1H6GA

Alpha-catenin m-domain
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
255
structure length
255
Chain Sequence
DLRRQLRKAVMDHVSDSFLETNVPLLVLIEAAKNGNEKEVKEYAQVFREHANKLIEVANLACSISNNEEGVKLVRMSASQLEALCPQVINAALALAAKPQSKLAQENMDLFKEQWEKQVRVLTDAVDDITSIDDFLAVSENHILEDVNKCVIALQEKDVDGLDRTAGAIRGRAARVIHVVTSEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-1 CATENIN
publication title Crystal Structure of the M-Fragment of Alpha-Catenin: Implications for Modulation of Cell Adhesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 101
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1h6gA02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1h6gA01
3T6GB 4ONSA 1DOWA 1SYQA 2HSQA 5L0DA 5L0FA 4W8PA 1RKEB 1T01A 1ZVZA 4K1OA 2GWWA 2L7AA 5L0CA 1RKCA 1ST6A 4E18A 5L0HA 1YDIA 4P9TA 1L7CA 2X0CA 1DOVA 1TR2A 3S90A 3MYIA 2IBFA 2LQGA 3TJ6A 3TJ5A 5L0GA 4E17A 4EHPA 2GDCA 3H2VA 1U6HA 1QKRA 3VF0A 4PR9A 3ZDLA 3H2UA 4DJ9A 1U89A 1ZW3A 2B0HA 5L0IA 1H6GA 3RF3A 1XWJA 4IGGA 5FZTA 1ZW2A 5L0JA 1RKEA
chains in the Genus database with same CATH superfamily
4CJOA 2YL7A 1ZHWA 2J45A 2J7PD 256BA 3ITFA 3C8GA 4PACA 1BR2A 4C3EA 5T3WA 1ZU5A 1A7DA 5L0DA 3NMJA 3U0CA 4QI2A 2V26A 3SXKA 3FVYA 1VTMP 1ST6A 2OJQA 4MS2A 4XTKA 3DJNB 1BBHA 1I5NA 2Q4FA 1BZ4A 3FXHA 2XSEA 1L3PA 4OD5A 1ZHTA 3GEHA 3QZCA 2WL8A 4RDAA 3HKKA 4U5CE 2QNLA 1AUEA 1CGNA 4JEAA 4P9FA 3WAQA 3WHNA 1NBBA 4EIYA 1NU9C 3R2PA 1OR3A 3LS0A 1YJGA 2P7VA 1OKKD 1OQCA 1ZW3A 2NSFA 3ECSA 4YT5A 1JPJA 1T5OA 2NUTA 4MVQA 2KC3A 3AQCA 4OIPF 1OW8A 2YRFA 3HNKA 1VYKA 2HV6A 3JT1A 2Q9CA 3Q7LA 4U5EE 2ZXPA 4JTAB 5AGFA 1G4US 1LI7A 4DOZA 5L3VA 5KYXB 5L0FA 2L6FA 3FHDA 3QVYA 3SXYA 3DMDA 2YZSA 1WASA 4K0DA 2J9VA 4DBQA 4Q4ZF 1H7IA 3B9QA 4JJGA 3U8VA 4AK9A 3NDBB 4CBEA 4KI2A 1MMDA 2P6VA 2DI3A 3T4RA 2GA0A 1VLSA 1YARO 4E0HA 5L0GA 2HMQA 2P1AA 3ZQYA 4D4XA 2G3VA 1OCRC 4PR9A 1NG1A 1PV3A 2D4UA 4N6HA 1XZQA 3R7CA 3EQLF 3DJUB 1JPNA 2EIKC 1G5ZA 2R7QA 5KYUA 3RQFA 2LSEA 1QLEC 2XXAA 4CJGA 2KW3C 5L0JA 3NRHA 1D1CA 2VCAA 3C8GD 4ONSA 3T6GB 2W9YA 3V5YA 1K04A 5JSLA 5F28E 4MVOA 4XLNF 4O79A 2L6HA 1R4TA 1YYXA 1YVIA 2CW0F 3SEOA 2XXAB 3HNIA 4A4AA 1NZEA 2EIJC 2M64A 2J9UA 3JRMO 2QLAA 1FFTC 3QMKA 1TFKB 5T1DB 1O87A 4YJWA 4YL3A 5B3SC 3B0UX 5A6BA 3A9CA 1CGOA 3M1CB 1BR4A 1T6IA 3AGUA 2LFDA 2AWYA 2CYDA 1TWAA 2J46A 4CS7A 3I5PA 2HKVA 5EHHA 3UMKA 3RKOF 4BJ5A 1H9TA 3G4ZA 4RBNA 3L0IA 4JKVA 1YLMA 4DJ9A 4MTOA 3EH1A 1KTMA 1T9KA 1S05A 2L81A 3V5ZA 2A0UA 4MVSA 3TK0A 3ZG1A 4CSAC 1F1MA 4O6MA 4ER9A 2X0CA 2BE5F 1EA8A 2OKUA 2R7SA 4Z9JA 3C8ZA 2A6EF 2AWCA 2L6GA 1YA7O 2R05A 2XM0A 3X2QC 2D5RB 4KC9A 4AX2A 5KYYB 2XRHA 2KGOA 4MVUA 1Z5ZA 3DI5A 4N06A 1D0ZA 3U8PA 3MLGA 3W4YA 1LKXA 2Y3GA 4WGYA 1Z7Qc 2IYLD 2VH3A 1M2VB 2DB4A 2R7XA 1GS9A 1Z6AA 3EFOB 4OINF 1B68A 4C3DA 2UUHA 4BJTA 1BDJB 2IXNA 5BUOA 4JRZA 1AEPA 2J8WA 1OW7A 3HLZA 1OR2A 5A6JA 3AG3C 3FOPA 4R32A 5KYNA 2FFHA 5BQGA 1MNDA 2PFDA 1VMAA 3UNGC 2R7VA 3HNJA 1K05A 3L8JA 4JVSA 1HW2A 1RMVA 4OIRF 3F46A 1CPRA 1MMGA 4EUKB 1Q0GA 1Q0DA 3IQTA 2XLMA 4CIPA 5F5FA 3PMRA 1YZCA 1RKEB 1ZVZA 2A69F 5IY5C 3ATPA 1H9GA 2Q3TA 1D1BA 1NSGB 3MYFA 4JJFA 4E18A 2FAPB 3FOOA 1YDIA 3LLKA 1L7CA 3CAXA 3NMKA 1ORYA 3GODA 3JTLO 4ULVA 2J9WA 2Q9AA 2W45A 2IM8A 1CGME 1Q0MA 4O6NA 1E84A 1APCA 3K33A 2WZFA 4C7OA 3W8HA 5BQHA 3K7DA 4G7ZF 2KK1A 4KBLA 2YKZA 4FX5A 1QKRA 5COGA 2R7TA 3VF0A 5CI9A 1Q0FA 3J06A 3Q6MA 2H8AA 1GGQA 4DVZA 2PP4A 3K66A 3TOLA 1EQ1A 3U5SA 4YT8A 2HJ3A 5FZTA 3S84A 2WVOA 3EHNA 2P61A 1JOGA 4GYTA 3ABMC 4YN0B 3EZIA 2MWQA 4JE9A 4XQ1A 3A11A 3AOUA 4NY3A 3B71A 5EGYA 2ICWG 2ZXRA 3UMIA 1E85A 4U9EA 2DGJA 4GQHA 3U2LA 1RJ9A 3LEVA 5E33A 3HJCA 3S90A 2YLGA 4KNWA 5E3AA 3NYLA 1K40A 4E17A 4EHPA 2YL3A 2OQMA 3K1IA 1RJ9B 2HSBA 3U9MA 4PJMA 1ZYRF 5TJ5E 3LS1A 4XWJA 5KYXA 2A6HF 2I15A 2A0BA 4XPWA 3RF3A 1LE2A 3LUTB 4IGGA 2F22A 4MVZA 4J30B 1O5HA 3LLIA 3ASNC 5F5HA 2VC9A 3OEOA 1T01A 2XLWA 3ASOC 3EGXA 3L8IA 3VAYA 4BJ5C 5EK0A 1N1CA 1G8XA 2XLOA 4LERA 1UFBA 4ZLCA 4ANJA 4Q5SF 3EZHA 3CQZA 3TD7A 3U9JA 4KNVA 3DWWA 2ZXOA 3EGXB 2QY9A 4PJLA 2P0NA 1MQVA 1NFOA 3LEOA 3O10A 2EILC 4EKWA 3ZSUA 3NYJA 3DM5A 2XS8A 1Z23A 5D91A 3H2VA 3B0VC 2J9BA 2GAQA 1NU7D 4JCHA 4JW1A 3N24A 3AG4C 4EWCA 5CIVA 5FCLA 1EKYA 1OCCC 3GM3A 3GORA 4D4NA 2H7BA 3N0TA 3QVZA 2ASRA 3UMHA 4BPMA 2EINC 1OCOC 2R25A 3GWLA 3FAPB 2EPLX 4FAPB 5COMA 1ZW2A 3Q6NA 1G4WR 1LS1A 2JD3A 3M4BA 3ZQVA 2OEXA 5D92A 3LAYA 1IZMA 4G78A 4F4BA 1R5ID 1ZU4A 4AL0A 2VCCA 5B1AC 4WJ0A 3QW0A 5DS6A 3K1HA 3OA1A 2CDQA 3JSZA 3BRJA 1ORSC 4P9TA 1E86A 2Y69C 2OOCA 4MQ9F 5GPGB 2XLHA 3DM9B 4IB4A 3GWNA 2ZD9A 1Y6DA 4MW3A 1RCPA 5E2QA 1A0BA 2HV7A 2GFHA 3JSEO 2PBEA 1UG7A 4BJ1A 5A6AA 5JLIA 2QTVA 1ZZPA 2G3KA 3H2UA 1U89A 3ABKC 4BJ6C 2CCYA 4M63A 3O55A 1IW7F 5KYYA 3U2MA 1M56C 2Y3HA 3RIPA 1LPEA 4H54A 4IJJA 1D0YA 1T6QA 3DKAA 4AE4A 2J0WA 4J7YA 2OCCC 1HY5A 2LD6A 1ZHZA 3C7JA 1M2VA 4K1OA 2XLDA 4W8PA 2GWWA 4YK5A 3O6XA 5DS5A 4EBJA 2X51A 3EFOA 5HV9A 4O7GA 2EPKX 4JZAA 5KYWB 2R02A 4AE4B 4P6IC 1PD0A 2KQ9A 4YWQA 1OW6A 2R7WA 3U3BA 2KSFA 3AQBA 4CS8C 3AG1C 3RYLA 1NLXA 2ETSA 2IBFA 2Q9BA 3TJ6A 2TMVP 2E87A 2H7OA 4E7SA 2WZLA 4YT2A 2GDCA 3RVZA 2MHRA 1TWHA 1LS4A 2KNHA 3W8IA 4QDLA 4L6RA 4XEVA 1TQGA 4CDYA 1TWCA 3SYNA 3MBGA 4MW8A 3AG2C 4LDQA 1MNEA 3AJMA 1RKEA 3JYHA 3KYJA 3RH3A 4IARA 3ZWIA 4BEJA 4CDVA 1TWGA 4FESA 5A69A 2HMZA 1HE9A 2HSQA 2YWAA 3KPHA 4YL0A 4UDVA 3TOMA 1XZPA 1O3UA 5L0CA 2NSGA 5AC5A 1E2XA 4CS9A 1SZIA 2KYHA 3FAJA 4HFFB 5JRAA 3DD7A 1DOVA 2Q00A 2UUIA 3AGTA 3LESA 4G7HF 2O9XA 3ZIBA 3LNRA 2PF4E 2R03A 3DE9A 1MMNA 3IPMO 3G4XA 1BR1A 2JX0A 4NTFA 1J8YF 5E3CA 2CNWA 1FAPB 3NYMA 1VK5A 2Y3BA 2LK4A 3NMIA 4MVRA 1FTSA 2H7VC 1H6GA 3EJNA 3KYIA 4NC3A 3U3FA 1OCZC 1QSPA 3C62A 3DZAA 4Z9IA 3POVA 4U5GA 2HS5A 2AVKA 2C03A 1JR8A 5HSWA 4YT4A 1NFNA 1A7EA 1Z63A 2R7RA 2L7AA 1VYIA 5DVWA 3V7OA 2KJGA 2EIMC 4PFPA 4RD9A 2EPOA 2W4BA 2XS1A 4I3MA 4YL1A 5DS4A 3NKDA 4CSAA 3VRCA 1W2WA 3OWTA 3DE8A 3CSKA 2VB6A 4MTFA 1M6TA 3GEEA 3FDQA 1HMDA 2C04A 4CX9A 3S0XA 3IQ6A 4PFOA 2HZ8A 2V3CC 4N4WA 1V74B 4G0HA 2PX0A 2XL4A 1LVKA 1SF8A 1T6UA 5A6KA 4BG0A 4U5HA 3EPVA 1TKNA 1YA9A 2WVNA 4I1OB 5L0IA 4IAQA 4OIQF 2B0JA 1U0BB 4W8KA 1QVXA 3VYWA 3GM1A 3Q7GA 3JCUQ 3EGDB 2BL2A 3F47A 1GQAA 3IHUA 5DQZA 1SYQA 5B1BC 1OXKA 3SP1A 2I8BA 4FWVA 4JURI 2J0XA 1WGWA 1S7ZA 2VCBA 3C8GB 4JIOA 4JTDB 1A7VA 2XLVA 1WATA 4J32B 4IRUA 1PD1A 4IAOA 3MFNA 3DAGA 2RD9A 4E0IA 1PCXA 4U9DA 1YAUO 1LIHA 1V54C 1WTYA 3FMSA 3C63A 2YQYA 3IEEA 4A2NB 3JZ0A 1QQ3A 1SMYF 3QW1A 3N2ZB 4H4KC 4GEHA 4WABA 4NQFA 2CNWD 4O6YA 2BC5A 1U6HA 2M4EA 2G62A 2Y3DA 1YYJA 2PX3A 3S27A 1D0XA 4MVMA 4BEMJ 1FNTc 3LJBA 2B0HA 4U5FE 3EH2A 3EHMA 3T9OA 2RSEB 4DRJB 1Q0KA 2DYRC 1FMVA 2LIGA 4NCQA 1V55C 3E70C 2L9JA 2NUTB 1EI7A 4NTBA 2MYSA 4JCZA 2YL0A 4OD4A 3S9OA 1RXQA 2OU6A 4AL1A 4HEAJ 1C17M 3GANA 3UR3C 4DBRA 5L3QA 3MX3A 2XM4A 4XEFA 3L34A 4LDKA 3WG7C 1M2OA 3H65A 3W2WA 2Z15A 4J7TA 3ZVRA 2LQGA 2HUJA 2YHSA 3DAFA 3M4CA 4ULWA 4DXWA 3V5XA 4I1MA 5AC4A 2LFFA 4E7ZA 1FR0A 4X0RA 1ORJA 3SNHA 3RFYA 2IXOA 4LLEA 4DRIB 3M15A 4CS9C 3VM6A 5JVEA 1A41A 1FMWA 1YZAA 2AP3A 3RQEA 1TFOB 2WVQA 5K0IA 2QUPA 2IXPA 3KH2A 1VLTA 4JTCB 5KYUB 5KYWA 2NPUA 3WODF 5DQTA 1I4YA 4XEKA 3GEIA 2YL1A 2QE9A 4K7BA 1WN0A 3S28A 4NTAA 2OJED 1WOLA 3CEXA 4EBKA 2EPNA 2YLIA 2OG2A 1QZXA 2W4MA 3TQOA 1WWPA 1ZHXA 2DYSC 3S29A 3ZTZA 1TR2A 1CPQA 1AVOB 3MYIA 1E83A 3L1MA 3TJ5A 3ZTMA 4QI0A 3I5QA 4LACB 1LE4A 2IXMA 1JRAA 2A68F 1HMOA 3ZC4A 2YVKA 1VOMA 2CGEA 3JYYA 2WB7A 3E9VA 4LLCA 4DVYP 4LDRA 4G7OF 2NUPA 2R9RB 1VB5A 1V4AA 2ZXWC 3M79A 1D1AA 2XL8A 1HE1A 4PJNA 1J8MF 1Y4CA 2J7PA 4WGZA 3PCVA 4HFKB 1I4ZA 4OIOF 3CZ6A 3T6BA 2NUPB 5T3TA 3DXJF 4MNDA 4U5BE 2HJMA 3K1IC 1ZHYA 1RKCA 1Z3IX 4DRHB 2XLEA 1FFHA 2EPMX 4MTGA 2R7UA 3X1OA 5DLJA 3TULA 2JPUA 4Q7CA 4PK4A 5JS5A 3KL4A 3SZRA 4EBBA 1MMAA 1LI5A 1QPUA 4I44A 3SXZA 3B29A 5COFA 4ZLDA 1SR2A 2HFIA 2IOQA 3RQGA 3HTKC 2LP4A 4JC7A 1C03A 3RW0A 4XPXA 4C3BA 3G50A 2FGYA 3W2VA 4B6IA 3BEHA 4PJJA 3NG1A 3HNLA 1OKKA 3IQCA 3JRTA 4U5DE 1XWJA 2LCHA 3C18A 2Q7RA 1M57C 2A1DD 3IQ5A 3RVYA 3UGOA 1DOWA 2NG1A 1OXBA 2R7OA 2XL6A 3KKBA 5JT4A 2YLDA 4HE8D 1LM3B 3EG9A 3KMIA 3K6BA 3ABLC 4IWBA 3SXMA 3UGPA 3T6JA 3I4UA 2PNOA 4BJ6A 5BQIA 5L0HA 5A6BD 1KNYA 5JP7A 4XLPF 3NKEA 3EG9B 4CIHA 3GM2A 4Z9HA 2OEVA 1KU2A 2Y39A 2WZGA 3O39A 1JAFA 5JUAA 3PHF2 3US6A 3PDMP 3B0PA 1HW1A 4JEBA 5CI8A 2YEVA 2AU5A 4N6CA 2VASA 1JMWA 1GM5A 3ZDLA 5B3IA 1C02A 4C7OB 3LNMB 3EGDA 3QTHA 4XPYA 4CS8A 2ZPAA 4CDAA
chains in the Genus database with same CATH topology
3T6GB 4ONSA 1DOWA 1SYQA 2HSQA 5L0DA 5L0FA 4W8PA 1RKEB 1T01A 1ZVZA 4K1OA 2GWWA 2L7AA 5L0CA 1RKCA 1ST6A 4E18A 5L0HA 1YDIA 4P9TA 1L7CA 2X0CA 1DOVA 1TR2A 3S90A 3MYIA 2IBFA 2LQGA 3TJ6A 3TJ5A 5L0GA 4E17A 4EHPA 2GDCA 3H2VA 1U6HA 1QKRA 3VF0A 4PR9A 3ZDLA 3H2UA 4DJ9A 1U89A 1ZW3A 2B0HA 5L0IA 1H6GA 3RF3A 1XWJA 4IGGA 5FZTA 1ZW2A 5L0JA 1RKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T6G B;  4ONS A;  1DOW A;  1SYQ A;  2HSQ A;  5L0D A;  5L0F A;  4W8P A;  1RKE B;  1T01 A;  1ZVZ A;  4K1O A;  2GWW A;  2L7A A;  5L0C A;  1RKC A;  1ST6 A;  4E18 A;  5L0H A;  1YDI A;  4P9T A;  1L7C A;  2X0C A;  1DOV A;  1TR2 A;  3S90 A;  3MYI A;  2IBF A;  2LQG A;  3TJ6 A;  3TJ5 A;  5L0G A;  4E17 A;  4EHP A;  2GDC A;  3H2V A;  1U6H A;  1QKR A;  3VF0 A;  4PR9 A;  3ZDL A;  3H2U A;  4DJ9 A;  1U89 A;  1ZW3 A;  2B0H A;  5L0I A;  1H6G A;  3RF3 A;  1XWJ A;  4IGG A;  5FZT A;  1ZW2 A;  5L0J A;  1RKE A; 
#chains in the Genus database with same CATH topology
 4CJO A;  2YL7 A;  1ZHW A;  2J45 A;  2J7P D;  256B A;  3ITF A;  3C8G A;  4PAC A;  1BR2 A;  4C3E A;  5T3W A;  1ZU5 A;  1A7D A;  5L0D A;  3NMJ A;  3U0C A;  4QI2 A;  2V26 A;  3SXK A;  3FVY A;  1VTM P;  1ST6 A;  2OJQ A;  4MS2 A;  4XTK A;  3DJN B;  1BBH A;  1I5N A;  2Q4F A;  1BZ4 A;  3FXH A;  2XSE A;  1L3P A;  4OD5 A;  1ZHT A;  3GEH A;  3QZC A;  2WL8 A;  4RDA A;  3HKK A;  4U5C E;  2QNL A;  1AUE A;  1CGN A;  4JEA A;  4P9F A;  3WAQ A;  3WHN A;  1NBB A;  4EIY A;  1NU9 C;  3R2P A;  1OR3 A;  3LS0 A;  1YJG A;  2P7V A;  1OKK D;  1OQC A;  1ZW3 A;  2NSF A;  3ECS A;  4YT5 A;  1JPJ A;  1T5O A;  2NUT A;  4MVQ A;  2KC3 A;  3AQC A;  4OIP F;  1OW8 A;  2YRF A;  3HNK A;  1VYK A;  2HV6 A;  3JT1 A;  2Q9C A;  3Q7L A;  4U5E E;  2ZXP A;  4JTA B;  5AGF A;  1G4U S;  1LI7 A;  4DOZ A;  5L3V A;  5KYX B;  5L0F A;  2L6F A;  3FHD A;  3QVY A;  3SXY A;  3DMD A;  2YZS A;  1WAS A;  4K0D A;  2J9V A;  4DBQ A;  4Q4Z F;  1H7I A;  3B9Q A;  4JJG A;  3U8V A;  4AK9 A;  3NDB B;  4CBE A;  4KI2 A;  1MMD A;  2P6V A;  2DI3 A;  3T4R A;  2GA0 A;  1VLS A;  1YAR O;  4E0H A;  5L0G A;  2HMQ A;  2P1A A;  3ZQY A;  4D4X A;  2G3V A;  1OCR C;  4PR9 A;  1NG1 A;  1PV3 A;  2D4U A;  4N6H A;  1XZQ A;  3R7C A;  3EQL F;  3DJU B;  1JPN A;  2EIK C;  1G5Z A;  2R7Q A;  5KYU A;  3RQF A;  2LSE A;  1QLE C;  2XXA A;  4CJG A;  2KW3 C;  5L0J A;  3NRH A;  1D1C A;  2VCA A;  3C8G D;  4ONS A;  3T6G B;  2W9Y A;  3V5Y A;  1K04 A;  5JSL A;  5F28 E;  4MVO A;  4XLN F;  4O79 A;  2L6H A;  1R4T A;  1YYX A;  1YVI A;  2CW0 F;  3SEO A;  2XXA B;  3HNI A;  4A4A A;  1NZE A;  2EIJ C;  2M64 A;  2J9U A;  3JRM O;  2QLA A;  1FFT C;  3QMK A;  1TFK B;  5T1D B;  1O87 A;  4YJW A;  4YL3 A;  5B3S C;  3B0U X;  5A6B A;  3A9C A;  1CGO A;  3M1C B;  1BR4 A;  1T6I A;  3AGU A;  2LFD A;  2AWY A;  2CYD A;  1TWA A;  2J46 A;  4CS7 A;  3I5P A;  2HKV A;  5EHH A;  3UMK A;  3RKO F;  4BJ5 A;  1H9T A;  3G4Z A;  4RBN A;  3L0I A;  4JKV A;  1YLM A;  4DJ9 A;  4MTO A;  3EH1 A;  1KTM A;  1T9K A;  1S05 A;  2L81 A;  3V5Z A;  2A0U A;  4MVS A;  3TK0 A;  3ZG1 A;  4CSA C;  1F1M A;  4O6M A;  4ER9 A;  2X0C A;  2BE5 F;  1EA8 A;  2OKU A;  2R7S A;  4Z9J A;  3C8Z A;  2A6E F;  2AWC A;  2L6G A;  1YA7 O;  2R05 A;  2XM0 A;  3X2Q C;  2D5R B;  4KC9 A;  4AX2 A;  5KYY B;  2XRH A;  2KGO A;  4MVU A;  1Z5Z A;  3DI5 A;  4N06 A;  1D0Z A;  3U8P A;  3MLG A;  3W4Y A;  1LKX A;  2Y3G A;  4WGY A;  1Z7Q c;  2IYL D;  2VH3 A;  1M2V B;  2DB4 A;  2R7X A;  1GS9 A;  1Z6A A;  3EFO B;  4OIN F;  1B68 A;  4C3D A;  2UUH A;  4BJT A;  1BDJ B;  2IXN A;  5BUO A;  4JRZ A;  1AEP A;  2J8W A;  1OW7 A;  3HLZ A;  1OR2 A;  5A6J A;  3AG3 C;  3FOP A;  4R32 A;  5KYN A;  2FFH A;  5BQG A;  1MND A;  2PFD A;  1VMA A;  3UNG C;  2R7V A;  3HNJ A;  1K05 A;  3L8J A;  4JVS A;  1HW2 A;  1RMV A;  4OIR F;  3F46 A;  1CPR A;  1MMG A;  4EUK B;  1Q0G A;  1Q0D A;  3IQT A;  2XLM A;  4CIP A;  5F5F A;  3PMR A;  1YZC A;  1RKE B;  1ZVZ A;  2A69 F;  5IY5 C;  3ATP A;  1H9G A;  2Q3T A;  1D1B A;  1NSG B;  3MYF A;  4JJF A;  4E18 A;  2FAP B;  3FOO A;  1YDI A;  3LLK A;  1L7C A;  3CAX A;  3NMK A;  1ORY A;  3GOD A;  3JTL O;  4ULV A;  2J9W A;  2Q9A A;  2W45 A;  2IM8 A;  1CGM E;  1Q0M A;  4O6N A;  1E84 A;  1APC A;  3K33 A;  2WZF A;  4C7O A;  3W8H A;  5BQH A;  3K7D A;  4G7Z F;  2KK1 A;  4KBL A;  2YKZ A;  4FX5 A;  1QKR A;  5COG A;  2R7T A;  3VF0 A;  5CI9 A;  1Q0F A;  3J06 A;  3Q6M A;  2H8A A;  1GGQ A;  4DVZ A;  2PP4 A;  3K66 A;  3TOL A;  1EQ1 A;  3U5S A;  4YT8 A;  2HJ3 A;  5FZT A;  3S84 A;  2WVO A;  3EHN A;  2P61 A;  1JOG A;  4GYT A;  3ABM C;  4YN0 B;  3EZI A;  2MWQ A;  4JE9 A;  4XQ1 A;  3A11 A;  3AOU A;  4NY3 A;  3B71 A;  5EGY A;  2ICW G;  2ZXR A;  3UMI A;  1E85 A;  4U9E A;  2DGJ A;  4GQH A;  3U2L A;  1RJ9 A;  3LEV A;  5E33 A;  3HJC A;  3S90 A;  2YLG A;  4KNW A;  5E3A A;  3NYL A;  1K40 A;  4E17 A;  4EHP A;  2YL3 A;  2OQM A;  3K1I A;  1RJ9 B;  2HSB A;  3U9M A;  4PJM A;  1ZYR F;  5TJ5 E;  3LS1 A;  4XWJ A;  5KYX A;  2A6H F;  2I15 A;  2A0B A;  4XPW A;  3RF3 A;  1LE2 A;  3LUT B;  4IGG A;  2F22 A;  4MVZ A;  4J30 B;  1O5H A;  3LLI A;  3ASN C;  5F5H A;  2VC9 A;  3OEO A;  1T01 A;  2XLW A;  3ASO C;  3EGX A;  3L8I A;  3VAY A;  4BJ5 C;  5EK0 A;  1N1C A;  1G8X A;  2XLO A;  4LER A;  1UFB A;  4ZLC A;  4ANJ A;  4Q5S F;  3EZH A;  3CQZ A;  3TD7 A;  3U9J A;  4KNV A;  3DWW A;  2ZXO A;  3EGX B;  2QY9 A;  4PJL A;  2P0N A;  1MQV A;  1NFO A;  3LEO A;  3O10 A;  2EIL C;  4EKW A;  3ZSU A;  3NYJ A;  3DM5 A;  2XS8 A;  1Z23 A;  5D91 A;  3H2V A;  3B0V C;  2J9B A;  2GAQ A;  1NU7 D;  4JCH A;  4JW1 A;  3N24 A;  3AG4 C;  4EWC A;  5CIV A;  5FCL A;  1EKY A;  1OCC C;  3GM3 A;  3GOR A;  4D4N A;  2H7B A;  3N0T A;  3QVZ A;  2ASR A;  3UMH A;  4BPM A;  2EIN C;  1OCO C;  2R25 A;  3GWL A;  3FAP B;  2EPL X;  4FAP B;  5COM A;  1ZW2 A;  3Q6N A;  1G4W R;  1LS1 A;  2JD3 A;  3M4B A;  3ZQV A;  2OEX A;  5D92 A;  3LAY A;  1IZM A;  4G78 A;  4F4B A;  1R5I D;  1ZU4 A;  4AL0 A;  2VCC A;  5B1A C;  4WJ0 A;  3QW0 A;  5DS6 A;  3K1H A;  3OA1 A;  2CDQ A;  3JSZ A;  3BRJ A;  1ORS C;  4P9T A;  1E86 A;  2Y69 C;  2OOC A;  4MQ9 F;  5GPG B;  2XLH A;  3DM9 B;  4IB4 A;  3GWN A;  2ZD9 A;  1Y6D A;  4MW3 A;  1RCP A;  5E2Q A;  1A0B A;  2HV7 A;  2GFH A;  3JSE O;  2PBE A;  1UG7 A;  4BJ1 A;  5A6A A;  5JLI A;  2QTV A;  1ZZP A;  2G3K A;  3H2U A;  1U89 A;  3ABK C;  4BJ6 C;  2CCY A;  4M63 A;  3O55 A;  1IW7 F;  5KYY A;  3U2M A;  1M56 C;  2Y3H A;  3RIP A;  1LPE A;  4H54 A;  4IJJ A;  1D0Y A;  1T6Q A;  3DKA A;  4AE4 A;  2J0W A;  4J7Y A;  2OCC C;  1HY5 A;  2LD6 A;  1ZHZ A;  3C7J A;  1M2V A;  4K1O A;  2XLD A;  4W8P A;  2GWW A;  4YK5 A;  3O6X A;  5DS5 A;  4EBJ A;  2X51 A;  3EFO A;  5HV9 A;  4O7G A;  2EPK X;  4JZA A;  5KYW B;  2R02 A;  4AE4 B;  4P6I C;  1PD0 A;  2KQ9 A;  4YWQ A;  1OW6 A;  2R7W A;  3U3B A;  2KSF A;  3AQB A;  4CS8 C;  3AG1 C;  3RYL A;  1NLX A;  2ETS A;  2IBF A;  2Q9B A;  3TJ6 A;  2TMV P;  2E87 A;  2H7O A;  4E7S A;  2WZL A;  4YT2 A;  2GDC A;  3RVZ A;  2MHR A;  1TWH A;  1LS4 A;  2KNH A;  3W8I A;  4QDL A;  4L6R A;  4XEV A;  1TQG A;  4CDY A;  1TWC A;  3SYN A;  3MBG A;  4MW8 A;  3AG2 C;  4LDQ A;  1MNE A;  3AJM A;  1RKE A;  3JYH A;  3KYJ A;  3RH3 A;  4IAR A;  3ZWI A;  4BEJ A;  4CDV A;  1TWG A;  4FES A;  5A69 A;  2HMZ A;  1HE9 A;  2HSQ A;  2YWA A;  3KPH A;  4YL0 A;  4UDV A;  3TOM A;  1XZP A;  1O3U A;  5L0C A;  2NSG A;  5AC5 A;  1E2X A;  4CS9 A;  1SZI A;  2KYH A;  3FAJ A;  4HFF B;  5JRA A;  3DD7 A;  1DOV A;  2Q00 A;  2UUI A;  3AGT A;  3LES A;  4G7H F;  2O9X A;  3ZIB A;  3LNR A;  2PF4 E;  2R03 A;  3DE9 A;  1MMN A;  3IPM O;  3G4X A;  1BR1 A;  2JX0 A;  4NTF A;  1J8Y F;  5E3C A;  2CNW A;  1FAP B;  3NYM A;  1VK5 A;  2Y3B A;  2LK4 A;  3NMI A;  4MVR A;  1FTS A;  2H7V C;  1H6G A;  3EJN A;  3KYI A;  4NC3 A;  3U3F A;  1OCZ C;  1QSP A;  3C62 A;  3DZA A;  4Z9I A;  3POV A;  4U5G A;  2HS5 A;  2AVK A;  2C03 A;  1JR8 A;  5HSW A;  4YT4 A;  1NFN A;  1A7E A;  1Z63 A;  2R7R A;  2L7A A;  1VYI A;  5DVW A;  3V7O A;  2KJG A;  2EIM C;  4PFP A;  4RD9 A;  2EPO A;  2W4B A;  2XS1 A;  4I3M A;  4YL1 A;  5DS4 A;  3NKD A;  4CSA A;  3VRC A;  1W2W A;  3OWT A;  3DE8 A;  3CSK A;  2VB6 A;  4MTF A;  1M6T A;  3GEE A;  3FDQ A;  1HMD A;  2C04 A;  4CX9 A;  3S0X A;  3IQ6 A;  4PFO A;  2HZ8 A;  2V3C C;  4N4W A;  1V74 B;  4G0H A;  2PX0 A;  2XL4 A;  1LVK A;  1SF8 A;  1T6U A;  5A6K A;  4BG0 A;  4U5H A;  3EPV A;  1TKN A;  1YA9 A;  2WVN A;  4I1O B;  5L0I A;  4IAQ A;  4OIQ F;  2B0J A;  1U0B B;  4W8K A;  1QVX A;  3VYW A;  3GM1 A;  3Q7G A;  3JCU Q;  3EGD B;  2BL2 A;  3F47 A;  1GQA A;  3IHU A;  5DQZ A;  1SYQ A;  5B1B C;  1OXK A;  3SP1 A;  2I8B A;  4FWV A;  4JUR I;  2J0X A;  1WGW A;  1S7Z A;  2VCB A;  3C8G B;  4JIO A;  4JTD B;  1A7V A;  2XLV A;  1WAT A;  4J32 B;  4IRU A;  1PD1 A;  4IAO A;  3MFN A;  3DAG A;  2RD9 A;  4E0I A;  1PCX A;  4U9D A;  1YAU O;  1LIH A;  1V54 C;  1WTY A;  3FMS A;  3C63 A;  2YQY A;  3IEE A;  4A2N B;  3JZ0 A;  1QQ3 A;  1SMY F;  3QW1 A;  3N2Z B;  4H4K C;  4GEH A;  4WAB A;  4NQF A;  2CNW D;  4O6Y A;  2BC5 A;  1U6H A;  2M4E A;  2G62 A;  2Y3D A;  1YYJ A;  2PX3 A;  3S27 A;  1D0X A;  4MVM A;  4BEM J;  1FNT c;  3LJB A;  2B0H A;  4U5F E;  3EH2 A;  3EHM A;  3T9O A;  2RSE B;  4DRJ B;  1Q0K A;  2DYR C;  1FMV A;  2LIG A;  4NCQ A;  1V55 C;  3E70 C;  2L9J A;  2NUT B;  1EI7 A;  4NTB A;  2MYS A;  4JCZ A;  2YL0 A;  4OD4 A;  3S9O A;  1RXQ A;  2OU6 A;  4AL1 A;  4HEA J;  1C17 M;  3GAN A;  3UR3 C;  4DBR A;  5L3Q A;  3MX3 A;  2XM4 A;  4XEF A;  3L34 A;  4LDK A;  3WG7 C;  1M2O A;  3H65 A;  3W2W A;  2Z15 A;  4J7T A;  3ZVR A;  2LQG A;  2HUJ A;  2YHS A;  3DAF A;  3M4C A;  4ULW A;  4DXW A;  3V5X A;  4I1M A;  5AC4 A;  2LFF A;  4E7Z A;  1FR0 A;  4X0R A;  1ORJ A;  3SNH A;  3RFY A;  2IXO A;  4LLE A;  4DRI B;  3M15 A;  4CS9 C;  3VM6 A;  5JVE A;  1A41 A;  1FMW A;  1YZA A;  2AP3 A;  3RQE A;  1TFO B;  2WVQ A;  5K0I A;  2QUP A;  2IXP A;  3KH2 A;  1VLT A;  4JTC B;  5KYU B;  5KYW A;  2NPU A;  3WOD F;  5DQT A;  1I4Y A;  4XEK A;  3GEI A;  2YL1 A;  2QE9 A;  4K7B A;  1WN0 A;  3S28 A;  4NTA A;  2OJE D;  1WOL A;  3CEX A;  4EBK A;  2EPN A;  2YLI A;  2OG2 A;  1QZX A;  2W4M A;  3TQO A;  1WWP A;  1ZHX A;  2DYS C;  3S29 A;  3ZTZ A;  1TR2 A;  1CPQ A;  1AVO B;  3MYI A;  1E83 A;  3L1M A;  3TJ5 A;  3ZTM A;  4QI0 A;  3I5Q A;  4LAC B;  1LE4 A;  2IXM A;  1JRA A;  2A68 F;  1HMO A;  3ZC4 A;  2YVK A;  1VOM A;  2CGE A;  3JYY A;  2WB7 A;  3E9V A;  4LLC A;  4DVY P;  4LDR A;  4G7O F;  2NUP A;  2R9R B;  1VB5 A;  1V4A A;  2ZXW C;  3M79 A;  1D1A A;  2XL8 A;  1HE1 A;  4PJN A;  1J8M F;  1Y4C A;  2J7P A;  4WGZ A;  3PCV A;  4HFK B;  1I4Z A;  4OIO F;  3CZ6 A;  3T6B A;  2NUP B;  5T3T A;  3DXJ F;  4MND A;  4U5B E;  2HJM A;  3K1I C;  1ZHY A;  1RKC A;  1Z3I X;  4DRH B;  2XLE A;  1FFH A;  2EPM X;  4MTG A;  2R7U A;  3X1O A;  5DLJ A;  3TUL A;  2JPU A;  4Q7C A;  4PK4 A;  5JS5 A;  3KL4 A;  3SZR A;  4EBB A;  1MMA A;  1LI5 A;  1QPU A;  4I44 A;  3SXZ A;  3B29 A;  5COF A;  4ZLD A;  1SR2 A;  2HFI A;  2IOQ A;  3RQG A;  3HTK C;  2LP4 A;  4JC7 A;  1C03 A;  3RW0 A;  4XPX A;  4C3B A;  3G50 A;  2FGY A;  3W2V A;  4B6I A;  3BEH A;  4PJJ A;  3NG1 A;  3HNL A;  1OKK A;  3IQC A;  3JRT A;  4U5D E;  1XWJ A;  2LCH A;  3C18 A;  2Q7R A;  1M57 C;  2A1D D;  3IQ5 A;  3RVY A;  3UGO A;  1DOW A;  2NG1 A;  1OXB A;  2R7O A;  2XL6 A;  3KKB A;  5JT4 A;  2YLD A;  4HE8 D;  1LM3 B;  3EG9 A;  3KMI A;  3K6B A;  3ABL C;  4IWB A;  3SXM A;  3UGP A;  3T6J A;  3I4U A;  2PNO A;  4BJ6 A;  5BQI A;  5L0H A;  5A6B D;  1KNY A;  5JP7 A;  4XLP F;  3NKE A;  3EG9 B;  4CIH A;  3GM2 A;  4Z9H A;  2OEV A;  1KU2 A;  2Y39 A;  2WZG A;  3O39 A;  1JAF A;  5JUA A;  3PHF 2;  3US6 A;  3PDM P;  3B0P A;  1HW1 A;  4JEB A;  5CI8 A;  2YEV A;  2AU5 A;  4N6C A;  2VAS A;  1JMW A;  1GM5 A;  3ZDL A;  5B3I A;  1C02 A;  4C7O B;  3LNM B;  3EGD A;  3QTH A;  4XPY A;  4CS8 A;  2ZPA A;  4CDA A; 
#chains in the Genus database with same CATH homology
 3T6G B;  4ONS A;  1DOW A;  1SYQ A;  2HSQ A;  5L0D A;  5L0F A;  4W8P A;  1RKE B;  1T01 A;  1ZVZ A;  4K1O A;  2GWW A;  2L7A A;  5L0C A;  1RKC A;  1ST6 A;  4E18 A;  5L0H A;  1YDI A;  4P9T A;  1L7C A;  2X0C A;  1DOV A;  1TR2 A;  3S90 A;  3MYI A;  2IBF A;  2LQG A;  3TJ6 A;  3TJ5 A;  5L0G A;  4E17 A;  4EHP A;  2GDC A;  3H2V A;  1U6H A;  1QKR A;  3VF0 A;  4PR9 A;  3ZDL A;  3H2U A;  4DJ9 A;  1U89 A;  1ZW3 A;  2B0H A;  5L0I A;  1H6G A;  3RF3 A;  1XWJ A;  4IGG A;  5FZT A;  1ZW2 A;  5L0J A;  1RKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...