1H6GA

Alpha-catenin m-domain
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
255
structure length
255
Chain Sequence
DLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYAQVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-1 CATENIN
publication title Crystal Structure of the M-Fragment of Alpha-Catenin: Implications for Modulation of Cell Adhesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 101
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1h6gA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1h6gA01
2HSQA 4E17A 1U6HA 4PR9A 4P9TA 1DOWA 4K1OA 3H2VA 1QKRA 3S90A 3T6GB 1RKCA 2GDCA 5L0FA 5L0JA 3VF0A 3TJ6A 1ST6A 2B0HA 4ONSA 5L0GA 1DOVA 1U89A 1XWJA 1ZW2A 1RKEB 1ZW3A 2IBFA 4EHPA 1ZVZA 3TJ5A 3ZDLA 1T01A 1RKEA 5L0CA 3H2UA 5L0DA 1SYQA 1TR2A 5FZTA 2LQGA 2GWWA 3MYIA 5L0HA 2L7AA 4DJ9A 4IGGA 2X0CA 1H6GA 4E18A 1YDIA 3RF3A 1L7CA 5L0IA 4W8PA
chains in the Genus database with same CATH superfamily
2Y3HA 3EZIA 1HW1A 4PFPA 1YA7O 4YK5A 1G4WR 3RQEA 3EFOB 5COGA 1YAUO 3RKOF 3SXZA 3DXJF 4M63A 1XZPA 3AOUA 4KNVA 4PJJA 5DQZA 1D0ZA 3LAYA 2KSFA 1RMVA 2J0XA 3A9CA 3Q6NA 2J9VA 3NKDA 4QI2A 3PHF2 2ZXRA 4EBJA 5DS4A 5AC5A 3C8GD 3JYHA 3TJ5A 4MVUA 2V26A 3CZ6A 2W4MA 1WTYA 2UUHA 4MW8A 2BL2A 1RJ9A 1IW7F 2GFHA 2NPUA 1OXBA 2QY9A 3GEHA 1M56C 4EWCA 2MHRA 4K0DA 3JSZA 3T6JA 2CNWA 3C62A 2XRHA 4AX2A 1M6TA 1NG1A 2A0UA 2DYRC 1OCOC 3U2MA 5KYNA 4PR9A 4W8KA 3EJNA 3L8JA 2LSEA 1JOGA 1SMYF 1IZMA 3G4XA 5A69A 1Z6AA 3EHMA 5E3AA 4C3EA 4MTGA 1ORSC 4MVMA 4NTFA 4MTOA 1LS1A 1ST6A 1AUEA 2VB6A 1QSPA 1VB5A 2ZXPA 2Y3GA 3F46A 3LLIA 5GPGB 5TJ5E 5L3QA 2OKUA 1EI7A 3B0PA 3KYIA 1T01A 1VLTA 2EPNA 2WZLA 4JURI 3H2UA 5KYXB 4J7TA 4U5GA 4DRHB 4OD4A 1G4US 4CSAA 2J7PA 3TQOA 5KYUB 3ATPA 2GA0A 2XXAA 5L0HA 4YL1A 3S27A 4CIPA 2BC5A 3ZTZA 3S28A 1RXQA 1WN0A 3SP1A 3GANA 3U3BA 3GM3A 4IAOA 4XWJA 1H6GA 4I1MA 2PP4A 2LP4A 1NFNA 4A2NB 1ZZPA 4AL1A 3DAGA 2EPOA 4Z9JA 2KGOA 1MMNA 2V3CC 3C8GA 1HW2A 1K05A 1PCXA 2E87A 1AEPA 1RKCA 1A7DA 1TFOB 3QTHA 4JIOA 4RD9A 5DS5A 4JW1A 1FFTC 1PD0A 1CPQA 1NU9C 2MYSA 3KPHA 3W8HA 2A1DD 4U9DA 2NUTB 2HSBA 2R7VA 4JTDB 1NZEA 2NSFA 2YRFA 4JTAB 3WHNA 4EBKA 5B1AC 1ORYA 1D0XA 2Q9CA 4HFKB 3AQCA 3ASOC 4U5HA 4ZLDA 3EPVA 4A4AA 4CX9A 4NTBA 1YJGA 3ABMC 1NFOA 4IAQA 4DJ9A 3LJBA 4IARA 4OIRF 3FOPA 3TOMA 2ASRA 5F5HA 4NY3A 4OIQF 5JRAA 3I5QA 4G0HA 5JSLA 2Z15A 3LS0A 3UR3C 4BJ1A 1SZIA 2Q3TA 2HZ8A 3W8IA 4JE9A 1WGWA 2WVQA 1V55C 1YA9A 3L1MA 4YL3A 5D92A 4HFFB 3NYJA 2J9BA 4FX5A 2O9XA 4LDRA 4J30B 1JPNA 2YLIA 1KU2A 5A6AA 3NYLA 2H8AA 1DOVA 4L6RA 1TWHA 4JVSA 4MW3A 3JYYA 2I8BA 5A6BD 1D1BA 1Z3IX 1ZVZA 3W2VA 1OW6A 1TKNA 3I5PA 4O79A 1LVKA 3K1IC 4FESA 3ZWIA 4E7ZA 3MBGA 1N1CA 1GQAA 3L8IA 3SZRA 4O7GA 2Q7RA 3DD7A 3GM1A 4Q4ZF 2DI3A 3M4BA 4DVYP 2H7VC 4G78A 4Z9HA 4EKWA 3JSEO 1BR1A 1ORJA 1L7CA 1FFHA 3PMRA 4MVSA 3R2PA 3GODA 4N6HA 3DM9B 3EGXB 4P9FA 3JZ0A 4XQ1A 3LEVA 4JKVA 3BRJA 5JS5A 2XL4A 2AU5A 2WVNA 4XPXA 2LCHA 4Z9IA 3T4RA 2R05A 3TULA 3DZAA 1LE2A 2HMZA 4PJNA 1FNTc 3VF0A 2XLDA 3A11A 4XPWA 1YZCA 3S9OA 3SNHA 5DQTA 5K0IA 3HNKA 3EHNA 2Y3BA 5A6KA 3HJCA 2R25A 3C8ZA 4PACA 4K7BA 1EQ1A 2CYDA 2MWQA 2XLMA 3IQ6A 3M4CA 3RFYA 1CGNA 2HJMA 4LERA 1M57C 4O6NA 4U5BE 3LNMB 5FZTA 1E85A 4GEHA 2D5RB 4IB4A 2QUPA 3U3FA 2P61A 2LQGA 2A6EF 3Q6MA 4X0RA 2L9JA 1M2OA 1CGOA 2YHSA 2C04A 3AGTA 1VMAA 4NTAA 1RKEB 3LUTB 2XLOA 4N4WA 1YARO 3W4YA 2R7RA 2Y69C 5KYYB 1MMDA 2J7PD 4YJWA 1D1AA 5FCLA 2JX0A 1Y6DA 5JP7A 1LM3B 1LPEA 4CS8C 2L81A 3DMDA 4JTCB 3T6BA 5B3SC 5A6BA 1A41A 4XEFA 4BEMJ 3NRHA 3DE8A 4P6IC 4CJGA 2IXOA 1QZXA 3LESA 2XL6A 4ULWA 3FMSA 2KYHA 1APCA 1XWJA 3X2QC 4BJ5A 3ABLC 2Q00A 2W4BA 1ZW3A 3HLZA 3JRMO 1YYXA 3N0TA 4BEJA 4QI0A 4FWVA 2YEVA 1Z23A 4IWBA 3PCVA 3ITFA 1HY5A 4EBBA 4DXWA 1OKKD 3U0CA 3EFOA 1H9TA 5KYWB 2IYLD 4CS9A 3NKEA 3UMHA 2W9YA 4ANJA 5EK0A 2WVOA 5HSWA 1VYIA 1KNYA 1RJ9B 3HNJA 2DYSC 4MNDA 3SXYA 1TWGA 3VM6A 4LDKA 1OW7A 1ZU5A 1Z5ZA 3UGOA 3SXMA 2AP3A 2EIMC 1MNEA 3KH2A 3MFNA 4YT4A 4LLCA 4C7OA 4IRUA 3WG7C 3V7OA 2A0BA 2NUPA 4MVZA 4NQFA 4AL0A 2X51A 3TOLA 3FVYA 1R4TA 1FTSA 3DJNB 3QW1A 4OIOF 2VASA 1JR8A 1NBBA 3M79A 5T3TA 2WB7A 2YL7A 3O55A 1O87A 2YWAA 1MMGA 2PNOA 1LE4A 1Q0GA 4WJ0A 3K33A 3E70C 2R7XA 1HMOA 2DGJA 1Y4CA 2YLGA 2X0CA 2WL8A 3AG1C 1QPUA 2XLEA 3U9JA 4AE4A 3SEOA 4DRIB 4N6CA 1C03A 4U5DE 2FFHA 2XS1A 3VAYA 4HE8D 4CBEA 4OINF 1JMWA 3JTLO 2JD3A 1LIHA 2JPUA 1BBHA 5B1BC 3K1HA 4EIYA 3U8PA 4PJMA 5KYXA 3O39A 3ZIBA 2HJ3A 2R03A 1A7VA 3L34A 5KYUA 3SXKA 3HNLA 1G5ZA 1OKKA 2QE9A 2YQYA 3HKKA 3GM2A 4RDAA 5CIVA 2GAQA 2LD6A 4CDYA 3UMIA 2PF4E 1EKYA 1I4ZA 2YZSA 2PX0A 1V4AA 2HV6A 2KNHA 1PD1A 4I3MA 3CSKA 3O10A 4O6MA 3IEEA 2XSEA 2A69F 3NMJA 2UUIA 5HV9A 2HV7A 2XM4A 4KNWA 5L0IA 1U0BB 3HTKC 4YWQA 4AK9A 1Q0FA 2EPLX 3C7JA 4CDVA 3ZVRA 4XEVA 2J9WA 2G3VA 2NUTA 4YT2A 1R5ID 3S90A 3E9VA 3KL4A 1OR3A 2H7BA 3GEIA 4U5CE 5CI8A 4NCQA 1FR0A 1OCZC 5F5FA 2XLVA 3ABKC 3S29A 2DB4A 4CSAC 3LS1A 4U9EA 2IM8A 4JCHA 5BQIA 3QVYA 1SR2A 2IBFA 2YL3A 3M1CB 2F22A 1ZYRF 3OA1A 1JRAA 3EH1A 4H54A 2P1AA 4KC9A 3AG3C 3RYLA 2LFDA 1BR4A 3WAQA 1BR2A 2IOQA 2NG1A 3MLGA 1HE9A 2P7VA 3B29A 2EPMX 3V5ZA 1M2VA 4WGYA 1A7EA 3GORA 1ZU4A 4JCZA 3B0VC 4BJTA 2G3KA 1GGQA 3K7DA 2VCAA 3JT1A 4OD5A 3R7CA 3F47A 4YT8A 3CAXA 2EILC 2FGYA 2QNLA 3EQLF 3N2ZB 3GWLA 3OWTA 4DBQA 2Y39A 3NMKA 1ZHYA 3RH3A 5EGYA 2Q9BA 1MQVA 3EH2A 4J7YA 3H2VA 1QKRA 3UGPA 2OJQA 4GYTA 1JPJA 4F4BA 3FAPB 2OU6A 3GEEA 3G50A 3FDQA 5L0GA 1MMAA 4D4NA 4WABA 4B6IA 4U5EE 1ZHTA 2WZFA 2R7WA 1VLSA 3EGDB 5L3VA 3VRCA 4BPMA 1A0BA 2QTVA 1PV3A 2OOCA 3IQTA 1VTMP 3EGXA 4YT5A 3V5XA 3FHDA 3MYIA 1GM5A 1LI7A 4JC7A 2L7AA 2YKZA 1LI5A 2ETSA 1CGME 1NLXA 1H7IA 5DLJA 4MQ9F 1UFBA 2PFDA 3CQZA 1VK5A 5F28E 5A6JA 3EG9A 1VOMA 1ZHWA 1T6QA 4ER9A 5IY5C 4EUKB 4JJFA 4G7ZF 3DWWA 5BQHA 1D0YA 2KC3A 2PBEA 4I44A 2XLWA 4J32B 2HMQA 4P9TA 1WASA 2B0JA 4G7OF 3S84A 5BUOA 3Q7LA 1E84A 1Q0KA 2CGEA 1NSGB 4BJ6C 1V74B 3U8VA 3B9QA 4R32A 1OR2A 1HMDA 1RKEA 1Q0DA 4E0HA 5L0DA 4PFOA 3RQFA 1O5HA 2OEXA 1I5NA 3QVZA 5KYYA 3IHUA 1BDJB 4JRZA 3DJUB 5E33A 3AG2C 3US6A 5AGFA 3W2WA 2VC9A 1T6UA 1BZ4A 3FOOA 1J8YF 3JCUQ 4E18A 1OW8A 4JEBA 3RF3A 3U5SA 3KMIA 1LS4A 4FAPB 4ZLCA 1Z7Qc 2R7QA 2PX3A 3K66A 4QDLA 3ZQVA 2XL8A 1JAFA 3B71A 3MX3A 1EA8A 2KQ9A 3RVYA 2EIKC 3U9MA 2L6FA 1AVOB 1T6IA 2GDCA 4JEAA 5L0FA 1L3PA 3K6BA 2B0HA 1T9KA 4ONSA 5KYWA 2LK4A 1YZAA 256BA 2M64A 2P6VA 3C63A 3IQ5A 3NMIA 4PK4A 2ZPAA 5E3CA 1FMVA 1G8XA 3DI5A 2AWYA 3AQBA 1T5OA 2C03A 3LLKA 5COMA 2EPKX 2OJED 3TD7A 5AC4A 1TWAA 4LACB 4C7OB 3NYMA 2NUPB 3DM5A 2GWWA 1YLMA 2D4UA 3ZTMA 1HE1A 3CEXA 2IXMA 2J9UA 5CI9A 1Z63A 3FAJA 1YYJA 3ASNC 2HSQA 3BEHA 3FXHA 4OIPF 4KI2A 2ZXWC 4BJ5C 1LKXA 1NU7D 2ICWG 1Q0MA 2XXAB 2ZXOA 4H4KC 5DS6A 3ZSUA 4PJLA 4AE4B 3UMKA 3AGUA 3V5YA 3B0UX 4BG0A 3POVA 3ZQYA 3T9OA 4XLPF 4KBLA 2R7TA 4MVOA 3WODF 2R7UA 4IJJA 1W2WA 2L6GA 2HUJA 2VH3A 4EHPA 4CS9C 3C8GB 2J0WA 2Q4FA 3RW0A 1E2XA 5L0CA 1WATA 1TR2A 5JVEA 3Q7GA 3C18A 3L0IA 1F1MA 4MVRA 3LEOA 5B3IA 4YL0A 3RQGA 1QQ3A 5E2QA 1O3UA 4ULVA 3J06A 2L6HA 2TMVP 2HS5A 2AVKA 2FAPB 1VYKA 2XS8A 3HNIA 2YL0A 3K1IA 2H7OA 2VCCA 3RVZA 4DRJB 2EIJC 3UNGC 2YL1A 4CS7A 3VYWA 2XLHA 4C3DA 1FMWA 4G7HF 1DOWA 3EZHA 2W45A 3NG1A 3LNRA 1B68A 1S05A 2KJGA 1ZHZA 4MTFA 4D4XA 3MYFA 5L0JA 1UG7A 2HFIA 1GS9A 1U89A 4I1OB 5EHHA 2R9RB 2ZD9A 5COFA 2G62A 3U2LA 1V54C 1SYQA 4MVQA 1SF8A 3I4UA 2KK1A 3AJMA 3DE9A 1D1CA 1K40A 4XLNF 3KYJA 4LDQA 2J46A 1J8MF 2CW0F 4DVZA 4XEKA 3S0XA 5T1DB 4CJOA 2M4EA 4C3BA 4XPYA 1TFKB 2I15A 4W8PA 2OG2A 1OXKA 4E17A 4JJGA 1KTMA 2WZGA 2RSEB 1M2VB 2R7OA 5D91A 4UDVA 1S7ZA 2QLAA 4DOZA 4K1OA 2BE5F 5BQGA 1E86A 2HKVA 2EINC 3T6GB 5JLIA 2R7SA 2R02A 1OCRC 2A68F 1RCPA 1ZW2A 4CS8A 2IXPA 3IPMO 3X1OA 4DBRA 3ZDLA 3KKBA 4Q7CA 1C02A 5T3WA 3ZG1A 4Q5SF 3H65A 4GQHA 4E0IA 2CCYA 2P0NA 4RBNA 4E7SA 3SYNA 1MNDA 2LFFA 2Y3DA 4BJ6A 1E83A 1FAPB 2YLDA 1XZQA 4IGGA 2OEVA 2KW3C 3OEOA 1ZHXA 3M15A 1OCCC 3JRTA 1TWCA 4MS2A 3N24A 3TK0A 3GWNA 3IQCA 2J45A 1U6HA 1CPRA 3QW0A 1QLEC 2CDQA 3O6XA 4LLEA 1QVXA 4O6YA 2NSGA 5JT4A 3EGDA 1WOLA 2RD9A 4NC3A 4N06A 2CNWD 2LIGA 1TQGA 2IXNA 2XM0A 1C17M 2OCCC 3EG9B 4U5FE 1YVIA 3TJ6A 2OQMA 4WGZA 4CIHA 2J8WA 2A6HF 3G4ZA 1H9GA 2VCBA 4CDAA 1WWPA 3QMKA 1K04A 2AWCA 2Q9AA 4YN0B 3QZCA 5JUAA 3ZC4A 4XTKA 3PDMP 3ECSA 3RIPA 1OQCA 3DKAA 3AG4C 4JZAA 4HEAJ 3NDBB 5DVWA 1I4YA 2YVKA 3DAFA 1YDIA
chains in the Genus database with same CATH topology
2HSQA 4E17A 1U6HA 4PR9A 4P9TA 1DOWA 4K1OA 3H2VA 1QKRA 3S90A 3T6GB 1RKCA 2GDCA 5L0FA 5L0JA 3VF0A 3TJ6A 1ST6A 2B0HA 4ONSA 5L0GA 1DOVA 1U89A 1XWJA 1ZW2A 1RKEB 1ZW3A 2IBFA 4EHPA 1ZVZA 3TJ5A 3ZDLA 1T01A 1RKEA 5L0CA 3H2UA 5L0DA 1SYQA 1TR2A 5FZTA 2LQGA 2GWWA 3MYIA 5L0HA 2L7AA 4DJ9A 4IGGA 2X0CA 1H6GA 4E18A 1YDIA 3RF3A 1L7CA 5L0IA 4W8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HSQ A;  4E17 A;  1U6H A;  4PR9 A;  4P9T A;  1DOW A;  4K1O A;  3H2V A;  1QKR A;  3S90 A;  3T6G B;  1RKC A;  2GDC A;  5L0F A;  5L0J A;  3VF0 A;  3TJ6 A;  1ST6 A;  2B0H A;  4ONS A;  5L0G A;  1DOV A;  1U89 A;  1XWJ A;  1ZW2 A;  1RKE B;  1ZW3 A;  2IBF A;  4EHP A;  1ZVZ A;  3TJ5 A;  3ZDL A;  1T01 A;  1RKE A;  5L0C A;  3H2U A;  5L0D A;  1SYQ A;  1TR2 A;  5FZT A;  2LQG A;  2GWW A;  3MYI A;  5L0H A;  2L7A A;  4DJ9 A;  4IGG A;  2X0C A;  1H6G A;  4E18 A;  1YDI A;  3RF3 A;  1L7C A;  5L0I A;  4W8P A; 
#chains in the Genus database with same CATH topology
 2Y3H A;  3EZI A;  1HW1 A;  4PFP A;  1YA7 O;  4YK5 A;  1G4W R;  3RQE A;  3EFO B;  5COG A;  1YAU O;  3RKO F;  3SXZ A;  3DXJ F;  4M63 A;  1XZP A;  3AOU A;  4KNV A;  4PJJ A;  5DQZ A;  1D0Z A;  3LAY A;  2KSF A;  1RMV A;  2J0X A;  3A9C A;  3Q6N A;  2J9V A;  3NKD A;  4QI2 A;  3PHF 2;  2ZXR A;  4EBJ A;  5DS4 A;  5AC5 A;  3C8G D;  3JYH A;  3TJ5 A;  4MVU A;  2V26 A;  3CZ6 A;  2W4M A;  1WTY A;  2UUH A;  4MW8 A;  2BL2 A;  1RJ9 A;  1IW7 F;  2GFH A;  2NPU A;  1OXB A;  2QY9 A;  3GEH A;  1M56 C;  4EWC A;  2MHR A;  4K0D A;  3JSZ A;  3T6J A;  2CNW A;  3C62 A;  2XRH A;  4AX2 A;  1M6T A;  1NG1 A;  2A0U A;  2DYR C;  1OCO C;  3U2M A;  5KYN A;  4PR9 A;  4W8K A;  3EJN A;  3L8J A;  2LSE A;  1JOG A;  1SMY F;  1IZM A;  3G4X A;  5A69 A;  1Z6A A;  3EHM A;  5E3A A;  4C3E A;  4MTG A;  1ORS C;  4MVM A;  4NTF A;  4MTO A;  1LS1 A;  1ST6 A;  1AUE A;  2VB6 A;  1QSP A;  1VB5 A;  2ZXP A;  2Y3G A;  3F46 A;  3LLI A;  5GPG B;  5TJ5 E;  5L3Q A;  2OKU A;  1EI7 A;  3B0P A;  3KYI A;  1T01 A;  1VLT A;  2EPN A;  2WZL A;  4JUR I;  3H2U A;  5KYX B;  4J7T A;  4U5G A;  4DRH B;  4OD4 A;  1G4U S;  4CSA A;  2J7P A;  3TQO A;  5KYU B;  3ATP A;  2GA0 A;  2XXA A;  5L0H A;  4YL1 A;  3S27 A;  4CIP A;  2BC5 A;  3ZTZ A;  3S28 A;  1RXQ A;  1WN0 A;  3SP1 A;  3GAN A;  3U3B A;  3GM3 A;  4IAO A;  4XWJ A;  1H6G A;  4I1M A;  2PP4 A;  2LP4 A;  1NFN A;  4A2N B;  1ZZP A;  4AL1 A;  3DAG A;  2EPO A;  4Z9J A;  2KGO A;  1MMN A;  2V3C C;  3C8G A;  1HW2 A;  1K05 A;  1PCX A;  2E87 A;  1AEP A;  1RKC A;  1A7D A;  1TFO B;  3QTH A;  4JIO A;  4RD9 A;  5DS5 A;  4JW1 A;  1FFT C;  1PD0 A;  1CPQ A;  1NU9 C;  2MYS A;  3KPH A;  3W8H A;  2A1D D;  4U9D A;  2NUT B;  2HSB A;  2R7V A;  4JTD B;  1NZE A;  2NSF A;  2YRF A;  4JTA B;  3WHN A;  4EBK A;  5B1A C;  1ORY A;  1D0X A;  2Q9C A;  4HFK B;  3AQC A;  3ASO C;  4U5H A;  4ZLD A;  3EPV A;  4A4A A;  4CX9 A;  4NTB A;  1YJG A;  3ABM C;  1NFO A;  4IAQ A;  4DJ9 A;  3LJB A;  4IAR A;  4OIR F;  3FOP A;  3TOM A;  2ASR A;  5F5H A;  4NY3 A;  4OIQ F;  5JRA A;  3I5Q A;  4G0H A;  5JSL A;  2Z15 A;  3LS0 A;  3UR3 C;  4BJ1 A;  1SZI A;  2Q3T A;  2HZ8 A;  3W8I A;  4JE9 A;  1WGW A;  2WVQ A;  1V55 C;  1YA9 A;  3L1M A;  4YL3 A;  5D92 A;  4HFF B;  3NYJ A;  2J9B A;  4FX5 A;  2O9X A;  4LDR A;  4J30 B;  1JPN A;  2YLI A;  1KU2 A;  5A6A A;  3NYL A;  2H8A A;  1DOV A;  4L6R A;  1TWH A;  4JVS A;  4MW3 A;  3JYY A;  2I8B A;  5A6B D;  1D1B A;  1Z3I X;  1ZVZ A;  3W2V A;  1OW6 A;  1TKN A;  3I5P A;  4O79 A;  1LVK A;  3K1I C;  4FES A;  3ZWI A;  4E7Z A;  3MBG A;  1N1C A;  1GQA A;  3L8I A;  3SZR A;  4O7G A;  2Q7R A;  3DD7 A;  3GM1 A;  4Q4Z F;  2DI3 A;  3M4B A;  4DVY P;  2H7V C;  4G78 A;  4Z9H A;  4EKW A;  3JSE O;  1BR1 A;  1ORJ A;  1L7C A;  1FFH A;  3PMR A;  4MVS A;  3R2P A;  3GOD A;  4N6H A;  3DM9 B;  3EGX B;  4P9F A;  3JZ0 A;  4XQ1 A;  3LEV A;  4JKV A;  3BRJ A;  5JS5 A;  2XL4 A;  2AU5 A;  2WVN A;  4XPX A;  2LCH A;  4Z9I A;  3T4R A;  2R05 A;  3TUL A;  3DZA A;  1LE2 A;  2HMZ A;  4PJN A;  1FNT c;  3VF0 A;  2XLD A;  3A11 A;  4XPW A;  1YZC A;  3S9O A;  3SNH A;  5DQT A;  5K0I A;  3HNK A;  3EHN A;  2Y3B A;  5A6K A;  3HJC A;  2R25 A;  3C8Z A;  4PAC A;  4K7B A;  1EQ1 A;  2CYD A;  2MWQ A;  2XLM A;  3IQ6 A;  3M4C A;  3RFY A;  1CGN A;  2HJM A;  4LER A;  1M57 C;  4O6N A;  4U5B E;  3LNM B;  5FZT A;  1E85 A;  4GEH A;  2D5R B;  4IB4 A;  2QUP A;  3U3F A;  2P61 A;  2LQG A;  2A6E F;  3Q6M A;  4X0R A;  2L9J A;  1M2O A;  1CGO A;  2YHS A;  2C04 A;  3AGT A;  1VMA A;  4NTA A;  1RKE B;  3LUT B;  2XLO A;  4N4W A;  1YAR O;  3W4Y A;  2R7R A;  2Y69 C;  5KYY B;  1MMD A;  2J7P D;  4YJW A;  1D1A A;  5FCL A;  2JX0 A;  1Y6D A;  5JP7 A;  1LM3 B;  1LPE A;  4CS8 C;  2L81 A;  3DMD A;  4JTC B;  3T6B A;  5B3S C;  5A6B A;  1A41 A;  4XEF A;  4BEM J;  3NRH A;  3DE8 A;  4P6I C;  4CJG A;  2IXO A;  1QZX A;  3LES A;  2XL6 A;  4ULW A;  3FMS A;  2KYH A;  1APC A;  1XWJ A;  3X2Q C;  4BJ5 A;  3ABL C;  2Q00 A;  2W4B A;  1ZW3 A;  3HLZ A;  3JRM O;  1YYX A;  3N0T A;  4BEJ A;  4QI0 A;  4FWV A;  2YEV A;  1Z23 A;  4IWB A;  3PCV A;  3ITF A;  1HY5 A;  4EBB A;  4DXW A;  1OKK D;  3U0C A;  3EFO A;  1H9T A;  5KYW B;  2IYL D;  4CS9 A;  3NKE A;  3UMH A;  2W9Y A;  4ANJ A;  5EK0 A;  2WVO A;  5HSW A;  1VYI A;  1KNY A;  1RJ9 B;  3HNJ A;  2DYS C;  4MND A;  3SXY A;  1TWG A;  3VM6 A;  4LDK A;  1OW7 A;  1ZU5 A;  1Z5Z A;  3UGO A;  3SXM A;  2AP3 A;  2EIM C;  1MNE A;  3KH2 A;  3MFN A;  4YT4 A;  4LLC A;  4C7O A;  4IRU A;  3WG7 C;  3V7O A;  2A0B A;  2NUP A;  4MVZ A;  4NQF A;  4AL0 A;  2X51 A;  3TOL A;  3FVY A;  1R4T A;  1FTS A;  3DJN B;  3QW1 A;  4OIO F;  2VAS A;  1JR8 A;  1NBB A;  3M79 A;  5T3T A;  2WB7 A;  2YL7 A;  3O55 A;  1O87 A;  2YWA A;  1MMG A;  2PNO A;  1LE4 A;  1Q0G A;  4WJ0 A;  3K33 A;  3E70 C;  2R7X A;  1HMO A;  2DGJ A;  1Y4C A;  2YLG A;  2X0C A;  2WL8 A;  3AG1 C;  1QPU A;  2XLE A;  3U9J A;  4AE4 A;  3SEO A;  4DRI B;  4N6C A;  1C03 A;  4U5D E;  2FFH A;  2XS1 A;  3VAY A;  4HE8 D;  4CBE A;  4OIN F;  1JMW A;  3JTL O;  2JD3 A;  1LIH A;  2JPU A;  1BBH A;  5B1B C;  3K1H A;  4EIY A;  3U8P A;  4PJM A;  5KYX A;  3O39 A;  3ZIB A;  2HJ3 A;  2R03 A;  1A7V A;  3L34 A;  5KYU A;  3SXK A;  3HNL A;  1G5Z A;  1OKK A;  2QE9 A;  2YQY A;  3HKK A;  3GM2 A;  4RDA A;  5CIV A;  2GAQ A;  2LD6 A;  4CDY A;  3UMI A;  2PF4 E;  1EKY A;  1I4Z A;  2YZS A;  2PX0 A;  1V4A A;  2HV6 A;  2KNH A;  1PD1 A;  4I3M A;  3CSK A;  3O10 A;  4O6M A;  3IEE A;  2XSE A;  2A69 F;  3NMJ A;  2UUI A;  5HV9 A;  2HV7 A;  2XM4 A;  4KNW A;  5L0I A;  1U0B B;  3HTK C;  4YWQ A;  4AK9 A;  1Q0F A;  2EPL X;  3C7J A;  4CDV A;  3ZVR A;  4XEV A;  2J9W A;  2G3V A;  2NUT A;  4YT2 A;  1R5I D;  3S90 A;  3E9V A;  3KL4 A;  1OR3 A;  2H7B A;  3GEI A;  4U5C E;  5CI8 A;  4NCQ A;  1FR0 A;  1OCZ C;  5F5F A;  2XLV A;  3ABK C;  3S29 A;  2DB4 A;  4CSA C;  3LS1 A;  4U9E A;  2IM8 A;  4JCH A;  5BQI A;  3QVY A;  1SR2 A;  2IBF A;  2YL3 A;  3M1C B;  2F22 A;  1ZYR F;  3OA1 A;  1JRA A;  3EH1 A;  4H54 A;  2P1A A;  4KC9 A;  3AG3 C;  3RYL A;  2LFD A;  1BR4 A;  3WAQ A;  1BR2 A;  2IOQ A;  2NG1 A;  3MLG A;  1HE9 A;  2P7V A;  3B29 A;  2EPM X;  3V5Z A;  1M2V A;  4WGY A;  1A7E A;  3GOR A;  1ZU4 A;  4JCZ A;  3B0V C;  4BJT A;  2G3K A;  1GGQ A;  3K7D A;  2VCA A;  3JT1 A;  4OD5 A;  3R7C A;  3F47 A;  4YT8 A;  3CAX A;  2EIL C;  2FGY A;  2QNL A;  3EQL F;  3N2Z B;  3GWL A;  3OWT A;  4DBQ A;  2Y39 A;  3NMK A;  1ZHY A;  3RH3 A;  5EGY A;  2Q9B A;  1MQV A;  3EH2 A;  4J7Y A;  3H2V A;  1QKR A;  3UGP A;  2OJQ A;  4GYT A;  1JPJ A;  4F4B A;  3FAP B;  2OU6 A;  3GEE A;  3G50 A;  3FDQ A;  5L0G A;  1MMA A;  4D4N A;  4WAB A;  4B6I A;  4U5E E;  1ZHT A;  2WZF A;  2R7W A;  1VLS A;  3EGD B;  5L3V A;  3VRC A;  4BPM A;  1A0B A;  2QTV A;  1PV3 A;  2OOC A;  3IQT A;  1VTM P;  3EGX A;  4YT5 A;  3V5X A;  3FHD A;  3MYI A;  1GM5 A;  1LI7 A;  4JC7 A;  2L7A A;  2YKZ A;  1LI5 A;  2ETS A;  1CGM E;  1NLX A;  1H7I A;  5DLJ A;  4MQ9 F;  1UFB A;  2PFD A;  3CQZ A;  1VK5 A;  5F28 E;  5A6J A;  3EG9 A;  1VOM A;  1ZHW A;  1T6Q A;  4ER9 A;  5IY5 C;  4EUK B;  4JJF A;  4G7Z F;  3DWW A;  5BQH A;  1D0Y A;  2KC3 A;  2PBE A;  4I44 A;  2XLW A;  4J32 B;  2HMQ A;  4P9T A;  1WAS A;  2B0J A;  4G7O F;  3S84 A;  5BUO A;  3Q7L A;  1E84 A;  1Q0K A;  2CGE A;  1NSG B;  4BJ6 C;  1V74 B;  3U8V A;  3B9Q A;  4R32 A;  1OR2 A;  1HMD A;  1RKE A;  1Q0D A;  4E0H A;  5L0D A;  4PFO A;  3RQF A;  1O5H A;  2OEX A;  1I5N A;  3QVZ A;  5KYY A;  3IHU A;  1BDJ B;  4JRZ A;  3DJU B;  5E33 A;  3AG2 C;  3US6 A;  5AGF A;  3W2W A;  2VC9 A;  1T6U A;  1BZ4 A;  3FOO A;  1J8Y F;  3JCU Q;  4E18 A;  1OW8 A;  4JEB A;  3RF3 A;  3U5S A;  3KMI A;  1LS4 A;  4FAP B;  4ZLC A;  1Z7Q c;  2R7Q A;  2PX3 A;  3K66 A;  4QDL A;  3ZQV A;  2XL8 A;  1JAF A;  3B71 A;  3MX3 A;  1EA8 A;  2KQ9 A;  3RVY A;  2EIK C;  3U9M A;  2L6F A;  1AVO B;  1T6I A;  2GDC A;  4JEA A;  5L0F A;  1L3P A;  3K6B A;  2B0H A;  1T9K A;  4ONS A;  5KYW A;  2LK4 A;  1YZA A;  256B A;  2M64 A;  2P6V A;  3C63 A;  3IQ5 A;  3NMI A;  4PK4 A;  2ZPA A;  5E3C A;  1FMV A;  1G8X A;  3DI5 A;  2AWY A;  3AQB A;  1T5O A;  2C03 A;  3LLK A;  5COM A;  2EPK X;  2OJE D;  3TD7 A;  5AC4 A;  1TWA A;  4LAC B;  4C7O B;  3NYM A;  2NUP B;  3DM5 A;  2GWW A;  1YLM A;  2D4U A;  3ZTM A;  1HE1 A;  3CEX A;  2IXM A;  2J9U A;  5CI9 A;  1Z63 A;  3FAJ A;  1YYJ A;  3ASN C;  2HSQ A;  3BEH A;  3FXH A;  4OIP F;  4KI2 A;  2ZXW C;  4BJ5 C;  1LKX A;  1NU7 D;  2ICW G;  1Q0M A;  2XXA B;  2ZXO A;  4H4K C;  5DS6 A;  3ZSU A;  4PJL A;  4AE4 B;  3UMK A;  3AGU A;  3V5Y A;  3B0U X;  4BG0 A;  3POV A;  3ZQY A;  3T9O A;  4XLP F;  4KBL A;  2R7T A;  4MVO A;  3WOD F;  2R7U A;  4IJJ A;  1W2W A;  2L6G A;  2HUJ A;  2VH3 A;  4EHP A;  4CS9 C;  3C8G B;  2J0W A;  2Q4F A;  3RW0 A;  1E2X A;  5L0C A;  1WAT A;  1TR2 A;  5JVE A;  3Q7G A;  3C18 A;  3L0I A;  1F1M A;  4MVR A;  3LEO A;  5B3I A;  4YL0 A;  3RQG A;  1QQ3 A;  5E2Q A;  1O3U A;  4ULV A;  3J06 A;  2L6H A;  2TMV P;  2HS5 A;  2AVK A;  2FAP B;  1VYK A;  2XS8 A;  3HNI A;  2YL0 A;  3K1I A;  2H7O A;  2VCC A;  3RVZ A;  4DRJ B;  2EIJ C;  3UNG C;  2YL1 A;  4CS7 A;  3VYW A;  2XLH A;  4C3D A;  1FMW A;  4G7H F;  1DOW A;  3EZH A;  2W45 A;  3NG1 A;  3LNR A;  1B68 A;  1S05 A;  2KJG A;  1ZHZ A;  4MTF A;  4D4X A;  3MYF A;  5L0J A;  1UG7 A;  2HFI A;  1GS9 A;  1U89 A;  4I1O B;  5EHH A;  2R9R B;  2ZD9 A;  5COF A;  2G62 A;  3U2L A;  1V54 C;  1SYQ A;  4MVQ A;  1SF8 A;  3I4U A;  2KK1 A;  3AJM A;  3DE9 A;  1D1C A;  1K40 A;  4XLN F;  3KYJ A;  4LDQ A;  2J46 A;  1J8M F;  2CW0 F;  4DVZ A;  4XEK A;  3S0X A;  5T1D B;  4CJO A;  2M4E A;  4C3B A;  4XPY A;  1TFK B;  2I15 A;  4W8P A;  2OG2 A;  1OXK A;  4E17 A;  4JJG A;  1KTM A;  2WZG A;  2RSE B;  1M2V B;  2R7O A;  5D91 A;  4UDV A;  1S7Z A;  2QLA A;  4DOZ A;  4K1O A;  2BE5 F;  5BQG A;  1E86 A;  2HKV A;  2EIN C;  3T6G B;  5JLI A;  2R7S A;  2R02 A;  1OCR C;  2A68 F;  1RCP A;  1ZW2 A;  4CS8 A;  2IXP A;  3IPM O;  3X1O A;  4DBR A;  3ZDL A;  3KKB A;  4Q7C A;  1C02 A;  5T3W A;  3ZG1 A;  4Q5S F;  3H65 A;  4GQH A;  4E0I A;  2CCY A;  2P0N A;  4RBN A;  4E7S A;  3SYN A;  1MND A;  2LFF A;  2Y3D A;  4BJ6 A;  1E83 A;  1FAP B;  2YLD A;  1XZQ A;  4IGG A;  2OEV A;  2KW3 C;  3OEO A;  1ZHX A;  3M15 A;  1OCC C;  3JRT A;  1TWC A;  4MS2 A;  3N24 A;  3TK0 A;  3GWN A;  3IQC A;  2J45 A;  1U6H A;  1CPR A;  3QW0 A;  1QLE C;  2CDQ A;  3O6X A;  4LLE A;  1QVX A;  4O6Y A;  2NSG A;  5JT4 A;  3EGD A;  1WOL A;  2RD9 A;  4NC3 A;  4N06 A;  2CNW D;  2LIG A;  1TQG A;  2IXN A;  2XM0 A;  1C17 M;  2OCC C;  3EG9 B;  4U5F E;  1YVI A;  3TJ6 A;  2OQM A;  4WGZ A;  4CIH A;  2J8W A;  2A6H F;  3G4Z A;  1H9G A;  2VCB A;  4CDA A;  1WWP A;  3QMK A;  1K04 A;  2AWC A;  2Q9A A;  4YN0 B;  3QZC A;  5JUA A;  3ZC4 A;  4XTK A;  3PDM P;  3ECS A;  3RIP A;  1OQC A;  3DKA A;  3AG4 C;  4JZA A;  4HEA J;  3NDB B;  5DVW A;  1I4Y A;  2YVK A;  3DAF A;  1YDI A; 
#chains in the Genus database with same CATH homology
 2HSQ A;  4E17 A;  1U6H A;  4PR9 A;  4P9T A;  1DOW A;  4K1O A;  3H2V A;  1QKR A;  3S90 A;  3T6G B;  1RKC A;  2GDC A;  5L0F A;  5L0J A;  3VF0 A;  3TJ6 A;  1ST6 A;  2B0H A;  4ONS A;  5L0G A;  1DOV A;  1U89 A;  1XWJ A;  1ZW2 A;  1RKE B;  1ZW3 A;  2IBF A;  4EHP A;  1ZVZ A;  3TJ5 A;  3ZDL A;  1T01 A;  1RKE A;  5L0C A;  3H2U A;  5L0D A;  1SYQ A;  1TR2 A;  5FZT A;  2LQG A;  2GWW A;  3MYI A;  5L0H A;  2L7A A;  4DJ9 A;  4IGG A;  2X0C A;  1H6G A;  4E18 A;  1YDI A;  3RF3 A;  1L7C A;  5L0I A;  4W8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...