3EHMA

Structure of bt1043
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
510
structure length
510
Chain Sequence
PLKYGARFMNMQQRVIPIGSPSLTTGPGNDLQNTDLISSGNYIGYFGNNNNWGFNNEANWNFTDSRMNYAYQNFYSQIFLPWNEIYEIAKDSDSPSEQAILEIANIVRNIAWLRATDVFGPIAYNSAGDGSIAPKFDSQEVVYRSMLADLSKSVELLNTISYSVMAQYDLIYNGNVQNWVKLANSLMLRIVVRVHFIDETLAKEYITKALDPKNGGVIEDISSEAKIKSSDKMPLLNSMLASVNEYNETRMGATIWGYLDGYKDPRLSAYFTEGTYGSGSWAQTGYFPVAPTNSKSKSETSYSAKFASRPKVDSNSPLYWFRASETYFLKAEAALYNLIGGDPKTFYEQGINISFQEQGVSGVATYLSGTGKPTGLTGSNYKYGTYNHDLSIGNTSPKWDDYTGNLSKQEEQLQKIITQKYLALYPNAVEAWTEYRRTGFPYLMKPMDEAAPGRIGASIEDCRVPERFRFAPTAYNSNPNMAEIPTLLGGGDIGATKLWWVRSNRPKQPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords SusD homolog
publication title Structure of a SusD homologue, BT1043, involved in mucin O-glycan utilization in a prominent human gut symbiont.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
total genus 180
structure length 510
sequence length 510
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12741 SusD-like Susd and RagB outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ehmA03
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ehmA01
5LX8A 3EHNA 3P1UA 5T4YA 3NQPA 3CK8A 3SNXA 3QNKA 3CK7A 4F53A 3MCXA 3MYVA 3GZSA 3MX3A 3EHMA 3IV0A 4PUCA 4Q69A 3LEWA 3CKCA 4F7AA 3CGHA 5E75A 5E76A 3SGHA 3L22A 4MRUA 3JYSA 5FQ8A 3KEZA 3HDXA 4L7TA 5FQ7A 5T3RA 3JQ0A 3I4GA 4LERA 3OTNA 5J90A 5FQ6A 3FDHA 3CK9A 3CKBA 3EJNA 3JQ1A 5FQ4A
chains in the Genus database with same CATH superfamily
2AW6A 1N11A 2PL2A 5EKQD 1UOHA 1G8XA 2VTBA 3FTXA 3VYWA 3F6QA 3CR3A 3CVVA 3JSZA 2LQGA 3UGPA 4B93B 2R2LA 3FEXA 3ZTZA 3T8MA 4HNAD 2KZTB 4A1SA 2ZXPA 4MW8A 5B3SC 1YVIA 4KMOA 4YDOA 3VM6A 2FI7A 3U66A 3RQEA 1EA8A 1MMAA 3JQ0A 1TNBA 3FU3A 5ENPD 2RD9A 1NFIE 3V30A 3UPVA 4LNGA 1YYJA 2XZDG 2HJMA 5CMYA 1K8KG 3V5XA 1ZHZA 3EFOA 3K9IA 5ITZF 3AGUA 3TWVA 4F53A 1JPLA 3ABLC 2WXLA 5JP7A 4NTBA 2DZNA 3NKDA 2BTDA 4UWHA 1WDYA 3RQFA 3L22A 3B0UX 2CDQA 1E7UA 256BA 2X51A 4FX5A 2RFAA 2GRMA 4ZLDA 1X5BA 2ETAA 2XLWA 3V5YA 4CJOA 3T8KA 1BZ4A 3AAAC 3U2LA 4HRMB 3Q5MA 3ASOC 4NIKA 4V3IA 3EQLF 3QNKA 3B7UX 2W9YA 2QTVA 3Q4AB 4BEMJ 2YHEA 4NURA 1DCQA 2OEWA 2YLGA 4JHKA 5EIDA 4BX8A 3GM1A 5E3AA 3FUIA 5FCLA 3PZDA 5M72A 1FFTC 3T4RA 3KEZA 3G2UA 3CSTA 2IOQA 2R59A 3L9TA 2VYIA 4TUMA 3FY4A 3QAQA 1MMNA 3H65A 1DVPA 5A23A 5L0GA 1MHQA 3P1UA 3NQPA 4JA9A 1G5ZA 4GMLA 4L2YA 4K1OA 5KYUA 3C62A 4NTAA 4A63B 2EIMC 5ANRA 3SO8A 3QTHA 1ZVZA 4CEMA 4URKA 3Q7GA 3PREA 4AE4A 4BX9A 5C2YA 3N24A 3SXYA 1LI5A 4P6IC 2P9UG 3FFLA 5J08A 5FTPA 3S84A 3CK9A 3LUTB 3HVEA 5IY5E 5E2QA 1HF8A 1I4ZA 2LAHA 2J9WA 3IQ6A 1Z3XA 2WXNA 2ASRA 3I5PA 1ZW2A 2DI3A 2KYHA 1H0AA 3S28A 5CIVA 1ZHWA 4G24A 2ZPAA 3UR3C 1LIHA 3DSXA 1M6TA 4AOFA 4OIQF 5JJTA 2IEJA 2YL1A 3ASGA 2BE5F 3EG9A 1SYQA 4XPYA 1Z6TA 2VB6A 5B1AC 1PD0A 1OW7A 4RLYA 2HS5A 3HXBA 3CZ6A 1JWFA 4N2QA 3PRZA 3ZN3A 3FTVA 2X6JA 1LD8A 3MCXA 2CGEA 3L17A 3Q73A 2CW0F 2XLDA 3MFNA 2J45A 3DZAA 2YINA 5BW8C 5AGFA 4U95D 1S05A 3MZLB 2XPIA 4L9PA 3B7TA 3C98A 4JKVA 5ENSD 4JC8A 3TWUA 4EZJA 3TJ5A 2GAQA 1WG0A 2GWWA 2AWIA 1OR3A 2PM7A 4HOUA 5KJKA 5EK0A 4UWKA 5DS4A 3IQTA 3UI2A 2F8XK 2GGFA 2IBFA 3EHQA 3BRJA 3FWVA 4F1PA 4I2WA 3OXGA 1A0BA 5AQ9A 2IY0C 3ZQYA 2YHCA 4XI0A 2PF4E 4LDRA 1H6PA 3I4GA 3ESLA 1VLTA 3TULA 3PDMP 2OOCA 3UIOC 2M4EA 1VYKA 3NF1A 4IGGA 4F6RD 1QLEC 4TXPA 2P2CP 1NU7D 3U9JA 5LP0A 2MYOA 3TL5A 2Q7FA 3PEVB 5L0DA 4L2LA 4X8QA 2HZ8A 5FQ8A 3TG5A 3HXEA 2LFDA 4P9FA 1YAUO 3ZIBA 1IZMA 2KW3C 3ABMC 4D4XA 1TJCA 1P5QA 2EIJE 4JC7A 5CRVA 4O79A 1O87A 2KJGA 3LYAA 3MKRA 3FUDA 5AYWD 5DBKA 2VSNA 4C48B 2Y39A 4G23A 2H7OA 1TQGA 4FU3A 3B29A 5CMWA 2ZIRA 4J6IA 1E83A 3CVQA 1FMVA 3ZHEB 5B1BC 4BSZB 2OCCC 5JHAA 3V79K 3LY7A 3NYLA 1QSPA 2WZLA 4UI9C 4ANUA 2OEXA 4CDVA 3MEKA 2EPOA 3E4BA 1YJGA 5T8IA 4KNWA 1NP7A 3IHVA 2NUPB 4G7ZF 3V2OA 5KCMA 3X1OA 5AAOA 4K5CA 4OAVB 4F7AA 4G11A 2CNWA 5AQBA 3N2ZB 2XEEA 5EILA 3L6AA 3HXCA 1NZNA 3Q79A 1HW1A 3S90A 2QFCA 5F5FA 2L7AA 3C8ZA 3C8GB 4N06A 2V5FA 1T01A 2J9BA 4F4BA 3S2AA 4I6GA 1NLXA 2H6GA 3AOUA 1SVXA 3T6GB 3BEHA 2H7VC 1ZHYA 2VGXA 1ORYA 3MX3A 3LVQE 4R32A 2HFIA 1ZBPA 1JR8A 1HW2A 3TOMA 4R7LA 4BPMA 3PHF2 2Y3GA 1OWOA 1J8YF 2M64A 4YK5A 1A17A 3Q49B 5G05C 1RW2A 1U3CA 4W9RA 3LCAA 5JLIA 2GW1A 4XEVA 1H6OA 1E7VA 1L3PA 4JE9A 4DBQA 4CDNA 1UW4B 3M15A 3HKKA 5LX8A 3ZIMA 3RW0A 3N0TA 1MYOA 5BV1A 4XPXA 5A6BD 5ENNA 1TWAA 5FZTA 4CS9C 4WJ0A 1MX4A 4YT5A 1O5MA 1MX6A 4Q94A 2ZU6B 2L6FA 4CT0A 3FVYA 1E84A 3U3WA 2KBXA 2AXUA 3C3OA 3QVZA 3RQGA 4OIOF 5AC5A 1UJJA 2XXAB 3ZXPA 4RD9A 4B6IA 1TR2A 2J0XA 1V4AA 3B0PA 3AJMA 1M57C 5EHHA 3GWNA 3S7FA 3MYVA 3UM3A 1JCRA 4PS7A 5G55A 3HYMB 4HI9A 1HE9A 1FT2A 3NOCD 4BFRA 4CS9A 5DQTA 3Q7LA 3SP1A 4X0RA 3L8JA 1HXIA 1ZW3A 3W8IA 2J49A 1NL4A 2WXFA 3K7DA 1TR4A 5L0IA 3KKBA 4LEUA 1Z6AA 3NRHA 2YWAA 1ZU5A 4ANJA 3NYJA 4N6HA 3V5ZA 2NPUA 1NSGB 3IXEA 4CS8C 1S0PA 3B9QA 2H6IA 2PNOA 2LXMA 5JJ6A 3F47A 3KL4A 3L54A 1H7IA 1QQ3A 1BDJB 2KCKA 2LD6A 3EGXA 3FUJA 1LPEA 2EIKE 2XEHA 2HSQA 1EI7A 3JYHA 1E96B 2FFHA 5DS6A 5T3WA 3EJNA 1EDUA 3AU4A 4GTPA 5KYWB 1U3DA 3KAEA 2DYRE 3AU5A 1OKKA 2WXRA 3E37A 3LDZA 1BU9A 3US6A 3JYYA 3D9OA 4G1TA 2Q3TA 3CK7A 1A7VA 2R5SA 2KK1A 5JUAA 5FIOA 4QFVA 4I6JA 4AM9A 4J8FA 4UWGA 2Y3AA 3FTSA 3CVNA 3RIPA 3BUAA 5CCMA 3B7RL 2Y1LE 3I4RB 4GU5A 3QWWA 3CQGB 3FTZA 4K5AB 3Q47B 1E85A 1OCOE 4Q69A 1LTXA 2Q00A 1Z7Qc 2VSXE 2ONDA 4XIFA 1FTSA 3RYLA 4FULA 4GQHA 4JURI 4I9CA 4JEUA 1MX2A 1YMPA 3FH8A 2GA0A 3L34A 4JJFA 4XLPF 4Q7CA 3CKBA 3G2VA 2P6VA 5COFA 3R2PA 3ASNC 2BKKB 4APOA 1RKEB 3CHPA 4I43A 2J8WA 1EPUA 4BWRA 3I4UA 2M63A 3U4TA 4ZLCA 2L6JA 2EPNA 4LACB 1E86A 3DXJF 4DVYP 3NDBB 1EQ1A 1TFOB 3UT7A 4DVZA 4LNBA 4YDEA 2AXZA 1TN7A 4RG9A 1FCHA 4G8KA 2NG1A 4CX9A 2HUJA 4CYMD 3FOPA 1SR2A 3PVLA 4Q5SF 4U7EB 5CEDB 3S0XA 2R9RB 5ARGA 3JUIA 2XS1A 3PEUB 1G4US 3TG4A 2LSUA 2J7PA 3ULYA 1E2XA 4G78A 3NG1A 2MHKA 3CSFA 3CVWA 1ZB1A 4BT8A 4C9BB 2CHZA 1H6GA 3U5SA 4IN3B 3O4ZA 1EYHA 2PP4A 1H9GA 5DIZA 2WB7A 1LF8A 1U6HA 4N3AA 3SFYA 2IYLD 5DQZA 1QZXA 5HKPA 3PE3A 1V55C 3R7QA 2QLAA 1PC2A 5BUZA 3OA1A 5FT9A 3WAQA 4PUCA 4AIFA 3RKOF 3ZU7B 3LS0A 3ZYLA 2CFZA 1HMDA 3ML9A 3LJBA 1VLSA 2R7XA 3TD7A 3JRMO 3E30A 4BTAA 1V74B 1D1AA 4GTTA 5TJ5E 2HV6A 1Z5SC 4I1OB 1YARO 4U96D 3HIZA 5A69A 3UT4A 3KMIA 5E33A 2R7RA 4NC3A 4U5DE 1CPQA 2NUPA 1BPOA 4Z9JA 3SXKA 3U9MA 3DSWA 2C0MA 1WOLA 1V54E 4EQFA 4CBEA 3B95A 1OXKA 2VGEA 1NBBA 1TEZA 5A6JA 3JZ0A 2JX0A 3CAXA 3M4CA 4DOZA 2XRZA 1A41A 1UJKA 4U63A 4M63A 3NKEA 3C8GA 1OCRE 2KCLA 1LE4A 4LSZE 3K33A 5CEAA 2FO1E 4ER9A 3H2VA 3CHMA 1D1BA 2A4ZA 2LIGA 4WAFA 2GDCA 2UUIA 1E90A 4OINF 1LS4A 1XGWA 2IXOA 2OJED 3ABKC 3HNKA 2X0CA 2XCCA 3ESKA 4I17A 1F1MA 1S64A 3X2QE 4JHRA 2LO6A 1IQUA 4CRWA 2WXJA 2XL6A 3EZHA 3SZRA 1Y4CA 4CS7A 1KZOA 1TWGA 1N94A 1TNYA 3U8VA 4J7TA 4KBQA 4DX1A 4GPKA 3CKCA 1XZQA 2XLOA 2OEVA 4HRLA 5CBNA 2NC9A 5KYYB 2HV7A 3KYJA 4ONSA 2AU5A 1TYQG 2I6HA 4N39A 4CDYA 3J5PA 4ABNA 1XWJA 2VCAA 3QZCA 3ZG1A 1B89A 4F1SA 5AJLA 4C0MA 1NA3A 1QNFA 3GANA 3AG1C 4YT4A 2PZIA 4PFOA 4A2NB 4O6MA 2XXAA 3DSTA 4BJ1A 3IEGA 2X6KA 4DRXE 2QZAA 3ZQVA 4PACA 2IFUA 2D4UA 2WB2A 2PBEA 3LVRE 2P9PG 3Q6MA 3FDQA 4IJJA 2XLMA 3DMDA 3CEXA 1VMAA 3CVPA 1IXVA 4PS3A 2GRLA 1D9SA 2ZGDA 3J5QB 2WXGA 3LNMB 3B71A 4DI3A 4EIYA 4XI9A 3MYFA 2UY1B 1KT0A 2YRFA 3DRAA 3ZRHA 5B3SE 4KZ0A 4D4NA 1E8YA 1VK5A 4AJWA 1YZAA 4O7GA 3UKUG 5ENQD 3ZDLA 2FGYA 4CDMA 3SEOA 2WM9A 2R25A 3G2SA 4JTAB 3ML8A 2WQ6A 2ZD9A 3UMHA 2IO3C 3ABLE 2IXPA 1TWCA 4GCOA 3K1IC 1K3ZD 4JL0A 2I9CA 2DYSC 3PZ3A 1B68A 5FZQA 4JRZA 4MNDA 3NAWA 3ENEA 5KYWA 1WGWA 3EU9A 3E33A 4MVRA 1UG7A 3EIQC 1NZEA 1GM5A 5KNHD 3ATPA 1MMDA 3ASOE 3AQCA 4LERA 3CLJA 4DX7D 2OVFA 3RKVA 3FXHA 4HLEA 3AS5A 4LLEA 5BXUA 4CJGA 3ZVVA 3QJZA 3K1IA 3SXZA 1UG3A 5CHEE 3CVYA 4U8HA 1OWLA 1MNDA 4HXIA 3CVUA 4MTFA 5HS0A 5BV0A 1T5OA 2P9KG 3FU0A 3AJIA 5FINA 4CIPA 4U0SA 1Q0FA 4XPWA 3B7SA 4I44A 3V31A 1TWHA 2UUHA 1R5ID 2YZSA 4FWVA 4GZDA 2EIME 3ONKA 2X38A 3TXMA 2ICWG 2EPMX 3RFYA 3LY8A 4J0UA 1RMVA 4U04A 4WABA 1YYXA 2PQRA 2A0BA 2XLHA 3ZUVB 4E85A 4E7ZA 1BD8A 3DSUA 1U2VG 4A3TA 4XTKA 2XHEA 5JS5A 1RKEA 5G05J 4BJ6C 2KM4A 3D9PA 3FTUA 3KS2A 2LFFA 2VJ8A 4EPZA 4XKCA 2VSOE 4YL0A 5KJMA 5KNGA 4B0ZA 4EHPA 2DB4A 1H2UA 4QQIA 3V2XA 2W4MA 4QI2A 1YYHA 5B1AE 1J8MF 3HTKC 3MLGA 3VTYA 5LFAA 2NUTB 3DM9B 1FT1A 1L5JA 3W2VA 4BJ6A 4KXKB 3G4XA 4DI4A 4O60A 4FJZA 4JHJA 5KYXB 3FHEA 3UUXA 3RJVA 3FH7A 3RH3A 3MV2B 4DLOA 1DC2A 5AN8A 5C1DA 5CBOA 2GRRB 2VGYA 2BC5A 2AXVA 4U5GA 3UX4A 3OXLA 4JJGA 1S7ZA 3W8HA 3I5QA 5E76A 3HLZA 2GRQB 3EH2A 3DSSA 4GCNA 3UMIA 5T3TA 2H6HA 1YA9A 4JCHA 1BLXB 1OUVA 4UUCA 3JTLO 2CNWD 4KI2A 5ENTD 3ONLA 4L23A 5EIBE 4AY6A 1U89A 3G50A 2MRIA 3D3MA 3KD7A 2NSGA 3FUHA 4DK5A 3QVYA 1ZHTA 3GEHA 3LXUX 3SD5A 1FR0A 4GMRA 4JZAA 1VTMP 4FLHA 2YHSA 5F5HA 1M2OA 2AP3A 3FOOA 1ZYRF 1T9KA 4Y6WA 4NACA 1H6KA 4IYPA 3Q7AA 4MVQA 4IAQA 4JD2G 1OW8A 3DAGA 3A9CA 3ABME 1VB5A 2LSVA 3LEWA 2WPVA 3JUEA 4JA7A 4NCQA 4U9EA 4BJTA 3W9GA 1SZ9A 3BU8A 4GEHA 2YEVA 4O6YA 3GZ1A 4NQFA 3SY2A 2KC7A 2OU6A 2B0OE 1Y6DA 2LUHA 4WGYA 5JSLA 3WG7C 3AG2C 4AL0A 4DX5D 4ILHB 2R7QA 5DVWA 5B1BE 2OCCE 1U0BB 2DVWA 2E2EA 4RG6A 2WVOA 1KNYA 2NXPA 5A6KA 3C3QA 3EZIA 2WQ7A 2PX3A 3FAJA 3FTYA 3GZ2A 2A5EA 2BEDA 2AWCA 4MW3A 5KBAA 2IQCA 4FAPB 4ILGA 4EUKB 5KYYA 5D2MC 2KZTA 5KYNA 2IONA 1OR2A 3KSQA 3U2MA 3SYNA 2KSFA 2R7SA 2HR2A 3UINC 5LCWC 2YVKA 5DLJA 1TKNA 3AGTA 2QNLA 3SXMA 4N6CA 2FEZA 2HE0A 3EH1A 4CSAC 2J08A 1YDIA 1E8WA 3FHDA 3CV0A 1OCZC 2IO2C 4BEJA 1E8ZA 2PQNA 4GTQA 5FQ7A 4BETA 3D9HA 1SQMA 2Q9BA 2ETCA 1CGNA 5FJYA 1X81A 2WXQA 3KH2A 4I1AA 2BUGA 3S29A 4J7WA 4U5FE 4RQIA 1K40A 2IJGX 3JCUQ 3RRNB 4BJ5C 5K0IA 1Q0MA 1YZCA 4PS8A 3VLEA 3AS8A 3VRCA 2DZOA 3HG0D 1H9TA 3LPZA 5L0CA 4HLLA 5HRYA 4P9TA 5KWDA 2IOLA 3ULQA 1WTYA 3E9VA 4CSAA 3RU0A 3BG0B 2UY1A 1OKKD 3PMRA 2LXLA 5COGA 3EFOB 3RSEG 1SW6A 4GTOA 2Y69C 5JHBA 2WMNA 4AK9A 5J90A 4WWPA 5FQ6A 3DI5A 4B89A 5AQ7A 4EECA 3L0IA 1N95A 3QARA 2Y3DA 1SA4A 3ULEG 2L9BA 3LKUA 4BJ5A 2EILC 1OCZE 3SBTB 1D0ZA 4DLQA 3SFXA 2P9NG 3JXJA 1Q0KA 4OD4A 1ELWA 1NA0A 4FADA 5EN5D 2OV8A 3J06A 3EIJA 3HXFA 2EQXA 2JLBA 1Z5ZA 3UIPC 3GEEA 4DX2A 5CECB 3C63A 3NOGD 1IKND 3U8PA 2V26A 4CCAA 2B0JA 3JRTA 1DOWA 3L08A 2RG8A 4UQZA 4EBBA 2J9QA 3TWWA 3C3RA 4YDYA 3ZW3A 1KU2A 5L0HA 3R9AB 3ISMC 3EU5A 2ZGGA 4EZKA 4MVOA 3IQ5A 2YKZA 4XWJA 1FVHA 3CVXA 3DM5A 5B3IA 1L7CA 2VH3A 3JXIA 1CGME 4KYOB 4BERA 1BI7B 3IQCA 4YT8A 3QWVA 1UFBA 3BQOA 1C17M 3QB2A 2XQ0A 1NI1A 3PDNA 3B0VC 3CHQA 1A7DA 2XLEA 2WXHA 1IYGA 3PNLB 3DWLG 2HMQA 2YL3A 1HG2A 3LJNA 1VOMA 1MNEA 2KGOA 1SZAA 4U9DA 4G7HF 5L0JA 3GEIA 4XQ1A 4U8YD 1OXJA 1NFNA 4CGWA 3TWQA 3PS6A 2ETSA 3ZVRA 5BQHA 3GW4A 2Q9CA 3MGBA 2PFDA 3W2WA 4B8AA 2XRHA 4IWBA 1JCQA 1A5EA 3KYIA 1OWPA 4RVBA 4BESA 2G3VA 2YLDA 3L16A 3D9IA 1JRAA 1VDYA 4CT4A 4FLBA 3EG9B 4JTCB 2BKGA 3G2WA 4JXTA 3M1CB 3Q78A 3ZEFA 1YLMA 2Y4UA 4GB9A 3DJNB 2HYZA 3CHRA 3F46A 3K1HA 2PM6A 1GS9A 2EPLX 2HMZA 3IHYA 1N0QA 5D91A 3CHSA 3HXDA 4HOSA 2A6HF 2R02A 1Z3YA 2X3MA 4F3VA 4ULVA 4GYWA 2NUTA 4GA2A 4AV7A 5G04C 1ORSC 2J0WA 1BI8B 2OVBA 4LDKA 2LAIA 1W3BA 4E7SA 3D9KA 3VF0A 4O6NA 1C02A 5KYXA 1MQSA 3IKOB 2G3KA 3FP3A 2DGJA 3HJCA 4U5EE 1Q0GA 2J9UA 3MBGA 1WY6A 2LK4A 3ZNGA 4ANVA 3ASDA 3ASNE 1RXQA 4L7TA 3KEAA 4CDAA 4N3CA 5AQAA 4HEAJ 3ECSA 2BL2A 5HV9A 3E32A 4CGVA 5JA4D 4HBDA 4RDAA 1BR4A 4PDXA 1CPRA 3T5VA 2WL8A 3O10A 2XGOA 2Y3HA 2J9VA 2CHWA 2WXMA 3NZSA 2LSEA 2Y3BA 3EHRA 3NMJA 2J46A 5BNWA 4KC9A 4OAUC 1FMWA 4EBAA 2XL4A 3HNIA 3RVZA 3C8GD 5CERB 2MHRA 3TWXA 1OQCA 3APFA 4OD5A 3AG3C 2QYJA 2P7VA 3B7BA 3ZHEA 2AVPA 2EINC 3K66A 4CIHA 4JCZA 1FFHA 4YDWA 2E87A 4W8KA 3PUKA 2ZXRA 1MMGA 4K0RA 3DEPA 4JTDB 2FAPB 5T1DB 1VYIA 5EDSA 4ANXA 5E75A 4L1BA 3DAFA 4GYTA 2I2OA 3E34A 4LCTA 3QW0A 1DCEA 1HU3A 1UN9A 4Q96A 3FH5A 3AG4C 2Q7RA 1OCCC 2XM4A 4Z9HA 4MQ9F 3TWTA 2R7UA 1V55E 3DPYA 3PCVA 3SNHA 3PE4A 3TQOA 3Q15A 3ITFA 2GRPB 4DJAA 1E8XA 4G7OF 2V4HC 3RF3A 3WXXA 4HFGA 2OKUA 3CQCB 4HQDA 4PJNA 4RSYA 4MTOA 2ZXOA 4ACLA 3FULA 4AY5A 4QI0A 3O39A 2QE9A 3HNLA 4XLNF 3SF4A 4PJMA 4C3DA 1O1SA 2C2LA 3R9MA 2CFUA 4XZ4A 2X6HA 3U64A 3OTNA 2Z15A 3CVLA 5LOZA 3SZ7A 3SHFA 3ZSUA 2FULA 4YL3A 4J8SA 3DEOA 1CGOA 3DSVA 4JIOA 3C72A 3HHMA 3DKAA 4HOTA 3C7JA 3FU6A 2RD0A 4EKWA 1ZZPA 3ZYQA 4U8VD 3DXKG 4JZYA 1TNUA 2I15A 5CI9A 3SI5A 4J7YA 2VASA 3E70C 3Q9UC 3EPVA 2MYSA 3T5XA 2KQ9A 2DCPA 2F8YA 4TXRA 1YA0A 1AUEA 1HFAA 3HRAA 3S27A 3T6JA 2CYDA 1D0YA 1HO8A 1OWNA 4JPSA 5KJNA 4ME2A 5D0QD 2I1JA 4MTGA 5CRUA 3TXNA 5L3VA 3ABKE 3A11A 1JPNA 4FESA 4WNEA 3VLDA 1MQVA 3FU5A 5EYPF 3O55A 4DXWA 5HSWA 2IU1A 1N54A 1T6UA 2XGSA 2V3CC 4E6HA 2WXKA 2G62A 1RJ9B 3NMKA 2QYUA 4GPMA 1BR1A 4Y6CA 4EBAG 2JPUA 4I1MA 3UT8A 2Y0BG 4G8LA 3NZUA 4C7OB 4KZCA 2A0UA 1MZCA 2P9LG 1D8DA 5DS5A 4I6EA 4FHKA 2YL7A 3T6BA 3TK0A 3TAXA 2A69F 3L13A 5HQ8A 4KVMA 3S9OA 4E18A 2IF4A 4UQYA 3QKYA 1Z3IX 1OT8A 3O6XA 3LNRA 5KJLA 3PNTB 4MRUA 5ANLA 1BR2A 4P29A 1ZHXA 2J07A 2KC3A 1H19A 2F0YA 4GZCA 5GPGB 1IHBA 3AG1E 3BEEA 3QW1A 2JEKA 4XE0A 4E0IA 4RBNA 4M3OA 3FDHA 2BF0X 2XPZA 1XZPA 1KT1A 3PH0C 1S70B 3DE9A 4CDRA 3QDNA 3GM3A 3VLFA 1UN8A 1WATA 3IBEA 3C5RA 2CHXA 4EBJA 5IY5C 1N9AA 2VQ2A 4J32B 2H7BA 2YQYA 4JEAA 5CI8A 4UI9J 4IARA 2LNIA 1GGQA 3KSLA 5BQGA 3NBNB 3VAYA 2HM8A 3MKQB 4AEZC 1H2TC 1Y8MA 2B0HA 3JQ1A 3Q6NA 4C3EA 1DOVA 3W9FA 3EGXB 4AX2A 5A7DB 2LCHA 4MS6A 4OYSA 4BT9A 2J4BA 5FZRA 4GTSA 2J8SD 4KBLA 4WNDA 2L6HA 1ZU2A 3WHNA 3CHOA 3POVA 4YT2A 2DYSE 2KATA 4G26A 2XZTG 1YA7O 3ZGQA 1KPSB 3QMKA 4XEKA 1JCSA 1I5NA 4GA1A 3PZ2A 1TNOA 3OAWA 3H2UA 2XCBA 4KNVA 2CCYA 4GZ3A 4APFA 1QKRA 5BPPA 3GORA 1JAFA 1HX8A 4HOQA 2DIWA 1ELKA 1Z23A 1M2VB 3HNJA 2OOEA 4WWOA 2A1DD 2IM8A 1INZA 2F37A 4YWQA 1N4QA 4O6FA 2L81A 2YL0A 4D10C 5LCWJ 1WN0A 4MVZA 2R7OA 3MA5A 1AEPA 4N5CA 1LKXA 2DBAA 3AQBA 5COMA 1HZ4A 1T6IA 1KLXA 2VSYA 4OIPF 4ZHBA 4HORA 5EX0A 3L8IA 4EBKA 2R7TA 4K03A 3CGHA 4J8DA 3G4ZA 3SBSA 4PH4B 4FC8A 4LUNU 1FAPB 3FAPB 3U3BA 4E0HA 2C0LA 2XM0A 2J4DA 5T3RA 2QC9A 2WMOA 4YJWA 2XENA 4E17A 2WXPA 3UTMA 4G2VA 1K04A 3EUVA 4HI8A 2RFMA 3CIAA 3RAUA 1JPJA 4A1GA 4DX6D 4IB4A 2EIJC 4KT6B 3D9LA 1Z63A 3FUMA 2H8AA 1N4SA 4G0HA 3WODF 3SFZA 2C04A 2GROB 2VC9A 3N71A 4OVUA 5L3QA 4J30B 3HDXA 1AVOB 1ORJA 4LDQA 1Y6IA 1PAQA 1TNZA 1D1CA 4HE8D 5HI7A 3PUJA 3EHNA 4M7CA 3M4BA 4C0EA 3JCKC 4UI9K 1K1AA 2XL8A 4NTFA 3TWRA 1K05A 3ZYKA 3PZ1A 2A5UA 3D9JA 5H7PA 4BY6A 4U5HA 5AENA 2WVQA 3S7JA 3UM1A 4O1OA 2L6GA 3QC1A 1LM3B 1O1RA 5F28E 3CEQA 4DPRA 1KTMA 1JUQA 2RSEB 3UM2A 3RIBA 4I3MA 2FO7A 2Q4FA 1Q2ZA 1BBHA 2L6BA 2IOSA 3UQ3A 1WM5A 4MVSA 2KCVA 4JVSA 4JW1A 3DD7A 2XGMA 3FMSA 4GAAA 4L6RA 1ZU4A 2H6FA 3VTXA 2CG3A 4HFKB 4LRZA 4TRQA 1APCA 1H2VC 4YL1A 5FZSA 1WASA 3RO2A 4U5CE 1OXBA 4GTRA 5EGYA 1O5HA 1N4PA 1K1BA 4B8CB 4W8PA 4A55A 2PX0A 5ENRD 2HJ3A 2TMVP 1IQRA 5E3CA 1FVFA 3FTWA 2I8BA 2IXMA 1GQAA 2QY7A 4MLPA 4GTMA 1FNTc 3RO3A 3T9KA 4GYYA 3EGDB 1LI7A 4GTVA 2ILRA 3S7DA 1PV3A 4MS2A 4JB8P 4U0ZA 2XS8A 2D5RB 3C18A 4A3VA 1NG1A 3V7OA 4IRUA 3LEVA 2FF4A 1TN8A 2FBNA 4NRHB 2WZGA 1AP7A 2V0PA 5JT4A 4TV3A 4WNFA 3RRMB 4H4KC 2X6FA 4FJYA 5BQIA 2EPKX 3Q75A 3T9OA 4IAOA 2Y4TA 3R7RA 2MWQA 3P2BA 3WG7E 3AG2E 2VTBB 3ZXSA 3K6BA 5G04J 2J09A 3ZYMA 4HB5A 4N4WA 2F22A 4NY3A 1T6QA 3ZTMA 1N0RA 1RJ9A 2A6EF 2KNHA 2ZISA 1N4RA 1RZ4A 4K7BA 1I4YA 2R17C 4C7OA 4ZFHA 3CSKA 3QOUA 4DRJB 3IPMO 1RKCA 4UDVA 1JOGA 4C3BA 2L0IA 3MJWA 4N3BA 4U07A 2A68F 3DXMG 4H7YA 2XEVA 2R7VA 1O1TA 3LAYA 4HS2A 1A7EA 2XPYA 2EIKC 4LLCA 2W45A 3U0CA 4AP2A 4K5BA 1W2WA 1QPUA 1R4TA 1OWMA 1LVKA 1KZPA 2I1KA 2IXNA 5BT1A 1SZIA 3GZSA 2E0IA 1MJ0A 3LS8A 1C03A 2DYRC 3O48A 5ARFA 2P9SG 1N1CA 4Z68A 3RVYA 5L0FA 5JRAA 1HY5A 3TJ6A 1HS6A 2RKKA 4LNUD 1HG5A 3PZ4A 2VCBA 1HH8A 3TOLA 5A6BA 2PNNA 5D92A 4EHMA 3LY9A 3ZFWA 4H7XA 4U0UA 2GFHA 1PCXA 4Z9IA 1QQEA 3B13A 4XEIG 4AXHA 3DJUB 1QYMA 3MKQA 3UKRG 2ZXWC 1EF1C 2Y69E 4HRNA 3SGHA 3FUFA 1GW6A 2HO1A 3UMKA 5JJ7A 3AS4A 1OCOC 2YQ8A 2EILE 1G3NB 2WXOA 5KYUB 3L1MA 2WXIA 3QK0A 2HKVA 4JEHA 1IHGA 1TN6A 2OJQA 4CS8A 4AE4B 4UWLA 4IULA 4J8YA 2R03A 2LP4A 1OY3D 2P58C 4TUUA 3HVEB 4LG6A 4HVBA 1WWPA 4WWNA 3I3NA 5EYLA 4PR9A 1Q0DA 4DBRA 1EKYA 2V4LA 2J7PD 2AWYA 2V8SE 4WUYA 4PK4A 3U3FA 2ZXWE 2QUPA 2X6IA 5ENOD 2OQMA 3Q9NC 3UNGC 1LS1A 5D66A 4ATGA 1M2VA 1G4WR 1D8EA 1HE8A 2NSZA 3L82A 4ILIA 3IV0A 4GYOA 1TJFA 4EWCA 5D0OD 4DJ9A 3EDTB 2WVIA 2R7WA 3UGOA 1TFKB 1LE2A 5AIJA 3FEYA 4BSXA 4DRIB 2YLIA 2L9JA 1ST6A 3ZWIA 1PY1A 2CG2A 4OVVA 2UWJG 2WZFA 3DBSA 3GWLA 4JEBA 4GA0A 3LLIA 2NSFA 3GYZA 4YVQC 2HSBA 2AVKA 1D0XA 1ELRA 3UMVA 3G2TA 3DE8A 2P9IG 3D9MA 3OWTA 3ZPJA 2VCCA 3CQZA 1NFOA 3FUNA 2ETBA 2XRYA 3FUEA 3URZA 1NU9C 4I9EA 4BTBA 3TWSA 2V5QC 2AJAA 1PD1A 4UQXA 3LS1A 1QVXA 2YNQA 3ZKJA 5FQ4A 1AWCB 3M79A 1S63A 3RRUA 3W4YA 4XX5A 4N5QA 3LJ3A 2NYJA 5T4YA 1QBQA 1N52A 2WVNA 3QWPA 4MVMA 4AL1A 3MYIA 1FPPA 4AVXA 3LEOA 3NYMA 3U9WA 3NB2A 3DWWA 4WNGA 3R7CA 4Q4ZF 4YVOA 5BUOA 3DPDA 1HMOA 2JD3A 1SMYF 4FHJA 4DUIA 2P0NA 4PFPA 4K0DA 2QY9A 3TJPA 3JSEO 3ASFA 1O3UA 1JMWA 1V54C 2P1AA 4PJJA 3IHUA 4OIRF 3IEEA 2B6CA 3EHMA 4YN0B 4ACKA 4U5BE 2KXPC 1XNFA 3ZC4A 5AARA 3UXGA 1WAO1 1JWGA 2XSEA 1OCRC 5A6CA 4J8EA 4BG0A 3LESA 4GZ6A 5CCLA 4B94A 4HFFB 4UWFA 3LLKA 1M56C 5BXOA 3TGOA 3ASHA 4DRHB 2WQHA 4MVUA 5A6AA 2OG2A 3KPHA 2C03A 4ATZD 5JMND 1DNPA 4O1PA 1LD7A 1SA5A 2Q9AA 1RCPA 2R05A 4A4AA 1QZ2A 3CK8A 2GRNB 3SQVA 3APDA 4BEPA 3OXFA 4H54A 3X2QC 1IW7F 4CZ2D 4XEFA 2MOWA 3AG3E 2P61A 3NMIA 2EINE 4ANWA 3BG1B 3GODA 3OEOA 4KVOA 5FWQA 1SF8A 4N2SA 4G25A 3UM0A 5G2NA 5JVEA 3RK6A 3GM2A 2L0TB 2JABA 4MKTA 2DWZA 3EGDA 5AC4A 4NQ0A 4TXQA 4WGZA 3Q7FA 4I2ZA 4FP7A 3S7BA 4XKBA 5AJDA 4EZLA 3FUKA 4MBGA 3SNXA 3JT1A 3AG4E 4QDLA 3APCA 2O9XA 1OCCE 3MV3B 2W4BA 4GMJA 4GZ5A 4ULWA 3JYSA 3D9NA 1YCSB 1OW6A 4PJLA 4FA6A 2VGXB 1HE1A 4YNDA 5EX3A 2XLVA
chains in the Genus database with same CATH topology
2AW6A 2PL2A 5EKQD 1G8XA 2VTBA 3FTXA 3VYWA 3CVVA 3CR3A 3JSZA 3UGPA 3FEXA 3T8MA 2KZTB 4A1SA 2ZXPA 5B3SC 4KMOA 2FI7A 3U66A 1MMAA 3JQ0A 3FU3A 3UPVA 5CMYA 1ZHZA 3EFOA 3K9IA 4F53A 1JPLA 3ABLC 2WXLA 3NKDA 2BTDA 4UWHA 3L22A 3B0UX 2CDQA 1E7UA 2X51A 4FX5A 2GRMA 4ZLDA 1X5BA 3Q5MA 3ASOC 4V3IA 3EQLF 3QNKA 3B7UX 2W9YA 2QTVA 3Q4AB 2YHEA 4NURA 4JHKA 4BX8A 5E3AA 3FUIA 5FCLA 3PZDA 5M72A 1FFTC 3T4RA 3KEZA 3G2UA 3CSTA 2IOQA 2R59A 2VYIA 3FY4A 3QAQA 1MMNA 3H65A 1DVPA 5A23A 1MHQA 3P1UA 3NQPA 4JA9A 4L2YA 4GMLA 5KYUA 2EIMC 5ANRA 4CEMA 4URKA 3Q7GA 3PREA 4AE4A 4BX9A 5C2YA 3N24A 4P6IC 3FFLA 5J08A 5FTPA 3CK9A 3HVEA 5E2QA 1HF8A 2LAHA 2J9WA 2WXNA 1Z3XA 3I5PA 1H0AA 3S28A 1ZHWA 4G24A 2ZPAA 3UR3C 4AOFA 4OIQF 5JJTA 3ASGA 2BE5F 3EG9A 1Z6TA 2VB6A 5B1AC 1PD0A 3CZ6A 1JWFA 4N2QA 3PRZA 3ZN3A 3FTVA 2X6JA 3MCXA 2CGEA 3L17A 2CW0F 2J45A 3DZAA 2YINA 5BW8C 3MZLB 2XPIA 3B7TA 3C98A 4JC8A 4EZJA 2AWIA 2PM7A 4HOUA 5KJKA 4UWKA 5DS4A 2GGFA 3FWVA 4I2WA 3OXGA 2YHCA 4XI0A 2PF4E 3I4GA 3ESLA 2M4EA 1VYKA 3NF1A 1QLEC 5LP0A 1NU7D 3TL5A 2Q7FA 3PEVB 4L2LA 5FQ8A 3TG5A 3ZIBA 1IZMA 2KW3C 3ABMC 1TJCA 1P5QA 4O79A 1O87A 2KJGA 3LYAA 3MKRA 3FUDA 5AYWD 5DBKA 2VSNA 2Y39A 4G23A 2H7OA 4FU3A 5CMWA 4J6IA 3CVQA 1FMVA 3ZHEB 5B1BC 2OCCC 5JHAA 3LY7A 3NYLA 2WZLA 4UI9C 4ANUA 3MEKA 3E4BA 5T8IA 4KNWA 1NP7A 3IHVA 2NUPB 4G7ZF 5KCMA 3X1OA 4F7AA 4G11A 2CNWA 3N2ZB 3L6AA 1NZNA 2QFCA 5F5FA 4N06A 2V5FA 4F4BA 3S2AA 4I6GA 2H7VC 1ZHYA 2VGXA 3MX3A 3LVQE 1ZBPA 4R7LA 3PHF2 2Y3GA 1OWOA 1J8YF 1A17A 3Q49B 5G05C 1U3CA 4W9RA 3LCAA 2GW1A 1E7VA 4CDNA 4DBQA 1UW4B 5LX8A 3ZIMA 3N0TA 5BV1A 5ENNA 1TWAA 4CS9C 4WJ0A 4YT5A 4Q94A 2ZU6B 4CT0A 3FVYA 3U3WA 2AXUA 4OIOF 1UJJA 2XXAB 4RD9A 4B6IA 1TR2A 2J0XA 3B0PA 1M57C 5EHHA 3S7FA 3MYVA 4PS7A 5G55A 3HYMB 4BFRA 4CS9A 5DQTA 3Q7LA 3SP1A 4X0RA 1HXIA 3W8IA 2WXFA 2J49A 3K7DA 3KKBA 4LEUA 1Z6AA 3NRHA 1ZU5A 4ANJA 3NYJA 4CS8C 1S0PA 3B9QA 5JJ6A 3F47A 3KL4A 3L54A 2KCKA 3EGXA 3FUJA 3JYHA 1E96B 2FFHA 5DS6A 5T3WA 3EJNA 1EDUA 3AU4A 5KYWB 1U3DA 3KAEA 3AU5A 1OKKA 2WXRA 3LDZA 3D9OA 4G1TA 2Q3TA 3CK7A 2R5SA 4QFVA 4I6JA 4AM9A 4J8FA 4UWGA 2Y3AA 3FTSA 3CVNA 3RIPA 5CCMA 3B7RL 3I4RB 4GU5A 3QWWA 3CQGB 3FTZA 3Q47B 4Q69A 2VSXE 4XIFA 2ONDA 1FTSA 3RYLA 4FULA 4JURI 4I9CA 4JEUA 3FH8A 3L34A 4JJFA 4XLPF 4Q7CA 3CKBA 3G2VA 2P6VA 3ASNC 4APOA 3CHPA 4I43A 1EPUA 4BWRA 3I4UA 2M63A 3U4TA 4ZLCA 2L6JA 4LACB 3DXJF 4DVYP 3NDBB 3UT7A 4DVZA 2AXZA 4RG9A 1FCHA 2NG1A 3PVLA 4Q5SF 3S0XA 5ARGA 3JUIA 3PEUB 3TG4A 2LSUA 2J7PA 3NG1A 2MHKA 3CSFA 3CVWA 4BT8A 4C9BB 2CHZA 4IN3B 3O4ZA 1EYHA 2PP4A 5DIZA 2WB7A 1LF8A 4N3AA 2IYLD 5DQZA 1QZXA 3PE3A 1V55C 3R7QA 1PC2A 5BUZA 3OA1A 5FT9A 4PUCA 4AIFA 3RKOF 3LS0A 3ZYLA 2CFZA 3ML9A 3LJBA 2R7XA 3TD7A 4BTAA 1D1AA 2HV6A 4I1OB 3HIZA 3UT4A 3KMIA 5E33A 2R7RA 4U5DE 2NUPA 1BPOA 2C0MA 4EQFA 4CBEA 1TEZA 4DOZA 2XRZA 1UJKA 4U63A 4M63A 3NKEA 2KCLA 3K33A 3CHMA 1D1BA 2A4ZA 4WAFA 1E90A 4OINF 1XGWA 2IXOA 3ABKC 2XCCA 3ESKA 4I17A 4JHRA 2LO6A 1IQUA 4CRWA 2WXJA 3EZHA 3SZRA 4CS7A 1TWGA 4KBQA 4GPKA 3CKCA 2NC9A 5KYYB 2HV7A 2I6HA 4N39A 4ABNA 3QZCA 3ZG1A 1B89A 4F1SA 5AJLA 4C0MA 1NA3A 1QNFA 3GANA 3AG1C 4YT4A 2PZIA 4PFOA 4A2NB 4O6MA 2XXAA 4BJ1A 3IEGA 2X6KA 2IFUA 2WB2A 3LVRE 3Q6MA 3FDQA 4IJJA 3DMDA 1VMAA 3CVPA 4PS3A 2GRLA 2WXGA 4DI3A 4XI9A 2UY1B 1KT0A 3ZRHA 4KZ0A 1E8YA 1VK5A 4AJWA 4O7GA 2FGYA 4CDMA 3SEOA 2WM9A 3G2SA 3ML8A 2WQ6A 3UMHA 2IXPA 1TWCA 4GCOA 3K1IC 4JL0A 2I9CA 2DYSC 5FZQA 4MNDA 3ENEA 5KYWA 1WGWA 3EIQC 1NZEA 1MMDA 3AQCA 4LERA 3CLJA 2OVFA 3RKVA 4HLEA 3AS5A 4LLEA 3ZVVA 3QJZA 1UG3A 5CHEE 3CVYA 4U8HA 1OWLA 1MNDA 4HXIA 3CVUA 5BV0A 3FU0A 4U0SA 3B7SA 4I44A 1TWHA 2YZSA 4FWVA 4GZDA 3ONKA 2X38A 3TXMA 4J0UA 3RFYA 3LY8A 4U04A 2PQRA 4E85A 4E7ZA 4A3TA 4XTKA 2XHEA 5G05J 4BJ6C 2KM4A 3D9PA 3FTUA 3KS2A 2VJ8A 4EPZA 4XKCA 2VSOE 5KJMA 4B0ZA 1H2UA 2W4MA 4QI2A 1J8MF 3HTKC 3MLGA 3VTYA 5LFAA 2NUTB 3DM9B 1L5JA 3W2VA 4BJ6A 4KXKB 4DI4A 4FJZA 4JHJA 5KYXB 3FHEA 3UUXA 3RJVA 3FH7A 3RH3A 3MV2B 4DLOA 5C1DA 2VGYA 2AXVA 4U5GA 3UX4A 3OXLA 4JJGA 1S7ZA 3W8HA 3I5QA 5E76A 3HLZA 3EH2A 4GCNA 3UMIA 5T3TA 4JCHA 1OUVA 2CNWD 4KI2A 3ONLA 4L23A 4AY6A 2MRIA 3D3MA 3KD7A 3FUHA 4DK5A 1ZHTA 3LXUX 3SD5A 4JZAA 4FLHA 2YHSA 5F5HA 1M2OA 1ZYRF 4Y6WA 4NACA 1H6KA 4IYPA 3DAGA 2LSVA 3LEWA 2WPVA 4JA7A 4BJTA 1SZ9A 4GEHA 2YEVA 4O6YA 3GZ1A 2KC7A 3WG7C 3AG2C 4ILHB 2R7QA 5DVWA 2E2EA 4RG6A 2WVOA 2NXPA 3EZIA 2WQ7A 2PX3A 3FAJA 3FTYA 3GZ2A 2IQCA 4ILGA 5KYYA 2KZTA 5KYNA 2IONA 3SYNA 2R7SA 2HR2A 5LCWC 5DLJA 1TKNA 2FEZA 3EH1A 4CSAC 2J08A 1E8WA 3FHDA 3CV0A 1OCZC 4BEJA 1E8ZA 2PQNA 5FQ7A 1SQMA 2Q9BA 5FJYA 2WXQA 3KH2A 4I1AA 2BUGA 3S29A 4U5FE 2IJGX 3JCUQ 3RRNB 4BJ5C 4PS8A 3VLEA 3AS8A 3LPZA 2IOLA 3ULQA 3E9VA 4CSAA 3RU0A 3BG0B 2UY1A 1OKKD 3PMRA 3EFOB 2Y69C 5JHBA 2WMNA 4AK9A 5J90A 4WWPA 5FQ6A 4B89A 4EECA 3L0IA 3QARA 2Y3DA 2L9BA 3LKUA 4BJ5A 2EILC 3SBTB 1D0ZA 4DLQA 4OD4A 1ELWA 1NA0A 4FADA 2OV8A 3EIJA 2EQXA 2JLBA 1Z5ZA 2V26A 4CCAA 2B0JA 3JRTA 3L08A 2RG8A 4UQZA 4EBBA 2J9QA 3ZW3A 1KU2A 3R9AB 4EZKA 4XWJA 1FVHA 3CVXA 3DM5A 4KYOB 2VH3A 4YT8A 3QWVA 3QB2A 2XQ0A 3PDNA 3B0VC 3CHQA 2WXHA 1IYGA 3PNLB 1HG2A 1VOMA 1MNEA 2KGOA 1SZAA 4G7HF 4CGWA 3PS6A 3ZVRA 3GW4A 2Q9CA 3MGBA 2PFDA 3W2WA 4B8AA 2XRHA 4IWBA 1OWPA 4RVBA 2G3VA 3L16A 3D9IA 1VDYA 4CT4A 4FLBA 3EG9B 3G2WA 4JXTA 3M1CB 3ZEFA 2Y4UA 4GB9A 3DJNB 2HYZA 3CHRA 3F46A 3K1HA 2PM6A 3IHYA 5D91A 3CHSA 4HOSA 2A6HF 1Z3YA 2X3MA 4F3VA 4GYWA 2NUTA 4GA2A 4AV7A 5G04C 2J0WA 2OVBA 2LAIA 1W3BA 4E7SA 3D9KA 4O6NA 5KYXA 1MQSA 3IKOB 2G3KA 3FP3A 2DGJA 3HJCA 4U5EE 2J9UA 1WY6A 4ANVA 3ASDA 4L7TA 4N3CA 4HEAJ 3ECSA 4CGVA 4RDAA 1BR4A 4PDXA 3T5VA 2WL8A 2XGOA 2Y3HA 2J9VA 2CHWA 2WXMA 3NZSA 2LSEA 2Y3BA 2J46A 5BNWA 4KC9A 1FMWA 4EBAA 2XL4A 3APFA 4OD5A 3AG3C 2P7VA 3ZHEA 2AVPA 2EINC 3K66A 4CIHA 1FFHA 2E87A 4W8KA 3PUKA 2ZXRA 1MMGA 4K0RA 5T1DB 1VYIA 5EDSA 4ANXA 5E75A 4L1BA 3DAFA 4GYTA 2I2OA 4LCTA 1HU3A 1UN9A 4Q96A 3FH5A 3AG4C 1OCCC 4MQ9F 2R7UA 3SNHA 3PE4A 3Q15A 3ITFA 4DJAA 1E8XA 4G7OF 3WXXA 4HFGA 3CQCB 4PJNA 4RSYA 2ZXOA 4ACLA 3FULA 4AY5A 4QI0A 3O39A 3SF4A 4XLNF 4PJMA 4C3DA 2C2LA 2CFUA 4XZ4A 2X6HA 3U64A 3OTNA 2Z15A 3CVLA 5LOZA 3SZ7A 3SHFA 3ZSUA 2FULA 4J8SA 3HHMA 4HOTA 3FU6A 2RD0A 3ZYQA 4JZYA 5CI9A 3SI5A 2VASA 3E70C 3EPVA 2MYSA 3T5XA 2KQ9A 2DCPA 1YA0A 1HFAA 3S27A 3T6JA 1D0YA 1HO8A 1OWNA 4JPSA 5KJNA 4ME2A 5D0QD 2I1JA 3TXNA 5L3VA 4WNEA 1JPNA 4FESA 3VLDA 3FU5A 5HSWA 2IU1A 1N54A 2XGSA 2V3CC 4E6HA 2WXKA 2G62A 1RJ9B 1BR1A 4Y6CA 4EBAG 4I1MA 3UT8A 3NZUA 4C7OB 4KZCA 5DS5A 4I6EA 4FHKA 3T6BA 3TAXA 2A69F 3L13A 5HQ8A 4KVMA 2IF4A 4UQYA 3QKYA 1Z3IX 3O6XA 3LNRA 5KJLA 3PNTB 4MRUA 5ANLA 1BR2A 4P29A 1ZHXA 2J07A 1H19A 4GZCA 3BEEA 2JEKA 4XE0A 4M3OA 4RBNA 3FDHA 2BF0X 2XPZA 1KT1A 3PH0C 4CDRA 3QDNA 3VLFA 1UN8A 3IBEA 2CHXA 5IY5C 2VQ2A 4J32B 2H7BA 5CI8A 4UI9J 2LNIA 3VAYA 2HM8A 3MKQB 4AEZC 1H2TC 1Y8MA 3JQ1A 3Q6NA 4C3EA 3EGXB 4AX2A 5A7DB 4MS6A 4OYSA 4BT9A 2J4BA 5FZRA 4WNDA 4KBLA 1ZU2A 3CHOA 3POVA 4YT2A 2KATA 4G26A 3ZGQA 3QMKA 4GA1A 3OAWA 2XCBA 4KNVA 4GZ3A 4APFA 5BPPA 1HX8A 4HOQA 2DIWA 1ELKA 1Z23A 1M2VB 2OOEA 4WWOA 2A1DD 1INZA 4YWQA 4O6FA 2L81A 4D10C 5LCWJ 2R7OA 3MA5A 4N5CA 1LKXA 2DBAA 3AQBA 1HZ4A 1KLXA 2VSYA 4OIPF 4HORA 5EX0A 2R7TA 4K03A 3CGHA 4J8DA 3SBSA 4PH4B 4FC8A 4LUNU 2C0LA 2J4DA 5T3RA 2WMOA 4YJWA 2WXPA 4G2VA 3CIAA 1JPJA 4A1GA 2EIJC 4KT6B 3D9LA 1Z63A 3FUMA 4G0HA 3WODF 3SFZA 2C04A 3N71A 4OVUA 5L3QA 4J30B 3HDXA 1Y6IA 1PAQA 1D1CA 4HE8D 5HI7A 3PUJA 3EHNA 4C0EA 3JCKC 4UI9K 3ZYKA 2A5UA 3D9JA 4BY6A 5AENA 4U5HA 2WVQA 3S7JA 3QC1A 3CEQA 4DPRA 1JUQA 3RIBA 4I3MA 2FO7A 2IOSA 3UQ3A 1WM5A 2KCVA 4JVSA 4JW1A 3DD7A 2XGMA 4GAAA 1ZU4A 3VTXA 2CG3A 4HFKB 4LRZA 4TRQA 1H2VC 5FZSA 3RO2A 4U5CE 5EGYA 1O5HA 4B8CB 4A55A 2PX0A 1IQRA 5E3CA 1FVFA 3FTWA 2I8BA 2IXMA 2QY7A 4MLPA 3RO3A 4GYYA 3EGDB 2ILRA 3S7DA 4U0ZA 2D5RB 4A3VA 1NG1A 3V7OA 4IRUA 3LEVA 2FF4A 2FBNA 4NRHB 2WZGA 2V0PA 4TV3A 4WNFA 3RRMB 4H4KC 2X6FA 4FJYA 4IAOA 2Y4TA 3R7RA 2MWQA 3P2BA 2VTBB 3ZXSA 3K6BA 5G04J 2J09A 3ZYMA 4NY3A 1RJ9A 2A6EF 2KNHA 4K7BA 2R17C 4C7OA 3CSKA 3QOUA 4C3BA 2L0IA 3MJWA 4N3BA 4U07A 2A68F 4H7YA 2XEVA 2R7VA 3LAYA 4HS2A 2XPYA 2EIKC 4LLCA 2W45A 4AP2A 1W2WA 5BT1A 1OWMA 1LVKA 2I1KA 2IXNA 1SZIA 3GZSA 2E0IA 3LS8A 2DYRC 3O48A 5ARFA 1N1CA 1HS6A 1HG5A 1HH8A 5D92A 3LY9A 3ZFWA 4H7XA 4U0UA 2GFHA 1PCXA 3B13A 1QQEA 4AXHA 3DJUB 3MKQA 2ZXWC 1EF1C 3SGHA 3FUFA 1GW6A 2HO1A 3UMKA 5JJ7A 3AS4A 1OCOC 2YQ8A 2WXOA 5KYUB 2WXIA 3QK0A 4JEHA 1IHGA 4CS8A 4AE4B 4UWLA 4IULA 2P58C 4TUUA 3HVEB 4HVBA 4WWNA 3I3NA 4DBRA 2V4LA 2J7PD 2V8SE 4WUYA 4PK4A 2X6IA 3UNGC 1LS1A 4ATGA 1M2VA 1HE8A 2NSZA 4ILIA 3IV0A 4GYOA 1TJFA 4EWCA 5D0OD 3EDTB 2WVIA 2R7WA 3UGOA 5AIJA 3FEYA 4BSXA 1PY1A 2L9JA 1ST6A 2CG2A 4OVVA 2UWJG 2WZFA 3DBSA 4GA0A 3LLIA 3GYZA 4YVQC 1D0XA 1ELRA 3UMVA 3G2TA 3D9MA 3OWTA 3ZPJA 3CQZA 3FUNA 2XRYA 3FUEA 3URZA 1NU9C 4I9EA 4BTBA 1PD1A 4UQXA 3LS1A 2YNQA 5FQ4A 3RRUA 4XX5A 5T4YA 3LJ3A 1N52A 2WVNA 3QWPA 4AVXA 3NYMA 3U9WA 4WNGA 4Q4ZF 4YVOA 5BUOA 3DPDA 2JD3A 1SMYF 4FHJA 4PFPA 4K0DA 2QY9A 3TJPA 3ASFA 1V54C 4PJJA 4OIRF 3IEEA 3EHMA 4YN0B 4ACKA 4U5BE 1XNFA 3ZC4A 1WAO1 1JWGA 2XSEA 1OCRC 5A6CA 4J8EA 4BG0A 3LESA 4GZ6A 5CCLA 4B94A 4HFFB 4UWFA 3LLKA 1M56C 3TGOA 3ASHA 2WQHA 2OG2A 2C03A 1DNPA 2Q9AA 1QZ2A 3CK8A 3APDA 3OXFA 3X2QC 1IW7F 2MOWA 4ANWA 3BG1B 3GODA 3OEOA 4KVOA 5FWQA 1SF8A 4N2SA 4G25A 5G2NA 3RK6A 2L0TB 4MKTA 3EGDA 4NQ0A 4I2ZA 4FP7A 3S7BA 4XKBA 5AJDA 4EZLA 3FUKA 3SNXA 3JT1A 4QDLA 3APCA 2O9XA 3MV3B 2W4BA 4GMJA 4GZ5A 4ULWA 3JYSA 3D9NA 4PJLA 4FA6A 2VGXB 4YNDA 5EX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LX8 A;  3EHN A;  3P1U A;  5T4Y A;  3NQP A;  3CK8 A;  3SNX A;  3QNK A;  3CK7 A;  4F53 A;  3MCX A;  3MYV A;  3GZS A;  3MX3 A;  3EHM A;  3IV0 A;  4PUC A;  4Q69 A;  3LEW A;  3CKC A;  4F7A A;  3CGH A;  5E75 A;  5E76 A;  3SGH A;  3L22 A;  4MRU A;  3JYS A;  5FQ8 A;  3KEZ A;  3HDX A;  4L7T A;  5FQ7 A;  5T3R A;  3JQ0 A;  3I4G A;  4LER A;  3OTN A;  5J90 A;  5FQ6 A;  3FDH A;  3CK9 A;  3CKB A;  3EJN A;  3JQ1 A;  5FQ4 A; 
#chains in the Genus database with same CATH topology
 2AW6 A;  1N11 A;  2PL2 A;  5EKQ D;  1UOH A;  1G8X A;  2VTB A;  3FTX A;  3VYW A;  3F6Q A;  3CR3 A;  3CVV A;  3JSZ A;  2LQG A;  3UGP A;  4B93 B;  2R2L A;  3FEX A;  3ZTZ A;  3T8M A;  4HNA D;  2KZT B;  4A1S A;  2ZXP A;  4MW8 A;  5B3S C;  1YVI A;  4KMO A;  4YDO A;  3VM6 A;  2FI7 A;  3U66 A;  3RQE A;  1EA8 A;  1MMA A;  3JQ0 A;  1TNB A;  3FU3 A;  5ENP D;  2RD9 A;  1NFI E;  3V30 A;  3UPV A;  4LNG A;  1YYJ A;  2XZD G;  2HJM A;  5CMY A;  1K8K G;  3V5X A;  1ZHZ A;  3EFO A;  3K9I A;  5ITZ F;  3AGU A;  3TWV A;  4F53 A;  1JPL A;  3ABL C;  2WXL A;  5JP7 A;  4NTB A;  2DZN A;  3NKD A;  2BTD A;  4UWH A;  1WDY A;  3RQF A;  3L22 A;  3B0U X;  2CDQ A;  1E7U A;  256B A;  2X51 A;  4FX5 A;  2RFA A;  2GRM A;  4ZLD A;  1X5B A;  2ETA A;  2XLW A;  3V5Y A;  4CJO A;  3T8K A;  1BZ4 A;  3AAA C;  3U2L A;  4HRM B;  3Q5M A;  3ASO C;  4NIK A;  4V3I A;  3EQL F;  3QNK A;  3B7U X;  2W9Y A;  2QTV A;  3Q4A B;  4BEM J;  2YHE A;  4NUR A;  1DCQ A;  2OEW A;  2YLG A;  4JHK A;  5EID A;  4BX8 A;  3GM1 A;  5E3A A;  3FUI A;  5FCL A;  3PZD A;  5M72 A;  1FFT C;  3T4R A;  3KEZ A;  3G2U A;  3CST A;  2IOQ A;  2R59 A;  3L9T A;  2VYI A;  4TUM A;  3FY4 A;  3QAQ A;  1MMN A;  3H65 A;  1DVP A;  5A23 A;  5L0G A;  1MHQ A;  3P1U A;  3NQP A;  4JA9 A;  1G5Z A;  4GML A;  4L2Y A;  4K1O A;  5KYU A;  3C62 A;  4NTA A;  4A63 B;  2EIM C;  5ANR A;  3SO8 A;  3QTH A;  1ZVZ A;  4CEM A;  4URK A;  3Q7G A;  3PRE A;  4AE4 A;  4BX9 A;  5C2Y A;  3N24 A;  3SXY A;  1LI5 A;  4P6I C;  2P9U G;  3FFL A;  5J08 A;  5FTP A;  3S84 A;  3CK9 A;  3LUT B;  3HVE A;  5IY5 E;  5E2Q A;  1HF8 A;  1I4Z A;  2LAH A;  2J9W A;  3IQ6 A;  1Z3X A;  2WXN A;  2ASR A;  3I5P A;  1ZW2 A;  2DI3 A;  2KYH A;  1H0A A;  3S28 A;  5CIV A;  1ZHW A;  4G24 A;  2ZPA A;  3UR3 C;  1LIH A;  3DSX A;  1M6T A;  4AOF A;  4OIQ F;  5JJT A;  2IEJ A;  2YL1 A;  3ASG A;  2BE5 F;  3EG9 A;  1SYQ A;  4XPY A;  1Z6T A;  2VB6 A;  5B1A C;  1PD0 A;  1OW7 A;  4RLY A;  2HS5 A;  3HXB A;  3CZ6 A;  1JWF A;  4N2Q A;  3PRZ A;  3ZN3 A;  3FTV A;  2X6J A;  1LD8 A;  3MCX A;  2CGE A;  3L17 A;  3Q73 A;  2CW0 F;  2XLD A;  3MFN A;  2J45 A;  3DZA A;  2YIN A;  5BW8 C;  5AGF A;  4U95 D;  1S05 A;  3MZL B;  2XPI A;  4L9P A;  3B7T A;  3C98 A;  4JKV A;  5ENS D;  4JC8 A;  3TWU A;  4EZJ A;  3TJ5 A;  2GAQ A;  1WG0 A;  2GWW A;  2AWI A;  1OR3 A;  2PM7 A;  4HOU A;  5KJK A;  5EK0 A;  4UWK A;  5DS4 A;  3IQT A;  3UI2 A;  2F8X K;  2GGF A;  2IBF A;  3EHQ A;  3BRJ A;  3FWV A;  4F1P A;  4I2W A;  3OXG A;  1A0B A;  5AQ9 A;  2IY0 C;  3ZQY A;  2YHC A;  4XI0 A;  2PF4 E;  4LDR A;  1H6P A;  3I4G A;  3ESL A;  1VLT A;  3TUL A;  3PDM P;  2OOC A;  3UIO C;  2M4E A;  1VYK A;  3NF1 A;  4IGG A;  4F6R D;  1QLE C;  4TXP A;  2P2C P;  1NU7 D;  3U9J A;  5LP0 A;  2MYO A;  3TL5 A;  2Q7F A;  3PEV B;  5L0D A;  4L2L A;  4X8Q A;  2HZ8 A;  5FQ8 A;  3TG5 A;  3HXE A;  2LFD A;  4P9F A;  1YAU O;  3ZIB A;  1IZM A;  2KW3 C;  3ABM C;  4D4X A;  1TJC A;  1P5Q A;  2EIJ E;  4JC7 A;  5CRV A;  4O79 A;  1O87 A;  2KJG A;  3LYA A;  3MKR A;  3FUD A;  5AYW D;  5DBK A;  2VSN A;  4C48 B;  2Y39 A;  4G23 A;  2H7O A;  1TQG A;  4FU3 A;  3B29 A;  5CMW A;  2ZIR A;  4J6I A;  1E83 A;  3CVQ A;  1FMV A;  3ZHE B;  5B1B C;  4BSZ B;  2OCC C;  5JHA A;  3V79 K;  3LY7 A;  3NYL A;  1QSP A;  2WZL A;  4UI9 C;  4ANU A;  2OEX A;  4CDV A;  3MEK A;  2EPO A;  3E4B A;  1YJG A;  5T8I A;  4KNW A;  1NP7 A;  3IHV A;  2NUP B;  4G7Z F;  3V2O A;  5KCM A;  3X1O A;  5AAO A;  4K5C A;  4OAV B;  4F7A A;  4G11 A;  2CNW A;  5AQB A;  3N2Z B;  2XEE A;  5EIL A;  3L6A A;  3HXC A;  1NZN A;  3Q79 A;  1HW1 A;  3S90 A;  2QFC A;  5F5F A;  2L7A A;  3C8Z A;  3C8G B;  4N06 A;  2V5F A;  1T01 A;  2J9B A;  4F4B A;  3S2A A;  4I6G A;  1NLX A;  2H6G A;  3AOU A;  1SVX A;  3T6G B;  3BEH A;  2H7V C;  1ZHY A;  2VGX A;  1ORY A;  3MX3 A;  3LVQ E;  4R32 A;  2HFI A;  1ZBP A;  1JR8 A;  1HW2 A;  3TOM A;  4R7L A;  4BPM A;  3PHF 2;  2Y3G A;  1OWO A;  1J8Y F;  2M64 A;  4YK5 A;  1A17 A;  3Q49 B;  5G05 C;  1RW2 A;  1U3C A;  4W9R A;  3LCA A;  5JLI A;  2GW1 A;  4XEV A;  1H6O A;  1E7V A;  1L3P A;  4JE9 A;  4DBQ A;  4CDN A;  1UW4 B;  3M15 A;  3HKK A;  5LX8 A;  3ZIM A;  3RW0 A;  3N0T A;  1MYO A;  5BV1 A;  4XPX A;  5A6B D;  5ENN A;  1TWA A;  5FZT A;  4CS9 C;  4WJ0 A;  1MX4 A;  4YT5 A;  1O5M A;  1MX6 A;  4Q94 A;  2ZU6 B;  2L6F A;  4CT0 A;  3FVY A;  1E84 A;  3U3W A;  2KBX A;  2AXU A;  3C3O A;  3QVZ A;  3RQG A;  4OIO F;  5AC5 A;  1UJJ A;  2XXA B;  3ZXP A;  4RD9 A;  4B6I A;  1TR2 A;  2J0X A;  1V4A A;  3B0P A;  3AJM A;  1M57 C;  5EHH A;  3GWN A;  3S7F A;  3MYV A;  3UM3 A;  1JCR A;  4PS7 A;  5G55 A;  3HYM B;  4HI9 A;  1HE9 A;  1FT2 A;  3NOC D;  4BFR A;  4CS9 A;  5DQT A;  3Q7L A;  3SP1 A;  4X0R A;  3L8J A;  1HXI A;  1ZW3 A;  3W8I A;  2J49 A;  1NL4 A;  2WXF A;  3K7D A;  1TR4 A;  5L0I A;  3KKB A;  4LEU A;  1Z6A A;  3NRH A;  2YWA A;  1ZU5 A;  4ANJ A;  3NYJ A;  4N6H A;  3V5Z A;  2NPU A;  1NSG B;  3IXE A;  4CS8 C;  1S0P A;  3B9Q A;  2H6I A;  2PNO A;  2LXM A;  5JJ6 A;  3F47 A;  3KL4 A;  3L54 A;  1H7I A;  1QQ3 A;  1BDJ B;  2KCK A;  2LD6 A;  3EGX A;  3FUJ A;  1LPE A;  2EIK E;  2XEH A;  2HSQ A;  1EI7 A;  3JYH A;  1E96 B;  2FFH A;  5DS6 A;  5T3W A;  3EJN A;  1EDU A;  3AU4 A;  4GTP A;  5KYW B;  1U3D A;  3KAE A;  2DYR E;  3AU5 A;  1OKK A;  2WXR A;  3E37 A;  3LDZ A;  1BU9 A;  3US6 A;  3JYY A;  3D9O A;  4G1T A;  2Q3T A;  3CK7 A;  1A7V A;  2R5S A;  2KK1 A;  5JUA A;  5FIO A;  4QFV A;  4I6J A;  4AM9 A;  4J8F A;  4UWG A;  2Y3A A;  3FTS A;  3CVN A;  3RIP A;  3BUA A;  5CCM A;  3B7R L;  2Y1L E;  3I4R B;  4GU5 A;  3QWW A;  3CQG B;  3FTZ A;  4K5A B;  3Q47 B;  1E85 A;  1OCO E;  4Q69 A;  1LTX A;  2Q00 A;  1Z7Q c;  2VSX E;  2OND A;  4XIF A;  1FTS A;  3RYL A;  4FUL A;  4GQH A;  4JUR I;  4I9C A;  4JEU A;  1MX2 A;  1YMP A;  3FH8 A;  2GA0 A;  3L34 A;  4JJF A;  4XLP F;  4Q7C A;  3CKB A;  3G2V A;  2P6V A;  5COF A;  3R2P A;  3ASN C;  2BKK B;  4APO A;  1RKE B;  3CHP A;  4I43 A;  2J8W A;  1EPU A;  4BWR A;  3I4U A;  2M63 A;  3U4T A;  4ZLC A;  2L6J A;  2EPN A;  4LAC B;  1E86 A;  3DXJ F;  4DVY P;  3NDB B;  1EQ1 A;  1TFO B;  3UT7 A;  4DVZ A;  4LNB A;  4YDE A;  2AXZ A;  1TN7 A;  4RG9 A;  1FCH A;  4G8K A;  2NG1 A;  4CX9 A;  2HUJ A;  4CYM D;  3FOP A;  1SR2 A;  3PVL A;  4Q5S F;  4U7E B;  5CED B;  3S0X A;  2R9R B;  5ARG A;  3JUI A;  2XS1 A;  3PEU B;  1G4U S;  3TG4 A;  2LSU A;  2J7P A;  3ULY A;  1E2X A;  4G78 A;  3NG1 A;  2MHK A;  3CSF A;  3CVW A;  1ZB1 A;  4BT8 A;  4C9B B;  2CHZ A;  1H6G A;  3U5S A;  4IN3 B;  3O4Z A;  1EYH A;  2PP4 A;  1H9G A;  5DIZ A;  2WB7 A;  1LF8 A;  1U6H A;  4N3A A;  3SFY A;  2IYL D;  5DQZ A;  1QZX A;  5HKP A;  3PE3 A;  1V55 C;  3R7Q A;  2QLA A;  1PC2 A;  5BUZ A;  3OA1 A;  5FT9 A;  3WAQ A;  4PUC A;  4AIF A;  3RKO F;  3ZU7 B;  3LS0 A;  3ZYL A;  2CFZ A;  1HMD A;  3ML9 A;  3LJB A;  1VLS A;  2R7X A;  3TD7 A;  3JRM O;  3E30 A;  4BTA A;  1V74 B;  1D1A A;  4GTT A;  5TJ5 E;  2HV6 A;  1Z5S C;  4I1O B;  1YAR O;  4U96 D;  3HIZ A;  5A69 A;  3UT4 A;  3KMI A;  5E33 A;  2R7R A;  4NC3 A;  4U5D E;  1CPQ A;  2NUP A;  1BPO A;  4Z9J A;  3SXK A;  3U9M A;  3DSW A;  2C0M A;  1WOL A;  1V54 E;  4EQF A;  4CBE A;  3B95 A;  1OXK A;  2VGE A;  1NBB A;  1TEZ A;  5A6J A;  3JZ0 A;  2JX0 A;  3CAX A;  3M4C A;  4DOZ A;  2XRZ A;  1A41 A;  1UJK A;  4U63 A;  4M63 A;  3NKE A;  3C8G A;  1OCR E;  2KCL A;  1LE4 A;  4LSZ E;  3K33 A;  5CEA A;  2FO1 E;  4ER9 A;  3H2V A;  3CHM A;  1D1B A;  2A4Z A;  2LIG A;  4WAF A;  2GDC A;  2UUI A;  1E90 A;  4OIN F;  1LS4 A;  1XGW A;  2IXO A;  2OJE D;  3ABK C;  3HNK A;  2X0C A;  2XCC A;  3ESK A;  4I17 A;  1F1M A;  1S64 A;  3X2Q E;  4JHR A;  2LO6 A;  1IQU A;  4CRW A;  2WXJ A;  2XL6 A;  3EZH A;  3SZR A;  1Y4C A;  4CS7 A;  1KZO A;  1TWG A;  1N94 A;  1TNY A;  3U8V A;  4J7T A;  4KBQ A;  4DX1 A;  4GPK A;  3CKC A;  1XZQ A;  2XLO A;  2OEV A;  4HRL A;  5CBN A;  2NC9 A;  5KYY B;  2HV7 A;  3KYJ A;  4ONS A;  2AU5 A;  1TYQ G;  2I6H A;  4N39 A;  4CDY A;  3J5P A;  4ABN A;  1XWJ A;  2VCA A;  3QZC A;  3ZG1 A;  1B89 A;  4F1S A;  5AJL A;  4C0M A;  1NA3 A;  1QNF A;  3GAN A;  3AG1 C;  4YT4 A;  2PZI A;  4PFO A;  4A2N B;  4O6M A;  2XXA A;  3DST A;  4BJ1 A;  3IEG A;  2X6K A;  4DRX E;  2QZA A;  3ZQV A;  4PAC A;  2IFU A;  2D4U A;  2WB2 A;  2PBE A;  3LVR E;  2P9P G;  3Q6M A;  3FDQ A;  4IJJ A;  2XLM A;  3DMD A;  3CEX A;  1VMA A;  3CVP A;  1IXV A;  4PS3 A;  2GRL A;  1D9S A;  2ZGD A;  3J5Q B;  2WXG A;  3LNM B;  3B71 A;  4DI3 A;  4EIY A;  4XI9 A;  3MYF A;  2UY1 B;  1KT0 A;  2YRF A;  3DRA A;  3ZRH A;  5B3S E;  4KZ0 A;  4D4N A;  1E8Y A;  1VK5 A;  4AJW A;  1YZA A;  4O7G A;  3UKU G;  5ENQ D;  3ZDL A;  2FGY A;  4CDM A;  3SEO A;  2WM9 A;  2R25 A;  3G2S A;  4JTA B;  3ML8 A;  2WQ6 A;  2ZD9 A;  3UMH A;  2IO3 C;  3ABL E;  2IXP A;  1TWC A;  4GCO A;  3K1I C;  1K3Z D;  4JL0 A;  2I9C A;  2DYS C;  3PZ3 A;  1B68 A;  5FZQ A;  4JRZ A;  4MND A;  3NAW A;  3ENE A;  5KYW A;  1WGW A;  3EU9 A;  3E33 A;  4MVR A;  1UG7 A;  3EIQ C;  1NZE A;  1GM5 A;  5KNH D;  3ATP A;  1MMD A;  3ASO E;  3AQC A;  4LER A;  3CLJ A;  4DX7 D;  2OVF A;  3RKV A;  3FXH A;  4HLE A;  3AS5 A;  4LLE A;  5BXU A;  4CJG A;  3ZVV A;  3QJZ A;  3K1I A;  3SXZ A;  1UG3 A;  5CHE E;  3CVY A;  4U8H A;  1OWL A;  1MND A;  4HXI A;  3CVU A;  4MTF A;  5HS0 A;  5BV0 A;  1T5O A;  2P9K G;  3FU0 A;  3AJI A;  5FIN A;  4CIP A;  4U0S A;  1Q0F A;  4XPW A;  3B7S A;  4I44 A;  3V31 A;  1TWH A;  2UUH A;  1R5I D;  2YZS A;  4FWV A;  4GZD A;  2EIM E;  3ONK A;  2X38 A;  3TXM A;  2ICW G;  2EPM X;  3RFY A;  3LY8 A;  4J0U A;  1RMV A;  4U04 A;  4WAB A;  1YYX A;  2PQR A;  2A0B A;  2XLH A;  3ZUV B;  4E85 A;  4E7Z A;  1BD8 A;  3DSU A;  1U2V G;  4A3T A;  4XTK A;  2XHE A;  5JS5 A;  1RKE A;  5G05 J;  4BJ6 C;  2KM4 A;  3D9P A;  3FTU A;  3KS2 A;  2LFF A;  2VJ8 A;  4EPZ A;  4XKC A;  2VSO E;  4YL0 A;  5KJM A;  5KNG A;  4B0Z A;  4EHP A;  2DB4 A;  1H2U A;  4QQI A;  3V2X A;  2W4M A;  4QI2 A;  1YYH A;  5B1A E;  1J8M F;  3HTK C;  3MLG A;  3VTY A;  5LFA A;  2NUT B;  3DM9 B;  1FT1 A;  1L5J A;  3W2V A;  4BJ6 A;  4KXK B;  3G4X A;  4DI4 A;  4O60 A;  4FJZ A;  4JHJ A;  5KYX B;  3FHE A;  3UUX A;  3RJV A;  3FH7 A;  3RH3 A;  3MV2 B;  4DLO A;  1DC2 A;  5AN8 A;  5C1D A;  5CBO A;  2GRR B;  2VGY A;  2BC5 A;  2AXV A;  4U5G A;  3UX4 A;  3OXL A;  4JJG A;  1S7Z A;  3W8H A;  3I5Q A;  5E76 A;  3HLZ A;  2GRQ B;  3EH2 A;  3DSS A;  4GCN A;  3UMI A;  5T3T A;  2H6H A;  1YA9 A;  4JCH A;  1BLX B;  1OUV A;  4UUC A;  3JTL O;  2CNW D;  4KI2 A;  5ENT D;  3ONL A;  4L23 A;  5EIB E;  4AY6 A;  1U89 A;  3G50 A;  2MRI A;  3D3M A;  3KD7 A;  2NSG A;  3FUH A;  4DK5 A;  3QVY A;  1ZHT A;  3GEH A;  3LXU X;  3SD5 A;  1FR0 A;  4GMR A;  4JZA A;  1VTM P;  4FLH A;  2YHS A;  5F5H A;  1M2O A;  2AP3 A;  3FOO A;  1ZYR F;  1T9K A;  4Y6W A;  4NAC A;  1H6K A;  4IYP A;  3Q7A A;  4MVQ A;  4IAQ A;  4JD2 G;  1OW8 A;  3DAG A;  3A9C A;  3ABM E;  1VB5 A;  2LSV A;  3LEW A;  2WPV A;  3JUE A;  4JA7 A;  4NCQ A;  4U9E A;  4BJT A;  3W9G A;  1SZ9 A;  3BU8 A;  4GEH A;  2YEV A;  4O6Y A;  3GZ1 A;  4NQF A;  3SY2 A;  2KC7 A;  2OU6 A;  2B0O E;  1Y6D A;  2LUH A;  4WGY A;  5JSL A;  3WG7 C;  3AG2 C;  4AL0 A;  4DX5 D;  4ILH B;  2R7Q A;  5DVW A;  5B1B E;  2OCC E;  1U0B B;  2DVW A;  2E2E A;  4RG6 A;  2WVO A;  1KNY A;  2NXP A;  5A6K A;  3C3Q A;  3EZI A;  2WQ7 A;  2PX3 A;  3FAJ A;  3FTY A;  3GZ2 A;  2A5E A;  2BED A;  2AWC A;  4MW3 A;  5KBA A;  2IQC A;  4FAP B;  4ILG A;  4EUK B;  5KYY A;  5D2M C;  2KZT A;  5KYN A;  2ION A;  1OR2 A;  3KSQ A;  3U2M A;  3SYN A;  2KSF A;  2R7S A;  2HR2 A;  3UIN C;  5LCW C;  2YVK A;  5DLJ A;  1TKN A;  3AGT A;  2QNL A;  3SXM A;  4N6C A;  2FEZ A;  2HE0 A;  3EH1 A;  4CSA C;  2J08 A;  1YDI A;  1E8W A;  3FHD A;  3CV0 A;  1OCZ C;  2IO2 C;  4BEJ A;  1E8Z A;  2PQN A;  4GTQ A;  5FQ7 A;  4BET A;  3D9H A;  1SQM A;  2Q9B A;  2ETC A;  1CGN A;  5FJY A;  1X81 A;  2WXQ A;  3KH2 A;  4I1A A;  2BUG A;  3S29 A;  4J7W A;  4U5F E;  4RQI A;  1K40 A;  2IJG X;  3JCU Q;  3RRN B;  4BJ5 C;  5K0I A;  1Q0M A;  1YZC A;  4PS8 A;  3VLE A;  3AS8 A;  3VRC A;  2DZO A;  3HG0 D;  1H9T A;  3LPZ A;  5L0C A;  4HLL A;  5HRY A;  4P9T A;  5KWD A;  2IOL A;  3ULQ A;  1WTY A;  3E9V A;  4CSA A;  3RU0 A;  3BG0 B;  2UY1 A;  1OKK D;  3PMR A;  2LXL A;  5COG A;  3EFO B;  3RSE G;  1SW6 A;  4GTO A;  2Y69 C;  5JHB A;  2WMN A;  4AK9 A;  5J90 A;  4WWP A;  5FQ6 A;  3DI5 A;  4B89 A;  5AQ7 A;  4EEC A;  3L0I A;  1N95 A;  3QAR A;  2Y3D A;  1SA4 A;  3ULE G;  2L9B A;  3LKU A;  4BJ5 A;  2EIL C;  1OCZ E;  3SBT B;  1D0Z A;  4DLQ A;  3SFX A;  2P9N G;  3JXJ A;  1Q0K A;  4OD4 A;  1ELW A;  1NA0 A;  4FAD A;  5EN5 D;  2OV8 A;  3J06 A;  3EIJ A;  3HXF A;  2EQX A;  2JLB A;  1Z5Z A;  3UIP C;  3GEE A;  4DX2 A;  5CEC B;  3C63 A;  3NOG D;  1IKN D;  3U8P A;  2V26 A;  4CCA A;  2B0J A;  3JRT A;  1DOW A;  3L08 A;  2RG8 A;  4UQZ A;  4EBB A;  2J9Q A;  3TWW A;  3C3R A;  4YDY A;  3ZW3 A;  1KU2 A;  5L0H A;  3R9A B;  3ISM C;  3EU5 A;  2ZGG A;  4EZK A;  4MVO A;  3IQ5 A;  2YKZ A;  4XWJ A;  1FVH A;  3CVX A;  3DM5 A;  5B3I A;  1L7C A;  2VH3 A;  3JXI A;  1CGM E;  4KYO B;  4BER A;  1BI7 B;  3IQC A;  4YT8 A;  3QWV A;  1UFB A;  3BQO A;  1C17 M;  3QB2 A;  2XQ0 A;  1NI1 A;  3PDN A;  3B0V C;  3CHQ A;  1A7D A;  2XLE A;  2WXH A;  1IYG A;  3PNL B;  3DWL G;  2HMQ A;  2YL3 A;  1HG2 A;  3LJN A;  1VOM A;  1MNE A;  2KGO A;  1SZA A;  4U9D A;  4G7H F;  5L0J A;  3GEI A;  4XQ1 A;  4U8Y D;  1OXJ A;  1NFN A;  4CGW A;  3TWQ A;  3PS6 A;  2ETS A;  3ZVR A;  5BQH A;  3GW4 A;  2Q9C A;  3MGB A;  2PFD A;  3W2W A;  4B8A A;  2XRH A;  4IWB A;  1JCQ A;  1A5E A;  3KYI A;  1OWP A;  4RVB A;  4BES A;  2G3V A;  2YLD A;  3L16 A;  3D9I A;  1JRA A;  1VDY A;  4CT4 A;  4FLB A;  3EG9 B;  4JTC B;  2BKG A;  3G2W A;  4JXT A;  3M1C B;  3Q78 A;  3ZEF A;  1YLM A;  2Y4U A;  4GB9 A;  3DJN B;  2HYZ A;  3CHR A;  3F46 A;  3K1H A;  2PM6 A;  1GS9 A;  2EPL X;  2HMZ A;  3IHY A;  1N0Q A;  5D91 A;  3CHS A;  3HXD A;  4HOS A;  2A6H F;  2R02 A;  1Z3Y A;  2X3M A;  4F3V A;  4ULV A;  4GYW A;  2NUT A;  4GA2 A;  4AV7 A;  5G04 C;  1ORS C;  2J0W A;  1BI8 B;  2OVB A;  4LDK A;  2LAI A;  1W3B A;  4E7S A;  3D9K A;  3VF0 A;  4O6N A;  1C02 A;  5KYX A;  1MQS A;  3IKO B;  2G3K A;  3FP3 A;  2DGJ A;  3HJC A;  4U5E E;  1Q0G A;  2J9U A;  3MBG A;  1WY6 A;  2LK4 A;  3ZNG A;  4ANV A;  3ASD A;  3ASN E;  1RXQ A;  4L7T A;  3KEA A;  4CDA A;  4N3C A;  5AQA A;  4HEA J;  3ECS A;  2BL2 A;  5HV9 A;  3E32 A;  4CGV A;  5JA4 D;  4HBD A;  4RDA A;  1BR4 A;  4PDX A;  1CPR A;  3T5V A;  2WL8 A;  3O10 A;  2XGO A;  2Y3H A;  2J9V A;  2CHW A;  2WXM A;  3NZS A;  2LSE A;  2Y3B A;  3EHR A;  3NMJ A;  2J46 A;  5BNW A;  4KC9 A;  4OAU C;  1FMW A;  4EBA A;  2XL4 A;  3HNI A;  3RVZ A;  3C8G D;  5CER B;  2MHR A;  3TWX A;  1OQC A;  3APF A;  4OD5 A;  3AG3 C;  2QYJ A;  2P7V A;  3B7B A;  3ZHE A;  2AVP A;  2EIN C;  3K66 A;  4CIH A;  4JCZ A;  1FFH A;  4YDW A;  2E87 A;  4W8K A;  3PUK A;  2ZXR A;  1MMG A;  4K0R A;  3DEP A;  4JTD B;  2FAP B;  5T1D B;  1VYI A;  5EDS A;  4ANX A;  5E75 A;  4L1B A;  3DAF A;  4GYT A;  2I2O A;  3E34 A;  4LCT A;  3QW0 A;  1DCE A;  1HU3 A;  1UN9 A;  4Q96 A;  3FH5 A;  3AG4 C;  2Q7R A;  1OCC C;  2XM4 A;  4Z9H A;  4MQ9 F;  3TWT A;  2R7U A;  1V55 E;  3DPY A;  3PCV A;  3SNH A;  3PE4 A;  3TQO A;  3Q15 A;  3ITF A;  2GRP B;  4DJA A;  1E8X A;  4G7O F;  2V4H C;  3RF3 A;  3WXX A;  4HFG A;  2OKU A;  3CQC B;  4HQD A;  4PJN A;  4RSY A;  4MTO A;  2ZXO A;  4ACL A;  3FUL A;  4AY5 A;  4QI0 A;  3O39 A;  2QE9 A;  3HNL A;  4XLN F;  3SF4 A;  4PJM A;  4C3D A;  1O1S A;  2C2L A;  3R9M A;  2CFU A;  4XZ4 A;  2X6H A;  3U64 A;  3OTN A;  2Z15 A;  3CVL A;  5LOZ A;  3SZ7 A;  3SHF A;  3ZSU A;  2FUL A;  4YL3 A;  4J8S A;  3DEO A;  1CGO A;  3DSV A;  4JIO A;  3C72 A;  3HHM A;  3DKA A;  4HOT A;  3C7J A;  3FU6 A;  2RD0 A;  4EKW A;  1ZZP A;  3ZYQ A;  4U8V D;  3DXK G;  4JZY A;  1TNU A;  2I15 A;  5CI9 A;  3SI5 A;  4J7Y A;  2VAS A;  3E70 C;  3Q9U C;  3EPV A;  2MYS A;  3T5X A;  2KQ9 A;  2DCP A;  2F8Y A;  4TXR A;  1YA0 A;  1AUE A;  1HFA A;  3HRA A;  3S27 A;  3T6J A;  2CYD A;  1D0Y A;  1HO8 A;  1OWN A;  4JPS A;  5KJN A;  4ME2 A;  5D0Q D;  2I1J A;  4MTG A;  5CRU A;  3TXN A;  5L3V A;  3ABK E;  3A11 A;  1JPN A;  4FES A;  4WNE A;  3VLD A;  1MQV A;  3FU5 A;  5EYP F;  3O55 A;  4DXW A;  5HSW A;  2IU1 A;  1N54 A;  1T6U A;  2XGS A;  2V3C C;  4E6H A;  2WXK A;  2G62 A;  1RJ9 B;  3NMK A;  2QYU A;  4GPM A;  1BR1 A;  4Y6C A;  4EBA G;  2JPU A;  4I1M A;  3UT8 A;  2Y0B G;  4G8L A;  3NZU A;  4C7O B;  4KZC A;  2A0U A;  1MZC A;  2P9L G;  1D8D A;  5DS5 A;  4I6E A;  4FHK A;  2YL7 A;  3T6B A;  3TK0 A;  3TAX A;  2A69 F;  3L13 A;  5HQ8 A;  4KVM A;  3S9O A;  4E18 A;  2IF4 A;  4UQY A;  3QKY A;  1Z3I X;  1OT8 A;  3O6X A;  3LNR A;  5KJL A;  3PNT B;  4MRU A;  5ANL A;  1BR2 A;  4P29 A;  1ZHX A;  2J07 A;  2KC3 A;  1H19 A;  2F0Y A;  4GZC A;  5GPG B;  1IHB A;  3AG1 E;  3BEE A;  3QW1 A;  2JEK A;  4XE0 A;  4E0I A;  4RBN A;  4M3O A;  3FDH A;  2BF0 X;  2XPZ A;  1XZP A;  1KT1 A;  3PH0 C;  1S70 B;  3DE9 A;  4CDR A;  3QDN A;  3GM3 A;  3VLF A;  1UN8 A;  1WAT A;  3IBE A;  3C5R A;  2CHX A;  4EBJ A;  5IY5 C;  1N9A A;  2VQ2 A;  4J32 B;  2H7B A;  2YQY A;  4JEA A;  5CI8 A;  4UI9 J;  4IAR A;  2LNI A;  1GGQ A;  3KSL A;  5BQG A;  3NBN B;  3VAY A;  2HM8 A;  3MKQ B;  4AEZ C;  1H2T C;  1Y8M A;  2B0H A;  3JQ1 A;  3Q6N A;  4C3E A;  1DOV A;  3W9F A;  3EGX B;  4AX2 A;  5A7D B;  2LCH A;  4MS6 A;  4OYS A;  4BT9 A;  2J4B A;  5FZR A;  4GTS A;  2J8S D;  4KBL A;  4WND A;  2L6H A;  1ZU2 A;  3WHN A;  3CHO A;  3POV A;  4YT2 A;  2DYS E;  2KAT A;  4G26 A;  2XZT G;  1YA7 O;  3ZGQ A;  1KPS B;  3QMK A;  4XEK A;  1JCS A;  1I5N A;  4GA1 A;  3PZ2 A;  1TNO A;  3OAW A;  3H2U A;  2XCB A;  4KNV A;  2CCY A;  4GZ3 A;  4APF A;  1QKR A;  5BPP A;  3GOR A;  1JAF A;  1HX8 A;  4HOQ A;  2DIW A;  1ELK A;  1Z23 A;  1M2V B;  3HNJ A;  2OOE A;  4WWO A;  2A1D D;  2IM8 A;  1INZ A;  2F37 A;  4YWQ A;  1N4Q A;  4O6F A;  2L81 A;  2YL0 A;  4D10 C;  5LCW J;  1WN0 A;  4MVZ A;  2R7O A;  3MA5 A;  1AEP A;  4N5C A;  1LKX A;  2DBA A;  3AQB A;  5COM A;  1HZ4 A;  1T6I A;  1KLX A;  2VSY A;  4OIP F;  4ZHB A;  4HOR A;  5EX0 A;  3L8I A;  4EBK A;  2R7T A;  4K03 A;  3CGH A;  4J8D A;  3G4Z A;  3SBS A;  4PH4 B;  4FC8 A;  4LUN U;  1FAP B;  3FAP B;  3U3B A;  4E0H A;  2C0L A;  2XM0 A;  2J4D A;  5T3R A;  2QC9 A;  2WMO A;  4YJW A;  2XEN A;  4E17 A;  2WXP A;  3UTM A;  4G2V A;  1K04 A;  3EUV A;  4HI8 A;  2RFM A;  3CIA A;  3RAU A;  1JPJ A;  4A1G A;  4DX6 D;  4IB4 A;  2EIJ C;  4KT6 B;  3D9L A;  1Z63 A;  3FUM A;  2H8A A;  1N4S A;  4G0H A;  3WOD F;  3SFZ A;  2C04 A;  2GRO B;  2VC9 A;  3N71 A;  4OVU A;  5L3Q A;  4J30 B;  3HDX A;  1AVO B;  1ORJ A;  4LDQ A;  1Y6I A;  1PAQ A;  1TNZ A;  1D1C A;  4HE8 D;  5HI7 A;  3PUJ A;  3EHN A;  4M7C A;  3M4B A;  4C0E A;  3JCK C;  4UI9 K;  1K1A A;  2XL8 A;  4NTF A;  3TWR A;  1K05 A;  3ZYK A;  3PZ1 A;  2A5U A;  3D9J A;  5H7P A;  4BY6 A;  4U5H A;  5AEN A;  2WVQ A;  3S7J A;  3UM1 A;  4O1O A;  2L6G A;  3QC1 A;  1LM3 B;  1O1R A;  5F28 E;  3CEQ A;  4DPR A;  1KTM A;  1JUQ A;  2RSE B;  3UM2 A;  3RIB A;  4I3M A;  2FO7 A;  2Q4F A;  1Q2Z A;  1BBH A;  2L6B A;  2IOS A;  3UQ3 A;  1WM5 A;  4MVS A;  2KCV A;  4JVS A;  4JW1 A;  3DD7 A;  2XGM A;  3FMS A;  4GAA A;  4L6R A;  1ZU4 A;  2H6F A;  3VTX A;  2CG3 A;  4HFK B;  4LRZ A;  4TRQ A;  1APC A;  1H2V C;  4YL1 A;  5FZS A;  1WAS A;  3RO2 A;  4U5C E;  1OXB A;  4GTR A;  5EGY A;  1O5H A;  1N4P A;  1K1B A;  4B8C B;  4W8P A;  4A55 A;  2PX0 A;  5ENR D;  2HJ3 A;  2TMV P;  1IQR A;  5E3C A;  1FVF A;  3FTW A;  2I8B A;  2IXM A;  1GQA A;  2QY7 A;  4MLP A;  4GTM A;  1FNT c;  3RO3 A;  3T9K A;  4GYY A;  3EGD B;  1LI7 A;  4GTV A;  2ILR A;  3S7D A;  1PV3 A;  4MS2 A;  4JB8 P;  4U0Z A;  2XS8 A;  2D5R B;  3C18 A;  4A3V A;  1NG1 A;  3V7O A;  4IRU A;  3LEV A;  2FF4 A;  1TN8 A;  2FBN A;  4NRH B;  2WZG A;  1AP7 A;  2V0P A;  5JT4 A;  4TV3 A;  4WNF A;  3RRM B;  4H4K C;  2X6F A;  4FJY A;  5BQI A;  2EPK X;  3Q75 A;  3T9O A;  4IAO A;  2Y4T A;  3R7R A;  2MWQ A;  3P2B A;  3WG7 E;  3AG2 E;  2VTB B;  3ZXS A;  3K6B A;  5G04 J;  2J09 A;  3ZYM A;  4HB5 A;  4N4W A;  2F22 A;  4NY3 A;  1T6Q A;  3ZTM A;  1N0R A;  1RJ9 A;  2A6E F;  2KNH A;  2ZIS A;  1N4R A;  1RZ4 A;  4K7B A;  1I4Y A;  2R17 C;  4C7O A;  4ZFH A;  3CSK A;  3QOU A;  4DRJ B;  3IPM O;  1RKC A;  4UDV A;  1JOG A;  4C3B A;  2L0I A;  3MJW A;  4N3B A;  4U07 A;  2A68 F;  3DXM G;  4H7Y A;  2XEV A;  2R7V A;  1O1T A;  3LAY A;  4HS2 A;  1A7E A;  2XPY A;  2EIK C;  4LLC A;  2W45 A;  3U0C A;  4AP2 A;  4K5B A;  1W2W A;  1QPU A;  1R4T A;  1OWM A;  1LVK A;  1KZP A;  2I1K A;  2IXN A;  5BT1 A;  1SZI A;  3GZS A;  2E0I A;  1MJ0 A;  3LS8 A;  1C03 A;  2DYR C;  3O48 A;  5ARF A;  2P9S G;  1N1C A;  4Z68 A;  3RVY A;  5L0F A;  5JRA A;  1HY5 A;  3TJ6 A;  1HS6 A;  2RKK A;  4LNU D;  1HG5 A;  3PZ4 A;  2VCB A;  1HH8 A;  3TOL A;  5A6B A;  2PNN A;  5D92 A;  4EHM A;  3LY9 A;  3ZFW A;  4H7X A;  4U0U A;  2GFH A;  1PCX A;  4Z9I A;  1QQE A;  3B13 A;  4XEI G;  4AXH A;  3DJU B;  1QYM A;  3MKQ A;  3UKR G;  2ZXW C;  1EF1 C;  2Y69 E;  4HRN A;  3SGH A;  3FUF A;  1GW6 A;  2HO1 A;  3UMK A;  5JJ7 A;  3AS4 A;  1OCO C;  2YQ8 A;  2EIL E;  1G3N B;  2WXO A;  5KYU B;  3L1M A;  2WXI A;  3QK0 A;  2HKV A;  4JEH A;  1IHG A;  1TN6 A;  2OJQ A;  4CS8 A;  4AE4 B;  4UWL A;  4IUL A;  4J8Y A;  2R03 A;  2LP4 A;  1OY3 D;  2P58 C;  4TUU A;  3HVE B;  4LG6 A;  4HVB A;  1WWP A;  4WWN A;  3I3N A;  5EYL A;  4PR9 A;  1Q0D A;  4DBR A;  1EKY A;  2V4L A;  2J7P D;  2AWY A;  2V8S E;  4WUY A;  4PK4 A;  3U3F A;  2ZXW E;  2QUP A;  2X6I A;  5ENO D;  2OQM A;  3Q9N C;  3UNG C;  1LS1 A;  5D66 A;  4ATG A;  1M2V A;  1G4W R;  1D8E A;  1HE8 A;  2NSZ A;  3L82 A;  4ILI A;  3IV0 A;  4GYO A;  1TJF A;  4EWC A;  5D0O D;  4DJ9 A;  3EDT B;  2WVI A;  2R7W A;  3UGO A;  1TFK B;  1LE2 A;  5AIJ A;  3FEY A;  4BSX A;  4DRI B;  2YLI A;  2L9J A;  1ST6 A;  3ZWI A;  1PY1 A;  2CG2 A;  4OVV A;  2UWJ G;  2WZF A;  3DBS A;  3GWL A;  4JEB A;  4GA0 A;  3LLI A;  2NSF A;  3GYZ A;  4YVQ C;  2HSB A;  2AVK A;  1D0X A;  1ELR A;  3UMV A;  3G2T A;  3DE8 A;  2P9I G;  3D9M A;  3OWT A;  3ZPJ A;  2VCC A;  3CQZ A;  1NFO A;  3FUN A;  2ETB A;  2XRY A;  3FUE A;  3URZ A;  1NU9 C;  4I9E A;  4BTB A;  3TWS A;  2V5Q C;  2AJA A;  1PD1 A;  4UQX A;  3LS1 A;  1QVX A;  2YNQ A;  3ZKJ A;  5FQ4 A;  1AWC B;  3M79 A;  1S63 A;  3RRU A;  3W4Y A;  4XX5 A;  4N5Q A;  3LJ3 A;  2NYJ A;  5T4Y A;  1QBQ A;  1N52 A;  2WVN A;  3QWP A;  4MVM A;  4AL1 A;  3MYI A;  1FPP A;  4AVX A;  3LEO A;  3NYM A;  3U9W A;  3NB2 A;  3DWW A;  4WNG A;  3R7C A;  4Q4Z F;  4YVO A;  5BUO A;  3DPD A;  1HMO A;  2JD3 A;  1SMY F;  4FHJ A;  4DUI A;  2P0N A;  4PFP A;  4K0D A;  2QY9 A;  3TJP A;  3JSE O;  3ASF A;  1O3U A;  1JMW A;  1V54 C;  2P1A A;  4PJJ A;  3IHU A;  4OIR F;  3IEE A;  2B6C A;  3EHM A;  4YN0 B;  4ACK A;  4U5B E;  2KXP C;  1XNF A;  3ZC4 A;  5AAR A;  3UXG A;  1WAO 1;  1JWG A;  2XSE A;  1OCR C;  5A6C A;  4J8E A;  4BG0 A;  3LES A;  4GZ6 A;  5CCL A;  4B94 A;  4HFF B;  4UWF A;  3LLK A;  1M56 C;  5BXO A;  3TGO A;  3ASH A;  4DRH B;  2WQH A;  4MVU A;  5A6A A;  2OG2 A;  3KPH A;  2C03 A;  4ATZ D;  5JMN D;  1DNP A;  4O1P A;  1LD7 A;  1SA5 A;  2Q9A A;  1RCP A;  2R05 A;  4A4A A;  1QZ2 A;  3CK8 A;  2GRN B;  3SQV A;  3APD A;  4BEP A;  3OXF A;  4H54 A;  3X2Q C;  1IW7 F;  4CZ2 D;  4XEF A;  2MOW A;  3AG3 E;  2P61 A;  3NMI A;  2EIN E;  4ANW A;  3BG1 B;  3GOD A;  3OEO A;  4KVO A;  5FWQ A;  1SF8 A;  4N2S A;  4G25 A;  3UM0 A;  5G2N A;  5JVE A;  3RK6 A;  3GM2 A;  2L0T B;  2JAB A;  4MKT A;  2DWZ A;  3EGD A;  5AC4 A;  4NQ0 A;  4TXQ A;  4WGZ A;  3Q7F A;  4I2Z A;  4FP7 A;  3S7B A;  4XKB A;  5AJD A;  4EZL A;  3FUK A;  4MBG A;  3SNX A;  3JT1 A;  3AG4 E;  4QDL A;  3APC A;  2O9X A;  1OCC E;  3MV3 B;  2W4B A;  4GMJ A;  4GZ5 A;  4ULW A;  3JYS A;  3D9N A;  1YCS B;  1OW6 A;  4PJL A;  4FA6 A;  2VGX B;  1HE1 A;  4YND A;  5EX3 A;  2XLV A; 
#chains in the Genus database with same CATH homology
 2AW6 A;  2PL2 A;  5EKQ D;  1G8X A;  2VTB A;  3FTX A;  3VYW A;  3CVV A;  3CR3 A;  3JSZ A;  3UGP A;  3FEX A;  3T8M A;  2KZT B;  4A1S A;  2ZXP A;  5B3S C;  4KMO A;  2FI7 A;  3U66 A;  1MMA A;  3JQ0 A;  3FU3 A;  3UPV A;  5CMY A;  1ZHZ A;  3EFO A;  3K9I A;  4F53 A;  1JPL A;  3ABL C;  2WXL A;  3NKD A;  2BTD A;  4UWH A;  3L22 A;  3B0U X;  2CDQ A;  1E7U A;  2X51 A;  4FX5 A;  2GRM A;  4ZLD A;  1X5B A;  3Q5M A;  3ASO C;  4V3I A;  3EQL F;  3QNK A;  3B7U X;  2W9Y A;  2QTV A;  3Q4A B;  2YHE A;  4NUR A;  4JHK A;  4BX8 A;  5E3A A;  3FUI A;  5FCL A;  3PZD A;  5M72 A;  1FFT C;  3T4R A;  3KEZ A;  3G2U A;  3CST A;  2IOQ A;  2R59 A;  2VYI A;  3FY4 A;  3QAQ A;  1MMN A;  3H65 A;  1DVP A;  5A23 A;  1MHQ A;  3P1U A;  3NQP A;  4JA9 A;  4L2Y A;  4GML A;  5KYU A;  2EIM C;  5ANR A;  4CEM A;  4URK A;  3Q7G A;  3PRE A;  4AE4 A;  4BX9 A;  5C2Y A;  3N24 A;  4P6I C;  3FFL A;  5J08 A;  5FTP A;  3CK9 A;  3HVE A;  5E2Q A;  1HF8 A;  2LAH A;  2J9W A;  2WXN A;  1Z3X A;  3I5P A;  1H0A A;  3S28 A;  1ZHW A;  4G24 A;  2ZPA A;  3UR3 C;  4AOF A;  4OIQ F;  5JJT A;  3ASG A;  2BE5 F;  3EG9 A;  1Z6T A;  2VB6 A;  5B1A C;  1PD0 A;  3CZ6 A;  1JWF A;  4N2Q A;  3PRZ A;  3ZN3 A;  3FTV A;  2X6J A;  3MCX A;  2CGE A;  3L17 A;  2CW0 F;  2J45 A;  3DZA A;  2YIN A;  5BW8 C;  3MZL B;  2XPI A;  3B7T A;  3C98 A;  4JC8 A;  4EZJ A;  2AWI A;  2PM7 A;  4HOU A;  5KJK A;  4UWK A;  5DS4 A;  2GGF A;  3FWV A;  4I2W A;  3OXG A;  2YHC A;  4XI0 A;  2PF4 E;  3I4G A;  3ESL A;  2M4E A;  1VYK A;  3NF1 A;  1QLE C;  5LP0 A;  1NU7 D;  3TL5 A;  2Q7F A;  3PEV B;  4L2L A;  5FQ8 A;  3TG5 A;  3ZIB A;  1IZM A;  2KW3 C;  3ABM C;  1TJC A;  1P5Q A;  4O79 A;  1O87 A;  2KJG A;  3LYA A;  3MKR A;  3FUD A;  5AYW D;  5DBK A;  2VSN A;  2Y39 A;  4G23 A;  2H7O A;  4FU3 A;  5CMW A;  4J6I A;  3CVQ A;  1FMV A;  3ZHE B;  5B1B C;  2OCC C;  5JHA A;  3LY7 A;  3NYL A;  2WZL A;  4UI9 C;  4ANU A;  3MEK A;  3E4B A;  5T8I A;  4KNW A;  1NP7 A;  3IHV A;  2NUP B;  4G7Z F;  5KCM A;  3X1O A;  4F7A A;  4G11 A;  2CNW A;  3N2Z B;  3L6A A;  1NZN A;  2QFC A;  5F5F A;  4N06 A;  2V5F A;  4F4B A;  3S2A A;  4I6G A;  2H7V C;  1ZHY A;  2VGX A;  3MX3 A;  3LVQ E;  1ZBP A;  4R7L A;  3PHF 2;  2Y3G A;  1OWO A;  1J8Y F;  1A17 A;  3Q49 B;  5G05 C;  1U3C A;  4W9R A;  3LCA A;  2GW1 A;  1E7V A;  4CDN A;  4DBQ A;  1UW4 B;  5LX8 A;  3ZIM A;  3N0T A;  5BV1 A;  5ENN A;  1TWA A;  4CS9 C;  4WJ0 A;  4YT5 A;  4Q94 A;  2ZU6 B;  4CT0 A;  3FVY A;  3U3W A;  2AXU A;  4OIO F;  1UJJ A;  2XXA B;  4RD9 A;  4B6I A;  1TR2 A;  2J0X A;  3B0P A;  1M57 C;  5EHH A;  3S7F A;  3MYV A;  4PS7 A;  5G55 A;  3HYM B;  4BFR A;  4CS9 A;  5DQT A;  3Q7L A;  3SP1 A;  4X0R A;  1HXI A;  3W8I A;  2WXF A;  2J49 A;  3K7D A;  3KKB A;  4LEU A;  1Z6A A;  3NRH A;  1ZU5 A;  4ANJ A;  3NYJ A;  4CS8 C;  1S0P A;  3B9Q A;  5JJ6 A;  3F47 A;  3KL4 A;  3L54 A;  2KCK A;  3EGX A;  3FUJ A;  3JYH A;  1E96 B;  2FFH A;  5DS6 A;  5T3W A;  3EJN A;  1EDU A;  3AU4 A;  5KYW B;  1U3D A;  3KAE A;  3AU5 A;  1OKK A;  2WXR A;  3LDZ A;  3D9O A;  4G1T A;  2Q3T A;  3CK7 A;  2R5S A;  4QFV A;  4I6J A;  4AM9 A;  4J8F A;  4UWG A;  2Y3A A;  3FTS A;  3CVN A;  3RIP A;  5CCM A;  3B7R L;  3I4R B;  4GU5 A;  3QWW A;  3CQG B;  3FTZ A;  3Q47 B;  4Q69 A;  2VSX E;  4XIF A;  2OND A;  1FTS A;  3RYL A;  4FUL A;  4JUR I;  4I9C A;  4JEU A;  3FH8 A;  3L34 A;  4JJF A;  4XLP F;  4Q7C A;  3CKB A;  3G2V A;  2P6V A;  3ASN C;  4APO A;  3CHP A;  4I43 A;  1EPU A;  4BWR A;  3I4U A;  2M63 A;  3U4T A;  4ZLC A;  2L6J A;  4LAC B;  3DXJ F;  4DVY P;  3NDB B;  3UT7 A;  4DVZ A;  2AXZ A;  4RG9 A;  1FCH A;  2NG1 A;  3PVL A;  4Q5S F;  3S0X A;  5ARG A;  3JUI A;  3PEU B;  3TG4 A;  2LSU A;  2J7P A;  3NG1 A;  2MHK A;  3CSF A;  3CVW A;  4BT8 A;  4C9B B;  2CHZ A;  4IN3 B;  3O4Z A;  1EYH A;  2PP4 A;  5DIZ A;  2WB7 A;  1LF8 A;  4N3A A;  2IYL D;  5DQZ A;  1QZX A;  3PE3 A;  1V55 C;  3R7Q A;  1PC2 A;  5BUZ A;  3OA1 A;  5FT9 A;  4PUC A;  4AIF A;  3RKO F;  3LS0 A;  3ZYL A;  2CFZ A;  3ML9 A;  3LJB A;  2R7X A;  3TD7 A;  4BTA A;  1D1A A;  2HV6 A;  4I1O B;  3HIZ A;  3UT4 A;  3KMI A;  5E33 A;  2R7R A;  4U5D E;  2NUP A;  1BPO A;  2C0M A;  4EQF A;  4CBE A;  1TEZ A;  4DOZ A;  2XRZ A;  1UJK A;  4U63 A;  4M63 A;  3NKE A;  2KCL A;  3K33 A;  3CHM A;  1D1B A;  2A4Z A;  4WAF A;  1E90 A;  4OIN F;  1XGW A;  2IXO A;  3ABK C;  2XCC A;  3ESK A;  4I17 A;  4JHR A;  2LO6 A;  1IQU A;  4CRW A;  2WXJ A;  3EZH A;  3SZR A;  4CS7 A;  1TWG A;  4KBQ A;  4GPK A;  3CKC A;  2NC9 A;  5KYY B;  2HV7 A;  2I6H A;  4N39 A;  4ABN A;  3QZC A;  3ZG1 A;  1B89 A;  4F1S A;  5AJL A;  4C0M A;  1NA3 A;  1QNF A;  3GAN A;  3AG1 C;  4YT4 A;  2PZI A;  4PFO A;  4A2N B;  4O6M A;  2XXA A;  4BJ1 A;  3IEG A;  2X6K A;  2IFU A;  2WB2 A;  3LVR E;  3Q6M A;  3FDQ A;  4IJJ A;  3DMD A;  1VMA A;  3CVP A;  4PS3 A;  2GRL A;  2WXG A;  4DI3 A;  4XI9 A;  2UY1 B;  1KT0 A;  3ZRH A;  4KZ0 A;  1E8Y A;  1VK5 A;  4AJW A;  4O7G A;  2FGY A;  4CDM A;  3SEO A;  2WM9 A;  3G2S A;  3ML8 A;  2WQ6 A;  3UMH A;  2IXP A;  1TWC A;  4GCO A;  3K1I C;  4JL0 A;  2I9C A;  2DYS C;  5FZQ A;  4MND A;  3ENE A;  5KYW A;  1WGW A;  3EIQ C;  1NZE A;  1MMD A;  3AQC A;  4LER A;  3CLJ A;  2OVF A;  3RKV A;  4HLE A;  3AS5 A;  4LLE A;  3ZVV A;  3QJZ A;  1UG3 A;  5CHE E;  3CVY A;  4U8H A;  1OWL A;  1MND A;  4HXI A;  3CVU A;  5BV0 A;  3FU0 A;  4U0S A;  3B7S A;  4I44 A;  1TWH A;  2YZS A;  4FWV A;  4GZD A;  3ONK A;  2X38 A;  3TXM A;  4J0U A;  3RFY A;  3LY8 A;  4U04 A;  2PQR A;  4E85 A;  4E7Z A;  4A3T A;  4XTK A;  2XHE A;  5G05 J;  4BJ6 C;  2KM4 A;  3D9P A;  3FTU A;  3KS2 A;  2VJ8 A;  4EPZ A;  4XKC A;  2VSO E;  5KJM A;  4B0Z A;  1H2U A;  2W4M A;  4QI2 A;  1J8M F;  3HTK C;  3MLG A;  3VTY A;  5LFA A;  2NUT B;  3DM9 B;  1L5J A;  3W2V A;  4BJ6 A;  4KXK B;  4DI4 A;  4FJZ A;  4JHJ A;  5KYX B;  3FHE A;  3UUX A;  3RJV A;  3FH7 A;  3RH3 A;  3MV2 B;  4DLO A;  5C1D A;  2VGY A;  2AXV A;  4U5G A;  3UX4 A;  3OXL A;  4JJG A;  1S7Z A;  3W8H A;  3I5Q A;  5E76 A;  3HLZ A;  3EH2 A;  4GCN A;  3UMI A;  5T3T A;  4JCH A;  1OUV A;  2CNW D;  4KI2 A;  3ONL A;  4L23 A;  4AY6 A;  2MRI A;  3D3M A;  3KD7 A;  3FUH A;  4DK5 A;  1ZHT A;  3LXU X;  3SD5 A;  4JZA A;  4FLH A;  2YHS A;  5F5H A;  1M2O A;  1ZYR F;  4Y6W A;  4NAC A;  1H6K A;  4IYP A;  3DAG A;  2LSV A;  3LEW A;  2WPV A;  4JA7 A;  4BJT A;  1SZ9 A;  4GEH A;  2YEV A;  4O6Y A;  3GZ1 A;  2KC7 A;  3WG7 C;  3AG2 C;  4ILH B;  2R7Q A;  5DVW A;  2E2E A;  4RG6 A;  2WVO A;  2NXP A;  3EZI A;  2WQ7 A;  2PX3 A;  3FAJ A;  3FTY A;  3GZ2 A;  2IQC A;  4ILG A;  5KYY A;  2KZT A;  5KYN A;  2ION A;  3SYN A;  2R7S A;  2HR2 A;  5LCW C;  5DLJ A;  1TKN A;  2FEZ A;  3EH1 A;  4CSA C;  2J08 A;  1E8W A;  3FHD A;  3CV0 A;  1OCZ C;  4BEJ A;  1E8Z A;  2PQN A;  5FQ7 A;  1SQM A;  2Q9B A;  5FJY A;  2WXQ A;  3KH2 A;  4I1A A;  2BUG A;  3S29 A;  4U5F E;  2IJG X;  3JCU Q;  3RRN B;  4BJ5 C;  4PS8 A;  3VLE A;  3AS8 A;  3LPZ A;  2IOL A;  3ULQ A;  3E9V A;  4CSA A;  3RU0 A;  3BG0 B;  2UY1 A;  1OKK D;  3PMR A;  3EFO B;  2Y69 C;  5JHB A;  2WMN A;  4AK9 A;  5J90 A;  4WWP A;  5FQ6 A;  4B89 A;  4EEC A;  3L0I A;  3QAR A;  2Y3D A;  2L9B A;  3LKU A;  4BJ5 A;  2EIL C;  3SBT B;  1D0Z A;  4DLQ A;  4OD4 A;  1ELW A;  1NA0 A;  4FAD A;  2OV8 A;  3EIJ A;  2EQX A;  2JLB A;  1Z5Z A;  2V26 A;  4CCA A;  2B0J A;  3JRT A;  3L08 A;  2RG8 A;  4UQZ A;  4EBB A;  2J9Q A;  3ZW3 A;  1KU2 A;  3R9A B;  4EZK A;  4XWJ A;  1FVH A;  3CVX A;  3DM5 A;  4KYO B;  2VH3 A;  4YT8 A;  3QWV A;  3QB2 A;  2XQ0 A;  3PDN A;  3B0V C;  3CHQ A;  2WXH A;  1IYG A;  3PNL B;  1HG2 A;  1VOM A;  1MNE A;  2KGO A;  1SZA A;  4G7H F;  4CGW A;  3PS6 A;  3ZVR A;  3GW4 A;  2Q9C A;  3MGB A;  2PFD A;  3W2W A;  4B8A A;  2XRH A;  4IWB A;  1OWP A;  4RVB A;  2G3V A;  3L16 A;  3D9I A;  1VDY A;  4CT4 A;  4FLB A;  3EG9 B;  3G2W A;  4JXT A;  3M1C B;  3ZEF A;  2Y4U A;  4GB9 A;  3DJN B;  2HYZ A;  3CHR A;  3F46 A;  3K1H A;  2PM6 A;  3IHY A;  5D91 A;  3CHS A;  4HOS A;  2A6H F;  1Z3Y A;  2X3M A;  4F3V A;  4GYW A;  2NUT A;  4GA2 A;  4AV7 A;  5G04 C;  2J0W A;  2OVB A;  2LAI A;  1W3B A;  4E7S A;  3D9K A;  4O6N A;  5KYX A;  1MQS A;  3IKO B;  2G3K A;  3FP3 A;  2DGJ A;  3HJC A;  4U5E E;  2J9U A;  1WY6 A;  4ANV A;  3ASD A;  4L7T A;  4N3C A;  4HEA J;  3ECS A;  4CGV A;  4RDA A;  1BR4 A;  4PDX A;  3T5V A;  2WL8 A;  2XGO A;  2Y3H A;  2J9V A;  2CHW A;  2WXM A;  3NZS A;  2LSE A;  2Y3B A;  2J46 A;  5BNW A;  4KC9 A;  1FMW A;  4EBA A;  2XL4 A;  3APF A;  4OD5 A;  3AG3 C;  2P7V A;  3ZHE A;  2AVP A;  2EIN C;  3K66 A;  4CIH A;  1FFH A;  2E87 A;  4W8K A;  3PUK A;  2ZXR A;  1MMG A;  4K0R A;  5T1D B;  1VYI A;  5EDS A;  4ANX A;  5E75 A;  4L1B A;  3DAF A;  4GYT A;  2I2O A;  4LCT A;  1HU3 A;  1UN9 A;  4Q96 A;  3FH5 A;  3AG4 C;  1OCC C;  4MQ9 F;  2R7U A;  3SNH A;  3PE4 A;  3Q15 A;  3ITF A;  4DJA A;  1E8X A;  4G7O F;  3WXX A;  4HFG A;  3CQC B;  4PJN A;  4RSY A;  2ZXO A;  4ACL A;  3FUL A;  4AY5 A;  4QI0 A;  3O39 A;  3SF4 A;  4XLN F;  4PJM A;  4C3D A;  2C2L A;  2CFU A;  4XZ4 A;  2X6H A;  3U64 A;  3OTN A;  2Z15 A;  3CVL A;  5LOZ A;  3SZ7 A;  3SHF A;  3ZSU A;  2FUL A;  4J8S A;  3HHM A;  4HOT A;  3FU6 A;  2RD0 A;  3ZYQ A;  4JZY A;  5CI9 A;  3SI5 A;  2VAS A;  3E70 C;  3EPV A;  2MYS A;  3T5X A;  2KQ9 A;  2DCP A;  1YA0 A;  1HFA A;  3S27 A;  3T6J A;  1D0Y A;  1HO8 A;  1OWN A;  4JPS A;  5KJN A;  4ME2 A;  5D0Q D;  2I1J A;  3TXN A;  5L3V A;  4WNE A;  1JPN A;  4FES A;  3VLD A;  3FU5 A;  5HSW A;  2IU1 A;  1N54 A;  2XGS A;  2V3C C;  4E6H A;  2WXK A;  2G62 A;  1RJ9 B;  1BR1 A;  4Y6C A;  4EBA G;  4I1M A;  3UT8 A;  3NZU A;  4C7O B;  4KZC A;  5DS5 A;  4I6E A;  4FHK A;  3T6B A;  3TAX A;  2A69 F;  3L13 A;  5HQ8 A;  4KVM A;  2IF4 A;  4UQY A;  3QKY A;  1Z3I X;  3O6X A;  3LNR A;  5KJL A;  3PNT B;  4MRU A;  5ANL A;  1BR2 A;  4P29 A;  1ZHX A;  2J07 A;  1H19 A;  4GZC A;  3BEE A;  2JEK A;  4XE0 A;  4M3O A;  4RBN A;  3FDH A;  2BF0 X;  2XPZ A;  1KT1 A;  3PH0 C;  4CDR A;  3QDN A;  3VLF A;  1UN8 A;  3IBE A;  2CHX A;  5IY5 C;  2VQ2 A;  4J32 B;  2H7B A;  5CI8 A;  4UI9 J;  2LNI A;  3VAY A;  2HM8 A;  3MKQ B;  4AEZ C;  1H2T C;  1Y8M A;  3JQ1 A;  3Q6N A;  4C3E A;  3EGX B;  4AX2 A;  5A7D B;  4MS6 A;  4OYS A;  4BT9 A;  2J4B A;  5FZR A;  4WND A;  4KBL A;  1ZU2 A;  3CHO A;  3POV A;  4YT2 A;  2KAT A;  4G26 A;  3ZGQ A;  3QMK A;  4GA1 A;  3OAW A;  2XCB A;  4KNV A;  4GZ3 A;  4APF A;  5BPP A;  1HX8 A;  4HOQ A;  2DIW A;  1ELK A;  1Z23 A;  1M2V B;  2OOE A;  4WWO A;  2A1D D;  1INZ A;  4YWQ A;  4O6F A;  2L81 A;  4D10 C;  5LCW J;  2R7O A;  3MA5 A;  4N5C A;  1LKX A;  2DBA A;  3AQB A;  1HZ4 A;  1KLX A;  2VSY A;  4OIP F;  4HOR A;  5EX0 A;  2R7T A;  4K03 A;  3CGH A;  4J8D A;  3SBS A;  4PH4 B;  4FC8 A;  4LUN U;  2C0L A;  2J4D A;  5T3R A;  2WMO A;  4YJW A;  2WXP A;  4G2V A;  3CIA A;  1JPJ A;  4A1G A;  2EIJ C;  4KT6 B;  3D9L A;  1Z63 A;  3FUM A;  4G0H A;  3WOD F;  3SFZ A;  2C04 A;  3N71 A;  4OVU A;  5L3Q A;  4J30 B;  3HDX A;  1Y6I A;  1PAQ A;  1D1C A;  4HE8 D;  5HI7 A;  3PUJ A;  3EHN A;  4C0E A;  3JCK C;  4UI9 K;  3ZYK A;  2A5U A;  3D9J A;  4BY6 A;  5AEN A;  4U5H A;  2WVQ A;  3S7J A;  3QC1 A;  3CEQ A;  4DPR A;  1JUQ A;  3RIB A;  4I3M A;  2FO7 A;  2IOS A;  3UQ3 A;  1WM5 A;  2KCV A;  4JVS A;  4JW1 A;  3DD7 A;  2XGM A;  4GAA A;  1ZU4 A;  3VTX A;  2CG3 A;  4HFK B;  4LRZ A;  4TRQ A;  1H2V C;  5FZS A;  3RO2 A;  4U5C E;  5EGY A;  1O5H A;  4B8C B;  4A55 A;  2PX0 A;  1IQR A;  5E3C A;  1FVF A;  3FTW A;  2I8B A;  2IXM A;  2QY7 A;  4MLP A;  3RO3 A;  4GYY A;  3EGD B;  2ILR A;  3S7D A;  4U0Z A;  2D5R B;  4A3V A;  1NG1 A;  3V7O A;  4IRU A;  3LEV A;  2FF4 A;  2FBN A;  4NRH B;  2WZG A;  2V0P A;  4TV3 A;  4WNF A;  3RRM B;  4H4K C;  2X6F A;  4FJY A;  4IAO A;  2Y4T A;  3R7R A;  2MWQ A;  3P2B A;  2VTB B;  3ZXS A;  3K6B A;  5G04 J;  2J09 A;  3ZYM A;  4NY3 A;  1RJ9 A;  2A6E F;  2KNH A;  4K7B A;  2R17 C;  4C7O A;  3CSK A;  3QOU A;  4C3B A;  2L0I A;  3MJW A;  4N3B A;  4U07 A;  2A68 F;  4H7Y A;  2XEV A;  2R7V A;  3LAY A;  4HS2 A;  2XPY A;  2EIK C;  4LLC A;  2W45 A;  4AP2 A;  1W2W A;  5BT1 A;  1OWM A;  1LVK A;  2I1K A;  2IXN A;  1SZI A;  3GZS A;  2E0I A;  3LS8 A;  2DYR C;  3O48 A;  5ARF A;  1N1C A;  1HS6 A;  1HG5 A;  1HH8 A;  5D92 A;  3LY9 A;  3ZFW A;  4H7X A;  4U0U A;  2GFH A;  1PCX A;  3B13 A;  1QQE A;  4AXH A;  3DJU B;  3MKQ A;  2ZXW C;  1EF1 C;  3SGH A;  3FUF A;  1GW6 A;  2HO1 A;  3UMK A;  5JJ7 A;  3AS4 A;  1OCO C;  2YQ8 A;  2WXO A;  5KYU B;  2WXI A;  3QK0 A;  4JEH A;  1IHG A;  4CS8 A;  4AE4 B;  4UWL A;  4IUL A;  2P58 C;  4TUU A;  3HVE B;  4HVB A;  4WWN A;  3I3N A;  4DBR A;  2V4L A;  2J7P D;  2V8S E;  4WUY A;  4PK4 A;  2X6I A;  3UNG C;  1LS1 A;  4ATG A;  1M2V A;  1HE8 A;  2NSZ A;  4ILI A;  3IV0 A;  4GYO A;  1TJF A;  4EWC A;  5D0O D;  3EDT B;  2WVI A;  2R7W A;  3UGO A;  5AIJ A;  3FEY A;  4BSX A;  1PY1 A;  2L9J A;  1ST6 A;  2CG2 A;  4OVV A;  2UWJ G;  2WZF A;  3DBS A;  4GA0 A;  3LLI A;  3GYZ A;  4YVQ C;  1D0X A;  1ELR A;  3UMV A;  3G2T A;  3D9M A;  3OWT A;  3ZPJ A;  3CQZ A;  3FUN A;  2XRY A;  3FUE A;  3URZ A;  1NU9 C;  4I9E A;  4BTB A;  1PD1 A;  4UQX A;  3LS1 A;  2YNQ A;  5FQ4 A;  3RRU A;  4XX5 A;  5T4Y A;  3LJ3 A;  1N52 A;  2WVN A;  3QWP A;  4AVX A;  3NYM A;  3U9W A;  4WNG A;  4Q4Z F;  4YVO A;  5BUO A;  3DPD A;  2JD3 A;  1SMY F;  4FHJ A;  4PFP A;  4K0D A;  2QY9 A;  3TJP A;  3ASF A;  1V54 C;  4PJJ A;  4OIR F;  3IEE A;  3EHM A;  4YN0 B;  4ACK A;  4U5B E;  1XNF A;  3ZC4 A;  1WAO 1;  1JWG A;  2XSE A;  1OCR C;  5A6C A;  4J8E A;  4BG0 A;  3LES A;  4GZ6 A;  5CCL A;  4B94 A;  4HFF B;  4UWF A;  3LLK A;  1M56 C;  3TGO A;  3ASH A;  2WQH A;  2OG2 A;  2C03 A;  1DNP A;  2Q9A A;  1QZ2 A;  3CK8 A;  3APD A;  3OXF A;  3X2Q C;  1IW7 F;  2MOW A;  4ANW A;  3BG1 B;  3GOD A;  3OEO A;  4KVO A;  5FWQ A;  1SF8 A;  4N2S A;  4G25 A;  5G2N A;  3RK6 A;  2L0T B;  4MKT A;  3EGD A;  4NQ0 A;  4I2Z A;  4FP7 A;  3S7B A;  4XKB A;  5AJD A;  4EZL A;  3FUK A;  3SNX A;  3JT1 A;  4QDL A;  3APC A;  2O9X A;  3MV3 B;  2W4B A;  4GMJ A;  4GZ5 A;  4ULW A;  3JYS A;  3D9N A;  4PJL A;  4FA6 A;  2VGX B;  4YND A;  5EX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...