5L3VA

Structure of the crenarchaeal srp54 gtpase bound to gdp
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
291
structure length
291
Chain Sequence
b'ENIRDAVRKFLTGSTPYEKAVDEFIKDLQKSLISSDVNVKLVFSLTAKIKERLNKEKPPSVLERKEWFISIVYDELSKLFGGDKEPNVNPTKLPFIIMLVGVQGSGKTTTAGKLAYFYKKRGYKVGLVAADVYRPAAYDQLLQLGNQIGVQVYGEPNNQNPIEIAKKGVDIFVKNKMDIIIVDTAGRHGYGEETKLLEEMKEMYDVLKPDDVILVIDASIGQKAYDLASRFHQASPIGSVIITKMDGTAKGGGALSAVVATGATIKFIGTGEKIDELETFNAKRFVSRILG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal recognition particle 54 kDa protein
publication title Structural Basis for Conserved Regulation and Adaptation of the Signal Recognition Particle Targeting Complex.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Protein transport
total genus 105
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 5l3vA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5l3vA02
1Z47A 2RGNC 4LJYA 4TQUS 1K8RA 1OV4A 5FOXA 3MCAA 3U7EB 3NTUA 2G1JA 4B35A 2YVUA 1DE0A 4XOIA 2CCKA 5FBRB 4N0DA 2FU5C 2KBEA 3QE0A 3P27A 1AIPA 1XP8A 1TPZA 3T06B 4DSUA 2VL7A 4IDHA 4PAMA 1HYQA 5G40A 2H5EA 1YZLA 2RKOA 4M1YA 3TQFA 2I1VB 3MRSA 5JJKA 1IM2A 1KSHA 3QEJA 4AG6A 5KDOA 4ZDKA 3EZ2A 4FMCF 2QNRA 3OEHD 2ZTSA 3U4QB 1JXMA 1VCNA 3VHXA 5DNYB 2D2EA 2H8KA 4GNKA 4Q1FA 1CLUA 4C0JA 1EFCA 1GRNA 1ZC3A 2RMKA 1FQKA 1KI6B 2QORA 1RE0A 2QBYB 1Z3IX 3HPQA 2GEVA 3WBJA 1N25A 3EX7C 3CWQA 4LYHA 2ERYA 4CT4B 3SU8A 3M1IA 1MABA 5E3HA 2VBCA 3K70B 4FN5A 1HUQA 1LTQA 3B1WA 5LB2A 2HT1A 2YOGA 3IO5A 4QHSA 4AC9A 4LHYA 2JLWA 1Q0UA 2BM1A 1TL7C 1S96A 3T1TA 3U5ZB 3K1JA 3N5CA 1AS3A 1F2UB 2VF7A 3AQ4A 2OG2A 4GZLA 4IDPA 4F4JA 1P72A 4EPRA 3SS8A 2KSQA 3BXZA 3P4YA 3ZZ0A 3Q5EA 3X1YA 3UKDA 2FZLA 4H1UA 1VIAA 4C0BA 1L7VC 3RLFA 1EWQA 1NVVR 2AK3A 2HT6A 2XTMA 1XRJA 4GI7A 4PPGA 2PLFA 4AYTA 2PL3A 2VHQA 1T3LA 5FTMA 4DSNA 3SFZA 4I1VA 3A1VA 1SKQA 1WQ1R 2WPDA 5C4MA 5HCNA 4HLUA 2JLXA 2YOFA 4JJKA 1QHXA 3LLUA 521PA 4R98A 2BBWA 1JXOA 4A8JB 1T8UA 3AP1A 5BXQC 1BMFA 1G8PA 2REXB 3A4MA 4IHQA 4L8GA 3NKVA 4CYMA 2XB4A 5GVSA 5FOSA 3DOEA 1R5BA 4GMXA 3EWSA 4Q9JA 1SVKA 1CRPA 5FL7D 4BLSA 3FMOB 5CM9C 3ZS8A 2XTZA 4D82A 3IQXA 1TU4A 2ZJYA 5TVKA 1J8YF 3HYRA 4B3FX 1KOFA 3MG9A 4P33A 1SKYB 5UKDA 3R8FA 4URWR 2VIIA 4K8OA 1EWRA 1G7TA 1NF3A 4QNMA 4WBSA 4AYXA 3ZVNA 4WZ6A 2BCJQ 4B2IA 2DBYA 2IYQA 2JAQA 4BLOA 1WE2A 4F91B 2W6JD 4BWYA 1W49A 4AY2A 2RH5A 4A2PA 1KYIA 2FSHA 3MWYW 2QG6A 3FTQA 2JATA 4KFUA 3K09A 2QP3A 2YC4C 1JB1A 2G6BA 1NVXQ 3B2EA 4BRWA 5CJ2A 621PA 2CHQA 3P20A 2VHTA 2O8EB 4TL6A 4EPYA 2F9MA 3BH0A 2WWWA 4E09A 4EJSA 1J70A 3CONA 2ZYUX 1BYUA 2OZEA 4OHWA 3TR5A 5KNDA 4GP7A 1DG3A 1E94E 4NHOA 2JJ1A 1A2KC 2ERXA 1G3RA 4BLTA 5GADl 5KPJA 1W36D 4CEHA 2WWIA 2F6RA 1G9XA 1ODFA 3NC0C 3UANA 1D8TA 1NL3A 3EPHA 3NHAA 3LQRA 4Z51A 2ZRIA 4BLQA 1C9KA 3QXXA 4B2PA 3EG5A 4MYTA 1E9DA 4ZIRB 2CHVA 2IYXA 2QU8A 1EESA 1ZM4A 1H8ED 3CW2A 4Q01A 4ILEA 2ZRCA 4RD3A 1H8HD 2N46A 3TR0A 2XX3A 4C7OB 3I32A 3C4JA 1TUIA 1JR3E 2NMVA 2Z4SA 1YR6A 5LB4A 4Q7MB 2QL6A 1RRCA 2AHOA 3QKRA 3LVRE 1ZCBA 2CK3D 4BFWA 1M1YE 1HH4A 5F2EA 2FF7A 3EASA 1KY2A 4RFSA 4URYR 2JDIA 5A4JA 3LV8A 1AKEA 3B1ZA 5TV2A 2BJWA 4CT5A 2FN4A 4O0MA 4YMUA 5CDFE 2BBOA 4MGKR 1GM5A 1XJQA 4OI1A 2JLSA 2QN6A 1U90A 2P65A 1N6RA 2V8OA 2ZI4A 3ZQ6A 1W36C 2ZRMA 3L43A 3U7GA 3EPKA 2J87A 3PR1A 1J2JA 1FL9A 1WDTA 5CIQA 4FMCB 1XMSA 1KTVA 5FFMA 1P2SA 3TE6A 2V1UA 3RS3A 3PG5A 4CDGA 5KSZA 5GJCA 4B43A 1YE8A 2DCUA 1Y63A 1QVRA 4Q7LA 1RJ9B 2XXAA 1OFTA 4B33A 4TN1A 3C41J 1ETUA 3L8ZA 3LDAA 3EIQA 1E2NA 3EPLA 4JVSB 1U81A 2DWOA 4OBEA 4Q18A 4ZO4A 3VMFA 3ZIAD 1QG2A 1RPZA 3L0PA 3O8DA 4QXAA 4OK6A 3TVTA 5IHPA 4Z1MA 3LLMA 4AIIA 1FX0B 1D9ZA 1N5LA 1VPLA 3QPVA 4KBGA 3QY0A 2MSCB 2J46A 1TADA 4MRVA 2E9SA 2D4HA 1VMAA 1ZU5A 2F1IA 2VO1A 3TQCA 4C3ZA 2PX0A 4PX9A 3UIEA 3A36A 3L0SA 1FP6A 4XSHA 2DPXA 1SVWA 1X8KA 2QGNA 1II8A 3RAPR 3VKWA 3WRXC 1TF5A 2OV2A 2FFQA 5GVRA 4DLVA 3VNVA 4PC3A 1CJUC 3BH7A 4CVNA 1SXJE 2ZJ5A 4A82A 4KI0A 1Q1BA 1FTSA 3BWDD 2O0JA 3LD9A 5FUVA 1MKYA 1E2GA 4WIAA 4QBHA 4UQOA 1S9HA 1T4GA 2QP9X 1CEEA 2A5FA 3BFKA 2RGBA 3QBVA 3QKSB 3B60A 2F43B 2V7QA 1P9RA 2VP5A 2G83A 2WJJA 1TAGA 2W0MA 2R65A 4MRRA 2XSZA 3A1WA 5EE1A 1GUAA 1ZIOA 3B78A 3LXRA 821PA 5G3YA 1NVWQ 2C96A 4MITA 1UBEA 2FWRA 3GCGA 2E87A 4CRWB 1IONA 1KK0A 3VX4A 4Q02A 3B82A 4DDWA 4QJ5A 3B85A 3ETLA 4D0LB 3NC1C 1ZAKA 2NQ2C 1Z5ZA 1Q21A 2GZAA 2QPAA 4IKEA 2J0VA 1OW3B 4QRHA 1ANKA 1GAJA 4UJ5A 4F4IA 2IA5A 2RGNA 4NH0A 1OJLA 3B1XA 4P4SB 5DISB 2OXCA 2ZYWX 2QM8A 3QI2A 2J45A 1W44A 2IT1A 3VAAA 2PT5A 4EPXA 3U61B 3BORA 3FFAA 5FBLB 3L0OA 2EU8A 1UKEA 3UMSA 3M4YA 4P3YA 1EK0A 4B73A 4PR0A 3HYTA 4NCJA 3NHBA 2IS4A 1YZUA 2UZIR 1S3SA 2FEMA 3RRMA 3CRW1 4C0KA 4CEIA 3CNNA 1GKIA 1Z2CA 1O87A 1AKYA 2YWEA 3DKVA 1EGAA 2L0XA 4KBFA 4XTRA 4MKFA 2HF9A 3BH6A 4TYYA 4ZIRA 1D2EA 2IS1A 2GXAA 5AR1A 5FPTA 2NZJA 3U3JA 3A1SA 1NN3A 3CX8A 2WSMA 2GRJA 3QF4A 1OF1A 3EZ6A 5E7IA 5DO9A 2FNAA 1H65A 3BBPA 3V9PA 4X8HA 1P62B 1OHHA 3RDPA 3CH4B 1G8YA 1JI0A 2PJRA 5DLQC 3ICQB 1R7RA 1JBKA 3WBKA 2ZVPX 2SHKA 3I62A 1ZUNB 4KFRA 2ZXUA 1P2UA 1SHKA 1XCPA 3CNOA 4YDSA 3NG1A 2D62A 4YMSA 4XVRA 3LW7A 4ASUA 2ZROA 1RKBA 2EYQA 3NH6A 4Q19A 1DAKA 3FMFA 3Q5DA 2W2XA 4US1R 1US8A 3HPRA 4C9BA 4DLUA 4LBYA 3K9GA 4YLGA 3E2IA 3LQQA 2XNSA 1W48A 4TZ6A 4AKGA 3SR0A 1VYVA 3VTKA 3L0IB 2VHJA 1VIYA 5J5CA 1DO0A 4LWZA 2C03A 3GLIA 3SQWA 1WGWA 1VHTA 1TF7A 2WWXA 1AM4D 1E79D 5DH9A 1N5KA 3GLFB 2UKDA 1G20E 3C5HA 4UKDA 3GMTA 2FG5A 3KQUA 4Q47A 5CJPA 1D2NA 3HR7A 2AFIE 5EQTA 4HDQB 2BHRA 2F3RA 2V9PA 4P4TA 3RS5A 2QTVB 5K8TA 3BB1A 3CNLA 4IVQA 2ZJOA 4A0FA 3NIBA 1Q1EA 3AM1A 5L3RA 2BKUA 5IRCD 4KO8A 5CYPA 4Z54A 3IIKA 1HQYE 4M8NE 4HB2A 2EQBA 2J9RA 1M8PA 2AD1A 3VU9A 2JIZA 4Y0VA 1E2QA 1FP7A 4U02A 1ZNYA 3B9QA 5HTKA 3VNUA 1XZPA 4DCSA 3EIEA 2IXFA 2A5JA 4N3NA 3W6OA 4A36A 3KZ1E 4CIDA 1WBBA 3TSOA 3KJEA 1XPUA 2QE7D 4AKEA 1W4AA 2ODWA 1G6OA 4ERNA 3NEYA 5JRZA 4TLCA 4KYIB 4QOSA 5AK0A 2JJ8A 1Q57A 4W5JA 2QROA 4LYAA 1NIJA 1W4CA 4IXMA 4PFSA 3GLGE 2REBA 1XZQA 2FSGA 2F43A 1E2HA 1IY1A 1C4OA 1R5NA 1YRAA 3K0FA 3UMRA 4IOLA 1NLYA 3X1ZA 1R6BX 4QBFA 1Z08A 4LI0A 4MH0R 4XVQA 1FNMA 4O25A 3RS7A 3OE7D 5EP1A 2QGZA 3SN6A 3SYLA 4XD7D 4JBYA 3QF7A 5DI3B 4D6PA 3BJIC 1IN7A 3V4RA 1GTVA 5KSPA 1RRGA 4A6PA 3RYTC 1MR3F 5JS7A 2QQ0A 2BMFA 2P5TB 1JAIA 2VP0A 2A2ZA 1E9EA 3DVLA 3MJRA 2QTHA 1FTNA 4EAQA 3FHTA 1II9A 1PLKA 4DWJA 1HV8A 2IK8A 4D4KA 4F93B 4DDVA 5GJBA 1AQUA 3C5CA 5H68A 3GJ7A 1E2KA 4XSGA 2BEKA 4JVLA 2GHIA 1WP9A 2JGNA 2YYZA 5KNCA 3NEJA 5H70A 3T35A 2FX3A 4Q1AA 1Z0IA 1KO1A 4ZCLA 4NPHA 4DIEA 4A9AA 3UWOA 4EKDA 5FUYA 3LO5A 1ONBA 2QRZA 3L8YA 1B23P 1KI8A 5EP3A 4NZYA 2C2HA 2HXSA 1T8TA 3R20A 4OHXA 3LY5A 3CRMA 2IEYA 3QEOA 2RAPA 4A0GA 1IXRC 1OXTA 4QKQA 1K5GA 1W2GA 1FFHA 1MABB 4X8OA 2VSXA 4QM7A 2JLYA 3QQ5A 2GAAA 2ZSFA 4J0QA 2BOVA 3AVWA 1FUKA 2EW1A 4WW0A 3ZYCA 1G17A 3THWA 4FXPA 2VHUA 3RWMB 1QHHA 1PLLA 1YZTA 2HJVA 3GJ4A 3CRQA 3ZJYA 2FSIA 1JEEA 1SVOA 3UWKA 4M22A 4PZLA 2WKRA 2X2FA 3AF4A 4US0R 2VHCA 1ESMA 2MSEB 2YNMA 2QMEA 1BYIA 2A9KA 1LVGA 2X77A 4KFSA 3KKNA 1PUIA 1UEJA 2JLUA 2OHFA 3ASZA 3PUXA 4A92A 2GXUA 3GFTA 1M2OB 1XJCA 1G41A 1DAIA 4UNSA 2ZJBA 4EFLA 2VSFA 1DAMA 2DWQA 3TLXA 4BFTA 1OYYA 1KK3A 1NLFA 1NSFA 1RW4A 4KVGA 4DLRA 4P32A 3KX2A 1KSFX 2CJWA 5FTJA 5IF9A 5JFGA 1TQ2A 3SNHA 3A37A 4EPWA 1G3QA 1FUUA 1IAQA 1LF5A 4NCIA 5L3QA 1E2LA 2ZRPA 1F6BA 5AUQA 3TK1A 4A0HA 2CEAA 1FW6A 1XPOA 3NDBB 3IDQA 4LBZA 3CPEA 1ZVQA 2GEDA 4CF7A 4AKIA 4Q1EA 1ZUHA 2BVNA 3BFVA 4RD1A 4BFSA 4TSFA 1EX7A 2J0UA 5CITA 2ZI5A 3IKJA 4DLZA 3T5GA 5D3QA 1N2CE 3AGPA 5TB5A 3UG7A 3CPJB 4PHTA 4QFMA 2DFTA 3LAWA 4JBXA 5J4VA 1Q3TA 2ZUDA 1XEXA 1Z28A 2WJIA 3SFVA 3QXCA 2N42A 1OT3A 2GESA 1JPJA 4FWIB 4GOJA 4EQ6A 3PENA 1QF9A 4GFDA 2PMDA 3RSOA 2YHSA 4HZUA 3HU2A 4FWTA 4LYFA 1XWIA 4TMZA 2GJ9A 1KZGB 1ZD8A 3KKMA 4G5OA 4IXNA 4C0LA 2GCNA 2C78A 1YJ5A 4EJSB 5FPYA 1NNEA 5F9HA 2ZVQX 3EC2A 1G5RA 2RCNA 4TYWA 4BFUA 1GNQA 4P4UA 1COWA 2C99A 4CEHB 1XX6A 2PJZA 4Q9KA 4B34A 2IHYA 4OI0A 1EXMA 3K0SA 3H86A 1VKJA 2AR7A 2F3TA 1Q44A 3B1YA 4DSTA 1XD2B 1AK2A 2ZPTX 4HEJA 2ZI6A 4CZ2A 1R0ZA 1NN0A 3ADKA 1IBRA 3V4FA 2FEOA 3VR3A 3WNDA 2WIBA 1P61B 1W5SA 4RKFA 1SVLA 2X1VA 3K8YA 4Q1CA 4W5HA 2O8BA 1QVAA 3QPWA 2QMOA 2ZE7A 1UBGA 1KI9A 5IDVA 4LHWA 5K8UA 1OKKA 1E9CA 1P5ZB 1W0KA 3OF5A 3VR6A 2OEPA 3QKRB 2JCSA 2I4IA 3PJRA 3QJYA 4PO1A 3KKQA 1E69A 4LYJA 4YDHB 4GDFA 1KDPA 2BM0A 3F5FA 4ZCMA 3BGWA 4RFSB 4QBIA 1XFAA 2CBZA 3BB4A 4KSBA 2J7PA 1L4YA 4PANA 4ACBA 4HAYA 1G3UA 4KLZA 3WHLA 4B48A 2C5LA 3T5DA 3TBKA 2BV3A 3GPLA 1T5IA 3CLVA 4UXHA 4L9SA 1ZC4A 1ZD1A 4HDOB 4Q9LA 3FKSD 3LX8A 2NO6A 2ZRJA 4Q4HA 2ZRGA 5AJXA 5KYKA 4LJ4A 3GLHE 1E2DA 3W6NA 2FFAA 1WMSA 1RRFA 3C15C 3OEED 4M4SA 3ZDQA 3AVXA 2OCBA 2WSSD 2GZHA 3MLEA 4QJ4A 2VTKA 1E98A 1QHNA 4Q48A 1X8LA 1T9HA 2IBMA 3GFOA 3AF1A 4MKIA 3VKHA 5CK5A 2EFHB 4NONA 4D4LA 2XXAB 1DG1G 1YQTA 4JZKA 1PUJA 4JSYA 1MO6A 4UNPA 4C2UA 5EXSA 1JR3A 1E9SA 3LW8A 3N70A 1NBMA 4LPSA 5P21A 3DM5A 2GNOA 5LD2B 1S9DA 3PXGA 3JZAA 2Q21A 2C95A 4G01B 4DIDA 4B3DA 2OBMA 1PV4A 1CJMA 3I92A 1QHGA 1E0JA 1KMHA 1S1CA 5F9FA 1GG2A 4A0RA 3CB4A 4DC9A 2AD5A 1LW7A 2R6DA 1S4QA 1R8QA 2OUKA 2OXRA 4AURA 3K0CC 5TDHA 4TMKA 1MV5A 3CWZA 4JKIA 5CDFA 5J4YA 2ZE8A 4DXAA 2Z4RA 2RGGA 4JLMA 1CP2A 1VYUA 4JMPA 2R6AA 3WMFA 1II8B 2VP2A 2ZAMA 3FHOA 2ORIA 1XEWY 1EFRA 1ZUIA 5CB6A 2J0SA 4BASA 2EVWX 2KB0A 1NY5A 1TEVA 3AF3A 3KQHA 3GJXC 1A7JA 5K8LA 3WYAA 3SEAA 3ICEA 5DGXA 2Z6VA 1Z0AA 2QSZA 4BQSA 4YXWD 4G3XA 2XNDD 4LJAA 2Q9BA 5TXGA 2CNWA 1Z0JA 1XD8A 4HUQA 2XB2A 5AUNB 4WZAE 1N0VC 5F98A 4KCGA 2A5DA 4QGAA 3HR8A 1OXXK 2ZRNA 1AN0A 5JHHB 4ESHA 1Z06A 1DS6A 2IYTA 3CO5A 4TYPA 1YRBA 3GJ5A 3ZVLA 4DUGA 1W0JD 4OKSA 1MRNA 3GQBA 3C14C 3PIRA 1G5TA 2PEYA 1KO7A 4NCHA 2GF9A 4S2EA 4URVR 3AKDA 3K0AA 3QVVA 3KXIA 4ON9A 4I81A 1NMXA 3O47A 2QRNA 2QT1A 2ZAOA 2P3SA 3IPYA 5G53C 1NG9A 1W46A 2B7CA 2J3EA 2I3BA 1KK2A 4OQNA 5FPKA 3EXAA 3NBZC 2C9YA 4L5BA 4LOAA 4HAVA 5FI1B 4TL9A 4PXAA 2JJ2A 4LJ9A 4B3CA 1X6VA 2VA8A 3LBIA 5BQ5A 4JYBA 5EP2A 1SXJA 3H2YA 1UJ2A 1E32A 2ZRBA 2HF8A 4Z8YA 3U6KA 5HKKD 2XTNA 2G0NA 4KJZA 2WAXA 2NOAA 1G4UR 2C98A 2IF2A 2QAGC 1IN8A 3HWSA 4PPNA 1ZM3A 4P31A 4RD4A 3GP8A 2IUSA 3KXLA 2V3CC 1IOZA 4XTCS 1MO3A 3IIMA 1HY3A 4PSKA 2IX3A 3QENA 5ANRB 5KDLA 3WNCA 1JQJC 4DCNA 4CEIB 1P2VA 5FTKA 3KUCA 1J8MF 1XD2A 2WICA 3PCRB 3PVSA 1N5IA 3I3SR 3KL4A 2A30A 4LUCA 2RGDA 5KUTA 4G1UC 4V0ME 2ZR9A 3GFPA 5EE3A 3EZ9A 5GJWC 1XTSA 5CIWA 5EZ6B 1E9FA 3QF4B 3KKPA 5C2JB 3CF0A 5JS8A 2WKPA 1JAHA 4QC2A 2VYFA 3TKLA 2LKDA 2W6IA 1T6NA 4U7DA 2FFBA 2O8CB 2D7CA 4EIWA 1ZM2A 3AVPA 1OH5A 1AZSC 1XU4A 1CRQA 3AP3A 4L16A 2OM2A 4TWZA 4PC6A 2G1KA 1FNNA 5LPNA 5IT5A 2OSBA 1M6NA 2ATXA 2CDNA 1KI3A 3VX3A 4A15A 5CLQA 2KE5A 2R44A 4IW3B 3SQXA 3THYA 1DPFA 5JRJA 4NYMQ 2CL6X 2ZE6A 1US8B 3AF0A 4LJ5A 3CF2A 3FKQA 5FTLA 4HAUA 3W9YA 3ASYA 4AWXA 3B7GA 4Q4JA 2IL1A 3AV0B 5FH9A 3U44A 1XTIA 1P2TA 5IK2A 1Z6AA 1E9AA 3GLIB 1XXHE 3H84A 2IS6A 4QNRA 2ZU0C 5AUOB 4IOJA 4Q9IA 4WAUA 4OQFA 3T1QA 2RGEA 2HLDD 5FL3A 3HDTA 3IGFA 4B6EA 1GL7A 1N6KA 3NBFA 2GILA 3CIOA 1OXUA 4TQ9A 2V54A 1VCMA 3I8SA 3B13B 3B9PA 3IHLA 3OFNA 4OI4A 4OK5A 2XOKA 3J81k 1UKVY 5BYJA 1CKEA 4BLPA 3W6PA 5KTYA 2H1LA 2C04A 4CW7A 2GJAA 1YVDA 2X8AA 1TEXA 1U8ZA 1TQDA 3P26A 1G21E 4YONB 3AVVA 1R10A 2QQEA 4HATA 2CVFA 3IBYA 4TZ0A 3VU9B 2HCBA 2ZR7A 4I99A 2DYKA 5C4GB 1Q3HA 2WWGA 4I1SA 1QDEA 2OBNA 4D81A 5BN4A 2A7QA 3OAAA 3QUSA 1DAFA 4IFBA 5JWOA 2BMJA 4LC1A 4ABYA 3KKOA 5EJEA 2AKYA 4RSGA 3UATA 3WHKA 3KB1A 5FOTA 4BE7B 4L15A 4AD8A 1WB9A 4M21A 4BUJA 4O3MA 1R2QA 4XWOA 3EZ7A 3BAFA 4TT3D 3EARA 4W5WA 1D6JA 1HEIA 4NYJQ 2J1LA 2ZJ8A 1N6IA 1UADA 1U8YA 2KBFA 2B8TA 2BBSA 3QXHA 4V0KA 4LHVA 5K8IA 4RKEA 3G0HA 5KNBA 3RABA 1G6HA 2ZRLA 3K0FB 4ZI3A 1TU3A 4QL3A 4TMVA 2FFHA 4UNNA 3JZMA 4ZCIA 2D74A 3LBHA 2EFEB 5DN6A 1SHZA 1DEKA 3I8XA 1NSTA 2X19A 2IYUA 2ZEJA 2HDNB 4JT2A 2OFXA 4GMDA 5B30A 2AWOA 3ZS9A 1K6MA 1XPRA 2C9CA 3EC1A 2B6HA 3EA0A 4MRPA 3ZQJA 3VHLB 1Z6GA 1ZIPA 2GBLC 2VPPA 1HURA 4KFTA 4H9GA 1E99A 1WXQA 3U3OA 1F60A 5TARA 2Z5FA 1UEIA 4PC7A 3T1OA 2OILA 3AVYA 1RC8A 5DHAA 3SC3A 1YHNA 1E1QD 1BOFA 4PO9A 4TL7A 5JSZA 1D9XA 4ZPXA 3P32A 1IJFA 3MJHA 3CF6R 1JJ7A 1NLZA 2A5YB 4R71A 3AKEA 1Z63A 1UDWA 3D6TB 4C4PA 5C18A 4YMTA 3CX7A 3BOSA 3KDSE 3QKUA 1G64A 3OIWA 2XZPA 3VFDA 4AG5A 4TL8A 4RZXA 2ZYTX 4NE2A 3THOA 1U0LA 2C9OA 1X86B 1DO2A 2OT3B 2ZI9A 4LK2A 3TIFA 2TMKA 1WA5A 1KY3A 1W36B 4MDEA 3EA5A 1IN5A 1JPNA 2QENA 3R9WA 4W9MC 2G0TA 1G7CA 1XEFA 4RCZA 3ZVRA 2PT7A 4PQFA 4L9WA 5GJVC 2VSOA 1E1RA 2O8DA 3TGPA 1NG1A 1YR8A 1Z22A 3RC3A 4RZ3A 1IY2A 3CZQA 5BWMA 2GCOB 3QG5A 4TTRA 4PHFA 1AQYA 2OAQ1 2V4ZA 4KU4A 3THWB 1NVUQ 1QHHB 2KJQA 2R9VA 3U3KA 1G3IA 1GWNA 2O8CA 2V6IA 2P67A 2CMKA 1XDBA 1RIFA 1UKYA 2WOJA 2NPFA 4JS0A 3R9XA 3W90A 2G3YA 1F48A 4FCWA 5D3MB 4I1UA 4TTPA 2ASEA 1TTTA 2OO7A 2R2AA 1DTSA 4FI3C 4DJTA 2R62A 2CLSA 3OIVA 3F0TA 4FCVA 1N0WA 3TJZA 5KSYA 2ZRHA 1I4TD 1HT2E 4DDTA 3TAUA 3A1UA 5L8VA 5CM8B 1G8HA 4PTLA 2CJWB 3OEHA 4GBMA 1ELOA 3TMKA 3RS0A 2NO1A 4GP6A 3EWAA 3ZGXA 2J5XA 2QMUA 4OHYA 4LBWA 1Z8FA 3PEUA 1KSGA 5L3QB 3AVUA 4PHGA 3I4LA 4RFVA 4EPVA 1P60A 3L2OB 4RZUA 1R5OA 2NIPA 2J0UB 5EE0A 1F2TA 1XEWX 2H17A 2WPDD 3CBQA 4G5RA 1SULA 2LWIA 3E5HA 1M7BA 4WA7A 3H0KA 4ESVA 3BK7A 2KWIA 4LHXA 1RFLA 2JLRA 1XEXB 4LPKA 3WRYC 1XMIA 4C0AC 4EQ6B 1ZP6A 3MWKA 2VH5R 4HZUB 4DT1A 1NJGA 1FMJA 2WHXA 2HUPA 3FDIA 1LB1B 2CXXA 1K5DA 5CLLA 2WKQA 2YKGA 5FOVA 1A4RA 4C2TA 3SI7A 3ADBA 3CH5A 1XTJA 1W7AA 4XWKA 2Z0MA 2QPTA 4ZKEA 1CXZA 3Q8XB 3KTAB 1SKYE 4A2WA 2PH1A 1N6NA 2QAGA 3L82B 3ZZTA 3SHFA 2ONJA 1E2PA 3Q72A 4EFMA 5JCZA 4GOXA 1T0JB 4LY6A 4JSTA 3W8NA 5JWHA 5KU1A 1E0AA 2GKSA 2FA9A 1D2MA 3SHWA 1M7GA 4MYHA 3EIHA 3SYNA 2JJ1D 5FL7A 3U3RA 2O8BB 3A58B 4CEJA 1Z0KA 2B21A 2A5GA 2BMEA 4PHHA 5FTNA 2FJUA 2IYZA 4OQLA 4DCUA 2E1RA 2QSYA 4LJ6A 4WXRA 2DY1A 2BEJA 2GDJA 3U6BA 1SQ5A 2AXNA 5A5GA 2HXYA 4LDJA 3K53A 3FOZA 2W6JA 4R2HA 4FMDB 3RSLA 4NTZA 4B3GA 3PEYA 1EFHA 1Q1QA 5BN5A 1MO4A 1VECA 4LCBA 3OHMA 1XD9A 2P2LA 2OCPA 3IEVA 1Z07A 2JEOA 1SVIA 2RGAA 5J4HA 3B5JA 4Q4HB 5DIFA 4NYMR 5DSZA 1TUEA 4KITB 1DOAA 2BMDA 2ZANA 2JDID 1ZD9A 1SZPA 5EXXA 4JLJA 4HB4A 4ZI2A 4B6FA 2W0SA 5L3SA 4AYWA 4XIGS 1V43A 1HTWA 2EWVA 1EX6A 4IDQA 3WMGA 3D3QA 4EUNA 2BDTA 3I1FA 3PEVA 4HLQB 2YZ2A 4JLAA 1H8EA 2Q3MA 4JLNA 1F5NA 1H8HA 3AKCA 3VR5A 3GEEA 2GCOA 3E1SA 3MSXA 5B2ZA 2IEZA 2BWJA 1KAOA 1G19A 1KMHB 1E2JA 2GXQA 4OHZA 1YZGA 1CJKC 2MSDB 4WZBE 3IIJA 1GRQA 2D3WA 721PA 1IQPA 3AP2A 3D8BA 3KUDA 1L4UA 2CK3A 4D25A 3IHWA 2YOHA 5EP4A 2ZRKA 3JVVA 3ZLJA 1W4BA 1N0UA 5D3MA 3C16C 1GVNB 4KODA 3K70D 3PITA 4PPQA 3REFA 4YQFA 1Z0FA 1VG8A 2XGJA 1KMQA 3HJNA 2DFLA 3GLHA 4D0NA 3ZD6A 2CCJA 2AX4A 4BZQA 2QPOA 3DOFA 2FPKA 4NYIR 2ZETA 4OQMA 5JZVA 4LJ8A 2ZM5A 4JIMA 3CRRA 4FIDA 1V5WA 4Q7KA 1OH6A 1G8FA 4E07A 1WF3A 4HI0E 5ELXA 4HUQB 2GJ8A 3CUEF 1UPTA 3BRWD 1KI7A 1NJFA 3QNUA 4NYJR 2JLVA 4FINA 4W7SA 3RS2A 2JLQA 4BRUA 2ODNA 3FYHA 2PZGA 2HV8A 3CX6A 1S0UA 5JBQA 2R6FA 1W47A 4B47A 1Q12A 3KJHA 4MQBA 1UBCA 5AUPB 2Q6TA 1QHSA 1NP6A 4LJ7A 2GJSA 4TYNA 3V00A 2IYRA 4LV8B 1NKTA 1RZ3A 1E0SA 1LS1A 3K0AB 3PUWA 4PQRA 3ZIAA 2IWRA 2NG1A 3CPHA 4JL6A 2V7QD 3X1XA 2AN9A 1CBUA 1KI4A 2GBLA 1OXSC 2I1QA 1TQ6A 3D31A 3LA6A 2O0KA 4F38A 5KDDA 1CIPA 2H57A 3BIFA 1PLJA 3K70C 5LD2C 1T0HB 1YR7A 2IUTA 3X2SA 4LGMA 4DVGA 2RGXA 3DMDA 1SXJB 2XAUA 5H8WA 4WVFA 3AUXA 1VG9B 3RRZA 3Q9LA 4V0NA 3UXMA 1GITA 4DB2A 1EG7A 1XTRA 5HE8A 1YU9A 3U2QA 2H16A 3C7KA 2XITA 4JT4A 4ZDJA 4PPFA 1W2HA 1U2RA 1Z0DA 2GF0A 2O5VA 4HSEA 2A78A 3KTAA 3WYGA 1NN5A 1ZW6A 4R2IA 3LWNA 3T34A 4OHVA 3TSZA 1IXSB 4KHZA 4A1FA 1E9BA 4B3XA 5KPDA 3QIAA 3CRVA 5E4FA 3DKPA 1T3HA 1J99A 1M7HA 4V0OA 4B3BA 3ADCA 2ZS8A 4LRWA 4DSOA 2WJVA 3X1DA 2DB3A 3LX5A 3WXMA 1GKUB 3DZDA 2O0HA 1QZXA 2IXGA 5E7JA 4A8JC 2AKAB 1XMJA 4ITRC 2NZ8A 3WP0A 4ARZA 1RYHA 4V03A 1DARA 3O8BA 4JLOA 1Q22A 4C30A 4BLRA 4DBLC 1LV7A 5FBVB 1NN1A 1DADA 2Z83A 5DHFA 4F92B 4DCTA 1NI3A 4HZIA 4IOMA 1NRJB 4JL5A 2FMXA 4RVCA 3RS4A 3IEUA 1X3SA 3T15A 3ADDA 2NTYC 3THYB 3CR7A 3W8RA 3B6EA 3W3AA 1XTQA 1DELA 4GPTA 2EWWA 5FOWA 4QJ3A 4A6XA 4DB4A 1OB5A 1KDRA 4E5UA 5FR1A 4Q4JB 3U44B 1KO4A 4IVRA 1N6HA 5G41A 1MH1A 3FVQA 2NO9A 4R7ZA 1GL9B 2ATVA 2QP4A 5F3WB 1GIAA 1O3YA 1JNYA 4ASUD 4U00A 2Q9CA 3CZPA 1XJ0A 3DDCA 4V0MA 4B71A 2QI9C 2GK7A 2OLJA 2CVHA 5B58C 2ZQ5A 4Q03A 2DR3A 2WIAA 2Z43A 3HU1A 4GSYA 1ZMXA 4M2LA 421PA 2VLIA 5FBWB 1U8AA 1P9WA 1YZNA 3TW8B 2WVJA 3NVAA 3THXA 3W3ZB 2BKEA 1ZJ6A 1N3BA 4JLVA 3RWOA 2QTFA 4JJZA 1Z6XA 4GRAA 4RJLA 2PZEA 3VQTA 5DI9A 4K81B 4DLSA 4BPBA 2P0EA 1CU1A 3CR8A 3AH8A 4X8MA 2F1JA 3REGA 1KSJA 1QHIA 4DEXA 1XB2A 2VF8A 3C8UA 1R0YA 2ANCA 4NL4H 3GLFE 1RRPA 3KJIA 1IN4A 3DZ8A 3BC1A 4JKYA 3WYFA 2D2FA 4UNRA 2XJ9A 2ZI7A 5BYKA 1G4AE 3T12A 4Q4AA 2QM7A 2WJHA 4MDFA 3ECCA 3JVUA 1ZBDA 4IJMA 1XXHA 3W5JA 2D7DA 4N0EA 2JIZD 4WXPA 1W5TA 1CULC 2GXSA 3OIUA 1UF9A 1MO5A 4LBVA 3DPUA 1U94A 3Q7QA 4PZYA 1X1SA 3D7MA 1E79A 1MOZA 5FPSA 3K9LA 3FE2A 4MYCA 4M9XA 5JI3E 3KQLA 3QPUA 2C77A 3AF2A 2VP9A 4B76A 2GWHA 1NMYA 5HPYB 5JECA 1QRAA 2DHRA 4AI6A 2GAOA 3AVQA 1G8GA 3FGNA 3QG1A 2P6UA 4Q1BA 1OH7A 2WAYA 4M1SA 4AK9A 4B75A 5BW8A 4IRUB 4F4CA 1E2IA 3SDZA 3AEZA 2ZSAA 5KSOA 2CCGA 3RNLA 3WNBA 4HLCA 3BD9A 1QBKC 4FMBB 1E0KA 1KKMA 1KGDA 2VEDA 5JSZB 4OI2A 1BO6A 4LHZA 1E3MA 1TMKA 5KOYA 2LKCA 1JJVA 4JLPA 1LF0A 3S1AA 1ZCAA 4QGHA 2QE7A 3DM9B 3GLGB 2WWFA 1FPMA 2ODBA 3NBYC 4TQAA 3A4NA 2HJGA 4TMTA 3SBEA 4D0GA 5EE5B 5B57C 3TW4A 5SZIA 4IEEA 4M1OA 3FWYA 3LH5A 2YWHA 1JEDA 3QKTA 5FI0B 2YINC 1U0HC 3R7WA 3O8CA 1M74A 1A2BA 2ZRFA 1ZNXA 4E03A 4II7A 4MGZR 1J90A 1KNXA 5A0FA 3QSYA 1N5JA 1AA9A 2PMKA 2ZI3A 2ZJZA 2LCFA 2O8DB 2ZUBA 2AXPA 1VCOA 4PO8A 3OE7A 5TMPA 3EPJA 4XD7A 1HQCA 4IDOA 2PEZA 1CR4A 4Q21A 5H1YA 2ZU6A 4MA4A 4TMWA 1EFUA 2J41A 3VR2A 1BH2A 1GFIA 4FW9A 4CGZA 3I73A 4KAXA 1XF9A 1RVDA 2N1BA 1G16A 2Q0HA 2WWHA 3LXXA 5SZJA 3KQKA 2GVDC 2W83A 1L2TA 1NIPA 4Q5IA 4NKRA 4BEJA 3RRYA 4DHEA 3B1VA 4DKXA 5DYGA 4OK3A 2ZSDA 4I4LA 1NBME 2ZJ2A 2WJYA 3AVOA 4NBSA 4X8LA 2ZREA 3X1WA 1T5LA 2MMCA 2QY9A 2O8FB 2IYSA 2ZR0A 4QGFA 1UFQA 2QMHA 3HU3A 5KO2A 4MGYR 1KAGA 5FUXA 4Q1DA 2H18A 3ONWA 3VR1A 5JJIA 3RVBA 4EPTA 2R6GA 3EAQA 1VCIA 2PCLA 2G88A 4JVNA 3T1VA 2ZE5A 1GNPA 2NGRA 3H1TA 4KXFB 1VTKA 3R8CA 1T3SA 1HE1C 3B8HA 1CS4C 2IYYA 4NMMA 2FOLA 2ZRAA 4XWAA 3NBXX 2CE2X 4JL8A 1AJEA 1E9RA 3TVDA 3P1JA 2IW3A 1F2TB 2KI5A 2B7BA 1KO5A 3MUFA 3RANA 3U4QA 2VP6A 2EFCB 1ZNWA 3A8TA 3K9HA 3QOFA 3SE0A 4E22A 2AK2A 4HAZA 4RD2A 3MFYA 2GETA 1Z83A 5EUQB 3KFXA 2F7SA 3TAHA 1KI6A 2QBYA 2OAP1 1Q20A 1WBDA 4P0TA 2VRWA 4O2RA 4AKHA 4DT1B 2YC2C 3Q3JB 1I4DD 2J59A 2ZS9A 4TSFD 3M0EA 3Q85A 2DWPA 4TMXA 2ZSBA 1F3OA 2FPMA 1P6XA 1DVRA 2B92A 4NYIQ 4GZMA 3GJ6A 3GJ0A 2FGKA 4DCVA 4GOKA 4Q00A 3PQCA 2QT0A 3R9IA 1S1MA 4JBWA 1UKZA 4ACAA 2PX3A 1CTQA 3FB4A 4PSVA 1F2UA 1GOTA 2IYWA 2HCJB 1AZTA 4QG7A 4NCNA 4B2LA 2QAGB 4UNQA 4LSGA 6Q21A 2IF0A 5C1BA 2X2EA 2ORVA 1IHUA 2CL7X 2HYIC 1I4LD 4BFVA 1KI2A 4FD2A 2V55B 5BN3A 1CR1A 3IBGA 2XZLA 1N6PA 1ZU4A 1QHYA 5FBQB 1GKYA 2B8WA 2FV8A 2ZIAA 3A1TA 1COWD 1NY6A 1Z29A 2F1RA 3FHCB 1A82A 3HP1A 4LV5B 4CEJB 1YZQA 1U9IC 2QEQA 4DLTA 2MMGA 1ZINA 2F55A 4ZDWA 4G0NA 2GEUA 3FFBA 4G5SA 2H92A 2P5SA 4YC7A 1I2DA 4MYUA 1UAAA 1RYFA 4FMDF 3RHFA 4HB3A 2FZ4A 4OJQA 4Q9HA 1X1RA 2PBRA 3VR4A 4A8JA 4BFYA 5HCIA 5LBIA 3SJAA 4C0SA 4QM6A 1EFTA 121PA 3GEIA 4LX0A 1KZ7B 4QHTA 1R0WA 5HE9A 3ZD7A 2GTPA 1C1YA 1KNQA 1FZQA 4MRSA 3ND9A 2XJ4A 2IYLD 1OH8A 3IO3A 3F8TA 4V0LA 4Z8XA 2GJKA 3DHWC 4PQYA 2BIFA 4JLBA 4BGDA 1OKKD 3PFIA 1W0KD 1KO8A 3GLGA 4JLDA 4US2R 3MWLA 4Q4LA 1ZM7A 3U3MA 2R6CA 3T61A 1D5CA 2F9LA 2OFOA 2WOOA 1E4VA 3BFXA 2J7PD 4RD0A 4O2LA 3ND8A 1AGRA 3TSWA 2JLZA 3IILA 2O8EA 5L3SB 1PJRA 1KDOA 1N6LA 4MGIR 3KXKA 1N6OA 1GILA 1BS1A 1CR0A 2IYVA 1P7CA 2FE4A 4ZDIA 1U98A 4HDCA 4IOKA 4EDHA 5FOUA 2ANBA 2WWYA 2CLCX 3FPAA 1GL6A 1GZSA 1OFUX 4A2QA 1VDZA 2QAJA 3PEWA 4LV6A 3BS4A 1OIVA 3EW9A 3BERA 1ZNZA 4BFXA 3QXSA 4EFNA 5HZKA 2AL7A 4KV9A 1JR3D 3F3YA 2Q3HA 1NBMD 3GJ3A 1G18A 1YKSA 4URUR 3K0CA 5DE3A 4Y0AA 1OE0A 5E95A 5EXTA 1CJTC 4QHYA 5SZHB 1OSNA 2D06A 2NO0A 3I72A 4B32A 3GLHB 4C7OA 3MAAC 2ECKA 3TUJC 3Q7PA 4M53A 4D26A 3FKSA 4HB0A 2G77B 4UXIA 4RD6A 1XCGB 2O8FA 1LNZA 3KB2A 1XTKA 3MWJA 4JYCA 1S8FA 2WTUA 3MMPA 1E96A 5JI2E 4BZPA 5KHOC 2P6RA 2R8RA 3TUZC 4PC2A 2QUZA 2CLDX 3OEEA 2WSSA 4M1WA 4OJKA 2YV5A 3LVQE 1EFRD 1KI1A 4C0QC 3KJGA 4G5GA 3NWJA 3O8RA 1JALA 2GA8A 2YWFA 2G9NA 3OESA 2IC5A 1TQ4A 2Q9AA 1CJVC 1S2MA 4JVMA 4HUTA 1G1MA 1XNJA 3MGCA 2CNWD 4DZZA 5EXPA 5J47A 4NP6A 4D2IA 4RCYA 1GSIA 1TX4B 4D4JA 2H7VA 4ZV4A 1R8SA 2BC9A 3QBTA 4YMWA 3K0EA 1P9NA 2OCAA 4TLDA 1BMFD 1XBTA 3H4MA 1IXZA 3FMPB 4IEIA 3OIYA 4DUGD 5M04A 1RJ9A 2WV9A 4S35A 4LZZA 5JEEA 5JJLA 2FDCA 4TLEA 4K46A 2IHBA 1GNRA 4OYHA 2VP4A 2CL0X 4IFEA 4QGGA 3KQNA 2GZDA 1OIXA 1G5PA 1I2MA 5G3ZA 2PCJA 2GVZC 2WBLC 3OZXA 1FX0A 2CE7A 4KVAA 4YXWA 4F7WA 2IS2A 2XNDA 1KJWA 2NO7A 1ESNA 4BFZA 4TLBA 2RHMA 2JJ2D 2IWHA 4G5QA 1YZKA 3BE4A 2ZJAA 1AGPA 4M1MA 1SXJD 4PAQA 1W4RA 3SOPA 2OCYC 3LBNA 1NVVQ 4HAWA 1PVOA 1GRRA 1X8JA 4HLDA 1P4SA 1BKDR 4XJXA 4B74A 4Q66C 1Q1ZA 4RZ2A 2ONKA 3ZVMA 4GT1A 4M1KA 1IN6A 1W0JA 1KK1A 2WMOB 4HLUC 4I1OA 4GL2A 5AJZA 1PZNA 1J7KA 1VG1A 2J7KA 5JLJA 1UDXA 1P3JA 3M6AA 4DEYA 5TY0A 3U60B 3QKSA 1HE8B 2WJGA 4ARZB 4UJ3A 4Q7JB 4RY2A 3GJ8A 2HYDA 1KJYA 1E2EA 2HEIA 4N1AA 1FOEB 3EZFA 3AGQA 2OLKA 3I5YA 1GDDA 1MT0A 1TF2A 4WOPA 2DFNA 2J0QA 2W6ID 2FH5B 3BB3A 5CYOA 5HKKA 2FGJA 2FSFA 1TNDA 2GCPA 3AUYA 1OLOA 1XCMA 1Z6TA 2EYUA 4BEBA 2W2TA 3K09C 3FMIA 3IUYA 2XZOA 3I5XA 3ZH9B 3DL0A 8OHMA 4URZR 1SVSA 2F1HA 4OQXA 4DLWA 1SXJC 1YR9A 2VQSA 4D4MA 3UMFA 4IDNA 5EZ5A 4BECA 4TLAA 4EJSC 4P4SA 4IVPA 1KHTA 3P4XA 5E7MA 1A5TA 3CKLA 4H1VA 3W34A 4C0HA 2IXEA 3IPXA 3RC8A 4PAOA 4XH9B 3GEHA 3U7FB 3WMEA 2A3RA 2QA5A 3THXB 3SJZA 3A6PC 2PLRA 3PUYA 3G82C 5IK2D 3NH9A 3WP1B 1Z6YA 1OPXA 4KYUA 1OFIA 3LRPA 3LFUA 1DAGA 3AKYA 4BZXA 2BCGY 2GK6A 1OB2A 3SJBA 3QXJA 5CB8A 3SZRA 2DFKB 4MKHA 3GLIE 3RRNA 1ZRHA 2EFDB 1LY1A 4YMVA 2WMNB 1P75A 4MKGA 3OFND 1UBFA 2XOKD 3MD0A 1AS0A 1KDTA 1DAEA 3AB3A 1A1VA 4DLYA 3DMNA 1E2MA 4Q4AB 5JEDA 4Z1MD 1G7SA 2Y8EA 1QG4A 1XXHB 5HR5A 2UZ3A 5FPHA 1OYWA 1G3MA 3QVUA 1FQJA 4HYYA 3N2EA 2Q3FA 4ZKDA 4JLKA 2AWNA 2OE2A 4M9ZA 1E6CA 3OAAD 2CHGA 4PSAA 4DLXA 3DO6A 2RHDA 3WY9A 1E4YA 5JCPA 1R4AA 4KLNA 4KSCA 4B44A 5J40A 3TH5A 1B0UA 2HLDA 4M9SA 4D80A 5C46F 2UVQA 2JA1A 1G291 5JMTA 1DBSA 1KIMA 1JQLB 2P6NA 4NCKA 4V02A 1AS2A 2ZITA 1KJZA 2V1XA 2WM9B 221PA 4UXJA 1CR2A 2OESA 2OBLA 3SJCA 4DDUA 4LC0A 4MUBA 1LFDB 5FUWA 1VHLA 3UPUA 1Z2AA 3U7HB 1NKSA 3TNFA 1WRBA 2ZUCA 4MUAA 1U9IA 1ZYUA 3TRFA 2O52A 3IQWA 1M34E 1VG0B 2OFWA 2RGCA 3KFVA 5CK4A 3GLFA 2JASA 5DN6D 5SZKB 2W58A 3A4LA 3G5UA 2XSZD 2YJTD 4QBGB 1FMLA 3PUZA 1S3GA 4URXR 4HAXA 1JR6A 1DAHA 5J4KA 2XEXA 4M9QA 3LNCA 3S1AB 1LS6A 1MRSA 1UM8A 2EFGA 2QZ4A 2REOA 5AJWA 3W5IA 3ZZUA 3CM0A 4XVUA 5B64A 1G7RA 1OIWA 2V6JA 5J4LA 3PUVA 3K9NA 3DEFA 2W2VA 4TT3A 2IUUA 1T91A 5JHGB 1CF4A 2K5UA 1BIFA 5JWRA 4M0LA 5EUMA 5HZHA 2AFHE 1Y3AA 5AWFC 3PV0A 5AJYA 3R7WB 2YWGA 3E70C 3UK6A 4L4UA 1U99A 2C8VA 2BBTA 2ZSEA 4MRNA 4NDZA 4OL0A 1SGWA 3TUIC 4POAA 5EE9A 1XMVA 1VYTA 4M1TA 3GD7A 1KKLA 4NU0A 4PC1A 2PZFA 2BJVA 2FPLA 3NXSA 4A4DA 2ZYVX 3AVTA 1P73A 3VKGA 1JECA 1WCV1 4PZZA 1OXVA 2W00A 5DYIA 5L3VA 5LDDC 1HT1E 1U0JA 4FCTA 4TTQA 1SVMA 3NDPA 2ODEA 1GP2A 1E1RD 2WZQA 2ORWA 1E1QA 1NMZA 1II0A 1IY0A 1R0XA 1OFHA 2ZRDA 4DRZA 2RB4A 5DI3A 1HA3A 3N2IA 3SBDA 1W1WA 2ZS7A 3UG6A 3I61A 4TYQA 4U5XA 1IJEA 5AJVB 1OHHD 1ZM9A 3SYKA 4R9UC 1L8QA 1E2FA 2NPIA 5FR2A
chains in the Genus database with same CATH superfamily
4DMGA 3VISA 1XRRA 3UC5A 1PNOA 3PRYA 3JQGA 1Q0PA 3OEHD 4OA8A 4BP9A 3NM6B 3QQPA 3KKEA 1CP3A 1N25A 4X7PA 2ERYA 4DNFA 2R8PA 1QAQA 3K70B 1YUNA 3NRCA 5TQ0B 3PFFA 1JMVA 3UAYA 1F2UB 2ZB7A 1GTJ1 3HO6A 3L4KA 1YVIA 1CUBA 3BXZA 3M6FA 2EIKC 1OASA 3K0HA 3GUHA 2JIBA 2OU6A 3KPVA 4AYTA 5C51B 5JNRA 5JATA 2GA9A 3Q7LA 4HLUA 3U37A 3K9BA 4CLOB 3HG7A 2C4MA 2REXB 6LDHA 3R09A 4KFCA 1DBWA 3ZS8A 1E7RA 2ZJYA 5TVKA 5FHQA 4EITA 4J3JA 1KOFA 3FOAA 3MG9A 4OHFA 3P2KA 3B6ZA 1YZCA 4AJHA 1KYIA 2G6BA 1NVXQ 3WQRA 3ACBA 2FR8C 1JP7A 1OZAA 3F2IA 4EPYA 2QTZA 4EJSA 1H6GA 3C3EA 1USKA 1DG3A 1YI8A 2O14A 1G3RA 4ID9A 4XDZA 5KPJA 3RIEA 5LFAA 4PXYA 2VQDA 2PZ8A 3N5KA 2L19A 1G8XA 2CHVA 4REOA 3SK0A 3LO8A 1UCFA 2X1MA 3IFSA 3N87A 1PR9A 2QL6A 3LVRE 2PIDA 1ZCBA 2P0AA 5F2EA 2LDXA 2DKNA 3QVYA 1U7PA 1GTZA 4HQKA 2PGLA 2WILA 3BJZA 1F8UA 4HXGA 4HYQA 4EMTA 3L46A 4IP0A 3CXUA 2VJKA 4N7RA 5PNTA 1L9XA 1YE8A 2RG7A 2JKYA 4COOA 5FPQA 1GO2A 4XB2A 3DBIA 3RFXA 4MS3A 5F7ZA 1ETUA 1E2NA 2Q6VA 5EIOA 2NYVA 3O8DA 3QV1A 5MFPA 4ZK6A 4BU0A 4MRVA 5DLPA 2F1IA 2VO1A 1TAUA 3UMCA 2R11A 4UBMA 1L4EA 3M1LA 2SBTA 1TCAA 3MTIA 5DYTA 4A82A 1XCBA 4KI0A 3WJ1A 1CEEA 3FMSA 1ZHTA 2AQIA 4QXMA 4GZ3A 2FHPA 5H3CA 2XSZA 5LP6F 4OQPA 2ESRA 2GPWA 3HJBA 2WUVA 4KAFA 1AX9A 1KAMA 1PK8A 2IXAA 2NQ2C 2QPAA 1Q3KA 4JXKA 1ANKA 1N2XA 1YB1A 5DM1A 1GGMA 2AA3A 2PWPA 1G8JA 2LXNA 4R1SA 2PZMA 3WGQA 1W44A 2IQ5A 3TECE 4NOLA 1TKBA 1TPYA 5BQHA 2IS4A 3U40A 3R40A 2FEMA 5JAIA 1T4MA 1GKIA 4KBFA 2O3TA 2LRHA 3PNKA 4MKFA 4TYYA 5CCEA 5KVVA 1UFKA 3NKFA 1PBNA 2NXEA 4JLWA 4JEAA 3FNRA 1B0PA 1TWCA 4NPAA 3DAFA 1G8YA 3X2EA 3EUEA 2EPNA 1LNSA 4DMLA 3OQHA 4KUHA 1XCPA 3NG1A 5JUWA 4KR0A 1Q6ZA 3KLOA 3E2IA 4WXHA 4MEJA 3DLIA 2E2WA 1MMFB 3PXUA 3CNHA 1VL8A 4HD8A 4PNEA 3N0RA 3F67A 1ZMBA 3G0BA 4P8RA 3NIBA 1HQYE 2RBGA 1XZPA 3L8MA 2WZGA 3KZ1E 1ZK0A 3G9ZA 2QE7D 5JRZA 2EBWA 4QOSA 1WW8A 3T7TA 1WS6A 4ETNA 3X1ZA 1HNZB 4MV8A 5B3KA 4DRJB 4LI0A 4B4UA 4JBNA 4OCZA 3COPA 2HMQA 2BMFA 3CO0S 3VR2D 4LNAA 1JSLA 4H1HA 3G4XA 2IK8A 4XSGA 2KSFA 2RGRA 3OZRA 3KL2A 1VSVA 4E0IA 4NPHA 5ER6A 3TG2A 2RE8A 2Q07A 4X0EA 5C5CA 3IKMB 4KEAA 2PUAA 1T8TA 4UHCA 1V8ZA 1R74A 2W2NA 5E38A 1AT1A 4YP7A 4MUYA 1GZVA 4ETMA 4JR0A 2DUWA 1FFHA 2ZSFA 4KG7A 3S8EA 4WW0A 3THWA 5JCJA 4ZD6A 2WK1A 3CRQA 1JEEA 5C8DA 4PZLA 4DMKA 2WKRA 1OGIA 2GN9A 1UOOA 4AUEA 1OYYA 5BQIA 2YL1A 4QAQA 5IF9A 1XRSB 3O94A 1IAQA 4NCIA 3HB1A 1ZUHA 2XV1A 1JVBA 3AGPA 5HNKA 4IV5A 5TB5A 2EILC 3G88A 1NWHA 4JBXA 1CX9B 2V96A 3WDSA 2YHSA 4HZUA 4FWTA 1ZVZA 1SIOA 5HQJA 3LSYA 2Q0SA 2DH5A 4TYWA 4NAUA 4I1YA 1QHEA 4U6SA 1MEJA 2XUKA 2A57A 2BGNA 3R0JA 5JAMA 1R0ZA 3IP5A 3NYJA 3EFOB 4JRZA 4RKFA 4PONA 2VDLB 3UKJA 3MIIA 1FDWA 4LXQA 3RWBA 2R1VB 2YJZA 3QKRB 4CM7A 1WXDA 3F5FA 1VQ1A 4NDAA 4CMJA 3HUDA 4L9SA 3X0DA 2ZRGA 4KTTE 4NJEA 5K0CA 2VTKA 1GPKA 2BGIA 5DCLA 4BNNA 1DT5A 2RB5A 4ZI7B 1YQTA 1MO6A 3M9LA 5F35A 2XUGA 3ENNA 5AVTA 3HZRA 2C7BA 5P21A 3DM5A 3JZAA 3I92A 3TLYA 1WUKS 4R83A 2H9IA 2P3LA 1QSGA 3KYCB 3Q12A 3ZGOA 1NC3A 1EFAA 1DOZA 1XEWY 1A7JA 5EJ7A 1WZIA 4G3XA 2HPVA 1Z0JA 3NS7A 3QWHA 2V0NA 2ORYA 4MUMA 5E6RA 1EQUA 3BDAA 1AN0A 5JHHB 1KZYC 2NV2B 1E5DA 3G2OA 5SICE 1T0UA 5AVZA 3ASOC 5B3SC 2QRNA 1YGPA 3KQQA 2FP4A 2B7CA 1X1TA 4DILA 3DDUA 1KJJA 2QRUA 1SB8A 4TMFA 2IF2A 4FNGA 4QLBA 2EJBA 2BLLA 4CEIB 1P2VA 1WTYA 1JFLA 3I3SR 5ICGA 4Y3UA 4E17A 2A30A 3R0VA 2I5PO 1FY2A 4JWTA 3VXKA 2Y1FA 4G9GA 4UAVA 1GQAA 3ZHTA 1S2DA 3GPCA 5AIBA 2JARA 3QVOA 1F5SA 1YDIA 1I1NA 1Y3IA 2BDEA 2OMKA 1WMFA 2B5VA 4QNRA 3CC8A 4Q9IA 4OD4A 2HLDD 2WQ6A 1QAOA 3CYFA 2V54A 1VCMA 2YJ5A 1RJEA 2H1LA 5DX0A 2X4LA 4EY4A 1GPMA 3LY7A 3S7TA 3T5TA 2WFZA 3NKEA 4I14A 4XWOA 4RQUA 1PR2A 5HKLA 3DWFA 3IDOA 5BN1A 3I39X 1J0DA 3LUCA 2KBFA 3RVSA 4RKEA 1YJQA 5KNBA 4IJQA 5IBQA 3Q2IA 2J3DA 2SICE 3IAAA 5JQWA 1LM3B 1C7FA 4Q0MA 3RU2A 3ULKA 2JFZA 3U3OA 4PC7A 1E5LA 1BOFA 4ZPXA 3NTQA 4UMDA 3BOSA 3H6GA 4TL8A 3UTCA 2ZYTX 5D8DA 1IEXA 1SXIA 3DLAA 2XSEA 5KYWB 4ZEMA 3WGLA 3SYMA 1WCXA 4CDRA 1U6IA 1Z22A 3DHVA 5LLTA 1HO3A 3U81A 1QO9A 1FR0A 1NVUQ 3U3KA 4HX9A 4ARSA 2GH1A 5C7IO 1HF3A 1UMCA 4N5IX 5F1KA 5JYCA 2X7HA 1QRDA 2V7PA 5JSHA 2VYVA 4EQZA 1GQQA 3E82A 5CLGA 5TIIA 3DFKA 1OZ0A 2Q1YA 3OPYI 4TTPA 3SC6A 2VQFB 4BGUA 4KP7A 2QUAA 1WKVA 2ZYAA 1O96A 2YWXA 2AJDA 1GFSA 1EX1A 4J9VA 4G5RA 1OXBA 4MMXB 1EA7A 5LZ5A 4PM4A 1MAVA 3EIWA 4D3YA 3V8NA 4JXJA 4OREX 3T3EA 2CXXA 4BKUA 2I3ZA 2HL6A 1C7EA 4EA7A 1EVQA 2AEJA 1I6MA 1UK7A 2CLOB 1N36B 1E8NA 4GUAA 4BV9A 1E2PA 3ILVA 2CMDA 3DP7A 3W05A 4GOXA 5JWHA 2B8JA 1Q0KA 2FA9A 3FDQA 3A6HA 5KNDD 2JJ1D 3QOYA 3DXFA 4AWAA 2V03A 3OZSA 2B21A 1O9HA 3DONA 3OP4A 2JJYA 4LDJA 3K53A 4F46A 4I3GA 1ODSA 1B43A 3TD9A 3DAHA 2IV7A 1BAPA 4F3YA 3P2IA 3TMAA 3T38A 4KR3A 4E08A 2E82A 3JQBC 5KOJB 2LCHA 5BRNA 3BD6A 4KZPA 3HL4A 4ALMA 3D3QA 3GRAA 3HDGA 3AKCA 6YASA 4CR6A 3GORA 1Z2OX 1RWMA 4TPKA 721PA 3IALA 4MPDA 1C80A 5J3JA 1GZDA 1XKLA 3NT4A 3NFYA 4PSCA 7REQA 2FPKA 3CRRA 2HQOA 3CUEF 3NHJA 4JH0A 4MWOA 3D4OA 1MO2A 4JEMA 3D6JA 4HRXA 2DI3A 4X94A 2GZRA 5DTRA 3JZFA 3PUWA 3SX4A 3CEXA 2NG1A 2C7PA 2JL1A 2P69A 1L5KA 3EQ9A 1PLJA 2IUTA 1N4DA 3AUXA 1PK7A 5AK3A 1JQBA 4DB2A 1YU9A 4R32A 2HSJA 2Q4RA 1W2HA 3U3FA 1RXIA 3VVLA 4G63A 5DBOA 1A0BA 4A1FA 6AT1A 1K98A 3FI9A 1GZ3A 3DG9A 5A06A 3MINA 3GZ4A 4LQLA 1N2EA 1RYHA 1KF0A 4JLOA 1LV7A 5B1SA 1DDOA 1GXSB 4X64B 2ZBUA 3ADDA 2L6FA 4RVOA 2ZULA 4PFJA 3AOEA 4RHXA 4QJ3A 1PT9A 1CUEA 1RQLA 1JIKA 1O3YA 5HK9A 4RZHA 1G1AA 4DV6B 1XJ0A 1VE7A 3GAAA 2ZQ5A 4HXEB 2PYZA 4HPJB 1TVMA 3W3ZB 1QK4A 1ST2A 3K6SB 4CQMD 4HVLA 2H2IA 1Z8HA 3V7FA 3R8XA 4I5FA 4ZA2A 4QTXA 3NDRA 1SBIA 1MQSA 1WG8A 3DKKA 2GXSA 2UZAA 4GVXA 5BWNA 3GL9A 1BC5A 3B6JA 4F72A 1G21A 5HPYB 1OVMA 2JLAA 5K0ZA 5AFSA 3SXZA 5IJ9A 4AI6A 5B4VA 5M34A 1KOGA 4MLZA 5KSOA 2JGRA 1D6NA 1YTLA 3DTVB 3TN7A 3BD9A 1BN7A 4OI2A 4PHCA 3P9XA 2LKCA 4GKAA 2HA3A 1RKCA 5B36A 3IE2A 2Y67A 1C5KA 3H2GA 3LQ1A 3A4NA 3D3EA 2QE6A 3TW4A 1GYQA 2Y1EA 3LTNC 1U1CA 2G5PA 3UB2A 3R7WA 4CM8B 1M74A 4ZQCB 5J2TA 4ETIA 5CBKA 2OBYA 3AHCA 3PGLA 4TROA 5K2OA 4LACB 1XF9A 3RQSA 4E33A 3GOHA 1L2TA 2QAIA 4DHEA 4WI1A 4DREA 1TJ3A 4MP8A 3LGAA 3HEBA 4LHSA 3GUVA 5D1NA 1T5DX 3HU3A 3SZGA 1CPRA 2FB9A 5DNDA 2NU7B 3KQWA 1CDEA 3D7RA 1XXLA 3HSSA 4E18A 4XIJA 2WRZA 2Y1CA 2NGRA 1A7KA 1P5HA 2A69F 4RQTA 1NVEA 4XGNA 2FOLA 5ALVA 4YV2A 5DWDA 1ZI8A 5LA6F 4CMIB 2B7BA 3FHJA 3RANA 2EFCB 4Z9XA 2PWAA 3GD5A 1FCJA 2F7SA 3VYTB 3DMYA 2J9WA 4HH4A 5C8YB 3MGBA 1PWEA 1WASA 3M0EA 4KDFA 1NSYA 4B3IA 2H7YA 2J08A 1F3OA 2VG8A 3FB4A 1Z7BA 2VJMB 1UBNA 1NVMB 3D8SA 2IF0A 3O4RA 1MNEA 1SRQA 3QM1A 3IBGA 3PTZA 2QR2A 5C3UA 4NV1A 2AV6A 2Y0DA 2B8WA 1COWD 1NY6A 3CVXA 3KOXA 2QEQA 1PIWA 2XR1A 3PGXA 1R9NA 4S0ZA 3BJMA 3FRJA 7GPBA 1RYFA 3FGOA 3MQ2A 3S2IA 4DV2B 5ALLA 2GTPA 2XJ4A 4QUKA 5LQNA 3OC6A 2IUFA 2VOEA 2FR1A 3DHWC 4JLBA 3FBGA 4CKCA 4JLDA 4M88A 4YK7A 5SV2A 3HBLA 2RGUA 2QUJA 2H4FA 2H7XA 1RWQA 3CY6A 2E4UA 3ND8A 5DM0A 2JLZA 4G0HA 2X9QA 4K03A 1EUCA 2JGEA 1F51E 4QSMA 4I5GA 5LWHA 3ZE7A 5IH7A 1SKBA 2ZT5A 1U8EA 4OU5A 4LV6A 3EW9A 2R97A 5ULLA 4IBOA 4KR9A 3F3YA 2HB6A 1PYOA 2FZGA 4EGFA 3S8YA 4KIWA 4D26A 3H9EO 4QWWA 4MUJA 4AQDA 3ZTZA 3KZOA 2WSSA 1EQAA 3NWJA 3IEPA 4LMBA 5ISMA 1I3NA 3DJFA 2ECQA 4FXOA 5GONA 1X1EA 1I3KA 4ANJA 2YXNA 3K0EA 2PKCA 1JDPA 2FPGB 3E5RA 3IAUA 1JXQA 3ZJUA 3HBFA 2JCYA 3V6LA 4DUGD 1NKVA 1QC5B 3BL8A 2RSLA 4H0CA 1LPEA 4R05A 2KC3A 1THGA 5A7HA 4NAHA 1DL5A 2WIDA 2CMHA 1NXOA 5ALIA 2UZ1B 1OBFO 1TTQB 1AGPA 4PAQA 4PRZA 1Y33E 4ULWA 3DBLA 1HFJA 1FFSA 4EBBA 5C7YA 5CGQB 5DM70 5EIHA 2VTBA 3V3TA 2WZBA 1KORA 4FBLA 4KQ6A 1TF2A 3HUEA 4GSLA 3JD3A 3UFXB 1TNDA 1H22A 1Z6TA 3UC9A 3PJFA 4F3TA 4Z9HA 2JFNA 2NNLD 3EG9B 4D4MA 3ZC3A 2XMBA 5JSLA 4B6SA 2P6PA 3IH5A 3ELWA 3ANYB 1WZUA 2WTAA 3H5VA 1XZIA 2B4QA 1X42A 3CVOA 1O5TA 4LJRA 2OM6A 2GAJA 4MKGA 3T95A 2IIPA 2PR2A 1T9GR 4CMHA 3PNBA 2Y8EA 1JIXA 1G3MA 3EFEA 4PO3X 2ZKIA 3DWEX 1IVNA 1WQ4A 4B44A 5J40A 2WTXA 5HFNA 1O0SA 1W85A 3UENA 3KSRA 1MN6A 2EINC 1CR2A 3H0EA 4J1TC 3IDFA 3DL2A 1YUMA 3IJPA 3PQ8A 4CLRB 3TNFA 4IJJA 4DWVA 4MP3A 2AW5A 2REOA 1UM8A 3G8CA 1TCVA 4NJMA 2V6JA 5FRDA 3JVDA 3UCXA 8ADHA 5BV7A 4YRAA 1E0DA 4MRNA 3RO7A 1TK3A 4UUAA 2HMVA 1HT1E 3NDPA 4LIPD 1R0XA 1ZGCA 2R85A 3I61A 3L3BA 1L8QA 5CFZA 5CH5A 3DT6A 4HOYA 3LC2O 3RUAA 3ZBTA 1Q1NA 4C7XA 4MQUA 1DE0A 4XOIA 1WLYA 3JWHA 1LIHA 1RI2A 4F97A 4FGLA 1JXMA 5LXTB 4C0JA 3IQGX 5TC4A 3IC5A 3SXMA 5LJIA 1P1KA 2GEVA 4EHKA 2M1XA 1RXQA 3UJ6A 2WB2A 4G23A 1QE5A 5FJIA 1A7AA 2VCYA 2VYCA 3ETCA 3K1JA 3WGHA 4QU5A 2VF7A 1QJCA 4P2BA 4CWAA 4BNDA 4LYYA 1A9RA 1BEUB 4XPIA 3DE1X 1CZRA 1YYJA 2HRBA 4NABA 3OI7A 2YBEA 1PGPA 1EXWA 2N3ZA 2IZ6A 2MINB 4JJKA 2J3KA 1T43A 3GDOA 1TQHA 1OJ7A 4ZT7A 4M8SA 4PX2A 1X0VA 3ZNPA 3IUSA 3H5OA 2PNJA 1C0PA 3NNDA 3BMQA 2VIIA 2NZUG 4WBSA 4TT8A 1B00A 2JATA 1HE4A 3P20A 4MUNA 1PFVA 4YDQA 3N07A 4QO7A 5CPBA 3OT4A 4ZJPA 3W06A 2C20A 4DRXB 1NRXA 3FYCA 4GYWA 4QOFA 3RREA 5EK0A 2GBPA 2G76A 1ZM4A 4ILEA 4K1LA 5JAOA 2YTZA 2Z4SA 4BMPB 3MJVA 4O1HA 3BCSA 3K20A 5BQXA 3RVYA 3EASA 2JDIA 4L7VA 2XT6A 4WOBA 4Q24A 3HEAA 4AUKA 2O2GA 2R8XA 4Y7DA 3L43A 4YP1A 4YB8A 3LG2A 5A71A 4FMCB 2V1UA 2D4AA 3ZU6A 3CU5A 3RS3A 5KSZA 2DCUA 4Z4QA 1PO7A 4D7AA 4X41A 1QIFA 3AG5A 4N06A 2C88A 1SUEA 3S5UA 4Q9AA 5JOQA 3L0SA 3ABSB 2DP4E 3OHSX 4PPYA 1OX4B 2IXDA 4TS9A 1X8XA 1CJUC 1FQWA 4WIAA 1T4GA 1MC8A 2W90A 1IZ8A 4ENVA 4JGBA 1JQDA 3L04A 4C0XA 5DW3A 3QGMA 2A84A 3EXEA 2FRDA 2X86A 5DS6A 1UKCA 2E87A 1IONA 3VX4A 2X3FA 3HN7A 4W5TA 2AOXA 1Y9ZA 1JIJA 4TTSA 4P4SB 3KQOA 1X9IA 2PRSA 2ZYWX 2IT1A 5HKAA 3L0OA 4GR5A 4PR0A 3HYTA 5KX5F 4C0KA 5ICCA 1PK9A 2ADOA 5AR1A 1OCRC 4I9FA 2I76A 1OF1A 1I0LA 1CEQA 5EKTA 2FNAA 1DRUA 1MMDA 4F5DA 3T9BA 2PJRA 4ERXA 5HBGA 3P9NA 4KFRA 4FHZA 5L45A 1P5RA 5JH7B 1QGUB 1JQKA 1SUIA 4WQMA 3C70A 3SR0A 3OE1A 4G56A 2VSYA 2AOUA 4WGFA 3PA6A 1A69A 2UKDA 1E92A 1NUHA 3FF1A 1MU0A 3ELBA 4J0KA 1MB3A 4O4IB 3AM1A 1Y98A 1JG7A 5F3DA 4Y0VA 1FP7A 5HTKA 3B9QA 1WZCA 3D43A 3VSEA 3DNFA 4N3CA 3ZE9A 2PZLA 3PE6A 4TLCA 3ZTYA 4E94A 3ZEAA 1WATA 1Z3CA 4F5ZA 4XEKA 1R5NA 4UVHA 2VNKA 4XVQA 3RS7A 5COGA 5KS2A 2H1FA 3TFQA 4ITUA 2XCSB 2P5TB 2C3YA 2GK3A 3TNJA 3PNPA 4JCCA 1NJ1A 5B7GA 4JBLA 1T0PA 2BEKA 5ERGB 2F3UA 3LDFA 2D8MA 1CG6A 1LBIA 3UMHA 2G70A 4MV9A 4BFCA 4DBRA 3K8OE 5CX1A 5ADWA 1C2YA 3I5QA 2R25A 3AHHA 1H4SA 4FFPA 1K5GA 2QN9A 3K5WA 3KKKA 2JLYA 3IQZA 4J30B 3A06A 1FUKA 5DXJA 4A91A 4EVIA 1G17A 5JYBA 2HV6A 2IDJA 2QMQA 3VO2A 1I3MA 1SVUA 1MIOA 1QKKA 2P2CA 1ILEA 2MSEB 2NU8B 3QVMA 2HU8A 3S84A 1EFLA 4AXBA 2XLWA 3QEAZ 5D5PA 2WNSA 3AR5A 4WNAA 1JQEA 3SNHA 1KQ3A 4KO2S 5TQ2A 1D6SA 4EFDA 4BMOB 3HKDA 1CFJA 3UJ7A 3PCXA 2AN3A 2FQXA 3CUTA 4QFMA 5FWDA 5J4VA 5TJ9A 3Q2OA 1XCOA 3N2KB 2A6HF 1EVJA 1GGEA 4IXNA 4IHJF 1XZEA 1NW9B 3Q1KA 1NZDA 5FPYA 2WVQA 3EVGA 1ISFA 2C99A 3N2ZB 1L1RA 2O1XA 1ABBA 9MHTA 2NYRA 4Y2JA 1KDYA 5IDVA 4CMAA 4IX9A 1V26A 3UT5B 3G50A 2I4IA 4HYTA 5JD4A 2CBZA 2K6GA 3TBKA 2XYRA 2YJ4A 2CHEA 4D4NA 1PT5A 6ABPA 2FHSA 1E2DA 4XW2A 1RRFA 3OEED 1ONNA 4UUNA 1X8LA 1JR2A 1Y4CA 5A4AA 1XZFA 5AQ1A 1E9SA 2BFEA 3A0UA 5LD2B 4BVGA 3OZGA 1YASA 5F9FA 1GGVA 4DSZA 5L0DA 2FSUA 3CB4A 1LLQA 1TLFA 3PC2A 4N6HA 3FHDA 4EYKA 3MELA 2RD9A 5K2MA 5K8LA 5LBUA 3GPIA 3UJ9A 3NMUF 3DEAA 2IITA 1S2NA 5TXGA 2Q9BA 4D92A 4OTZA 1SUCA 2JIMA 3EIOA 4DJJA 3I64A 3GM1A 2IYPA 4CIAA 3OOWA 5FF9A 4Z9FA 1MIHA 5FJJA 2ID8A 3IPLA 1G5TA 2GF9A 4ON9A 3IBTA 4MYSA 2O05A 2C4KA 2WPNA 4XXHA 3FNQA 3NBZC 1PZFA 2EKPA 3QE2A 4CCWA 4C04A 2Q4BA 4JYBA 3VPCA 4F60A 3VPFA 4MVCA 1PGOA 3R7CA 1EFDN 3JAMA 1AHIA 1YRYE 2PUGA 2Z09A 3CLTD 4QOIA 4D8UA 1DXOA 3KL4A 3PHBE 1HE5A 5JCOC 1AQNA 5KWIA 2M32A 2B1JA 2M6LA 3WGMA 2I3GA 1T6NA 1OCZC 3KSAC 5ALSA 2H4XA 3FETA 3TQQA 2Y68A 2EEZA 3M6MD 1QU2A 3PI6A 4TKMA 2WLSA 3IULA 1RAGA 5CLQA 1CQJB 2IY8A 2OB2A 1GA4A 3L8HA 2FXVA 2P9JA 3LF1A 4OIQF 2EKZA 1A2OA 4BE4A 1I14A 1Z6AA 3W2TA 4BNHA 1LUAA 1XXHE 1ZS9A 2QN1A 1THZA 5AUOB 3T1QA 1K3FA 4MEAA 4MHTA 5B1AC 5HSGA 2FUG6 1R3UA 3W6PA 1CETA 1TJPB 1U8ZA 3P26A 4HATA 2M2IA 3ZX5A 3UW1A 5HJ7A 1JS1X 5E6SA 4HGNA 3WHKA 4RSGA 2ZBFA 2J5RA 3KKLA 1BSVA 5CD1A 2CV1A 4RIGA 3YASA 1YFKA 2C5BA 3IMCA 3R7NA 5EHHA 3O8OB 5EZSA 4LMAA 3CFYA 4RIFA 1BRMA 3MWFA 4ZCIA 3KOWA 1JEYB 3I8XA 1NSTA 2IYUA 2VJCA 3ZS9A 3ZDAA 3EA0A 1HURA 4KFTA 2UU9B 3TRIA 1WXQA 2AUNA 2VF4X 1TIBA 5DHAA 1RC8A 3CZ5A 2DKFA 5I48A 1NYRA 4BVEA 4FJ1A 1QIMA 3D6TB 1E5XA 3ACCA 3VM6A 3KHSA 4JCOA 4RZXA 3NFRA 2I8CA 2ZI9A 5A6JA 2V7XA 5E9WA 2PT7A 5HK8A 4G26A 4FB4A 3TGPA 4CUJA 3WGTA 2KJQA 2XF2A 3X1KA 3R9XA 1RKEA 3HCFA 4Y6RA 4G78A 1XTPA 2JFGA 2PSHA 2WT9A 1DTSA 3F6CA 4FCVA 1UJ5A 5BV0A 3QSGA 2PGNA 4JIOA 2YFYA 3TMKA 2QXYA 2J5XA 2QMUA 5COBA 4GRDA 1KSGA 3UF0A 4XPWA 3QLUA 2HEGA 3UY4A 1TA4A 1R5OA 4NTBA 3GGOA 4BNWA 2YFHA 2X9GA 4LYGA 4LPKA 2VXOA 3CSDA 2E6UX 1KVSA 2YASA 3QMKA 4QXQA 4JTDB 4J9UE 3NIFB 5IVIA 2FJ0A 4H7DA 5HFAA 1KPIA 2ZRQA 3GY0A 1SKYE 3DULA 4A2WA 4KO1S 3SHFA 5C35A 2C59A 3Q7EA 3RTAA 1FRQA 1UXGA 2X7JA 2NUTA 1APCA 1Z23A 1P4JA 4NEQA 3PWTA 1KPGA 3GRUA 2BMEA 4QOJA 5ITZB 3HI6A 1N2ZA 4LJ6A 2BEJA 2GDJA 2YMMA 3B20A 3SLKA 4GR4A 1LBHA 3HV2A 4JI1B 3I9MA 4OHPA 3OHMA 5GP1A 2OCPA 3IEVA 4K1OA 1CIVA 3V5YA 3OPXA 3SEOA 3B5JA 2XKKA 1MA3A 5C5DA 3VZPA 2G08A 2YLIA 3GEMA 3WGYA 1Z74A 4IDQA 1BMDA 1P33A 1N9GA 2Q3MA 2RHWA 3UJCA 2IEZA 4OGWA 4U9DA 3G2HA 3NBMA 3W4JA 1A8SA 4IIJF 1X3LA 5I9NA 3VNBA 3R3HA 4NEGA 4TZTA 1V5WA 3RVMA 1Q15A 4TKUA 4KWTA 1ISPA 3AI7A 1L4BA 1L7PA 3LPNA 2HV8A 2Y3GA 3CX6A 3NNSA 4B47A 5SY4A 3SSOA 4EB8A 3SOZA 1JDTA 4FX2A 1SXHA 3LRTA 3QIVA 4B45A 5KOIA 4J76A 2ODQA 4UUQA 3BRSA 2I67A 3E9QA 5J1TB 3Q9LA 2HJHA 3RIYA 3UJPA 4DIKA 1C8BA 1WXHA 1U2RA 1IJBA 4UM7A 3L7NA 1FLDA 3E58A 5T6BA 2WSLA 1PFYA 1C29B 1V8OA 4DY6A 3ZXSA 4NG5A 3PC7A 2O0HA 3QEMA 1M73E 1VYHA 1LPOA 2NAFA 2CB0A 1J0CA 4UAUA 4UM5A 4NFHA 4FR0A 1M2JA 2PVSA 4GI5A 4R5HA 2NTYC 4QQ8A 5A9SA 3W3AA 2YWAA 2ZVJA 5FOWA 3RAEC 3TVYA 2BUCA 2R5FA 2PANA 2Y3IA 1N6HA 4FFVA 1U0FA 2ATVA 5F3WB 5GQSA 4F71A 1J8VA 4W5NA 3DZKA 4UOZA 2YQ5A 1ZW1A 2I7DA 2Y92A 4LXTA 3JQ8B 4EG3A 3OEYA 1WDWB 1T2VA 1WXEA 5BRJA 5BN4B 1OZFA 3L1JA 4RENA 4DR1B 1T6UA 1G2PA 2NVUB 4N0EA 2G9VA 3ABZA 3IXMA 2O07A 5K3FA 1KETA 2XODA 1G20B 5CFOA 4MYCA 3QA9A 3ZDDA 4TTTS 3RYHB 1NMYA 1SKAA 1M54A 2DPHA 5BQGA 1C17M 3AVQA 3FGNA 1ZW2A 2HSWA 4M1SA 3ZJ5A 2R7XA 4HF7A 2P6VA 4R1UA 5DT9A 4FILA 2D1SA 4XM2A 1E1CB 5KNLA 1FAPB 2E5WA 2Q5LA 1B73A 1GV0A 1RQPA 1ZGHA 6GPBA 4QGHA 1N8SA 4L8VA 4FOTA 4WY2A 1VLSA 3SBEA 2G4VA 4F8YA 2BTQB 4OOEA 4CI9A 2YINC 1Z7YA 3NHUA 1L5YA 1B41A 1K27A 5KKNB 5A0FA 1N5JA 5AHXA 1L7MA 4L3WA 4KN8A 4X54A 3H5NA 3KJQA 2PS1A 1PX0A 2P79A 3CN7A 1DIAA 4FW9A 3CAXA 3N8KA 4DKXA 4PU0A 1NBME 4MI6A 4GO1A 1J56A 3O93A 3T1VA 4G0ZA 1VTKA 3V8RA 3W4YA 1Q17A 4YJWA 2CE2X 2E4VA 4EA8A 1U4SA 4PLVA 1KO5A 3PWSA 1ADCA 1T5HX 1YJ8A 1KBZA 2FPUA 4KTVE 2GT1A 2CW5A 1KI6A 4P0TA 2W4IA 1LDYA 4DT1B 4NYIQ 3KPWA 2IYEA 4X6XA 1KMNA 1H4VB 2FGKA 2C31A 1MD9A 2BF4A 3UOAB 6Q21A 2WZCA 3MS4A 1IHUA 1OTYA 2R7NA 3L7DA 1HDZA 2BMVA 1GU7A 1VP3A 2HWWA 2H59A 2HHJA 2HRCA 3FHCB 3HP1A 4IRMA 2JIDA 4FMDF 5HCIA 5IH3A 1OR8A 1L5RA 4XLTA 3ABKC 3IO3A 2RC5A 2DT8A 1DGQA 1PEYA 2JGJA 4G4IA 1E4VA 3BFXA 1NHGA 2XL4A 4Z7NB 2Z8ZA 3GRVA 3RODA 4C7JA 4H0NA 3ZCSA 4ZAYA 2GYVA 4DNPA 1PWYE 4PZCA 4JJ6A 3KUUA 1VDZA 2QAJA 4A10A 3R7BA 4BFXA 4QI0A 1FVOA 2VDUE 3BMCA 3B6IA 5K0JA 4CS8A 3IP3A 2VDRB 2X0RA 2QLJA 4DV1B 2CZGA 3PD7A 4MW1A 2XMZA 4HGZA 3ANMA 4G5GA 4X3PA 3G1UA 1JHZA 2QNBA 2GM9A 1YHZA 4UBNA 1DJLA 1P9NA 1GLGA 3ZKAA 4J4BA 3EH1A 1P2FA 3Q8MA 3FMPB 3OIYA 1R15A 1J09A 4V0QA 3W5UA 1F7UA 1JLKA 3BE4A 3RV4A 4EG7A 1PVOA 2J33A 1WF6A 1NP7A 4YRQA 4U3JB 2O2XA 4XEFA 3ZVMA 2CYDA 3D6UA 1KK1A 4HLUC 3AIMA 4PIMA 3KAQA 3LBYA 2WC1A 1EK5A 1I4YA 3QKSA 5GTDA 3HNOA 4WY8A 2RG1A 4EVSA 4OP3A 3O5AA 1CPYA 2G3VA 2ZZMA 2D0PB 3I5XA 4D8TA 2HQSA 2PIAA 1SXJC 5CVVA 5AM4A 4EJSC 1G8KA 1NYQA 4PAOA 4MQLA 3LHDA 1Y9AA 3G82C 2XDQA 4N3AA 4AY3A 1NVGA 1PCXA 3LRPA 3BTOA 3GVHA 1Z13A 3OFND 4JROA 4D1YA 1JDVA 4CKEA 2BFCB 1NGSA 4KQWA 3GGDA 4B0PA 4FC6A 2CHGA 3TH5A 1FP1D 4RTKA 1KIMA 4PF1A 1ULTA 3D6FA 2OZVA 3D0OA 4TM7A 4UHJA 1RQXA 3MUOA 5FUWA 3R24A 2OFWA 5AHRA 4E51A 4KK4A 2B99A 1S3GA 3NDJA 5J4KA 4YRPA 1MRSA 1TRKA 3P9SA 4UQPA 1G7RA 1NM5C 3PUVA 4QSHA 1IXKA 1TO1E 3IB3A 1O03A 4OLHA 1M2HA 2OSVA 2NT3A 5HZHA 1Z17A 5LNK1 1XHLA 2YWGA 2VEOA 5BOVA 1SGWA 2G9QA 3B12A 3GLTA 1KKLA 2PZFA 1GSOA 3L7IA 3O8QA 5JO0A 1LA2A 2R4UA 2HF2A 5DYIA 3PHCA 1NMZA 4LF5B 3G5LA 1N5OX 2PUWA 3MMSA 2Y9PB 5DI3A 3I9KA 4H77A 1MAHA 3OWOA 4BS9A 4M83A 3RBXA 1N3LA 2W71A 1K7XB 3KSBC 1Y1SA 5C53B 2FMHA 1OV4A 4B35A 4GBGA 1ZDMA 3UJDA 1KARA 4PAMA 2QYHA 1Z56C 2H2WA 2C00A 3WAKA 1VCHA 2V58A 4N39A 4YR9A 4DMUB 4CM9A 5E2QA 4IKPA 3K6JA 5CDSA 4TLMB 1IBLB 2VJBA 1GUFA 1F9AA 4WA8A 4BFLA 4E7ZA 3VJMA 1FFEA 2GUGA 4RO0A 2PZBA 1N57A 4F4JA 1P72A 2NXCA 3KYJB 4H1UA 1RI3A 1C1HA 1A97A 4EG6A 3A3NA 3F78A 4BWFB 2O7NA 4F4BA 4OIRF 2W6MA 5FWNA 2JLXA 1HK7A 3GROA 2B4AA 3A4MA 3VI4B 2Y3BA 3OTOB 4AZ0A 1SOMA 3FFWA 2SECE 1HRKA 4A16A 4Y30A 3VNSA 4F91B 2G8NA 4CKZA 3B2EA 4MRMB 3Q11A 5KNCD 2BKVA 3F6SA 2ZIUB 3HL0A 3UJNA 1C50A 1E94E 2FWIA 4IJ6A 5GADl 2ZYRA 4I46A 1L3IA 1ODFA 4PLWA 4U5GA 5AKHA 3DE0X 2YJNA 1T5SA 2FAXA 2AVKA 3PTAA 3IOYA 4ZIRB 1ZLYA 1SIUA 2I03A 1IEQA 3CUKA 2X23A 2NMVA 3SF0A 1AMNA 3DE6X 4CDAA 3SX2A 2AHOA 5KYGA 1UWCA 3HXKA 2OD7A 2A9JA 4FFBB 4RFSA 2FN4A 4J2HA 5IX8A 1V8FA 4UMEA 3CUUA 3KYDB 1IHYA 1PG5A 3FRIA 5M5BA 3U7GA 3SM9A 1KTVA 1DJQA 3NGMA 4XDHA 3K72B 1N1DA 4TN1A 2Q41A 3O03A 2ZUVA 1BFDA 3GM2A 7MHTA 1XQ6A 5GVRA 5BQOA 3EDRA 4FHGA 3PA8A 3C6QA 1BVHA 3BFKA 3EQZA 5L51A 4ZVSA 1QO0D 3F47A 2V7VA 2B34A 1RYZA 2Q8PA 3CLUC 4MITA 4Q02A 1NDHA 4DDWA 1CB0A 5TPWB 2J0VA 1HYHA 1SUSA 1XRLA 1IZ7A 1FPQA 2JFYA 3KG2A 5FBLB 2F62A 2Y05A 2DETA 3OA1A 5AVYA 5K0IA 5COMA 3BSWA 5FPTA 4GP9A 2A5LA 1K4MA 4OOFA 4ZAGA 4H7IA 2IOFK 4MROA 1P0QA 1RMYA 1BMTA 5NULA 3X2QC 4IV8A 3LW7A 4YP6A 1L7EA 1FDOA 3H5IA 2W2XA 3HPRA 3V4PB 2GYUA 2XNSA 3GCZA 3UUGA 3VTKA 3RK0A 1VIYA 2Z30A 1P4AA 1VHTA 2NUAA 3KWFA 4K6CA 3HR7A 5EQTA 2BHRA 4D56A 3THRA 5KWSA 2JFHA 3T9AA 5JO9A 2KMLA 5CEFA 4B46A