1H6GA

Alpha-catenin m-domain
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
255
structure length
255
Chain Sequence
b'DLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYAQVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-1 CATENIN
publication title Crystal Structure of the M-Fragment of Alpha-Catenin: Implications for Modulation of Cell Adhesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 101
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1h6gA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1h6gA01
3ZDLA 4W8PA 4DJ9A 4E18A 1DOWA 4P9TA 2GDCA 3TJ5A 5L0CA 4E17A 4K1OA 1ZW3A 1T01A 1ZVZA 3RF3A 1L7CA 1SYQA 3S90A 1TR2A 5L0GA 3H2UA 1ST6A 3H2VA 2L7AA 2LQGA 5L0FA 1XWJA 1RKEB 1U6HA 2B0HA 5FZTA 3T6GB 1YDIA 5L0HA 2GWWA 1QKRA 3VF0A 1ZW2A 3MYIA 5L0JA 5L0IA 2X0CA 1RKCA 1DOVA 4PR9A 2HSQA 1H6GA 4ONSA 5L0DA 1U89A 1RKEA 3TJ6A 4IGGA 4EHPA 2IBFA
chains in the Genus database with same CATH superfamily
1I4ZA 3CEXA 1LIHA 1YYXA 2UUHA 4W8PA 4XEKA 5B3SC 3H65A 2KJGA 2YQYA 4E0HA 2ZD9A 3LS0A 4WJ0A 3TJ5A 1HE9A 2EIKC 3NKDA 3I5QA 3LJBA 4JURI 3PHF2 3DAGA 3ZC4A 1CGNA 5K0IA 1H9GA 3ABKC 2QNLA 4AL0A 4CS9C 1D1BA 5L0GA 2QLAA 4X0RA 1HY5A 3ASNC 3F46A 2LIGA 4JVSA 1K40A 3KKBA 4OD4A 2I15A 2A6EF 2QE9A 2EINC 4YT8A 4K7BA 4OINF 2EPMX 5BUOA 3UGPA 1D1CA 1RCPA 1FTSA 4PR9A 1MMDA 1WWPA 1OW6A 3Q7LA 3QW1A 4ONSA 3L8JA 2OOCA 2DB4A 3ZG1A 2R7TA 2XM0A 4MTOA 3DM5A 3B9QA 5DQZA 2JPUA 2LCHA 2BE5F 2YRFA 4E18A 3EG9B 5JUAA 4U9DA 4PACA 3SXZA 1ZW3A 2HZ8A 4AK9A 4EWCA 3RF3A 5KYUB 1K04A 4CSAA 1EQ1A 1LI5A 3IQ6A 1MMAA 1ST6A 2W4BA 3GM3A 3M1CB 2FGYA 2J45A 1MMNA 2XM4A 1U6HA 2L6HA 3O55A 4XPWA 4NTAA 3EZHA 4XPXA 2RSEB 2Y3HA 5FZTA 2EIJC 4LLEA 1O3UA 2KSFA 5IY5C 4CS7A 3FDQA 4JJFA 1FFTC 4EUKB 4OIQF 3HKKA 3W2VA 1VLTA 2KW3C 2BL2A 4CIHA 3TJ6A 2P6VA 3SNHA 1G8XA 1R5ID 4BJ6A 3TK0A 1BDJB 1QZXA 3B0PA 3JSEO 2ZXRA 1ORYA 4MVQA 5JSLA 1Q0DA 5HV9A 5KYYA 2CDQA 4H4KC 2YLGA 3FVYA 4ER9A 3TULA 5JVEA 2PF4E 2VH3A 1SZIA 2ASRA 1OXBA 3S9OA 2PFDA 1Z3IX 3KYIA 1ORJA 2CGEA 3U3BA 3M79A 1OKKA 2GFHA 5L0FA 1C17M 3DE8A 3NMKA 1H7IA 2PBEA 3TD7A 5A6JA 1JPJA 1OCOC 3DZAA 1SR2A 5COFA 3EGXB 1NU7D 4E7ZA 1FR0A 1IZMA 1K05A 4IAQA 3MYIA 4U5DE 5JLIA 1LPEA 1NBBA 4PJMA 4BJ1A 2R7RA 3L34A 3GANA 1VTMP 1TFOB 5COGA 1ZU5A 2HS5A 3C7JA 5CI8A 3C8GA 4LACB 3VRCA 3VAYA 1JRAA 5T3WA 3ZDLA 4AE4B 2JX0A 4U5BE 2J9UA 5BQGA 3ZWIA 1D0XA 3IQ5A 3T4RA 3K6BA 4YT4A 4CIPA 2AVKA 4N4WA 1E2XA 2CYDA 2P0NA 2WB7A 2V26A 5A6KA 3FOOA 1C03A 4OIRF 2GA0A 4YT5A 4MQ9F 4IRUA 1BZ4A 4JTAB 3TOMA 3GODA 2MHRA 2AU5A 2LK4A 3AGTA 2Q9CA 4J32B 2XLDA 4G7ZF 1Z7Qc 3IEEA 2XLEA 4HE8D 1DOVA 2XLOA 3CQZA 1H6GA 1JPNA 1OQCA 3V7OA 3EGDB 5A6AA 1Q0KA 3AJMA 2NSFA 3NYJA 3AG1C 4CS9A 2CW0F 4EBBA 3EZIA 2L6FA 3GM2A 1NFOA 4G78A 1G5ZA 3Q6NA 3ZTZA 1IW7F 4MVOA 2Z15A 2XLWA 2G3KA 2B0JA 2FFHA 1M2VB 3FAPB 3SZRA 1VB5A 5CIVA 3CSKA 1ZVZA 4C3DA 4FWVA 3KPHA 4LDRA 1NSGB 1CPQA 4BJTA 1VYIA 2RD9A 5D92A 1HW1A 2G3VA 3EH2A 2HV6A 2YKZA 2AWCA 2LD6A 2P61A 4CS8A 4DXWA 3RVYA 1RMVA 3O39A 3RKOF 1GS9A 1YAUO 1TWGA 1T6IA 4N6CA 2IYLD 3T6GB 3UGOA 1QVXA 4LDQA 4QI0A 4I44A 5DS6A 3KYJA 5KYUA 1WATA 3UMHA 1RKCA 3NYMA 1J8YF 4ULVA 1LS4A 2R7WA 5AC4A 3O6XA 1JR8A 1M57C 4BJ5C 3QZCA 2D4UA 3EHMA 3B0VC 4NTBA 256BA 3FHDA 3QMKA 3JRMO 1WOLA 2OCCC 3AOUA 2C04A 3EFOB 4C3EA 2IXPA 2WVNA 3C8ZA 3F47A 3MX3A 2QUPA 1QLEC 4IAOA 3T6BA 3AGUA 3S84A 2QTVA 3G4ZA 5DVWA 2IXOA 4CJGA 3GEIA 1MNEA 1A7DA 1XWJA 2R7UA 1EKYA 1PD1A 4KNWA 3LNMB 5JP7A 3V5YA 4W8KA 4L6RA 4E7SA 1D0YA 3M15A 4RDAA 4CDAA 5DLJA 1LE4A 1LKXA 3K7DA 1LE2A 2F22A 1JAFA 3N24A 4G7OF 3LS1A 2O9XA 1LVKA 4N6HA 4U5HA 2WZFA 5KYNA 4J7TA 3EGXA 4CS8C 3PCVA 3TQOA 2FAPB 3GWNA 5A69A 3JYYA 4O79A 4OD5A 4BPMA 1TQGA 2OKUA 2OQMA 5EGYA 1T01A 1L3PA 1WGWA 1QQ3A 2Q3TA 1RXQA 1UFBA 2LFFA 3DJNB 3ZVRA 4DBQA 1JOGA 3NKEA 1SMYF 3U0CA 4JIOA 1VYKA 2XL8A 2Y3DA 5EK0A 3RW0A 3RVZA 1E84A 2AWYA 4LLCA 3S90A 3DXJF 4MVZA 2B0HA 3AQCA 4PJJA 2Q00A 3ZQVA 1QKRA 4KNVA 4WGYA 5DS4A 1S7ZA 5DS5A 1FMWA 1T9KA 1B68A 1FMVA 3WAQA 4GEHA 4DRJB 5BQHA 3W2WA 4AX2A 2A6HF 1ZHTA 3L1MA 3CZ6A 4DRHB 4OIOF 4EHPA 1VOMA 2IBFA 4P6IC 1YLMA 3EJNA 2VC9A 1OCZC 4DJ9A 1A7EA 1ZHWA 2TMVP 1OCCC 3QVYA 4NC3A 4PK4A 2YWAA 1M6TA 1UG7A 5L0CA 3U8VA 2XXAB 2R7XA 2ETSA 3EGDA 3QTHA 4FESA 4NY3A 3U2MA 1A0BA 1I4YA 1FNTc 2VCAA 2DYSC 2HJMA 3FOPA 5FCLA 2VB6A 2ZXWC 2EPNA 3U9JA 1ZU4A 1G4US 2J0WA 4JEAA 4EKWA 3DMDA 2ZXOA 1WTYA 4JKVA 4MW8A 4DOZA 5AC5A 1TWAA 2GWWA 3GM1A 5L3VA 4XQ1A 4F4BA 2CCYA 4U5EE 4ZLCA 5KYXB 3U3FA 4MNDA 3GEHA 2WVOA 3LLIA 4I3MA 4A2NB 3UNGC 2J9WA 4EBKA 1NG1A 3G4XA 4NCQA 2R02A 1GQAA 1JMWA 1DOWA 3E70C 3ECSA 1HMDA 4P9TA 2Q7RA 4D4NA 1PCXA 2A0BA 1EA8A 1BR1A 2Q4FA 3NYLA 2L81A 2YHSA 3DAFA 3NDBB 4O6NA 4XLNF 1NFNA 3J06A 4U5GA 4ULWA 1BBHA 5B1AC 4MVRA 1MNDA 4WGZA 2OJED 2YZSA 3S29A 1ZHZA 2CNWA 1RKEB 4MVSA 4BJ5A 1HE1A 2W4MA 2VASA 3I4UA 2IM8A 3LNRA 2A1DD 4WABA 2L9JA 2ZPAA 2KQ9A 4G0HA 5TJ5E 3S0XA 3SYNA 1GM5A 4PJNA 4JCZA 4XEVA 2J46A 4MVMA 1O5HA 1V55C 1QPUA 1R4TA 2I8BA 4JC7A 5AGFA 4C7OB 5E33A 5E2QA 2OG2A 2NUTB 2XLHA 1HW2A 2GAQA 2PX0A 2WZGA 4RBNA 3ZTMA 1MMGA 3VYWA 3ASOC 5T1DB 2R25A 3UR3C 1ZHXA 3ZIBA 1TKNA 2H8AA 3B29A 4Q4ZF 4IB4A 1T5OA 3IHUA 5E3AA 2H7BA 4HFKB 2H7VC 4B6IA 2YL1A 5B3IA 1WASA 1NU9C 3A9CA 3K1HA 4MTFA 4BEJA 3AQBA 1OKKD 2LQGA 3JT1A 5D91A 3SXYA 2J0XA 3ZSUA 4JZAA 2QY9A 3EG9A 4QDLA 4C3BA 2HMZA 3M4BA 1YDIA 3KMIA 5JRAA 1N1CA 3DKAA 1KNYA 5CI9A 4O6YA 5KYYB 1A41A 2PX3A 2AP3A 2KGOA 4JE9A 3W8HA 5COMA 4XWJA 1KTMA 2P1AA 3HTKC 4ZLDA 3JTLO 3RYLA 2PNOA 3C8GD 2WZLA 3RQFA 2WVQA 3U8PA 1F1MA 2EPLX 3RH3A 1E83A 2GDCA 2ICWG 4JEBA 4JJGA 1LM3B 4MW3A 3RQEA 1YYJA 4PJLA 2HV7A 1OCRC 2C03A 3G50A 4R32A 4Q5SF 2M64A 4I1OB 1Z23A 3OWTA 1ZZPA 4U5CE 2CNWD 3H2VA 3NMIA 2L7AA 3HNLA 1AUEA 1V74B 3JZ0A 3LEVA 1D1AA 1BR2A 2YL3A 3O10A 2A0UA 2IOQA 1NZEA 2EILC 2R7QA 2W45A 2WL8A 3DD7A 4J7YA 5E3CA 2J9VA 4IARA 4LERA 3U5SA 5EHHA 1NLXA 2YEVA 2HSQA 2L6GA 2NUPB 3N0TA 3FMSA 4RD9A 3TOLA 3WHNA 5L0DA 4GQHA 5T3TA 1U89A 5L3QA 2A69F 1ZHYA 1RJ9B 3B71A 3POVA 3PMRA 4GYTA 4MTGA 5A6BA 2DI3A 2LSEA 2R7SA 1OXKA 2Y69C 3ZQYA 4MVUA 3OEOA 3HNIA 2J7PA 1ZYRF 4KBLA 2P7VA 2J9BA 4M63A 2J8WA 1PD0A 1CGOA 3RFYA 2HKVA 3R2PA 5KYXA 1Q0MA 1VK5A 5HSWA 1T6UA 3BRJA 1S05A 1L7CA 1WN0A 3A11A 3DE9A 4JTDB 4KC9A 4Z9IA 3HLZA 5KYWB 3KH2A 3IQCA 2HUJA 3H2UA 2MYSA 2EPKX 3E9VA 1OW8A 1VLSA 4DBRA 1HMOA 4IWBA 3FAJA 2VCBA 4O6MA 2YLDA 3BEHA 2HFIA 3NMJA 2HJ3A 4AE4A 1Z63A 3ATPA 1U0BB 2IXMA 4NQFA 1ZW2A 4K0DA 3R7CA 1RKEA 1W2WA 4CDVA 2HSBA 3US6A 3B0UX 2R7VA 2PP4A 3Q7GA 2Q9BA 3T9OA 4JCHA 1AVOB 1FAPB 2MWQA 1I5NA 5F5FA 4D4XA 1Z6AA 5F5HA 1O87A 3DI5A 3RIPA 3LAYA 2R05A 4C7OA 3HJCA 4YL3A 1SYQA 4MS2A 4U5FE 4A4AA 1M56C 2E87A 2NPUA 3IQTA 3IPMO 2NUTA 2Y39A 2HMQA 4DRIB 3EH1A 2YL0A 4BEMJ 2IXNA 3JYHA 3K1IA 2YVKA 3MLGA 5F28E 4FAPB 1E86A 2OEVA 2VCCA 4BG0A 1M2VA 1OR3A 4CX9A 1EI7A 2XL4A 3VF0A 1E85A 2OU6A 5L0JA 2X0CA 3DM9B 4FX5A 4O7GA 3SXMA 3AG3C 1KU2A 3T6JA 1CGME 1SF8A 2OJQA 1G4WR 1LS1A 5A6BD 4IGGA 3PDMP 1BR4A 1OR2A 1LI7A 2ZXPA 3NRHA 2G62A 2J7PD 3V5XA 1QSPA 4DVZA 4EBJA 4XTKA 2YL7A 3EPVA 3ITFA 4E17A 3DWWA 1TFKB 3EHNA 4ANJA 2R9RB 2DGJA 3GORA 1YZAA 4YT2A 4NTFA 3SEOA 2A68F 3SXKA 2Y3GA 5JS5A 1H9TA 4JTCB 3VM6A 5DQTA 2NG1A 3C18A 3KL4A 3EFOA 5B1BC 4PFOA 2XRHA 3LEOA 2LFDA 2XLMA 4CSAC 4AL1A 4JW1A 2EPOA 3OA1A 3SP1A 4LDKA 4HFFB 1YA7O 1Y4CA 3QVZA 3Q6MA 5BQIA 1J8MF 1Q0GA 4G7HF 3L0IA 2KC3A 4P9FA 3K1IC 4CDYA 3X1OA 3JSZA 3FXHA 4KI2A 1XZPA 2LP4A 2M4EA 1A7VA 3GEEA 2NUPA 3S28A 1CPRA 1YZCA 5GPGB 3QW0A 1D0ZA 3S27A 1RJ9A 3M4CA 2UUIA 4XEFA 4YK5A 3U9MA 4U9EA 4Z9JA 3V5ZA 1M2OA 3U2LA 3HNKA 2BC5A 4BJ6C 4CJOA 4XLPF 3X2QC 1TWHA 3C63A 3CAXA 4QI2A 2Q9AA 1YA9A 4Q7CA 4HEAJ 2XSEA 3HNJA 1APCA 4XPYA 3AG4C 5L0IA 2XXAA 2EIMC 2NSGA 3MYFA 4N06A 4PFPA 1YJGA 5KYWA 2OEXA 1ORSC 3ABLC 3K66A 1AEPA 4EIYA 3JRTA 2D5RB 3AG2C 1C02A 1VMAA 1YVIA 3MBGA 3DJUB 4DVYP 4E0IA 2KNHA 2YLIA 3N2ZB 2R7OA 1Q0FA 3NG1A 4I1MA 4Z9HA 3WODF 3GWLA 2W9YA 4J30B 4IJJA 2H7OA 2XLVA 3JCUQ 3MFNA 4K1OA 2XL6A 3W8IA 3I5PA 1OW7A 1V54C 3UMKA 3UMIA 1PV3A 1TR2A 1V4AA 3RQGA 3WG7C 2KK1A 2R03A 3W4YA 1Y6DA 4YWQA 2DYRC 1Z5ZA 5JT4A 3L8IA 2KYHA 1FFHA 1XZQA 2XS8A 3K33A 2X51A 3LESA 3C8GB 4YL1A 4CBEA 1TWCA 3EQLF 2XS1A 2Y3BA 5L0HA 3LLKA 1YARO 1GGQA 4YJWA 4H54A 2JD3A 4OIPF 1T6QA 4YN0B 4YL0A 2V3CC 3ABMC 3C62A 1MQVA 3LUTB 4JRZA 4UDVA
chains in the Genus database with same CATH topology
3ZDLA 4W8PA 4DJ9A 4E18A 1DOWA 4P9TA 2GDCA 3TJ5A 5L0CA 4E17A 4K1OA 1ZW3A 1T01A 1ZVZA 3RF3A 1L7CA 1SYQA 3S90A 1TR2A 5L0GA 3H2UA 1ST6A 3H2VA 2L7AA 2LQGA 5L0FA 1XWJA 1RKEB 1U6HA 2B0HA 5FZTA 3T6GB 1YDIA 5L0HA 2GWWA 1QKRA 3VF0A 1ZW2A 3MYIA 5L0JA 5L0IA 2X0CA 1RKCA 1DOVA 4PR9A 2HSQA 1H6GA 4ONSA 5L0DA 1U89A 1RKEA 3TJ6A 4IGGA 4EHPA 2IBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDL A;  4W8P A;  4DJ9 A;  4E18 A;  1DOW A;  4P9T A;  2GDC A;  3TJ5 A;  5L0C A;  4E17 A;  4K1O A;  1ZW3 A;  1T01 A;  1ZVZ A;  3RF3 A;  1L7C A;  1SYQ A;  3S90 A;  1TR2 A;  5L0G A;  3H2U A;  1ST6 A;  3H2V A;  2L7A A;  2LQG A;  5L0F A;  1XWJ A;  1RKE B;  1U6H A;  2B0H A;  5FZT A;  3T6G B;  1YDI A;  5L0H A;  2GWW A;  1QKR A;  3VF0 A;  1ZW2 A;  3MYI A;  5L0J A;  5L0I A;  2X0C A;  1RKC A;  1DOV A;  4PR9 A;  2HSQ A;  1H6G A;  4ONS A;  5L0D A;  1U89 A;  1RKE A;  3TJ6 A;  4IGG A;  4EHP A;  2IBF A; 
#chains in the Genus database with same CATH topology
 1I4Z A;  3CEX A;  1LIH A;  1YYX A;  2UUH A;  4W8P A;  4XEK A;  5B3S C;  3H65 A;  2KJG A;  2YQY A;  4E0H A;  2ZD9 A;  3LS0 A;  4WJ0 A;  3TJ5 A;  1HE9 A;  2EIK C;  3NKD A;  3I5Q A;  3LJB A;  4JUR I;  3PHF 2;  3DAG A;  3ZC4 A;  1CGN A;  5K0I A;  1H9G A;  3ABK C;  2QNL A;  4AL0 A;  4CS9 C;  1D1B A;  5L0G A;  2QLA A;  4X0R A;  1HY5 A;  3ASN C;  3F46 A;  2LIG A;  4JVS A;  1K40 A;  3KKB A;  4OD4 A;  2I15 A;  2A6E F;  2QE9 A;  2EIN C;  4YT8 A;  4K7B A;  4OIN F;  2EPM X;  5BUO A;  3UGP A;  1D1C A;  1RCP A;  1FTS A;  4PR9 A;  1MMD A;  1WWP A;  1OW6 A;  3Q7L A;  3QW1 A;  4ONS A;  3L8J A;  2OOC A;  2DB4 A;  3ZG1 A;  2R7T A;  2XM0 A;  4MTO A;  3DM5 A;  3B9Q A;  5DQZ A;  2JPU A;  2LCH A;  2BE5 F;  2YRF A;  4E18 A;  3EG9 B;  5JUA A;  4U9D A;  4PAC A;  3SXZ A;  1ZW3 A;  2HZ8 A;  4AK9 A;  4EWC A;  3RF3 A;  5KYU B;  1K04 A;  4CSA A;  1EQ1 A;  1LI5 A;  3IQ6 A;  1MMA A;  1ST6 A;  2W4B A;  3GM3 A;  3M1C B;  2FGY A;  2J45 A;  1MMN A;  2XM4 A;  1U6H A;  2L6H A;  3O55 A;  4XPW A;  4NTA A;  3EZH A;  4XPX A;  2RSE B;  2Y3H A;  5FZT A;  2EIJ C;  4LLE A;  1O3U A;  2KSF A;  5IY5 C;  4CS7 A;  3FDQ A;  4JJF A;  1FFT C;  4EUK B;  4OIQ F;  3HKK A;  3W2V A;  1VLT A;  2KW3 C;  2BL2 A;  4CIH A;  3TJ6 A;  2P6V A;  3SNH A;  1G8X A;  1R5I D;  4BJ6 A;  3TK0 A;  1BDJ B;  1QZX A;  3B0P A;  3JSE O;  2ZXR A;  1ORY A;  4MVQ A;  5JSL A;  1Q0D A;  5HV9 A;  5KYY A;  2CDQ A;  4H4K C;  2YLG A;  3FVY A;  4ER9 A;  3TUL A;  5JVE A;  2PF4 E;  2VH3 A;  1SZI A;  2ASR A;  1OXB A;  3S9O A;  2PFD A;  1Z3I X;  3KYI A;  1ORJ A;  2CGE A;  3U3B A;  3M79 A;  1OKK A;  2GFH A;  5L0F A;  1C17 M;  3DE8 A;  3NMK A;  1H7I A;  2PBE A;  3TD7 A;  5A6J A;  1JPJ A;  1OCO C;  3DZA A;  1SR2 A;  5COF A;  3EGX B;  1NU7 D;  4E7Z A;  1FR0 A;  1IZM A;  1K05 A;  4IAQ A;  3MYI A;  4U5D E;  5JLI A;  1LPE A;  1NBB A;  4PJM A;  4BJ1 A;  2R7R A;  3L34 A;  3GAN A;  1VTM P;  1TFO B;  5COG A;  1ZU5 A;  2HS5 A;  3C7J A;  5CI8 A;  3C8G A;  4LAC B;  3VRC A;  3VAY A;  1JRA A;  5T3W A;  3ZDL A;  4AE4 B;  2JX0 A;  4U5B E;  2J9U A;  5BQG A;  3ZWI A;  1D0X A;  3IQ5 A;  3T4R A;  3K6B A;  4YT4 A;  4CIP A;  2AVK A;  4N4W A;  1E2X A;  2CYD A;  2P0N A;  2WB7 A;  2V26 A;  5A6K A;  3FOO A;  1C03 A;  4OIR F;  2GA0 A;  4YT5 A;  4MQ9 F;  4IRU A;  1BZ4 A;  4JTA B;  3TOM A;  3GOD A;  2MHR A;  2AU5 A;  2LK4 A;  3AGT A;  2Q9C A;  4J32 B;  2XLD A;  4G7Z F;  1Z7Q c;  3IEE A;  2XLE A;  4HE8 D;  1DOV A;  2XLO A;  3CQZ A;  1H6G A;  1JPN A;  1OQC A;  3V7O A;  3EGD B;  5A6A A;  1Q0K A;  3AJM A;  2NSF A;  3NYJ A;  3AG1 C;  4CS9 A;  2CW0 F;  4EBB A;  3EZI A;  2L6F A;  3GM2 A;  1NFO A;  4G78 A;  1G5Z A;  3Q6N A;  3ZTZ A;  1IW7 F;  4MVO A;  2Z15 A;  2XLW A;  2G3K A;  2B0J A;  2FFH A;  1M2V B;  3FAP B;  3SZR A;  1VB5 A;  5CIV A;  3CSK A;  1ZVZ A;  4C3D A;  4FWV A;  3KPH A;  4LDR A;  1NSG B;  1CPQ A;  4BJT A;  1VYI A;  2RD9 A;  5D92 A;  1HW1 A;  2G3V A;  3EH2 A;  2HV6 A;  2YKZ A;  2AWC A;  2LD6 A;  2P61 A;  4CS8 A;  4DXW A;  3RVY A;  1RMV A;  3O39 A;  3RKO F;  1GS9 A;  1YAU O;  1TWG A;  1T6I A;  4N6C A;  2IYL D;  3T6G B;  3UGO A;  1QVX A;  4LDQ A;  4QI0 A;  4I44 A;  5DS6 A;  3KYJ A;  5KYU A;  1WAT A;  3UMH A;  1RKC A;  3NYM A;  1J8Y F;  4ULV A;  1LS4 A;  2R7W A;  5AC4 A;  3O6X A;  1JR8 A;  1M57 C;  4BJ5 C;  3QZC A;  2D4U A;  3EHM A;  3B0V C;  4NTB A;  256B A;  3FHD A;  3QMK A;  3JRM O;  1WOL A;  2OCC C;  3AOU A;  2C04 A;  3EFO B;  4C3E A;  2IXP A;  2WVN A;  3C8Z A;  3F47 A;  3MX3 A;  2QUP A;  1QLE C;  4IAO A;  3T6B A;  3AGU A;  3S84 A;  2QTV A;  3G4Z A;  5DVW A;  2IXO A;  4CJG A;  3GEI A;  1MNE A;  1A7D A;  1XWJ A;  2R7U A;  1EKY A;  1PD1 A;  4KNW A;  3LNM B;  5JP7 A;  3V5Y A;  4W8K A;  4L6R A;  4E7S A;  1D0Y A;  3M15 A;  4RDA A;  4CDA A;  5DLJ A;  1LE4 A;  1LKX A;  3K7D A;  1LE2 A;  2F22 A;  1JAF A;  3N24 A;  4G7O F;  3LS1 A;  2O9X A;  1LVK A;  4N6H A;  4U5H A;  2WZF A;  5KYN A;  4J7T A;  3EGX A;  4CS8 C;  3PCV A;  3TQO A;  2FAP B;  3GWN A;  5A69 A;  3JYY A;  4O79 A;  4OD5 A;  4BPM A;  1TQG A;  2OKU A;  2OQM A;  5EGY A;  1T01 A;  1L3P A;  1WGW A;  1QQ3 A;  2Q3T A;  1RXQ A;  1UFB A;  2LFF A;  3DJN B;  3ZVR A;  4DBQ A;  1JOG A;  3NKE A;  1SMY F;  3U0C A;  4JIO A;  1VYK A;  2XL8 A;  2Y3D A;  5EK0 A;  3RW0 A;  3RVZ A;  1E84 A;  2AWY A;  4LLC A;  3S90 A;  3DXJ F;  4MVZ A;  2B0H A;  3AQC A;  4PJJ A;  2Q00 A;  3ZQV A;  1QKR A;  4KNV A;  4WGY A;  5DS4 A;  1S7Z A;  5DS5 A;  1FMW A;  1T9K A;  1B68 A;  1FMV A;  3WAQ A;  4GEH A;  4DRJ B;  5BQH A;  3W2W A;  4AX2 A;  2A6H F;  1ZHT A;  3L1M A;  3CZ6 A;  4DRH B;  4OIO F;  4EHP A;  1VOM A;  2IBF A;  4P6I C;  1YLM A;  3EJN A;  2VC9 A;  1OCZ C;  4DJ9 A;  1A7E A;  1ZHW A;  2TMV P;  1OCC C;  3QVY A;  4NC3 A;  4PK4 A;  2YWA A;  1M6T A;  1UG7 A;  5L0C A;  3U8V A;  2XXA B;  2R7X A;  2ETS A;  3EGD A;  3QTH A;  4FES A;  4NY3 A;  3U2M A;  1A0B A;  1I4Y A;  1FNT c;  2VCA A;  2DYS C;  2HJM A;  3FOP A;  5FCL A;  2VB6 A;  2ZXW C;  2EPN A;  3U9J A;  1ZU4 A;  1G4U S;  2J0W A;  4JEA A;  4EKW A;  3DMD A;  2ZXO A;  1WTY A;  4JKV A;  4MW8 A;  4DOZ A;  5AC5 A;  1TWA A;  2GWW A;  3GM1 A;  5L3V A;  4XQ1 A;  4F4B A;  2CCY A;  4U5E E;  4ZLC A;  5KYX B;  3U3F A;  4MND A;  3GEH A;  2WVO A;  3LLI A;  4I3M A;  4A2N B;  3UNG C;  2J9W A;  4EBK A;  1NG1 A;  3G4X A;  4NCQ A;  2R02 A;  1GQA A;  1JMW A;  1DOW A;  3E70 C;  3ECS A;  1HMD A;  4P9T A;  2Q7R A;  4D4N A;  1PCX A;  2A0B A;  1EA8 A;  1BR1 A;  2Q4F A;  3NYL A;  2L81 A;  2YHS A;  3DAF A;  3NDB B;  4O6N A;  4XLN F;  1NFN A;  3J06 A;  4U5G A;  4ULW A;  1BBH A;  5B1A C;  4MVR A;  1MND A;  4WGZ A;  2OJE D;  2YZS A;  3S29 A;  1ZHZ A;  2CNW A;  1RKE B;  4MVS A;  4BJ5 A;  1HE1 A;  2W4M A;  2VAS A;  3I4U A;  2IM8 A;  3LNR A;  2A1D D;  4WAB A;  2L9J A;  2ZPA A;  2KQ9 A;  4G0H A;  5TJ5 E;  3S0X A;  3SYN A;  1GM5 A;  4PJN A;  4JCZ A;  4XEV A;  2J46 A;  4MVM A;  1O5H A;  1V55 C;  1QPU A;  1R4T A;  2I8B A;  4JC7 A;  5AGF A;  4C7O B;  5E33 A;  5E2Q A;  2OG2 A;  2NUT B;  2XLH A;  1HW2 A;  2GAQ A;  2PX0 A;  2WZG A;  4RBN A;  3ZTM A;  1MMG A;  3VYW A;  3ASO C;  5T1D B;  2R25 A;  3UR3 C;  1ZHX A;  3ZIB A;  1TKN A;  2H8A A;  3B29 A;  4Q4Z F;  4IB4 A;  1T5O A;  3IHU A;  5E3A A;  2H7B A;  4HFK B;  2H7V C;  4B6I A;  2YL1 A;  5B3I A;  1WAS A;  1NU9 C;  3A9C A;  3K1H A;  4MTF A;  4BEJ A;  3AQB A;  1OKK D;  2LQG A;  3JT1 A;  5D91 A;  3SXY A;  2J0X A;  3ZSU A;  4JZA A;  2QY9 A;  3EG9 A;  4QDL A;  4C3B A;  2HMZ A;  3M4B A;  1YDI A;  3KMI A;  5JRA A;  1N1C A;  3DKA A;  1KNY A;  5CI9 A;  4O6Y A;  5KYY B;  1A41 A;  2PX3 A;  2AP3 A;  2KGO A;  4JE9 A;  3W8H A;  5COM A;  4XWJ A;  1KTM A;  2P1A A;  3HTK C;  4ZLD A;  3JTL O;  3RYL A;  2PNO A;  3C8G D;  2WZL A;  3RQF A;  2WVQ A;  3U8P A;  1F1M A;  2EPL X;  3RH3 A;  1E83 A;  2GDC A;  2ICW G;  4JEB A;  4JJG A;  1LM3 B;  4MW3 A;  3RQE A;  1YYJ A;  4PJL A;  2HV7 A;  1OCR C;  2C03 A;  3G50 A;  4R32 A;  4Q5S F;  2M64 A;  4I1O B;  1Z23 A;  3OWT A;  1ZZP A;  4U5C E;  2CNW D;  3H2V A;  3NMI A;  2L7A A;  3HNL A;  1AUE A;  1V74 B;  3JZ0 A;  3LEV A;  1D1A A;  1BR2 A;  2YL3 A;  3O10 A;  2A0U A;  2IOQ A;  1NZE A;  2EIL C;  2R7Q A;  2W45 A;  2WL8 A;  3DD7 A;  4J7Y A;  5E3C A;  2J9V A;  4IAR A;  4LER A;  3U5S A;  5EHH A;  1NLX A;  2YEV A;  2HSQ A;  2L6G A;  2NUP B;  3N0T A;  3FMS A;  4RD9 A;  3TOL A;  3WHN A;  5L0D A;  4GQH A;  5T3T A;  1U89 A;  5L3Q A;  2A69 F;  1ZHY A;  1RJ9 B;  3B71 A;  3POV A;  3PMR A;  4GYT A;  4MTG A;  5A6B A;  2DI3 A;  2LSE A;  2R7S A;  1OXK A;  2Y69 C;  3ZQY A;  4MVU A;  3OEO A;  3HNI A;  2J7P A;  1ZYR F;  4KBL A;  2P7V A;  2J9B A;  4M63 A;  2J8W A;  1PD0 A;  1CGO A;  3RFY A;  2HKV A;  3R2P A;  5KYX A;  1Q0M A;  1VK5 A;  5HSW A;  1T6U A;  3BRJ A;  1S05 A;  1L7C A;  1WN0 A;  3A11 A;  3DE9 A;  4JTD B;  4KC9 A;  4Z9I A;  3HLZ A;  5KYW B;  3KH2 A;  3IQC A;  2HUJ A;  3H2U A;  2MYS A;  2EPK X;  3E9V A;  1OW8 A;  1VLS A;  4DBR A;  1HMO A;  4IWB A;  3FAJ A;  2VCB A;  4O6M A;  2YLD A;  3BEH A;  2HFI A;  3NMJ A;  2HJ3 A;  4AE4 A;  1Z63 A;  3ATP A;  1U0B B;  2IXM A;  4NQF A;  1ZW2 A;  4K0D A;  3R7C A;  1RKE A;  1W2W A;  4CDV A;  2HSB A;  3US6 A;  3B0U X;  2R7V A;  2PP4 A;  3Q7G A;  2Q9B A;  3T9O A;  4JCH A;  1AVO B;  1FAP B;  2MWQ A;  1I5N A;  5F5F A;  4D4X A;  1Z6A A;  5F5H A;  1O87 A;  3DI5 A;  3RIP A;  3LAY A;  2R05 A;  4C7O A;  3HJC A;  4YL3 A;  1SYQ A;  4MS2 A;  4U5F E;  4A4A A;  1M56 C;  2E87 A;  2NPU A;  3IQT A;  3IPM O;  2NUT A;  2Y39 A;  2HMQ A;  4DRI B;  3EH1 A;  2YL0 A;  4BEM J;  2IXN A;  3JYH A;  3K1I A;  2YVK A;  3MLG A;  5F28 E;  4FAP B;  1E86 A;  2OEV A;  2VCC A;  4BG0 A;  1M2V A;  1OR3 A;  4CX9 A;  1EI7 A;  2XL4 A;  3VF0 A;  1E85 A;  2OU6 A;  5L0J A;  2X0C A;  3DM9 B;  4FX5 A;  4O7G A;  3SXM A;  3AG3 C;  1KU2 A;  3T6J A;  1CGM E;  1SF8 A;  2OJQ A;  1G4W R;  1LS1 A;  5A6B D;  4IGG A;  3PDM P;  1BR4 A;  1OR2 A;  1LI7 A;  2ZXP A;  3NRH A;  2G62 A;  2J7P D;  3V5X A;  1QSP A;  4DVZ A;  4EBJ A;  4XTK A;  2YL7 A;  3EPV A;  3ITF A;  4E17 A;  3DWW A;  1TFK B;  3EHN A;  4ANJ A;  2R9R B;  2DGJ A;  3GOR A;  1YZA A;  4YT2 A;  4NTF A;  3SEO A;  2A68 F;  3SXK A;  2Y3G A;  5JS5 A;  1H9T A;  4JTC B;  3VM6 A;  5DQT A;  2NG1 A;  3C18 A;  3KL4 A;  3EFO A;  5B1B C;  4PFO A;  2XRH A;  3LEO A;  2LFD A;  2XLM A;  4CSA C;  4AL1 A;  4JW1 A;  2EPO A;  3OA1 A;  3SP1 A;  4LDK A;  4HFF B;  1YA7 O;  1Y4C A;  3QVZ A;  3Q6M A;  5BQI A;  1J8M F;  1Q0G A;  4G7H F;  3L0I A;  2KC3 A;  4P9F A;  3K1I C;  4CDY A;  3X1O A;  3JSZ A;  3FXH A;  4KI2 A;  1XZP A;  2LP4 A;  2M4E A;  1A7V A;  3GEE A;  2NUP A;  3S28 A;  1CPR A;  1YZC A;  5GPG B;  3QW0 A;  1D0Z A;  3S27 A;  1RJ9 A;  3M4C A;  2UUI A;  4XEF A;  4YK5 A;  3U9M A;  4U9E A;  4Z9J A;  3V5Z A;  1M2O A;  3U2L A;  3HNK A;  2BC5 A;  4BJ6 C;  4CJO A;  4XLP F;  3X2Q C;  1TWH A;  3C63 A;  3CAX A;  4QI2 A;  2Q9A A;  1YA9 A;  4Q7C A;  4HEA J;  2XSE A;  3HNJ A;  1APC A;  4XPY A;  3AG4 C;  5L0I A;  2XXA A;  2EIM C;  2NSG A;  3MYF A;  4N06 A;  4PFP A;  1YJG A;  5KYW A;  2OEX A;  1ORS C;  3ABL C;  3K66 A;  1AEP A;  4EIY A;  3JRT A;  2D5R B;  3AG2 C;  1C02 A;  1VMA A;  1YVI A;  3MBG A;  3DJU B;  4DVY P;  4E0I A;  2KNH A;  2YLI A;  3N2Z B;  2R7O A;  1Q0F A;  3NG1 A;  4I1M A;  4Z9H A;  3WOD F;  3GWL A;  2W9Y A;  4J30 B;  4IJJ A;  2H7O A;  2XLV A;  3JCU Q;  3MFN A;  4K1O A;  2XL6 A;  3W8I A;  3I5P A;  1OW7 A;  1V54 C;  3UMK A;  3UMI A;  1PV3 A;  1TR2 A;  1V4A A;  3RQG A;  3WG7 C;  2KK1 A;  2R03 A;  3W4Y A;  1Y6D A;  4YWQ A;  2DYR C;  1Z5Z A;  5JT4 A;  3L8I A;  2KYH A;  1FFH A;  1XZQ A;  2XS8 A;  3K33 A;  2X51 A;  3LES A;  3C8G B;  4YL1 A;  4CBE A;  1TWC A;  3EQL F;  2XS1 A;  2Y3B A;  5L0H A;  3LLK A;  1YAR O;  1GGQ A;  4YJW A;  4H54 A;  2JD3 A;  4OIP F;  1T6Q A;  4YN0 B;  4YL0 A;  2V3C C;  3ABM C;  3C62 A;  1MQV A;  3LUT B;  4JRZ A;  4UDV A; 
#chains in the Genus database with same CATH homology
 3ZDL A;  4W8P A;  4DJ9 A;  4E18 A;  1DOW A;  4P9T A;  2GDC A;  3TJ5 A;  5L0C A;  4E17 A;  4K1O A;  1ZW3 A;  1T01 A;  1ZVZ A;  3RF3 A;  1L7C A;  1SYQ A;  3S90 A;  1TR2 A;  5L0G A;  3H2U A;  1ST6 A;  3H2V A;  2L7A A;  2LQG A;  5L0F A;  1XWJ A;  1RKE B;  1U6H A;  2B0H A;  5FZT A;  3T6G B;  1YDI A;  5L0H A;  2GWW A;  1QKR A;  3VF0 A;  1ZW2 A;  3MYI A;  5L0J A;  5L0I A;  2X0C A;  1RKC A;  1DOV A;  4PR9 A;  2HSQ A;  1H6G A;  4ONS A;  5L0D A;  1U89 A;  1RKE A;  3TJ6 A;  4IGG A;  4EHP A;  2IBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...