BEKA 5FH9A 2YOHA 3GQBA 2OXRA 1GKIA 4TQ9A 5GJWC 4MUBA 4N3NA 1E69A 5GVSA 2R65A 5KSYA 1D5CA 4DBLC 3EZ6A 4H9GA 1ZMXA 4J0QA 1L8QA 1TF7A 4ZCLA 4D4KA 3KKOA 3B7GA 4PO9A 3GLFB 1U0LA 1II0A 2IK8A 2H8KA 4B2LA 2IHYA 3GLGB 3ADDA 1N5JA 4KVAA 2OEPA 1IONA 4PO1A 2WBLC 3O47A 5KOYA 1G3MA 4L8GA 3PCRB 3KQHA 4IEIA 1AQYA 3SHFA 1N0WA 4PO8A 1HE8B 3NTUA 3WYFA 2ZRFA 4O0MA 2ZU0C 4LCBA 2RH5A 1SXJE 3RC3A 1F60A 2D74A 4Q7MB 2GCOA 3VHLB 3SBDA 2BEJA 1DPFA 3U3JA 1MO3A 3I62A 5HZKA 2J0VA 5FPTA 1M2OB 4M9ZA 3CRQA 2ASEA 2D06A 1HURA 4KYUA 2IYSA 5FTNA 4EQ6A 4F7WA 3IUYA 1JPNA 4QHYA 4PSVA 3SC3A 2G0TA 4ZV4A 5CJPA 4Q5IA 1GG2A 3A1VA 5H1YA 4G01B 4LUCA 1IJFA 4X8HA 2GDJA 3RS4A 5JI3E 4M53A 1NBMD 3UG6A 2AK3A 2IF0A 4P4SA 2XJ4A 3DVLA 2AKAB 3QF4B 3RSOA 3SFVA 1UKVY 2QPTA 4EJSB 1VYVA 1W0KD 2HEIA 1NBME 4AYXA 4UXJA 1JXOA 4DUGA 1PLLA 1ZC3A 5G3ZA 3IHWA 3QPUA 1PLJA 3OE7A 4NHOA 1E2IA 2RGBA 3EPHA 1P75A 3H4MA 1GP2A 1XF9A 5HCNA 5EUMA 2IS2A 1FPMA 1NJGA 1AZTA 2F43B 2P0EA 4MGIR 3VNVA 3CPHA 4JLNA 1KSGA 2OCBA 3ZJYA 1E32A 1GILA 2O0JA 4RFVA 4JLOA 4DCSA 3ZVRA 2YC4C 1U0HC 4ZPXA 4G0NA 2XZOA 1G5RA 4FINA 1CS4C 4AKEA 1P2VA 2HV8A 3VKWA 2BCJQ 4ZCMA 1E1QA 3W6PA 3L43A 2JJ2D 4Y0VA 1GNRA 1VG8A 2EQBA 2ZYTX 3CONA 1AS0A 1IN8A 1GL6A 2ZS8A 4PZZA 4M21A 5E7MA 3A37A 2ZI9A 5HTKA 4V0KA 1DAGA 1E9FA 1Q44A 5EP1A 2C8VA 1QHXA 4BLOA 3NBYC 3NC0C 4HAUA 3H86A 1H65A 5JHGB 1BKDR 1CU1A 1GITA 2ERXA 4WBSA 4DLWA 3KQNA 3B78A 3P1JA 3GLHE 1F5NA 3MWYW 5LB4A 3ZVLA 3MGCA 1TNDA 3AH8A 1US8B 4WAUA 1X8KA 3V9PA 3U61B 2JLUA 1E2LA 2CK3D 5FUVA 4ZO4A 3GJ5A 1MO4A 4UXIA 4TYQA 1EFRA 4M2LA 1NMYA 4DLXA 4PQFA 1GSIA 2QGNA 1GNQA 4QGAA 2QUZA 1UEJA 4XH9B 5BN5A 3LDAA 4HUQA 1ZM2A 2ZQ5A 4YMUA 2DFKB 1Z6YA 3E5HA 4QXAA 5SZIA 5E4FA 4TMXA 5FTLA 1OIWA 4XSGA 1JALA 4HB3A 3HR8A 2XTZA 4NTZA 1ZRHA 1JJ7A 4JS0A 3X2SA 3DDCA 4IFBA 1ZD9A 4CRWB 1SQ5A 2ODWA 3HWSA 1NN1A 2OFXA 1W2HA 4GOJA 2REOA 5FOUA 5JBQA 3THOA 4Q4LA 1N5KA 2V55B 3A36A 5FPHA 2OUKA 4KBFA 1R6BX 4ZKDA 5CK4A 3KZ1E 4BLQA 2CDNA 3BE4A 4LJ5A 5HZHA 1G3UA 4AI6A 2O0HA 5B64A 4MYHA 2QAGB 1Z6GA 5BYJA 2EU8A 4GSYA 1UF9A 2VA8A 3F8TA 4CT4B 1P3JA 3KFVA 4LV6A 4WOPA 2JEOA 3QKTA 3RRMA 5BW8A 3NHBA 1Q20A 2F1IA 4W5HA 2WM9B 2EFGA 4IHQA 4PPGA 2ZUCA 4Z54A 1OH5A 4ZIRA 2ZRGA 1FOEB 1KKLA 1S8FA 1XCGB 2BHRA 1S9HA 4Q01A 2GZAA 4A6XA 3REFA 3WXMA 3FFBA 3SYNA 4TMVA 5GJBA 4H1UA 4U5XA 4LJ8A 4U7DA 4TTPA 3AKYA 2RHMA 4C3ZA 3A1UA 1J90A 2FJUA 1AGPA 2JDID 3KKMA 2C04A 2CL0X 3EARA 2GJ8A 1MABB 1ZD8A 4PHFA 1KAOA 3FKSA 2YNMA 5FR2A 4P31A 1TU3A 3R9XA 2GBLC 5EXPA 2XNDA 4M0LA 4DLRA 2OLKA 1J7KA 2W6JA 1Z0KA 5AJWA 4TYWA 2ATVA 2KBFA 4DRZA 2PZFA 1TAGA 2I1VB 2WWWA 3HJNA 4QHTA 5FUYA 4B3BA 2HF9A 1ZW6A 1R0ZA 5BQ5A 3THXB 1LY1A 2AR7A 2BDTA 2QA5A 2Q3FA 5EZ5A 3L8YA 2WIAA 2ZJ5A 5J4HA 1G64A 4KO8A 5E95A 5CM9C 1R0WA 2NO6A 2ZYVX 1AS3A 2AKYA 4NMMA 4EFLA 1Q1BA 2XXAB 2IT1A 3L8ZA 1SZPA 3I5YA 2JJ8A 4O25A 4A8JA 4DDUA 4A2WA 5EP4A 1MO6A 4YDSA 1LB1B 4DLSA 4DLVA 2VH5R 3LBNA 4IW3B 3QKUA 1MO5A 5L3RA 3AQ4A 1E3MA 1J8MF 1K5GA 1UAAA 2CNWD 2JJ1D 5LPNA 3PFIA 1KO8A 4F91B 3CB4A 2PX0A 3C4JA 1N5IA 3VR4A 1JR3E 4M1KA 1KDPA 4IDNA 4UNNA 2V9PA 1E2KA 3LVQE 1Z6AA 2C96A 4NYJR 3U2QA 3U7FB 3AVVA 4A8JC 4W5WA 1KNQA 1IY0A 1A2BA 4KV9A 1W36D 4RFSB 5JSZB 3PENA 1IXSB 3RS3A 1AQUA 2ZRDA 1CKEA 1GIAA 3U4QA 1OHHA 1KK1A 3KJEA 4HB0A 1R5NA 5D3QA 1SXJB 2IYLD 3UMFA 1G291 2AD1A 3NBZC 1E79D 3T1TA 1LF0A 4JT2A 3R8CA 4HATA 3MWKA 3CLVA 1VG9B 4B74A 4ZDJA 1Q3TA 3AVXA 1G8FA 2GJSA 4LYHA 4NCNA 4LYJA 3ZZUA 3OAAD 3GFOA 2UKDA 5AJVB 1DAMA 2VEDA 3PUWA 5KTYA 1UBGA 2GK6A 1G3RA 3THWA 3SOPA 1R2QA 2Q9AA 2QBYA 3T1VA 3EIEA 3ZGXA 5A5GA 1EGAA 2QORA 1RRCA 1COWA 3I1FA 5FBVB 3S1AB 1FFHA 3A1SA 4E03A 1GZSA 3CUEF 2ONKA 5KDDA 3VX4A 4ESVA 1Z08A 2WWGA 3NXSA 2W2VA 2OHFA 8OHMA 1NF3A 4HUQB 1XP8A 4IDPA 1OKKA 2QZ4A 4BGDA 2QSZA 1HQYE 1T3HA 4EPRA 1IY2A 5KDOA 2OCYC 3GJ6A 5JCZA 1BOFA 1IXZA 1WA5A 2AN9A 1YQTA 1KI2A 3O8DA 5TY0A 2PEYA 4LJYA 4E22A 4AYWA 4QJ3A 4A0RA 2VO1A 1XMIA 121PA 3BH6A 4QNMA 1MOZA 3TMKA 2GXUA 3B9QA 3EPLA 3MUFA 1IOZA 4CT5A 3J81k 2ZS7A 1DG1G 4NZYA 4TTQA 4EKDA 4L9WA 5TB5A 3LXXA 2VSOA 3TVDA 3WNDA 2Q21A 3IO3A 2OO7A 2XGJA 3T15A 4HAYA 4IKEA 2D62A 2VPPA 4FW9A 1FP7A 1G4AE 4AKHA 1GL9B 1CTQA 2O8FB 3PG5A 4GP6A 2GXAA 4RCZA 3IDQA 2G1JA 4TSFD 3NEYA 3CKLA 1D2EA 2EFDB 4B47A 2OG2A 3F0TA 3I72A 1DAKA 2RGGA 4DSOA 2FEMA 4B3CA 1UKYA 4MGZR 5DSZA 2ZRHA 1SVSA 3VU9A 4BQSA 3TIFA 1TX4B 1Q12A 4A0FA 4LGMA 3GLHB 2F1HA 4DVGA 1T5IA 2A3RA 3BK7A 1KO4A 1AM4D 1QF9A 2XOKA 4TL8A 1YJ5A 1VIYA 2J5XA 2OT3B 2ZJAA 2ZJYA 3P27A 2ONJA 4MYUA 4RZXA 4EIWA 4DLYA 5DN6D 5J4VA 3QSYA 4JSTA 4A2PA 2IYTA 2PBRA 5HKKA 2R8RA 4MRRA 4XWAA 4UNRA 2FSIA 2ZITA 4LI0A 4M9XA 721PA 5JHHB 4EPXA 2DCUA 1XZQA 3HPRA 4JLAA 4TYNA 4R7ZA 1W4CA 1QZXA 4A92A 1Z06A 3B13B 2BKEA 3AVWA 1OT3A 2WOJA 1YE8A 2O8CA 4WA7A 4XJXA 1E1RA 3WRXC 2E1RA 2WKPA 4D0NA 5UKDA 3EPKA 2Z83A 4C0HA 4LJ4A 1G8GA 4BEJA 3T1QA 4D82A 3R9WA 2GVDC 3QXJA 5SZKB 4F4CA 2P6RA 4FI3C 2GAAA 3NH9A 1G7RA 4MH0R 1NY5A 4BWYA 5FL7A 1RJ9B 3I3SR 3K8YA 4D6PA 1VCOA 2QNRA 1A2KC 4C2TA 1U8YA 2XX3A 3VMFA 1HH4A 1KMHA 4ITRC 4B48A 1DEKA 2WOOA 1BH2A 4TLAA 4BPBA 3GFPA 4HZUA 2PLFA 4Q1AA 2VP6A 2ZS9A 2AFIE 3FE2A 3OIWA 4I1UA 4JMPA 5FTMA 4EUNA 1ZNZA 3KKNA 3KKQA 1XB2A 2YWFA 3M6AA 3TBKA 4UNPA 3KX2A 1ELOA 1XZPA 4JVMA 1G8PA 2X19A 2ZRAA 1CJVC 3ZZTA 4F92B 3L0OA 5G40A 1OFUX 3EC2A 2PJZA 1D2MA 4FMCF 4P0TA 3GLFA 1QRAA 2Q3MA 2WSSA 1AS2A 4L9SA 5CB6A 1OE0A 2X2FA 3B1WA 3ADBA 3GLGA 1GKYA 1NVXQ 3W8NA 3DMDA 1W4AA 5KNBA 4F93B 3U60B 2I4IA 3AB3A 2KJQA 2ZRCA 2CCJA 1EFHA 1KY2A 2BJWA 2JIZA 1AK2A 4TZ6A 4V0ME 4JBWA 2CL6X 4MKHA 1XEWY 2VBCA 2ZRBA 3MWLA 5JECA 4C2UA 2ORWA 1RYHA 4JJZA 3Q72A 4RKEA 3T1OA 1OFTA 1G41A 2J9RA 1E0AA 5FBWB 1LS6A 5K8UA 2CXXA 3SYKA 4NH0A 3ZVNA 3I92A 4POAA 3NWJA 4P4UA 1SKYB 4YONB 5DO9A 3QOFA 1IN7A 1WMSA 3JZMA 2V1UA 1XPOA 2DY1A 2ZSDA 4HSEA 2QENA 4PAOA 5TARA 4JL5A 4RD6A 2WWYA 1U81A 2ZXUA 5J5CA 4D25A 5FR1A 4LBYA 1ZM3A 1VHLA 1E2DA 2BKUA 3W6NA 2O8DB 2VHQA 2GF9A 3VR5A 1HUQA 4OK3A 5C1BA 4B33A 2G0NA 3VR6A 1WBBA 3QF4A 4JLJA 1UBFA 2QROA 4QBFA 4QBIA 2EFHB 1Z83A 4B3FX 4URVR 4Z1MD 4EJSA 1G6OA 2WICA 4B73A 4C9BA 3WMGA 2WSMA 4TT3D 2DWPA 3DL0A 4BZQA 1T3SA 1U9IA 1F6BA 2YOGA 2A5FA 3WY9A 2ZRLA 1OB2A 2FDCA 3FPAA 4AK9A 3IEVA 2B7BA 2FN4A 3M1IA 2ZANA 4WXPA 2N42A 5HE8A 2F43A 4CEJB 3IBGA 5IF9A 2BM1A 2P3SA 4Q21A 5DLQC 3ND8A 4HLUC 4I4LA 5JRZA 4O3MA 1T3LA 4TL6A 4C0BA 2CHGA 3CRRA 4EJSC 1ESMA 1T0JB 2V6IA 1P4SA 1KJZA 3K09A 4NCKA 1N0VC 3T5DA 3HU3A 1YZQA 1NG1A 1NI3A 2NTYC 3LW7A 5JEEA 1Z63A 1WGWA 5H68A 4GZLA 1U9IC 3OEED 4QRHA 4AURA 2Q9CA 4DEXA 4FXPA 3DMNA 3CNOA 4CGZA 4OHXA 1G7SA 4P4TA 1IAQA 3IEUA 1H8EA 4TQAA 3BH0A 4YMSA 2LCFA 3I61A 2BWJA 5CYPA 5JJKA 1MRNA 1N6RA 2ZE6A 4L15A 3AV0B 1G5TA 2PL3A 2FE4A 2C9YA 4C30A 1US8A 3K09C 2ERYA 2AXNA 3QIAA 3U3MA 3K70D 5LD2C 2CCGA 1BMFA 4O2RA 5EP2A 1G21E 2D7DA 3NG1A 2QQ0A 4LPSA 1Q21A 5HE9A 1E9EA 4IJMA 3RSLA 3TAHA 1DE0A 2W2TA 2KWIA 1VECA 5CDFA 1XMSA 1TEVA 5JFGA 3ONWA 4JLKA 1E9SA 2IWRA 1ZCBA 1XJQA 4BASA 2F9MA 3WYGA 3EASA 5EE9A 2UVQA 2BM0A 1E2JA 3CZPA 3LW8A 1TUIA 2ZU6A 2ZRNA 2FMXA 3BWDD 3HDTA 1OW3B 4TLBA 4TYPA 4DDTA 1P2TA 4KYIB 4NCHA 3PUYA 5JJIA 2ZRPA 3L0SA 1PUIA 1CR4A 1E0KA 1DAIA 1II9A 1NY6A 2G83A 2D2EA 2IC5A 2IWHA 5IDVA 4MYCA 4NKRA 2WWFA 4FMDB 1CR0A 2Z5FA 3AVUA 1TU4A 3ZZ0A 4DXAA 2OBMA 3AVYA 3ZD7A 1KSJA 1XX6A 1MH1A 2ZRMA 2QAGA 4LHWA 3NBFA 1GKUB 1RRFA 4FWIB 4BRUA 4Z51A 3QNUA 1P60A 2XB4A 4KI0A 5KSZA 1WP9A 1R5OA 2ZE8A 4PX9A 1TF5A 5DI9A 2O8EB 1RVDA 4WW0A 3NIBA 3FMOB 4Q03A 2PX3A 1XPUA 1U8AA 5FFMA 2H7VA 1KY3A 1N6IA 1M34E 1DOAA 1T6NA 1VPLA 2YVUA 2V7QA 1KK3A 1MKYA 1Q1EA 3EAQA 4PQYA 3TJZA 4DC9A 1TQ2A 1JB1A 3RWMB 4OQNA 3UMRA 4JLMA 2HCBA 1SULA 4XIGS 4B43A 2QAGC 3C5HA 5G41A 4DUGD 2QQEA 2Z6VA 4QGHA 1HQCA 3OE7D 1KAGA 3CIOA 4MGYR 5IHPA 2I3BA 5JLJA 1R10A 1N6OA 1OH6A 2ZJ8A 3BOSA 4US2R 1D6JA 2FFQA 1MABA 3T06B 5D3MB 4Q9IA 3CRMA 1F3OA 2KSQA 1KO7A 2JLWA 3ICQB 4KHZA 3GLIE 2ORVA 4BRWA 4TTRA 2Q9BA 2O8BB 2W2XA 2ZAOA 5FBLB 3CNLA 3SDZA 3I8XA 4D0LB 2FPKA 1O3YA 3IBYA 4M8NE 3RLFA 1W47A 3RRYA 1E1QD 1J70A 2DWQA 2WVJA 4OK6A 3THXA 4ZDWA 3OEHA 4NYIQ 1R8QA 4MKFA 1G20E 2QRZA 2QEQA 2B8TA 2WJYA 3AP3A 1KI4A 1HTWA 4G5OA 4R2IA 2GXQA 2GJKA 1JNYA 1I4TD 1NP6A 4M1WA 3SI7A 3WP0A 2HXSA 2AD5A 4KFRA 3BB4A 3TKLA 2XXAA 1XD9A 1CJMA 3PUZA 4UNQA 5LDDC 2AXPA 3U3OA 2BMDA 3NDBB 2FH5B 4RJLA 2NO9A 3ZYCA 3KUCA 4YLGA 3ND9A 1SVKA 4LV5B 4M9QA 1W0JD 2C95A 4DLTA 1E99A 4BZXA 1EFRD 3CR7A 1ZIOA 3TE6A 2ZR7A 5EUQB 2YWGA 5F3WB 2DYKA 4FCVA 2ANCA 1Z47A 4DCVA 1G7TA 2RKOA 1R0XA 2B8WA 3AKDA 2FF7A 3DO6A 3LLUA 5KNCA 1D8TA 2P6NA 1YU9A 2G77B 3KB1A 2HYDA 2FSFA 2UZ3A 3PR1A 3QQ5A 3W3ZB 2ZREA 2RAPA 3CX6A 4XD7A 3W90A 1NKTA 2AFHE 4AKIA 1R4AA 1LFDB 3F5FA 2H16A 5GJCA 4HAWA 4DCUA 2YKGA 4DT1B 3KUDA 3U44A 4RFSA 5JSZA 2BV3A 5LD2B 1Z5ZA 2FSHA 4PHTA 1V5WA 3CPJB 2XEXA 3KXLA 3K53A 1SXJA 4DDVA 1CF4A 1GVNB 1FP6A 4I1OA 1JQJC 2BBTA 1DAEA 2XZPA 3WNCA 2Z43A 1FNMA 4Q7LA 4HEJA 2G88A 2Y8EA 3U7EB 4MITA 1FW6A 1JBKA 2FFBA 1L7VC 2JLVA 2PMKA 3HR7A 1Z0JA 3EZFA 3ZLJA 4IOJA 1KKMA 3FHTA 1M1YE 3LX8A 3A4LA 1CBUA 1R0YA 3CRVA 3BJIC 4M1OA 3VR3A 4B3GA 1LS1A 5E7JA 3SU8A 4B3DA 4PHHA 2A5JA 4PPNA 2IS1A 1E94E 2VL7A 1HEIA 3KL4A 1VCNA 1SHKA 4AY2A 3S1AA 4PSAA 1SXJC 4G5RA 2DBYA 3X1DA 1E9BA 4Q4JB 2IBMA 2IEYA 2VRWA 3IIKA 5LB2A 2JLZA 3G0HA 4OYHA 1KO1A 4JBYA 4BFSA 5FI1B 4A1FA 3D6TB 2G1KA 4PXAA 1NBMA 4TMKA 1VTKA 1ZYUA 2J0UB 3TVTA 1RFLA 821PA 3TAUA 1FX0B 4Q47A 3CM0A 1S3GA 4LSGA 4DDWA 1OXVA 3FKSD 3AF2A 3GJ3A 3AF0A 1RIFA 4Q4AB 1PUJA 2OCAA 1GM5A 4AD8A 2XNDD 2G3YA 2XITA 1E6CA 5J47A 4LC0A 2W6JD 2IYWA 1NIPA 1L2TA 1T91A 4IEEA 1P62B 1W1WA 1Z2AA 4I81A 4Q19A 2O8FA 1KO5A 3D31A 1XDBA 1XTRA 3RNLA 2QM8A 3BFVA 1XD8A 2WTUA 1NSTA 3K0CA 4FMCB 2OLJA 4BLTA 3C8UA 4W7SA 2B6HA 1X6VA 5DH9A 5DYIA 4JLDA 5FUXA 3A8TA 3JZAA 1F2TB 1X1SA 1N3BA 2GBLA 1E9DA 2QL6A 1UEIA 3L2OB 4IDQA 1XXHB 5L3SA 3EA5A 521PA 4DEYA 4JLVA 3DOFA 3GLHA 1E2HA 4XVQA 4ARZB 3DHWC 4CYMA 1E0SA 1OH7A 4KFTA 3UMSA 3FVQA 5GADl 4HAZA 1N6PA 2A2ZA 2X8AA 2LKDA 2ORIA 4I1SA 1Z0IA 4Q1FA 2BC9A 3TLXA 3K0CC 1K5DA 2VHUA 3KJHA 4LWZA 2F9LA 4BFZA 4ZCIA 1GFIA 3MJRA 3QXXA 5F9FA 5CLQA 1D9XA 3QKRB 4BZPA 1DO2A 2CK3A 1WBDA 4URUR 1KI1A 1EX6A 2JLRA 3MD0A 4GDFA 4QM6A 3VKGA 5JS7A 3NHAA 4LK2A 4P33A 4F38A 1ZM7A 1OIXA 5JEDA 2CHVA 2ZIAA 4JLBA 3VQTA 1NLFA 2EYQA 1OHHD 2PEZA 1II8B 2WJJA 1WCV1 4PHGA 3SHWA 2DPXA 3OESA 3EIHA 2A5GA 1E4YA 1CULC 1AKEA 3AVOA 3LFUA 1RJ9A 421PA 5BN4A 1ZC4A 4OQLA 3DM9B 5KUTA 2QTHA 1QHNA 3FDIA 3B1YA 1IJEA 4QBGB 4C0KA 3E2IA 3EZ9A 5DE3A 1ZNXA 3FWYA 1W5TA 3K9HA 1CLUA 2VSFA 1RRPA 2ECKA 2ZJ2A 1B23P 4A15A 1AJEA 3H84A 1PV4A 4JVSB 2PJRA 3KKPA 4M1SA 1U8ZA 3TH5A 1COWD 1EXMA 4N0DA 4URZR 3MSXA 2GETA 1T8TA 2V3CC 1OXUA 2ZI4A 1BYIA 2O52A 3TR5A 1KI3A 4M22A 3QBTA 4G5GA 5M04A 3JVVA 2JA1A 2ZI5A 1OKKD 4WIAA 3AVPA 1TQ4A 5AUQA 1F48A 4BE7B 4Q9LA 2YINC 2RHDA 5DYGA 4IVPA 3QKSB 3FMFA 3OZXA 3UWKA 3NEJA 4KJZA 3CBQA 4A82A 2QTVB 4QOSA 1XNJA 4QFMA 1EX7A 1QHGA 3PJRA 2J59A 4LHZA 1G5PA 1NVWQ 5TXGA 3GPLA 3GLIB 2BIFA 1TL7C 5FL3A 3Q7QA 3V4RA 3VNUA 3KDSE 1JR6A 2ZPTX 1CRQA 1YVDA 2IL1A 4MRVA 1ANKA 1EWRA 1S1CA 3V00A 3T35A 1M7BA 4A0HA 2PZGA 1RYFA 3U6BA 3IIMA 2BBWA 5F2EA 5G53C 1UM8A 2EFCB 4KSCA 3V4FA 3RAPR 2O8DA 4QGFA 1E98A 1H8HA 4OQMA 3K0SA 2OAP1 3LNCA 3PEUA 4HZIA 3QE0A 1YZTA 1Q0UA 4C4PA 2HCJB 3CWZA 2VP5A 2NG1A 3PUVA 3P4YA 2X1VA 5FOSA 4IOKA 1KZGB 2A78A 5DIFA 2F55A 3QBVA 4YMVA 2IYUA 1KK0A 2XOKD 2BBOA 2CLCX 2HUPA 2WAXA 5L8VA 5F98A 5SZJA 4D4LA 3UATA 2J87A 2ZJOA 1GWNA 4MRSA 4CEJA 4GNKA 4XTCS 5HKKD 4NYMR 5KYKA 1Z8FA 3GEEA 1ZD1A 4ON9A 1LW7A 1W5SA 1JR3A 3GJ7A 3HU2A 5L3QB 3NH6A 3TSOA 1NNEA 1NN5A 2DFTA 3OF5A 5FBRB 2G9NA 2J46A 3LA6A 3QXCA 4MKGA 2G6BA 2BJVA 4TLCA 3RRZA 1U94A 2C2HA 2D4HA 2XZLA 2Z0MA 4ILEA 3SJZA 1ONBA 3HYRA 2J41A 1P2SA 4OQFA 5CIWA 3G82C 4LY6A 4QJ5A 3RABA 2Q6TA 2E87A 3MFYA 2EFEB 5FL7D 3BFXA 1SKQA 3ETLA 3LXRA 4F4IA 5EXXA 1QVAA 4D2IA 5ELXA 1UBCA 1OH8A 2VHJA 3U6KA 2XJ9A 1I4LD 2VQSA 2F6RA 4DSTA 4LYFA 5FPSA 3ZQJA 2FX3A 3W6OA 2J7PA 5KNDA 5L3SB 1A7JA 3VHXA 3D8BA 2DFLA 4MKIA 1IN4A 4NYJQ 3THYB 2ZUBA 4R98A 3MRSA 1XEWX 4OHWA 4P32A 1T9HA 1NLYA 1W4BA 3SN6A 2N1BA 4KAXA 1QBKC 1G9XA 4B35A 3RYTC 3IKJA 2JIZD 1RPZA 1W36C 2O0KA 2BCGY 3T61A 2WAYA 3KQUA 1KDTA 4PQRA 4DWJA 1KOFA 1Q57A 2OESA 4TN1A 4JT4A 3TSWA 3C16C 4D81A 1G4UR 2IF2A 4RZ2A 5AJZA 3Q9LA 3WHKA 2XNSA 2IX3A 4BECA 1L4YA 3LY5A 2QSYA 3P20A 1JJVA 1N6KA 1WF3A 1VYUA 4KODA 5FOWA 1NMZA 2BMFA 4KLNA 2QPOA 1S0UA 4ZI2A 4RD3A 3A1WA 1Z2CA 4OJKA 4NE2A 3SYLA 2QGZA 2RGCA 4LRWA 2O8EA 3KB2A 1GRQA 1Q3HA 3ZIAD 1P5ZB 1C1YA 4RVCA 4DZZA 2PT7A 5AR1A 2CE2X 3R9IA 5JWOA 4CVNA 4LHVA 3U3KA 2FZLA 4CDGA 1HT1E 1P61B 2J1LA 2QE7A 3I5XA 3UK6A 5FPKA 2DFNA 1IBRA 1XU4A 4BLSA 1YR9A 1BO6A 3TNFA 4NYMQ 4YC7A 1HYQA 4IVRA 4A2QA 2VYFA 4CZ2A 5JI2E 4G3XA 1DVRA 1TMKA 2R6GA 4ASUA 2OAQ1 1N0UA 3B8HA 2CBZA 4KU4A 2W58A 5D3MA 2CJWB 3CF0A 1D2NA 4PC2A 3TQCA 2ZVQX 3WYAA 4WXRA 4YQFA 1KYIA 621PA 1A82A 3C14C 1SGWA 1KJWA 3CO5A 5P21A 4XWOA 2CLDX 3BIFA 5J4LA 2FZ4A 2VP0A 2YWHA 2O8BA 5DI3B 2CMKA 4MRNA 1M7GA 2F1RA 3FYHA 4X8OA 4PZYA 2W6IA 4LBZA 4B2IA 3LX5A 4EFMA 1HY3A 2CHQA 2H17A 4RD2A 5HCIA 4CIDA 1E2PA 1R5BA 3N70A 4RZUA 2DWOA 1I4DD 4GZMA 4U02A 3Q5EA 3X1YA 3X1WA 3B2EA 1XPRA 3FGNA 3N5CA 3AUYA 3KXKA 3TUIC 2F3RA 2CL7X 1DAHA 1Z6XA 2OCPA 1KK2A 5FPYA 1KSHA 1H8ED 3CX8A 4RCYA 1E9CA 3Q3JB 2B92A 4HAVA 2ODNA 4Q00A 2FFHA 5C2JB 1UPTA 2XB2A 3AVTA 4MUAA 2MSCB 4GPTA 3FHCB 1G6HA 4FIDA 1OYWA 2QTFA 4HLUA 1DO0A 4FN5A 4HLDA 2K5UA 3GP8A 2NPFA 3B1XA 3BH7A 4ERNA 1BMFD 1ZBDA 3VR2A 1NLZA 3OIVA 4OL0A 4B3XA 3SEAA 2RMKA 1FMJA 5CLLA 1DADA 2ZR0A 5DHFA 5E3HA 1KSFX 3OFNA 3OHMA 3BGWA 4N0EA 2QU8A 2ZI6A 3C5CA 1OFIA 3WMEA 1NG9A 3DZ8A 3Q7PA 5EXSA 3IO5A 3QY0A 3LH5A 1N6LA 3VX3A 2F7SA 4V0OA 3BXZA 2P6UA 3X1ZA 4LHYA 1NIJA 1KGDA 2OXCA 1W7AA 1ZJ6A 2R6DA 5ANRB 1N6NA 4V0MA 1LTQA 1X3SA 1N6HA 2J3EA 4DT1A 2C9OA 1GRNA 2GILA 4URXR 2VP4A 4G5QA 3EX7C 3H0KA 4EDHA 4Q1DA 2DHRA 1ZU4A 1P2UA 5K8IA 5IK2A 2XAUA 2XSZA 4M9SA 1WQ1R 1E2MA 1CR1A 1TF2A 5J4YA 1W49A 3AM1A 4AC9A 1ZCAA 4HB4A 1DTSA 4EPTA 1Y63A 3U7GA 3QG5A 3VFDA 1E4VA 1RE0A 1E2EA 4B6EA 3QI2A 1W36B 2AL7A 4JKIA 1K6MA 2MMGA 4BEBA 5TVKA 1TUEA 5DGXA 5SZHB 3BERA 2NO7A 1FUKA 2V7QD 3IPYA 1NKSA 1Y3AA 3LAWA 4JBXA 4CF7A 4Q4JA 3AVQA 4C0QC 1VKJA 3L0PA 3TQFA 3CH4B 1NVVR 4D26A 1VIAA 2I1QA 1QVRA 4JKYA 3MAAC 3TK1A 1XTJA 6Q21A 2WWIA 1X86B 2R62A 4LC1A 3NC1C 2J0UA 5HPYB 4LX0A 3H1TA 2OILA 2IUUA 3UANA 2J45A 1FX0A 1SVLA 2FA9A 1YRBA 4MGKR 4A0GA 1YRAA 3I32A 4YMTA 5KPDA 1ZVQA 3E70C 4Q4AA 3PV0A 4DIEA 2LKCA 2B21A 2GHIA 1UDWA 1IXRC 5KU1A 1U90A 2B7CA 2PZEA 5FTJA 1DARA 3TW8B 2WV9A 3W8RA 3SJAA 5JCPA 2WWXA 3IILA 3NVAA 4GBMA 4GMXA 1YR6A 2PMDA 2GF0A 2FV8A 3PQCA 4CW7A 1JEDA 3OEHD 1G17A 1R8SA 1SVOA 2AHOA 3CW2A 1RZ3A 3I73A 3T12A 3UKDA 3HU1A 1BYUA 1OYYA 1WRBA 2VF7A 4Q1BA 1J2JA 3GMTA 3SFZA 2WMNB 4DLUA 4L4UA 2MMCA 2LWIA 2PCLA 4AYTA 4D4MA 2OZEA 3KTAB 2QY9A 3CWQA 1IN5A 1F2TA 3QXSA 4PC3A 1NJFA 1OPXA 3KFXA 2NGRA 2JASA 3LO5A 3LV8A 1CP2A 1S2MA 1XXHA 2AX4A 4CEIB 3TW4A 2FG5A 5FI0B 4Z8XA 4ARZA 5JS8A 3W9YA 2QM7A 2YOFA 3OIYA 3QVVA 2WPDA 4WZ6A 2QI9C 2GA8A 3QEOA 2OBNA 1AKYA 4JLPA 4RSGA 1X8JA 3R8FA 2N46A 2OSBA 4HLCA 3CH5A 3F3YA 5EE0A 1PVOA 2YYZA 3QKRA 4L16A 4OHZA 2FEOA 4XD7D 3QF7A 1YZLA 2RCNA 3L0IB 2ZR9A 5JWRA 2OV2A 3ZQ6A 5KPJA 4B71A 3CR8A 1YR7A 2A30A 4QGGA 1OSNA 2HXYA 3B60A 4DB4A 4BFTA 1II8A 2ZYUX 1SXJD 1MRSA 1P7CA 3REGA 5AJXA 1E9RA 2ZJBA 3BFKA 4YXWA 3LQQA 2GKSA 4K81B 1C9KA 4UKDA 2PT5A 4JL8A 4LPKA 4Y0AA 4TQUS 1XTKA 1K8RA 1KNXA 1PLKA 2GJ9A 2GRJA 2H18A 1I2MA 3K70C 4WZAE 2DR3A 4HAXA 4MYTA 3RS7A 3CNNA 1NN3A 4KXFB 4QC2A 1KDOA 5AJYA 3DKPA 4HYYA 1QHHB 2W0SA 4DLZA 2WIBA 4DHEA 3FOZA 1NVVQ 1RC8A 2H5EA 3OIUA 3UIEA 2P2LA 2OFWA 4G5SA 4DB2A 2IYQA 4BFWA 3HP1A 1IN6A 1YR8A 4US0R 5FOTA 2IW3A 2HLDA 1G3IA 4C0SA 2C03A 2VF8A 2X77A 4XVUA 5AUOB 4OI0A 2W00A 1EFTA 3A58B 1CJTC 2RGEA 2EWVA 1XD2A 4B44A 3SJCA 4A6PA 2WJIA 2ZM5A 4JVLA 4ZKEA 3QVUA 3QKSA 1EESA 4C7OB 1XJCA 3RHFA 3KXIA 5J40A 1KIMA 4OQXA 2JAQA 1GNPA 3AP1A 4AIIA 4PC7A 2KE5A 2V1XA 3K0FB 2ODBA 3M4YA 1G7CA 4FD2A 1KI6B 4G1UC 4HUTA 2IXFA 3GLIA 1E2QA 2TMKA 4PZLA 2NO0A 4EPYA 4EFNA 2A9KA 2IA5A 1OXXK 1LV7A 3WMFA 2OFOA 4RD0A 2F1JA 4R9UC 5DNYB 3MLEA 3UXMA 3SS8A 4JYCA 3EZ7A 1VDZA 3GEIA 4IVQA 4JIMA 3W5JA 1EK0A 4E09A 2D3WA 2YHSA 2D7CA 2AWOA 1KZ7B 4PPQA 3WBKA 2BOVA 4B2PA 3DEFA 1FL9A 4PANA 1UBEA 3D3QA 3W34A 5CK5A 2HDNB 3BORA 1Z3IX 2REXB 4BFXA 2VSXA 4BLPA 2P5SA 4MA4A 1CIPA 1ETUA 1ZIPA 1S96A 1JQLB 4LJ9A 4NL4H 3LWNA 5BYKA 5EE1A 3K0AB 3KJIA 1TTTA 5DISB 1XEXB 5B30A 5E7IA 1S1MA 1YHNA 1M7HA 3AGPA 3CZQA 2WJVA 3E1SA 3QUSA 4NBSA 1ZUIA 5IT5A 4PC6A 1ZINA 1GDDA 2NQ2C 4IOLA 5BWMA 4PPFA 4C0LA 1QHYA 2HJVA 3WBJA 2ZVPX 1E96A 3RWOA 1KHTA 4W5JA 3VR1A 3CRW1 5L3QA 4Q48A 1W0JA 1W0KA 1F2UB 3RANA 5EXTA 5HR5A 3TUZC 1N25A 4TZ0A 4M1TA 1AIPA 2XTMA 3PEVA 2IUTA 5JMTA 4Q18A 3MWJA 3N2IA 5H8WA 4Q4HB 2QP4A 4NCJA 2IS6A 3RRNA 3EWAA 1UKZA 2E9SA 1G8YA 2WJGA 4XTRA 3BAFA 2NMVA 3MJHA 1OB5A 4X8MA 1M8PA 4ESHA 4NU0A 2CVHA 3EA0A 4EPWA 2ZRJA 3MCAA 5FBQB 1KI8A 3GEHA 1Z0FA 1Z6TA 1FQKA 2D2FA 5FUWA 1NMXA 1FTNA 4I1VA 4BFVA 3RS2A 1G16A 1CJUC 2JJ2A 3DOEA 2ZSEA 2QT0A 4YMWA 2SHKA 2ZSAA 3ECCA 4GOXA 3R7WB 4TLEA 3LVRE 1Q22A 2RGAA 3B1ZA 2FGJA 5EQTA 4CEHB 1FMLA 1XTSA 3MG9A 4GRAA 4IXNA 3DZDA 3RS5A 1FUUA 4DSUA 3B5JA 3THYA 4DIDA 4TYYA 4GFDA 2NOAA 3ZDQA 3BBPA 5KHOC 4GMDA 1UADA 5CIQA 2VHCA 2FU5C 2ZUDA 1HA3A 2VLIA 4TMWA 4R2HA 3K70B 3BC1A 2WHXA 4DCTA 1XBTA 2QMHA 2H57A 1XJ0A 3A6PC 3FFAA 4IRUB 5TMPA 2QN6A 3N2EA 5C18A 1P72A 5G3YA 1G3QA 3FHOA 4EAQA 1E2FA 5TDHA 2RB4A 1I2DA 1P9NA 2AWNA 2QP3A 2NZJA 3U5ZB 4OI2A 2GCNA 3A4NA 2IHBA 1UFQA 2OBLA 4EPVA 3LLMA 3SR0A 2IEZA 2ATXA 4IDOA 3VKHA 3P4XA 2OM2A 5FOXA 4D4JA 3LD9A 4FCWA 4C0AC 2IXEA 1U0JA 1T8UA 1KTVA 1IQPA 2IYXA 3AF1A 4TLDA 3WP1B 2GCOB 2Q3HA 1SKYE 4JVNA 1H8HD 4QJ4A 4HB2A 4LBWA 3TR0A 3QPVA 4PAQA 5LBIA 4V0NA 1XFAA 3K9GA 2JLQA 1JEEA 3C7KA 3RC8A 4B75A 2QMEA 3BB3A 1JECA 2ANBA 4URYR 4GP7A 1ZU5A 1XMJA 3Q5DA 4IFEA 4EQ6B 1OV4A 2MSDB 4KITB 4RD4A 2ZETA 3Q8XB 2RGNA 2CLSA
chains in the Genus database with same CATH superfamily
4BWFB 5DM70 1JG7A 4FMDF 2FPRA 1FTSA 2H0AA 1XL0A 3GJ0A 1Q1QA 2DF8A 3JQ7A 4IIBA 5CFOA 1L7DA 1SWWA 5A4JA 4Y2SA 3F2IA 4Q7JB 1TLLA 2PUDA 1UJ2A 1MIOB 3K9BA 4A91A 4E2XA 4QEKA 2FPXA 2JATA 4EG8A 4FGWA 2PKWA 5A0FA 1X7WA 4KREA 4GQHA 4QU9A 4YK7A 4DXHA 1I5RA 2A14A 1HI9A 1PR1A 1LLFA 2L81A 5DHAA 4HQRA 3CVUA 3UAGA 1E2UA 1PEDA 6GPBA 4RS3A 3B9PA 2QQ5A 3F5QA 3KJZA 4WNIA 2CNNA 1FNNA 3E7DA 4DR6B 2GSWA 5JAUA 3LS2A 4JJKA 3MTDA 3W78A 4BYGA 1OBFO 3OD5A 4CDAA 1MORA 3O9ZA 2A5DA 4OK5A 4IQGA 3JQ8B 3BWXA 3FCXA 5J58A 4DKXA 1DDIA 5ARDA 4XZ3A 2HXGA 1O97D 4XCVA 1SUFA 1SKUA 2OO3A 2IIBA 2AG0A 2NZUG 4TSRA 4L8WB 2RGUA 4CT0A 2EILC 4YAJA 1VRCA 2V8BA 1ZSVA 1ZGGA 2BFWA 3PD0A 5HGJA 3BL6A 4RULA 4YUAA 2DB3A 2HU7A 4NOKA 4HG2A 2PFSA 2JGEA 3W4IA 1U65A 3DXFA 4B6JA 1LVGA 3DV9A 3BIWA 4O4LB 3RIGA 3WWPA 3AOUA 3L82B 1B41A 3IQTA 4I5GA 1XTVA 4N6CA 4ZI3A 1F0YA 3QNMA 4FLEA 5E9AA 5AUPB 4L6RA 3KYDA 2YWBA 2NU9B 3NRJA 1HOTA 3ZHSA 3L0IA 2CMHA 2PLWA 3R5HA 4R3UC 4D74A 2EW1A 1X7XA 4PS1A 5DEIA 4CM4B 5JLIA 1DRJA 3ZDDA 3HRIA 1UBMS 5JZVA 5C3UA 3CEPB 1O54A 4IIUA 2YTZA 5K0JA 2PH1A 2R25A 1Q83A 1R0SA 1ODFA 4R84A 2HADA 4L0MA 3QHPA 3GORA 4U9DA 4BJ1A 2JNWA 2GXSA 2R6CA 5H70A 3NHSA 4Q66C 3LUCA 2VZLA 4LHXA 5HCUA 1EG7A 4Q1CA 3ZV6A 1KI7A 2VAMA 1GHTA 2Z2XA 4J07A 1NL3A 4ZEOA 1K8ZB 2J48A 1JZQA 4MWGA 4KO4S 2Y1GA 4IXWA 2AMJA 3CIFA 3D64A 2PUFA 1UAYA 1VL6A 1WY5A 1U5AA 4UCQA 3K1AA 2CDQA 3WDMA 2AXQA 1C9MA 1DBPA 1EVKA 4WA8A 2WU8A 1JPJA 5BO5A 1N2ZA 2WJHA 3F7OA 1GQYA 2QAJA 1CRPA 3IPXA 4MQ6A 4KO3S 4YMIA 1GXSA 1XTQA 5F73A 1WXFA 4NVRA 4HL6A 5K01A 3CQZA 3POVA 3HKBA 3IEMA 1USKA 1ISHA 4RKFA 3ZD6A 1DSSG 4FNOA 1S8NA 4HEA1 2Z3WA 4J1SA 1CUGA 4D4XA 2HHAA 1D1SA 3K5WA 4R9RA 2Y3IA 4CEHA 2D5CA 1E18A 1RXUA 2WU4A 3L93A 1RMVA 4LOKA 1WE2A 3COWA 5KVAA 3AR9A 4TQ9A 3NALA 5BSKA 5CBPB 3OKAA 5AM3A 5ERYA 3LE8A 3UQZA 3IAXA 4CKEA 3KQHA 1ADBA 3WLLA 2HSDA 3NTUA 1EHIA 3OZGA 4LCBA 3WIOA 4UM8B 1NI5A 3VHLB 1H1LB 1CZRA 1JTVA 3UW1A 3CRQA 2H4XA 1N92A 4EZEA 4QHYA 3KZNA 1R9MA 1Z5NA 2IF0A 2WQZA 3RC1A 4XX0B 1JXOA 1N7IA 4DUGA 5F5NA 3D8RA 2IS2A 1CDZA 3U13A 1ZGBA 2OZLA 4X85A 3JALB 1XJWA 4ZHSA 4D5GA 2VSQA 3DC2A 5K0FA 3FOPA 1EIZA 4QFDA 3EVAA 2ZI9A 3KYCB 2AGVA 2O07A 1TNDA 2P40A 3AH8A 2EJBA 3L8HA 4EMUA 3MUNA 5A03A 5CH5A 3I53A 3UBMA 3CNBA 1GSIA 2QZSA 4ZQBA 4E12A 4HS9A 1ZM2A 3HHPA 3LUKA 4G0YA 4QXAA 5SZIA 1EI7A 3FAKA 4FFPA 5LXTF 1D4AA 4C4OA 4G6ZA 4Z7QB 2J5KA 5JBQA 3DO5A 5A1TA 4N0QA 4KQHA 4OB7A 1V5EA 4JSRA 4ZHQA 5B64A 3FNRA 3NGLA 3UC5A 3BCHA 5JYEA 3QKTA 1A5ZA 3ZWVA 2GOYA 2EFGA 1XCGB 3OZRA 4TTAA 1YVPA 2ZZMA 4HVLA 4TXMA 4U7DA 4TTPA 3KEFA 1YZCA 3FKSA 4E5NA 4HX2A 1O5IA 5IT0A 1HKHA 3OMWA 1VKHA 3THXB 3R0ZA 4F1WA 3KYBA 4D96A 5JAHA 4R6XA 4W1SA 1EJ0A 3DEIA 3L8ZA 1SZPA 1OI7A 1YRHA 1SCBA 2XE7A 5EP4A 1DTWA 4YRMA 2CVOA 1TUBA 1VC2A 4KLAA 1KO8A 4KQMA 2CB9A 4DYVA 3SFTA 1PGPA 4M1KA 3ZE9A 4NLLA 4PG5A 5KREA 4ZMRA 3I0NA 3NDJA 1KNQA 3G4XA 4JBLA 4LFCB 1BXGA 3PENA 4DBQA 2N75A 3KJEA 1XG5A 2XECA 3KDAA 1FFYA 3UMFA 1G291 4J6EA 4WVLA 4B74A 1X80B 1G8FA 3G59A 2WHPB 3L34A 3WSWA 3D6NB 4UHJA 2UKDA 3THWA 3SOPA 2QBYA 3ZIBA 4BKRA 1NVGA 4XW2A 5DMHA 3LBAA 5BN5B 3ND6A 4DR4B 4ZQHA 5K0ZA 4PZCA 3WYDA 4LISA 1L4NA 2ROQA 2EKQA 1X3LA 4CI0B 2YMPA 1YKFA 2ZWAA 5TB5A 2XWQA 4YCLA 2R8PA 4IKEA 5CTAA 1P5JA 4OO3A 1VHDA 3WBBA 1BD4A 4N40A 4OG2A 1V25A 1YB4A 4F11A 1VBFA 3F0TA 2YJNA 3D6AA 3E7FA 3UMHA 5IJ0A 2ZRHA 3FDJA 4ZT5A 4OQEA 1EQUA 3T3GA 2OORA 3L6UA 1JB9A 4JQCA 3GVPA 1LLQA 1H2BA 3TKYA 2ZITA 2GGSA 1XZQA 1OFGA 1XWWA 4QRDA 4F0JA 3QXJA 4MH0R 3I3SR 3KOYA 1WXHA 1A27A 2XX3A 1PJQA 4ITRC 3RASA 2WOOA 3JVIA 2GR9A 1W30A 4Q1AA 4JI1B 2CV2A 2VQ6A 2OYCA 2YWFA 3TBKA 1CY6A 3W3AD 2ZRAA 1E1NA 1A9XA 3E1KA 3GB9A 4JKOA 1DINA 1YAUO 4V39A 3FDZB 1EE2A 4GI1A 2KJQA 1QK5A 2PU7A 4OLFA 1VLTA 3GWZA 4JBWA 1XEWY 3DAGA 5A3JA 3GHYA 2NXCA 4UTOA 4FHGA 3VOAA 1ZISA 4LZJA 4IPTA 4F2WA 1IN7A 4JJ6A 1XPOA 3HNRA 3V4LA 1ORVA 4F71A 1E5XA 2O8DB 3VR5A 3LZ6A 1VLLA 1Z83A 5JXJA 3NNNA 3GGGA 3DQQA 2DWPA 4P2BA 1F0PA 5LXTB 1FVOA 1ORYA 2YOGA 1E1CB 3QLUA 3IUJA 2FN4A 3R1IA 5FB3A 4I4LA 4X94A 3NHZA 1ESMA 2V6IA 5A4FS 2BY4A 4E18A 4BMNA 1AUEA 1AZWA 2NTYC 3Q3EA 4TOIA 4FXPA 1JKJB 3VXKA 2O2HA 3EZLA 3ITNA 1NJSA 2AYZA 4ND4A 4U5EE 1Q21A 4NJMB 1DE0A 3QUCA 4BE9A 1FLAA 5C5IA 3GJTA 5LP6C 4BMCA 3N1UA 4OA5A 2LFFA 5EE9A 1QFXA 2QR2A 4BXOA 2FMXA 4EHNA 1VGRA 1KPHA 2NZVG 4W8KA 5IDVA 2ZTLA 4ZVRA 1SYQA 2WWFA 3ZGLA 4UDYX 1SURA 1W5AA 5KSZA 3I9LA 3CLSD 5K51A 4RETA 3RH3A 2PRKA 4CMGA 3MYFA 1N6IA 3GLSA 1LLUA 5GIPE 5DLJA 3RWMB 4OMDA 1PGJA 1RXCA 3CH6A 1XMPA 4Z4FA 2PT9A 4JXJA 1QS0B 1F2VA 4B79A 3CRMA 2OCKA 1RQXA 1YT5A 3NUQA 3RFYA 2ORVA 1A98A 2J4CA 2NW6A 1R37A 3NHLA 2Y3HA 3I8XA 5L6MB 3RRYA 3IJ5A 1JF8A 3NHJA 2CBXA 5CM2Z 2QEQA 3CCFA 4OEHA 5BSMA 4BY9E 4PWZA 3DDNA 1CJMA 5LDDC 2AXPA 3NDBB 4YMGA 1QYDA 3MLAA 3B7WA 1EVEA 4IARA 3TE6A 2ZR7A 1KORA 4EG6A 2P6NA 3F5DA 2GPWA 2JPUA 3VOBA 2X40A 3RU7A 1E7RA 3OEYA 1XLTA 1EVQA 4ZAFA 2ZIXA 4DT1B 1N0HA 1RWMA 2IVZA 3GLUA 3CPJB 4AROA 4OAOA 4BJ5C 4AJHA 1U6JA 2HK9A 3IKVA 5EQDA 1JKIA 1R0YA 3SU8A 4PPNA 3HKEA 1BCRA 4M8KA 3PWKA 1H9TA 3NEPX 4WV3A 2JEYA 1S3GA 3U0VA 1OXVA 2FZKA 3ZC4A 3AF0A 2XLWA 2XNDD 5IC4A 1W25A 2PSDA 3R75A 3QLJA 3BSSA 2WP0A 3AHHA 1T15A 2ZSKA 5J2UF 4ZCPA 1Z7YA 2N47A 2O8FA 2DPHA 3VH4A 1KIFA 1ECLA 3NIFB 5AVQA 1DFGA 5FYDA 2F1KA 2WG0A 2Q1YA 4DEYA 2R7NA 4GX0A 3C3AA 3JQAB 1ZVJA 3R6WA 5IAEA 3TLXA 4MW7A 1GFIA 4RA9A 3L01A 3QE9Y 2H48A 4NCBA 3SLRA 2A68F 2CHVA 3VQTA 3ZCQA 3OCXA 2A5GA 1O9BA 5DE3A 4D9IA 1W5TA 3K9HA 4MS1A 3N24A 3DTNA 4IDGA 3KKPA 4YIKA 1A9ZA 3A04A 4URZR 4Y2JA 2WHRA 2GETA 4EARA 5FUQA 3KUXA 2NXNA 1UXOA 2JA1A 2AJCA 1LLCA 1Y7TA 4B3TB 1ZZPA 4MS2A 1MNQA 5JMPA 4WKBA 3BXPA 4IZIA 1EX7A 3ZE8A 2J59A 1PT9A 4HWRA 5TXGA 3EXEB 2JGDA 3V00A 3UBTA 1XYVA 3QHQA 3RAPR 4OQMA 5K3CA 2VAXA 2YJZA 5FOSA 3BD7A 5SZJA 1BGVA 1GWNA 4RPHA 4YPVA 4J3JA 3V97A 3BIJA 3E9VA 3SXKA 1ECPA 5DPMA 1VZ2A 5EJMA 1GTJ1 4CM7A 2H8GA 5EMKA 5HP4A 2P35A 4V24A 3ZEAA 1N3YA 4PSUA 3RREA 1LPPA 1LNQA 1OT5A 2OU6A 2C9DA 2VQSA 1WTYA 3RV3A 2XM4A 4X7PA 5DLYA 3H1AA 3IH5A 4ZV7A 2EERA 1XV5A 3C18A 2YJ3A 2VKTA 3PJEA 1W36C 4FYJA 1JA0A 2W2OA 1QP8A 2YXEA 5JAPA 1N57A 1XZKA 3GZTB 2E49A 1I0ZA 4FP9A 3BTUA 4DZZA 3R9IA 2J1LA 1L1EA 2JIDA 2W4QA 7YASA 1HYQA 4YQZA 3ZUGA 1QQ6A 1IWPB 2VEOA 3BF8A 1DVRA 2ZAGA 1TYEB 4NEGA 5BY2A 4HEQA 2PXCA 4WXRA 1KYIA 2MWQA 4UEJA 2OK8A 2VP0A 4HUJA 4IWXA 2X3UA 2O8BA 4CIDA 4X20A 2YDYA 3MGBA 2PL9A 10MHA 2F3RA 2BR3A 1DAHA 5JCJA 4Y7DA 2FAPB 4RCYA 4HAVA 4QO7A 3ZV3A 4GPTA 2TMGA 3B1XA 3W1EA 5AIBA 5E6SB 1V95A 4AUEA 4FJ1A 2RMKA 5CLLA 5FJIA 3QKIA 1KNYA 1JHYA 3WJ2A 3BXZA 2ADOA 5AM5A 3LK6A 3R24A 4FW8A 3TB4A 4RE6A 3EX7C 4BKUA 2XSZA 5J4YA 1OPRA 1NE2A 2QZZA 2NAPA 4RZIA 1K6MA 1YBFA 2XQJA 3SE7A 5TVKA 1DU4A 2Q49A 3EMKA 4MZXA 5DWVA 1IBMB 5IARA 3LAWA 4U3JB 2C2YA 4C0QC 4K6MA 3EEOA 1JHMA 3TZQA 4BBZA 4D26A 1HNWB 4BB5A 6Q21A 4LC1A 3TTTA 4C3BA 1QK4A 4XGRA 4MGKR 4L0QA 1YRAA 2VJPA 2WM2A 2C07A 1P7ZA 2NSDA 3I12A 3M6XA 4N6HA 2B4QA 2FUG6 4GM4A 3FCCA 4IV8A 1WRBA 2VF7A 2MMCA 4CCYA 1NJFA 4XKJA 2YQYA 1YB7A 3JWPA 1CYEA 1LRJA 3GLVA 1QP7A 1QFZA 1MC4A 2QN3A 3EEIA 2AG6A 3R8FA 5KNCD 5EE0A 3LBYA 2YYZA 4FYMA 4OIQF 2I0FA 2VH3A 1SXJD 4C29A 2R7OA 1YI1A 3N74A 5MGNA 2WIBA 1UPUA 3Q3GE 4FR0A 4OKNA 3DNMA 5LLTA 3HV2A 2VF8A 2FAXA 1KPGA 3AC0A 3IMEA 3NYJA 4A6PA 4FIZA 4YJFB 3UH0A 2M6RA 1SOWA 5HRUA 1I51A 2V1XA 3FJ1A 5GTDA 2QT9A 2IA5A 4BO2A 1JVBA 3WLKX 3DZHA 1VDZA 4KBYA 3JW8A 3D3QA 4QUIA 1DO8A 5DM60 4KE7A 2RH8A 1Z16A 4KK3A 1VJ0A 2NUTB 1N5OX 2E5LB 4ZGWA 1ZHOA 1ZINA 2AFRA 4RGYA 3GRYA 4Q48A 1F2UB 3PEVA 1OXBA 5B7GA 5KS2A 3FPJA 2BUAA 2I6TA 1V9CA 4EF6A 3FSGA 3ZDXB 2FP3A 1KI8A 3HP4A 3EG9A 4E17A 4D8XA 5JYCA 2WSIA 3R7WB 3VZCA 2XYHA 5EQTA 5JD4A 2IODA 2CFCA 3B5JA 4TYYA 3EODA 4MMXB 2FK8A 3E9CA 1GPKA 8ATCA 2PH3A 3IIIA 4JA0A 3S0JA 3BIOA 1VJ5A 4DZRA 1P72A 4Y9RA 4AZVA 4EAQA 1P9NA 4DJDC 2C2OA 3LDHA 1RZRD 4WK2B 4YVFA 5JS6A 2ATXA 2ZUFA 3ZG1A 4C0AC 5A62A 5TRTA 3FVVA 3AF1A 3AJ9A 3TVYA 5K0BA 4IYRA 3QPVA 1XFAA 5TS2A 3PLNA 4L02A 5DT2A 2BL2A 4F8EA 1YDHA 4QYIB 3CHYA 1E9AA 3D8TA 4P53A 4LDQA 4C07A 2ZEJA 4WBNA 3TZLA 4I6GA 3SQWA 1Z73A 4NE9A 4LXGA 5DGCA 4DDHA 2J5RA 1TVCA 3EUWA 2BE9A 3I1YA 2JCVA 4E32A 2O19A 1Z38A 2IYRA 4BJTA 3B85A 3KPUA 4FUQA 2JD1A 1DL5A 1NN0A 3SGLA 5KNDD 3OCCA 3ZU2A 3MCWA 1PTJC 3DZCA 1EWQA 3UGKA 2WUWE 2C00A 1WIWA 2QMUA 1J8YF 4KBGA 1DG3A 5JH7B 1UMKA 1F1JA 5LZ9A 3N75A 1X38A 3NHUA 4YUVA 3H99A 1JFRA 2GAFA 1U4SA 2JFPA 4KEAA 4DARA 1M74A 4PGFA 2XDAA 3FYSA 3QWBA 5C46F 1BFDA 3UJAA 4FT4A 3GFSA 4OI4A 1TYBE 1AMNA 5GWXA 4U0JA 3ZCRA 4FMBB 1PBNA 5G02A 5JJLA 1ABBA 1Y3BE 2AQ8A 1VHWA 3ZTMA 4ZVTA 4MZDA 3LQ1A 3A27A 5GQSA 4UMDA 3ANNA 3A3NA 4PBSA 2HAEA 1UKEA 1UM9B 2X8WA 5K0LA 3TEMA 2WPNA 1EXDA 2ZROA 4M7RA 1XKXA 3ABZA 2QG6A 4BMDA 2JFNA 1A5TA 3TI7A 3LBFA 1KZYC 1SKBA 3AB8A 3CVOA 1NRJB 4G4SO 1DIHA 1URPA 4ZVPA 4DQLA 1WXXA 3MS4A 4P80A 1MNEA 4ISBA 3H1BA 4O4IB 1MAWA 3BQNB 4N7MA 3IB6A 3L02A 5AKEA 1FMVA 2ZQYA 4EB8A 4NDZA 2HHJA 2YRWA 4LDJA 4TQGA 1YHYA 4GX5A 3AJ8A 2VRBA 2VT3A 4OQZA 4PTLA 4PSKA 1MV5A 1SZJG 2E89A 4J76A 2FW9A 2MJLA 4GICA 3B82A 2TECE 3ZIAA 4JYPA 2X2EA 3ICEA 1Y3IA 1ZUHA 3R20A 2XEDA 4YJDA 3KO8A 2YVAA 2HUJA 3NJ4A 5MN5A 2O7RA 1TM4E 1EBUA 4BNXA 3K0FA 3PVSA 2P27A 2H2FA 4WGYA 1U8CB 3GCGA 3SYMA 3NVKI 1QMGA 3DEYX 3E3OA 3IPRA 2F17A 4OVKA 3TQQA 4BO8A 3P8ZA 4F5ZA 3I39X 1LE4A 3C39A 1Z28A 1Z0AA 3V8RA 2C4NA 5AI6A 3WHLA 3QVGB 1BMQA 5B58C 4GBGA 4US1R 4CM6A 2VXYA 3KE8A 4PICA 2BP7B 4D43A 1Z4KA 1OTYA 2IXMA 4LXXA 4IOMA 4RMGA 1DKPA 1D2HA 3EWIA 4R1QA 5JD3A 3DA8A 2AUMA 2W83A 3LUAA 1XR3A 5IAJA 3O6XA 3ZKAA 4EL5A 2ZB7A 1M57C 2B1GA 2IYZA 4CDRA 3F4KA 3EXHA 1ORDA 5BQOA 1U89A 3RIHA 2BFCB 3RODA 4PCAA 4CTKA 1L8QA 1TF7A 5B7PA 2CXUA 4DQXA 1N5JA 1Z0SA 4JMLA 1C80A 1AQYA 1CT9A 1HE8B 3I9FA 4G0QA 5FFNA 3U7JA 1O4WA 2BEJA 1NQWA 2GBPA 4YTEA 5CJJA 3THSA 2B7LA 3A70A 2PSEA 2HA3A 4LYGA 1UKVY 2Y93A 1VYVA 1BDJA 4Z4HA 4XYEA 5A4KA 3PE6A 1ZUNA 1FPMA 4MGIR 5SY9A 3RYFA 1F20A 4QWMA 2YC4C 2WM8A 2YV2A 2A0UA 2HWXA 1GNRA 1A8QA 1AS0A 3CUKA 2J9UA 3HFSA 1WNTA 4YCMA 4WBSA 4UDNA 1PFUA 1F5NA 3TTXA 1BFUA 4CMCA 3PYXA 3E8MA 1GUYA 4M2LA 4K6FA 2X6QA 3JATB 3OKPA 1SEVA 4PBRA 1OX5A 1A88A 5FKJA 2ERCA 1ZIDA 2B2NA 4GZ6A 2VQDA 2B4TO 5F7ZA 2P5UA 4GOND 2YJ4A 3KFVA 4LV6A 2I91A 2WM9B 2ZRGA 3HN6A 4L4XA 1KZ1A 4YIHA 2GZAA 3VZSA 1VZ3A 3GCDA 4NH4A 3H5VA 1SHTX 5FNVA 3QBEA 4RJJA 5FV4A 2AG5A 2FJUA 4I3GA 4AQYB 1MABB 3GRPA 4G81A 2OB1A 2JD3A 2A84A 2ESRA 5D7NA 1V41E 4PGGA 1FSZA 2H07A 4IGKA 5ES4B 5JRAA 5AJWA 5D3KA 3HJNA 4B3BA 4GE0A 1G8MA 4RK5A 4J7CA 2MSLA 5BORA 1HW1A 3FZEA 4J16C 3E9DA 4KKVA 4QZVA 4K9QA 2Q5EA 2AC7A 3S84A 3V4OA 1AQJA 4NBLA 1UAAA 1Y4ZA 4PF1A 3KHSA 4Z5XA 1N5IA 2G62A 2XUAA 3QEKA 5ADHA 1VHQA 5FPPA 3LGAA 1A2BA 2QF7A 3QMMA 2WAMA 4C7KA 1U8XX 3U4QA 4OXXA 1WLSA 3D4PA 4E7OA 4P8RA 4LYHA 1REQA 4NCNA 3W5UA 5KTYA 5L0JA 4J1TC 4KDCA 3OWOA 2QORA 2A88A 1FFHA 1T2UA 4K1XA 2D1SA 4J0HA 2L69A 3PF8A 3PP8A 3O8DA 3M4ZA 3VYSB 4NNJA 4H0CA 2GN8A 4XASA 1MZVA 1DG1G 4YT5A 2IHTA 4MW5A 2XL6A 2TS1A 4K3VA 1B8NA 4GBED 5LR6A 3LSYA 4FBGA 3ZTZA 2Z6AA 1UMCB 4ZVUA 1C2TA 3CISA 2KGOA 1IOVA 1L5SA 1WDLA 3P5SA 2G1JA 1E1MA 1YK1A 1OZHA 1XZEA 1XE3A 1PFQA 1O8BA 4PONA 3D1JA 1GS9A 3RSHA 2OT3B 4JJ8A 5HKKA 4MWDA 2CFSA 3TAXA 1UJMA 4WESB 2B61A 3PWTA 4D0NA 3CXRA 5BSEA 5DCYA 1U8YA 3QA9A 1DEKA 1ZJJA 4ALIA 2ZR8A 4HQNA 4LDAA 4ZGGA 4RELA 1PKXA 1RQ7A 2QI9F 3WO0A 2DWUA 3K94A 5G40A 4H1HA 2Q3MA 4C7BA 2YHIA 2X2FA 3ZG6A 2YL1A 1JG4A 5HMMA 5BYBA 3TSCA 4EYGA 3DBHA 4F93B 4TZ6A 2L6FA 4WEQA 1LU9A 5JECA 3WTBA 3Q72A 2NWQA 1GFSA 1W5FA 2A9FA 5F7OA 2Q7XA 5CEFA 5CI8A 2O14A 1SKYB 1T3TA 4WN9A 1L8XA 1DCKA 4NNOA 1AA6A 4UOQA 5J5CA 5JVDA 3GVHA 1X7YA 2XODA 5DNWA 2WVHA 1BS9A 3DVAA 3QFSA 2J3QA 2CLMB 4IMJB 4F6LA 2ZRLA 2J8ZA 2C7QA 5F3DA 2XGSA 3DQPA 3SM3A 1BCSB 5B3AA 1TZ2A 1RM3A 1VP3A 3F49S 5JEEA 1EJ6A 3BL5A 2BSQA 3N0TA 3I61A 4L15A 2D4UA 3C7CB 1US8A 4YJ3B 3KHUA 2RGWA 2D7DA 1VECA 5JFGA 1LBQA 5K5EA 3D6MA 4LACB 4HEAJ 1P8JA 3WYGA 2GBGA 2GPTA 4FYPA 3B6MA 2VXBA 3ZZ1A 1XF1A 4RTNA 1NY6A 1YCHA 1B1CA 4H0NA 4JWKA 3DT6A 2CFIA 4MYCA 1CR0A 5HTOA 1TU4A 4BQEA 3AVUA 1PSWA 1TD9A 5JSYA 1ST6A 4PNEA 3L41A 2B8NA 2WNHA 4E46A 1GKUB 1V6SA 2E3JA 2RK6A 2RBKA 2H7VA 3KJXA 4DC9A 1IHDA 4XIGS 1TCAA 1VA5A 3PNBA 4MARA 4QGHA 1PP4A 4IQ4A 1N6OA 2PYDA 1BR2A 3T06B 2KSQA 3VC3A 1C17M 4BV8A 5BV2P 3BWYA 4C06A 1PZHA 5DTQA 3A9CA 1ZBQA 4EOGA 4MKFA 3O6VA 4EHDA 1CQJA 4X71A 4AAYA 1AQ6A 2EQ5A 2X3YA 4O8ZA 3UMKA 2TMDA 1SUSA 1XD9A 2BMDA 4LNUA 3A1CA 1QRRA 4K8RB 3RTGA 4DLTA 4CG1A 1QWSA 3LIPA 2ZJ6A 3UJ3X 4W5QA 1JDPA 4PCUA 5A04A 2NO4A 3I52A 3L40A 1D8TA 5BVGB 4MHOA 4MV1A 3QQ5A 2RAPA 4XD7A 3PC4A 3ZJ5A 1B74A 1DZIA 3KD3A 1WVGA 4DCUA 3HFGA 3HQ4O 3A4VA 3K53A 4ND5A 4KXLA 3FTEA 1WU8A 2PKRA 2MYUA 5AVWA 1FNMA 5LYYA 1DDGA 3U7EB 4AJLA 3TTSA 3NT4A 3ZLJA 2R7KA 3CWCA 4PHHA 1HEIA 3ILYA 3BHNA 3ZHCA 3G0HA 4JBYA 3LC1O 1UJBA 3UYLA 1RFLA 3TAUA 3EDOA 4IDCA 3JAMA 4KP7A 4CSAC 5CDHA 3P0IA 1RJEA 2F8SA 3BWCA 4LS3A 2QM8A 3BFVA 3IC5A 1NSTA 5TF4A 3C8UA 4W7SA 3GT7A 3AG5A 5DYIA 1X1SA 4I2VA 2GQ0A 2JIMA 4JOCA 3Q6MA 4K9RA 1IYZA 1SA0A 1JR2A 4EQZA 2ORIA 4I1SA 2HHLA 3GZ4A 5KX5F 3QVWA 2ZXPA 1DUSA 4FGUA 5FWDA 5EC8A 3TRIA 4YJWA 1I4OA 1V1RA 3IDZA 1G4US 1WCV1 2HF7A 3SYTA 1QHNA 4J2HA 5CH8A 3M8KA 5C31A 4BX9A 3R6LA 3WMXA 2V3CC 1FBNA 3OCWA 2YMQA 4RABA 1SCUB 2E4XA 3I9KA 1KZ4A 4C5BA 2I1WA 1BVYF 3M6IA 3GPLA 2QTGA 1PR6A 4OQQA 1R4MA 2BSXA 4C7JA 1IPEA 3ESXA 4UVGA 4DVZA 3QE0A 3RSSA 2F55A 3M4BA 4O6YA 2J87A 5MFPA 2I4TA 3B52X 1W52X 3AESB 3B0UX 1L7XA 5KYKA 3VSDA 1QZZA 1ZD1A 2BZ0A 3GJ7A 5K8JB 1NN5A 2O4CA 2VLBA 4TLCA 1PL0A 1TT7A 1ISPA 5BNTA 3G5TA 1E8NA 1JP7A 3ZTWA 4DL9A 1K5HA 4B2YA 4BNGA 1AF7A 1OH8A 5ER6A 3A32A 4BC1A 1MZPA 3OE4A 5I47A 2QXTA 1FIUA 4MKIA 1OTHA 3CG0A 3OX2A 1R4NB 4GR9A 3MWDA 2N1BA 4PNHA 3S8MA 4L7VA 2CB0A 5ALPA 4DIMA 1XTUA 4J0DA 4P83A 1IVYA 3MTJA 1ZITA 5CLHA 4RZ2A 1T6UA 3ZC3A 2ZSHA 4MR7B 4LRTB 2GTHA 2P77A 2VNIA 5EAIA 1SUAA 2BM8A 4OJKA 3PX3A 1L3BA 1GRQA 2CE2X 1TO6A 1GAWA 4H35A 1KETA 4F9GA 1QLHA 2ODQA 2A9OA 4ZICA 2M6LA 2QR3A 4JFAA 1AN9A 3TQCA 3C14C 4LFAB 4N3GA 5J4LA 4U7TB 1M7GA 1XKQA 1HY3A 1L8OA 2XUJA 3V34A 4O2AB 1NU8A 1NT4A 1Z8DA 1UOOA 3KLBA 2EIJC 1KSHA 4Y2XA 2GCGA 2QTFA 1AO0A 3OLZA 4MVMA 3TW6A 2LIVA 3AY6A 1RQGA 2OVFA 1UPBA 3OCJA 5LVAA 4PLGA 1N6LA 2IU3A 5ANRB 3NJRA 4IGEA 2VP4A 4K0RA 1JUDA 3VM6A 3VO2A 1CR1A 1SJ9A 1KFBB 1OXMA 2LTAA 3UTCA 3QG5A 2OWDA 1E4VA 2WSBA 1ZSYA 1ZIXA 2R85A 4QPDA 3ZI4A 4QI2A 1OLXB 5HX7A 5AHXA 5KX5B 3BE5A 1VKJA 4L6AA 2A3NA 3CH4B 5GAJA 2HA5A 2XVMA 1P9OA 5DNCA 3H1TA 4DYDA 5LP1A 5L95A 3OA2A 4HR7A 3PA6A 1QCDA 4Z9JA 1DOHA 5ADUS 4EX7A 1T2EA 3HLTA 3TLAA 2WV9A 3RH0A 2WWXA 1UJNA 3AX6A 1Q15A 1YVRA 1Z33A 4FM9A 1RZ3A 3SBXA 3A9VA 3K96A 4MPTA 3B51X 4NK4A 4PC3A 2YMLA 5FO0A 2M32A 4RJKA 1RJFA 4WZ6A 1U1CA 3ZU4A 3FYUC 4Y30A 1UXIA 2AC4A 5C8DA 5JCOA 1T10A 2A30A 3SWWA 4XJSA 3PDHA 2ZYUX 5BOSA 5T7BA 3TNYA 4WI1A 2GKSA 2IDJA 5FWNA 7MDHA 4NATA 3DMHA 1X1QA 2EJTA 1HORA 3VR3D 4JBGA 4P22A 2PUJA 4G5SA 3GFVA 2ZQZA 2HLDA 1PS0A 3H5NA 1M34A 4XVUA 5KQLA 5CCBA 3TL2A 4NFSA 3R3JA 3W9SA 3IPAA 5LZ8A 2C2GA 3BMOB 3VV3A 1PYOA 3KOZA 4B3RB 1SUPA 4KQ1A 4H1TA 1BHSA 3K1IA 2QTVA 2D8AA 3PXUA 3ZV7A 5C5CA 1E60A 3WQRA 2Y0CA 3BTVA 2H31A 1RYBA 1K97A 3MLEA 3O93A 3SS8A 1M0WA 3S7TA 2YHSA 4GYTA 3DEFA 1CERA 4UEQA 2Z5VA 1H9CA 1O5OA 3BKWA 5EIBD 2XSEA 4ZARA 2Q0SA 3SDBA 3OVMA 3L4JA 2XUPA 5IT5A 2GJ4A 1DWPA 1H2FA 1Y82A 3ESZA 3ABKC 4ZI7A 2GFIA 1FRZA 3KOWA 2W98A 4HYEA 4MJXA 1HTTA 5HFAA 5TGDA 1N3LA 2X9GA 1AGXA 5FUWA 3EQ6A 4I1VA 2JANA 1Q22A 3VJRA 3HWX1 2O3QA 1CVLA 5C34B 1J21A 4MB2A 3WHNA 3NMKA 3U4CA 1QTNA 4PFJA 4UU0A 5J1SB 2QRUA 2J07A 1DC5A 1HSZA 2AMYA 1A0OA 4UAUA 3FOOA 4TLDA 4EMSA 1DDOA 1SKYE 2Q3HA 2HWUA 5EEGA 4X45A 2O8VA 4ZRMA 1SBCA 1RQ2A 1SPXA 4GP7A 3W5BA 4EQ6B 2MSDB 3DMTC 5D1NA 4WZBE 1XD2B 1TZBA 1D9ZA 2YL2A 4LOJA 3PD7A 4AW9A 3ONNA 3KZOA 3MOGA 2HYIC 1Y1SA 1X8LA 3GNSA 2CCKA 1PQ4A 2RGNC 3GM1A 3N2LA 4O4JA 4GM0A 1Y81A 4D8TA 2CXRA 1NYLA 4OBXA 4BO6A 4MRPA 4ZJYA 4MQBA 4HH4A 4JT9A 3RK4A 1IZYA 1W4RA 2IHKA 3AETA 1P7YA 5FAXA 5DYYA 4OA8A 4RIIA 2YZMA 1E5VA 1YUMA 1WUTA 1T9DA 2VDVE 3OJFA 1LW6E 3U7QA 2K4MA 1S5PA 1GGKA 4NC3A 1ZUWA 4ACAA 1ACLA 3AIMA 2X51A 4UW9A 2XD4A 3FPLA 3RYCA 2Z4RA 4U5HA 4ID9A 2XTAA 1BTOA 4U2DA 5I3ZA 2GCPA 3UV6A 2TRSB 4RMIA 1YMVA 3G17A 4GLLA 3L8JA 4QDJA 2XLBA 5HFJA 1XCJA 1JAIA 1LVHA 1E63A 5JE8A 4HGQA 2J0QA 3L04A 3RSGA 4GGOA 1L4UA 3GLGE 4KAFA 2PCJA 4RD1A 1MFZA 1HC7A 1LM3B 2NU6B 2VB6A 4MIOA 1C9EA 4E4TA 3R9XB 1DBIA 1OXTA 2UV8A 2YV5A 4MNDA 3A9SA 2X7JA 1PJRA 1J2YA 1K6XA 1ZN8A 3OFND 1HRKA 1R6AA 4MPRA 4YJ2A 2D13A 1XZJA 3VZPA 2ACWA 4DNPA 2VHZA 1D0VA 3WKAA 4F72A 1CY7A 2NPIA 3AT1A 1IQUA 3ZGYA 2JRCA 3TD7A 2BW0A 3REOA 4O2LA 1YD7A 5HJ5A 4KMOA 4LW8A 1BBHA 3UFXB 3BCUA 2J0XA 3EZGA 4IFIA 4PYMA 3US6A 4L4SA 3GT4A 2PR7A 4LY9A 5JRJA 3OLXA 3R44A 1B8OA 1I7NA 4UEWA 3QOXA 4KMSA 5HF6A 2O5CA 2JH8A 4LYAA 4KSBA 3WFZA 4GYYA 4QVIA 2LZ0A 3PXDA 1AC5A 1VM6A 4MVYA 1JI0A 2HIHA 1YYXA 3K1YA 1QJCA 1UDRA 1ILEA 3LHKA 2FRXA 4KQWA 3KJGA 4MDEA 4URWR 4ARCA 1XZFA 3B6ZA 1NXXA 2CLIB 4FWBA 4MJLA 5IMSA 3GVIA 4QTXA 3BGSA 5LU8A 1M67A 3FUUA 3JQAD 1AKVA 4UMFA 1KYXA 1AHHA 1BMTA 3PIIA 1OLUB 4WXHA 4FTWA 2MYNA 3WLOA 3UN1A 2RAVA 1PL7A 4Q4HA 2GNOA 3TSYA 3SHVA 4PGMA 2DSNA 3ISJA 4AE4A 3MB5A 2C9ZA 1Z7Qc 3K9NA 3V1KA 2HPVA 4ML3A 1HWYA 3ICVA 1Q0FA 1YZKA 1THZA 2FW8A 3GC6A 3RTDA 1U31A 4TLLB 2MDTA 1H9GA 1RBQA 3QUAA 2H4FA 3BMQA 1WDKA 1VE9A 3K9LA 1D5CA 2JBAA 5L0CA 1U1GA 1Y7IA 3KOUA 4AS3A 2IHYA 1AHPA 2AMFA 3UMGA 1NBEA 4MWOA 1NV8A 5F7JA 2RH5A 5J23A 2MT9A 4NBUA 1F60A 3I62A 2R25B 2LD6A 1W4LA 2VJYA 1D7OA 4WMLA 1O94A 3CINA 4GWKA 1IJFA 4ZYTA 2ZIGA 4M53A 2PAAA 5F3RA 3KR1A 4O3FA 1RI5A 1VXOA 3ITDA 4ZAVA 4Y2UA 4J75A 1NBME 1ZMOA 5GM2A 5CT4A 3LWBA 5G3ZA 3QZUA 1FR0A 4I7EA 3TRKA 2RGBA 3EPHA 3TK0A 3C6QA 5L7TA 5LOVA 2J67A 1V96A 5L7YA 1TZJA 4GPIB 4JEBA 4CLDA 2BCJQ 4ZCMA 2JJ2D 1G5IA 3LWDA 1JEQA 5L51A 5P8WA 1H65A 4ZYUA 1CU1A 3TOMA 3V8NA 3AMVA 1Q0HA 2D00A 3C8ZA 3UFBA 3HJGA 1I4YA