1H6GA

Alpha-catenin m-domain
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
255
structure length
255
Chain Sequence
DLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYAQVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the M-Fragment of Alpha-Catenin: Implications for Modulation of Cell Adhesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords ALPHA-1 CATENIN
total genus 101
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1h6gA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1h6gA01
3RF3A 4ONSA 4K1OA 4EHPA 1TR2A 2HSQA 2B0HA 1U89A 2IBFA 5L0HA 1T01A 3H2VA 1RKCA 4E18A 5L0CA 1L7CA 5L0JA 1QKRA 2GDCA 2L7AA 1ZW2A 5L0IA 3TJ5A 4IGGA 1DOWA 4W8PA 2GWWA 1H6GA 3ZDLA 5L0DA 3H2UA 3MYIA 1RKEB 1RKEA 5L0GA 1U6HA 1ZW3A 1XWJA 4P9TA 2X0CA 1ST6A 1ZVZA 5L0FA 1DOVA 3S90A 3VF0A 3T6GB 4DJ9A 1YDIA 3TJ6A 4E17A 2LQGA 1SYQA 4PR9A 5FZTA
chains in the Genus database with same CATH superfamily
1HW1A 2Q4FA 3AG2C 4FESA 1QZXA 1OQCA 2JX0A 3HNIA 4JEBA 4Q7CA 2OJED 5GPGB 1VLTA 3S9OA 3W2VA 5KYYB 3ABLC 2XL8A 4BEJA 1Q0GA 3PMRA 3GODA 2BL2A 4J32B 3POVA 3FMSA 1TQGA 3K1HA 5L0CA 1NBBA 1VYIA 3FXHA 1SMYF 2YWAA 4YL0A 1I4YA 2HS5A 1ZW2A 2Q00A 1LKXA 3EFOA 3SP1A 2R7OA 3U8PA 3LNMB 3S28A 5A69A 5L0DA 4PFOA 4LLEA 4PJJA 4CS8C 2DB4A 3TOLA 2R02A 3NYLA 3JYHA 3UGOA 2E87A 4NTBA 1OKKA 3NYMA 5AGFA 1XWJA 2OEXA 3V5YA 3C63A 3VAYA 4BJ6A 3SXKA 1YDIA 2H7VC 4U5GA 3US6A 1VOMA 1WN0A 5DLJA 1H7IA 5KYXA 1Z63A 2KK1A 4U5EE 3IPMO 5DS5A 2J46A 3JZ0A 2A0UA 1YVIA 3C8GB 2W45A 3IQTA 3LAYA 2Y3HA 3TQOA 4JCHA 4N6HA 2ZXPA 1HE9A 2L9JA 3MX3A 2LCHA 3U2MA 4JJGA 2R7XA 1E85A 2HKVA 3EGXB 2HSQA 2LIGA 1VTMP 4JTCB 4HEAJ 4MTFA 1MNEA 1T01A 4J30B 5KYUB 3WHNA 3FOPA 4R32A 4JEAA 2ASRA 5D92A 3AGTA 4Z9JA 3ZG1A 5K0IA 3LLKA 2Y3DA 4LACB 3VRCA 3NMJA 3SXMA 3QW0A 1A7VA 1HY5A 2YVKA 3ASNC 3IEEA 2EPLX 4I3MA 4PJNA 3ZQVA 4ZLDA 4YT4A 2VC9A 4MVOA 4G78A 2LFDA 4UDVA 1KTMA 2R9RB 1YAUO 1ORYA 2L6HA 5B1BC 4OINF 2H7OA 3DAGA 3EFOB 1OCZC 3GEHA 3MYFA 5CI8A 2Q9CA 5JRAA 2V26A 2ZXOA 1S05A 2YQYA 2XS1A 4OD5A 1OW6A 3DI5A 3T6JA 1LM3B 5A6BD 1ZHYA 1IZMA 3VM6A 2PF4E 5CIVA 3S84A 4XLNF 1HMOA 4EBJA 3TK0A 4N6CA 4EBKA 2PFDA 2A0BA 2YLIA 3KYIA 1EI7A 5BQHA 4DRJB 4KNVA 1LS1A 2NUTB 1QVXA 3K1IA 2R03A 5A6JA 1M56C 1F1MA 1N1CA 4C7OA 2XLOA 2WZFA 3UMHA 1YZCA 1HE1A 3JRMO 4MVMA 3UR3C 1DOVA 1ZU5A 2KW3C 4NTAA 3JRTA 4YT2A 2J9VA 3LEOA 1KU2A 2XL4A 3PDMP 2CDQA 4Q4ZF 1JOGA 4MVUA 2MWQA 1ZHWA 3E70C 1XZQA 2A69F 4XEKA 1VB5A 2NUPA 2G62A 3DJUB 1BZ4A 1WTYA 4X0RA 3B0PA 3L0IA 4BG0A 4JCZA 3SXZA 2QNLA 2PX0A 2YL1A 3W4YA 3KPHA 1AVOB 2QTVA 3DMDA 2B0JA 2HJMA 1A7EA 3AGUA 4JKVA 5T1DB 5L0JA 3AG4C 2PX3A 1Q0DA 4P9FA 1YYXA 4CS9C 1RJ9A 3RQEA 2PNOA 4RD9A 4MS2A 2FFHA 2WVOA 1G8XA 3K6BA 5HSWA 1M6TA 5KYUA 1RXQA 1QQ3A 1Q0KA 2LD6A 3QVYA 1M2VB 3N24A 1TWCA 3JYYA 2HUJA 4HFFB 1BR4A 3DKAA 1NZEA 1WASA 1T6QA 4G7ZF 2D4UA 3A11A 1K05A 3CEXA 3OEOA 3MFNA 1TKNA 2Z15A 3CAXA 3T4RA 4KNWA 4DRHB 4Z9HA 5EK0A 2KJGA 2RSEB 2UUIA 2Y69C 1H9GA 2YZSA 4KI2A 3RFYA 2MYSA 3TJ5A 4CIHA 1IW7F 2HMQA 2XXAA 3EPVA 3LNRA 1L3PA 1O87A 4PK4A 3RVYA 3U9MA 3UMKA 4BEMJ 4D4XA 1MMAA 2YEVA 5F5FA 1BBHA 1RKEB 2KYHA 3EG9B 3DM9B 1VK5A 3EZHA 1ZHZA 1U6HA 1ZW3A 3GWNA 3DD7A 2NG1A 4P9TA 4PJMA 3EH2A 4EBBA 3Q7LA 1U0BB 2O9XA 4YL3A 5HV9A 3TJ6A 1LVKA 4BPMA 4MQ9F 3AOUA 3M79A 3U5SA 1JRAA 1QSPA 1OW7A 4OD4A 5B1AC 1PCXA 3G4XA 1LI7A 2EIMC 3RF3A 4CJGA 2QE9A 1G4US 1MMNA 2AWYA 3DXJF 3KL4A 4ULWA 4NC3A 2IBFA 3RH3A 5AC5A 3HNLA 1S7ZA 1SF8A 2XLHA 4E18A 3GANA 4EIYA 4YT8A 1V74B 2NPUA 1NFNA 2RD9A 2OG2A 3SXYA 1DOWA 4I1MA 4HFKB 4MW3A 2WL8A 1I4ZA 2EIJC 4DBQA 2A1DD 4DVYP 1RMVA 1OW8A 2LP4A 3GORA 3KMIA 3NKDA 5IY5C 3AG3C 1RCPA 4I44A 1V55C 2OQMA 2J9WA 2XLDA 2YLDA 4NTFA 2Q3TA 2LQGA 3U2LA 1FMWA 2Y39A 5FZTA 2ZXWC 3FHDA 4JW1A 5DS6A 1GQAA 4K0DA 3EGDB 3ABMC 5JLIA 3V5ZA 2IOQA 2X51A 1CGME 3ITFA 2Q9AA 1WOLA 1VYKA 1HMDA 4XPWA 5COGA 1QKRA 4H54A 4NQFA 3J06A 5A6KA 1M57C 2J45A 2J7PA 3C8GD 3RKOF 5DS4A 2GWWA 5FCLA 2QUPA 1TWHA 2DYRC 3V7OA 4XPYA 2A68F 3JSEO 1TWGA 4K7BA 3MYIA 3U0CA 3DE8A 2HSBA 1ZHXA 2BE5F 2DGJA 3I4UA 5BQGA 4MVQA 3S90A 4GQHA 5JUAA 1D0XA 2WZGA 1G4WR 2HMZA 3B9QA 1PD0A 5EGYA 1D1CA 2AP3A 1SYQA 3DM5A 3JT1A 3S29A 2IXMA 2HV6A 3M1CB 1FAPB 1UG7A 2VH3A 3NMIA 1R5ID 4JTAB 1B68A 4U5HA 3O39A 4CIPA 3A9CA 2DI3A 3JTLO 4A2NB 4CS9A 3RW0A 1BR2A 2YL7A 3GEEA 3TOMA 4AE4A 4JTDB 1Y4CA 4CDYA 5KYXB 3K7DA 1QLEC 5L3VA 4IAQA 4P6IC 2EILC 2PBEA 5KYWB 1D0YA 2CGEA 3O6XA 3K33A 2FAPB 4MTGA 4CX9A 4BJ5C 2WB7A 4I1OB 1D1AA 3Q6NA 1J8MF 4OIRF 2JD3A 2UUHA 2EPMX 2OEVA 2ZPAA 3ZQYA 1M2VA 3DZAA 2MHRA 1FR0A 3LUTB 2CNWA 4U5BE 2CCYA 3QVZA 1D0ZA 2L6GA 5L0GA 2HV7A 4N06A 5KYYA 2FGYA 2IM8A 4J7YA 5F28E 2C04A 2HJ3A 3OWTA 1TR2A 3ECSA 3X2QC 2EPOA 1HW2A 3AQCA 3U8VA 4MVZA 2J0WA 2I8BA 1RKCA 1T5OA 4AL1A 1OCRC 4MVRA 4CDVA 4AK9A 4LDRA 1NFOA 2HZ8A 2XS8A 1E2XA 4IGGA 4AX2A 3FOOA 2M64A 1OCCC 4PFPA 3RQGA 5B3SC 2XLVA 2XXAB 3GWLA 2G3VA 2P7VA 2NUPB 4NY3A 1RKEA 3EG9A 3Q7GA 1WATA 4U9EA 5KYNA 1E84A 1LE2A 3BRJA 1ZHTA 1TFKB 2BC5A 5F5HA 1FTSA 4MNDA 4OIPF 2R7WA 2LFFA 3TD7A 3ZTMA 3CZ6A 3O55A 1RJ9B 4JE9A 3DWWA 3FAJA 4FWVA 5E33A 1FNTc 1TWAA 2AU5A 1W2WA 4IAOA 3Q6MA 4CJOA 4EHPA 4WJ0A 2YL3A 4ZLCA 1BR1A 5L0HA 1OKKD 3OA1A 5DVWA 1GS9A 3HNJA 4B6IA 4CS7A 1O5HA 3ASOC 1L7CA 1CPRA 4YN0B 1G5ZA 1NG1A 2L81A 3H65A 4XEFA 3O10A 2KQ9A 4EKWA 3NMKA 4FX5A 2XLMA 1H6GA 2WVNA 2OU6A 5JP7A 5BQIA 3RYLA 1XZPA 3ZTZA 2P6VA 1LE4A 2R7QA 4PR9A 1JR8A 1Q0FA 1JPNA 1ST6A 3IQ6A 1E83A 4OIQF 3QW1A 4C3BA 4IB4A 1C03A 4YL1A 4AE4B 3FAPB 1LS4A 1YYJA 1A41A 1BDJB 2EINC 2IYLD 3LS1A 4JURI 3SNHA 2D5RB 4JC7A 2CNWD 4KBLA 4YT5A 4E7SA 3N2ZB 1VLSA 1CPQA 4WGZA 1A0BA 3F46A 3VYWA 4ANJA 1JPJA 4IWBA 1EKYA 4ONSA 3ZVRA 4K1OA 4MVSA 4XLPF 3S27A 1JAFA 3EJNA 2EPNA 4D4NA 1YJGA 4QI2A 3M15A 4O79A 4WABA 4OIOF 1PV3A 2KGOA 2CYDA 2VCBA 5JVEA 2YRFA 3PCVA 2VASA 4U9DA 3NG1A 3K1IC 1V4AA 3U9JA 3ZDLA 4O6YA 4DXWA 1CGNA 1SZIA 3W8IA 1Q0MA 1ZYRF 3H2UA 4GYTA 2R05A 2AVKA 4W8KA 3T9OA 5JS5A 1Z7Qc 1ZVZA 1C17M 1MMGA 3X1OA 3FDQA 3EHMA 2J9UA 2R7UA 2CW0F 3TULA 1A7DA 2J0XA 3EH1A 2P1AA 5E2QA 1Z3IX 1NSGB 4IJJA 4IRUA 4DVZA 4JRZA 5DQZA 1R4TA 3G4ZA 4MTOA 1V54C 3HTKC 3QTHA 1YZAA 3WAQA 4CDAA 4QI0A 1EA8A 1LIHA 4YJWA 2OJQA 5A6BA 2L7AA 3QMKA 3G50A 4XEVA 3C8GA 3KH2A 3CQZA 2WZLA 4O6MA 2DYSC 2XRHA 5KYWA 3IQCA 2GA0A 2NSGA 3ZIBA 2YLGA 2A6HF 2NSFA 1LI5A 3L34A 3EGDA 4Z9IA 3SEOA 4L6RA 3NKEA 3AG1C 2XL6A 3L8JA 1E86A 3B71A 1UFBA 1FMVA 2AWCA 2KSFA 3HJCA 3L8IA 1Y6DA 2YKZA 5CI9A 3FVYA 1T6UA 4DRIB 2F22A 3F47A 5BUOA 2XSEA 2H7BA 1ORSC 3IHUA 1FFHA 3GM1A 3MLGA 3RQFA 4AL0A 3SYNA 1I5NA 2JPUA 4CSAA 4CSAC 3AQBA 2R7TA 4YK5A 4E0IA 3U3BA 4XPXA 2Q7RA 4F4BA 3LEVA 4JVSA 2VCAA 3HLZA 1U89A 4G7HF 3H2VA 3LJBA 1OXKA 4BJ6C 4QDLA 3ABKC 4WGYA 1PD1A 2TMVP 2VB6A 1ZU4A 1NU9C 5A6AA 4HE8D 2I15A 2IXNA 4JIOA 4C3DA 3EZIA 3JSZA 5COFA 4CS8A 2ZD9A 1KNYA 2L6FA 2YL0A 2V3CC 2OKUA 2WVQA 2R25A 2YHSA 4PJLA 3KKBA 2IXOA 2X0CA 1ZZPA 2J8WA 1C02A 3LESA 4YWQA 3VF0A 2QY9A 2R7SA 1NLXA 1Z23A 3I5QA 3NRHA 1J8YF 3RVZA 4DBRA 2A6EF 4LDQA 3C8ZA 3W8HA 4BJ1A 1CGOA 4O6NA 3SZRA 3GM3A 3UMIA 2J7PD 3RIPA 4LLCA 3V5XA 4CBEA 1APCA 4NCQA 4G7OF 1M2OA 1YARO 3EGXA 2B0HA 1QPUA 1ORJA 2OOCA 4XQ1A 1YLMA 4IARA 4LERA 3IQ5A 5JT4A 5L0IA 2GFHA 3C62A 2KC3A 2QLAA 1K40A 2Q9BA 2EIKC 4XWJA 2LK4A 4W8PA 3HKKA 1K04A 3KYJA 2C03A 3WODF 2XLEA 4JZAA 1NU7D 2EPKX 2HFIA 1YA9A 4ULVA 1TFOB 1OR2A 3T6GB 4DJ9A 3E9VA 3K66A 4RDAA 4M63A 1VMAA 4E17A 4GEHA 3C7JA 1T9KA 2M4EA 2LSEA 1Z6AA 5E3AA 3GM2A 3ZC4A 3U3FA 3C18A 5T3WA 3PHF2 1OXBA 5DQTA 1OR3A 256BA 2P61A 4O7GA 3W2WA 4LDKA 3DE9A 1WWPA 1AEPA 4MW8A 1OCOC 3L1MA 3CSKA 3ZWIA 5B3IA 1EQ1A 2W9YA 5COMA 4H4KC 2GDCA 5TJ5E 1T6IA 1H9TA 3JCUQ 2R7RA 3AJMA 3NDBB 1MMDA 3LLIA 5EHHA 4RBNA 2XM4A 5JSLA 2NUTA 2ETSA 2P0NA 1MNDA 3M4BA 3S0XA 2J9BA 3GEIA 1Z5ZA 1GGQA 3B0VC 4U5FE 4PACA 4C7OB 1FFTC 4A4AA 3EQLF 5AC4A 1GM5A 3BEHA 5L3QA 1MQVA 3QZCA 4JJFA 2ICWG 4G0HA 1WGWA 4E7ZA 3WG7C 2W4MA 4EUKB 2XM0A 2ZXRA 1SR2A 3EHNA 3UNGC 4Q5SF 3DAFA 3T6BA 3ATPA 2Y3BA 4BJ5A 3M4CA 3B29A 1O3UA 1YA7O 2OCCC 1D1BA 2PP4A 2VCCA 3DJNB 3HNKA 2H8AA 4N4WA 2G3KA 4XTKA 5E3CA 3B0UX 1JMWA 3R2PA 3I5PA 3N0TA 2Y3GA 4U5CE 3MBGA 2R7VA 4ER9A 2XLWA 1AUEA 5D91A 4C3EA 5L0FA 4FAPB 2W4BA 4KC9A 4EWCA 4DOZA 2GAQA 3NYJA 3UGPA 4E0HA 1LPEA 4BJTA 4U5DE 3ZSUA 4J7TA 3LS0A 2IXPA 2KNHA 5T3TA 3R7CA
chains in the Genus database with same CATH topology
3RF3A 4ONSA 4K1OA 4EHPA 1TR2A 2HSQA 2B0HA 1U89A 2IBFA 5L0HA 1T01A 3H2VA 1RKCA 4E18A 5L0CA 1L7CA 5L0JA 1QKRA 2GDCA 2L7AA 1ZW2A 5L0IA 3TJ5A 4IGGA 1DOWA 4W8PA 2GWWA 1H6GA 3ZDLA 5L0DA 3H2UA 3MYIA 1RKEB 1RKEA 5L0GA 1U6HA 1ZW3A 1XWJA 4P9TA 2X0CA 1ST6A 1ZVZA 5L0FA 1DOVA 3S90A 3VF0A 3T6GB 4DJ9A 1YDIA 3TJ6A 4E17A 2LQGA 1SYQA 4PR9A 5FZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RF3 A;  4ONS A;  4K1O A;  4EHP A;  1TR2 A;  2HSQ A;  2B0H A;  1U89 A;  2IBF A;  5L0H A;  1T01 A;  3H2V A;  1RKC A;  4E18 A;  5L0C A;  1L7C A;  5L0J A;  1QKR A;  2GDC A;  2L7A A;  1ZW2 A;  5L0I A;  3TJ5 A;  4IGG A;  1DOW A;  4W8P A;  2GWW A;  1H6G A;  3ZDL A;  5L0D A;  3H2U A;  3MYI A;  1RKE B;  1RKE A;  5L0G A;  1U6H A;  1ZW3 A;  1XWJ A;  4P9T A;  2X0C A;  1ST6 A;  1ZVZ A;  5L0F A;  1DOV A;  3S90 A;  3VF0 A;  3T6G B;  4DJ9 A;  1YDI A;  3TJ6 A;  4E17 A;  2LQG A;  1SYQ A;  4PR9 A;  5FZT A; 
#chains in the Genus database with same CATH topology
 1HW1 A;  2Q4F A;  3AG2 C;  4FES A;  1QZX A;  1OQC A;  2JX0 A;  3HNI A;  4JEB A;  4Q7C A;  2OJE D;  5GPG B;  1VLT A;  3S9O A;  3W2V A;  5KYY B;  3ABL C;  2XL8 A;  4BEJ A;  1Q0G A;  3PMR A;  3GOD A;  2BL2 A;  4J32 B;  3POV A;  3FMS A;  1TQG A;  3K1H A;  5L0C A;  1NBB A;  1VYI A;  3FXH A;  1SMY F;  2YWA A;  4YL0 A;  1I4Y A;  2HS5 A;  1ZW2 A;  2Q00 A;  1LKX A;  3EFO A;  3SP1 A;  2R7O A;  3U8P A;  3LNM B;  3S28 A;  5A69 A;  5L0D A;  4PFO A;  4LLE A;  4PJJ A;  4CS8 C;  2DB4 A;  3TOL A;  2R02 A;  3NYL A;  3JYH A;  3UGO A;  2E87 A;  4NTB A;  1OKK A;  3NYM A;  5AGF A;  1XWJ A;  2OEX A;  3V5Y A;  3C63 A;  3VAY A;  4BJ6 A;  3SXK A;  1YDI A;  2H7V C;  4U5G A;  3US6 A;  1VOM A;  1WN0 A;  5DLJ A;  1H7I A;  5KYX A;  1Z63 A;  2KK1 A;  4U5E E;  3IPM O;  5DS5 A;  2J46 A;  3JZ0 A;  2A0U A;  1YVI A;  3C8G B;  2W45 A;  3IQT A;  3LAY A;  2Y3H A;  3TQO A;  4JCH A;  4N6H A;  2ZXP A;  1HE9 A;  2L9J A;  3MX3 A;  2LCH A;  3U2M A;  4JJG A;  2R7X A;  1E85 A;  2HKV A;  3EGX B;  2HSQ A;  2LIG A;  1VTM P;  4JTC B;  4HEA J;  4MTF A;  1MNE A;  1T01 A;  4J30 B;  5KYU B;  3WHN A;  3FOP A;  4R32 A;  4JEA A;  2ASR A;  5D92 A;  3AGT A;  4Z9J A;  3ZG1 A;  5K0I A;  3LLK A;  2Y3D A;  4LAC B;  3VRC A;  3NMJ A;  3SXM A;  3QW0 A;  1A7V A;  1HY5 A;  2YVK A;  3ASN C;  3IEE A;  2EPL X;  4I3M A;  4PJN A;  3ZQV A;  4ZLD A;  4YT4 A;  2VC9 A;  4MVO A;  4G78 A;  2LFD A;  4UDV A;  1KTM A;  2R9R B;  1YAU O;  1ORY A;  2L6H A;  5B1B C;  4OIN F;  2H7O A;  3DAG A;  3EFO B;  1OCZ C;  3GEH A;  3MYF A;  5CI8 A;  2Q9C A;  5JRA A;  2V26 A;  2ZXO A;  1S05 A;  2YQY A;  2XS1 A;  4OD5 A;  1OW6 A;  3DI5 A;  3T6J A;  1LM3 B;  5A6B D;  1ZHY A;  1IZM A;  3VM6 A;  2PF4 E;  5CIV A;  3S84 A;  4XLN F;  1HMO A;  4EBJ A;  3TK0 A;  4N6C A;  4EBK A;  2PFD A;  2A0B A;  2YLI A;  3KYI A;  1EI7 A;  5BQH A;  4DRJ B;  4KNV A;  1LS1 A;  2NUT B;  1QVX A;  3K1I A;  2R03 A;  5A6J A;  1M56 C;  1F1M A;  1N1C A;  4C7O A;  2XLO A;  2WZF A;  3UMH A;  1YZC A;  1HE1 A;  3JRM O;  4MVM A;  3UR3 C;  1DOV A;  1ZU5 A;  2KW3 C;  4NTA A;  3JRT A;  4YT2 A;  2J9V A;  3LEO A;  1KU2 A;  2XL4 A;  3PDM P;  2CDQ A;  4Q4Z F;  1JOG A;  4MVU A;  2MWQ A;  1ZHW A;  3E70 C;  1XZQ A;  2A69 F;  4XEK A;  1VB5 A;  2NUP A;  2G62 A;  3DJU B;  1BZ4 A;  1WTY A;  4X0R A;  3B0P A;  3L0I A;  4BG0 A;  4JCZ A;  3SXZ A;  2QNL A;  2PX0 A;  2YL1 A;  3W4Y A;  3KPH A;  1AVO B;  2QTV A;  3DMD A;  2B0J A;  2HJM A;  1A7E A;  3AGU A;  4JKV A;  5T1D B;  5L0J A;  3AG4 C;  2PX3 A;  1Q0D A;  4P9F A;  1YYX A;  4CS9 C;  1RJ9 A;  3RQE A;  2PNO A;  4RD9 A;  4MS2 A;  2FFH A;  2WVO A;  1G8X A;  3K6B A;  5HSW A;  1M6T A;  5KYU A;  1RXQ A;  1QQ3 A;  1Q0K A;  2LD6 A;  3QVY A;  1M2V B;  3N24 A;  1TWC A;  3JYY A;  2HUJ A;  4HFF B;  1BR4 A;  3DKA A;  1NZE A;  1WAS A;  1T6Q A;  4G7Z F;  2D4U A;  3A11 A;  1K05 A;  3CEX A;  3OEO A;  3MFN A;  1TKN A;  2Z15 A;  3CAX A;  3T4R A;  4KNW A;  4DRH B;  4Z9H A;  5EK0 A;  2KJG A;  2RSE B;  2UUI A;  2Y69 C;  1H9G A;  2YZS A;  4KI2 A;  3RFY A;  2MYS A;  3TJ5 A;  4CIH A;  1IW7 F;  2HMQ A;  2XXA A;  3EPV A;  3LNR A;  1L3P A;  1O87 A;  4PK4 A;  3RVY A;  3U9M A;  3UMK A;  4BEM J;  4D4X A;  1MMA A;  2YEV A;  5F5F A;  1BBH A;  1RKE B;  2KYH A;  3EG9 B;  3DM9 B;  1VK5 A;  3EZH A;  1ZHZ A;  1U6H A;  1ZW3 A;  3GWN A;  3DD7 A;  2NG1 A;  4P9T A;  4PJM A;  3EH2 A;  4EBB A;  3Q7L A;  1U0B B;  2O9X A;  4YL3 A;  5HV9 A;  3TJ6 A;  1LVK A;  4BPM A;  4MQ9 F;  3AOU A;  3M79 A;  3U5S A;  1JRA A;  1QSP A;  1OW7 A;  4OD4 A;  5B1A C;  1PCX A;  3G4X A;  1LI7 A;  2EIM C;  3RF3 A;  4CJG A;  2QE9 A;  1G4U S;  1MMN A;  2AWY A;  3DXJ F;  3KL4 A;  4ULW A;  4NC3 A;  2IBF A;  3RH3 A;  5AC5 A;  3HNL A;  1S7Z A;  1SF8 A;  2XLH A;  4E18 A;  3GAN A;  4EIY A;  4YT8 A;  1V74 B;  2NPU A;  1NFN A;  2RD9 A;  2OG2 A;  3SXY A;  1DOW A;  4I1M A;  4HFK B;  4MW3 A;  2WL8 A;  1I4Z A;  2EIJ C;  4DBQ A;  2A1D D;  4DVY P;  1RMV A;  1OW8 A;  2LP4 A;  3GOR A;  3KMI A;  3NKD A;  5IY5 C;  3AG3 C;  1RCP A;  4I44 A;  1V55 C;  2OQM A;  2J9W A;  2XLD A;  2YLD A;  4NTF A;  2Q3T A;  2LQG A;  3U2L A;  1FMW A;  2Y39 A;  5FZT A;  2ZXW C;  3FHD A;  4JW1 A;  5DS6 A;  1GQA A;  4K0D A;  3EGD B;  3ABM C;  5JLI A;  3V5Z A;  2IOQ A;  2X51 A;  1CGM E;  3ITF A;  2Q9A A;  1WOL A;  1VYK A;  1HMD A;  4XPW A;  5COG A;  1QKR A;  4H54 A;  4NQF A;  3J06 A;  5A6K A;  1M57 C;  2J45 A;  2J7P A;  3C8G D;  3RKO F;  5DS4 A;  2GWW A;  5FCL A;  2QUP A;  1TWH A;  2DYR C;  3V7O A;  4XPY A;  2A68 F;  3JSE O;  1TWG A;  4K7B A;  3MYI A;  3U0C A;  3DE8 A;  2HSB A;  1ZHX A;  2BE5 F;  2DGJ A;  3I4U A;  5BQG A;  4MVQ A;  3S90 A;  4GQH A;  5JUA A;  1D0X A;  2WZG A;  1G4W R;  2HMZ A;  3B9Q A;  1PD0 A;  5EGY A;  1D1C A;  2AP3 A;  1SYQ A;  3DM5 A;  3JT1 A;  3S29 A;  2IXM A;  2HV6 A;  3M1C B;  1FAP B;  1UG7 A;  2VH3 A;  3NMI A;  1R5I D;  4JTA B;  1B68 A;  4U5H A;  3O39 A;  4CIP A;  3A9C A;  2DI3 A;  3JTL O;  4A2N B;  4CS9 A;  3RW0 A;  1BR2 A;  2YL7 A;  3GEE A;  3TOM A;  4AE4 A;  4JTD B;  1Y4C A;  4CDY A;  5KYX B;  3K7D A;  1QLE C;  5L3V A;  4IAQ A;  4P6I C;  2EIL C;  2PBE A;  5KYW B;  1D0Y A;  2CGE A;  3O6X A;  3K33 A;  2FAP B;  4MTG A;  4CX9 A;  4BJ5 C;  2WB7 A;  4I1O B;  1D1A A;  3Q6N A;  1J8M F;  4OIR F;  2JD3 A;  2UUH A;  2EPM X;  2OEV A;  2ZPA A;  3ZQY A;  1M2V A;  3DZA A;  2MHR A;  1FR0 A;  3LUT B;  2CNW A;  4U5B E;  2CCY A;  3QVZ A;  1D0Z A;  2L6G A;  5L0G A;  2HV7 A;  4N06 A;  5KYY A;  2FGY A;  2IM8 A;  4J7Y A;  5F28 E;  2C04 A;  2HJ3 A;  3OWT A;  1TR2 A;  3ECS A;  3X2Q C;  2EPO A;  1HW2 A;  3AQC A;  3U8V A;  4MVZ A;  2J0W A;  2I8B A;  1RKC A;  1T5O A;  4AL1 A;  1OCR C;  4MVR A;  4CDV A;  4AK9 A;  4LDR A;  1NFO A;  2HZ8 A;  2XS8 A;  1E2X A;  4IGG A;  4AX2 A;  3FOO A;  2M64 A;  1OCC C;  4PFP A;  3RQG A;  5B3S C;  2XLV A;  2XXA B;  3GWL A;  2G3V A;  2P7V A;  2NUP B;  4NY3 A;  1RKE A;  3EG9 A;  3Q7G A;  1WAT A;  4U9E A;  5KYN A;  1E84 A;  1LE2 A;  3BRJ A;  1ZHT A;  1TFK B;  2BC5 A;  5F5H A;  1FTS A;  4MND A;  4OIP F;  2R7W A;  2LFF A;  3TD7 A;  3ZTM A;  3CZ6 A;  3O55 A;  1RJ9 B;  4JE9 A;  3DWW A;  3FAJ A;  4FWV A;  5E33 A;  1FNT c;  1TWA A;  2AU5 A;  1W2W A;  4IAO A;  3Q6M A;  4CJO A;  4EHP A;  4WJ0 A;  2YL3 A;  4ZLC A;  1BR1 A;  5L0H A;  1OKK D;  3OA1 A;  5DVW A;  1GS9 A;  3HNJ A;  4B6I A;  4CS7 A;  1O5H A;  3ASO C;  1L7C A;  1CPR A;  4YN0 B;  1G5Z A;  1NG1 A;  2L81 A;  3H65 A;  4XEF A;  3O10 A;  2KQ9 A;  4EKW A;  3NMK A;  4FX5 A;  2XLM A;  1H6G A;  2WVN A;  2OU6 A;  5JP7 A;  5BQI A;  3RYL A;  1XZP A;  3ZTZ A;  2P6V A;  1LE4 A;  2R7Q A;  4PR9 A;  1JR8 A;  1Q0F A;  1JPN A;  1ST6 A;  3IQ6 A;  1E83 A;  4OIQ F;  3QW1 A;  4C3B A;  4IB4 A;  1C03 A;  4YL1 A;  4AE4 B;  3FAP B;  1LS4 A;  1YYJ A;  1A41 A;  1BDJ B;  2EIN C;  2IYL D;  3LS1 A;  4JUR I;  3SNH A;  2D5R B;  4JC7 A;  2CNW D;  4KBL A;  4YT5 A;  4E7S A;  3N2Z B;  1VLS A;  1CPQ A;  4WGZ A;  1A0B A;  3F46 A;  3VYW A;  4ANJ A;  1JPJ A;  4IWB A;  1EKY A;  4ONS A;  3ZVR A;  4K1O A;  4MVS A;  4XLP F;  3S27 A;  1JAF A;  3EJN A;  2EPN A;  4D4N A;  1YJG A;  4QI2 A;  3M15 A;  4O79 A;  4WAB A;  4OIO F;  1PV3 A;  2KGO A;  2CYD A;  2VCB A;  5JVE A;  2YRF A;  3PCV A;  2VAS A;  4U9D A;  3NG1 A;  3K1I C;  1V4A A;  3U9J A;  3ZDL A;  4O6Y A;  4DXW A;  1CGN A;  1SZI A;  3W8I A;  1Q0M A;  1ZYR F;  3H2U A;  4GYT A;  2R05 A;  2AVK A;  4W8K A;  3T9O A;  5JS5 A;  1Z7Q c;  1ZVZ A;  1C17 M;  1MMG A;  3X1O A;  3FDQ A;  3EHM A;  2J9U A;  2R7U A;  2CW0 F;  3TUL A;  1A7D A;  2J0X A;  3EH1 A;  2P1A A;  5E2Q A;  1Z3I X;  1NSG B;  4IJJ A;  4IRU A;  4DVZ A;  4JRZ A;  5DQZ A;  1R4T A;  3G4Z A;  4MTO A;  1V54 C;  3HTK C;  3QTH A;  1YZA A;  3WAQ A;  4CDA A;  4QI0 A;  1EA8 A;  1LIH A;  4YJW A;  2OJQ A;  5A6B A;  2L7A A;  3QMK A;  3G50 A;  4XEV A;  3C8G A;  3KH2 A;  3CQZ A;  2WZL A;  4O6M A;  2DYS C;  2XRH A;  5KYW A;  3IQC A;  2GA0 A;  2NSG A;  3ZIB A;  2YLG A;  2A6H F;  2NSF A;  1LI5 A;  3L34 A;  3EGD A;  4Z9I A;  3SEO A;  4L6R A;  3NKE A;  3AG1 C;  2XL6 A;  3L8J A;  1E86 A;  3B71 A;  1UFB A;  1FMV A;  2AWC A;  2KSF A;  3HJC A;  3L8I A;  1Y6D A;  2YKZ A;  5CI9 A;  3FVY A;  1T6U A;  4DRI B;  2F22 A;  3F47 A;  5BUO A;  2XSE A;  2H7B A;  1ORS C;  3IHU A;  1FFH A;  3GM1 A;  3MLG A;  3RQF A;  4AL0 A;  3SYN A;  1I5N A;  2JPU A;  4CSA A;  4CSA C;  3AQB A;  2R7T A;  4YK5 A;  4E0I A;  3U3B A;  4XPX A;  2Q7R A;  4F4B A;  3LEV A;  4JVS A;  2VCA A;  3HLZ A;  1U89 A;  4G7H F;  3H2V A;  3LJB A;  1OXK A;  4BJ6 C;  4QDL A;  3ABK C;  4WGY A;  1PD1 A;  2TMV P;  2VB6 A;  1ZU4 A;  1NU9 C;  5A6A A;  4HE8 D;  2I15 A;  2IXN A;  4JIO A;  4C3D A;  3EZI A;  3JSZ A;  5COF A;  4CS8 A;  2ZD9 A;  1KNY A;  2L6F A;  2YL0 A;  2V3C C;  2OKU A;  2WVQ A;  2R25 A;  2YHS A;  4PJL A;  3KKB A;  2IXO A;  2X0C A;  1ZZP A;  2J8W A;  1C02 A;  3LES A;  4YWQ A;  3VF0 A;  2QY9 A;  2R7S A;  1NLX A;  1Z23 A;  3I5Q A;  3NRH A;  1J8Y F;  3RVZ A;  4DBR A;  2A6E F;  4LDQ A;  3C8Z A;  3W8H A;  4BJ1 A;  1CGO A;  4O6N A;  3SZR A;  3GM3 A;  3UMI A;  2J7P D;  3RIP A;  4LLC A;  3V5X A;  4CBE A;  1APC A;  4NCQ A;  4G7O F;  1M2O A;  1YAR O;  3EGX A;  2B0H A;  1QPU A;  1ORJ A;  2OOC A;  4XQ1 A;  1YLM A;  4IAR A;  4LER A;  3IQ5 A;  5JT4 A;  5L0I A;  2GFH A;  3C62 A;  2KC3 A;  2QLA A;  1K40 A;  2Q9B A;  2EIK C;  4XWJ A;  2LK4 A;  4W8P A;  3HKK A;  1K04 A;  3KYJ A;  2C03 A;  3WOD F;  2XLE A;  4JZA A;  1NU7 D;  2EPK X;  2HFI A;  1YA9 A;  4ULV A;  1TFO B;  1OR2 A;  3T6G B;  4DJ9 A;  3E9V A;  3K66 A;  4RDA A;  4M63 A;  1VMA A;  4E17 A;  4GEH A;  3C7J A;  1T9K A;  2M4E A;  2LSE A;  1Z6A A;  5E3A A;  3GM2 A;  3ZC4 A;  3U3F A;  3C18 A;  5T3W A;  3PHF 2;  1OXB A;  5DQT A;  1OR3 A;  256B A;  2P61 A;  4O7G A;  3W2W A;  4LDK A;  3DE9 A;  1WWP A;  1AEP A;  4MW8 A;  1OCO C;  3L1M A;  3CSK A;  3ZWI A;  5B3I A;  1EQ1 A;  2W9Y A;  5COM A;  4H4K C;  2GDC A;  5TJ5 E;  1T6I A;  1H9T A;  3JCU Q;  2R7R A;  3AJM A;  3NDB B;  1MMD A;  3LLI A;  5EHH A;  4RBN A;  2XM4 A;  5JSL A;  2NUT A;  2ETS A;  2P0N A;  1MND A;  3M4B A;  3S0X A;  2J9B A;  3GEI A;  1Z5Z A;  1GGQ A;  3B0V C;  4U5F E;  4PAC A;  4C7O B;  1FFT C;  4A4A A;  3EQL F;  5AC4 A;  1GM5 A;  3BEH A;  5L3Q A;  1MQV A;  3QZC A;  4JJF A;  2ICW G;  4G0H A;  1WGW A;  4E7Z A;  3WG7 C;  2W4M A;  4EUK B;  2XM0 A;  2ZXR A;  1SR2 A;  3EHN A;  3UNG C;  4Q5S F;  3DAF A;  3T6B A;  3ATP A;  2Y3B A;  4BJ5 A;  3M4C A;  3B29 A;  1O3U A;  1YA7 O;  2OCC C;  1D1B A;  2PP4 A;  2VCC A;  3DJN B;  3HNK A;  2H8A A;  4N4W A;  2G3K A;  4XTK A;  5E3C A;  3B0U X;  1JMW A;  3R2P A;  3I5P A;  3N0T A;  2Y3G A;  4U5C E;  3MBG A;  2R7V A;  4ER9 A;  2XLW A;  1AUE A;  5D91 A;  4C3E A;  5L0F A;  4FAP B;  2W4B A;  4KC9 A;  4EWC A;  4DOZ A;  2GAQ A;  3NYJ A;  3UGP A;  4E0H A;  1LPE A;  4BJT A;  4U5D E;  3ZSU A;  4J7T A;  3LS0 A;  2IXP A;  2KNH A;  5T3T A;  3R7C A; 
#chains in the Genus database with same CATH homology
 3RF3 A;  4ONS A;  4K1O A;  4EHP A;  1TR2 A;  2HSQ A;  2B0H A;  1U89 A;  2IBF A;  5L0H A;  1T01 A;  3H2V A;  1RKC A;  4E18 A;  5L0C A;  1L7C A;  5L0J A;  1QKR A;  2GDC A;  2L7A A;  1ZW2 A;  5L0I A;  3TJ5 A;  4IGG A;  1DOW A;  4W8P A;  2GWW A;  1H6G A;  3ZDL A;  5L0D A;  3H2U A;  3MYI A;  1RKE B;  1RKE A;  5L0G A;  1U6H A;  1ZW3 A;  1XWJ A;  4P9T A;  2X0C A;  1ST6 A;  1ZVZ A;  5L0F A;  1DOV A;  3S90 A;  3VF0 A;  3T6G B;  4DJ9 A;  1YDI A;  3TJ6 A;  4E17 A;  2LQG A;  1SYQ A;  4PR9 A;  5FZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...