3EHMA

Structure of bt1043
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
510
structure length
510
Chain Sequence
PLKYGARFMNMQQRVIPIGSPSLTTGPGNDLQNTDLISSGNYIGYFGNNNNWGFNNEANWNFTDSRMNYAYQNFYSQIFLPWNEIYEIAKDSDSPSEQAILEIANIVRNIAWLRATDVFGPIAYNSAGDGSIAPKFDSQEVVYRSMLADLSKSVELLNTISYSVMAQYDLIYNGNVQNWVKLANSLMLRIVVRVHFIDETLAKEYITKALDPKNGGVIEDISSEAKIKSSDKMPLLNSMLASVNEYNETRMGATIWGYLDGYKDPRLSAYFTEGTYGSGSWAQTGYFPVAPTNSKSKSETSYSAKFASRPKVDSNSPLYWFRASETYFLKAEAALYNLIGGDPKTFYEQGINISFQEQGVSGVATYLSGTGKPTGLTGSNYKYGTYNHDLSIGNTSPKWDDYTGNLSKQEEQLQKIITQKYLALYPNAVEAWTEYRRTGFPYLMKPMDEAAPGRIGASIEDCRVPERFRFAPTAYNSNPNMAEIPTLLGGGDIGATKLWWVRSNRPKQPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SusD homolog
publication title Structure of a SusD homologue, BT1043, involved in mucin O-glycan utilization in a prominent human gut symbiont.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
total genus 180
structure length 510
sequence length 510
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12741 SusD-like Susd and RagB outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ehmA03
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ehmA01
3KEZA 4Q69A 3JYSA 5LX8A 3JQ0A 3CK9A 3L22A 3I4GA 5FQ7A 3MCXA 3HDXA 3EHMA 5E76A 5J90A 3MYVA 4MRUA 4F7AA 4PUCA 3MX3A 3P1UA 4F53A 5T3RA 4LERA 3CK8A 3EHNA 3EJNA 5T4YA 3SNXA 3CGHA 4L7TA 3IV0A 3GZSA 3CK7A 3CKCA 5FQ4A 3JQ1A 3NQPA 3LEWA 3QNKA 5FQ8A 3OTNA 5FQ6A 3FDHA 5E75A 3SGHA 3CKBA
chains in the Genus database with same CATH superfamily
4J7TA 3TWQA 2TMVP 5JHAA 3KPHA 1LTXA 3Q7AA 4BSZB 2RD9A 2H8AA 1HG5A 1TNBA 4JHKA 3KD7A 5EKQD 4TUUA 2FULA 1N1CA 2KNHA 3SNHA 3KSQA 2J7PD 2XPYA 1NBBA 4YL0A 3DWLG 3MKQA 3LEVA 5D2MC 5G05C 1KLXA 3RKVA 4YJWA 4ACLA 4E6HA 3UMIA 2ZPAA 2EPOA 3EIQC 4OYSA 4GZ6A 3PZ2A 4EBAG 1HS6A 5J90A 3GZ2A 3AG2E 3AJMA 4CDAA 3ULEG 1OCZC 1BZ4A 4I3MA 2QE9A 4XX5A 2CHXA 1RKCA 4N4WA 2GFHA 3NMIA 4J6IA 2WQHA 2J9BA 1T9KA 3U66A 4JA9A 4UQXA 3QMKA 4LLEA 2L9JA 4B0ZA 2M63A 2EQXA 3E33A 1SW6A 1K40A 2KQ9A 3RF3A 3V31A 4ANXA 4N06A 5JJTA 3TGOA 4DJ9A 3ZDLA 3IEGA 4O6YA 3KEZA 4HFGA 4XTKA 4O7GA 3FUEA 1EA8A 4J7WA 4DBQA 1O87A 4HOUA 4DUIA 2ZIRA 3AAAC 3UT4A 2KATA 3PMRA 4HFKB 3F46A 3FAPB 1LF8A 4RSYA 3SO8A 1K3ZD 3B29A 1HU3A 2P61A 2WB2A 5L0JA 4CS9C 2F37A 3HJCA 3SHFA 2VGEA 4KXKB 4B8CB 1CPQA 5DVWA 1PC2A 3NF1A 4NTFA 4NCQA 4P9TA 2R7OA 2YRFA 1HO8A 4HFFB 1I4ZA 4G7OF 1V54E 2WXKA 1FPPA 2XL6A 3ZG1A 1RW2A 1A7EA 1WAO1 1LIHA 4BJ5A 3ML8A 2KBXA 4KYOB 4HOSA 3FUMA 2GGFA 4JB8P 2A0UA 1KT0A 1BI8B 1MMNA 1T6IA 1UJKA 1E96B 2V3CC 2L81A 4BJ6A 3CLJA 2B0OE 3CVWA 4CZ2D 3A11A 3D9NA 3ZYLA 2WXMA 1O1TA 2NXPA 1ZHYA 3ZYMA 2OG2A 4EUKB 2XM0A 3GWNA 1OCRE 1PV3A 2HFIA 2EIMC 3CHQA 2WQ6A 4TV3A 4MVQA 3PUJA 4A3VA 3DXMG 3LJNA 2WXOA 3DRAA 5CRVA 3RIPA 2JPUA 2JX0A 5T3WA 1H7IA 1UW4B 2BEDA 2CDQA 3ABKC 2W4MA 1MMGA 4DLQA 5JT4A 3FH8A 3ONLA 5CHEE 2XHEA 1FMWA 2MRIA 4AX2A 3QVYA 3IV0A 4OIRF 3PREA 2LCHA 2VSNA 4E7ZA 1H2UA 2AXUA 3LVRE 1Z3IX 1VLTA 1A17A 3SXZA 4EWCA 5FQ6A 4FA6A 4CSAA 2EIJC 2GRNB 3CKBA 2X6FA 3QWPA 2JEKA 1D8DA 2MWQA 3WG7C 2DZOA 2ETCA 4DBRA 3RRUA 4UDVA 1YDIA 1V4AA 3LEOA 4LERA 3C98A 1YYHA 1FCHA 1LE4A 3FUFA 4XEKA 3WODF 2Y0BG 2I1JA 1DCQA 3EU9A 5KCMA 3LNRA 1AVOB 1N54A 4JPSA 4BY6A 4CSAC 1SA5A 4WNGA 4IN3B 4OVUA 4W9RA 2XENA 3AG1C 5HQ8A 4CJGA 3DPYA 5KYWA 2X38A 3HKKA 3UGPA 4ILGA 3L08A 5KJLA 2EINC 5A69A 1MYOA 2YL3A 2GRRB 5EN5D 3C8ZA 1TR2A 3IQ6A 1Z5SC 2AW6A 5EYLA 5ENRD 4J30B 2CFUA 3HRAA 3S2AA 3RFYA 3LLIA 2V4HC 3UMVA 3AG4C 1OT8A 1H6KA 3JZ0A 2YWAA 3PEVB 3PUKA 4AOFA 3B0PA 3ZHEB 4ANJA 3O48A 1JCSA 4K5BA 1E8ZA 2KYHA 2PM7A 1AWCB 2KCLA 5DS5A 3TD7A 2KJGA 3SI5A 4RQIA 1Z23A 5C1DA 1KTMA 2X6HA 2LO6A 1NZEA 1GW6A 4WABA 2XLDA 4L23A 4Z68A 1JAFA 3NZUA 3DE9A 3PH0C 2VB6A 2XEVA 4Q7CA 5FJYA 4BETA 4EZLA 3MEKA 4XIFA 3S90A 4U0ZA 2V0PA 5AJDA 4PH4B 3I4GA 1TQGA 2P9PG 1RKEB 1S7ZA 2F0YA 1H6OA 3U3BA 3AGUA 4EPZA 3ONKA 2CFZA 5ARFA 3OAWA 1PY1A 4YVOA 3AGTA 1DNPA 3ASOE 5CEAA 4YK5A 2Z15A 3DSVA 3V5ZA 3N0TA 3VAYA 2R59A 2NC9A 4U95D 4JCHA 1D0ZA 5B1AE 2LAHA 3C3RA 2HV6A 3CHMA 2NSZA 1M2OA 3CQCB 2UWJG 2XRYA 5L0IA 2KXPC 2BC5A 4M63A 2PX3A 2HV7A 3DM5A 4MVMA 5F5FA 3VM6A 1WWPA 2ETSA 2XEEA 1OXBA 3RU0A 1JPLA 1W3BA 2VSYA 2HE0A 2YL0A 4U9DA 4TXPA 4F4BA 3NBNB 4MNDA 4HRNA 3UQ3A 1LKXA 3DXKG 2CNWD 5BUOA 4ANVA 5IY5E 3PS6A 4WJ0A 5T3TA 3POVA 4LDKA 4LDQA 2XGOA 2R7QA 4B89A 2R17C 3ABKE 4BT8A 2Y69C 2P2CP 5DBKA 4YDYA 4ULVA 3IQ5A 2DBAA 4GB9A 2X6KA 1D8EA 3E70C 3EQLF 2VCAA 1DCEA 3SBTB 3BRJA 1N11A 3PZ3A 5BV0A 3IPMO 3FOOA 1BPOA 2GA0A 2VQ2A 2L6GA 5ENTD 3MZLB 1C17M 1NU7D 2EIJE 3FUIA 3B71A 5DS6A 1NZNA 1U0BB 4U0UA 4O1PA 4N5CA 3SXMA 3VYWA 5FCLA 3IEEA 2XRZA 4MS6A 3LLKA 5CMWA 4N3AA 3AOUA 4ONSA 3B7UX 2VCBA 5KJNA 3L34A 1TEZA 2WXNA 1L7CA 1IKND 4OVVA 2LSVA 1QZ2A 4RVBA 3W2WA 1FNTc 3AG1E 4NURA 4LRZA 4GZDA 3FUDA 2EINE 4N2SA 1JUQA 1RCPA 4UWKA 2J7PA 3BEEA 5LOZA 3W2VA 2L6BA 3PHF2 3C72A 4GA0A 3Q78A 3JXIA 2ETBA 4U96D 2KK1A 2YINA 3BG1B 3PZ1A 1FT2A 4Q94A 3UIPC 1JPJA 5KNHD 1K04A 4NC3A 3FFLA 3H2VA 4ANUA 3B0VC 2A1DD 1APCA 2QUPA 4OD4A 1T01A 4MW3A 3JCKC 3RO3A 5JJ7A 2YHEA 3Q75A 3UT8A 4MTOA 3SYNA 2WXRA 3VF0A 5JSLA 3MYFA 1IYGA 3NYLA 2WVNA 3C8GD 4WWPA 3APCA 3NYMA 2WQ7A 3DEOA 3SXYA 5EYPF 1BR1A 5B3IA 3IHUA 1U89A 3FTVA 3CVPA 4XKCA 3CVVA 3RW0A 4IGGA 3D9IA 2P9IG 3U3WA 4IRUA 4OAVB 4NTAA 3UGOA 4PS3A 1JCQA 4RDAA 1NP7A 3CK9A 3E32A 2J9WA 1JR8A 4MS2A 1H0AA 3ZU7B 1G5ZA 3TWSA 2DWZA 4GPKA 2WMNA 1Q0FA 3KS2A 3FY4A 3MKRA 4EBAA 1N4SA 3AU5A 3KMIA 1ZB1A 1UFBA 1S05A 1RKEA 4DRHB 4DX5D 4JTAB 1ZW3A 3OXLA 3Q15A 3CVNA 2AU5A 3W9GA 5ITZF 4C7OB 3DI5A 4A1GA 4NQFA 4E0HA 3FWVA 1UJJA 1D0XA 2V5QC 4I9CA 3NKDA 2IOQA 3JTLO 2IOLA 4JEHA 3FVYA 4HI9A 3Q79A 2HJ3A 3IBEA 2HSQA 4UWHA 2ZXWE 1G8XA 3GEEA 3ZN3A 4J32B 2R7RA 3NOCD 4UQZA 3U3FA 3CEQA 2P6VA 1OWMA 1BD8A 2FF4A 4U8VD 4G0HA 1CGNA 3ZWIA 3EHNA 3L8JA 4YDWA 4EHMA 3K66A 2X0CA 4Y6CA 3M1CB 4AY5A 1BDJB 3EH1A 1NFOA 3ESKA 1Q0KA 4HQDA 2NSFA 3ZIBA 3TULA 3PZDA 3MV2B 1J8MF 3U2LA 3V79K 3N2ZB 5KJKA 3FH5A 1MX6A 3PVLA 4JXTA 2Q9AA 3R7CA 3LKUA 3ZSUA 4DLOA 3B0UX 2F22A 5EX3A 4N5QA 2CHWA 3GM3A 3CGHA 5CECB 1EI7A 1SZIA 4MVRA 4YT8A 4O1OA 4YNDA 1ZZPA 2WXGA 1YZCA 2WZFA 1S63A 4ULWA 2HYZA 2BKGA 2EILC 4C3EA 4UWGA 1VMAA 2XM4A 4U04A 4DX7D 2VASA 5LX8A 3EH2A 3HXBA 1ORYA 3MCXA 4BFRA 1U6HA 2Y4UA 3GYZA 1H2TC 1TNYA 3DZAA 3AG3C 1DOVA 4C0MA 3MLGA 1NA3A 4CGVA 4UI9K 4L7TA 4NIKA 1E83A 4FWVA 3RSEG 3Q4AB 3ABLC 4U07A 2QZAA 3ZKJA 3HYMB 1C02A 5HI7A 3CQZA 4CRWA 3LUTB 4L2LA 1MQSA 4FX5A 3C8GB 3JRTA 4RG9A 3K1IA 3G2VA 3RH3A 2FGYA 3FXHA 1KT1A 1XNFA 2HR2A 3Q5MA 4MVZA 4Z9JA 3SZRA 4XI9A 5EHHA 3PNTB 4I6GA 4JHRA 1IHGA 2I1KA 3EJNA 3GEIA 4GZ3A 4DI4A 4ABNA 5JS5A 3CAXA 2LP4A 2ZXPA 3X2QE 4APFA 4AXHA 4CBEA 1QPUA 1QSPA 3HTKC 4NQ0A 4KBQA 4X8QA 3S7JA 2X51A 4U8YD 4EZJA 5LFAA 5D66A 4YDEA 3US6A 3RAUA 1O1RA 1YJGA 5BPPA 3FTZA 2NUPA 3ZC4A 3C63A 2VSXE 3RK6A 1TN8A 3GZ1A 1S0PA 1VLSA 1OUVA 3ASNC 3RRMB 2R7UA 2ASRA 1A5EA 1ZU5A 1N0QA 3UPVA 3GORA 4MKTA 2XPZA 1Y4CA 3ZNGA 3J5QB 3VLDA 1HMDA 2J8SD 4GYWA 2KC3A 3ULQA 4U5DE 4FJZA 1YAUO 1EYHA 4YVQC 4JVSA 5EILA 5LCWJ 2E2EA 1ZU4A 2RG8A 4JRZA 2IONA 2AXVA 3HXEA 4Z9IA 1ZHZA 1GS9A 2DGJA 1LS1A 1G4WR 3GW4A 3HHMA 5EX0A 4TXRA 2EPMX 3DSUA 2R9RB 1TWAA 4I44A 2IU1A 4AVXA 3S84A 4TXQA 3GM1A 2FO7A 1QLEC 1YA9A 4WWNA 3K9IA 3D9JA 5KBAA 5K0IA 4ILIA 2IBFA 1HX8A 4QI0A 3FEYA 1Z3YA 3NZSA 4HVBA 2IXNA 3NMKA 3R9AB 5BQGA 2DYSC 3T6BA 4ZFHA 4FULA 5AIJA 1IXVA 5EIDA 1ORSC 4C7OA 2BKKB 4GYYA 3U64A 4G25A 3TG4A 2FI7A 1RJ9B 4AK9A 5AC4A 4EBBA 1CGOA 3GEHA 2LAIA 1H19A 2UUHA 2PX0A 3LCAA 1S70B 3ZGQA 3SFYA 2VTBB 3MJWA 2G3KA 3HNLA 4NY3A 2E87A 1KU2A 4U5GA 4BJ5C 4H7XA 3KEAA 5KYYA 5BXUA 4HLEA 2GROB 2QTVA 2M4EA 4JURI 1OY3D 1I5NA 2HKVA 3T6JA 4BJ6C 5L0CA 4I43A 1WN0A 3F47A 3SFXA 4F1PA 1OR3A 2ZISA 3NB2A 3PNLB 1G4US 1OXKA 2EILE 4AL1A 3LYAA 4QQIA 3MA5A 3E30A 4A3TA 1M56C 2Q4FA 2XLOA 3QOUA 2ZXRA 3DWWA 1ZU2A 3ASFA 3ML9A 3NYJA 2Y3DA 3JSZA 2XGSA 4BTBA 4MBGA 4J8SA 4N6CA 2UY1B 4ATZD 1ELWA 5ENOD 2LUHA 2P9KG 1QZXA 4PFOA 4HE8D 3L17A 5LP0A 1XGWA 3ABLE 1PD1A 2WL8A 1SVXA 2ZU6B 1KZOA 2R7SA 2BE5F 2YQ8A 2AWYA 2IXPA 4KI2A 1D9SA 3IXEA 4L1BA 2DYRC 2MOWA 2ZGDA 4AEZC 3JYHA 3UM0A 5AAOA 5JLIA 1FMVA 2LSUA 2R03A 1NI1A 3UM2A 2KW3C 3A9CA 2C0MA 3APDA 4KZCA 4GTRA 3E4BA 3V5XA 4E85A 4D4NA 2FO1E 3UX4A 3SBSA 4EBKA 4HNAD 2QNLA 3GANA 2XCBA 3ZTMA 4GCNA 4DPRA 3C8GA 3TQOA 1V74B 1QNFA 3B95A 3VTYA 4BX9A 2YNQA 3HG0D 3TWUA 5KYNA 3TG5A 3KH2A 2IJGX 1OCZE 2AWIA 2X6IA 3UKUG 3U4TA 4H54A 2EIKC 5CIVA 4EZKA 1L5JA 4HI8A 2P9UG 3ASNE 3Q7GA 3S7DA 1K1AA 3AS5A 2KCKA 2QFCA 2WXHA 1RXQA 5T1DB 4BEPA 5DIZA 3TJ6A 1IZMA 3HNIA 1Q0MA 1SR2A 3DMDA 2D5RB 3MFNA 3AU4A 3U2MA 1Z6TA 1W2WA 1G3NB 4CYMD 5EDSA 4CT0A 4IARA 1HFAA 1Y6DA 1NU9C 2AVKA 3HXCA 1H9GA 4YL1A 1M6TA 3SEOA 4JA7A 2OQMA 4N39A 5A6JA 4XEFA 4HEAJ 1WASA 4C0EA 2P9LG 3RJVA 2AWCA 3B7TA 3AJIA 1QBQA 5JA4D 3UNGC 2MYSA 3LY9A 3J5PA 2RKKA 4Q96A 5FWQA 3I4RB 3UT7A 2P9NG 4JZYA 4LUNU 5E75A 5T8IA 5L3VA 2CYDA 3MGBA 5G04J 3T8KA 1N4PA 3F6QA 1NL4A 3EU5A 4GQHA 4LNGA 2I8BA 1Z7Qc 3TK0A 4P6IC 4XLNF 5AQ7A 1OKKD 2L0TB 1UG3A 3NMJA 3ATPA 4MTGA 3C5RA 3URZA 4KT6B 4BSXA 3J06A 4AJWA 3U8VA 2A4ZA 3GZSA 2R5SA 3UXGA 4G8KA 2KGOA 3G2TA 1XZPA 3GODA 3SF4A 1EPUA 4KNVA 4HBDA 2Q7FA 3T8MA 4DX1A 2UUIA 3ASHA 3L1MA 3EUVA 2WXQA 4P9FA 2O9XA 3KAEA 2QYUA 3GWLA 4JHJA 256BA 2ONDA 3BUAA 3QTHA 2EPKX 3ABMC 4F53A 4H4KC 3QB2A 2KM4A 1RJ9A 3QW1A 4A4AA 2EIME 1TKNA 2ZXOA 3OXFA 1OCOC 3B7SA 4N6HA 3FOPA 3L0IA 1HH8A 1FFTC 3L16A 2YVKA 5KWDA 2YZSA 2J9VA 2VTBA 3LEWA 2Y39A 3QVZA 1VDYA 1VK5A 3EGXB 2HM8A 3SGHA 3ZW3A 4UI9J 1YMPA 1Z3XA 3EFOB 1ZVZA 3HDXA 4YWQA 3ITFA 3E34A 4JIOA 4KNWA 3ENEA 3S7FA 2IO3C 3L82A 4LSZE 4XZ4A 3G4XA 5FZSA 1VOMA 3RQGA 3CHRA 3WG7E 4YT4A 4GAAA 1M2VB 3QNKA 1MX4A 1TNUA 1VYIA 4PFPA 3N71A 5JMND 3TWTA 3T5VA 4U8HA 1T6QA 3DD7A 5HV9A 4F7AA 2WVIA 4K5CA 2R25A 1E84A 1GGQA 3QC1A 4ILHB 4N2QA 3AQBA 3FTSA 4K0RA 3OA1A 4AP2A 2UY1A 4KVMA 1HE9A 5FTPA 3SY2A 4R32A 1JWGA 1UOHA 4BWRA 4FLHA 5CCMA 4CDMA 2DZNA 2Y1LE 3PE3A 4DX2A 4LNUD 4F1SA 4ZHBA 5EIBE 3N24A 2R2LA 1VTMP 5L0HA 3I3NA 5B3SC 4LDRA 3B13A 3FU0A 3R7QA 1LI7A 4APOA 3LY7A 3T5XA 3AG4E 5D0QD 1HY5A 3DSTA 1AEPA 3EDTB 5F28E 4AIFA 5B1BC 2VH3A 3FUHA 4U5HA 3PDMP 3FEXA 5CI8A 2RFMA 3OWTA 1LS4A 3CSFA 3UM3A 1QKRA 2OEXA 4EHPA 2GRMA 3B9QA 1MMAA 3ULYA 2H7VC 1KNYA 3ZFWA 2CG3A 2PL2A 3QARA 5AGFA 3Q7FA 3DBSA 5BUZA 4ATGA 3DAGA 2KZTB 2PFDA 4GCOA 2QYJA 1EKYA 1U2VG 3DE8A 4G2VA 1WTYA 1SMYF 2J07A 2R05A 3ZHEA 3D9MA 3FU5A 3ESLA 4C9BB 4HXIA 5DS4A 1RZ4A 2C2LA 2J9UA 3ECSA 2WZLA 1FAPB 3L54A 4B8AA 5E2QA 5CBNA 2J0WA 3R7RA 4IWBA 3MYVA 4DOZA 2ILRA 1SF8A 4GTSA 2GWWA 5JVEA 3U8PA 4Q5SF 4IYPA 1YA7O 1N52A 3G2SA 4GMRA 2IY0C 1BI7B 3AG2C 3TWVA 1JOGA 2XLEA 1E86A 4TUMA 1X81A 3KSLA 1D1AA 4JE9A 5D91A 3CIAA 5A7DB 4CGWA 2AVPA 2I9CA 3BEHA 2NUTB 2WVQA 3EIJA 2CW0F 1LD8A 5DLJA 2B6CA 5DQZA 3FUKA 3EHMA 1EF1C 3HVEB 2LQGA 4GPMA 4OIOF 3CHPA 1FFHA 5A6BD 4OIQF 4O6NA 4Z9HA 2R7WA 5LCWC 3EPVA 3FAJA 5TJ5E 4K5AB 3T9OA 5BQIA 3U9JA 2XRHA 3WHNA 2F8XK 4RD9A 3RVZA 3JUIA 3AS4A 3ABME 1H2VC 1J8YF 2OU6A 3DAFA 4UQYA 4W8PA 1TFKB 3ZTZA 4WNFA 1OCOE 3LXUX 1MZCA 5A6AA 1Q0GA 5D0OD 4FESA 3E37A 4MRUA 1KZPA 3Q6NA 2Y69E 5KYUB 4DJAA 2L6HA 3R2PA 4FHJA 4JL0A 1DC2A 5FINA 5L0DA 5CI9A 5JUAA 4NTBA 3KYIA 4MVSA 3DM9B 4ZLDA 5FT9A 3D9OA 1O1SA 3K1HA 3V2XA 3AS8A 1NFNA 4I6EA 4MVUA 3HNKA 2D4UA 4OINF 4WGYA 5CBOA 3CSTA 3LAYA 5KJMA 3U9WA 1INZA 4JJGA 2X6JA 2VGYA 2J08A 4I1MA 2J09A 4XI0A 2A6HF 3CZ6A 4O6FA 3DSWA 3EGXA 3G50A 4GTMA 4CCAA 3T4RA 3EFOA 1LM3B 3S27A 1OW8A 2Q9CA 2XS8A 1A7VA 1A41A 3S28A 1E7VA 3ASDA 4G7HF 3W9FA 3ZYQA 4JCZA 4D4XA 4J8EA 3C3OA 3ZYKA 3UR3C 3CVYA 1NFIE 4HOTA 4U5CE 1OCRC 3ZVVA 4GTOA 3JCUQ 1YA0A 2LFFA 2DB4A 4DRIB 1FT1A 3MV3B 1K05A 1L3PA 4GZ5A 2BTDA 5AC5A 2G62A 1M2VA 1ORJA 1NSGB 2C04A 1WY6A 2HO1A 2XS1A 3B7BA 5AQ9A 2VYIA 2GRPB 3VLFA 2H6HA 2I2OA 4PR9A 1GM5A 5ENQD 2H6FA 4PK4A 5FQ7A 3WXXA 4KZ0A 3UKRG 1Q2ZA 1SZAA 3FUJA 3KYJA 3IHYA 5B1BE 3MBGA 4MVOA 1FR0A 2FBNA 2GAQA 3FTWA 4YT2A 2XLWA 1B89A 3BG0B 3HIZA 3EG9B 1I4YA 4XPWA 5FZTA 4PACA 3CK7A 2B0HA 4QI2A 5COGA 3LVQE 3S29A 3K1IC 3TXNA 2Y3AA 1LD7A 3IHVA 3RQEA 2DIWA 5BXOA 4G78A 4BESA 1Y6IA 4JJFA 2VSOE 2OCCC 2CG2A 1D0YA 4WWOA 5AN8A 4GTPA 1GQAA 4QFVA 1NA0A 4U5BE 3G4ZA 3UM1A 1PAQA 3I4UA 2F8YA 2P1AA 4LEUA 4U9EA 2KZTA 3OTNA 2J46A 4ER9A 2XLMA 1FVFA 3ZRHA 2XXAB 2XSEA 4DVYP 1AUEA 4FLBA 3QDNA 3SFZA 1CPRA 1HW2A 3O4ZA 5AENA 4P29A 4PUCA 2Q7RA 3W8HA 1N95A 2DVWA 1UN8A 4AV7A 2L6FA 4J7YA 3RVYA 3CHSA 3LJ3A 3CV0A 2IQCA 3KL4A 3CKCA 3JQ1A 1M57C 1OKKA 4G8LA 4MTFA 4C48B 3TL5A 1Q0DA 3DSSA 3QWVA 4ANWA 3FU6A 2HMZA 2WXIA 3JQ0A 2GDCA 4ACKA 3OEOA 3D9LA 4EBJA 4AM9A 4NRHB 5CMYA 1LE2A 4K7BA 4CS9A 5BV1A 2CGEA 2IM8A 2XZDG 5T3RA 4CS7A 2E0IA 3RYLA 4HRLA 1PD0A 2IO2C 5T4YA 1Y8MA 2WXPA 3LY8A 4PJMA 2NUTA 4JEBA 4WNDA 3K6BA 4XKBA 3LJBA 4YL3A 5ANLA 2CNWA 2PNOA 4O60A 4MLPA 3HVEA 2L9BA 3CEXA 3S9OA 2HS5A 2JD3A 3NOGD 3UMHA 1NLXA 2OEVA 2IEJA 3ASOC 5G04C 4RLYA 2C0LA 5E3AA 5CERB 2J49A 2Y4TA 2GW1A 1WDYA 5HS0A 4CT4A 2OV8A 2W9YA 4GYOA 4AE4B 1U3CA 5B1AC 2Q3TA 1E85A 3LDZA 4JTCB 1BU9A 2RFAA 5JRAA 4NACA 5EK0A 4CS8A 1JMWA 2QY9A 4U0SA 1BR4A 2EPNA 4WNEA 1OCCC 3O39A 1FVHA 3NRHA 3FHEA 4FADA 2J4BA 3PEUB 4KC9A 4I2ZA 2G3VA 4L6RA 5KYUA 3UINC 3TOLA 2A69F 2ZD9A 4K0DA 4G23A 4PJLA 1QQEA 1IQUA 4DRXE 1H6GA 1R4TA 1OR2A 4G26A 4CS8C 3C62A 1TYQG 3UTMA 5ENSD 2J8WA 4PJJA 1OXJA 3EGDB 4BPMA 2YEVA 2V4LA 5IY5C 2HZ8A 1O5MA 3LNMB 2OEWA 3ISMC 1JRAA 1LI5A 3NKEA 4XLPF 2W45A 3UIOC 2ZGGA 3QK0A 3AG3E 4I17A 3ASGA 4EKWA 3NDBB 4UI9C 4HB5A 1KPSB 3W4YA 4WUYA 2PM6A 4N3CA 3V2OA 3FU3A 3JYYA 2NYJA 3I5PA 3D9KA 3Q6MA 1BLXB 1IHBA 4GTVA 3FULA 3X1OA 3PRZA 3VTXA 4OAUC 2VJ8A 2OVBA 3LS1A 1O3UA 1JCRA 4WGZA 1B68A 4L9PA 4I9EA 4M7CA 1TWHA 3ZIMA 1ZHXA 2AP3A 5DQTA 3QW0A 4CDVA 1Z63A 2CHZA 4JEUA 3L13A 4XPYA 3W8IA 2NG1A 4I1OB 1E8YA 3AQCA 2YL7A 3S0XA 2XGMA 2MHKA 5J08A 5E33A 5JP7A 3BU8A 5G05J 3EZHA 5BNWA 3Q73A 2IYLD 5L0GA 1MJ0A 2L6JA 1SYQA 5FQ8A 1PCXA 2OCCE 4MQ9F 5CEDB 2YQYA 5KYXB 3L22A 1HE1A 2XLVA 3EG9A 2J0XA 4XWJA 3JRMO 2VCCA 3TXMA 4ME2A 1Z6AA 4GEHA 4BEJA 2H7BA 2DCPA 1HMOA 1TN7A 3GM2A 3PDNA 2XZTG 4XEIG 4CIPA 1V55C 4IULA 2HJMA 4IAOA 2KC7A 1TNOA 2XL4A 1ST6A 4K03A 5COFA 4FC8A 4OD5A 4J8DA 4CJOA 4LLCA 3UMKA 2DI3A 3DJNB 2A0BA 1K1BA 1P5QA 3VLEA 4U5EE 1SA4A 4BJ1A 5COMA 4BEMJ 4B94A 3TWWA 3RRNB 1SQMA 3ZXPA 4EIYA 3K33A 1LVKA 2WXLA 4YN0B 2WM9A 1S64A 5A6BA 2XXAA 4CDNA 2I6HA 4EECA 1TWCA 2LFDA 3FDQA 3L9TA 3M15A 1N0RA 1TJFA 2RSEB 4E7SA 3APFA 4C3BA 4FJYA 2A5EA 3Q9UC 4JTDB 1QYMA 3EHRA 2LXMA 3FMSA 5AJLA 2LNIA 2JABA 4GZCA 2DYSE 1D1BA 2R7XA 2IF4A 2YHCA 2QC9A 4LNBA 1SZ9A 5ARGA 4X0RA 1YYJA 1E8WA 4FU3A 5FZQA 1E2XA 1BBHA 2P9SG 1YVIA 3H65A 3CVXA 3CHOA 3T9KA 3D9HA 5C2YA 3L8IA 4WAFA 5H7PA 1YYXA 4PDXA 3NG1A 1TR4A 3FP3A 5G2NA 3FUNA 2Y3GA 4RBNA 5ANRA 4CX9A 4FP7A 3ZPJA 1AP7A 4CDYA 3SP1A 4HS2A 2FFHA 2J9QA 3JUEA 1OCCE 2Q9BA 5A6CA 1WM5A 2LK4A 3Q9NC 4BG0A 1N4RA 3ZEFA 2WB7A 3IQCA 1WGWA 2PF4E 4RG6A 4D10C 1YARO 2OVFA 4FHKA 2L0IA 4J0UA 2IFUA 2PBEA 1R5ID 4AE4A 1N9AA 2IOSA 4LACB 3M4BA 4GMLA 2ZXWC 3M4CA 3NAWA 3FTUA 5ENPD 2OJED 3DJUB 3MX3A 1JWFA 4TRQA 3B7RL 4I1AA 4URKA 2YKZA 4GYTA 2WXJA 3QAQA 4IB4A 1MHQA 2A68F 3QZCA 1TJCA 2A5UA 4CIHA 3FTYA 5D92A 1MQVA 2FEZA 3FTXA 4L2YA 3DSXA 2GRQB 1ELKA 4G1TA 4HORA 4DI3A 2YL1A 3IKOB 2ICWG 5G55A 4BJTA 3SXKA 2BUGA 3CR3A 3JYSA 3LPZA 4G24A 4HOQA 3SZ7A 2R02A 2Y3HA 1HZ4A 3CVLA 4G7ZF 3EGDA 4JKVA 2PP4A 2YLGA 5E3CA 4UWFA 2DYRE 2W4BA 5M72A 3ZVRA 4OIPF 3I5QA 1X5BA 3T6GB 4E18A 4W8KA 4BERA 1A7DA 3TWXA 4BX8A 2EPLX 1DOWA 2OKUA 1EQ1A 2XPIA 4XE0A 4J8YA 2VGXB 3KKBA 1ZBPA 4DK5A 1OWNA 1MNDA 3HXFA 5HSWA 4N3BA 4XQ1A 2R7TA 4UWLA 2GRLA 1XWJA 2V26A 1RMVA 2NPUA 3TOMA 4E17A 1BR2A 1F1MA 4LG6A 3QJZA 4YT5A 3TWRA 2HUJA 1NG1A 3CQGB 4IAQA 3LS0A 2NSGA 3TJ5A 3V7OA 4QDLA 3IQTA 3S7BA 1K8KG 5EGYA 2EIKE 3FHDA 5AQAA 2Y3BA 5JHBA 1OW7A 3V30A 4ZLCA 5FZRA 5BQHA 4YDOA 5BT1A 2P58C 4KMOA 5FIOA 1HW1A 3MKQB 5ENNA 1O5HA 2PZIA 4U7EB 4GTQA 1V55E 1YLMA 3BQOA 4JW1A 1T5OA 3G2WA 2YLDA 3SNXA 4B6IA 2LSEA 2NUPB 2H7OA 1OW6A 3PZ4A 2P7VA 3VRCA 5KYXA 4R7LA 2B0JA 2VC9A 4HRMB 1TWGA 1LPEA 3SQVA 2XQ0A 1MMDA 4J8FA 3QWWA 1OQCA 1WOLA 4Y6WA 4FAPB 4B93B 4F3VA 2WZGA 3X2QC 1A0BA 4A2NB 3QKYA 5A23A 2J4DA 3WAQA 3CVUA 1N94A 2YHSA 1WATA 1EDUA 3DKAA 4PS8A 4GA2A 4U5FE 2QY7A 3U5SA 3C3QA 2XEHA 1QVXA 1WG0A 3L6AA 4JEAA 2MYOA 3NQPA 2FAPB 4MW8A 3JT1A 4C3DA 1T6UA 3D9PA 4XPXA 4V3IA 4A1SA 2M64A 1CGME 5BW8C 3TJPA 4JC7A 1YCSB 1ZW2A 5AQBA 4G11A 5GPGB 1IQRA 4K1OA 4A55A 3P2BA 3RO2A 3O55A 4KVOA 5L0FA 2RD0A 4DX6D 3O10A 2R7VA 1JPNA 4JZAA 1E8XA 1ELRA 2V8SE 4O79A 3ZQVA 3H2UA 1N4QA 1UN9A 2X3MA 3G2UA 2WPVA 2BL2A 4E0IA 4GMJA 4BT9A 4Q69A 1HG2A 5CCLA 2P0NA 1HF8A 5E76A 1HXIA 3O6XA 1TNZA 2LIGA 3P1UA 4HLLA 2JLBA 1ZHTA 1HE8A 1DVPA 5A6KA 2XCCA 1E7UA 3UUXA 2OOEA 4M3OA 5AYWD 4DVZA 2XLHA 4XEVA 4DRJB 3V5YA 2OOCA 4A63B 2PNNA 5FQ4A 5CRUA 3TAXA 3HXDA 1V54C 1C03A 3SD5A 3K7DA 1H9TA 2ETAA 2IXMA 3M79A 1OWLA 1TN6A 2H6GA 5AARA 2WXFA 1D1CA 5KYYB 3FH7A 2MHRA 4AY6A 3Q7LA 2XL8A 5HKPA 3HNJA 4O6MA 2H6IA 3UI2A 5L3QA 1MNEA 1Z5ZA 4PS7A 4IJJA 4LCTA 3RKOF 2CCYA 2WMOA 1QQ3A 2OJQA 4PJNA 3ZUVB 3DEPA 4U63A 3EZIA 4GA1A 3CVQA 3RQFA 2HMQA 2HSBA 4I6JA 3DPDA 3ZQYA 1H6PA 2KCVA 5F5HA 4H7YA 2I15A 3OXGA 2Q00A 2AJAA 4JD2G 2LXLA 3ZXSA 3MYIA 2BF0X 3PCVA 4UUCA 3LS8A 1VYKA 2PQRA 3C7JA 2AXZA 4I2WA 2WVOA 4GU5A 1FTSA 3C18A 3R9MA 4CEMA 5JJ6A 1TFOB 4KBLA 2J45A 2KSFA 5B3SE 3DXJF 4JC8A 3Q49B 2QLAA 2LD6A 1MX2A 3PE4A 5HRYA 3RIBA 2PQNA 5KNGA 3U0CA 3E9VA 4AL0A 1IW7F 3JXJA 1U3DA 3HLZA 3U9MA 4Q4ZF 4BTAA 3CSKA 1XZQA 1E90A 3EHQA 2C03A 1YZAA 3JSEO 2V5FA 1UG7A 2VGXA 3CK8A 4CDRA 1ZYRF 5KYWB 4GTTA 2YLIA 3LESA 2L7AA 1OWPA 4F6RD 4DXWA 1VB5A 1ZHWA 3Q47B 1OWOA 3FDHA 4EQFA 2A6EF 2IXOA 3D3MA
chains in the Genus database with same CATH topology
5JHAA 1HG5A 4JHKA 3KD7A 5EKQD 4TUUA 2FULA 1N1CA 2KNHA 3SNHA 2J7PD 2XPYA 3MKQA 3LEVA 5G05C 3RKVA 1KLXA 4YJWA 4ACLA 4E6HA 3UMIA 2ZPAA 3EIQC 4OYSA 4GZ6A 4EBAG 1HS6A 5J90A 3GZ2A 1OCZC 4I3MA 4XX5A 2CHXA 4J6IA 2GFHA 2WQHA 3U66A 4JA9A 4UQXA 3QMKA 4LLEA 2L9JA 4B0ZA 2M63A 2EQXA 5JJTA 4ANXA 2KQ9A 3TGOA 4N06A 3IEGA 4O6YA 3KEZA 4HFGA 4XTKA 4O7GA 3FUEA 4DBQA 1O87A 4HOUA 3UT4A 2KATA 3PMRA 4HFKB 3F46A 1LF8A 4RSYA 1HU3A 2WB2A 4CS9C 3SHFA 3HJCA 4KXKB 4B8CB 3NF1A 5DVWA 1PC2A 2R7OA 1HO8A 4HFFB 4G7OF 2WXKA 3ZG1A 1WAO1 4BJ5A 3ML8A 4KYOB 4HOSA 3FUMA 2GGFA 1KT0A 1MMNA 1UJKA 1E96B 2V3CC 2L81A 4BJ6A 3CLJA 3CVWA 3D9NA 3ZYLA 2WXMA 2NXPA 1ZHYA 3ZYMA 2OG2A 2EIMC 3CHQA 2WQ6A 4TV3A 3PUJA 4A3VA 2WXOA 3RIPA 5T3WA 1UW4B 2CDQA 3ABKC 2W4MA 1MMGA 4DLQA 3FH8A 3ONLA 5CHEE 2XHEA 1FMWA 2MRIA 4AX2A 3IV0A 4OIRF 3PREA 2VSNA 4E7ZA 1H2UA 2AXUA 3LVRE 1Z3IX 1A17A 4EWCA 5FQ6A 4FA6A 4CSAA 2EIJC 3CKBA 2X6FA 3QWPA 2JEKA 2MWQA 3WG7C 4DBRA 3RRUA 4LERA 3C98A 1FCHA 3FUFA 3WODF 2I1JA 5KCMA 3LNRA 1N54A 4JPSA 4BY6A 4CSAC 4WNGA 4IN3B 4OVUA 4W9RA 3AG1C 5HQ8A 5KYWA 2X38A 3UGPA 4ILGA 3L08A 5KJLA 2EINC 1TR2A 2AW6A 4J30B 2CFUA 3S2AA 3RFYA 3LLIA 3UMVA 3AG4C 1H6KA 3PEVB 3PUKA 4AOFA 3B0PA 3ZHEB 4ANJA 3O48A 1E8ZA 2PM7A 2KCLA 5DS5A 3TD7A 2KJGA 3SI5A 1Z23A 5C1DA 2X6HA 2LO6A 1NZEA 1GW6A 4L23A 3NZUA 3PH0C 2VB6A 2XEVA 4Q7CA 5FJYA 4EZLA 3MEKA 4XIFA 4U0ZA 2V0PA 5AJDA 4PH4B 3I4GA 1S7ZA 4EPZA 3ONKA 2CFZA 5ARFA 3OAWA 1PY1A 4YVOA 1DNPA 2Z15A 3N0TA 3VAYA 2R59A 2NC9A 4JCHA 1D0ZA 2LAHA 2HV6A 3CHMA 2NSZA 1M2OA 3CQCB 2UWJG 2XRYA 4M63A 2PX3A 2HV7A 3DM5A 5F5FA 3RU0A 1JPLA 1W3BA 2VSYA 4F4BA 4MNDA 3UQ3A 1LKXA 2CNWD 5BUOA 4ANVA 3PS6A 4WJ0A 5T3TA 3POVA 4B89A 2XGOA 2R7QA 2R17C 4BT8A 2Y69C 5DBKA 2DBAA 4GB9A 2X6KA 3E70C 3EQLF 3SBTB 5BV0A 2VQ2A 1BPOA 3MZLB 1NU7D 3FUIA 5DS6A 1NZNA 4U0UA 4N5CA 3VYWA 5FCLA 3IEEA 2XRZA 4MS6A 3LLKA 5CMWA 4N3AA 3B7UX 5KJNA 3L34A 1TEZA 2WXNA 4OVVA 2LSVA 1QZ2A 4RVBA 3W2WA 4NURA 4LRZA 4GZDA 3FUDA 4N2SA 1JUQA 4UWKA 2J7PA 3BEEA 5LOZA 3W2VA 3PHF2 4GA0A 2YINA 3BG1B 4Q94A 1JPJA 3FFLA 4ANUA 3B0VC 2A1DD 4OD4A 3JCKC 3RO3A 5JJ7A 2YHEA 3UT8A 3SYNA 2WXRA 1IYGA 3NYLA 2WVNA 4WWPA 3APCA 3NYMA 2WQ7A 1BR1A 3FTVA 3CVVA 3CVPA 4XKCA 3D9IA 3U3WA 4IRUA 3UGOA 4PS3A 4RDAA 1NP7A 3CK9A 2J9WA 1H0AA 4GPKA 2WMNA 3KS2A 3FY4A 3MKRA 4EBAA 3AU5A 3KMIA 3OXLA 3Q15A 3CVNA 4C7OB 4A1GA 3FWVA 1UJJA 1D0XA 4I9CA 3NKDA 2IOQA 2IOLA 4JEHA 3FVYA 3IBEA 4UWHA 1G8XA 3ZN3A 4J32B 2R7RA 4UQZA 3CEQA 2P6VA 1OWMA 2FF4A 4G0HA 3EHNA 3K66A 4Y6CA 3M1CB 4AY5A 3EH1A 3ESKA 3ZIBA 3PZDA 3MV2B 1J8MF 3N2ZB 5KJKA 3FH5A 3PVLA 4JXTA 2Q9AA 3LKUA 3ZSUA 4DLOA 3B0UX 5EX3A 2CHWA 3CGHA 1SZIA 4YT8A 4YNDA 2WXGA 2WZFA 4ULWA 2HYZA 2EILC 4C3EA 4UWGA 1VMAA 4U04A 2VASA 5LX8A 3EH2A 3MCXA 4BFRA 2Y4UA 3GYZA 1H2TC 3DZAA 3AG3C 4C0MA 3MLGA 1NA3A 4CGVA 4UI9K 4L7TA 4FWVA 3Q4AB 3ABLC 4U07A 3HYMB 5HI7A 3CQZA 4CRWA 4L2LA 1MQSA 4FX5A 3JRTA 4RG9A 3G2VA 3RH3A 2FGYA 1KT1A 1XNFA 2HR2A 3Q5MA 3SZRA 4XI9A 5EHHA 3PNTB 4I6GA 4JHRA 1IHGA 2I1KA 3EJNA 4GZ3A 4DI4A 4ABNA 2ZXPA 4APFA 4AXHA 4CBEA 3HTKC 4NQ0A 4KBQA 4EZJA 3S7JA 2X51A 5LFAA 5BPPA 3FTZA 2NUPA 3ZC4A 2VSXE 3RK6A 3GZ1A 1S0PA 1OUVA 3ASNC 3RRMB 2R7UA 1ZU5A 3UPVA 4MKTA 2XPZA 3VLDA 4GYWA 3ULQA 4U5DE 4FJZA 1EYHA 4YVQC 4JVSA 5LCWJ 2E2EA 1ZU4A 2RG8A 2IONA 2AXVA 1ZHZA 2DGJA 1LS1A 3GW4A 3HHMA 5EX0A 1TWAA 4I44A 2IU1A 4AVXA 2FO7A 1QLEC 4WWNA 3K9IA 3D9JA 4ILIA 3NZSA 4QI0A 1HX8A 3FEYA 1Z3YA 4HVBA 2IXNA 3R9AB 2DYSC 3T6BA 4FULA 5AIJA 4C7OA 4GYYA 3U64A 4G25A 3TG4A 2FI7A 1RJ9B 4AK9A 4EBBA 2LAIA 1H19A 2PX0A 3LCAA 3ZGQA 2VTBB 3MJWA 2G3KA 4NY3A 2E87A 1KU2A 4U5GA 4BJ5C 4H7XA 5KYYA 4HLEA 2QTVA 2M4EA 4JURI 3T6JA 4BJ6C 4I43A 3F47A 3PNLB 3LYAA 3MA5A 4A3TA 1M56C 3QOUA 2ZXRA 1ZU2A 3ASFA 3ML9A 3NYJA 2Y3DA 3JSZA 2XGSA 4BTBA 4J8SA 2UY1B 1ELWA 1QZXA 4PFOA 4HE8D 3L17A 5LP0A 1XGWA 1PD1A 2WL8A 2ZU6B 2R7SA 2BE5F 2YQ8A 2IXPA 4KI2A 4L1BA 2DYRC 2MOWA 4AEZC 3JYHA 2LSUA 1FMVA 2KW3C 2C0MA 3APDA 4KZCA 3E4BA 4E85A 3UX4A 3SBSA 3GANA 2XCBA 4GCNA 4DPRA 3VTYA 1QNFA 4BX9A 2YNQA 5KYNA 3TG5A 3KH2A 2IJGX 2AWIA 2X6IA 3U4TA 2EIKC 4EZKA 1L5JA 3Q7GA 3S7DA 3AS5A 2KCKA 2QFCA 2WXHA 5T1DB 5DIZA 1IZMA 3AU4A 3DMDA 2D5RB 1Z6TA 1W2WA 5EDSA 4CT0A 1HFAA 1NU9C 3SEOA 4JA7A 4N39A 4HEAJ 4C0EA 3RJVA 3B7TA 3UNGC 2MYSA 3LY9A 4Q96A 5FWQA 3I4RB 3UT7A 4LUNU 4JZYA 5E75A 5T8IA 5L3VA 3MGBA 5G04J 2I8BA 4P6IC 4XLNF 1OKKD 2L0TB 1UG3A 3URZA 4KT6B 4BSXA 4AJWA 2A4ZA 3GZSA 2R5SA 2KGOA 3G2TA 3GODA 3SF4A 1EPUA 4KNVA 2Q7FA 3T8MA 3ASHA 2WXQA 2O9XA 3KAEA 4JHJA 2ONDA 3ABMC 4F53A 4H4KC 3QB2A 2KM4A 1RJ9A 1TKNA 2ZXOA 3OXFA 1OCOC 3B7SA 1HH8A 3L0IA 1FFTC 3L16A 2YZSA 2J9VA 2VTBA 3LEWA 2Y39A 1VDYA 1VK5A 3EGXB 2HM8A 3SGHA 3ZW3A 4UI9J 1Z3XA 3EFOB 3HDXA 4YWQA 3ITFA 4KNWA 3ENEA 3S7FA 4XZ4A 5FZSA 1VOMA 3CHRA 4YT4A 4GAAA 1M2VB 3QNKA 1VYIA 4PFPA 3N71A 3T5VA 4U8HA 3DD7A 4F7AA 2WVIA 3QC1A 4ILHB 4N2QA 3AQBA 3FTSA 4K0RA 3OA1A 4AP2A 2UY1A 4KVMA 5FTPA 1JWGA 4BWRA 4FLHA 5CCMA 4CDMA 3PE3A 4F1SA 3N24A 3I3NA 5B3SC 3B13A 3FU0A 3R7QA 4APOA 3LY7A 3T5XA 5D0QD 3EDTB 4AIFA 5B1BC 2VH3A 3FUHA 4U5HA 3FEXA 5CI8A 3OWTA 3CSFA 2GRMA 3B9QA 1MMAA 2H7VC 3ZFWA 2CG3A 2PL2A 3QARA 3DBSA 5BUZA 4ATGA 3DAGA 2KZTB 2PFDA 4GCOA 4G2VA 1SMYF 2J07A 3ZHEA 3D9MA 3FU5A 3ESLA 4C9BB 4HXIA 5DS4A 2C2LA 2J9UA 3ECSA 2WZLA 3L54A 4B8AA 5E2QA 2J0WA 3R7RA 4IWBA 3MYVA 4DOZA 2ILRA 1SF8A 4Q5SF 4IYPA 1N52A 3G2SA 3AG2C 1D1AA 5D91A 3CIAA 5A7DB 4CGWA 2AVPA 2I9CA 2NUTB 2WVQA 3EIJA 2CW0F 5DLJA 5DQZA 3FUKA 3EHMA 1EF1C 3HVEB 4OIOF 3CHPA 1FFHA 4OIQF 4O6NA 2R7WA 5LCWC 3EPVA 3FAJA 2XRHA 4RD9A 3JUIA 3AS4A 1H2VC 1J8YF 3DAFA 4UQYA 4WNFA 3LXUX 5D0OD 4FESA 4MRUA 3Q6NA 5KYUB 4DJAA 4JL0A 4FHJA 5CI9A 3DM9B 4ZLDA 5FT9A 3D9OA 3K1HA 3AS8A 4I6EA 4OINF 3CSTA 3LAYA 5KJMA 3U9WA 1INZA 4JJGA 2X6JA 2VGYA 2J08A 4I1MA 2J09A 4XI0A 2A6HF 3CZ6A 4O6FA 3EGXA 4CCAA 3T4RA 3EFOA 3S27A 2Q9CA 3S28A 1E7VA 3ASDA 4G7HF 3ZYQA 4J8EA 3ZYKA 3UR3C 3CVYA 4HOTA 4U5CE 1OCRC 3ZVVA 3JCUQ 1YA0A 3MV3B 4GZ5A 2BTDA 2G62A 1M2VA 2C04A 1WY6A 2HO1A 2VYIA 3VLFA 2I2OA 4PK4A 5FQ7A 3WXXA 4KZ0A 1SZAA 3FUJA 3IHYA 2FBNA 3FTWA 4YT2A 1B89A 3BG0B 3HIZA 3EG9B 3CK7A 4QI2A 3LVQE 3S29A 3K1IC 3TXNA 2Y3AA 3IHVA 2DIWA 1Y6IA 4JJFA 2VSOE 2OCCC 2CG2A 1D0YA 4WWOA 4QFVA 1NA0A 4U5BE 1PAQA 3I4UA 4LEUA 2KZTA 3OTNA 2J46A 1FVFA 3ZRHA 2XXAB 2XSEA 4DVYP 4FLBA 3QDNA 3SFZA 5AENA 3O4ZA 4P29A 4PUCA 3W8HA 1UN8A 4AV7A 3LJ3A 3CHSA 3CV0A 2IQCA 3KL4A 3CKCA 3JQ1A 1M57C 1OKKA 3TL5A 3QWVA 4ANWA 3FU6A 2WXIA 3JQ0A 4ACKA 3OEOA 3D9LA 4AM9A 4NRHB 5CMYA 4K7BA 4CS9A 5BV1A 2CGEA 5T3RA 4CS7A 2E0IA 3RYLA 1PD0A 5T4YA 1Y8MA 2WXPA 3LY8A 4PJMA 2NUTA 4WNDA 3K6BA 4XKBA 3LJBA 5ANLA 2CNWA 4MLPA 3HVEA 2L9BA 2JD3A 3UMHA 3ASOC 5G04C 2C0LA 5E3AA 2J49A 2Y4TA 2GW1A 4CT4A 2OV8A 2W9YA 4GYOA 4AE4B 1U3CA 5B1AC 2Q3TA 3LDZA 4NACA 4CS8A 2QY9A 4U0SA 4WNEA 1BR4A 1OCCC 3O39A 1FVHA 3NRHA 3FHEA 4FADA 2J4BA 3PEUB 4KC9A 4I2ZA 2G3VA 5KYUA 2A69F 4K0DA 4G23A 4PJLA 1QQEA 1IQUA 4G26A 4CS8C 4PJJA 3EGDB 2YEVA 2V4LA 5IY5C 3NKEA 4XLPF 2W45A 3QK0A 4I17A 3ASGA 3NDBB 4UI9C 4WUYA 2PM6A 4N3CA 3FU3A 3I5PA 3D9KA 3Q6MA 3FULA 3X1OA 3PRZA 3VTXA 2VJ8A 2OVBA 3LS1A 4I9EA 1TWHA 3ZIMA 1ZHXA 5DQTA 1Z63A 2CHZA 4JEUA 3L13A 3W8IA 2NG1A 4I1OB 1E8YA 3AQCA 3S0XA 2XGMA 2MHKA 5J08A 5E33A 5G05J 3EZHA 5BNWA 2IYLD 2L6JA 5FQ8A 1PCXA 4MQ9F 5KYXB 3L22A 3EG9A 2J0XA 4XWJA 3TXMA 4ME2A 1Z6AA 4GEHA 4BEJA 2H7BA 2DCPA 3PDNA 1V55C 4IULA 4IAOA 2KC7A 2XL4A 1ST6A 4K03A 4FC8A 4OD5A 4J8DA 4LLCA 3UMKA 3DJNB 1P5QA 3VLEA 4U5EE 4BJ1A 4B94A 3RRNB 1SQMA 3K33A 1LVKA 2WXLA 4YN0B 2WM9A 2XXAA 4CDNA 2I6HA 4EECA 1TWCA 3FDQA 1TJFA 4E7SA 3APFA 4C3BA 4FJYA 5AJLA 2LNIA 4GZCA 1D1BA 2R7XA 2IF4A 2YHCA 1SZ9A 5ARGA 4X0RA 1E8WA 4FU3A 5FZQA 3H65A 3CVXA 3CHOA 5C2YA 4WAFA 4PDXA 3NG1A 3FP3A 5G2NA 3FUNA 2Y3GA 4RBNA 5ANRA 4FP7A 3ZPJA 3SP1A 4HS2A 2FFHA 2J9QA 2Q9BA 5A6CA 1WM5A 4BG0A 3ZEFA 2WB7A 1WGWA 2PF4E 4RG6A 4D10C 2OVFA 4FHKA 2L0IA 4J0UA 2IFUA 4AE4A 2IOSA 4LACB 4GMLA 2ZXWC 3FTUA 3DJUB 3MX3A 1JWFA 4TRQA 3B7RL 4I1AA 4URKA 4GYTA 2WXJA 3QAQA 1MHQA 2A68F 3QZCA 3FTYA 1TJCA 2A5UA 4CIHA 5D92A 2FEZA 3FTXA 4L2YA 1ELKA 4G1TA 4HORA 4DI3A 3IKOB 5G55A 4BJTA 2BUGA 3CR3A 3JYSA 3LPZA 4G24A 4HOQA 3SZ7A 2Y3HA 3CVLA 1HZ4A 4G7ZF 3EGDA 2PP4A 4UWFA 5E3CA 5M72A 2W4BA 3ZVRA 4OIPF 3I5QA 1X5BA 4W8KA 4BX8A 2XPIA 4XE0A 2VGXB 3KKBA 1ZBPA 4DK5A 1OWNA 1MNDA 5HSWA 4N3BA 2R7TA 4UWLA 2GRLA 2V26A 1BR2A 3QJZA 4YT5A 1NG1A 3CQGB 3LS0A 3V7OA 4QDLA 3S7BA 5EGYA 3FHDA 2Y3BA 5JHBA 4ZLCA 5FZRA 5BT1A 2P58C 4KMOA 3MKQB 5ENNA 1O5HA 2PZIA 4JW1A 3G2WA 3SNXA 4B6IA 2LSEA 2NUPB 2H7OA 2P7VA 5KYXA 4R7LA 2B0JA 1TWGA 2XQ0A 1MMDA 4J8FA 3QWWA 4Y6WA 4F3VA 2WZGA 3X2QC 4A2NB 3QKYA 5A23A 2J4DA 3CVUA 2YHSA 1EDUA 4PS8A 4GA2A 4U5FE 2QY7A 3L6AA 3NQPA 3JT1A 4C3DA 3D9PA 4V3IA 4A1SA 5BW8C 3TJPA 4G11A 1IQRA 4A55A 3P2BA 3RO2A 4KVOA 2RD0A 2R7VA 1JPNA 4JZAA 1E8XA 1ELRA 2V8SE 4O79A 1UN9A 2X3MA 3G2UA 2WPVA 4GMJA 4BT9A 4Q69A 1HG2A 5CCLA 1HF8A 5E76A 1HXIA 3O6XA 3P1UA 2JLBA 1ZHTA 1HE8A 1DVPA 2XCCA 1E7UA 3UUXA 2OOEA 4M3OA 5AYWD 4DVZA 5FQ4A 3TAXA 1V54C 3SD5A 3K7DA 2IXMA 1OWLA 2WXFA 1D1CA 5KYYB 3FH7A 4AY6A 3Q7LA 4O6MA 5L3QA 1MNEA 1Z5ZA 4PS7A 4IJJA 4LCTA 3RKOF 2WMOA 4PJNA 4U63A 3EZIA 4GA1A 3CVQA 4I6JA 3DPDA 2KCVA 5F5HA 4H7YA 3OXGA 3ZXSA 2BF0X 3LS8A 1VYKA 2PQRA 2AXZA 4I2WA 2WVOA 4GU5A 1FTSA 4CEMA 5JJ6A 4KBLA 2J45A 3DXJF 4JC8A 3Q49B 3PE4A 3RIBA 2PQNA 3E9VA 1IW7F 1U3DA 3HLZA 4Q4ZF 4BTAA 3CSKA 1E90A 2C03A 2V5FA 2VGXA 3CK8A 4CDRA 1ZYRF 5KYWB 3LESA 1OWPA 1ZHWA 3Q47B 1OWOA 3FDHA 4EQFA 2A6EF 2IXOA 3D3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KEZ A;  4Q69 A;  3JYS A;  5LX8 A;  3JQ0 A;  3CK9 A;  3L22 A;  3I4G A;  5FQ7 A;  3MCX A;  3HDX A;  3EHM A;  5E76 A;  5J90 A;  3MYV A;  4MRU A;  4F7A A;  4PUC A;  3MX3 A;  3P1U A;  4F53 A;  5T3R A;  4LER A;  3CK8 A;  3EHN A;  3EJN A;  5T4Y A;  3SNX A;  3CGH A;  4L7T A;  3IV0 A;  3GZS A;  3CK7 A;  3CKC A;  5FQ4 A;  3JQ1 A;  3NQP A;  3LEW A;  3QNK A;  5FQ8 A;  3OTN A;  5FQ6 A;  3FDH A;  5E75 A;  3SGH A;  3CKB A; 
#chains in the Genus database with same CATH topology
 4J7T A;  3TWQ A;  2TMV P;  5JHA A;  3KPH A;  1LTX A;  3Q7A A;  4BSZ B;  2RD9 A;  2H8A A;  1HG5 A;  1TNB A;  4JHK A;  3KD7 A;  5EKQ D;  4TUU A;  2FUL A;  1N1C A;  2KNH A;  3SNH A;  3KSQ A;  2J7P D;  2XPY A;  1NBB A;  4YL0 A;  3DWL G;  3MKQ A;  3LEV A;  5D2M C;  5G05 C;  1KLX A;  3RKV A;  4YJW A;  4ACL A;  4E6H A;  3UMI A;  2ZPA A;  2EPO A;  3EIQ C;  4OYS A;  4GZ6 A;  3PZ2 A;  4EBA G;  1HS6 A;  5J90 A;  3GZ2 A;  3AG2 E;  3AJM A;  4CDA A;  3ULE G;  1OCZ C;  1BZ4 A;  4I3M A;  2QE9 A;  4XX5 A;  2CHX A;  1RKC A;  4N4W A;  2GFH A;  3NMI A;  4J6I A;  2WQH A;  2J9B A;  1T9K A;  3U66 A;  4JA9 A;  4UQX A;  3QMK A;  4LLE A;  2L9J A;  4B0Z A;  2M63 A;  2EQX A;  3E33 A;  1SW6 A;  1K40 A;  2KQ9 A;  3RF3 A;  3V31 A;  4ANX A;  4N06 A;  5JJT A;  3TGO A;  4DJ9 A;  3ZDL A;  3IEG A;  4O6Y A;  3KEZ A;  4HFG A;  4XTK A;  4O7G A;  3FUE A;  1EA8 A;  4J7W A;  4DBQ A;  1O87 A;  4HOU A;  4DUI A;  2ZIR A;  3AAA C;  3UT4 A;  2KAT A;  3PMR A;  4HFK B;  3F46 A;  3FAP B;  1LF8 A;  4RSY A;  3SO8 A;  1K3Z D;  3B29 A;  1HU3 A;  2P61 A;  2WB2 A;  5L0J A;  4CS9 C;  2F37 A;  3HJC A;  3SHF A;  2VGE A;  4KXK B;  4B8C B;  1CPQ A;  5DVW A;  1PC2 A;  3NF1 A;  4NTF A;  4NCQ A;  4P9T A;  2R7O A;  2YRF A;  1HO8 A;  4HFF B;  1I4Z A;  4G7O F;  1V54 E;  2WXK A;  1FPP A;  2XL6 A;  3ZG1 A;  1RW2 A;  1A7E A;  1WAO 1;  1LIH A;  4BJ5 A;  3ML8 A;  2KBX A;  4KYO B;  4HOS A;  3FUM A;  2GGF A;  4JB8 P;  2A0U A;  1KT0 A;  1BI8 B;  1MMN A;  1T6I A;  1UJK A;  1E96 B;  2V3C C;  2L81 A;  4BJ6 A;  3CLJ A;  2B0O E;  3CVW A;  4CZ2 D;  3A11 A;  3D9N A;  3ZYL A;  2WXM A;  1O1T A;  2NXP A;  1ZHY A;  3ZYM A;  2OG2 A;  4EUK B;  2XM0 A;  3GWN A;  1OCR E;  1PV3 A;  2HFI A;  2EIM C;  3CHQ A;  2WQ6 A;  4TV3 A;  4MVQ A;  3PUJ A;  4A3V A;  3DXM G;  3LJN A;  2WXO A;  3DRA A;  5CRV A;  3RIP A;  2JPU A;  2JX0 A;  5T3W A;  1H7I A;  1UW4 B;  2BED A;  2CDQ A;  3ABK C;  2W4M A;  1MMG A;  4DLQ A;  5JT4 A;  3FH8 A;  3ONL A;  5CHE E;  2XHE A;  1FMW A;  2MRI A;  4AX2 A;  3QVY A;  3IV0 A;  4OIR F;  3PRE A;  2LCH A;  2VSN A;  4E7Z A;  1H2U A;  2AXU A;  3LVR E;  1Z3I X;  1VLT A;  1A17 A;  3SXZ A;  4EWC A;  5FQ6 A;  4FA6 A;  4CSA A;  2EIJ C;  2GRN B;  3CKB A;  2X6F A;  3QWP A;  2JEK A;  1D8D A;  2MWQ A;  3WG7 C;  2DZO A;  2ETC A;  4DBR A;  3RRU A;  4UDV A;  1YDI A;  1V4A A;  3LEO A;  4LER A;  3C98 A;  1YYH A;  1FCH A;  1LE4 A;  3FUF A;  4XEK A;  3WOD F;  2Y0B G;  2I1J A;  1DCQ A;  3EU9 A;  5KCM A;  3LNR A;  1AVO B;  1N54 A;  4JPS A;  4BY6 A;  4CSA C;  1SA5 A;  4WNG A;  4IN3 B;  4OVU A;  4W9R A;  2XEN A;  3AG1 C;  5HQ8 A;  4CJG A;  3DPY A;  5KYW A;  2X38 A;  3HKK A;  3UGP A;  4ILG A;  3L08 A;  5KJL A;  2EIN C;  5A69 A;  1MYO A;  2YL3 A;  2GRR B;  5EN5 D;  3C8Z A;  1TR2 A;  3IQ6 A;  1Z5S C;  2AW6 A;  5EYL A;  5ENR D;  4J30 B;  2CFU A;  3HRA A;  3S2A A;  3RFY A;  3LLI A;  2V4H C;  3UMV A;  3AG4 C;  1OT8 A;  1H6K A;  3JZ0 A;  2YWA A;  3PEV B;  3PUK A;  4AOF A;  3B0P A;  3ZHE B;  4ANJ A;  3O48 A;  1JCS A;  4K5B A;  1E8Z A;  2KYH A;  2PM7 A;  1AWC B;  2KCL A;  5DS5 A;  3TD7 A;  2KJG A;  3SI5 A;  4RQI A;  1Z23 A;  5C1D A;  1KTM A;  2X6H A;  2LO6 A;  1NZE A;  1GW6 A;  4WAB A;  2XLD A;  4L23 A;  4Z68 A;  1JAF A;  3NZU A;  3DE9 A;  3PH0 C;  2VB6 A;  2XEV A;  4Q7C A;  5FJY A;  4BET A;  4EZL A;  3MEK A;  4XIF A;  3S90 A;  4U0Z A;  2V0P A;  5AJD A;  4PH4 B;  3I4G A;  1TQG A;  2P9P G;  1RKE B;  1S7Z A;  2F0Y A;  1H6O A;  3U3B A;  3AGU A;  4EPZ A;  3ONK A;  2CFZ A;  5ARF A;  3OAW A;  1PY1 A;  4YVO A;  3AGT A;  1DNP A;  3ASO E;  5CEA A;  4YK5 A;  2Z15 A;  3DSV A;  3V5Z A;  3N0T A;  3VAY A;  2R59 A;  2NC9 A;  4U95 D;  4JCH A;  1D0Z A;  5B1A E;  2LAH A;  3C3R A;  2HV6 A;  3CHM A;  2NSZ A;  1M2O A;  3CQC B;  2UWJ G;  2XRY A;  5L0I A;  2KXP C;  2BC5 A;  4M63 A;  2PX3 A;  2HV7 A;  3DM5 A;  4MVM A;  5F5F A;  3VM6 A;  1WWP A;  2ETS A;  2XEE A;  1OXB A;  3RU0 A;  1JPL A;  1W3B A;  2VSY A;  2HE0 A;  2YL0 A;  4U9D A;  4TXP A;  4F4B A;  3NBN B;  4MND A;  4HRN A;  3UQ3 A;  1LKX A;  3DXK G;  2CNW D;  5BUO A;  4ANV A;  5IY5 E;  3PS6 A;  4WJ0 A;  5T3T A;  3POV A;  4LDK A;  4LDQ A;  2XGO A;  2R7Q A;  4B89 A;  2R17 C;  3ABK E;  4BT8 A;  2Y69 C;  2P2C P;  5DBK A;  4YDY A;  4ULV A;  3IQ5 A;  2DBA A;  4GB9 A;  2X6K A;  1D8E A;  3E70 C;  3EQL F;  2VCA A;  1DCE A;  3SBT B;  3BRJ A;  1N11 A;  3PZ3 A;  5BV0 A;  3IPM O;  3FOO A;  1BPO A;  2GA0 A;  2VQ2 A;  2L6G A;  5ENT D;  3MZL B;  1C17 M;  1NU7 D;  2EIJ E;  3FUI A;  3B71 A;  5DS6 A;  1NZN A;  1U0B B;  4U0U A;  4O1P A;  4N5C A;  3SXM A;  3VYW A;  5FCL A;  3IEE A;  2XRZ A;  4MS6 A;  3LLK A;  5CMW A;  4N3A A;  3AOU A;  4ONS A;  3B7U X;  2VCB A;  5KJN A;  3L34 A;  1TEZ A;  2WXN A;  1L7C A;  1IKN D;  4OVV A;  2LSV A;  1QZ2 A;  4RVB A;  3W2W A;  1FNT c;  3AG1 E;  4NUR A;  4LRZ A;  4GZD A;  3FUD A;  2EIN E;  4N2S A;  1JUQ A;  1RCP A;  4UWK A;  2J7P A;  3BEE A;  5LOZ A;  3W2V A;  2L6B A;  3PHF 2;  3C72 A;  4GA0 A;  3Q78 A;  3JXI A;  2ETB A;  4U96 D;  2KK1 A;  2YIN A;  3BG1 B;  3PZ1 A;  1FT2 A;  4Q94 A;  3UIP C;  1JPJ A;  5KNH D;  1K04 A;  4NC3 A;  3FFL A;  3H2V A;  4ANU A;  3B0V C;  2A1D D;  1APC A;  2QUP A;  4OD4 A;  1T01 A;  4MW3 A;  3JCK C;  3RO3 A;  5JJ7 A;  2YHE A;  3Q75 A;  3UT8 A;  4MTO A;  3SYN A;  2WXR A;  3VF0 A;  5JSL A;  3MYF A;  1IYG A;  3NYL A;  2WVN A;  3C8G D;  4WWP A;  3APC A;  3NYM A;  2WQ7 A;  3DEO A;  3SXY A;  5EYP F;  1BR1 A;  5B3I A;  3IHU A;  1U89 A;  3FTV A;  3CVP A;  4XKC A;  3CVV A;  3RW0 A;  4IGG A;  3D9I A;  2P9I G;  3U3W A;  4IRU A;  4OAV B;  4NTA A;  3UGO A;  4PS3 A;  1JCQ A;  4RDA A;  1NP7 A;  3CK9 A;  3E32 A;  2J9W A;  1JR8 A;  4MS2 A;  1H0A A;  3ZU7 B;  1G5Z A;  3TWS A;  2DWZ A;  4GPK A;  2WMN A;  1Q0F A;  3KS2 A;  3FY4 A;  3MKR A;  4EBA A;  1N4S A;  3AU5 A;  3KMI A;  1ZB1 A;  1UFB A;  1S05 A;  1RKE A;  4DRH B;  4DX5 D;  4JTA B;  1ZW3 A;  3OXL A;  3Q15 A;  3CVN A;  2AU5 A;  3W9G A;  5ITZ F;  4C7O B;  3DI5 A;  4A1G A;  4NQF A;  4E0H A;  3FWV A;  1UJJ A;  1D0X A;  2V5Q C;  4I9C A;  3NKD A;  2IOQ A;  3JTL O;  2IOL A;  4JEH A;  3FVY A;  4HI9 A;  3Q79 A;  2HJ3 A;  3IBE A;  2HSQ A;  4UWH A;  2ZXW E;  1G8X A;  3GEE A;  3ZN3 A;  4J32 B;  2R7R A;  3NOC D;  4UQZ A;  3U3F A;  3CEQ A;  2P6V A;  1OWM A;  1BD8 A;  2FF4 A;  4U8V D;  4G0H A;  1CGN A;  3ZWI A;  3EHN A;  3L8J A;  4YDW A;  4EHM A;  3K66 A;  2X0C A;  4Y6C A;  3M1C B;  4AY5 A;  1BDJ B;  3EH1 A;  1NFO A;  3ESK A;  1Q0K A;  4HQD A;  2NSF A;  3ZIB A;  3TUL A;  3PZD A;  3MV2 B;  1J8M F;  3U2L A;  3V79 K;  3N2Z B;  5KJK A;  3FH5 A;  1MX6 A;  3PVL A;  4JXT A;  2Q9A A;  3R7C A;  3LKU A;  3ZSU A;  4DLO A;  3B0U X;  2F22 A;  5EX3 A;  4N5Q A;  2CHW A;  3GM3 A;  3CGH A;  5CEC B;  1EI7 A;  1SZI A;  4MVR A;  4YT8 A;  4O1O A;  4YND A;  1ZZP A;  2WXG A;  1YZC A;  2WZF A;  1S63 A;  4ULW A;  2HYZ A;  2BKG A;  2EIL C;  4C3E A;  4UWG A;  1VMA A;  2XM4 A;  4U04 A;  4DX7 D;  2VAS A;  5LX8 A;  3EH2 A;  3HXB A;  1ORY A;  3MCX A;  4BFR A;  1U6H A;  2Y4U A;  3GYZ A;  1H2T C;  1TNY A;  3DZA A;  3AG3 C;  1DOV A;  4C0M A;  3MLG A;  1NA3 A;  4CGV A;  4UI9 K;  4L7T A;  4NIK A;  1E83 A;  4FWV A;  3RSE G;  3Q4A B;  3ABL C;  4U07 A;  2QZA A;  3ZKJ A;  3HYM B;  1C02 A;  5HI7 A;  3CQZ A;  4CRW A;  3LUT B;  4L2L A;  1MQS A;  4FX5 A;  3C8G B;  3JRT A;  4RG9 A;  3K1I A;  3G2V A;  3RH3 A;  2FGY A;  3FXH A;  1KT1 A;  1XNF A;  2HR2 A;  3Q5M A;  4MVZ A;  4Z9J A;  3SZR A;  4XI9 A;  5EHH A;  3PNT B;  4I6G A;  4JHR A;  1IHG A;  2I1K A;  3EJN A;  3GEI A;  4GZ3 A;  4DI4 A;  4ABN A;  5JS5 A;  3CAX A;  2LP4 A;  2ZXP A;  3X2Q E;  4APF A;  4AXH A;  4CBE A;  1QPU A;  1QSP A;  3HTK C;  4NQ0 A;  4KBQ A;  4X8Q A;  3S7J A;  2X51 A;  4U8Y D;  4EZJ A;  5LFA A;  5D66 A;  4YDE A;  3US6 A;  3RAU A;  1O1R A;  1YJG A;  5BPP A;  3FTZ A;  2NUP A;  3ZC4 A;  3C63 A;  2VSX E;  3RK6 A;  1TN8 A;  3GZ1 A;  1S0P A;  1VLS A;  1OUV A;  3ASN C;  3RRM B;  2R7U A;  2ASR A;  1A5E A;  1ZU5 A;  1N0Q A;  3UPV A;  3GOR A;  4MKT A;  2XPZ A;  1Y4C A;  3ZNG A;  3J5Q B;  3VLD A;  1HMD A;  2J8S D;  4GYW A;  2KC3 A;  3ULQ A;  4U5D E;  4FJZ A;  1YAU O;  1EYH A;  4YVQ C;  4JVS A;  5EIL A;  5LCW J;  2E2E A;  1ZU4 A;  2RG8 A;  4JRZ A;  2ION A;  2AXV A;  3HXE A;  4Z9I A;  1ZHZ A;  1GS9 A;  2DGJ A;  1LS1 A;  1G4W R;  3GW4 A;  3HHM A;  5EX0 A;  4TXR A;  2EPM X;  3DSU A;  2R9R B;  1TWA A;  4I44 A;  2IU1 A;  4AVX A;  3S84 A;  4TXQ A;  3GM1 A;  2FO7 A;  1QLE C;  1YA9 A;  4WWN A;  3K9I A;  3D9J A;  5KBA A;  5K0I A;  4ILI A;  2IBF A;  1HX8 A;  4QI0 A;  3FEY A;  1Z3Y A;  3NZS A;  4HVB A;  2IXN A;  3NMK A;  3R9A B;  5BQG A;  2DYS C;  3T6B A;  4ZFH A;  4FUL A;  5AIJ A;  1IXV A;  5EID A;  1ORS C;  4C7O A;  2BKK B;  4GYY A;  3U64 A;  4G25 A;  3TG4 A;  2FI7 A;  1RJ9 B;  4AK9 A;  5AC4 A;  4EBB A;  1CGO A;  3GEH A;  2LAI A;  1H19 A;  2UUH A;  2PX0 A;  3LCA A;  1S70 B;  3ZGQ A;  3SFY A;  2VTB B;  3MJW A;  2G3K A;  3HNL A;  4NY3 A;  2E87 A;  1KU2 A;  4U5G A;  4BJ5 C;  4H7X A;  3KEA A;  5KYY A;  5BXU A;  4HLE A;  2GRO B;  2QTV A;  2M4E A;  4JUR I;  1OY3 D;  1I5N A;  2HKV A;  3T6J A;  4BJ6 C;  5L0C A;  4I43 A;  1WN0 A;  3F47 A;  3SFX A;  4F1P A;  1OR3 A;  2ZIS A;  3NB2 A;  3PNL B;  1G4U S;  1OXK A;  2EIL E;  4AL1 A;  3LYA A;  4QQI A;  3MA5 A;  3E30 A;  4A3T A;  1M56 C;  2Q4F A;  2XLO A;  3QOU A;  2ZXR A;  3DWW A;  1ZU2 A;  3ASF A;  3ML9 A;  3NYJ A;  2Y3D A;  3JSZ A;  2XGS A;  4BTB A;  4MBG A;  4J8S A;  4N6C A;  2UY1 B;  4ATZ D;  1ELW A;  5ENO D;  2LUH A;  2P9K G;  1QZX A;  4PFO A;  4HE8 D;  3L17 A;  5LP0 A;  1XGW A;  3ABL E;  1PD1 A;  2WL8 A;  1SVX A;  2ZU6 B;  1KZO A;  2R7S A;  2BE5 F;  2YQ8 A;  2AWY A;  2IXP A;  4KI2 A;  1D9S A;  3IXE A;  4L1B A;  2DYR C;  2MOW A;  2ZGD A;  4AEZ C;  3JYH A;  3UM0 A;  5AAO A;  5JLI A;  1FMV A;  2LSU A;  2R03 A;  1NI1 A;  3UM2 A;  2KW3 C;  3A9C A;  2C0M A;  3APD A;  4KZC A;  4GTR A;  3E4B A;  3V5X A;  4E85 A;  4D4N A;  2FO1 E;  3UX4 A;  3SBS A;  4EBK A;  4HNA D;  2QNL A;  3GAN A;  2XCB A;  3ZTM A;  4GCN A;  4DPR A;  3C8G A;  3TQO A;  1V74 B;  1QNF A;  3B95 A;  3VTY A;  4BX9 A;  2YNQ A;  3HG0 D;  3TWU A;  5KYN A;  3TG5 A;  3KH2 A;  2IJG X;  1OCZ E;  2AWI A;  2X6I A;  3UKU G;  3U4T A;  4H54 A;  2EIK C;  5CIV A;  4EZK A;  1L5J A;  4HI8 A;  2P9U G;  3ASN E;  3Q7G A;  3S7D A;  1K1A A;  3AS5 A;  2KCK A;  2QFC A;  2WXH A;  1RXQ A;  5T1D B;  4BEP A;  5DIZ A;  3TJ6 A;  1IZM A;  3HNI A;  1Q0M A;  1SR2 A;  3DMD A;  2D5R B;  3MFN A;  3AU4 A;  3U2M A;  1Z6T A;  1W2W A;  1G3N B;  4CYM D;  5EDS A;  4CT0 A;  4IAR A;  1HFA A;  1Y6D A;  1NU9 C;  2AVK A;  3HXC A;  1H9G A;  4YL1 A;  1M6T A;  3SEO A;  4JA7 A;  2OQM A;  4N39 A;  5A6J A;  4XEF A;  4HEA J;  1WAS A;  4C0E A;  2P9L G;  3RJV A;  2AWC A;  3B7T A;  3AJI A;  1QBQ A;  5JA4 D;  3UNG C;  2MYS A;  3LY9 A;  3J5P A;  2RKK A;  4Q96 A;  5FWQ A;  3I4R B;  3UT7 A;  2P9N G;  4JZY A;  4LUN U;  5E75 A;  5T8I A;  5L3V A;  2CYD A;  3MGB A;  5G04 J;  3T8K A;  1N4P A;  3F6Q A;  1NL4 A;  3EU5 A;  4GQH A;  4LNG A;  2I8B A;  1Z7Q c;  3TK0 A;  4P6I C;  4XLN F;  5AQ7 A;  1OKK D;  2L0T B;  1UG3 A;  3NMJ A;  3ATP A;  4MTG A;  3C5R A;  3URZ A;  4KT6 B;  4BSX A;  3J06 A;  4AJW A;  3U8V A;  2A4Z A;  3GZS A;  2R5S A;  3UXG A;  4G8K A;  2KGO A;  3G2T A;  1XZP A;  3GOD A;  3SF4 A;  1EPU A;  4KNV A;  4HBD A;  2Q7F A;  3T8M A;  4DX1 A;  2UUI A;  3ASH A;  3L1M A;  3EUV A;  2WXQ A;  4P9F A;  2O9X A;  3KAE A;  2QYU A;  3GWL A;  4JHJ A;  256B A;  2OND A;  3BUA A;  3QTH A;  2EPK X;  3ABM C;  4F53 A;  4H4K C;  3QB2 A;  2KM4 A;  1RJ9 A;  3QW1 A;  4A4A A;  2EIM E;  1TKN A;  2ZXO A;  3OXF A;  1OCO C;  3B7S A;  4N6H A;  3FOP A;  3L0I A;  1HH8 A;  1FFT C;  3L16 A;  2YVK A;  5KWD A;  2YZS A;  2J9V A;  2VTB A;  3LEW A;  2Y39 A;  3QVZ A;  1VDY A;  1VK5 A;  3EGX B;  2HM8 A;  3SGH A;  3ZW3 A;  4UI9 J;  1YMP A;  1Z3X A;  3EFO B;  1ZVZ A;  3HDX A;  4YWQ A;  3ITF A;  3E34 A;  4JIO A;  4KNW A;  3ENE A;  3S7F A;  2IO3 C;  3L82 A;  4LSZ E;  4XZ4 A;  3G4X A;  5FZS A;  1VOM A;  3RQG A;  3CHR A;  3WG7 E;  4YT4 A;  4GAA A;  1M2V B;  3QNK A;  1MX4 A;  1TNU A;  1VYI A;  4PFP A;  3N71 A;  5JMN D;  3TWT A;  3T5V A;  4U8H A;  1T6Q A;  3DD7 A;  5HV9 A;  4F7A A;  2WVI A;  4K5C A;  2R25 A;  1E84 A;  1GGQ A;  3QC1 A;  4ILH B;  4N2Q A;  3AQB A;  3FTS A;  4K0R A;  3OA1 A;  4AP2 A;  2UY1 A;  4KVM A;  1HE9 A;  5FTP A;  3SY2 A;  4R32 A;  1JWG A;  1UOH A;  4BWR A;  4FLH A;  5CCM A;  4CDM A;  2DZN A;  2Y1L E;  3PE3 A;  4DX2 A;  4LNU D;  4F1S A;  4ZHB A;  5EIB E;  3N24 A;  2R2L A;  1VTM P;  5L0H A;  3I3N A;  5B3S C;  4LDR A;  3B13 A;  3FU0 A;  3R7Q A;  1LI7 A;  4APO A;  3LY7 A;  3T5X A;  3AG4 E;  5D0Q D;  1HY5 A;  3DST A;  1AEP A;  3EDT B;  5F28 E;  4AIF A;  5B1B C;  2VH3 A;  3FUH A;  4U5H A;  3PDM P;  3FEX A;  5CI8 A;  2RFM A;  3OWT A;  1LS4 A;  3CSF A;  3UM3 A;  1QKR A;  2OEX A;  4EHP A;  2GRM A;  3B9Q A;  1MMA A;  3ULY A;  2H7V C;  1KNY A;  3ZFW A;  2CG3 A;  2PL2 A;  3QAR A;  5AGF A;  3Q7F A;  3DBS A;  5BUZ A;  4ATG A;  3DAG A;  2KZT B;  2PFD A;  4GCO A;  2QYJ A;  1EKY A;  1U2V G;  3DE8 A;  4G2V A;  1WTY A;  1SMY F;  2J07 A;  2R05 A;  3ZHE A;  3D9M A;  3FU5 A;  3ESL A;  4C9B B;  4HXI A;  5DS4 A;  1RZ4 A;  2C2L A;  2J9U A;  3ECS A;  2WZL A;  1FAP B;  3L54 A;  4B8A A;  5E2Q A;  5CBN A;  2J0W A;  3R7R A;  4IWB A;  3MYV A;  4DOZ A;  2ILR A;  1SF8 A;  4GTS A;  2GWW A;  5JVE A;  3U8P A;  4Q5S F;  4IYP A;  1YA7 O;  1N52 A;  3G2S A;  4GMR A;  2IY0 C;  1BI7 B;  3AG2 C;  3TWV A;  1JOG A;  2XLE A;  1E86 A;  4TUM A;  1X81 A;  3KSL A;  1D1A A;  4JE9 A;  5D91 A;  3CIA A;  5A7D B;  4CGW A;  2AVP A;  2I9C A;  3BEH A;  2NUT B;  2WVQ A;  3EIJ A;  2CW0 F;  1LD8 A;  5DLJ A;  2B6C A;  5DQZ A;  3FUK A;  3EHM A;  1EF1 C;  3HVE B;  2LQG A;  4GPM A;  4OIO F;  3CHP A;  1FFH A;  5A6B D;  4OIQ F;  4O6N A;  4Z9H A;  2R7W A;  5LCW C;  3EPV A;  3FAJ A;  5TJ5 E;  4K5A B;  3T9O A;  5BQI A;  3U9J A;  2XRH A;  3WHN A;  2F8X K;  4RD9 A;  3RVZ A;  3JUI A;  3AS4 A;  3ABM E;  1H2V C;  1J8Y F;  2OU6 A;  3DAF A;  4UQY A;  4W8P A;  1TFK B;  3ZTZ A;  4WNF A;  1OCO E;  3LXU X;  1MZC A;  5A6A A;  1Q0G A;  5D0O D;  4FES A;  3E37 A;  4MRU A;  1KZP A;  3Q6N A;  2Y69 E;  5KYU B;  4DJA A;  2L6H A;  3R2P A;  4FHJ A;  4JL0 A;  1DC2 A;  5FIN A;  5L0D A;  5CI9 A;  5JUA A;  4NTB A;  3KYI A;  4MVS A;  3DM9 B;  4ZLD A;  5FT9 A;  3D9O A;  1O1S A;  3K1H A;  3V2X A;  3AS8 A;  1NFN A;  4I6E A;  4MVU A;  3HNK A;  2D4U A;  4OIN F;  4WGY A;  5CBO A;  3CST A;  3LAY A;  5KJM A;  3U9W A;  1INZ A;  4JJG A;  2X6J A;  2VGY A;  2J08 A;  4I1M A;  2J09 A;  4XI0 A;  2A6H F;  3CZ6 A;  4O6F A;  3DSW A;  3EGX A;  3G50 A;  4GTM A;  4CCA A;  3T4R A;  3EFO A;  1LM3 B;  3S27 A;  1OW8 A;  2Q9C A;  2XS8 A;  1A7V A;  1A41 A;  3S28 A;  1E7V A;  3ASD A;  4G7H F;  3W9F A;  3ZYQ A;  4JCZ A;  4D4X A;  4J8E A;  3C3O A;  3ZYK A;  3UR3 C;  3CVY A;  1NFI E;  4HOT A;  4U5C E;  1OCR C;  3ZVV A;  4GTO A;  3JCU Q;  1YA0 A;  2LFF A;  2DB4 A;  4DRI B;  1FT1 A;  3MV3 B;  1K05 A;  1L3P A;  4GZ5 A;  2BTD A;  5AC5 A;  2G62 A;  1M2V A;  1ORJ A;  1NSG B;  2C04 A;  1WY6 A;  2HO1 A;  2XS1 A;  3B7B A;  5AQ9 A;  2VYI A;  2GRP B;  3VLF A;  2H6H A;  2I2O A;  4PR9 A;  1GM5 A;  5ENQ D;  2H6F A;  4PK4 A;  5FQ7 A;  3WXX A;  4KZ0 A;  3UKR G;  1Q2Z A;  1SZA A;  3FUJ A;  3KYJ A;  3IHY A;  5B1B E;  3MBG A;  4MVO A;  1FR0 A;  2FBN A;  2GAQ A;  3FTW A;  4YT2 A;  2XLW A;  1B89 A;  3BG0 B;  3HIZ A;  3EG9 B;  1I4Y A;  4XPW A;  5FZT A;  4PAC A;  3CK7 A;  2B0H A;  4QI2 A;  5COG A;  3LVQ E;  3S29 A;  3K1I C;  3TXN A;  2Y3A A;  1LD7 A;  3IHV A;  3RQE A;  2DIW A;  5BXO A;  4G78 A;  4BES A;  1Y6I A;  4JJF A;  2VSO E;  2OCC C;  2CG2 A;  1D0Y A;  4WWO A;  5AN8 A;  4GTP A;  1GQA A;  4QFV A;  1NA0 A;  4U5B E;  3G4Z A;  3UM1 A;  1PAQ A;  3I4U A;  2F8Y A;  2P1A A;  4LEU A;  4U9E A;  2KZT A;  3OTN A;  2J46 A;  4ER9 A;  2XLM A;  1FVF A;  3ZRH A;  2XXA B;  2XSE A;  4DVY P;  1AUE A;  4FLB A;  3QDN A;  3SFZ A;  1CPR A;  1HW2 A;  3O4Z A;  5AEN A;  4P29 A;  4PUC A;  2Q7R A;  3W8H A;  1N95 A;  2DVW A;  1UN8 A;  4AV7 A;  2L6F A;  4J7Y A;  3RVY A;  3CHS A;  3LJ3 A;  3CV0 A;  2IQC A;  3KL4 A;  3CKC A;  3JQ1 A;  1M57 C;  1OKK A;  4G8L A;  4MTF A;  4C48 B;  3TL5 A;  1Q0D A;  3DSS A;  3QWV A;  4ANW A;  3FU6 A;  2HMZ A;  2WXI A;  3JQ0 A;  2GDC A;  4ACK A;  3OEO A;  3D9L A;  4EBJ A;  4AM9 A;  4NRH B;  5CMY A;  1LE2 A;  4K7B A;  4CS9 A;  5BV1 A;  2CGE A;  2IM8 A;  2XZD G;  5T3R A;  4CS7 A;  2E0I A;  3RYL A;  4HRL A;  1PD0 A;  2IO2 C;  5T4Y A;  1Y8M A;  2WXP A;  3LY8 A;  4PJM A;  2NUT A;  4JEB A;  4WND A;  3K6B A;  4XKB A;  3LJB A;  4YL3 A;  5ANL A;  2CNW A;  2PNO A;  4O60 A;  4MLP A;  3HVE A;  2L9B A;  3CEX A;  3S9O A;  2HS5 A;  2JD3 A;  3NOG D;  3UMH A;  1NLX A;  2OEV A;  2IEJ A;  3ASO C;  5G04 C;  4RLY A;  2C0L A;  5E3A A;  5CER B;  2J49 A;  2Y4T A;  2GW1 A;  1WDY A;  5HS0 A;  4CT4 A;  2OV8 A;  2W9Y A;  4GYO A;  4AE4 B;  1U3C A;  5B1A C;  2Q3T A;  1E85 A;  3LDZ A;  4JTC B;  1BU9 A;  2RFA A;  5JRA A;  4NAC A;  5EK0 A;  4CS8 A;  1JMW A;  2QY9 A;  4U0S A;  1BR4 A;  2EPN A;  4WNE A;  1OCC C;  3O39 A;  1FVH A;  3NRH A;  3FHE A;  4FAD A;  2J4B A;  3PEU B;  4KC9 A;  4I2Z A;  2G3V A;  4L6R A;  5KYU A;  3UIN C;  3TOL A;  2A69 F;  2ZD9 A;  4K0D A;  4G23 A;  4PJL A;  1QQE A;  1IQU A;  4DRX E;  1H6G A;  1R4T A;  1OR2 A;  4G26 A;  4CS8 C;  3C62 A;  1TYQ G;  3UTM A;  5ENS D;  2J8W A;  4PJJ A;  1OXJ A;  3EGD B;  4BPM A;  2YEV A;  2V4L A;  5IY5 C;  2HZ8 A;  1O5M A;  3LNM B;  2OEW A;  3ISM C;  1JRA A;  1LI5 A;  3NKE A;  4XLP F;  2W45 A;  3UIO C;  2ZGG A;  3QK0 A;  3AG3 E;  4I17 A;  3ASG A;  4EKW A;  3NDB B;  4UI9 C;  4HB5 A;  1KPS B;  3W4Y A;  4WUY A;  2PM6 A;  4N3C A;  3V2O A;  3FU3 A;  3JYY A;  2NYJ A;  3I5P A;  3D9K A;  3Q6M A;  1BLX B;  1IHB A;  4GTV A;  3FUL A;  3X1O A;  3PRZ A;  3VTX A;  4OAU C;  2VJ8 A;  2OVB A;  3LS1 A;  1O3U A;  1JCR A;  4WGZ A;  1B68 A;  4L9P A;  4I9E A;  4M7C A;  1TWH A;  3ZIM A;  1ZHX A;  2AP3 A;  5DQT A;  3QW0 A;  4CDV A;  1Z63 A;  2CHZ A;  4JEU A;  3L13 A;  4XPY A;  3W8I A;  2NG1 A;  4I1O B;  1E8Y A;  3AQC A;  2YL7 A;  3S0X A;  2XGM A;  2MHK A;  5J08 A;  5E33 A;  5JP7 A;  3BU8 A;  5G05 J;  3EZH A;  5BNW A;  3Q73 A;  2IYL D;  5L0G A;  1MJ0 A;  2L6J A;  1SYQ A;  5FQ8 A;  1PCX A;  2OCC E;  4MQ9 F;  5CED B;  2YQY A;  5KYX B;  3L22 A;  1HE1 A;  2XLV A;  3EG9 A;  2J0X A;  4XWJ A;  3JRM O;  2VCC A;  3TXM A;  4ME2 A;  1Z6A A;  4GEH A;  4BEJ A;  2H7B A;  2DCP A;  1HMO A;  1TN7 A;  3GM2 A;  3PDN A;  2XZT G;  4XEI G;  4CIP A;  1V55 C;  4IUL A;  2HJM A;  4IAO A;  2KC7 A;  1TNO A;  2XL4 A;  1ST6 A;  4K03 A;  5COF A;  4FC8 A;  4OD5 A;  4J8D A;  4CJO A;  4LLC A;  3UMK A;  2DI3 A;  3DJN B;  2A0B A;  1K1B A;  1P5Q A;  3VLE A;  4U5E E;  1SA4 A;  4BJ1 A;  5COM A;  4BEM J;  4B94 A;  3TWW A;  3RRN B;  1SQM A;  3ZXP A;  4EIY A;  3K33 A;  1LVK A;  2WXL A;  4YN0 B;  2WM9 A;  1S64 A;  5A6B A;  2XXA A;  4CDN A;  2I6H A;  4EEC A;  1TWC A;  2LFD A;  3FDQ A;  3L9T A;  3M15 A;  1N0R A;  1TJF A;  2RSE B;  4E7S A;  3APF A;  4C3B A;  4FJY A;  2A5E A;  3Q9U C;  4JTD B;  1QYM A;  3EHR A;  2LXM A;  3FMS A;  5AJL A;  2LNI A;  2JAB A;  4GZC A;  2DYS E;  1D1B A;  2R7X A;  2IF4 A;  2YHC A;  2QC9 A;  4LNB A;  1SZ9 A;  5ARG A;  4X0R A;  1YYJ A;  1E8W A;  4FU3 A;  5FZQ A;  1E2X A;  1BBH A;  2P9S G;  1YVI A;  3H65 A;  3CVX A;  3CHO A;  3T9K A;  3D9H A;  5C2Y A;  3L8I A;  4WAF A;  5H7P A;  1YYX A;  4PDX A;  3NG1 A;  1TR4 A;  3FP3 A;  5G2N A;  3FUN A;  2Y3G A;  4RBN A;  5ANR A;  4CX9 A;  4FP7 A;  3ZPJ A;  1AP7 A;  4CDY A;  3SP1 A;  4HS2 A;  2FFH A;  2J9Q A;  3JUE A;  1OCC E;  2Q9B A;  5A6C A;  1WM5 A;  2LK4 A;  3Q9N C;  4BG0 A;  1N4R A;  3ZEF A;  2WB7 A;  3IQC A;  1WGW A;  2PF4 E;  4RG6 A;  4D10 C;  1YAR O;  2OVF A;  4FHK A;  2L0I A;  4J0U A;  2IFU A;  2PBE A;  1R5I D;  4AE4 A;  1N9A A;  2IOS A;  4LAC B;  3M4B A;  4GML A;  2ZXW C;  3M4C A;  3NAW A;  3FTU A;  5ENP D;  2OJE D;  3DJU B;  3MX3 A;  1JWF A;  4TRQ A;  3B7R L;  4I1A A;  4URK A;  2YKZ A;  4GYT A;  2WXJ A;  3QAQ A;  4IB4 A;  1MHQ A;  2A68 F;  3QZC A;  1TJC A;  2A5U A;  4CIH A;  3FTY A;  5D92 A;  1MQV A;  2FEZ A;  3FTX A;  4L2Y A;  3DSX A;  2GRQ B;  1ELK A;  4G1T A;  4HOR A;  4DI3 A;  2YL1 A;  3IKO B;  2ICW G;  5G55 A;  4BJT A;  3SXK A;  2BUG A;  3CR3 A;  3JYS A;  3LPZ A;  4G24 A;  4HOQ A;  3SZ7 A;  2R02 A;  2Y3H A;  1HZ4 A;  3CVL A;  4G7Z F;  3EGD A;  4JKV A;  2PP4 A;  2YLG A;  5E3C A;  4UWF A;  2DYR E;  2W4B A;  5M72 A;  3ZVR A;  4OIP F;  3I5Q A;  1X5B A;  3T6G B;  4E18 A;  4W8K A;  4BER A;  1A7D A;  3TWX A;  4BX8 A;  2EPL X;  1DOW A;  2OKU A;  1EQ1 A;  2XPI A;  4XE0 A;  4J8Y A;  2VGX B;  3KKB A;  1ZBP A;  4DK5 A;  1OWN A;  1MND A;  3HXF A;  5HSW A;  4N3B A;  4XQ1 A;  2R7T A;  4UWL A;  2GRL A;  1XWJ A;  2V26 A;  1RMV A;  2NPU A;  3TOM A;  4E17 A;  1BR2 A;  1F1M A;  4LG6 A;  3QJZ A;  4YT5 A;  3TWR A;  2HUJ A;  1NG1 A;  3CQG B;  4IAQ A;  3LS0 A;  2NSG A;  3TJ5 A;  3V7O A;  4QDL A;  3IQT A;  3S7B A;  1K8K G;  5EGY A;  2EIK E;  3FHD A;  5AQA A;  2Y3B A;  5JHB A;  1OW7 A;  3V30 A;  4ZLC A;  5FZR A;  5BQH A;  4YDO A;  5BT1 A;  2P58 C;  4KMO A;  5FIO A;  1HW1 A;  3MKQ B;  5ENN A;  1O5H A;  2PZI A;  4U7E B;  4GTQ A;  1V55 E;  1YLM A;  3BQO A;  4JW1 A;  1T5O A;  3G2W A;  2YLD A;  3SNX A;  4B6I A;  2LSE A;  2NUP B;  2H7O A;  1OW6 A;  3PZ4 A;  2P7V A;  3VRC A;  5KYX A;  4R7L A;  2B0J A;  2VC9 A;  4HRM B;  1TWG A;  1LPE A;  3SQV A;  2XQ0 A;  1MMD A;  4J8F A;  3QWW A;  1OQC A;  1WOL A;  4Y6W A;  4FAP B;  4B93 B;  4F3V A;  2WZG A;  3X2Q C;  1A0B A;  4A2N B;  3QKY A;  5A23 A;  2J4D A;  3WAQ A;  3CVU A;  1N94 A;  2YHS A;  1WAT A;  1EDU A;  3DKA A;  4PS8 A;  4GA2 A;  4U5F E;  2QY7 A;  3U5S A;  3C3Q A;  2XEH A;  1QVX A;  1WG0 A;  3L6A A;  4JEA A;  2MYO A;  3NQP A;  2FAP B;  4MW8 A;  3JT1 A;  4C3D A;  1T6U A;  3D9P A;  4XPX A;  4V3I A;  4A1S A;  2M64 A;  1CGM E;  5BW8 C;  3TJP A;  4JC7 A;  1YCS B;  1ZW2 A;  5AQB A;  4G11 A;  5GPG B;  1IQR A;  4K1O A;  4A55 A;  3P2B A;  3RO2 A;  3O55 A;  4KVO A;  5L0F A;  2RD0 A;  4DX6 D;  3O10 A;  2R7V A;  1JPN A;  4JZA A;  1E8X A;  1ELR A;  2V8S E;  4O79 A;  3ZQV A;  3H2U A;  1N4Q A;  1UN9 A;  2X3M A;  3G2U A;  2WPV A;  2BL2 A;  4E0I A;  4GMJ A;  4BT9 A;  4Q69 A;  1HG2 A;  5CCL A;  2P0N A;  1HF8 A;  5E76 A;  1HXI A;  3O6X A;  1TNZ A;  2LIG A;  3P1U A;  4HLL A;  2JLB A;  1ZHT A;  1HE8 A;  1DVP A;  5A6K A;  2XCC A;  1E7U A;  3UUX A;  2OOE A;  4M3O A;  5AYW D;  4DVZ A;  2XLH A;  4XEV A;  4DRJ B;  3V5Y A;  2OOC A;  4A63 B;  2PNN A;  5FQ4 A;  5CRU A;  3TAX A;  3HXD A;  1V54 C;  1C03 A;  3SD5 A;  3K7D A;  1H9T A;  2ETA A;  2IXM A;  3M79 A;  1OWL A;  1TN6 A;  2H6G A;  5AAR A;  2WXF A;  1D1C A;  5KYY B;  3FH7 A;  2MHR A;  4AY6 A;  3Q7L A;  2XL8 A;  5HKP A;  3HNJ A;  4O6M A;  2H6I A;  3UI2 A;  5L3Q A;  1MNE A;  1Z5Z A;  4PS7 A;  4IJJ A;  4LCT A;  3RKO F;  2CCY A;  2WMO A;  1QQ3 A;  2OJQ A;  4PJN A;  3ZUV B;  3DEP A;  4U63 A;  3EZI A;  4GA1 A;  3CVQ A;  3RQF A;  2HMQ A;  2HSB A;  4I6J A;  3DPD A;  3ZQY A;  1H6P A;  2KCV A;  5F5H A;  4H7Y A;  2I15 A;  3OXG A;  2Q00 A;  2AJA A;  4JD2 G;  2LXL A;  3ZXS A;  3MYI A;  2BF0 X;  3PCV A;  4UUC A;  3LS8 A;  1VYK A;  2PQR A;  3C7J A;  2AXZ A;  4I2W A;  2WVO A;  4GU5 A;  1FTS A;  3C18 A;  3R9M A;  4CEM A;  5JJ6 A;  1TFO B;  4KBL A;  2J45 A;  2KSF A;  5B3S E;  3DXJ F;  4JC8 A;  3Q49 B;  2QLA A;  2LD6 A;  1MX2 A;  3PE4 A;  5HRY A;  3RIB A;  2PQN A;  5KNG A;  3U0C A;  3E9V A;  4AL0 A;  1IW7 F;  3JXJ A;  1U3D A;  3HLZ A;  3U9M A;  4Q4Z F;  4BTA A;  3CSK A;  1XZQ A;  1E90 A;  3EHQ A;  2C03 A;  1YZA A;  3JSE O;  2V5F A;  1UG7 A;  2VGX A;  3CK8 A;  4CDR A;  1ZYR F;  5KYW B;  4GTT A;  2YLI A;  3LES A;  2L7A A;  1OWP A;  4F6R D;  4DXW A;  1VB5 A;  1ZHW A;  3Q47 B;  1OWO A;  3FDH A;  4EQF A;  2A6E F;  2IXO A;  3D3M A; 
#chains in the Genus database with same CATH homology
 5JHA A;  1HG5 A;  4JHK A;  3KD7 A;  5EKQ D;  4TUU A;  2FUL A;  1N1C A;  2KNH A;  3SNH A;  2J7P D;  2XPY A;  3MKQ A;  3LEV A;  5G05 C;  3RKV A;  1KLX A;  4YJW A;  4ACL A;  4E6H A;  3UMI A;  2ZPA A;  3EIQ C;  4OYS A;  4GZ6 A;  4EBA G;  1HS6 A;  5J90 A;  3GZ2 A;  1OCZ C;  4I3M A;  4XX5 A;  2CHX A;  4J6I A;  2GFH A;  2WQH A;  3U66 A;  4JA9 A;  4UQX A;  3QMK A;  4LLE A;  2L9J A;  4B0Z A;  2M63 A;  2EQX A;  5JJT A;  4ANX A;  2KQ9 A;  3TGO A;  4N06 A;  3IEG A;  4O6Y A;  3KEZ A;  4HFG A;  4XTK A;  4O7G A;  3FUE A;  4DBQ A;  1O87 A;  4HOU A;  3UT4 A;  2KAT A;  3PMR A;  4HFK B;  3F46 A;  1LF8 A;  4RSY A;  1HU3 A;  2WB2 A;  4CS9 C;  3SHF A;  3HJC A;  4KXK B;  4B8C B;  3NF1 A;  5DVW A;  1PC2 A;  2R7O A;  1HO8 A;  4HFF B;  4G7O F;  2WXK A;  3ZG1 A;  1WAO 1;  4BJ5 A;  3ML8 A;  4KYO B;  4HOS A;  3FUM A;  2GGF A;  1KT0 A;  1MMN A;  1UJK A;  1E96 B;  2V3C C;  2L81 A;  4BJ6 A;  3CLJ A;  3CVW A;  3D9N A;  3ZYL A;  2WXM A;  2NXP A;  1ZHY A;  3ZYM A;  2OG2 A;  2EIM C;  3CHQ A;  2WQ6 A;  4TV3 A;  3PUJ A;  4A3V A;  2WXO A;  3RIP A;  5T3W A;  1UW4 B;  2CDQ A;  3ABK C;  2W4M A;  1MMG A;  4DLQ A;  3FH8 A;  3ONL A;  5CHE E;  2XHE A;  1FMW A;  2MRI A;  4AX2 A;  3IV0 A;  4OIR F;  3PRE A;  2VSN A;  4E7Z A;  1H2U A;  2AXU A;  3LVR E;  1Z3I X;  1A17 A;  4EWC A;  5FQ6 A;  4FA6 A;  4CSA A;  2EIJ C;  3CKB A;  2X6F A;  3QWP A;  2JEK A;  2MWQ A;  3WG7 C;  4DBR A;  3RRU A;  4LER A;  3C98 A;  1FCH A;  3FUF A;  3WOD F;  2I1J A;  5KCM A;  3LNR A;  1N54 A;  4JPS A;  4BY6 A;  4CSA C;  4WNG A;  4IN3 B;  4OVU A;  4W9R A;  3AG1 C;  5HQ8 A;  5KYW A;  2X38 A;  3UGP A;  4ILG A;  3L08 A;  5KJL A;  2EIN C;  1TR2 A;  2AW6 A;  4J30 B;  2CFU A;  3S2A A;  3RFY A;  3LLI A;  3UMV A;  3AG4 C;  1H6K A;  3PEV B;  3PUK A;  4AOF A;  3B0P A;  3ZHE B;  4ANJ A;  3O48 A;  1E8Z A;  2PM7 A;  2KCL A;  5DS5 A;  3TD7 A;  2KJG A;  3SI5 A;  1Z23 A;  5C1D A;  2X6H A;  2LO6 A;  1NZE A;  1GW6 A;  4L23 A;  3NZU A;  3PH0 C;  2VB6 A;  2XEV A;  4Q7C A;  5FJY A;  4EZL A;  3MEK A;  4XIF A;  4U0Z A;  2V0P A;  5AJD A;  4PH4 B;  3I4G A;  1S7Z A;  4EPZ A;  3ONK A;  2CFZ A;  5ARF A;  3OAW A;  1PY1 A;  4YVO A;  1DNP A;  2Z15 A;  3N0T A;  3VAY A;  2R59 A;  2NC9 A;  4JCH A;  1D0Z A;  2LAH A;  2HV6 A;  3CHM A;  2NSZ A;  1M2O A;  3CQC B;  2UWJ G;  2XRY A;  4M63 A;  2PX3 A;  2HV7 A;  3DM5 A;  5F5F A;  3RU0 A;  1JPL A;  1W3B A;  2VSY A;  4F4B A;  4MND A;  3UQ3 A;  1LKX A;  2CNW D;  5BUO A;  4ANV A;  3PS6 A;  4WJ0 A;  5T3T A;  3POV A;  4B89 A;  2XGO A;  2R7Q A;  2R17 C;  4BT8 A;  2Y69 C;  5DBK A;  2DBA A;  4GB9 A;  2X6K A;  3E70 C;  3EQL F;  3SBT B;  5BV0 A;  2VQ2 A;  1BPO A;  3MZL B;  1NU7 D;  3FUI A;  5DS6 A;  1NZN A;  4U0U A;  4N5C A;  3VYW A;  5FCL A;  3IEE A;  2XRZ A;  4MS6 A;  3LLK A;  5CMW A;  4N3A A;  3B7U X;  5KJN A;  3L34 A;  1TEZ A;  2WXN A;  4OVV A;  2LSV A;  1QZ2 A;  4RVB A;  3W2W A;  4NUR A;  4LRZ A;  4GZD A;  3FUD A;  4N2S A;  1JUQ A;  4UWK A;  2J7P A;  3BEE A;  5LOZ A;  3W2V A;  3PHF 2;  4GA0 A;  2YIN A;  3BG1 B;  4Q94 A;  1JPJ A;  3FFL A;  4ANU A;  3B0V C;  2A1D D;  4OD4 A;  3JCK C;  3RO3 A;  5JJ7 A;  2YHE A;  3UT8 A;  3SYN A;  2WXR A;  1IYG A;  3NYL A;  2WVN A;  4WWP A;  3APC A;  3NYM A;  2WQ7 A;  1BR1 A;  3FTV A;  3CVV A;  3CVP A;  4XKC A;  3D9I A;  3U3W A;  4IRU A;  3UGO A;  4PS3 A;  4RDA A;  1NP7 A;  3CK9 A;  2J9W A;  1H0A A;  4GPK A;  2WMN A;  3KS2 A;  3FY4 A;  3MKR A;  4EBA A;  3AU5 A;  3KMI A;  3OXL A;  3Q15 A;  3CVN A;  4C7O B;  4A1G A;  3FWV A;  1UJJ A;  1D0X A;  4I9C A;  3NKD A;  2IOQ A;  2IOL A;  4JEH A;  3FVY A;  3IBE A;  4UWH A;  1G8X A;  3ZN3 A;  4J32 B;  2R7R A;  4UQZ A;  3CEQ A;  2P6V A;  1OWM A;  2FF4 A;  4G0H A;  3EHN A;  3K66 A;  4Y6C A;  3M1C B;  4AY5 A;  3EH1 A;  3ESK A;  3ZIB A;  3PZD A;  3MV2 B;  1J8M F;  3N2Z B;  5KJK A;  3FH5 A;  3PVL A;  4JXT A;  2Q9A A;  3LKU A;  3ZSU A;  4DLO A;  3B0U X;  5EX3 A;  2CHW A;  3CGH A;  1SZI A;  4YT8 A;  4YND A;  2WXG A;  2WZF A;  4ULW A;  2HYZ A;  2EIL C;  4C3E A;  4UWG A;  1VMA A;  4U04 A;  2VAS A;  5LX8 A;  3EH2 A;  3MCX A;  4BFR A;  2Y4U A;  3GYZ A;  1H2T C;  3DZA A;  3AG3 C;  4C0M A;  3MLG A;  1NA3 A;  4CGV A;  4UI9 K;  4L7T A;  4FWV A;  3Q4A B;  3ABL C;  4U07 A;  3HYM B;  5HI7 A;  3CQZ A;  4CRW A;  4L2L A;  1MQS A;  4FX5 A;  3JRT A;  4RG9 A;  3G2V A;  3RH3 A;  2FGY A;  1KT1 A;  1XNF A;  2HR2 A;  3Q5M A;  3SZR A;  4XI9 A;  5EHH A;  3PNT B;  4I6G A;  4JHR A;  1IHG A;  2I1K A;  3EJN A;  4GZ3 A;  4DI4 A;  4ABN A;  2ZXP A;  4APF A;  4AXH A;  4CBE A;  3HTK C;  4NQ0 A;  4KBQ A;  4EZJ A;  3S7J A;  2X51 A;  5LFA A;  5BPP A;  3FTZ A;  2NUP A;  3ZC4 A;  2VSX E;  3RK6 A;  3GZ1 A;  1S0P A;  1OUV A;  3ASN C;  3RRM B;  2R7U A;  1ZU5 A;  3UPV A;  4MKT A;  2XPZ A;  3VLD A;  4GYW A;  3ULQ A;  4U5D E;  4FJZ A;  1EYH A;  4YVQ C;  4JVS A;  5LCW J;  2E2E A;  1ZU4 A;  2RG8 A;  2ION A;  2AXV A;  1ZHZ A;  2DGJ A;  1LS1 A;  3GW4 A;  3HHM A;  5EX0 A;  1TWA A;  4I44 A;  2IU1 A;  4AVX A;  2FO7 A;  1QLE C;  4WWN A;  3K9I A;  3D9J A;  4ILI A;  3NZS A;  4QI0 A;  1HX8 A;  3FEY A;  1Z3Y A;  4HVB A;  2IXN A;  3R9A B;  2DYS C;  3T6B A;  4FUL A;  5AIJ A;  4C7O A;  4GYY A;  3U64 A;  4G25 A;  3TG4 A;  2FI7 A;  1RJ9 B;  4AK9 A;  4EBB A;  2LAI A;  1H19 A;  2PX0 A;  3LCA A;  3ZGQ A;  2VTB B;  3MJW A;  2G3K A;  4NY3 A;  2E87 A;  1KU2 A;  4U5G A;  4BJ5 C;  4H7X A;  5KYY A;  4HLE A;  2QTV A;  2M4E A;  4JUR I;  3T6J A;  4BJ6 C;  4I43 A;  3F47 A;  3PNL B;  3LYA A;  3MA5 A;  4A3T A;  1M56 C;  3QOU A;  2ZXR A;  1ZU2 A;  3ASF A;  3ML9 A;  3NYJ A;  2Y3D A;  3JSZ A;  2XGS A;  4BTB A;  4J8S A;  2UY1 B;  1ELW A;  1QZX A;  4PFO A;  4HE8 D;  3L17 A;  5LP0 A;  1XGW A;  1PD1 A;  2WL8 A;  2ZU6 B;  2R7S A;  2BE5 F;  2YQ8 A;  2IXP A;  4KI2 A;  4L1B A;  2DYR C;  2MOW A;  4AEZ C;  3JYH A;  2LSU A;  1FMV A;  2KW3 C;  2C0M A;  3APD A;  4KZC A;  3E4B A;  4E85 A;  3UX4 A;  3SBS A;  3GAN A;  2XCB A;  4GCN A;  4DPR A;  3VTY A;  1QNF A;  4BX9 A;  2YNQ A;  5KYN A;  3TG5 A;  3KH2 A;  2IJG X;  2AWI A;  2X6I A;  3U4T A;  2EIK C;  4EZK A;  1L5J A;  3Q7G A;  3S7D A;  3AS5 A;  2KCK A;  2QFC A;  2WXH A;  5T1D B;  5DIZ A;  1IZM A;  3AU4 A;  3DMD A;  2D5R B;  1Z6T A;  1W2W A;  5EDS A;  4CT0 A;  1HFA A;  1NU9 C;  3SEO A;  4JA7 A;  4N39 A;  4HEA J;  4C0E A;  3RJV A;  3B7T A;  3UNG C;  2MYS A;  3LY9 A;  4Q96 A;  5FWQ A;  3I4R B;  3UT7 A;  4LUN U;  4JZY A;  5E75 A;  5T8I A;  5L3V A;  3MGB A;  5G04 J;  2I8B A;  4P6I C;  4XLN F;  1OKK D;  2L0T B;  1UG3 A;  3URZ A;  4KT6 B;  4BSX A;  4AJW A;  2A4Z A;  3GZS A;  2R5S A;  2KGO A;  3G2T A;  3GOD A;  3SF4 A;  1EPU A;  4KNV A;  2Q7F A;  3T8M A;  3ASH A;  2WXQ A;  2O9X A;  3KAE A;  4JHJ A;  2OND A;  3ABM C;  4F53 A;  4H4K C;  3QB2 A;  2KM4 A;  1RJ9 A;  1TKN A;  2ZXO A;  3OXF A;  1OCO C;  3B7S A;  1HH8 A;  3L0I A;  1FFT C;  3L16 A;  2YZS A;  2J9V A;  2VTB A;  3LEW A;  2Y39 A;  1VDY A;  1VK5 A;  3EGX B;  2HM8 A;  3SGH A;  3ZW3 A;  4UI9 J;  1Z3X A;  3EFO B;  3HDX A;  4YWQ A;  3ITF A;  4KNW A;  3ENE A;  3S7F A;  4XZ4 A;  5FZS A;  1VOM A;  3CHR A;  4YT4 A;  4GAA A;  1M2V B;  3QNK A;  1VYI A;  4PFP A;  3N71 A;  3T5V A;  4U8H A;  3DD7 A;  4F7A A;  2WVI A;  3QC1 A;  4ILH B;  4N2Q A;  3AQB A;  3FTS A;  4K0R A;  3OA1 A;  4AP2 A;  2UY1 A;  4KVM A;  5FTP A;  1JWG A;  4BWR A;  4FLH A;  5CCM A;  4CDM A;  3PE3 A;  4F1S A;  3N24 A;  3I3N A;  5B3S C;  3B13 A;  3FU0 A;  3R7Q A;  4APO A;  3LY7 A;  3T5X A;  5D0Q D;  3EDT B;  4AIF A;  5B1B C;  2VH3 A;  3FUH A;  4U5H A;  3FEX A;  5CI8 A;  3OWT A;  3CSF A;  2GRM A;  3B9Q A;  1MMA A;  2H7V C;  3ZFW A;  2CG3 A;  2PL2 A;  3QAR A;  3DBS A;  5BUZ A;  4ATG A;  3DAG A;  2KZT B;  2PFD A;  4GCO A;  4G2V A;  1SMY F;  2J07 A;  3ZHE A;  3D9M A;  3FU5 A;  3ESL A;  4C9B B;  4HXI A;  5DS4 A;  2C2L A;  2J9U A;  3ECS A;  2WZL A;  3L54 A;  4B8A A;  5E2Q A;  2J0W A;  3R7R A;  4IWB A;  3MYV A;  4DOZ A;  2ILR A;  1SF8 A;  4Q5S F;  4IYP A;  1N52 A;  3G2S A;  3AG2 C;  1D1A A;  5D91 A;  3CIA A;  5A7D B;  4CGW A;  2AVP A;  2I9C A;  2NUT B;  2WVQ A;  3EIJ A;  2CW0 F;  5DLJ A;  5DQZ A;  3FUK A;  3EHM A;  1EF1 C;  3HVE B;  4OIO F;  3CHP A;  1FFH A;  4OIQ F;  4O6N A;  2R7W A;  5LCW C;  3EPV A;  3FAJ A;  2XRH A;  4RD9 A;  3JUI A;  3AS4 A;  1H2V C;  1J8Y F;  3DAF A;  4UQY A;  4WNF A;  3LXU X;  5D0O D;  4FES A;  4MRU A;  3Q6N A;  5KYU B;  4DJA A;  4JL0 A;  4FHJ A;  5CI9 A;  3DM9 B;  4ZLD A;  5FT9 A;  3D9O A;  3K1H A;  3AS8 A;  4I6E A;  4OIN F;  3CST A;  3LAY A;  5KJM A;  3U9W A;  1INZ A;  4JJG A;  2X6J A;  2VGY A;  2J08 A;  4I1M A;  2J09 A;  4XI0 A;  2A6H F;  3CZ6 A;  4O6F A;  3EGX A;  4CCA A;  3T4R A;  3EFO A;  3S27 A;  2Q9C A;  3S28 A;  1E7V A;  3ASD A;  4G7H F;  3ZYQ A;  4J8E A;  3ZYK A;  3UR3 C;  3CVY A;  4HOT A;  4U5C E;  1OCR C;  3ZVV A;  3JCU Q;  1YA0 A;  3MV3 B;  4GZ5 A;  2BTD A;  2G62 A;  1M2V A;  2C04 A;  1WY6 A;  2HO1 A;  2VYI A;  3VLF A;  2I2O A;  4PK4 A;  5FQ7 A;  3WXX A;  4KZ0 A;  1SZA A;  3FUJ A;  3IHY A;  2FBN A;  3FTW A;  4YT2 A;  1B89 A;  3BG0 B;  3HIZ A;  3EG9 B;  3CK7 A;  4QI2 A;  3LVQ E;  3S29 A;  3K1I C;  3TXN A;  2Y3A A;  3IHV A;  2DIW A;  1Y6I A;  4JJF A;  2VSO E;  2OCC C;  2CG2 A;  1D0Y A;  4WWO A;  4QFV A;  1NA0 A;  4U5B E;  1PAQ A;  3I4U A;  4LEU A;  2KZT A;  3OTN A;  2J46 A;  1FVF A;  3ZRH A;  2XXA B;  2XSE A;  4DVY P;  4FLB A;  3QDN A;  3SFZ A;  5AEN A;  3O4Z A;  4P29 A;  4PUC A;  3W8H A;  1UN8 A;  4AV7 A;  3LJ3 A;  3CHS A;  3CV0 A;  2IQC A;  3KL4 A;  3CKC A;  3JQ1 A;  1M57 C;  1OKK A;  3TL5 A;  3QWV A;  4ANW A;  3FU6 A;  2WXI A;  3JQ0 A;  4ACK A;  3OEO A;  3D9L A;  4AM9 A;  4NRH B;  5CMY A;  4K7B A;  4CS9 A;  5BV1 A;  2CGE A;  5T3R A;  4CS7 A;  2E0I A;  3RYL A;  1PD0 A;  5T4Y A;  1Y8M A;  2WXP A;  3LY8 A;  4PJM A;  2NUT A;  4WND A;  3K6B A;  4XKB A;  3LJB A;  5ANL A;  2CNW A;  4MLP A;  3HVE A;  2L9B A;  2JD3 A;  3UMH A;  3ASO C;  5G04 C;  2C0L A;  5E3A A;  2J49 A;  2Y4T A;  2GW1 A;  4CT4 A;  2OV8 A;  2W9Y A;  4GYO A;  4AE4 B;  1U3C A;  5B1A C;  2Q3T A;  3LDZ A;  4NAC A;  4CS8 A;  2QY9 A;  4U0S A;  4WNE A;  1BR4 A;  1OCC C;  3O39 A;  1FVH A;  3NRH A;  3FHE A;  4FAD A;  2J4B A;  3PEU B;  4KC9 A;  4I2Z A;  2G3V A;  5KYU A;  2A69 F;  4K0D A;  4G23 A;  4PJL A;  1QQE A;  1IQU A;  4G26 A;  4CS8 C;  4PJJ A;  3EGD B;  2YEV A;  2V4L A;  5IY5 C;  3NKE A;  4XLP F;  2W45 A;  3QK0 A;  4I17 A;  3ASG A;  3NDB B;  4UI9 C;  4WUY A;  2PM6 A;  4N3C A;  3FU3 A;  3I5P A;  3D9K A;  3Q6M A;  3FUL A;  3X1O A;  3PRZ A;  3VTX A;  2VJ8 A;  2OVB A;  3LS1 A;  4I9E A;  1TWH A;  3ZIM A;  1ZHX A;  5DQT A;  1Z63 A;  2CHZ A;  4JEU A;  3L13 A;  3W8I A;  2NG1 A;  4I1O B;  1E8Y A;  3AQC A;  3S0X A;  2XGM A;  2MHK A;  5J08 A;  5E33 A;  5G05 J;  3EZH A;  5BNW A;  2IYL D;  2L6J A;  5FQ8 A;  1PCX A;  4MQ9 F;  5KYX B;  3L22 A;  3EG9 A;  2J0X A;  4XWJ A;  3TXM A;  4ME2 A;  1Z6A A;  4GEH A;  4BEJ A;  2H7B A;  2DCP A;  3PDN A;  1V55 C;  4IUL A;  4IAO A;  2KC7 A;  2XL4 A;  1ST6 A;  4K03 A;  4FC8 A;  4OD5 A;  4J8D A;  4LLC A;  3UMK A;  3DJN B;  1P5Q A;  3VLE A;  4U5E E;  4BJ1 A;  4B94 A;  3RRN B;  1SQM A;  3K33 A;  1LVK A;  2WXL A;  4YN0 B;  2WM9 A;  2XXA A;  4CDN A;  2I6H A;  4EEC A;  1TWC A;  3FDQ A;  1TJF A;  4E7S A;  3APF A;  4C3B A;  4FJY A;  5AJL A;  2LNI A;  4GZC A;  1D1B A;  2R7X A;  2IF4 A;  2YHC A;  1SZ9 A;  5ARG A;  4X0R A;  1E8W A;  4FU3 A;  5FZQ A;  3H65 A;  3CVX A;  3CHO A;  5C2Y A;  4WAF A;  4PDX A;  3NG1 A;  3FP3 A;  5G2N A;  3FUN A;  2Y3G A;  4RBN A;  5ANR A;  4FP7 A;  3ZPJ A;  3SP1 A;  4HS2 A;  2FFH A;  2J9Q A;  2Q9B A;  5A6C A;  1WM5 A;  4BG0 A;  3ZEF A;  2WB7 A;  1WGW A;  2PF4 E;  4RG6 A;  4D10 C;  2OVF A;  4FHK A;  2L0I A;  4J0U A;  2IFU A;  4AE4 A;  2IOS A;  4LAC B;  4GML A;  2ZXW C;  3FTU A;  3DJU B;  3MX3 A;  1JWF A;  4TRQ A;  3B7R L;  4I1A A;  4URK A;  4GYT A;  2WXJ A;  3QAQ A;  1MHQ A;  2A68 F;  3QZC A;  3FTY A;  1TJC A;  2A5U A;  4CIH A;  5D92 A;  2FEZ A;  3FTX A;  4L2Y A;  1ELK A;  4G1T A;  4HOR A;  4DI3 A;  3IKO B;  5G55 A;  4BJT A;  2BUG A;  3CR3 A;  3JYS A;  3LPZ A;  4G24 A;  4HOQ A;  3SZ7 A;  2Y3H A;  3CVL A;  1HZ4 A;  4G7Z F;  3EGD A;  2PP4 A;  4UWF A;  5E3C A;  5M72 A;  2W4B A;  3ZVR A;  4OIP F;  3I5Q A;  1X5B A;  4W8K A;  4BX8 A;  2XPI A;  4XE0 A;  2VGX B;  3KKB A;  1ZBP A;  4DK5 A;  1OWN A;  1MND A;  5HSW A;  4N3B A;  2R7T A;  4UWL A;  2GRL A;  2V26 A;  1BR2 A;  3QJZ A;  4YT5 A;  1NG1 A;  3CQG B;  3LS0 A;  3V7O A;  4QDL A;  3S7B A;  5EGY A;  3FHD A;  2Y3B A;  5JHB A;  4ZLC A;  5FZR A;  5BT1 A;  2P58 C;  4KMO A;  3MKQ B;  5ENN A;  1O5H A;  2PZI A;  4JW1 A;  3G2W A;  3SNX A;  4B6I A;  2LSE A;  2NUP B;  2H7O A;  2P7V A;  5KYX A;  4R7L A;  2B0J A;  1TWG A;  2XQ0 A;  1MMD A;  4J8F A;  3QWW A;  4Y6W A;  4F3V A;  2WZG A;  3X2Q C;  4A2N B;  3QKY A;  5A23 A;  2J4D A;  3CVU A;  2YHS A;  1EDU A;  4PS8 A;  4GA2 A;  4U5F E;  2QY7 A;  3L6A A;  3NQP A;  3JT1 A;  4C3D A;  3D9P A;  4V3I A;  4A1S A;  5BW8 C;  3TJP A;  4G11 A;  1IQR A;  4A55 A;  3P2B A;  3RO2 A;  4KVO A;  2RD0 A;  2R7V A;  1JPN A;  4JZA A;  1E8X A;  1ELR A;  2V8S E;  4O79 A;  1UN9 A;  2X3M A;  3G2U A;  2WPV A;  4GMJ A;  4BT9 A;  4Q69 A;  1HG2 A;  5CCL A;  1HF8 A;  5E76 A;  1HXI A;  3O6X A;  3P1U A;  2JLB A;  1ZHT A;  1HE8 A;  1DVP A;  2XCC A;  1E7U A;  3UUX A;  2OOE A;  4M3O A;  5AYW D;  4DVZ A;  5FQ4 A;  3TAX A;  1V54 C;  3SD5 A;  3K7D A;  2IXM A;  1OWL A;  2WXF A;  1D1C A;  5KYY B;  3FH7 A;  4AY6 A;  3Q7L A;  4O6M A;  5L3Q A;  1MNE A;  1Z5Z A;  4PS7 A;  4IJJ A;  4LCT A;  3RKO F;  2WMO A;  4PJN A;  4U63 A;  3EZI A;  4GA1 A;  3CVQ A;  4I6J A;  3DPD A;  2KCV A;  5F5H A;  4H7Y A;  3OXG A;  3ZXS A;  2BF0 X;  3LS8 A;  1VYK A;  2PQR A;  2AXZ A;  4I2W A;  2WVO A;  4GU5 A;  1FTS A;  4CEM A;  5JJ6 A;  4KBL A;  2J45 A;  3DXJ F;  4JC8 A;  3Q49 B;  3PE4 A;  3RIB A;  2PQN A;  3E9V A;  1IW7 F;  1U3D A;  3HLZ A;  4Q4Z F;  4BTA A;  3CSK A;  1E90 A;  2C03 A;  2V5F A;  2VGX A;  3CK8 A;  4CDR A;  1ZYR F;  5KYW B;  3LES A;  1OWP A;  1ZHW A;  3Q47 B;  1OWO A;  3FDH A;  4EQF A;  2A6E F;  2IXO A;  3D3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...