3EHMA

Structure of bt1043
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
510
structure length
510
Chain Sequence
b'PLKYGARFMNMQQRVIPIGSPSLTTGPGNDLQNTDLISSGNYIGYFGNNNNWGFNNEANWNFTDSRMNYAYQNFYSQIFLPWNEIYEIAKDSDSPSEQAILEIANIVRNIAWLRATDVFGPIAYNSAGDGSIAPKFDSQEVVYRSMLADLSKSVELLNTISYSVMAQYDLIYNGNVQNWVKLANSLMLRIVVRVHFIDETLAKEYITKALDPKNGGVIEDISSEAKIKSSDKMPLLNSMLASVNEYNETRMGATIWGYLDGYKDPRLSAYFTEGTYGSGSWAQTGYFPVAPTNSKSKSETSYSAKFASRPKVDSNSPLYWFRASETYFLKAEAALYNLIGGDPKTFYEQGINISFQEQGVSGVATYLSGTGKPTGLTGSNYKYGTYNHDLSIGNTSPKWDDYTGNLSKQEEQLQKIITQKYLALYPNAVEAWTEYRRTGFPYLMKPMDEAAPGRIGASIEDCRVPERFRFAPTAYNSNPNMAEIPTLLGGGDIGATKLWWVRSNRPKQPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SusD homolog
publication title Structure of a SusD homologue, BT1043, involved in mucin O-glycan utilization in a prominent human gut symbiont.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
total genus 180
structure length 510
sequence length 510
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12741 SusD-like Susd and RagB outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ehmA03
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ehmA01
4MRUA 5FQ4A 5J90A 3P1UA 3MX3A 4L7TA 3JQ0A 3GZSA 3HDXA 5LX8A 3JQ1A 3CKBA 3OTNA 3EJNA 4F53A 5T3RA 5FQ6A 4LERA 3FDHA 3MCXA 3CK7A 5E75A 3CKCA 3I4GA 4Q69A 3L22A 3MYVA 5FQ8A 3SNXA 3CK9A 3IV0A 3CGHA 3QNKA 3EHNA 3JYSA 5FQ7A 4F7AA 3NQPA 3CK8A 3EHMA 3KEZA 3SGHA 5E76A 3LEWA 4PUCA 5T4YA
chains in the Genus database with same CATH superfamily
2BKKB 5C2YA 2XENA 4ANVA 2VSOE 2PQRA 1U89A 3B0VC 3U66A 2R02A 3SZ7A 3EPVA 5CHEE 3RAUA 3HXFA 2YHCA 4GZCA 3V2OA 2J8SD 4JTAB 3UT8A 4DI3A 5DLJA 4M3OA 3UI2A 4CCAA 2GRQB 1E7UA 3O6XA 2E0IA 3HXCA 1NU9C 5CEDB 1GM5A 3ABLC 3O39A 5CRVA 2AJAA 2P9PG 3RIBA 3K1HA 3PH0C 1LM3B 1Q0GA 3SQVA 4JIOA 1NZEA 4I3MA 3L54A 1T6UA 5E3CA 2KCLA 3UQ3A 1G4WR 4PFPA 3B0PA 5GPGB 2I6HA 2IQCA 1NFNA 1QKRA 1BD8A 2P58C 5A6BA 5KJKA 2ZXRA 1ORSC 3C3QA 3OXGA 3T6JA 3UNGC 1U0BB 1S7ZA 1LIHA 3CSKA 5CIVA 5CCMA 1V74B 2KBXA 2VGXB 2VSXE 2IXMA 3R9MA 2IOQA 3GZ1A 3FMSA 1OCRE 3IEGA 3MA5A 4O6FA 5AARA 2YLIA 4JEHA 4U5CE 1VYKA 1EKYA 5HS0A 3O4ZA 3N24A 3SNXA 4ATZD 2RSEB 5CEAA 3QZCA 2VTBA 3CHOA 4C0EA 3EHNA 2XLOA 3S2AA 3JYHA 2XLEA 5FTPA 4ZLCA 3KL4A 5T8IA 2OQMA 1R5ID 3SY2A 4YT2A 4EECA 1EA8A 3AJMA 3CKCA 4XTKA 4WNGA 5KYNA 2V3CC 2JEKA 3AQBA 2MRIA 1ELRA 3U3WA 1OCZE 4Z9HA 2EIMC 4N3CA 3LNRA 4JXTA 5BT1A 1NBBA 1HZ4A 1YA9A 3SBSA 4XPYA 5L3QA 1OT8A 1YMPA 4M7CA 2Y1LE 4Q96A 3QMKA 1SQMA 4PK4A 1ZHZA 2NYJA 4EBJA 4TXPA 1O5HA 2PFDA 3FTUA 4DX5D 3M1CB 2FGYA 3RFYA 4J0UA 4BEPA 2QC9A 2GAQA 2WZFA 2R7SA 3RW0A 1D8EA 1WAO1 2DYRE 3SNHA 1FNTc 3SO8A 3TG5A 3EGXB 3DBSA 2W45A 3CIAA 3HNJA 5LFAA 4E6HA 4HXIA 4WUYA 1Z6AA 4LSZE 1ZBPA 4E7SA 3LKUA 2DZNA 5D0QD 3ZIMA 3Q7GA 1JUQA 1WDYA 4QQIA 3CHMA 2CHWA 3Q7AA 2EIJC 4PJMA 3W8HA 1V55E 4ZHBA 4DVZA 3ZUVB 3UM2A 1C02A 2IJGX 2QY7A 3TWQA 1UN8A 4LEUA 3AGTA 1FVHA 2P9LG 3T8KA 3T9KA 4C3DA 5KWDA 5AQAA 1TR4A 4G7ZF 3U64A 1O87A 1HY5A 1TNBA 3NOGD 4TRQA 1ELWA 5BQIA 1OCCE 3L13A 5BW8C 1Z7Qc 5L0CA 3PEVB 4GU5A 3TQOA 3LJNA 3EGDB 2YLGA 5BV1A 3FUJA 2J9UA 3DJNB 4HFKB 2IONA 2HSQA 3FEXA 2OOEA 1E85A 4NTFA 3Q9NC 3ULEG 4A3VA 1AP7A 3PS6A 4GTRA 3GM2A 3HIZA 1BU9A 4L9PA 3MKQB 4AM9A 1H7IA 3FOPA 4Q5SF 1H6PA 2EINC 4MVSA 1KU2A 3CVLA 3LAYA 5EDSA 4YVOA 2LSVA 4J8DA 1TYQG 2E2EA 5DS6A 4PH4B 2ZGDA 2ZXWC 4UWFA 1LKXA 5K0IA 2XXAA 3K7DA 2YL0A 1ZU4A 3F6QA 4UQYA 3E37A 3IQTA 5LCWJ 4CS8A 5B3SC 4HI9A 1MX4A 2IU1A 1M2VA 3L8IA 1DCQA 3SD5A 5ENRD 5F28E 2KC7A 1U2VG 2IY0C 3D9NA 4HLEA 4U5BE 2PQNA 2H6HA 2DZOA 2E87A 3EZHA 4KBLA 2FI7A 4ULWA 1VLTA 3L08A 2X51A 1P5QA 1WM5A 1TWAA 4JPSA 2B0OE 4N5QA 1WY6A 2CCYA 4KNVA 2XPZA 1Z63A 4YT5A 1DNPA 2YQ8A 3EU5A 3JTLO 4G23A 3U9WA 4BPMA 2A4ZA 4YK5A 1APCA 4Z68A 1JRAA 3FDHA 5EGYA 2BF0X 2J49A 3GEEA 3UMKA 3HRAA 1JAFA 4BTBA 4FU3A 3ULYA 3J5PA 2QUPA 2L81A 2QFCA 5KYYB 3VRCA 4XEFA 4CIHA 2JD3A 2EILC 4CDAA 2VQ2A 4B93B 1M57C 4N6HA 1DCEA 1JCSA 1ZW3A 2L9JA 5L0FA 4ANJA 2R7XA 5EYPF 2A0BA 1OXKA 3ITFA 4C3EA 5B1AC 1S63A 4AJWA 1T9KA 4EIYA 2A5UA 2IYLD 3ML8A 3TWXA 3ENEA 5BNWA 4FLBA 3ZXSA 2KZTB 3FU5A 4TV3A 3QARA 4GTOA 2CW0F 2L0TB 3IPMO 5EIBE 1A17A 4YL3A 3OXFA 3CVPA 4GA2A 2J0XA 5HRYA 1LI7A 2PP4A 1N52A 4C9BB 4JHJA 1MQSA 2VGXA 3GORA 4DBRA 4IULA 1H2UA 5JJ7A 3TWTA 3GEHA 3QAQA 3RKVA 5T3TA 3RQEA 3QNKA 1Q0KA 4K5BA 4CZ2D 4BT8A 3RF3A 4UWLA 3HLZA 4LUNU 4CT0A 1E90A 2WZLA 2XRYA 2MHRA 3SBTB 1UW4B 2R03A 1OWMA 3SP1A 3C72A 1CGNA 3B0UX 3DEOA 3QW0A 3ASNC 4HFFB 3ABKE 3Q15A 3B95A 4I17A 4KMOA 1SZ9A 4WWNA 2EPOA 4U96D 2LIGA 4WWPA 1NLXA 2OVBA 4LLCA 3AU4A 4AY5A 4J7TA 1QZ2A 2J09A 1JWGA 1C03A 3L17A 1N4PA 2KATA 2EPMX 1A5EA 3PUJA 4UDVA 1HW1A 3WG7C 4OVUA 4DX6D 3FY4A 4RQIA 4GPMA 4ILGA 3QWWA 2LQGA 3ML9A 3AG4C 3SI5A 3G50A 3AG3C 4BX8A 3FTSA 1OW7A 4I6EA 3ZHEB 4PJLA 4IARA 2VJ8A 3SXKA 3NF1A 3U4TA 1Z3XA 2DYSE 4NRHB 2GW1A 1ORYA 3V2XA 1JR8A 4BJ6C 1D0ZA 2ZXOA 3ECSA 2RD9A 3EGXA 1U3CA 2I15A 4DVYP 2UY1B 3DRAA 3PMRA 3TWUA 3JRMO 3CK7A 2IXOA 4JZAA 5FCLA 3U5SA 2DGJA 4L2YA 2IO3C 2JABA 5J08A 3FEYA 3NRHA 1HE1A 2YL1A 3O10A 1IHGA 4P9FA 3L0IA 3EIJA 2TMVP 3APDA 4N2SA 3RIPA 3VTXA 4HOSA 1ZHTA 3UMIA 5D92A 5FJYA 2A69F 4ZLDA 3L1MA 2R59A 1H2TC 2X6FA 4J8YA 3RQFA 3EQLF 2AWYA 3FUFA 4GTSA 3Q78A 4CSAC 2WXJA 3K66A 2WXHA 3RSEG 4C48B 2ETSA 4J7WA 3C7JA 2Q4FA 1EPUA 3NG1A 4U5DE 3W9FA 4XWJA 4E85A 2GA0A 4UWGA 4DLQA 1QQEA 3TOMA 2BUGA 3Q4AB 3QVYA 3PCVA 3KEZA 1ORJA 1MMNA 1QSPA 3Q9UC 2Y3GA 2XSEA 2Y3AA 4BEJA 3B7BA 3MFNA 3ZG1A 1NI1A 3Q47B 4GA0A 1MNDA 2RKKA 4PACA 3MKQA 2P61A 3IKOB 3VTYA 2WVIA 3AG1C 3NZSA 4CYMD 3I5PA 2GRPB 3ZQYA 1QYMA 4WJ0A 1LVKA 2NC9A 4MW3A 2P9SG 5L0JA 3NYLA 4QI0A 3H65A 1Z3YA 2XL6A 4L7TA 1INZA 5EHHA 1K05A 5KYUB 1PY1A 1DOWA 2L6GA 3DD7A 4O6MA 1QZXA 3UGPA 1NFIE 3MLGA 4IN3B 2IOLA 2NG1A 2HE0A 4DX7D 2IXNA 2PL2A 4GTTA 5FT9A 4XEIG 2I8BA 1KT0A 2HKVA 2M64A 4BJTA 2WQHA 3E9VA 5L3VA 2J0WA 3NOCD 3AG2C 2IBFA 3DSXA 3I3NA 4I6JA 4WAFA 1AVOB 4DRXE 3IBEA 1A41A 1TJCA 3DE8A 4P29A 3LDZA 3U2LA 3BEEA 5DIZA 2LD6A 2AXVA 2LSUA 4U5EE 1Z6TA 4RG9A 3CHPA 2WQ6A 3CQCB 4HRMB 1MMDA 3AJIA 2HFIA 2JX0A 4ATGA 2LFDA 3L8JA 1ZYRF 1PC2A 4XE0A 3FTYA 1MNEA 1H2VC 1LPEA 3ZIBA 3LJ3A 3U3BA 4TXRA 5CMWA 2RD0A 2YNQA 4RVBA 4F1SA 5KYYA 1VK5A 4MTFA 4MLPA 1JPJA 3KH2A 2XS8A 1QPUA 3SYNA 4FHKA 4KVMA 3ZNGA 2MWQA 4FHJA 3CVVA 2IM8A 2LXLA 2B6CA 3JCKC 2KCKA 2WXQA 1VB5A 5L0HA 2GDCA 3IHYA 5CCLA 1RJ9A 2L6FA 4UI9C 1J8MF 1VTMP 3CVYA 1K8KG 3J5QB 2XM4A 4RD9A 3L34A 4Y6WA 3U9MA 2KZTA 1AUEA 1FTSA 1K40A 2EPLX 3NYJA 2V0PA 5A6BD 1A0BA 3LEVA 5AC4A 3G2TA 3TWVA 4U07A 3S7BA 5T1DB 2A68F 5KYWB 4K5AB 4J30B 2OCCC 3RVYA 3JSZA 2XL4A 1O1SA 2QYJA 2UUIA 4D4NA 5A69A 1OWOA 2NUPB 1BR2A 2LNIA 3MGBA 1UJKA 2CHXA 1OWNA 2J08A 4HOQA 3X2QC 5D91A 1I4YA 4BEMJ 2DB4A 4JEAA 4KNWA 2YL7A 5A6CA 4Q7CA 4EHMA 1O3UA 3ESKA 1Q2ZA 5CBNA 2CYDA 4GQHA 4O79A 2AVPA 3I5QA 5AIJA 4MVRA 4J8SA 4FWVA 2Y4TA 4U8HA 1Z23A 3FOOA 4DUIA 3FAPB 4JRZA 4FX5A 5HV9A 3PREA 4H7XA 3S84A 5G04J 2YWAA 1HX8A 4LNGA 5EX3A 4BERA 5ENPD 4KYOB 1BR4A 2FFHA 1WATA 1UG3A 2AWCA 2F37A 3JQ0A 3HJCA 3ZU7B 4BFRA 4ULVA 3PE4A 4OVVA 1VLSA 4ANWA 1BZ4A 2ETAA 4AXHA 3EH2A 3Q6MA 3B9QA 3Q49B 4B6IA 4Y6CA 4J8FA 3S7FA 1FFTC 3RU0A 3FHDA 1RKEA 2XEEA 1L3PA 1BI8B 1A7VA 1TFOB 2ETCA 3HVEB 5L0DA 2ZISA 4JE9A 3R7CA 4A1GA 5LX8A 3EFOA 5LCWC 1WN0A 1TFKB 4NQ0A 2L6JA 3UT7A 3TAXA 4U0ZA 4BSXA 3DM5A 4BSZB 5G05C 4A3TA 2UY1A 2J4BA 1V54C 1QNFA 4OIRF 3Q7FA 3VLDA 5FZQA 1NA0A 4XEVA 1NFOA 4I2ZA 3DM9B 4XLNF 4W8KA 2KJGA 4LNBA 3L6AA 2RFAA 1Y8MA 2J9VA 3NMKA 3FUMA 2GRMA 2AXZA 3HNKA 2Y4UA 1YYJA 1DVPA 5JA4D 2GROB 2KQ9A 5FQ8A 3BG1B 4X8QA 3JZ0A 2GWWA 1FCHA 4F7AA 4JHRA 4GA1A 4GYWA 3EG9B 3ABLE 1R4TA 2Y39A 4GTVA 4B8CB 3ZYQA 5KCMA 4HLLA 1ZZPA 4U5HA 3T5VA 4QFVA 1YARO 1ZHWA 2J07A 4ANXA 3CVNA 2R17C 3M4BA 1H9GA 3JYSA 1K04A 3FAJA 2B0JA 3PZ1A 4PDXA 2Y69C 1IQUA 4I1AA 3BEHA 4APFA 2D4UA 3AAAC 4I9EA 3S9OA 2OU6A 3G2SA 1LE2A 2LP4A 3TULA 3M79A 1IYGA 3E32A 4AE4A 2LO6A 4KZ0A 3N0TA 1SVXA 3ASFA 1D1CA 4G2VA 5ARGA 1AWCB 4NIKA 3NKDA 3MBGA 2KNHA 1NL4A 2W4BA 2XHEA 3FUKA 1ELKA 5KNGA 2X6JA 2EIME 2VGEA 3MEKA 5B1BC 4JA9A 2Q3TA 3KAEA 3PHF2 3GANA 3GWLA 1OXJA 3JT1A 3LCAA 2WXIA 5E76A 2J45A 2WVOA 5DS4A 2RG8A 1W2WA 4HE8D 2WXNA 3DMDA 3B29A 3V79K 3KYIA 4JHKA 3U0CA 3D9OA 3ZWIA 1XGWA 4MW8A 1OR3A 2XLHA 5FQ6A 4IGGA 4XI9A 2OEVA 3QKYA 4C0MA 4HS2A 1HF8A 3T6BA 4PFOA 1FR0A 2WXGA 1BBHA 4GZ5A 2J7PD 2ZD9A 3Q6NA 3DWLG 1TKNA 4CDMA 3H2VA 2NUTA 3EIQC 1SF8A 2FAPB 1X5BA 2EIJE 4G25A 3AU5A 4CGVA 3PNTB 2PBEA 4DLOA 1T6QA 4TUUA 1LS1A 4DXWA 3FTZA 4G1TA 5LP0A 1GQAA 3G2UA 3LUTB 4U95D 4YT4A 1NA3A 5CI8A 1VMAA 1L7CA 2IFUA 1SZAA 2BTDA 4C7OB 5EYLA 4LLEA 5AQBA 4CT4A 4JURI 4EKWA 3FTVA 2WB7A 2H6GA 5JJ6A 4MBGA 3LEWA 2A6EF 5AENA 4CS7A 4U7EB 1BI7B 4LNUD 2P0NA 3PNLB 4A4AA 3HNIA 3IHVA 5ANRA 1WTYA 1VOMA 4JJFA 4HI8A 5EIDA 3HG0D 3C8GB 2JLBA 2L9BA 2EQXA 4EBAG 3JXJA 2QNLA 3IQ5A 1E83A 2Q7FA 1LD7A 1OKKD 3B13A 3LS1A 4A1SA 2G3KA 2HJ3A 5F5FA 2G3VA 3QWVA 4U0UA 4GMJA 3TJ5A 4JTDB 3A9CA 3FH7A 5IY5C 2ASRA 3CK8A 3WHNA 4B89A 3MYFA 3TJ6A 4JVSA 4W9RA 4UUCA 1TWGA 5JS5A 3S29A 2EINE 5JMND 3WXXA 3ABMC 4RDAA 1TN7A 2CG3A 1ZHYA 2X6HA 1HMOA 3AS8A 2GRRB 3TGOA 2ZXWE 2MOWA 3TD7A 2C2LA 4N3AA 2J7PA 3RVZA 2EIKC 2I9CA 4FADA 4PJJA 3EUVA 3V7OA 2L6BA 3AOUA 3TK0A 4DJ9A 2C0LA 3MYIA 5B3SE 4OAVB 2MYSA 5A23A 4WNEA 3K6BA 1WG0A 3EHRA 3FDQA 3M15A 1RZ4A 5JUAA 2ZIRA 4DRJB 3FFLA 1HW2A 1H0AA 4G78A 2VB6A 5EN5D 3UXGA 3ONLA 3HVEA 3Q75A 3ASOC 3APFA 3DJUB 3B7RL 4AL0A 3CK9A 2MHKA 5JRAA 3ZYMA 2Q00A 4GZ3A 1HS6A 2X0CA 3PE3A 2KXPC 3TXNA 2H6FA 4EZKA 1OCOC 1OKKA 4A2NB 4HBDA 3LJBA 4FLHA 3GYZA 1N9AA 3IHUA 1N1CA 1YVIA 1E86A 4D4XA 3IEEA 3TG4A 4GAAA 3GWNA 3VM6A 3W4YA 4GCOA 2OKUA 3D9HA 1TNYA 3M4CA 2OJQA 2EILE 3DXKG 4EUKB 1KZPA 3GODA 2R7QA 3W8IA 2DVWA 4TXQA 3V31A 4JC8A 4F6RD 1HO8A 4CDRA 3B71A 4MTOA 4CSAA 2PNNA 4A63B 3RO2A 1EF1C 3ZVVA 3K33A 3POVA 3EG9A 3UM1A 5B1AE 3T4RA 4CS9C 3PDMP 1HH8A 2LCHA 1OWLA 4EZJA 4YL0A 2LXMA 1Q0DA 3ZTZA 4N5CA 3Q79A 4UQZA 1FMWA 4N6CA 4CDNA 4MNDA 1MYOA 4ONSA 1FPPA 2Y3BA 3LS8A 4J7YA 1JOGA 4BG0A 3FHEA 3C63A 2WVNA 4UI9K 4GYOA 1NU7D 3PZDA 3LYAA 5AN8A 4GTPA 4NCQA 1ZB1A 1TJFA 2A1DD 1FT2A 3FUHA 3LPZA 3UGOA 3LESA 2WM9A 3CEXA 2WQ7A 3GM1A 3PEUB 3KPHA 2DCPA 5H7PA 1ZU2A 4XEKA 4Q4ZF 3NQPA 3B7UX 4OINF 3Q7LA 2CNWD 1RW2A 4I1MA 5AGFA 1HG5A 3E33A 4I43A 3FU3A 3ASNE 5FZRA 4U5FE 2AU5A 2X6IA 5E2QA 2J46A 4HNAD 3OTNA 4DX1A 2A6HF 4JCZA 3OAWA 3A11A 1H6KA 1ZW2A 1Z3IX 4I44A 2XRZA 2ILRA 3U2MA 4E7ZA 1SW6A 3WG7E 3DXMG 1WASA 4CJOA 2G62A 2W4MA 1YA7O 3EGDA 4E17A 2V5QC 3URZA 1C17M 4WNFA 4EBAA 5JP7A 3KKBA 5BXOA 3NYMA 5L0IA 3L9TA 4R32A 3AG4E 1N94A 3AG3E 1KTMA 4XI0A 3SF4A 5CRUA 1ZVZA 2NXPA 1GW6A 4JKVA 1IHBA 1HE8A 4NURA 2HV6A 2KCVA 3MV3B 1D1AA 5EK0A 4HRNA 3QK0A 1N0RA 2OEWA 4I2WA 2R7RA 1OW8A 4FJYA 3S28A 4ACLA 2UUHA 1OW6A 1D1BA 5JVEA 1V4AA 1EQ1A 1O1TA 4GYYA 4XPWA 5T3WA 3G4XA 4JA7A 2CNWA 4L23A 3D9KA 2KC3A 1FVFA 1LS4A 2XEHA 5E33A 2A5EA 1H19A 5CBOA 3WAQA 2QE9A 4G11A 4URKA 2BKGA 3CQZA 3D9IA 5EX0A 1S0PA 3L82A 1MMGA 5EKQD 4WABA 2V5FA 4N3BA 1Q0MA 2M4EA 1M56C 3RO3A 4GPKA 2HR2A 2KM4A 3L22A 3R7QA 4F4BA 3MYVA 5L0GA 4F1PA 3C8GA 5KJNA 5JLIA 4UQXA 3LEOA 1YDIA 4YDYA 1CGME 4XIFA 5KJLA 4HEAJ 2XZDG 3SGHA 4N4WA 3FP3A 4J32B 4PR9A 3FU0A 1GS9A 5HKPA 3ZKJA 3W9GA 5FWQA 4AV7A 2J9QA 4DRIB 1JCRA 256BA 1T01A 2LFFA 3ZVRA 3AG1E 4TUMA 4F53A 3D9JA 4YVQC 4R7LA 3RRUA 1B68A 2R2LA 3UINC 3LS0A 2BL2A 4O6NA 3VAYA 1XWJA 2KK1A 3S0XA 2PX3A 4BESA 1T6IA 4HOUA 2VH3A 1Y6DA 3K1IC 2LUHA 4NTAA 1SMYF 2R25A 3EHMA 3EZIA 3BG0B 3APCA 2GGFA 2WZGA 2FBNA 2H8AA 3ISMC 4O7GA 3FXHA 3TJPA 4DJAA 4U04A 1M2OA 1BPOA 4F3VA 3ATPA 4A55A 3QVZA 1QBQA 3PVLA 4J8EA 1LF8A 4HQDA 3LY7A 5BUZA 2VCAA 3KYJA 2V26A 3U9JA 4G7HF 3OXLA 1M2VB 4YDOA 3AG2E 3JCUQ 3UPVA 2HV7A 1HE9A 1XNFA 3MV2B 3ASHA 2R7WA 3FTWA 1HMDA 3GW4A 2WMNA 5KJMA 2L0IA 4K5CA 2VGYA 3JSEO 1IQRA 3SXZA 2OEXA 3TOLA 3WODF 3NKEA 3HXEA 3VLEA 1OCRC 3VYWA 3F47A 2OG2A 4GB9A 2XLMA 2CFZA 3QWPA 1OR2A 2I1KA 4IYPA 4OIOF 1TNUA 4KXKB 4FESA 3EHQA 4LG6A 3UKRG 4RSYA 3I4UA 2WXPA 3V30A 3OA1A 4AVXA 2V4HC 5BUOA 3AS5A 3JXIA 2J9WA 2QTVA 2O9XA 3O48A 1TNOA 4BWRA 4YNDA 2AWIA 1UG7A 4E0HA 1CPRA 1EDUA 2ICWG 5FZSA 1XZQA 3SXMA 5AJLA 5BXUA 4OD5A 4MS6A 1OCZC 2C03A 1NZNA 1MMAA 2VASA 2ZPAA 3PDNA 1G8XA 2F8YA 2J9BA 4AX2A 3HYMB 4YWQA 1CGOA 1KNYA 3ZHEA 5COFA 5J90A 2OCCE 2XRHA 2ZU6B 4O1PA 2P1AA 4K7BA 5DBKA 1TR2A 3FH5A 1YZCA 5T3RA 3SXYA 3DSSA 5ITZF 1MX6A 4FA6A 3TXMA 2F22A 3X2QE 4APOA 1N4SA 4CDYA 3PZ3A 2XGOA 2D5RB 2DYRC 2CFUA 4BJ5C 3AS4A 2YL3A 3F46A 4ME2A 2XLWA 4EZLA 4GYTA 2IF4A 3V5YA 2CHZA 1GGQA 3SFXA 2XL8A 5A6AA 1Z5SC 5ENNA 1G3NB 2BEDA 2XPIA 4YDWA 2WXFA 1OUVA 3BUAA 3ZEFA 3UMHA 1AEPA 4XKBA 2KGOA 4I1OB 3FH8A 2F0YA 2X3MA 2HS5A 4AOFA 1V55C 2HSBA 1D9SA 4MTGA 1Z5ZA 1WOLA 2AW6A 4U8YD 2C0MA 4KVOA 2P9NG 3FULA 4H7YA 1N4QA 1JPNA 4AEZC 3ZYKA 4H4KC 4IRUA 2HMZA 3E70C 2V8SE 1K1AA 1B89A 4AK9A 4JL0A 1TWCA 3JQ1A 1O5MA 1OCCC 2PX0A 1XZPA 1MX2A 3Q73A 2OOCA 2P7VA 5A7DB 4JTCB 2F8XK 3DSVA 1BLXB 2P9KG 3D3MA 2NPUA 1MJ0A 4FAPB 1SR2A 4JJGA 4AL1A 1RKCA 1T5OA 2YINA 2LK4A 4K1OA 5A6JA 3EU9A 2QZAA 1TQGA 3MX3A 3DAFA 2L7AA 1QQ3A 2FF4A 2IOSA 2IO2C 2WXLA 3SEOA 3RRMB 3L16A 3MCXA 4N06A 3LVQE 3QB2A 4Q69A 1UN9A 3C18A 1V54E 4UI9J 4RG6A 4EHPA 3G2VA 1KZOA 3CHRA 3ZN3A 4IAOA 5CI9A 1KT1A 5KYUA 2FO7A 4DPRA 3UUXA 4E18A 3W2VA 2R7VA 2CG2A 4OIPF 5M72A 2XEVA 3QOUA 1KPSB 3US6A 1MHQA 3QW1A 3QJZA 3S7DA 3RJVA 3HXBA 5BV0A 4ILIA 3DPDA 4U8VD 4I6GA 3RKOF 5E3AA 4LDKA 1PD1A 2PM7A 4LACB 1LTXA 5HI7A 1BDJB 1S70B 5BQGA 2X6KA 5KNHD 3TWWA 4CDVA 3FUDA 3OEOA 3HHMA 3X1OA 2R9RB 3LLIA 3Q5MA 3PUKA 2WXOA 4ILHB 1FT1A 3FUEA 1FAPB 4CRWA 2Y0BG 4WWOA 3U8PA 2QYUA 1YAUO 5CMYA 2FO1E 1LI5A 3O55A 4NACA 4B8AA 2WPVA 4XQ1A 3QC1A 3UM3A 4L6RA 2YZSA 3UX4A 3DEPA 2BC5A 4DOZA 4NTBA 3KD7A 1S05A 5AJDA 3CGHA 2I1JA 2Y69E 5KBAA 3DPYA 2X38A 3NBNB 1UFBA 4MVUA 4UWKA 3HTKC 4NC3A 5EILA 5C1DA 1A7EA 3HKKA 4L2LA 4D10C 4P6IC 2OJED 1E8ZA 3B7SA 2YKZA 3UKUG 3MJWA 4U9EA 5FQ4A 1VDYA 4K0RA 3CVXA 3UMVA 4O60A 4O6YA 1ZHXA 4Q94A 1E2XA 1LE4A 4CBEA 2YQYA 4MVOA 1SA4A 4JW1A 4MVQA 5COMA 4OIQF 3SFZA 3GZ2A 2ETBA 3C8ZA 5HSWA 5FQ7A 3G4ZA 3KMIA 3CEQA 5KYWA 4FULA 3C3OA 5DQTA 5ENQD 4MRUA 2NUPA 1D0YA 4G26A 5LOZA 2P9UG 5B1BE 3W2WA 1HG2A 2XQ0A 4U5GA 2IEJA 1A7DA 1E8WA 2WXMA 3FU6A 4XKCA 4XPXA 5G05J 2DBAA 5BQHA 3T8MA 2WL8A 1HU3A 2J4DA 5FZTA 4G8LA 3FUNA 3V5ZA 2DWZA 1N4RA 2V4LA 2Q9AA 2XCBA 3RQGA 1LD8A 1K3ZD 3CHQA 4EPZA 3CR3A 2AP3A 1I5NA 4DI4A 3TWRA 4CIPA 3J06A 4NY3A 4O1OA 2YVKA 1HXIA 1E7VA 3OWTA 2VCBA 2DIWA 5ENTD 2GRNB 3VF0A 4P9TA 2B0HA 2HYZA 2XLDA 2XGSA 3ULQA 2H7VC 3ABKC 3IQ6A 3H2UA 1PCXA 1IXVA 1OY3D 4Z9IA 1NG1A 2RFMA 3NMJA 3JUEA 1WWPA 3D9LA 4LDQA 5JT4A 4JD2G 2Q7RA 4CS9A 3D9PA 1N0QA 2M63A 5BPPA 4MVMA 1E8XA 1OXBA 5KYXB 1Y4CA 3K9IA 3R7RA 4JZYA 3SFYA 2UWJG 4GCNA 4U63A 3CAXA 3CVWA 1RJ9B 2J8WA 4CS8C 3P2BA 5G2NA 4C3BA 4N39A 3RRNB 2OV8A 5A6KA 4MKTA 4BJ6A 3S7JA 3NDBB 5G55A 1TEZA 3E34A 2Q9CA 3G2WA 2R7TA 5JHBA 2CGEA 2OVFA 3HXDA 3C3RA 2XPYA 1E84A 3FVYA 3PZ2A 4BX9A 2DYSC 3C5RA 4OAUC 1YA0A 4BJ1A 1D8DA 2Q9BA 4WGYA 2NSFA 3CV0A 2XLVA 3ZW3A 3D9MA 3ZXPA 2VSNA 4LERA 4PS8A 2R7OA 3FUIA 2YRFA 2XCCA 4CX9A 2YEVA 4G0HA 3BQOA 3ASDA 5ENOD 4X0RA 5IY5E 4HORA 2YHEA 4JC7A 1VYIA 4IWBA 1Y6IA 3S90A 4PS7A 4KT6B 3ABME 4K03A 3I4RB 3C62A 3LNMB 4DRHB 5JJTA 3ZGQA 4U9DA 4YL1A 2KYHA 1S64A 2EIKE 4KC9A 1PD0A 1HFAA 5D2MC 1UOHA 2WXRA 1O1RA 3ZRHA 4HB5A 3KS2A 4IB4A 4YT8A 4GZDA 4MQ9F 2WVQA 1YYXA 4ANUA 4MVZA 4CJGA 4HRLA 3NMIA 3EH1A 3S27A 3SZRA 4JB8P 5D66A 4BT9A 2VC9A 3JYYA 3NZUA 4WGZA 4JCHA 1SZIA 3ASOE 4FC8A 1YZAA 4JEBA 3DSTA 4HVBA 1RKEB 2XZTG 1YYHA 1FMVA 3E30A 2LAIA 2ONDA 1RCPA 1TWHA 4EBBA 5FIOA 4GMRA 2VYIA 3JRTA 3FWVA 4GTMA 1OCOE 4WNDA 3UIOC 3EFOB 4M63A 1PV3A 1U6HA 3R9AB 4I9CA 5T4YA 5DQZA 3PZ4A 1RXQA 4GEHA 2L6HA 1JMWA 3QDNA 2VTBB 1NSGB 3E4BA 1IZMA 3U8VA 4XLPF 4NQFA 5JHAA 3PRZA 1MZCA 4QDLA 4CEMA 1DOVA 1BR1A 4BY6A 4HOTA 4V3IA 3GM3A 2I2OA 3DZAA 2BE5F 2Y3HA 2XGMA 2P6VA 1G4US 1RMVA 2FEZA 1N95A 1E96B 5HQ8A 4PJNA 1EI7A 4LCTA 4UWHA 4G8KA 3LXUX 1J8YF 4L1BA 3CZ6A 3MKRA 3C8GD 5G04C 1OWPA 5AAOA 3UT4A 2NSGA 4GTQA 2PM6A 3ZFWA 1WGWA 5JSLA 3UIPC 2HJMA 5DVWA 2XS1A 2Y3DA 3ZTMA 4J6IA 1FFHA 5ARFA 2VCCA 4HFGA 1TN6A 3UM0A 3V5XA 3IV0A 2ZXPA 3CVUA 3LY9A 3T9OA 4RLYA 4AP2A 1JPLA 1W3BA 4G24A 1YCSB 4OYSA 4EQFA 1K1BA 4LRZA 1F1MA 3UTMA 2GRLA 2GFHA 1EYHA 1YLMA 1H6GA 3EJNA 4DK5A 4FP7A 3K1IA 5ENSD 2HM8A 3MZLB 2ZGGA 4LDRA 5D0OD 1TN8A 1G5ZA 3SHFA 1H9TA 3AQCA 3UR3C 3BRJA 3ASGA 2IXPA 3ZQVA 4FJZA 2R5SA 3ONKA 1IW7F 4H54A 2MYOA 4U0SA 5AC5A 1N11A 1PAQA 1CPQA 3KSQA 3IQCA 3LLKA 1KLXA 3DSUA 1JCQA 3P1UA 2HUJA 4AE4B 4C7OA 1H6OA 4KZCA 2EPNA 3CSTA 2LSEA 2CDQA 2VSYA 2HZ8A 2PZIA 3CSFA 4XX5A 3DAGA 4IJJA 5DS5A 4PS3A 3VLFA 3I4GA 3DSWA 2H7BA 5AQ7A 1NP7A 5AQ9A 3T5XA 2P9IG 3RH3A 3N71A 2NSZA 3ZPJA 4ABNA 3DKAA 4RBNA 2C04A 5CECB 2XM0A 5TJ5E 2QY9A 2R05A 1E8YA 4ER9A 3TL5A 3U3FA 1JWFA 2KSFA 4B0ZA 3CQGB 3GZSA 3DWWA 3HNLA 3FTXA 3DXJF 4YJWA 2YLDA 4QI2A 3CLJA 2YHSA 1M6TA 4JEUA 4YN0B 4BETA 5E75A 1SYQA 3EDTB 4AIFA 5COGA 3NB2A 5ANLA 2H6IA 4CGWA 4E0IA 1QVXA 5B3IA 2FULA 4G7OF 3ZSUA 4KBQA 3LY8A 2P2CP 5AYWD 2PF4E 2WMOA 2LAHA 2AVKA 3ZDLA 3ZYLA 2WB2A 2JPUA 3NAWA 1U3DA 2Z15A 4MS2A 2XXAB 4ACKA 1IKND 3RK6A 3JUIA 3KEAA 3LVRE 5CERB 4ZFHA 3T6GB 2R7UA 3ZC4A 2DI3A 1OQCA 2NUTB 3BU8A 4N2QA 1L5JA 3B7TA 4YDEA 5KYXA 1Q0FA 4EBKA 1SA5A 1I4ZA 1N54A 4GZ6A 3N2ZB 1ZU5A 3GEIA 4Z9JA 4GMLA 4AY6A 4B94A 1UJJA 3KSLA 2H7OA 4EWCA 1MQVA 3ESLA 4BTAA 5FINA 2HO1A 2QLAA 1X81A 4OD4A 2WXKA 2A0UA 3C98A 3HDXA 2W9YA 3DE9A 3CKBA 3CVQA 4IAQA 4W8PA 1TNZA 4XZ4A 1D0XA 1DC2A 4K0DA 4BJ5A 3R2PA 2PNOA 4KI2A 3AGUA 3RYLA 3DI5A 4DBQA 2AXUA 3CHSA 3TWSA 1QLEC 1ST6A 3QTHA 2KW3C 1YJGA 5F5HA 2EPKX 3IXEA 4DX2A 2HMQA 4PUCA
chains in the Genus database with same CATH topology
5C2YA 4ANVA 2VSOE 2PQRA 3B0VC 3U66A 3SZ7A 3EPVA 5CHEE 2YHCA 4GZCA 3UT8A 4DI3A 5DLJA 4M3OA 4CCAA 1E7UA 3O6XA 2E0IA 1NU9C 3ABLC 3O39A 3RIBA 3K1HA 3PH0C 1NZEA 4I3MA 3L54A 5E3CA 2KCLA 3UQ3A 4PFPA 3B0PA 2I6HA 2IQCA 2P58C 5KJKA 2ZXRA 3OXGA 3T6JA 3UNGC 1S7ZA 3CSKA 5CCMA 2VGXB 2VSXE 2IXMA 2IOQA 3GZ1A 3IEGA 3MA5A 4O6FA 4JEHA 4U5CE 1VYKA 3O4ZA 3N24A 3SNXA 3QZCA 2VTBA 3CHOA 4C0EA 3EHNA 3S2AA 3JYHA 5FTPA 4ZLCA 3KL4A 5T8IA 4YT2A 4EECA 3CKCA 4XTKA 4WNGA 5KYNA 2V3CC 2JEKA 3AQBA 2MRIA 1ELRA 3U3WA 2EIMC 4N3CA 3LNRA 4JXTA 5BT1A 1HZ4A 3SBSA 5L3QA 4Q96A 3QMKA 1SQMA 4PK4A 1ZHZA 1O5HA 2PFDA 3FTUA 3M1CB 2FGYA 3RFYA 4J0UA 2WZFA 2R7SA 1WAO1 3SNHA 3TG5A 3EGXB 3DBSA 2W45A 3CIAA 5LFAA 4E6HA 4HXIA 4WUYA 1Z6AA 1ZBPA 4E7SA 3LKUA 3ZIMA 5D0QD 3Q7GA 1JUQA 3CHMA 2CHWA 2EIJC 4PJMA 3W8HA 4DVZA 2IJGX 2QY7A 1UN8A 4LEUA 1FVHA 4C3DA 4G7ZF 3U64A 1O87A 4TRQA 1ELWA 3L13A 5BW8C 3PEVB 4GU5A 3EGDB 5BV1A 3FUJA 2J9UA 3DJNB 4HFKB 2IONA 3FEXA 2OOEA 4A3VA 3PS6A 3HIZA 3MKQB 4AM9A 4Q5SF 2EINC 1KU2A 3CVLA 3LAYA 5EDSA 4YVOA 2LSVA 4J8DA 2E2EA 5DS6A 4PH4B 2ZXWC 4UWFA 1LKXA 2XXAA 3K7DA 1ZU4A 4UQYA 5LCWJ 4CS8A 5B3SC 2IU1A 1M2VA 3SD5A 2KC7A 3D9NA 4HLEA 4U5BE 2PQNA 2E87A 3EZHA 4KBLA 2FI7A 4ULWA 3L08A 2X51A 1P5QA 1WM5A 1TWAA 4JPSA 1WY6A 4KNVA 2XPZA 1Z63A 4YT5A 1DNPA 2YQ8A 4G23A 3U9WA 2A4ZA 3FDHA 5EGYA 2BF0X 2J49A 3UMKA 4BTBA 4FU3A 2L81A 2QFCA 5KYYB 4CIHA 2JD3A 2EILC 2VQ2A 1M57C 2L9JA 4ANJA 2R7XA 3ITFA 4C3EA 5B1AC 4AJWA 3ML8A 2A5UA 2IYLD 5BNWA 3ENEA 4FLBA 3ZXSA 2KZTB 3FU5A 4TV3A 3QARA 2CW0F 2L0TB 1A17A 3OXFA 3CVPA 4GA2A 2J0XA 2PP4A 1N52A 4C9BB 4JHJA 1MQSA 2VGXA 4DBRA 4IULA 1H2UA 5JJ7A 3QAQA 3RKVA 5T3TA 3QNKA 4BT8A 4UWLA 3HLZA 4LUNU 4CT0A 1E90A 2WZLA 2XRYA 3SBTB 1UW4B 1OWMA 3SP1A 3B0UX 3ASNC 4HFFB 3Q15A 4I17A 4KMOA 1SZ9A 4WWNA 4WWPA 2OVBA 4LLCA 3AU4A 4AY5A 1QZ2A 2J09A 1JWGA 3L17A 2KATA 3PUJA 3WG7C 4OVUA 3FY4A 4ILGA 3QWWA 3ML9A 3AG4C 3SI5A 4BX8A 3AG3C 3FTSA 4I6EA 3ZHEB 4PJLA 2VJ8A 3NF1A 3U4TA 1Z3XA 4NRHB 2GW1A 4BJ6C 1D0ZA 2ZXOA 3ECSA 3EGXA 1U3CA 4DVYP 2UY1B 3PMRA 3CK7A 2IXOA 4JZAA 5FCLA 4L2YA 2DGJA 5J08A 3FEYA 3NRHA 1IHGA 3L0IA 3EIJA 3APDA 4N2SA 3RIPA 3VTXA 4HOSA 1ZHTA 3UMIA 5D92A 5FJYA 2A69F 4ZLDA 2R59A 1H2TC 2X6FA 3EQLF 3FUFA 4CSAC 2WXJA 3K66A 2WXHA 1EPUA 3NG1A 4U5DE 4XWJA 4E85A 4UWGA 4DLQA 1QQEA 2BUGA 3Q4AB 3KEZA 1MMNA 2Y3GA 2XSEA 2Y3AA 4BEJA 3ZG1A 3Q47B 4GA0A 1MNDA 3VTYA 3MKQA 3IKOB 2WVIA 3AG1C 3NZSA 3I5PA 4WJ0A 1LVKA 2NC9A 3NYLA 4QI0A 3H65A 1Z3YA 4L7TA 1INZA 5EHHA 5KYUB 1PY1A 4O6MA 3DD7A 1QZXA 3UGPA 3MLGA 4IN3B 2IOLA 2NG1A 2IXNA 2PL2A 5FT9A 2I8BA 1KT0A 4BJTA 2WQHA 3E9VA 5L3VA 2J0WA 3AG2C 3I3NA 4I6JA 4WAFA 3IBEA 1TJCA 4P29A 3LDZA 3BEEA 5DIZA 2AXVA 2LSUA 4U5EE 1Z6TA 4RG9A 3CHPA 2WQ6A 3CQCB 1MMDA 4ATGA 1ZYRF 1PC2A 4XE0A 3FTYA 1MNEA 1H2VC 3ZIBA 3LJ3A 5CMWA 2RD0A 2YNQA 4RVBA 4F1SA 5KYYA 1VK5A 4MLPA 1JPJA 3KH2A 4FHKA 3SYNA 4KVMA 2MWQA 4FHJA 3CVVA 3JCKC 2KCKA 2WXQA 3IHYA 5CCLA 1RJ9A 4UI9C 1J8MF 3CVYA 4Y6WA 4RD9A 3L34A 2KZTA 1FTSA 3G2TA 2V0PA 3NYJA 3LEVA 4U07A 3S7BA 5T1DB 2A68F 5KYWB 4J30B 2OCCC 3JSZA 2XL4A 1OWOA 2NUPB 1BR2A 2LNIA 3MGBA 1UJKA 2CHXA 1OWNA 2J08A 4HOQA 3X2QC 5D91A 4KNWA 5A6CA 4Q7CA 3ESKA 4O79A 2AVPA 3I5QA 5AIJA 4J8SA 4FWVA 2Y4TA 4U8HA 1Z23A 4FX5A 3PREA 4H7XA 5G04J 1HX8A 5EX3A 4KYOB 1BR4A 2FFHA 1UG3A 3JQ0A 3HJCA 4BFRA 3PE4A 4OVVA 4ANWA 4AXHA 3EH2A 3Q6MA 3B9QA 3Q49B 4B6IA 4Y6CA 4J8FA 3S7FA 1FFTC 3RU0A 3FHDA 3HVEB 4A1GA 5LX8A 3EFOA 5LCWC 4NQ0A 2L6JA 3UT7A 3TAXA 4U0ZA 4BSXA 3DM5A 5G05C 4A3TA 2UY1A 2J4BA 1V54C 1QNFA 4OIRF 3VLDA 5FZQA 1NA0A 4I2ZA 3DM9B 4XLNF 4W8KA 2KJGA 3L6AA 1Y8MA 2J9VA 3FUMA 2GRMA 2AXZA 2Y4UA 1DVPA 5FQ8A 2KQ9A 3BG1B 1FCHA 4F7AA 4JHRA 4GA1A 4GYWA 3EG9B 2Y39A 4B8CB 3ZYQA 5KCMA 4U5HA 3T5VA 4QFVA 1ZHWA 2J07A 4ANXA 3CVNA 2R17C 3JYSA 3FAJA 2B0JA 4PDXA 2Y69C 1IQUA 4I1AA 4APFA 4I9EA 3G2SA 1IYGA 4AE4A 2LO6A 4KZ0A 3N0TA 3ASFA 1D1CA 4G2VA 5ARGA 3NKDA 2KNHA 2W4BA 2XHEA 3FUKA 1ELKA 2X6JA 3MEKA 5B1BC 4JA9A 2Q3TA 3KAEA 3PHF2 3GANA 3JT1A 3LCAA 2WXIA 2J45A 2WVOA 5DS4A 2RG8A 1W2WA 4HE8D 2WXNA 3DMDA 4JHKA 3D9OA 1XGWA 5FQ6A 4XI9A 3QKYA 4C0MA 4HS2A 1HF8A 3T6BA 4PFOA 2WXGA 4GZ5A 2J7PD 3Q6NA 1TKNA 4CDMA 2NUTA 3EIQC 1SF8A 1X5BA 4G25A 3AU5A 4CGVA 3PNTB 4DLOA 4TUUA 1LS1A 3FTZA 4G1TA 5LP0A 3G2UA 4YT4A 1NA3A 5CI8A 1VMAA 2IFUA 1SZAA 2BTDA 4C7OB 4CT4A 4LLEA 4JURI 3FTVA 2WB7A 5JJ6A 3LEWA 2A6EF 5AENA 4CS7A 3PNLB 3IHVA 5ANRA 1VOMA 4JJFA 2JLBA 2L9BA 2EQXA 4EBAG 2Q7FA 3B13A 1OKKD 3LS1A 4A1SA 2G3KA 5F5FA 2G3VA 3QWVA 4U0UA 4GMJA 3FH7A 5IY5C 3CK8A 4B89A 4JVSA 4W9RA 1TWGA 3S29A 3WXXA 3ABMC 4RDAA 2CG3A 1ZHYA 2X6HA 3AS8A 3TGOA 2MOWA 3TD7A 2C2LA 4N3AA 2J7PA 2I9CA 2EIKC 4FADA 4PJJA 3V7OA 2C0LA 2MYSA 5A23A 4WNEA 3K6BA 3FDQA 3FFLA 1H0AA 2VB6A 3ONLA 3HVEA 3ASOC 3APFA 3DJUB 3B7RL 3CK9A 2MHKA 3ZYMA 4GZ3A 1HS6A 3PE3A 3TXNA 4EZKA 1OCOC 1OKKA 4A2NB 3LJBA 4FLHA 3GYZA 1N1CA 3IEEA 3TG4A 4GAAA 4GCOA 3GODA 2R7QA 3W8IA 4JC8A 1HO8A 4CDRA 4CSAA 3RO2A 1EF1C 3ZVVA 3K33A 3POVA 3EG9A 3T4RA 4CS9C 1HH8A 1OWLA 4EZJA 4N5CA 4UQZA 1FMWA 4CDNA 4MNDA 2Y3BA 3LS8A 4BG0A 3FHEA 2WVNA 4UI9K 4GYOA 1NU7D 3PZDA 3LYAA 1TJFA 2A1DD 3FUHA 3LPZA 3UGOA 3LESA 2WM9A 2WQ7A 3PEUB 2DCPA 1ZU2A 4Q4ZF 3NQPA 3B7UX 4OINF 3Q7LA 2CNWD 4I1MA 1HG5A 4I43A 3FU3A 5FZRA 4U5FE 2X6IA 5E2QA 2J46A 3OTNA 2A6HF 3OAWA 1H6KA 1Z3IX 4I44A 2XRZA 2ILRA 4E7ZA 2G62A 2W4MA 3EGDA 3URZA 4WNFA 4EBAA 3KKBA 3NYMA 4XI0A 3SF4A 2NXPA 1GW6A 1HE8A 4NURA 2HV6A 2KCVA 3MV3B 1D1AA 3QK0A 4I2WA 2R7RA 4FJYA 3S28A 4ACLA 1D1BA 4GYYA 5T3WA 4JA7A 2CNWA 4L23A 3D9KA 1FVFA 5E33A 1H19A 4G11A 4URKA 3CQZA 3D9IA 5EX0A 1S0PA 1MMGA 5EKQD 2V5FA 4N3BA 2M4EA 1M56C 3RO3A 4GPKA 2HR2A 2KM4A 3L22A 3R7QA 4F4BA 3MYVA 5KJNA 4UQXA 4XIFA 5KJLA 4HEAJ 3SGHA 3FP3A 4J32B 3FU0A 5FWQA 4AV7A 2J9QA 3ZVRA 4F53A 3D9JA 4YVQC 4R7LA 3RRUA 3LS0A 4O6NA 3VAYA 3S0XA 2PX3A 4HOUA 2VH3A 3K1IC 1SMYF 3EHMA 3EZIA 3BG0B 3APCA 2GGFA 2WZGA 2FBNA 4O7GA 3TJPA 4DJAA 4U04A 1M2OA 1BPOA 4F3VA 4A55A 3PVLA 4J8EA 1LF8A 3LY7A 5BUZA 2V26A 4G7HF 3OXLA 1M2VB 3JCUQ 3UPVA 2HV7A 1XNFA 3MV2B 3ASHA 2R7WA 3FTWA 3GW4A 2WMNA 5KJMA 2L0IA 2VGYA 1IQRA 3WODF 3NKEA 3VLEA 1OCRC 3VYWA 3F47A 2OG2A 4GB9A 2CFZA 3QWPA 2I1KA 4IYPA 4OIOF 4KXKB 4FESA 4RSYA 3I4UA 2WXPA 3OA1A 4AVXA 5BUOA 3AS5A 2J9WA 2QTVA 2O9XA 3O48A 4BWRA 4YNDA 2AWIA 1EDUA 5FZSA 5AJLA 4OD5A 4MS6A 1OCZC 2C03A 1NZNA 1MMAA 2VASA 2ZPAA 3PDNA 1G8XA 4AX2A 3HYMB 4YWQA 3ZHEA 5J90A 2XRHA 2ZU6B 4K7BA 5DBKA 1TR2A 3FH5A 5T3RA 4FA6A 3TXMA 4APOA 2XGOA 2D5RB 2DYRC 2CFUA 4BJ5C 3AS4A 3F46A 4ME2A 4EZLA 4GYTA 2IF4A 2CHZA 5ENNA 2XPIA 2WXFA 1OUVA 3ZEFA 3UMHA 4XKBA 2KGOA 4I1OB 3FH8A 2X3MA 4AOFA 1V55C 1Z5ZA 2AW6A 2C0MA 4KVOA 3FULA 4AEZC 4H7YA 1JPNA 3ZYKA 4H4KC 4IRUA 3E70C 2V8SE 1B89A 4AK9A 4JL0A 1TWCA 3JQ1A 1OCCC 2PX0A 2P7VA 5A7DB 3D3MA 4JJGA 2YINA 3MX3A 3DAFA 2FF4A 2IOSA 2WXLA 3SEOA 3RRMB 3L16A 3MCXA 4N06A 3LVQE 3QB2A 4Q69A 1UN9A 4UI9J 4RG6A 3G2VA 3ZN3A 3CHRA 4IAOA 5CI9A 1KT1A 5KYUA 2FO7A 4DPRA 3UUXA 3W2VA 2R7VA 2CG2A 4OIPF 5M72A 2XEVA 3QOUA 1MHQA 3QJZA 3S7DA 3RJVA 5BV0A 4ILIA 3DPDA 4I6GA 3RKOF 5E3AA 1PD1A 2PM7A 4LACB 5HI7A 2X6KA 3FUDA 3OEOA 3HHMA 3X1OA 3Q5MA 3LLIA 3PUKA 2WXOA 4ILHB 3FUEA 4CRWA 4WWOA 5CMYA 4NACA 4B8AA 2WPVA 3QC1A 2YZSA 3UX4A 4DOZA 3KD7A 5AJDA 3CGHA 2I1JA 2X38A 4UWKA 3HTKC 5C1DA 4D10C 4L2LA 4P6IC 1E8ZA 3B7SA 3MJWA 5FQ4A 1VDYA 4K0RA 3CVXA 3UMVA 4O6YA 1ZHXA 4Q94A 4CBEA 4JW1A 4OIQF 3SFZA 3GZ2A 5HSWA 5FQ7A 3KMIA 3CEQA 5KYWA 4FULA 5DQTA 4MRUA 2NUPA 1D0YA 4G26A 5LOZA 3W2WA 1HG2A 2XQ0A 4U5GA 2WXMA 1E8WA 4XKCA 3FU6A 5G05J 2DBAA 3T8MA 2WL8A 1HU3A 2J4DA 3FUNA 2V4LA 2Q9AA 2XCBA 3CHQA 4EPZA 3CR3A 4DI4A 4NY3A 1HXIA 1E7VA 3OWTA 2DIWA 2HYZA 2XGSA 3ULQA 2H7VC 3ABKC 1PCXA 1NG1A 3D9LA 4CS9A 3D9PA 5BPPA 2M63A 1E8XA 5KYXB 3K9IA 3R7RA 4JZYA 2UWJG 4GCNA 4U63A 3CVWA 1RJ9B 4CS8C 3P2BA 5G2NA 4C3BA 4N39A 3RRNB 2OV8A 4MKTA 4BJ6A 3S7JA 3NDBB 5G55A 1TEZA 2Q9CA 3G2WA 2R7TA 5JHBA 2CGEA 2OVFA 2XPYA 3FVYA 4BX9A 2DYSC 1YA0A 4BJ1A 2Q9BA 3CV0A 3ZW3A 3D9MA 2VSNA 4LERA 4PS8A 2R7OA 3FUIA 2XCCA 2YEVA 4G0HA 3ASDA 4X0RA 4HORA 2YHEA 1VYIA 4IWBA 1Y6IA 4PS7A 4KT6B 4K03A 3I4RB 5JJTA 3ZGQA 4KC9A 1PD0A 1HFAA 2WXRA 3ZRHA 3KS2A 4YT8A 4GZDA 4MQ9F 2WVQA 4ANUA 3EH1A 3S27A 3SZRA 4BT9A 3NZUA 4JCHA 1SZIA 4FC8A 4HVBA 1FMVA 2LAIA 2ONDA 1TWHA 4EBBA 2VYIA 3JRTA 3FWVA 4WNDA 3EFOB 4M63A 3R9AB 4I9CA 5T4YA 5DQZA 4GEHA 3QDNA 2VTBB 3E4BA 1IZMA 4XLPF 5JHAA 3PRZA 4QDLA 4CEMA 4BY6A 1BR1A 4HOTA 4V3IA 2I2OA 3DZAA 2BE5F 2Y3HA 2XGMA 2P6VA 2FEZA 1E96B 5HQ8A 4PJNA 4LCTA 4UWHA 3LXUX 1J8YF 4L1BA 3CZ6A 3MKRA 5G04C 1OWPA 3UT4A 2PM6A 3ZFWA 1WGWA 5DVWA 2Y3DA 4J6IA 1FFHA 5ARFA 4HFGA 3IV0A 2ZXPA 3CVUA 3LY9A 4AP2A 1JPLA 1W3BA 4G24A 4OYSA 4EQFA 4LRZA 2GRLA 2GFHA 1EYHA 3EJNA 4DK5A 4FP7A 2HM8A 3MZLB 5D0OD 3SHFA 3AQCA 3UR3C 3ASGA 2IXPA 4FJZA 2R5SA 3ONKA 1IW7F 4U0SA 1PAQA 3LLKA 1KLXA 3P1UA 4AE4B 4C7OA 4KZCA 3CSTA 2LSEA 2CDQA 2VSYA 4XX5A 2PZIA 3CSFA 3DAGA 4IJJA 5DS5A 4PS3A 3VLFA 3I4GA 2H7BA 1NP7A 3T5XA 3RH3A 3N71A 2NSZA 3ZPJA 4ABNA 4RBNA 2C04A 2QY9A 1E8YA 3TL5A 1JWFA 4B0ZA 3CQGB 3GZSA 3FTXA 3DXJF 4YJWA 4QI2A 3CLJA 2YHSA 4JEUA 4YN0B 5E75A 3EDTB 4AIFA 5ANLA 4CGWA 2FULA 4G7OF 3ZSUA 4KBQA 3LY8A 5AYWD 2PF4E 2WMOA 2LAHA 3ZYLA 2WB2A 1U3DA 2Z15A 2XXAB 4ACKA 3RK6A 3JUIA 3LVRE 2R7UA 3ZC4A 2NUTB 4N2QA 1L5JA 3B7TA 5KYXA 1N54A 4GZ6A 3N2ZB 1ZU5A 4GMLA 4AY6A 4B94A 1UJJA 2H7OA 4EWCA 3ESLA 4BTAA 2HO1A 4OD4A 2WXKA 3C98A 3HDXA 2W9YA 3CKBA 3CVQA 4XZ4A 1D0XA 4K0DA 4BJ5A 4KI2A 3RYLA 4DBQA 2AXUA 3CHSA 1QLEC 1ST6A 2KW3C 5F5HA 5E76A 4PUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MRU A;  5FQ4 A;  5J90 A;  3P1U A;  3MX3 A;  4L7T A;  3JQ0 A;  3GZS A;  3HDX A;  5LX8 A;  3JQ1 A;  3CKB A;  3OTN A;  3EJN A;  4F53 A;  5T3R A;  5FQ6 A;  4LER A;  3FDH A;  3MCX A;  3CK7 A;  5E75 A;  3CKC A;  3I4G A;  4Q69 A;  3L22 A;  3MYV A;  5FQ8 A;  3SNX A;  3CK9 A;  3IV0 A;  3CGH A;  3QNK A;  3EHN A;  3JYS A;  5FQ7 A;  4F7A A;  3NQP A;  3CK8 A;  3EHM A;  3KEZ A;  3SGH A;  5E76 A;  3LEW A;  4PUC A;  5T4Y A; 
#chains in the Genus database with same CATH topology
 2BKK B;  5C2Y A;  2XEN A;  4ANV A;  2VSO E;  2PQR A;  1U89 A;  3B0V C;  3U66 A;  2R02 A;  3SZ7 A;  3EPV A;  5CHE E;  3RAU A;  3HXF A;  2YHC A;  4GZC A;  3V2O A;  2J8S D;  4JTA B;  3UT8 A;  4DI3 A;  5DLJ A;  4M3O A;  3UI2 A;  4CCA A;  2GRQ B;  1E7U A;  3O6X A;  2E0I A;  3HXC A;  1NU9 C;  5CED B;  1GM5 A;  3ABL C;  3O39 A;  5CRV A;  2AJA A;  2P9P G;  3RIB A;  3K1H A;  3PH0 C;  1LM3 B;  1Q0G A;  3SQV A;  4JIO A;  1NZE A;  4I3M A;  3L54 A;  1T6U A;  5E3C A;  2KCL A;  3UQ3 A;  1G4W R;  4PFP A;  3B0P A;  5GPG B;  2I6H A;  2IQC A;  1NFN A;  1QKR A;  1BD8 A;  2P58 C;  5A6B A;  5KJK A;  2ZXR A;  1ORS C;  3C3Q A;  3OXG A;  3T6J A;  3UNG C;  1U0B B;  1S7Z A;  1LIH A;  3CSK A;  5CIV A;  5CCM A;  1V74 B;  2KBX A;  2VGX B;  2VSX E;  2IXM A;  3R9M A;  2IOQ A;  3GZ1 A;  3FMS A;  1OCR E;  3IEG A;  3MA5 A;  4O6F A;  5AAR A;  2YLI A;  4JEH A;  4U5C E;  1VYK A;  1EKY A;  5HS0 A;  3O4Z A;  3N24 A;  3SNX A;  4ATZ D;  2RSE B;  5CEA A;  3QZC A;  2VTB A;  3CHO A;  4C0E A;  3EHN A;  2XLO A;  3S2A A;  3JYH A;  2XLE A;  5FTP A;  4ZLC A;  3KL4 A;  5T8I A;  2OQM A;  1R5I D;  3SY2 A;  4YT2 A;  4EEC A;  1EA8 A;  3AJM A;  3CKC A;  4XTK A;  4WNG A;  5KYN A;  2V3C C;  2JEK A;  3AQB A;  2MRI A;  1ELR A;  3U3W A;  1OCZ E;  4Z9H A;  2EIM C;  4N3C A;  3LNR A;  4JXT A;  5BT1 A;  1NBB A;  1HZ4 A;  1YA9 A;  3SBS A;  4XPY A;  5L3Q A;  1OT8 A;  1YMP A;  4M7C A;  2Y1L E;  4Q96 A;  3QMK A;  1SQM A;  4PK4 A;  1ZHZ A;  2NYJ A;  4EBJ A;  4TXP A;  1O5H A;  2PFD A;  3FTU A;  4DX5 D;  3M1C B;  2FGY A;  3RFY A;  4J0U A;  4BEP A;  2QC9 A;  2GAQ A;  2WZF A;  2R7S A;  3RW0 A;  1D8E A;  1WAO 1;  2DYR E;  3SNH A;  1FNT c;  3SO8 A;  3TG5 A;  3EGX B;  3DBS A;  2W45 A;  3CIA A;  3HNJ A;  5LFA A;  4E6H A;  4HXI A;  4WUY A;  1Z6A A;  4LSZ E;  1ZBP A;  4E7S A;  3LKU A;  2DZN A;  5D0Q D;  3ZIM A;  3Q7G A;  1JUQ A;  1WDY A;  4QQI A;  3CHM A;  2CHW A;  3Q7A A;  2EIJ C;  4PJM A;  3W8H A;  1V55 E;  4ZHB A;  4DVZ A;  3ZUV B;  3UM2 A;  1C02 A;  2IJG X;  2QY7 A;  3TWQ A;  1UN8 A;  4LEU A;  3AGT A;  1FVH A;  2P9L G;  3T8K A;  3T9K A;  4C3D A;  5KWD A;  5AQA A;  1TR4 A;  4G7Z F;  3U64 A;  1O87 A;  1HY5 A;  1TNB A;  3NOG D;  4TRQ A;  1ELW A;  5BQI A;  1OCC E;  3L13 A;  5BW8 C;  1Z7Q c;  5L0C A;  3PEV B;  4GU5 A;  3TQO A;  3LJN A;  3EGD B;  2YLG A;  5BV1 A;  3FUJ A;  2J9U A;  3DJN B;  4HFK B;  2ION A;  2HSQ A;  3FEX A;  2OOE A;  1E85 A;  4NTF A;  3Q9N C;  3ULE G;  4A3V A;  1AP7 A;  3PS6 A;  4GTR A;  3GM2 A;  3HIZ A;  1BU9 A;  4L9P A;  3MKQ B;  4AM9 A;  1H7I A;  3FOP A;  4Q5S F;  1H6P A;  2EIN C;  4MVS A;  1KU2 A;  3CVL A;  3LAY A;  5EDS A;  4YVO A;  2LSV A;  4J8D A;  1TYQ G;  2E2E A;  5DS6 A;  4PH4 B;  2ZGD A;  2ZXW C;  4UWF A;  1LKX A;  5K0I A;  2XXA A;  3K7D A;  2YL0 A;  1ZU4 A;  3F6Q A;  4UQY A;  3E37 A;  3IQT A;  5LCW J;  4CS8 A;  5B3S C;  4HI9 A;  1MX4 A;  2IU1 A;  1M2V A;  3L8I A;  1DCQ A;  3SD5 A;  5ENR D;  5F28 E;  2KC7 A;  1U2V G;  2IY0 C;  3D9N A;  4HLE A;  4U5B E;  2PQN A;  2H6H A;  2DZO A;  2E87 A;  3EZH A;  4KBL A;  2FI7 A;  4ULW A;  1VLT A;  3L08 A;  2X51 A;  1P5Q A;  1WM5 A;  1TWA A;  4JPS A;  2B0O E;  4N5Q A;  1WY6 A;  2CCY A;  4KNV A;  2XPZ A;  1Z63 A;  4YT5 A;  1DNP A;  2YQ8 A;  3EU5 A;  3JTL O;  4G23 A;  3U9W A;  4BPM A;  2A4Z A;  4YK5 A;  1APC A;  4Z68 A;  1JRA A;  3FDH A;  5EGY A;  2BF0 X;  2J49 A;  3GEE A;  3UMK A;  3HRA A;  1JAF A;  4BTB A;  4FU3 A;  3ULY A;  3J5P A;  2QUP A;  2L81 A;  2QFC A;  5KYY B;  3VRC A;  4XEF A;  4CIH A;  2JD3 A;  2EIL C;  4CDA A;  2VQ2 A;  4B93 B;  1M57 C;  4N6H A;  1DCE A;  1JCS A;  1ZW3 A;  2L9J A;  5L0F A;  4ANJ A;  2R7X A;  5EYP F;  2A0B A;  1OXK A;  3ITF A;  4C3E A;  5B1A C;  1S63 A;  4AJW A;  1T9K A;  4EIY A;  2A5U A;  2IYL D;  3ML8 A;  3TWX A;  3ENE A;  5BNW A;  4FLB A;  3ZXS A;  2KZT B;  3FU5 A;  4TV3 A;  3QAR A;  4GTO A;  2CW0 F;  2L0T B;  3IPM O;  5EIB E;  1A17 A;  4YL3 A;  3OXF A;  3CVP A;  4GA2 A;  2J0X A;  5HRY A;  1LI7 A;  2PP4 A;  1N52 A;  4C9B B;  4JHJ A;  1MQS A;  2VGX A;  3GOR A;  4DBR A;  4IUL A;  1H2U A;  5JJ7 A;  3TWT A;  3GEH A;  3QAQ A;  3RKV A;  5T3T A;  3RQE A;  3QNK A;  1Q0K A;  4K5B A;  4CZ2 D;  4BT8 A;  3RF3 A;  4UWL A;  3HLZ A;  4LUN U;  4CT0 A;  1E90 A;  2WZL A;  2XRY A;  2MHR A;  3SBT B;  1UW4 B;  2R03 A;  1OWM A;  3SP1 A;  3C72 A;  1CGN A;  3B0U X;  3DEO A;  3QW0 A;  3ASN C;  4HFF B;  3ABK E;  3Q15 A;  3B95 A;  4I17 A;  4KMO A;  1SZ9 A;  4WWN A;  2EPO A;  4U96 D;  2LIG A;  4WWP A;  1NLX A;  2OVB A;  4LLC A;  3AU4 A;  4AY5 A;  4J7T A;  1QZ2 A;  2J09 A;  1JWG A;  1C03 A;  3L17 A;  1N4P A;  2KAT A;  2EPM X;  1A5E A;  3PUJ A;  4UDV A;  1HW1 A;  3WG7 C;  4OVU A;  4DX6 D;  3FY4 A;  4RQI A;  4GPM A;  4ILG A;  3QWW A;  2LQG A;  3ML9 A;  3AG4 C;  3SI5 A;  3G50 A;  3AG3 C;  4BX8 A;  3FTS A;  1OW7 A;  4I6E A;  3ZHE B;  4PJL A;  4IAR A;  2VJ8 A;  3SXK A;  3NF1 A;  3U4T A;  1Z3X A;  2DYS E;  4NRH B;  2GW1 A;  1ORY A;  3V2X A;  1JR8 A;  4BJ6 C;  1D0Z A;  2ZXO A;  3ECS A;  2RD9 A;  3EGX A;  1U3C A;  2I15 A;  4DVY P;  2UY1 B;  3DRA A;  3PMR A;  3TWU A;  3JRM O;  3CK7 A;  2IXO A;  4JZA A;  5FCL A;  3U5S A;  2DGJ A;  4L2Y A;  2IO3 C;  2JAB A;  5J08 A;  3FEY A;  3NRH A;  1HE1 A;  2YL1 A;  3O10 A;  1IHG A;  4P9F A;  3L0I A;  3EIJ A;  2TMV P;  3APD A;  4N2S A;  3RIP A;  3VTX A;  4HOS A;  1ZHT A;  3UMI A;  5D92 A;  5FJY A;  2A69 F;  4ZLD A;  3L1M A;  2R59 A;  1H2T C;  2X6F A;  4J8Y A;  3RQF A;  3EQL F;  2AWY A;  3FUF A;  4GTS A;  3Q78 A;  4CSA C;  2WXJ A;  3K66 A;  2WXH A;  3RSE G;  4C48 B;  2ETS A;  4J7W A;  3C7J A;  2Q4F A;  1EPU A;  3NG1 A;  4U5D E;  3W9F A;  4XWJ A;  4E85 A;  2GA0 A;  4UWG A;  4DLQ A;  1QQE A;  3TOM A;  2BUG A;  3Q4A B;  3QVY A;  3PCV A;  3KEZ A;  1ORJ A;  1MMN A;  1QSP A;  3Q9U C;  2Y3G A;  2XSE A;  2Y3A A;  4BEJ A;  3B7B A;  3MFN A;  3ZG1 A;  1NI1 A;  3Q47 B;  4GA0 A;  1MND A;  2RKK A;  4PAC A;  3MKQ A;  2P61 A;  3IKO B;  3VTY A;  2WVI A;  3AG1 C;  3NZS A;  4CYM D;  3I5P A;  2GRP B;  3ZQY A;  1QYM A;  4WJ0 A;  1LVK A;  2NC9 A;  4MW3 A;  2P9S G;  5L0J A;  3NYL A;  4QI0 A;  3H65 A;  1Z3Y A;  2XL6 A;  4L7T A;  1INZ A;  5EHH A;  1K05 A;  5KYU B;  1PY1 A;  1DOW A;  2L6G A;  3DD7 A;  4O6M A;  1QZX A;  3UGP A;  1NFI E;  3MLG A;  4IN3 B;  2IOL A;  2NG1 A;  2HE0 A;  4DX7 D;  2IXN A;  2PL2 A;  4GTT A;  5FT9 A;  4XEI G;  2I8B A;  1KT0 A;  2HKV A;  2M64 A;  4BJT A;  2WQH A;  3E9V A;  5L3V A;  2J0W A;  3NOC D;  3AG2 C;  2IBF A;  3DSX A;  3I3N A;  4I6J A;  4WAF A;  1AVO B;  4DRX E;  3IBE A;  1A41 A;  1TJC A;  3DE8 A;  4P29 A;  3LDZ A;  3U2L A;  3BEE A;  5DIZ A;  2LD6 A;  2AXV A;  2LSU A;  4U5E E;  1Z6T A;  4RG9 A;  3CHP A;  2WQ6 A;  3CQC B;  4HRM B;  1MMD A;  3AJI A;  2HFI A;  2JX0 A;  4ATG A;  2LFD A;  3L8J A;  1ZYR F;  1PC2 A;  4XE0 A;  3FTY A;  1MNE A;  1H2V C;  1LPE A;  3ZIB A;  3LJ3 A;  3U3B A;  4TXR A;  5CMW A;  2RD0 A;  2YNQ A;  4RVB A;  4F1S A;  5KYY A;  1VK5 A;  4MTF A;  4MLP A;  1JPJ A;  3KH2 A;  2XS8 A;  1QPU A;  3SYN A;  4FHK A;  4KVM A;  3ZNG A;  2MWQ A;  4FHJ A;  3CVV A;  2IM8 A;  2LXL A;  2B6C A;  3JCK C;  2KCK A;  2WXQ A;  1VB5 A;  5L0H A;  2GDC A;  3IHY A;  5CCL A;  1RJ9 A;  2L6F A;  4UI9 C;  1J8M F;  1VTM P;  3CVY A;  1K8K G;  3J5Q B;  2XM4 A;  4RD9 A;  3L34 A;  4Y6W A;  3U9M A;  2KZT A;  1AUE A;  1FTS A;  1K40 A;  2EPL X;  3NYJ A;  2V0P A;  5A6B D;  1A0B A;  3LEV A;  5AC4 A;  3G2T A;  3TWV A;  4U07 A;  3S7B A;  5T1D B;  2A68 F;  5KYW B;  4K5A B;  4J30 B;  2OCC C;  3RVY A;  3JSZ A;  2XL4 A;  1O1S A;  2QYJ A;  2UUI A;  4D4N A;  5A69 A;  1OWO A;  2NUP B;  1BR2 A;  2LNI A;  3MGB A;  1UJK A;  2CHX A;  1OWN A;  2J08 A;  4HOQ A;  3X2Q C;  5D91 A;  1I4Y A;  4BEM J;  2DB4 A;  4JEA A;  4KNW A;  2YL7 A;  5A6C A;  4Q7C A;  4EHM A;  1O3U A;  3ESK A;  1Q2Z A;  5CBN A;  2CYD A;  4GQH A;  4O79 A;  2AVP A;  3I5Q A;  5AIJ A;  4MVR A;  4J8S A;  4FWV A;  2Y4T A;  4U8H A;  1Z23 A;  3FOO A;  4DUI A;  3FAP B;  4JRZ A;  4FX5 A;  5HV9 A;  3PRE A;  4H7X A;  3S84 A;  5G04 J;  2YWA A;  1HX8 A;  4LNG A;  5EX3 A;  4BER A;  5ENP D;  4KYO B;  1BR4 A;  2FFH A;  1WAT A;  1UG3 A;  2AWC A;  2F37 A;  3JQ0 A;  3HJC A;  3ZU7 B;  4BFR A;  4ULV A;  3PE4 A;  4OVV A;  1VLS A;  4ANW A;  1BZ4 A;  2ETA A;  4AXH A;  3EH2 A;  3Q6M A;  3B9Q A;  3Q49 B;  4B6I A;  4Y6C A;  4J8F A;  3S7F A;  1FFT C;  3RU0 A;  3FHD A;  1RKE A;  2XEE A;  1L3P A;  1BI8 B;  1A7V A;  1TFO B;  2ETC A;  3HVE B;  5L0D A;  2ZIS A;  4JE9 A;  3R7C A;  4A1G A;  5LX8 A;  3EFO A;  5LCW C;  1WN0 A;  1TFK B;  4NQ0 A;  2L6J A;  3UT7 A;  3TAX A;  4U0Z A;  4BSX A;  3DM5 A;  4BSZ B;  5G05 C;  4A3T A;  2UY1 A;  2J4B A;  1V54 C;  1QNF A;  4OIR F;  3Q7F A;  3VLD A;  5FZQ A;  1NA0 A;  4XEV A;  1NFO A;  4I2Z A;  3DM9 B;  4XLN F;  4W8K A;  2KJG A;  4LNB A;  3L6A A;  2RFA A;  1Y8M A;  2J9V A;  3NMK A;  3FUM A;  2GRM A;  2AXZ A;  3HNK A;  2Y4U A;  1YYJ A;  1DVP A;  5JA4 D;  2GRO B;  2KQ9 A;  5FQ8 A;  3BG1 B;  4X8Q A;  3JZ0 A;  2GWW A;  1FCH A;  4F7A A;  4JHR A;  4GA1 A;  4GYW A;  3EG9 B;  3ABL E;  1R4T A;  2Y39 A;  4GTV A;  4B8C B;  3ZYQ A;  5KCM A;  4HLL A;  1ZZP A;  4U5H A;  3T5V A;  4QFV A;  1YAR O;  1ZHW A;  2J07 A;  4ANX A;  3CVN A;  2R17 C;  3M4B A;  1H9G A;  3JYS A;  1K04 A;  3FAJ A;  2B0J A;  3PZ1 A;  4PDX A;  2Y69 C;  1IQU A;  4I1A A;  3BEH A;  4APF A;  2D4U A;  3AAA C;  4I9E A;  3S9O A;  2OU6 A;  3G2S A;  1LE2 A;  2LP4 A;  3TUL A;  3M79 A;  1IYG A;  3E32 A;  4AE4 A;  2LO6 A;  4KZ0 A;  3N0T A;  1SVX A;  3ASF A;  1D1C A;  4G2V A;  5ARG A;  1AWC B;  4NIK A;  3NKD A;  3MBG A;  2KNH A;  1NL4 A;  2W4B A;  2XHE A;  3FUK A;  1ELK A;  5KNG A;  2X6J A;  2EIM E;  2VGE A;  3MEK A;  5B1B C;  4JA9 A;  2Q3T A;  3KAE A;  3PHF 2;  3GAN A;  3GWL A;  1OXJ A;  3JT1 A;  3LCA A;  2WXI A;  5E76 A;  2J45 A;  2WVO A;  5DS4 A;  2RG8 A;  1W2W A;  4HE8 D;  2WXN A;  3DMD A;  3B29 A;  3V79 K;  3KYI A;  4JHK A;  3U0C A;  3D9O A;  3ZWI A;  1XGW A;  4MW8 A;  1OR3 A;  2XLH A;  5FQ6 A;  4IGG A;  4XI9 A;  2OEV A;  3QKY A;  4C0M A;  4HS2 A;  1HF8 A;  3T6B A;  4PFO A;  1FR0 A;  2WXG A;  1BBH A;  4GZ5 A;  2J7P D;  2ZD9 A;  3Q6N A;  3DWL G;  1TKN A;  4CDM A;  3H2V A;  2NUT A;  3EIQ C;  1SF8 A;  2FAP B;  1X5B A;  2EIJ E;  4G25 A;  3AU5 A;  4CGV A;  3PNT B;  2PBE A;  4DLO A;  1T6Q A;  4TUU A;  1LS1 A;  4DXW A;  3FTZ A;  4G1T A;  5LP0 A;  1GQA A;  3G2U A;  3LUT B;  4U95 D;  4YT4 A;  1NA3 A;  5CI8 A;  1VMA A;  1L7C A;  2IFU A;  1SZA A;  2BTD A;  4C7O B;  5EYL A;  4LLE A;  5AQB A;  4CT4 A;  4JUR I;  4EKW A;  3FTV A;  2WB7 A;  2H6G A;  5JJ6 A;  4MBG A;  3LEW A;  2A6E F;  5AEN A;  4CS7 A;  4U7E B;  1BI7 B;  4LNU D;  2P0N A;  3PNL B;  4A4A A;  3HNI A;  3IHV A;  5ANR A;  1WTY A;  1VOM A;  4JJF A;  4HI8 A;  5EID A;  3HG0 D;  3C8G B;  2JLB A;  2L9B A;  2EQX A;  4EBA G;  3JXJ A;  2QNL A;  3IQ5 A;  1E83 A;  2Q7F A;  1LD7 A;  1OKK D;  3B13 A;  3LS1 A;  4A1S A;  2G3K A;  2HJ3 A;  5F5F A;  2G3V A;  3QWV A;  4U0U A;  4GMJ A;  3TJ5 A;  4JTD B;  3A9C A;  3FH7 A;  5IY5 C;  2ASR A;  3CK8 A;  3WHN A;  4B89 A;  3MYF A;  3TJ6 A;  4JVS A;  4W9R A;  4UUC A;  1TWG A;  5JS5 A;  3S29 A;  2EIN E;  5JMN D;  3WXX A;  3ABM C;  4RDA A;  1TN7 A;  2CG3 A;  1ZHY A;  2X6H A;  1HMO A;  3AS8 A;  2GRR B;  3TGO A;  2ZXW E;  2MOW A;  3TD7 A;  2C2L A;  4N3A A;  2J7P A;  3RVZ A;  2EIK C;  2I9C A;  4FAD A;  4PJJ A;  3EUV A;  3V7O A;  2L6B A;  3AOU A;  3TK0 A;  4DJ9 A;  2C0L A;  3MYI A;  5B3S E;  4OAV B;  2MYS A;  5A23 A;  4WNE A;  3K6B A;  1WG0 A;  3EHR A;  3FDQ A;  3M15 A;  1RZ4 A;  5JUA A;  2ZIR A;  4DRJ B;  3FFL A;  1HW2 A;  1H0A A;  4G78 A;  2VB6 A;  5EN5 D;  3UXG A;  3ONL A;  3HVE A;  3Q75 A;  3ASO C;  3APF A;  3DJU B;  3B7R L;  4AL0 A;  3CK9 A;  2MHK A;  5JRA A;  3ZYM A;  2Q00 A;  4GZ3 A;  1HS6 A;  2X0C A;  3PE3 A;  2KXP C;  3TXN A;  2H6F A;  4EZK A;  1OCO C;  1OKK A;  4A2N B;  4HBD A;  3LJB A;  4FLH A;  3GYZ A;  1N9A A;  3IHU A;  1N1C A;  1YVI A;  1E86 A;  4D4X A;  3IEE A;  3TG4 A;  4GAA A;  3GWN A;  3VM6 A;  3W4Y A;  4GCO A;  2OKU A;  3D9H A;  1TNY A;  3M4C A;  2OJQ A;  2EIL E;  3DXK G;  4EUK B;  1KZP A;  3GOD A;  2R7Q A;  3W8I A;  2DVW A;  4TXQ A;  3V31 A;  4JC8 A;  4F6R D;  1HO8 A;  4CDR A;  3B71 A;  4MTO A;  4CSA A;  2PNN A;  4A63 B;  3RO2 A;  1EF1 C;  3ZVV A;  3K33 A;  3POV A;  3EG9 A;  3UM1 A;  5B1A E;  3T4R A;  4CS9 C;  3PDM P;  1HH8 A;  2LCH A;  1OWL A;  4EZJ A;  4YL0 A;  2LXM A;  1Q0D A;  3ZTZ A;  4N5C A;  3Q79 A;  4UQZ A;  1FMW A;  4N6C A;  4CDN A;  4MND A;  1MYO A;  4ONS A;  1FPP A;  2Y3B A;  3LS8 A;  4J7Y A;  1JOG A;  4BG0 A;  3FHE A;  3C63 A;  2WVN A;  4UI9 K;  4GYO A;  1NU7 D;  3PZD A;  3LYA A;  5AN8 A;  4GTP A;  4NCQ A;  1ZB1 A;  1TJF A;  2A1D D;  1FT2 A;  3FUH A;  3LPZ A;  3UGO A;  3LES A;  2WM9 A;  3CEX A;  2WQ7 A;  3GM1 A;  3PEU B;  3KPH A;  2DCP A;  5H7P A;  1ZU2 A;  4XEK A;  4Q4Z F;  3NQP A;  3B7U X;  4OIN F;  3Q7L A;  2CNW D;  1RW2 A;  4I1M A;  5AGF A;  1HG5 A;  3E33 A;  4I43 A;  3FU3 A;  3ASN E;  5FZR A;  4U5F E;  2AU5 A;  2X6I A;  5E2Q A;  2J46 A;  4HNA D;  3OTN A;  4DX1 A;  2A6H F;  4JCZ A;  3OAW A;  3A11 A;  1H6K A;  1ZW2 A;  1Z3I X;  4I44 A;  2XRZ A;  2ILR A;  3U2M A;  4E7Z A;  1SW6 A;  3WG7 E;  3DXM G;  1WAS A;  4CJO A;  2G62 A;  2W4M A;  1YA7 O;  3EGD A;  4E17 A;  2V5Q C;  3URZ A;  1C17 M;  4WNF A;  4EBA A;  5JP7 A;  3KKB A;  5BXO A;  3NYM A;  5L0I A;  3L9T A;  4R32 A;  3AG4 E;  1N94 A;  3AG3 E;  1KTM A;  4XI0 A;  3SF4 A;  5CRU A;  1ZVZ A;  2NXP A;  1GW6 A;  4JKV A;  1IHB A;  1HE8 A;  4NUR A;  2HV6 A;  2KCV A;  3MV3 B;  1D1A A;  5EK0 A;  4HRN A;  3QK0 A;  1N0R A;  2OEW A;  4I2W A;  2R7R A;  1OW8 A;  4FJY A;  3S28 A;  4ACL A;  2UUH A;  1OW6 A;  1D1B A;  5JVE A;  1V4A A;  1EQ1 A;  1O1T A;  4GYY A;  4XPW A;  5T3W A;  3G4X A;  4JA7 A;  2CNW A;  4L23 A;  3D9K A;  2KC3 A;  1FVF A;  1LS4 A;  2XEH A;  5E33 A;  2A5E A;  1H19 A;  5CBO A;  3WAQ A;  2QE9 A;  4G11 A;  4URK A;  2BKG A;  3CQZ A;  3D9I A;  5EX0 A;  1S0P A;  3L82 A;  1MMG A;  5EKQ D;  4WAB A;  2V5F A;  4N3B A;  1Q0M A;  2M4E A;  1M56 C;  3RO3 A;  4GPK A;  2HR2 A;  2KM4 A;  3L22 A;  3R7Q A;  4F4B A;  3MYV A;  5L0G A;  4F1P A;  3C8G A;  5KJN A;  5JLI A;  4UQX A;  3LEO A;  1YDI A;  4YDY A;  1CGM E;  4XIF A;  5KJL A;  4HEA J;  2XZD G;  3SGH A;  4N4W A;  3FP3 A;  4J32 B;  4PR9 A;  3FU0 A;  1GS9 A;  5HKP A;  3ZKJ A;  3W9G A;  5FWQ A;  4AV7 A;  2J9Q A;  4DRI B;  1JCR A;  256B A;  1T01 A;  2LFF A;  3ZVR A;  3AG1 E;  4TUM A;  4F53 A;  3D9J A;  4YVQ C;  4R7L A;  3RRU A;  1B68 A;  2R2L A;  3UIN C;  3LS0 A;  2BL2 A;  4O6N A;  3VAY A;  1XWJ A;  2KK1 A;  3S0X A;  2PX3 A;  4BES A;  1T6I A;  4HOU A;  2VH3 A;  1Y6D A;  3K1I C;  2LUH A;  4NTA A;  1SMY F;  2R25 A;  3EHM A;  3EZI A;  3BG0 B;  3APC A;  2GGF A;  2WZG A;  2FBN A;  2H8A A;  3ISM C;  4O7G A;  3FXH A;  3TJP A;  4DJA A;  4U04 A;  1M2O A;  1BPO A;  4F3V A;  3ATP A;  4A55 A;  3QVZ A;  1QBQ A;  3PVL A;  4J8E A;  1LF8 A;  4HQD A;  3LY7 A;  5BUZ A;  2VCA A;  3KYJ A;  2V26 A;  3U9J A;  4G7H F;  3OXL A;  1M2V B;  4YDO A;  3AG2 E;  3JCU Q;  3UPV A;  2HV7 A;  1HE9 A;  1XNF A;  3MV2 B;  3ASH A;  2R7W A;  3FTW A;  1HMD A;  3GW4 A;  2WMN A;  5KJM A;  2L0I A;  4K5C A;  2VGY A;  3JSE O;  1IQR A;  3SXZ A;  2OEX A;  3TOL A;  3WOD F;  3NKE A;  3HXE A;  3VLE A;  1OCR C;  3VYW A;  3F47 A;  2OG2 A;  4GB9 A;  2XLM A;  2CFZ A;  3QWP A;  1OR2 A;  2I1K A;  4IYP A;  4OIO F;  1TNU A;  4KXK B;  4FES A;  3EHQ A;  4LG6 A;  3UKR G;  4RSY A;  3I4U A;  2WXP A;  3V30 A;  3OA1 A;  4AVX A;  2V4H C;  5BUO A;  3AS5 A;  3JXI A;  2J9W A;  2QTV A;  2O9X A;  3O48 A;  1TNO A;  4BWR A;  4YND A;  2AWI A;  1UG7 A;  4E0H A;  1CPR A;  1EDU A;  2ICW G;  5FZS A;  1XZQ A;  3SXM A;  5AJL A;  5BXU A;  4OD5 A;  4MS6 A;  1OCZ C;  2C03 A;  1NZN A;  1MMA A;  2VAS A;  2ZPA A;  3PDN A;  1G8X A;  2F8Y A;  2J9B A;  4AX2 A;  3HYM B;  4YWQ A;  1CGO A;  1KNY A;  3ZHE A;  5COF A;  5J90 A;  2OCC E;  2XRH A;  2ZU6 B;  4O1P A;  2P1A A;  4K7B A;  5DBK A;  1TR2 A;  3FH5 A;  1YZC A;  5T3R A;  3SXY A;  3DSS A;  5ITZ F;  1MX6 A;  4FA6 A;  3TXM A;  2F22 A;  3X2Q E;  4APO A;  1N4S A;  4CDY A;  3PZ3 A;  2XGO A;  2D5R B;  2DYR C;  2CFU A;  4BJ5 C;  3AS4 A;  2YL3 A;  3F46 A;  4ME2 A;  2XLW A;  4EZL A;  4GYT A;  2IF4 A;  3V5Y A;  2CHZ A;  1GGQ A;  3SFX A;  2XL8 A;  5A6A A;  1Z5S C;  5ENN A;  1G3N B;  2BED A;  2XPI A;  4YDW A;  2WXF A;  1OUV A;  3BUA A;  3ZEF A;  3UMH A;  1AEP A;  4XKB A;  2KGO A;  4I1O B;  3FH8 A;  2F0Y A;  2X3M A;  2HS5 A;  4AOF A;  1V55 C;  2HSB A;  1D9S A;  4MTG A;  1Z5Z A;  1WOL A;  2AW6 A;  4U8Y D;  2C0M A;  4KVO A;  2P9N G;  3FUL A;  4H7Y A;  1N4Q A;  1JPN A;  4AEZ C;  3ZYK A;  4H4K C;  4IRU A;  2HMZ A;  3E70 C;  2V8S E;  1K1A A;  1B89 A;  4AK9 A;  4JL0 A;  1TWC A;  3JQ1 A;  1O5M A;  1OCC C;  2PX0 A;  1XZP A;  1MX2 A;  3Q73 A;  2OOC A;  2P7V A;  5A7D B;  4JTC B;  2F8X K;  3DSV A;  1BLX B;  2P9K G;  3D3M A;  2NPU A;  1MJ0 A;  4FAP B;  1SR2 A;  4JJG A;  4AL1 A;  1RKC A;  1T5O A;  2YIN A;  2LK4 A;  4K1O A;  5A6J A;  3EU9 A;  2QZA A;  1TQG A;  3MX3 A;  3DAF A;  2L7A A;  1QQ3 A;  2FF4 A;  2IOS A;  2IO2 C;  2WXL A;  3SEO A;  3RRM B;  3L16 A;  3MCX A;  4N06 A;  3LVQ E;  3QB2 A;  4Q69 A;  1UN9 A;  3C18 A;  1V54 E;  4UI9 J;  4RG6 A;  4EHP A;  3G2V A;  1KZO A;  3CHR A;  3ZN3 A;  4IAO A;  5CI9 A;  1KT1 A;  5KYU A;  2FO7 A;  4DPR A;  3UUX A;  4E18 A;  3W2V A;  2R7V A;  2CG2 A;  4OIP F;  5M72 A;  2XEV A;  3QOU A;  1KPS B;  3US6 A;  1MHQ A;  3QW1 A;  3QJZ A;  3S7D A;  3RJV A;  3HXB A;  5BV0 A;  4ILI A;  3DPD A;  4U8V D;  4I6G A;  3RKO F;  5E3A A;  4LDK A;  1PD1 A;  2PM7 A;  4LAC B;  1LTX A;  5HI7 A;  1BDJ B;  1S70 B;  5BQG A;  2X6K A;  5KNH D;  3TWW A;  4CDV A;  3FUD A;  3OEO A;  3HHM A;  3X1O A;  2R9R B;  3LLI A;  3Q5M A;  3PUK A;  2WXO A;  4ILH B;  1FT1 A;  3FUE A;  1FAP B;  4CRW A;  2Y0B G;  4WWO A;  3U8P A;  2QYU A;  1YAU O;  5CMY A;  2FO1 E;  1LI5 A;  3O55 A;  4NAC A;  4B8A A;  2WPV A;  4XQ1 A;  3QC1 A;  3UM3 A;  4L6R A;  2YZS A;  3UX4 A;  3DEP A;  2BC5 A;  4DOZ A;  4NTB A;  3KD7 A;  1S05 A;  5AJD A;  3CGH A;  2I1J A;  2Y69 E;  5KBA A;  3DPY A;  2X38 A;  3NBN B;  1UFB A;  4MVU A;  4UWK A;  3HTK C;  4NC3 A;  5EIL A;  5C1D A;  1A7E A;  3HKK A;  4L2L A;  4D10 C;  4P6I C;  2OJE D;  1E8Z A;  3B7S A;  2YKZ A;  3UKU G;  3MJW A;  4U9E A;  5FQ4 A;  1VDY A;  4K0R A;  3CVX A;  3UMV A;  4O60 A;  4O6Y A;  1ZHX A;  4Q94 A;  1E2X A;  1LE4 A;  4CBE A;  2YQY A;  4MVO A;  1SA4 A;  4JW1 A;  4MVQ A;  5COM A;  4OIQ F;  3SFZ A;  3GZ2 A;  2ETB A;  3C8Z A;  5HSW A;  5FQ7 A;  3G4Z A;  3KMI A;  3CEQ A;  5KYW A;  4FUL A;  3C3O A;  5DQT A;  5ENQ D;  4MRU A;  2NUP A;  1D0Y A;  4G26 A;  5LOZ A;  2P9U G;  5B1B E;  3W2W A;  1HG2 A;  2XQ0 A;  4U5G A;  2IEJ A;  1A7D A;  1E8W A;  2WXM A;  3FU6 A;  4XKC A;  4XPX A;  5G05 J;  2DBA A;  5BQH A;  3T8M A;  2WL8 A;  1HU3 A;  2J4D A;  5FZT A;  4G8L A;  3FUN A;  3V5Z A;  2DWZ A;  1N4R A;  2V4L A;  2Q9A A;  2XCB A;  3RQG A;  1LD8 A;  1K3Z D;  3CHQ A;  4EPZ A;  3CR3 A;  2AP3 A;  1I5N A;  4DI4 A;  3TWR A;  4CIP A;  3J06 A;  4NY3 A;  4O1O A;  2YVK A;  1HXI A;  1E7V A;  3OWT A;  2VCB A;  2DIW A;  5ENT D;  2GRN B;  3VF0 A;  4P9T A;  2B0H A;  2HYZ A;  2XLD A;  2XGS A;  3ULQ A;  2H7V C;  3ABK C;  3IQ6 A;  3H2U A;  1PCX A;  1IXV A;  1OY3 D;  4Z9I A;  1NG1 A;  2RFM A;  3NMJ A;  3JUE A;  1WWP A;  3D9L A;  4LDQ A;  5JT4 A;  4JD2 G;  2Q7R A;  4CS9 A;  3D9P A;  1N0Q A;  2M63 A;  5BPP A;  4MVM A;  1E8X A;  1OXB A;  5KYX B;  1Y4C A;  3K9I A;  3R7R A;  4JZY A;  3SFY A;  2UWJ G;  4GCN A;  4U63 A;  3CAX A;  3CVW A;  1RJ9 B;  2J8W A;  4CS8 C;  3P2B A;  5G2N A;  4C3B A;  4N39 A;  3RRN B;  2OV8 A;  5A6K A;  4MKT A;  4BJ6 A;  3S7J A;  3NDB B;  5G55 A;  1TEZ A;  3E34 A;  2Q9C A;  3G2W A;  2R7T A;  5JHB A;  2CGE A;  2OVF A;  3HXD A;  3C3R A;  2XPY A;  1E84 A;  3FVY A;  3PZ2 A;  4BX9 A;  2DYS C;  3C5R A;  4OAU C;  1YA0 A;  4BJ1 A;  1D8D A;  2Q9B A;  4WGY A;  2NSF A;  3CV0 A;  2XLV A;  3ZW3 A;  3D9M A;  3ZXP A;  2VSN A;  4LER A;  4PS8 A;  2R7O A;  3FUI A;  2YRF A;  2XCC A;  4CX9 A;  2YEV A;  4G0H A;  3BQO A;  3ASD A;  5ENO D;  4X0R A;  5IY5 E;  4HOR A;  2YHE A;  4JC7 A;  1VYI A;  4IWB A;  1Y6I A;  3S90 A;  4PS7 A;  4KT6 B;  3ABM E;  4K03 A;  3I4R B;  3C62 A;  3LNM B;  4DRH B;  5JJT A;  3ZGQ A;  4U9D A;  4YL1 A;  2KYH A;  1S64 A;  2EIK E;  4KC9 A;  1PD0 A;  1HFA A;  5D2M C;  1UOH A;  2WXR A;  1O1R A;  3ZRH A;  4HB5 A;  3KS2 A;  4IB4 A;  4YT8 A;  4GZD A;  4MQ9 F;  2WVQ A;  1YYX A;  4ANU A;  4MVZ A;  4CJG A;  4HRL A;  3NMI A;  3EH1 A;  3S27 A;  3SZR A;  4JB8 P;  5D66 A;  4BT9 A;  2VC9 A;  3JYY A;  3NZU A;  4WGZ A;  4JCH A;  1SZI A;  3ASO E;  4FC8 A;  1YZA A;  4JEB A;  3DST A;  4HVB A;  1RKE B;  2XZT G;  1YYH A;  1FMV A;  3E30 A;  2LAI A;  2OND A;  1RCP A;  1TWH A;  4EBB A;  5FIO A;  4GMR A;  2VYI A;  3JRT A;  3FWV A;  4GTM A;  1OCO E;  4WND A;  3UIO C;  3EFO B;  4M63 A;  1PV3 A;  1U6H A;  3R9A B;  4I9C A;  5T4Y A;  5DQZ A;  3PZ4 A;  1RXQ A;  4GEH A;  2L6H A;  1JMW A;  3QDN A;  2VTB B;  1NSG B;  3E4B A;  1IZM A;  3U8V A;  4XLP F;  4NQF A;  5JHA A;  3PRZ A;  1MZC A;  4QDL A;  4CEM A;  1DOV A;  1BR1 A;  4BY6 A;  4HOT A;  4V3I A;  3GM3 A;  2I2O A;  3DZA A;  2BE5 F;  2Y3H A;  2XGM A;  2P6V A;  1G4U S;  1RMV A;  2FEZ A;  1N95 A;  1E96 B;  5HQ8 A;  4PJN A;  1EI7 A;  4LCT A;  4UWH A;  4G8K A;  3LXU X;  1J8Y F;  4L1B A;  3CZ6 A;  3MKR A;  3C8G D;  5G04 C;  1OWP A;  5AAO A;  3UT4 A;  2NSG A;  4GTQ A;  2PM6 A;  3ZFW A;  1WGW A;  5JSL A;  3UIP C;  2HJM A;  5DVW A;  2XS1 A;  2Y3D A;  3ZTM A;  4J6I A;  1FFH A;  5ARF A;  2VCC A;  4HFG A;  1TN6 A;  3UM0 A;  3V5X A;  3IV0 A;  2ZXP A;  3CVU A;  3LY9 A;  3T9O A;  4RLY A;  4AP2 A;  1JPL A;  1W3B A;  4G24 A;  1YCS B;  4OYS A;  4EQF A;  1K1B A;  4LRZ A;  1F1M A;  3UTM A;  2GRL A;  2GFH A;  1EYH A;  1YLM A;  1H6G A;  3EJN A;  4DK5 A;  4FP7 A;  3K1I A;  5ENS D;  2HM8 A;  3MZL B;  2ZGG A;  4LDR A;  5D0O D;  1TN8 A;  1G5Z A;  3SHF A;  1H9T A;  3AQC A;  3UR3 C;  3BRJ A;  3ASG A;  2IXP A;  3ZQV A;  4FJZ A;  2R5S A;  3ONK A;  1IW7 F;  4H54 A;  2MYO A;  4U0S A;  5AC5 A;  1N11 A;  1PAQ A;  1CPQ A;  3KSQ A;  3IQC A;  3LLK A;  1KLX A;  3DSU A;  1JCQ A;  3P1U A;  2HUJ A;  4AE4 B;  4C7O A;  1H6O A;  4KZC A;  2EPN A;  3CST A;  2LSE A;  2CDQ A;  2VSY A;  2HZ8 A;  2PZI A;  3CSF A;  4XX5 A;  3DAG A;  4IJJ A;  5DS5 A;  4PS3 A;  3VLF A;  3I4G A;  3DSW A;  2H7B A;  5AQ7 A;  1NP7 A;  5AQ9 A;  3T5X A;  2P9I G;  3RH3 A;  3N71 A;  2NSZ A;  3ZPJ A;  4ABN A;  3DKA A;  4RBN A;  2C04 A;  5CEC B;  2XM0 A;  5TJ5 E;  2QY9 A;  2R05 A;  1E8Y A;  4ER9 A;  3TL5 A;  3U3F A;  1JWF A;  2KSF A;  4B0Z A;  3CQG B;  3GZS A;  3DWW A;  3HNL A;  3FTX A;  3DXJ F;  4YJW A;  2YLD A;  4QI2 A;  3CLJ A;  2YHS A;  1M6T A;  4JEU A;  4YN0 B;  4BET A;  5E75 A;  1SYQ A;  3EDT B;  4AIF A;  5COG A;  3NB2 A;  5ANL A;  2H6I A;  4CGW A;  4E0I A;  1QVX A;  5B3I A;  2FUL A;  4G7O F;  3ZSU A;  4KBQ A;  3LY8 A;  2P2C P;  5AYW D;  2PF4 E;  2WMO A;  2LAH A;  2AVK A;  3ZDL A;  3ZYL A;  2WB2 A;  2JPU A;  3NAW A;  1U3D A;  2Z15 A;  4MS2 A;  2XXA B;  4ACK A;  1IKN D;  3RK6 A;  3JUI A;  3KEA A;  3LVR E;  5CER B;  4ZFH A;  3T6G B;  2R7U A;  3ZC4 A;  2DI3 A;  1OQC A;  2NUT B;  3BU8 A;  4N2Q A;  1L5J A;  3B7T A;  4YDE A;  5KYX A;  1Q0F A;  4EBK A;  1SA5 A;  1I4Z A;  1N54 A;  4GZ6 A;  3N2Z B;  1ZU5 A;  3GEI A;  4Z9J A;  4GML A;  4AY6 A;  4B94 A;  1UJJ A;  3KSL A;  2H7O A;  4EWC A;  1MQV A;  3ESL A;  4BTA A;  5FIN A;  2HO1 A;  2QLA A;  1X81 A;  4OD4 A;  2WXK A;  2A0U A;  3C98 A;  3HDX A;  2W9Y A;  3DE9 A;  3CKB A;  3CVQ A;  4IAQ A;  4W8P A;  1TNZ A;  4XZ4 A;  1D0X A;  1DC2 A;  4K0D A;  4BJ5 A;  3R2P A;  2PNO A;  4KI2 A;  3AGU A;  3RYL A;  3DI5 A;  4DBQ A;  2AXU A;  3CHS A;  3TWS A;  1QLE C;  1ST6 A;  3QTH A;  2KW3 C;  1YJG A;  5F5H A;  2EPK X;  3IXE A;  4DX2 A;  2HMQ A;  4PUC A; 
#chains in the Genus database with same CATH homology
 5C2Y A;  4ANV A;  2VSO E;  2PQR A;  3B0V C;  3U66 A;  3SZ7 A;  3EPV A;  5CHE E;  2YHC A;  4GZC A;  3UT8 A;  4DI3 A;  5DLJ A;  4M3O A;  4CCA A;  1E7U A;  3O6X A;  2E0I A;  1NU9 C;  3ABL C;  3O39 A;  3RIB A;  3K1H A;  3PH0 C;  1NZE A;  4I3M A;  3L54 A;  5E3C A;  2KCL A;  3UQ3 A;  4PFP A;  3B0P A;  2I6H A;  2IQC A;  2P58 C;  5KJK A;  2ZXR A;  3OXG A;  3T6J A;  3UNG C;  1S7Z A;  3CSK A;  5CCM A;  2VGX B;  2VSX E;  2IXM A;  2IOQ A;  3GZ1 A;  3IEG A;  3MA5 A;  4O6F A;  4JEH A;  4U5C E;  1VYK A;  3O4Z A;  3N24 A;  3SNX A;  3QZC A;  2VTB A;  3CHO A;  4C0E A;  3EHN A;  3S2A A;  3JYH A;  5FTP A;  4ZLC A;  3KL4 A;  5T8I A;  4YT2 A;  4EEC A;  3CKC A;  4XTK A;  4WNG A;  5KYN A;  2V3C C;  2JEK A;  3AQB A;  2MRI A;  1ELR A;  3U3W A;  2EIM C;  4N3C A;  3LNR A;  4JXT A;  5BT1 A;  1HZ4 A;  3SBS A;  5L3Q A;  4Q96 A;  3QMK A;  1SQM A;  4PK4 A;  1ZHZ A;  1O5H A;  2PFD A;  3FTU A;  3M1C B;  2FGY A;  3RFY A;  4J0U A;  2WZF A;  2R7S A;  1WAO 1;  3SNH A;  3TG5 A;  3EGX B;  3DBS A;  2W45 A;  3CIA A;  5LFA A;  4E6H A;  4HXI A;  4WUY A;  1Z6A A;  1ZBP A;  4E7S A;  3LKU A;  3ZIM A;  5D0Q D;  3Q7G A;  1JUQ A;  3CHM A;  2CHW A;  2EIJ C;  4PJM A;  3W8H A;  4DVZ A;  2IJG X;  2QY7 A;  1UN8 A;  4LEU A;  1FVH A;  4C3D A;  4G7Z F;  3U64 A;  1O87 A;  4TRQ A;  1ELW A;  3L13 A;  5BW8 C;  3PEV B;  4GU5 A;  3EGD B;  5BV1 A;  3FUJ A;  2J9U A;  3DJN B;  4HFK B;  2ION A;  3FEX A;  2OOE A;  4A3V A;  3PS6 A;  3HIZ A;  3MKQ B;  4AM9 A;  4Q5S F;  2EIN C;  1KU2 A;  3CVL A;  3LAY A;  5EDS A;  4YVO A;  2LSV A;  4J8D A;  2E2E A;  5DS6 A;  4PH4 B;  2ZXW C;  4UWF A;  1LKX A;  2XXA A;  3K7D A;  1ZU4 A;  4UQY A;  5LCW J;  4CS8 A;  5B3S C;  2IU1 A;  1M2V A;  3SD5 A;  2KC7 A;  3D9N A;  4HLE A;  4U5B E;  2PQN A;  2E87 A;  3EZH A;  4KBL A;  2FI7 A;  4ULW A;  3L08 A;  2X51 A;  1P5Q A;  1WM5 A;  1TWA A;  4JPS A;  1WY6 A;  4KNV A;  2XPZ A;  1Z63 A;  4YT5 A;  1DNP A;  2YQ8 A;  4G23 A;  3U9W A;  2A4Z A;  3FDH A;  5EGY A;  2BF0 X;  2J49 A;  3UMK A;  4BTB A;  4FU3 A;  2L81 A;  2QFC A;  5KYY B;  4CIH A;  2JD3 A;  2EIL C;  2VQ2 A;  1M57 C;  2L9J A;  4ANJ A;  2R7X A;  3ITF A;  4C3E A;  5B1A C;  4AJW A;  3ML8 A;  2A5U A;  2IYL D;  5BNW A;  3ENE A;  4FLB A;  3ZXS A;  2KZT B;  3FU5 A;  4TV3 A;  3QAR A;  2CW0 F;  2L0T B;  1A17 A;  3OXF A;  3CVP A;  4GA2 A;  2J0X A;  2PP4 A;  1N52 A;  4C9B B;  4JHJ A;  1MQS A;  2VGX A;  4DBR A;  4IUL A;  1H2U A;  5JJ7 A;  3QAQ A;  3RKV A;  5T3T A;  3QNK A;  4BT8 A;  4UWL A;  3HLZ A;  4LUN U;  4CT0 A;  1E90 A;  2WZL A;  2XRY A;  3SBT B;  1UW4 B;  1OWM A;  3SP1 A;  3B0U X;  3ASN C;  4HFF B;  3Q15 A;  4I17 A;  4KMO A;  1SZ9 A;  4WWN A;  4WWP A;  2OVB A;  4LLC A;  3AU4 A;  4AY5 A;  1QZ2 A;  2J09 A;  1JWG A;  3L17 A;  2KAT A;  3PUJ A;  3WG7 C;  4OVU A;  3FY4 A;  4ILG A;  3QWW A;  3ML9 A;  3AG4 C;  3SI5 A;  4BX8 A;  3AG3 C;  3FTS A;  4I6E A;  3ZHE B;  4PJL A;  2VJ8 A;  3NF1 A;  3U4T A;  1Z3X A;  4NRH B;  2GW1 A;  4BJ6 C;  1D0Z A;  2ZXO A;  3ECS A;  3EGX A;  1U3C A;  4DVY P;  2UY1 B;  3PMR A;  3CK7 A;  2IXO A;  4JZA A;  5FCL A;  4L2Y A;  2DGJ A;  5J08 A;  3FEY A;  3NRH A;  1IHG A;  3L0I A;  3EIJ A;  3APD A;  4N2S A;  3RIP A;  3VTX A;  4HOS A;  1ZHT A;  3UMI A;  5D92 A;  5FJY A;  2A69 F;  4ZLD A;  2R59 A;  1H2T C;  2X6F A;  3EQL F;  3FUF A;  4CSA C;  2WXJ A;  3K66 A;  2WXH A;  1EPU A;  3NG1 A;  4U5D E;  4XWJ A;  4E85 A;  4UWG A;  4DLQ A;  1QQE A;  2BUG A;  3Q4A B;  3KEZ A;  1MMN A;  2Y3G A;  2XSE A;  2Y3A A;  4BEJ A;  3ZG1 A;  3Q47 B;  4GA0 A;  1MND A;  3VTY A;  3MKQ A;  3IKO B;  2WVI A;  3AG1 C;  3NZS A;  3I5P A;  4WJ0 A;  1LVK A;  2NC9 A;  3NYL A;  4QI0 A;  3H65 A;  1Z3Y A;  4L7T A;  1INZ A;  5EHH A;  5KYU B;  1PY1 A;  4O6M A;  3DD7 A;  1QZX A;  3UGP A;  3MLG A;  4IN3 B;  2IOL A;  2NG1 A;  2IXN A;  2PL2 A;  5FT9 A;  2I8B A;  1KT0 A;  4BJT A;  2WQH A;  3E9V A;  5L3V A;  2J0W A;  3AG2 C;  3I3N A;  4I6J A;  4WAF A;  3IBE A;  1TJC A;  4P29 A;  3LDZ A;  3BEE A;  5DIZ A;  2AXV A;  2LSU A;  4U5E E;  1Z6T A;  4RG9 A;  3CHP A;  2WQ6 A;  3CQC B;  1MMD A;  4ATG A;  1ZYR F;  1PC2 A;  4XE0 A;  3FTY A;  1MNE A;  1H2V C;  3ZIB A;  3LJ3 A;  5CMW A;  2RD0 A;  2YNQ A;  4RVB A;  4F1S A;  5KYY A;  1VK5 A;  4MLP A;  1JPJ A;  3KH2 A;  4FHK A;  3SYN A;  4KVM A;  2MWQ A;  4FHJ A;  3CVV A;  3JCK C;  2KCK A;  2WXQ A;  3IHY A;  5CCL A;  1RJ9 A;  4UI9 C;  1J8M F;  3CVY A;  4Y6W A;  4RD9 A;  3L34 A;  2KZT A;  1FTS A;  3G2T A;  2V0P A;  3NYJ A;  3LEV A;  4U07 A;  3S7B A;  5T1D B;  2A68 F;  5KYW B;  4J30 B;  2OCC C;  3JSZ A;  2XL4 A;  1OWO A;  2NUP B;  1BR2 A;  2LNI A;  3MGB A;  1UJK A;  2CHX A;  1OWN A;  2J08 A;  4HOQ A;  3X2Q C;  5D91 A;  4KNW A;  5A6C A;  4Q7C A;  3ESK A;  4O79 A;  2AVP A;  3I5Q A;  5AIJ A;  4J8S A;  4FWV A;  2Y4T A;  4U8H A;  1Z23 A;  4FX5 A;  3PRE A;  4H7X A;  5G04 J;  1HX8 A;  5EX3 A;  4KYO B;  1BR4 A;  2FFH A;  1UG3 A;  3JQ0 A;  3HJC A;  4BFR A;  3PE4 A;  4OVV A;  4ANW A;  4AXH A;  3EH2 A;  3Q6M A;  3B9Q A;  3Q49 B;  4B6I A;  4Y6C A;  4J8F A;  3S7F A;  1FFT C;  3RU0 A;  3FHD A;  3HVE B;  4A1G A;  5LX8 A;  3EFO A;  5LCW C;  4NQ0 A;  2L6J A;  3UT7 A;  3TAX A;  4U0Z A;  4BSX A;  3DM5 A;  5G05 C;  4A3T A;  2UY1 A;  2J4B A;  1V54 C;  1QNF A;  4OIR F;  3VLD A;  5FZQ A;  1NA0 A;  4I2Z A;  3DM9 B;  4XLN F;  4W8K A;  2KJG A;  3L6A A;  1Y8M A;  2J9V A;  3FUM A;  2GRM A;  2AXZ A;  2Y4U A;  1DVP A;  5FQ8 A;  2KQ9 A;  3BG1 B;  1FCH A;  4F7A A;  4JHR A;  4GA1 A;  4GYW A;  3EG9 B;  2Y39 A;  4B8C B;  3ZYQ A;  5KCM A;  4U5H A;  3T5V A;  4QFV A;  1ZHW A;  2J07 A;  4ANX A;  3CVN A;  2R17 C;  3JYS A;  3FAJ A;  2B0J A;  4PDX A;  2Y69 C;  1IQU A;  4I1A A;  4APF A;  4I9E A;  3G2S A;  1IYG A;  4AE4 A;  2LO6 A;  4KZ0 A;  3N0T A;  3ASF A;  1D1C A;  4G2V A;  5ARG A;  3NKD A;  2KNH A;  2W4B A;  2XHE A;  3FUK A;  1ELK A;  2X6J A;  3MEK A;  5B1B C;  4JA9 A;  2Q3T A;  3KAE A;  3PHF 2;  3GAN A;  3JT1 A;  3LCA A;  2WXI A;  2J45 A;  2WVO A;  5DS4 A;  2RG8 A;  1W2W A;  4HE8 D;  2WXN A;  3DMD A;  4JHK A;  3D9O A;  1XGW A;  5FQ6 A;  4XI9 A;  3QKY A;  4C0M A;  4HS2 A;  1HF8 A;  3T6B A;  4PFO A;  2WXG A;  4GZ5 A;  2J7P D;  3Q6N A;  1TKN A;  4CDM A;  2NUT A;  3EIQ C;  1SF8 A;  1X5B A;  4G25 A;  3AU5 A;  4CGV A;  3PNT B;  4DLO A;  4TUU A;  1LS1 A;  3FTZ A;  4G1T A;  5LP0 A;  3G2U A;  4YT4 A;  1NA3 A;  5CI8 A;  1VMA A;  2IFU A;  1SZA A;  2BTD A;  4C7O B;  4CT4 A;  4LLE A;  4JUR I;  3FTV A;  2WB7 A;  5JJ6 A;  3LEW A;  2A6E F;  5AEN A;  4CS7 A;  3PNL B;  3IHV A;  5ANR A;  1VOM A;  4JJF A;  2JLB A;  2L9B A;  2EQX A;  4EBA G;  2Q7F A;  3B13 A;  1OKK D;  3LS1 A;  4A1S A;  2G3K A;  5F5F A;  2G3V A;  3QWV A;  4U0U A;  4GMJ A;  3FH7 A;  5IY5 C;  3CK8 A;  4B89 A;  4JVS A;  4W9R A;  1TWG A;  3S29 A;  3WXX A;  3ABM C;  4RDA A;  2CG3 A;  1ZHY A;  2X6H A;  3AS8 A;  3TGO A;  2MOW A;  3TD7 A;  2C2L A;  4N3A A;  2J7P A;  2I9C A;  2EIK C;  4FAD A;  4PJJ A;  3V7O A;  2C0L A;  2MYS A;  5A23 A;  4WNE A;  3K6B A;  3FDQ A;  3FFL A;  1H0A A;  2VB6 A;  3ONL A;  3HVE A;  3ASO C;  3APF A;  3DJU B;  3B7R L;  3CK9 A;  2MHK A;  3ZYM A;  4GZ3 A;  1HS6 A;  3PE3 A;  3TXN A;  4EZK A;  1OCO C;  1OKK A;  4A2N B;  3LJB A;  4FLH A;  3GYZ A;  1N1C A;  3IEE A;  3TG4 A;  4GAA A;  4GCO A;  3GOD A;  2R7Q A;  3W8I A;  4JC8 A;  1HO8 A;  4CDR A;  4CSA A;  3RO2 A;  1EF1 C;  3ZVV A;  3K33 A;  3POV A;  3EG9 A;  3T4R A;  4CS9 C;  1HH8 A;  1OWL A;  4EZJ A;  4N5C A;  4UQZ A;  1FMW A;  4CDN A;  4MND A;  2Y3B A;  3LS8 A;  4BG0 A;  3FHE A;  2WVN A;  4UI9 K;  4GYO A;  1NU7 D;  3PZD A;  3LYA A;  1TJF A;  2A1D D;  3FUH A;  3LPZ A;  3UGO A;  3LES A;  2WM9 A;  2WQ7 A;  3PEU B;  2DCP A;  1ZU2 A;  4Q4Z F;  3NQP A;  3B7U X;  4OIN F;  3Q7L A;  2CNW D;  4I1M A;  1HG5 A;  4I43 A;  3FU3 A;  5FZR A;  4U5F E;  2X6I A;  5E2Q A;  2J46 A;  3OTN A;  2A6H F;  3OAW A;  1H6K A;  1Z3I X;  4I44 A;  2XRZ A;  2ILR A;  4E7Z A;  2G62 A;  2W4M A;  3EGD A;  3URZ A;  4WNF A;  4EBA A;  3KKB A;  3NYM A;  4XI0 A;  3SF4 A;  2NXP A;  1GW6 A;  1HE8 A;  4NUR A;  2HV6 A;  2KCV A;  3MV3 B;  1D1A A;  3QK0 A;  4I2W A;  2R7R A;  4FJY A;  3S28 A;  4ACL A;  1D1B A;  4GYY A;  5T3W A;  4JA7 A;  2CNW A;  4L23 A;  3D9K A;  1FVF A;  5E33 A;  1H19 A;  4G11 A;  4URK A;  3CQZ A;  3D9I A;  5EX0 A;  1S0P A;  1MMG A;  5EKQ D;  2V5F A;  4N3B A;  2M4E A;  1M56 C;  3RO3 A;  4GPK A;  2HR2 A;  2KM4 A;  3L22 A;  3R7Q A;  4F4B A;  3MYV A;  5KJN A;  4UQX A;  4XIF A;  5KJL A;  4HEA J;  3SGH A;  3FP3 A;  4J32 B;  3FU0 A;  5FWQ A;  4AV7 A;  2J9Q A;  3ZVR A;  4F53 A;  3D9J A;  4YVQ C;  4R7L A;  3RRU A;  3LS0 A;  4O6N A;  3VAY A;  3S0X A;  2PX3 A;  4HOU A;  2VH3 A;  3K1I C;  1SMY F;  3EHM A;  3EZI A;  3BG0 B;  3APC A;  2GGF A;  2WZG A;  2FBN A;  4O7G A;  3TJP A;  4DJA A;  4U04 A;  1M2O A;  1BPO A;  4F3V A;  4A55 A;  3PVL A;  4J8E A;  1LF8 A;  3LY7 A;  5BUZ A;  2V26 A;  4G7H F;  3OXL A;  1M2V B;  3JCU Q;  3UPV A;  2HV7 A;  1XNF A;  3MV2 B;  3ASH A;  2R7W A;  3FTW A;  3GW4 A;  2WMN A;  5KJM A;  2L0I A;  2VGY A;  1IQR A;  3WOD F;  3NKE A;  3VLE A;  1OCR C;  3VYW A;  3F47 A;  2OG2 A;  4GB9 A;  2CFZ A;  3QWP A;  2I1K A;  4IYP A;  4OIO F;  4KXK B;  4FES A;  4RSY A;  3I4U A;  2WXP A;  3OA1 A;  4AVX A;  5BUO A;  3AS5 A;  2J9W A;  2QTV A;  2O9X A;  3O48 A;  4BWR A;  4YND A;  2AWI A;  1EDU A;  5FZS A;  5AJL A;  4OD5 A;  4MS6 A;  1OCZ C;  2C03 A;  1NZN A;  1MMA A;  2VAS A;  2ZPA A;  3PDN A;  1G8X A;  4AX2 A;  3HYM B;  4YWQ A;  3ZHE A;  5J90 A;  2XRH A;  2ZU6 B;  4K7B A;  5DBK A;  1TR2 A;  3FH5 A;  5T3R A;  4FA6 A;  3TXM A;  4APO A;  2XGO A;  2D5R B;  2DYR C;  2CFU A;  4BJ5 C;  3AS4 A;  3F46 A;  4ME2 A;  4EZL A;  4GYT A;  2IF4 A;  2CHZ A;  5ENN A;  2XPI A;  2WXF A;  1OUV A;  3ZEF A;  3UMH A;  4XKB A;  2KGO A;  4I1O B;  3FH8 A;  2X3M A;  4AOF A;  1V55 C;  1Z5Z A;  2AW6 A;  2C0M A;  4KVO A;  3FUL A;  4AEZ C;  4H7Y A;  1JPN A;  3ZYK A;  4H4K C;  4IRU A;  3E70 C;  2V8S E;  1B89 A;  4AK9 A;  4JL0 A;  1TWC A;  3JQ1 A;  1OCC C;  2PX0 A;  2P7V A;  5A7D B;  3D3M A;  4JJG A;  2YIN A;  3MX3 A;  3DAF A;  2FF4 A;  2IOS A;  2WXL A;  3SEO A;  3RRM B;  3L16 A;  3MCX A;  4N06 A;  3LVQ E;  3QB2 A;  4Q69 A;  1UN9 A;  4UI9 J;  4RG6 A;  3G2V A;  3ZN3 A;  3CHR A;  4IAO A;  5CI9 A;  1KT1 A;  5KYU A;  2FO7 A;  4DPR A;  3UUX A;  3W2V A;  2R7V A;  2CG2 A;  4OIP F;  5M72 A;  2XEV A;  3QOU A;  1MHQ A;  3QJZ A;  3S7D A;  3RJV A;  5BV0 A;  4ILI A;  3DPD A;  4I6G A;  3RKO F;  5E3A A;  1PD1 A;  2PM7 A;  4LAC B;  5HI7 A;  2X6K A;  3FUD A;  3OEO A;  3HHM A;  3X1O A;  3Q5M A;  3LLI A;  3PUK A;  2WXO A;  4ILH B;  3FUE A;  4CRW A;  4WWO A;  5CMY A;  4NAC A;  4B8A A;  2WPV A;  3QC1 A;  2YZS A;  3UX4 A;  4DOZ A;  3KD7 A;  5AJD A;  3CGH A;  2I1J A;  2X38 A;  4UWK A;  3HTK C;  5C1D A;  4D10 C;  4L2L A;  4P6I C;  1E8Z A;  3B7S A;  3MJW A;  5FQ4 A;  1VDY A;  4K0R A;  3CVX A;  3UMV A;  4O6Y A;  1ZHX A;  4Q94 A;  4CBE A;  4JW1 A;  4OIQ F;  3SFZ A;  3GZ2 A;  5HSW A;  5FQ7 A;  3KMI A;  3CEQ A;  5KYW A;  4FUL A;  5DQT A;  4MRU A;  2NUP A;  1D0Y A;  4G26 A;  5LOZ A;  3W2W A;  1HG2 A;  2XQ0 A;  4U5G A;  2WXM A;  1E8W A;  4XKC A;  3FU6 A;  5G05 J;  2DBA A;  3T8M A;  2WL8 A;  1HU3 A;  2J4D A;  3FUN A;  2V4L A;  2Q9A A;  2XCB A;  3CHQ A;  4EPZ A;  3CR3 A;  4DI4 A;  4NY3 A;  1HXI A;  1E7V A;  3OWT A;  2DIW A;  2HYZ A;  2XGS A;  3ULQ A;  2H7V C;  3ABK C;  1PCX A;  1NG1 A;  3D9L A;  4CS9 A;  3D9P A;  5BPP A;  2M63 A;  1E8X A;  5KYX B;  3K9I A;  3R7R A;  4JZY A;  2UWJ G;  4GCN A;  4U63 A;  3CVW A;  1RJ9 B;  4CS8 C;  3P2B A;  5G2N A;  4C3B A;  4N39 A;  3RRN B;  2OV8 A;  4MKT A;  4BJ6 A;  3S7J A;  3NDB B;  5G55 A;  1TEZ A;  2Q9C A;  3G2W A;  2R7T A;  5JHB A;  2CGE A;  2OVF A;  2XPY A;  3FVY A;  4BX9 A;  2DYS C;  1YA0 A;  4BJ1 A;  2Q9B A;  3CV0 A;  3ZW3 A;  3D9M A;  2VSN A;  4LER A;  4PS8 A;  2R7O A;  3FUI A;  2XCC A;  2YEV A;  4G0H A;  3ASD A;  4X0R A;  4HOR A;  2YHE A;  1VYI A;  4IWB A;  1Y6I A;  4PS7 A;  4KT6 B;  4K03 A;  3I4R B;  5JJT A;  3ZGQ A;  4KC9 A;  1PD0 A;  1HFA A;  2WXR A;  3ZRH A;  3KS2 A;  4YT8 A;  4GZD A;  4MQ9 F;  2WVQ A;  4ANU A;  3EH1 A;  3S27 A;  3SZR A;  4BT9 A;  3NZU A;  4JCH A;  1SZI A;  4FC8 A;  4HVB A;  1FMV A;  2LAI A;  2OND A;  1TWH A;  4EBB A;  2VYI A;  3JRT A;  3FWV A;  4WND A;  3EFO B;  4M63 A;  3R9A B;  4I9C A;  5T4Y A;  5DQZ A;  4GEH A;  3QDN A;  2VTB B;  3E4B A;  1IZM A;  4XLP F;  5JHA A;  3PRZ A;  4QDL A;  4CEM A;  4BY6 A;  1BR1 A;  4HOT A;  4V3I A;  2I2O A;  3DZA A;  2BE5 F;  2Y3H A;  2XGM A;  2P6V A;  2FEZ A;  1E96 B;  5HQ8 A;  4PJN A;  4LCT A;  4UWH A;  3LXU X;  1J8Y F;  4L1B A;  3CZ6 A;  3MKR A;  5G04 C;  1OWP A;  3UT4 A;  2PM6 A;  3ZFW A;  1WGW A;  5DVW A;  2Y3D A;  4J6I A;  1FFH A;  5ARF A;  4HFG A;  3IV0 A;  2ZXP A;  3CVU A;  3LY9 A;  4AP2 A;  1JPL A;  1W3B A;  4G24 A;  4OYS A;  4EQF A;  4LRZ A;  2GRL A;  2GFH A;  1EYH A;  3EJN A;  4DK5 A;  4FP7 A;  2HM8 A;  3MZL B;  5D0O D;  3SHF A;  3AQC A;  3UR3 C;  3ASG A;  2IXP A;  4FJZ A;  2R5S A;  3ONK A;  1IW7 F;  4U0S A;  1PAQ A;  3LLK A;  1KLX A;  3P1U A;  4AE4 B;  4C7O A;  4KZC A;  3CST A;  2LSE A;  2CDQ A;  2VSY A;  4XX5 A;  2PZI A;  3CSF A;  3DAG A;  4IJJ A;  5DS5 A;  4PS3 A;  3VLF A;  3I4G A;  2H7B A;  1NP7 A;  3T5X A;  3RH3 A;  3N71 A;  2NSZ A;  3ZPJ A;  4ABN A;  4RBN A;  2C04 A;  2QY9 A;  1E8Y A;  3TL5 A;  1JWF A;  4B0Z A;  3CQG B;  3GZS A;  3FTX A;  3DXJ F;  4YJW A;  4QI2 A;  3CLJ A;  2YHS A;  4JEU A;  4YN0 B;  5E75 A;  3EDT B;  4AIF A;  5ANL A;  4CGW A;  2FUL A;  4G7O F;  3ZSU A;  4KBQ A;  3LY8 A;  5AYW D;  2PF4 E;  2WMO A;  2LAH A;  3ZYL A;  2WB2 A;  1U3D A;  2Z15 A;  2XXA B;  4ACK A;  3RK6 A;  3JUI A;  3LVR E;  2R7U A;  3ZC4 A;  2NUT B;  4N2Q A;  1L5J A;  3B7T A;  5KYX A;  1N54 A;  4GZ6 A;  3N2Z B;  1ZU5 A;  4GML A;  4AY6 A;  4B94 A;  1UJJ A;  2H7O A;  4EWC A;  3ESL A;  4BTA A;  2HO1 A;  4OD4 A;  2WXK A;  3C98 A;  3HDX A;  2W9Y A;  3CKB A;  3CVQ A;  4XZ4 A;  1D0X A;  4K0D A;  4BJ5 A;  4KI2 A;  3RYL A;  4DBQ A;  2AXU A;  3CHS A;  1QLE C;  1ST6 A;  2KW3 C;  5F5H A;  5E76 A;  4PUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...