3EHMA

Structure of bt1043
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
510
structure length
510
Chain Sequence
PLKYGARFMNMQQRVIPIGSPSLTTGPGNDLQNTDLISSGNYIGYFGNNNNWGFNNEANWNFTDSRMNYAYQNFYSQIFLPWNEIYEIAKDSDSPSEQAILEIANIVRNIAWLRATDVFGPIAYNSAGDGSIAPKFDSQEVVYRSMLADLSKSVELLNTISYSVMAQYDLIYNGNVQNWVKLANSLMLRIVVRVHFIDETLAKEYITKALDPKNGGVIEDISSEAKIKSSDKMPLLNSMLASVNEYNETRMGATIWGYLDGYKDPRLSAYFTEGTYGSGSWAQTGYFPVAPTNSKSKSETSYSAKFASRPKVDSNSPLYWFRASETYFLKAEAALYNLIGGDPKTFYEQGINISFQEQGVSGVATYLSGTGKPTGLTGSNYKYGTYNHDLSIGNTSPKWDDYTGNLSKQEEQLQKIITQKYLALYPNAVEAWTEYRRTGFPYLMKPMDEAAPGRIGASIEDCRVPERFRFAPTAYNSNPNMAEIPTLLGGGDIGATKLWWVRSNRPKQPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a SusD homologue, BT1043, involved in mucin O-glycan utilization in a prominent human gut symbiont.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
molecule keywords SusD homolog
total genus 180
structure length 510
sequence length 510
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12741 SusD-like Susd and RagB outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ehmA03
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ehmA01
3JYSA 3NQPA 5LX8A 3GZSA 3CK8A 3JQ1A 3HDXA 5T3RA 3EHMA 4MRUA 5FQ7A 3MX3A 3EHNA 3FDHA 3I4GA 3L22A 3JQ0A 3IV0A 3MYVA 3MCXA 4F7AA 3CGHA 3CKCA 4F53A 3SNXA 4PUCA 3P1UA 3LEWA 5FQ6A 4L7TA 3CK9A 5FQ8A 4Q69A 5E76A 3CKBA 5E75A 3KEZA 3SGHA 5T4YA 3QNKA 5J90A 5FQ4A 3CK7A 3EJNA 3OTNA 4LERA
chains in the Genus database with same CATH superfamily
4U5HA 2VASA 2P61A 1U2VG 3AJMA 3HLZA 1FT2A 2XRYA 3AS8A 3F6QA 3K1IC 5FZSA 3W4YA 1PD0A 4UI9C 3IV0A 4U8YD 1M56C 1M6TA 3GEIA 4BESA 1ZW3A 2XM0A 3U4TA 4FLHA 4MVZA 5HRYA 3LEWA 3QDNA 3NKEA 2MHKA 1YJGA 4P9FA 4JTDB 4LLEA 4EKWA 2XEEA 2XHEA 3C3RA 4XPYA 2R7TA 5D91A 1PY1A 4EBBA 2Q3TA 4J7WA 1BU9A 3DSTA 1VLSA 1O1RA 3AG4E 4A2NB 3PEVB 3D9PA 1OCOE 2IF4A 3UIPC 5LX8A 1RJ9A 2LQGA 4KYOB 2J9VA 3I3NA 3Q73A 1HG2A 4UI9J 2EPMX 3UMKA 2J9BA 4CDYA 2QLAA 3DXKG 5DS6A 1DC2A 1JPNA 3H2VA 2Y3DA 2XLDA 5AC4A 2YHEA 4PJJA 2XGOA 3LXUX 2V0PA 1S7ZA 5KNGA 2V8SE 4Q4ZF 1Q0KA 2QY9A 1L3PA 4DI3A 2ETCA 3SXZA 2GFHA 4TXRA 4XKBA 4U63A 5L0IA 2A1DD 1VTMP 5BT1A 5B1AE 2AXVA 3FUJA 2Y3GA 4XEKA 5EILA 4KC9A 2NSZA 4B0ZA 3RW0A 2R7RA 3FH8A 3TWUA 4KI2A 4KZCA 3IHUA 4IAOA 2VC9A 1N4SA 3FHEA 4YT2A 2AVPA 1TEZA 1E86A 2XLEA 5BXUA 4EBAA 2F37A 4OVUA 3A11A 3ASOC 2QYJA 1KZPA 2L6FA 4Z68A 3DBSA 1VMAA 3V5ZA 1E85A 1XZQA 4G24A 3X1OA 3ML8A 3S2AA 4ULVA 3I5QA 4PR9A 3FUKA 4C9BB 3ECSA 3NYJA 1LM3B 2ZXOA 2J07A 2VJ8A 2FGYA 3RVZA 3ASHA 4R32A 4CZ2D 5KJMA 3Q4AB 1SYQA 4L2YA 3TOMA 3FAPB 2P6VA 4MS2A 2OV8A 2KCLA 2PZIA 2R9RB 3US6A 1LKXA 2C03A 2PNOA 3JYSA 5ENSD 2QFCA 3MZLB 2OEWA 3TGOA 3J5QB 1LF8A 3D9OA 4TUMA 3IQ6A 2XEHA 4YDWA 1WATA 2XS1A 1TNZA 1IQRA 4CYMD 3B9QA 2M64A 3CQGB 1LTXA 2KW3C 1CPQA 4JL0A 5A6BA 5T4YA 3KD7A 2HE0A 4L9PA 2B6CA 3EJNA 5FZQA 3K1IA 2ZPAA 5EX3A 3RAUA 1E84A 1NU7D 2RD0A 1YYJA 2H8AA 1ZVZA 4NTBA 2YL0A 1SW6A 4C3BA 3PE3A 2PFDA 4HOQA 1NI1A 3SNXA 2L0TB 1ZYRF 4G26A 1HS6A 2DI3A 1EDUA 4ATZD 5J90A 2LFDA 4L1BA 5DBKA 4GYYA 4BX9A 3CVNA 1AEPA 5AQAA 3LYAA 1CPRA 1KPSB 4K5BA 4XEIG 3AOUA 4DPRA 1BR4A 4ZHBA 1RKEB 5LP0A 3N24A 4YN0B 3L22A 3M4CA 4DRHB 1UG3A 2AP3A 4PJNA 1MMGA 4F53A 5KJLA 4I1MA 4OIOF 2L6GA 2WQ6A 2L0IA 3B95A 5ARFA 3N71A 3OXFA 4B93B 2WM9A 1MHQA 3Q79A 3N2ZB 4G11A 3PZDA 1W3BA 3FU6A 3I5PA 2F22A 4CBEA 2J49A 2XQ0A 3QWWA 1IQUA 2H6GA 3L8IA 2WZLA 4ZLCA 4AK9A 1IHGA 3I4UA 1FCHA 5G2NA 4HB5A 5E3CA 2I6HA 3APDA 3ZHEB 3RKVA 4ABNA 4M7CA 1L7CA 5BPPA 4IB4A 2J45A 3ULQA 2ILRA 3TWQA 3RIBA 3ZG1A 4KNVA 3GW4A 5JJ7A 2YNQA 2IFUA 3M15A 4D4XA 4ZFHA 4HOUA 1OW7A 2YLGA 4Z9JA 1RMVA 2KYHA 1J8YF 3L54A 4KVMA 4FHKA 1IXVA 1E8ZA 3SD5A 4O6MA 2J46A 3FH7A 3EGXB 5AIJA 3RRMB 3LJ3A 3M1CB 1OT8A 3U9MA 1VYKA 2RG8A 3E33A 5CEDB 3CGHA 4HFGA 3KAEA 3M4BA 3AG2C 4JRZA 5CRUA 3HXDA 3EFOB 4DRXE 2DZNA 3AG1E 3CHOA 5KNHD 4RDAA 2OEXA 5CI9A 3B7SA 3UM0A 2P9LG 2CHZA 4P9TA 4IN3B 1HH8A 1ORSC 1H2UA 3FXHA 3ZVVA 4WNGA 4Y6CA 3MBGA 4PDXA 2HR2A 3CAXA 3FEXA 3C18A 4OIQF 4C7OB 4I6GA 2NG1A 4H4KC 3K9IA 4BT9A 4UQXA 5CCMA 3B71A 4J32B 2Y1LE 5DQZA 3CZ6A 3JUEA 3QKYA 3VM6A 1JWGA 3EDTB 3QAQA 3W8HA 3CHQA 3L34A 1JRAA 2E87A 3C8GD 2GW1A 3IEGA 1O5MA 3CQZA 2NXPA 3AU4A 1OWOA 4HORA 4YVQC 2V4LA 3GWNA 3VF0A 3B29A 1TJFA 4O1PA 4PFOA 2R59A 4U04A 1BR1A 1B89A 1YYHA 5AGFA 4L6RA 4GZCA 1H6OA 3P2BA 3TWWA 2KM4A 4JHRA 3IQTA 5JHAA 4J8SA 1SQMA 3IEEA 5ANLA 4U5EE 3C98A 3BU8A 4J8EA 3RO3A 4ILGA 3R9AB 4XEVA 3DMDA 2P0NA 3PZ1A 4DX2A 3HDXA 3JCKC 2OVFA 3U9JA 1SR2A 3IHYA 4N06A 1U0BB 3BRJA 4DOZA 1OXJA 4HEAJ 3BQOA 3PEUB 4E17A 4GZ3A 3MFNA 3CVPA 2D5RB 4OD4A 3LEOA 4I43A 3R7QA 1FFHA 2HKVA 2EIJE 5E75A 2X38A 5KJNA 3BEHA 4EHMA 3PCVA 4QI2A 1ELKA 4GCOA 2X6IA 1N1CA 1N54A 1OCZE 3DJUB 5LCWJ 3LS0A 4G0HA 4HFKB 3U2LA 2W4MA 4NQFA 3TD7A 3D9IA 2LIGA 3LS1A 1G5ZA 4MRUA 3R7RA 3ONLA 4FULA 3SFZA 4O6YA 1JR8A 1Y6IA 4DBRA 1UN8A 2HZ8A 5CCLA 3RKOF 2QE9A 2WVOA 1H9TA 2GROB 1TKNA 3O48A 3W8IA 1TWCA 2WXGA 3JCUQ 3EPVA 3L0IA 3NZSA 4CCAA 3A9CA 5G55A 3CQCB 1YYXA 4PH4B 5AAOA 3EGXA 4XKCA 5AJDA 4CJOA 3KS2A 3PUJA 2Q9CA 3EG9B 3D9JA 3R9MA 1FPPA 3DZAA 1T9KA 2G3KA 2GAQA 2XEVA 5COGA 3FY4A 5FTPA 3JRTA 3C3QA 3CSKA 3LY9A 1S0PA 2VYIA 1LD7A 1U6HA 3PDNA 4V3IA 4GTQA 5JMND 4GPMA 5COMA 4BTBA 1MMDA 4JC8A 3B0VC 4ANXA 3PZ2A 1A7EA 2EPKX 3E30A 3Q9UC 1SVXA 3O55A 4BSXA 3UMIA 2C0MA 2HV7A 4EBJA 4L2LA 4JTCB 4XZ4A 1U3DA 1AVOB 5FCLA 4OD5A 4G2VA 1MMNA 3CEQA 4BX8A 2I15A 3TQOA 3RYLA 4QQIA 2RKKA 2AWYA 2CW0F 5AQ7A 4WGYA 2KBXA 3WAQA 2QUPA 2IONA 3OTNA 3Q6MA 4UDVA 4U5CE 1ST6A 4YL0A 1JCSA 2L7AA 3EQLF 4YNDA 1NBBA 5CECB 1H7IA 1H6GA 4KT6B 3FEYA 3EGDA 3GZ2A 2QY7A 3ABKE 5EN5D 4JZYA 2A69F 3JXJA 1HZ4A 1VDYA 2W9YA 1SZIA 3IHVA 2P9KG 4JEBA 5CHEE 1ZU4A 3Q15A 4GTVA 2YVKA 1BDJB 3NDBB 3FULA 1Z63A 4FU3A 1LS4A 3LCAA 2H6FA 2UUHA 4P6IC 4DBQA 2XGSA 2XZDG 4HVBA 4JE9A 3U8PA 3ZWIA 5FQ6A 4DX6D 4PJLA 2QZAA 4Z9IA 4A1SA 2XENA 4F1PA 3DWWA 4GA1A 4AEZC 1TFKB 5FZRA 4MS6A 3EG9A 4MVMA 1NLXA 1T6UA 3NYMA 1G8XA 3ENEA 2AW6A 3ISMC 1R5ID 4C0MA 5D92A 3IXEA 2OQMA 4IYPA 1CGNA 1MMAA 2OCCE 1M2OA 3ASNC 3DSVA 1E90A 1O5HA 4DX5D 3NKDA 2WB2A 4G23A 1QPUA 4DI4A 4KBQA 4AM9A 2V4HC 3UTMA 2W45A 1ZB1A 1EI7A 3CK7A 3PREA 3PZ4A 3IQ5A 4NRHB 5JS5A 4YJWA 4I17A 3RO2A 5B1BC 1OCCE 4CS9A 3T6BA 4CGWA 3FTZA 4EZJA 2IJGX 5LOZA 3ASGA 2F8XK 3PH0C 5EHHA 5ANRA 2P9IG 4YDYA 1DCEA 3RRNB 3I4RB 5M72A 1HMDA 4LCTA 1H19A 3QK0A 4N2QA 4BTAA 3SYNA 1XZPA 3UMVA 3FU3A 4M63A 5HV9A 3FUHA 5B3IA 4FJZA 2C2LA 2WMNA 4M3OA 4YK5A 1YZCA 4G78A 1WDYA 3NQPA 5B1BE 4MLPA 3UQ3A 5FINA 3WHNA 2J8WA 1UFBA 4ACKA 1EF1C 4I2ZA 3UIOC 3RH3A 5JVEA 2R7OA 4BJ6A 3JUIA 3CHSA 1HF8A 4TRQA 2HMZA 5KYXA 4JEUA 1ZZPA 2YQYA 4LLCA 1HU3A 3FFLA 3CVUA 2P7VA 3TOLA 3UGPA 4FADA 2JPUA 2HJ3A 1ZHYA 4K7BA 4AL0A 2YEVA 4G8KA 2KXPC 3HG0D 2LFFA 2YLIA 2IU1A 1UOHA 3LS8A 2FEZA 2HJMA 3SP1A 1Y8MA 1EKYA 1BBHA 4JURI 3C8ZA 5CRVA 2EIKE 3HKKA 1Z5SC 4ANWA 1FFTC 3GZSA 3FTSA 1A5EA 1MX2A 3OEOA 4JJFA 4MTGA 4LDRA 4X8QA 2ASRA 1K1BA 3UKRG 1WM5A 3RQGA 2PM6A 4E85A 1VK5A 4TV3A 2NPUA 2EILE 2Y4UA 4J7TA 2YL7A 2YHSA 4NY3A 3NF1A 4IULA 3G4ZA 4MVOA 3G2TA 3S90A 3U2MA 1E8WA 4N5CA 1ORJA 1WN0A 2I8BA 4WUYA 3OA1A 3APCA 5ENTD 4WNDA 2KK1A 2IXNA 2OVBA 4GTRA 5T3WA 5FJYA 3DEPA 1Q0DA 3T4RA 1N4QA 4I9CA 3U66A 3FUNA 4ANVA 3K7DA 4C0EA 4G25A 5L0CA 4BT8A 5FQ8A 2I2OA 2KCKA 2EINE 2LAIA 3LEVA 5IY5C 5DS5A 1KT1A 3VTXA 4I2WA 2Q9BA 3AGTA 3TWTA 1M57C 5T8IA 2J7PA 4WAFA 2JD3A 5JP7A 3B0UX 2BKKB 4EBAG 2DBAA 2VSYA 3VLFA 2TMVP 2WXQA 3ZYMA 2MOWA 5FT9A 3NOGD 3UI2A 2Q7RA 1ZU2A 2IO2C 2CG2A 3FWVA 3U3FA 2WXIA 4CDNA 4UQYA 4PS8A 2YZSA 3EH2A 3NMJA 4RVBA 4EWCA 3GYZA 3TAXA 4LERA 3FTUA 4GTMA 4U9EA 4CS7A 4NQ0A 3Q5MA 1K1AA 3HNKA 5A6KA 3LY8A 3NAWA 2Q00A 3EHMA 4GZ5A 2Z15A 1O1TA 3CVVA 3PZ3A 3CVLA 3C5RA 1NFIE 5CI8A 3MKQB 3T6JA 3G2VA 4JHKA 1T01A 3Q7AA 5ITZF 3MLGA 2FFHA 1TWGA 4H54A 4RBNA 3NZUA 2EPLX 5D66A 2F8YA 1KU2A 1E2XA 1QBQA 2R03A 2VB6A 2DZOA 1QZ2A 5AN8A 3S7DA 4ZLDA 3K33A 2MYOA 4GTOA 2BL2A 4U9DA 1N0RA 2QC9A 3SXYA 4N3BA 4PUCA 2PF4E 4OAUC 2OEVA 3QJZA 1HXIA 4ILIA 2PX0A 5D0QD 3U5SA 1UW4B 3QNKA 5A6BD 1N9AA 3JRMO 5L0DA 1INZA 4XPWA 3KSQA 2R17C 3B0PA 1Y4CA 2ZXPA 3HVEA 4J6IA 1I4YA 4IAQA 5A6JA 4HQDA 3FOPA 3MV2B 2KQ9A 1YCSB 3T5XA 1RKCA 5COFA 3VLDA 2X6FA 2I1JA 1HE9A 3PS6A 5L0JA 4XEFA 2BEDA 3SGHA 3ZYLA 2Y3HA 1DNPA 3B7BA 4YVOA 1HW2A 1H2VC 1ZHZA 1N95A 4FC8A 3RU0A 3LLIA 2AXZA 4CRWA 4FP7A 1Z7Qc 4LNUD 4DXWA 4E6HA 4BEJA 2MHRA 4BJ6C 1BPOA 3RJVA 3R2PA 2DB4A 4HLLA 1MJ0A 2YWAA 2VH3A 3ZNGA 2J4BA 4L23A 3T8MA 1RKEA 1LS1A 4BJ5C 1E7UA 2YRFA 3BG1B 4N3CA 1FVFA 3DSUA 3ZFWA 2AXUA 5G04C 5KYWB 2VSXE 3CR3A 2J09A 4FX5A 3RRUA 4TUUA 1ZU5A 3Q6NA 1E7VA 4HRMB 5TJ5E 2XXAA 4CIHA 3U3WA 3GM3A 3VYWA 5F28E 2P9SG 5JT4A 4KBLA 3ZSUA 4BFRA 1WASA 3LLKA 3FDHA 3D9MA 3GZ1A 5KCMA 2UWJG 3EHRA 1TN6A 1OKKA 1QNFA 2VCCA 4RQIA 3U64A 4U0SA 4FHJA 3G2UA 2A0UA 3E37A 4KVOA 1A7VA 4E7SA 3DPDA 3POVA 4Q7CA 4Q94A 4YT8A 1C02A 2LK4A 4HE8D 3TWVA 3DE9A 5H7PA 3FOOA 2UY1A 3ABLC 2J9UA 3CSTA 2KC3A 2R7WA 4GQHA 4JVSA 4CDVA 4F7AA 1QLEC 3UKUG 5G05C 3UPVA 3EFOA 3GANA 3TULA 3MJWA 4APOA 2LAHA 4B8AA 1JPLA 2AWIA 1EA8A 1SMYF 4ANJA 1S05A 1NL4A 2QNLA 4I3MA 2BC5A 4CT0A 4E0HA 3UM2A 1SA5A 4DLQA 1OR2A 5KYNA 2PBEA 1LVKA 2J9QA 3ZHEA 3J5PA 2L6BA 1OR3A 3V79K 2DYRE 4JC7A 3S29A 2GRNB 2OKUA 4APFA 4H7YA 5AJLA 1V55C 4ATGA 3NG1A 3FDQA 4JA9A 4LDKA 5G04J 3U3BA 1D9SA 3CKBA 1RXQA 4OIPF 4EPZA 2IYLD 4DVZA 3AQCA 2R7QA 3DE8A 2C0LA 1ELWA 3V2XA 3TJ6A 1WAO1 3SBSA 2DCPA 2OOCA 2DYRC 3MKRA 4GTTA 2WXHA 4O7GA 3KPHA 2WB7A 1YMPA 5FIOA 5DQTA 2XLWA 2HUJA 4LSZE 4LUNU 1UJJA 2A6EF 4K5CA 2P1AA 1UN9A 3TG5A 3Q7FA 2EIME 1JWFA 3NMKA 4NTFA 2A5UA 4RG9A 1ZHWA 5EIBE 3L8JA 3EU9A 3C8GA 1N0QA 2IOSA 5L0FA 2CG3A 4GA2A 2HSQA 5KYUB 5L0HA 1HY5A 5AARA 1I5NA 3LPZA 4K1OA 3KYJA 3AG1C 1YA0A 4FESA 4GEHA 1Q0MA 3NBNB 1MZCA 3D3MA 1IZMA 4JB8P 2BKGA 3S7FA 2VGYA 1G4WR 2AU5A 2RFAA 1TNBA 4EUKB 3ZKJA 2BE5F 2XS8A 3JQ1A 4GMRA 2B0JA 5KJKA 3QVYA 1CGOA 2L81A 4F4BA 3UUXA 2ZD9A 3TK0A 1E96B 4H7XA 4JPSA 1JPJA 3OAWA 2ZXWC 3APFA 3ZGQA 1NA3A 3DRAA 2W4BA 4YDOA 3L17A 4JHJA 2LXLA 1N4PA 1NU9C 1TNYA 2LO6A 4ACLA 1M2VB 2R7SA 3S27A 3PNTB 4CDRA 3QW0A 3LAYA 1D8EA 2GA0A 2XPYA 4JW1A 2JEKA 4CSAA 4NACA 4W9RA 1I4ZA 4CEMA 3L16A 1D8DA 5B3SC 2IOQA 2IXPA 5JJ6A 3E4BA 4GMLA 3DI5A 2WQ7A 1T5OA 5EIDA 1J8MF 1V54C 4FJYA 3TG4A 3DXMG 3BUAA 4GYOA 2YLDA 3V30A 5F5FA 3JXIA 4IGGA 4MVUA 3B7RL 1JOGA 3U9WA 3SNHA 3ESLA 1OW8A 2GWWA 3ZQVA 1YDIA 2Y69E 3QWVA 2KATA 3ZXPA 1QKRA 3HXFA 5AYWD 2DVWA 2WXRA 1SZAA 3C63A 3ML9A 3L82A 2QTVA 3G4XA 4LDQA 2ICWG 5E33A 5B3SE 2OU6A 4J30B 4UWHA 1QZXA 1W2WA 2XL4A 3VLEA 4A1GA 3EHNA 4DJ9A 2R7XA 5AC5A 2UY1B 1AWCB 2QYUA 3EIQC 4CT4A 3U8VA 2NSFA 1B68A 2YKZA 1OY3D 1JAFA 2R5SA 4JD2G 2XCBA 4KZ0A 2Y69C 1XNFA 4QDLA 3DSXA 1YAUO 1D0ZA 3WG7C 1KT0A 2OCCC 4BERA 3RQEA 3DXJF 1E8YA 3ASNE 3S7BA 4JA7A 1KTMA 3WG7E 2J0XA 2VTBA 3DKAA 3GEEA 4AE4A 4DX1A 3FUMA 3HRAA 4N6CA 4U5DE 2OG2A 2RD9A 4YL3A 2P9NG 2XCCA 3CKCA 1MX4A 1T6IA 5ENQD 5JSLA 5BQHA 3ABME 4KNWA 3L08A 2ZU6B 4U07A 3V31A 4FAPB 1OCCC 4EHPA 5EYPF 4C3EA 3C62A 4BY6A 3QMKA 1EYHA 2XSEA 4K0DA 2WXNA 3MGBA 3F47A 4HBDA 1K40A 4OIRF 4RG6A 3TWRA 5BXOA 2G3VA 3NMIA 1LE4A 3ZRHA 1K8KG 5A6AA 5G05J 3ZVRA 4XI9A 2ETSA 3X2QC 3NB2A 5A23A 1ZHTA 3VTYA 3DM9B 1MX6A 3AU5A 4DUIA 1SF8A 2XM4A 2J9WA 3G50A 4XPXA 5BUZA 4AL1A 1FMWA 3MYFA 2FULA 2XPIA 4RD9A 4BEMJ 3QWPA 5BV1A 2JX0A 1N52A 3H65A 3IKOB 2PL2A 3SZ7A 2WXFA 3AAAC 4NURA 3CK8A 1QVXA 2LXMA 2J8SD 4WWPA 3RK6A 3QOUA 3EUVA 5EX0A 3X2QE 4I9EA 3MX3A 4JZAA 4JKVA 5CBOA 4F6RD 1KNYA 4XE0A 4A55A 1H2TC 4HRLA 4DX7D 4WJ0A 1TWAA 1XGWA 1N94A 1TJCA 1TNUA 5E76A 1YARO 4I6EA 4AE4B 3DAFA 1TR2A 2F0YA 4JCZA 2EPOA 3Q49B 3SXMA 3AG4C 3UM3A 3F46A 2HYZA 5AQBA 2I1KA 1OCOC 1NG1A 1WGWA 4FLBA 2J08A 4LEUA 2WQHA 3CIAA 4HXIA 1TQGA 1WOLA 4PFPA 1NZNA 4LG6A 2IM8A 3WXXA 3EU5A 4AY6A 4GZ6A 1U3CA 3FUEA 4XI0A 4JTAB 4G7HF 2WL8A 4EIYA 2X51A 4D4NA 3NOCD 1Y6DA 3DWLG 3CVYA 1LIHA 1HX8A 3D9HA 3NYLA 2ZISA 4EZLA 1HG5A 2RSEB 2ETBA 4KMOA 4WWNA 4BPMA 4I6JA 4NCQA 2IOLA 3PVLA 2VQ2A 5CERB 4NC3A 3JQ0A 2R02A 5FWQA 2V3CC 4MTFA 3C7JA 3HXBA 5JA4D 3RIPA 3V5YA 5EYLA 2Y4TA 2CDQA 3EZIA 2D4UA 5BQGA 1FNTc 1LI7A 3UT7A 2ETAA 4U8HA 4GYWA 1GQAA 5T3RA 5A69A 1D1BA 3S28A 3ASDA 2GGFA 3LNMB 1SZ9A 4TXPA 2WZGA 1GGQA 3UINC 5ARGA 3SF4A 3DEOA 4AP2A 2PX3A 2VCAA 3QARA 3ZW3A 4WNEA 5ENNA 3RFYA 3B7TA 4J0UA 3OWTA 1OCRC 3BEEA 4GMJA 4R7LA 4RLYA 5DS4A 3H2UA 2CNWD 3FUDA 3FHDA 5HKPA 4YL1A 3AG3C 4WABA 1YA7O 4WGZA 2FF4A 1EQ1A 4FWVA 3TJPA 2LSEA 3LJBA 2NYJA 3MEKA 4BJ1A 3OXGA 2KNHA 4BSZB 3JYHA 1S63A 4ME2A 4CS9C 2XLVA 3D9KA 4J7YA 2E2EA 2LSUA 1O3UA 1OCRE 1AP7A 2EPNA 4DRIB 1D0YA 1AUEA 3AG3E 2A0BA 4BJTA 2B0OE 2YL1A 2X6KA 4O79A 4ONSA 2KSFA 4DLOA 3CVXA 1MNDA 4C3DA 4U7EB 3DD7A 1YVIA 4CJGA 1GM5A 3IQCA 4JIOA 2RFMA 3AS5A 1QYMA 4QI0A 4PK4A 1PAQA 1NFOA 1VB5A 2Q7FA 4K03A 3VRCA 4GCNA 2H7BA 4GA0A 2L9JA 3KEZA 4G1TA 5FQ4A 2IXMA 5BW8C 4AVXA 5BNWA 4U0UA 1OWNA 2Q4FA 4J8FA 2WMOA 1PCXA 4B94A 3CEXA 5HQ8A 1NZEA 1Z3XA 5FQ7A 3ESKA 2PQRA 3ZU7B 3Q47B 1BLXB 1QQ3A 3ZTMA 1PV3A 1HO8A 4BG0A 3CLJA 1E83A 2J4DA 4IRUA 3GEHA 3FTYA 3UMHA 5B1AC 3QZCA 5ENRD 2P9PG 2WXMA 4GZDA 3HNJA 3HXEA 5EDSA 3LJNA 1H6PA 4IJJA 2VGXB 1KLXA 2UUIA 5KYYB 2DIWA 2WXOA 3ZUVB 3ZPJA 1OXBA 4EBKA 1Z6AA 3GORA 4HS2A 3M79A 2PQNA 3L9TA 4AOFA 4J8YA 3QB2A 3NRHA 3C8GB 2AWCA 3Q75A 5BQIA 2GRQB 2PNNA 2DWZA 4L7TA 3SY2A 1O87A 4HLEA 2VSNA 4U95D 2LD6A 4EECA 1H6KA 5JLIA 1QQEA 4MW3A 5K0IA 4E18A 2YINA 4G8LA 3ASFA 1Z23A 3LY7A 4O6NA 5J08A 2PP4A 1H0AA 3T6GB 5E3AA 3KSLA 3LVQE 3IPMO 2Q9AA 1BZ4A 2XZTG 1TYQG 3QW1A 4TXQA 4BWRA 2DGJA 3LKUA 2EINC 1BI7B 4JEHA 2CFUA 4UWFA 3V7OA 1MQVA 2H6HA 3TJ5A 2WXLA 4N6HA 2HM8A 3TXNA 5KBAA 3G2SA 2AVKA 1G3NB 1APCA 3N0TA 2OOEA 3S7JA 3ZYQA 2GRRB 4YT5A 2BF0X 4AV7A 4LACB 3MYIA 1RJ9B 3AGUA 4C48B 3TWXA 2YL3A 4D10C 2HS5A 3HXCA 4JEAA 1HFAA 5C2YA 4GU5A 3TXMA 3UXGA 1DOWA 3UR3C 2L9BA 4GTPA 5T1DB 5D2MC 1KZOA 5KYWA 3LVRE 3AQBA 5KYYA 5IY5E 1MYOA 3LESA 4GB9A 2P9UG 5DIZA 1VYIA 2R7UA 3E9VA 3LDZA 3MKQA 1FTSA 3PRZA 1E8XA 2G62A 2R05A 3HNIA 4MVRA 3CVWA 4A3VA 2X6HA 1HMOA 3JZ0A 3B7UX 4DJAA 4XTKA 3HTKC 3SI5A 3HJCA 4MNDA 4XX5A 1WTYA 4B6IA 2VGEA 5ENPD 1FAPB 3CV0A 1L5JA 4Q69A 4I1AA 4MVSA 4A4AA 1FT1A 3DSWA 3W2VA 3E70C 3JT1A 3ZDLA 2VGXA 2XLHA 3FMSA 2WPVA 4YT4A 3SZRA 3W2WA 3FAJA 3DPYA 4JXTA 1FMVA 1VOMA 3K66A 4ILHB 4MVQA 2CHXA 2WXJA 3MYVA 1ZHXA 3EZHA 2WXPA 2X0CA 2BTDA 3FP3A 2B0HA 1A41A 4F3VA 1UG7A 3ZIMA 3ONKA 1G4US 2XL8A 3O10A 4C7OA 4OVVA 4UI9K 3GWLA 3KKBA 2LSVA 1WG0A 4PJMA 1XWJA 2V26A 1FR0A 4O60A 3IBEA 1QSPA 2VSOE 1D1AA 1NFNA 1HW1A 1BD8A 2X3MA 2EIMC 4CS8C 2IXOA 3ATPA 5L3QA 4CX9A 4U5FE 4YDEA 1OWLA 4OYSA 1NSGB 2KGOA 4HFFB 2ZIRA 4E0IA 3CK9A 4CS8A 3J06A 2DYSE 2ZGDA 1TFOB 5JUAA 4UQZA 4URKA 2IO3C 3FUIA 3HYMB 3FTVA 4HRNA 1Z6TA 2X6JA 2FBNA 1N11A 2J0WA 3S9OA 1V55E 2CFZA 3CHRA 1BI8B 5JHBA 2L6JA 1D0XA 4KXKB 3SQVA 3RSEG 1JMWA 1IHBA 4EQFA 1K3ZD 4LNBA 1YZAA 3Q7GA 3KL4A 2GRPB 1ZW2A 3JTLO 2A5EA 4HOSA 3OXLA 3JYYA 4HI9A 1TNOA 2PM7A 2L6HA 3BG0B 3D9NA 1GS9A 3HVEB 2EIJC 3AG2E 4AIFA 3ZYKA 3EHQA 4O1OA 5LFAA 3MV3B 5CMWA 256BA 4CIPA 3D9LA 3JSZA 1V74B 4AY5A 5HS0A 3ITFA 4QFVA 4NTAA 2R25A 2J7PD 4AXHA 2LP4A 4LNGA 2MRIA 3ZN3A 4LRZA 2FAPB 1A17A 1LI5A 3CHMA 3K6BA 4MQ9F 4W8KA 2V5FA 2XLMA 2IQCA 4MBGA 5A6CA 1BR2A 2IBFA 2VCBA 3DJNB 2MYSA 4Z9HA 1DCQA 1HE1A 3DAGA 3ULEG 2Y3BA 1F1MA 1YLMA 1RZ4A 1V4AA 3V5XA 1IYGA 1LE2A 4N3AA 3HNLA 3TL5A 2FO7A 3RF3A 2A4ZA 1UJKA 3Q7LA 5JRAA 4CDAA 3T8KA 3DSSA 3G2WA 3KMIA 2YQ8A 3SFXA 5BV0A 1Z3YA 2A68F 3JSEO 4Y6WA 3SO8A 5CBNA 3FH5A 3ABLE 4X0RA 3FU0A 2JABA 5KYUA 4Q5SF 2GDCA 1PC2A 2GRLA 3FVYA 3E32A 4AJWA 4GTSA 1LPEA 3O4ZA 2P2CP 2XLOA 4N2SA 2CCYA 2WVNA 5LCWC 2EQXA 2LCHA 3EGDB 1M2VA 3O39A 5L3VA 1Q0GA 3UX4A 3PE4A 3C3OA 3PMRA 3QC1A 4FA6A 4DK5A 2LUHA 5AQ9A 4Q96A 5EK0A 2P58C 5EGYA 1C03A 4WWOA 4JCHA 2MWQA 4U5GA 4E7ZA 2CNWA 3CVQA 3UNGC 3DM5A 3QVZA 3C72A 4MKTA 1OKKD 3RVYA 2WZFA 3EH1A 3ZIBA 2R2LA 3P1UA 2CHWA 2A6HF 4MTOA 2O9XA 2KZTA 1JCRA 3ZXSA 3FTWA 4DVYP 4U96D 2KCVA 4UWGA 2DYSC 5EKQD 5E2QA 3UT4A 4J8DA 3PDMP 5DVWA 3PUKA 3O6XA 3ZQYA 4YWQA 1ELRA 2KJGA 4ER9A 4GYTA 1HE8A 1OUVA 4AX2A 3UM1A 2AJAA 4A3TA 4G7ZF 1H9GA 1U89A 3Q78A 1RCPA 1SA4A 2ZGGA 3R7CA 3SFYA 1NP7A 1OW6A 4XLPF 2HO1A 2CYDA 3GM1A 4XQ1A 4U8VD 5HI7A 1YA9A 1Z3IX 3EIJA 5T3TA 4UWKA 1X81A 1MQSA 5CIVA 2Y39A 1OCZC 3WODF 4G7OF 1P5QA 3I4GA 4A63B 4BEPA 2WXKA 3KH2A 3ZEFA 5FZTA 4O6FA 4OAVB 1OQCA 2M4EA 4N5QA 4P29A 2XRZA 2HFIA 4U5BE 1TN8A 4ANUA 1Z5ZA 2H7VC 2OJQA 2NUPB 2CGEA 4DRJB 3KYIA 3L13A 1TN7A 2ZXRA 2FO1E 3SHFA 3PHF2 3AJIA 3CSFA 3LNRA 4I1OB 4JJGA 4CDMA 4ULWA 5A7DB 2WVQA 3T5VA 3B13A 1A7DA 3Q9NC 3QTHA 5JJTA 1K04A 1R4TA 2VTBB 1K05A 2ZXWE 2NC9A 5HSWA 4XWJA 5BUOA 2M63A 5C1DA 3RQFA 4PS7A 1VLTA 4XIFA 5KWDA 1S64A 3TWSA 1EPUA 2XXAB 2XL6A 1OXKA 3ZTZA 4UWLA 3KEAA 3V2OA 2I9CA 1TWHA 4BJ5A 2XGMA 2FI7A 4IWBA 4GPKA 3HIZA 1IKND 4F1SA 1WWPA 4EZKA 4I44A 1TR4A 1Q2ZA 3MCXA 1WY6A 1V54E 1OWMA 2WVIA 2R7VA 2Y3AA 4HNAD 1O1SA 5AENA 1DVPA 4N4WA 4RSYA 3CHPA 4WNFA 2NUTA 1ORYA 2JLBA 3SBTB 2NUPA 1T6QA 5KYXB 4B8CB 1CGME 2IEJA 1DOVA 3LUTB 2HMQA 3ULYA 2KC7A 1RW2A 4N39A 3ZC4A 2EILC 3W9FA 4IARA 3VAYA 3ABKC 3FU5A 3ASOE 5ENOD 2BUGA 4BETA 1ZBPA 1OWPA 1GW6A 3AS4A 4PACA 1IW7F 1JUQA 3FUFA 2EIKC 5DLJA 5CEAA 1NA0A 5D0OD 3GODA 4NIKA 1LD8A 3UT8A 3SEOA 2NSGA 3MA5A 4MW8A 2ONDA 3HHMA 2YHCA 1MNEA 3ABMC 4CSAC 1C17M 3L6AA 2Y0BG 2IY0C 1D1CA 4GAAA 4HI8A 5L0GA 2HSBA 2XRHA 3T9OA 1PD1A 3S0XA 2XPZA 1X5BA 4XLNF 3S84A 2KZTB 5CMYA 2OJED 3GM2A 3L1MA 4PS3A 2HV6A 3UGOA 4K0RA 5F5HA 1S70B 3PNLB 3E34A 3W9GA 2C04A 3FTXA 4K5AB 3U0CA 4CGVA 3URZA 4W8PA 5GPGB 1A0BA 4HOTA 2V5QC 4UUCA 2E0IA 2NUTB 3SXKA 3T9KA 1Q0FA 2H6IA 1FVHA 3K1HA 2H7OA 2GRMA 4U0ZA 4OINF 4B89A 2LNIA 1N4RA 1JCQA
chains in the Genus database with same CATH topology
4U5HA 2VASA 3HLZA 2XRYA 3AS8A 3K1IC 5FZSA 1PD0A 4UI9C 3IV0A 1M56C 3U4TA 4FLHA 3LEWA 3QDNA 3NKEA 2MHKA 4LLEA 2XHEA 2R7TA 5D91A 1PY1A 4EBBA 2Q3TA 4A2NB 3PEVB 3D9PA 2IF4A 5LX8A 1RJ9A 4KYOB 2J9VA 3I3NA 1HG2A 4UI9J 3UMKA 5DS6A 1JPNA 2Y3DA 2YHEA 4PJJA 2XGOA 3LXUX 2V0PA 1S7ZA 2V8SE 4Q4ZF 2QY9A 4DI3A 2GFHA 4XKBA 4U63A 2A1DD 5BT1A 2AXVA 3FUJA 2Y3GA 4KC9A 2NSZA 4B0ZA 2R7RA 3FH8A 4KI2A 4KZCA 4IAOA 3FHEA 4YT2A 2AVPA 1TEZA 4EBAA 4OVUA 3ASOC 3DBSA 1VMAA 4G24A 3X1OA 3ML8A 3S2AA 3I5QA 3FUKA 4C9BB 3ECSA 3NYJA 2ZXOA 2J07A 2VJ8A 2FGYA 3ASHA 5KJMA 3Q4AB 4L2YA 2P6VA 2OV8A 2KCLA 2PZIA 1LKXA 2C03A 3JYSA 2QFCA 3MZLB 3TGOA 1LF8A 3D9OA 1IQRA 3B9QA 3CQGB 2KW3C 4JL0A 5T4YA 3KD7A 3EJNA 5FZQA 2ZPAA 5EX3A 1NU7D 2RD0A 4C3BA 3PE3A 2PFDA 4HOQA 3SNXA 2L0TB 1ZYRF 4G26A 1HS6A 1EDUA 5J90A 4L1BA 5DBKA 4GYYA 4BX9A 3CVNA 3LYAA 4DPRA 1BR4A 5LP0A 3N24A 4YN0B 3L22A 1UG3A 4F53A 4PJNA 1MMGA 5KJLA 4I1MA 4OIOF 2WQ6A 2L0IA 5ARFA 3N71A 3OXFA 2WM9A 1MHQA 3N2ZB 4G11A 3PZDA 1W3BA 3FU6A 3I5PA 4CBEA 2J49A 2XQ0A 3QWWA 1IQUA 2WZLA 4ZLCA 4AK9A 1IHGA 3I4UA 1FCHA 5G2NA 5E3CA 2I6HA 3APDA 3ZHEB 3RKVA 4ABNA 5BPPA 2J45A 3ULQA 2ILRA 3RIBA 3ZG1A 4KNVA 3GW4A 5JJ7A 2YNQA 2IFUA 4HOUA 1J8YF 3L54A 4KVMA 4FHKA 1E8ZA 3SD5A 4O6MA 2J46A 3FH7A 3EGXB 5AIJA 3RRMB 3LJ3A 3M1CB 1VYKA 2RG8A 3CGHA 4HFGA 3KAEA 3AG2C 3EFOB 3CHOA 4RDAA 5CI9A 3B7SA 2CHZA 4IN3B 1HH8A 1H2UA 3ZVVA 4WNGA 4Y6CA 4PDXA 2HR2A 3FEXA 4OIQF 4C7OB 4I6GA 2NG1A 4H4KC 3K9IA 4BT9A 4UQXA 5CCMA 4J32B 5DQZA 3CZ6A 3QKYA 1JWGA 3EDTB 3QAQA 3W8HA 3CHQA 3L34A 2E87A 3IEGA 2GW1A 3CQZA 2NXPA 3AU4A 1OWOA 4HORA 4YVQC 2V4LA 1TJFA 4PFOA 2R59A 4U04A 1BR1A 1B89A 4GZCA 3P2BA 2KM4A 4JHRA 5JHAA 4J8SA 1SQMA 3IEEA 5ANLA 4U5EE 3C98A 4J8EA 3RO3A 4ILGA 3R9AB 3DMDA 3HDXA 3JCKC 2OVFA 3IHYA 4N06A 4DOZA 3PEUB 4HEAJ 4GZ3A 3CVPA 2D5RB 4OD4A 4I43A 3R7QA 1FFHA 5E75A 2X38A 5KJNA 4QI2A 1ELKA 4GCOA 2X6IA 1N1CA 1N54A 3DJUB 5LCWJ 3LS0A 4G0HA 4HFKB 2W4MA 3TD7A 3D9IA 3LS1A 4MRUA 3R7RA 3ONLA 4FULA 3SFZA 4O6YA 1Y6IA 4DBRA 1UN8A 5CCLA 3RKOF 2WVOA 1TKNA 3O48A 3W8IA 1TWCA 2WXGA 3JCUQ 3EPVA 3L0IA 3NZSA 4CCAA 5G55A 3CQCB 4PH4B 3EGXA 4XKCA 5AJDA 3KS2A 3PUJA 2Q9CA 3EG9B 3D9JA 3DZAA 2G3KA 5FTPA 2XEVA 3FY4A 3JRTA 3CSKA 3LY9A 1S0PA 2VYIA 3PDNA 4V3IA 4BTBA 1MMDA 4JC8A 3B0VC 4ANXA 4BSXA 3UMIA 2C0MA 2HV7A 4L2LA 4XZ4A 1U3DA 5FCLA 4OD5A 4G2VA 1MMNA 3CEQA 4BX8A 3RYLA 2CW0F 2IONA 3OTNA 3Q6MA 4U5CE 1ST6A 3EQLF 4YNDA 4KT6B 3FEYA 3EGDA 3GZ2A 2QY7A 4JZYA 2A69F 1HZ4A 1VDYA 2W9YA 1SZIA 3IHVA 5CHEE 1ZU4A 3Q15A 3NDBB 3FULA 1Z63A 4FU3A 3LCAA 4P6IC 4DBQA 2XGSA 4HVBA 5FQ6A 4PJLA 4A1SA 4GA1A 4AEZC 5FZRA 4MS6A 3EG9A 3NYMA 1G8XA 3ENEA 2AW6A 4C0MA 5D92A 4IYPA 1MMAA 1M2OA 3ASNC 1E90A 1O5HA 3NKDA 2WB2A 4G23A 4DI4A 4KBQA 4AM9A 2W45A 3CK7A 3PREA 4NRHB 4YJWA 4I17A 3RO2A 5B1BC 4CS9A 3T6BA 4CGWA 3FTZA 4EZJA 2IJGX 5LOZA 3ASGA 3PH0C 5EHHA 5ANRA 3RRNB 3I4RB 5M72A 4LCTA 1H19A 3QK0A 4N2QA 4BTAA 3SYNA 3UMVA 3FU3A 4M63A 3FUHA 4FJZA 2C2LA 2WMNA 4M3OA 3NQPA 4MLPA 3UQ3A 4ACKA 1EF1C 4I2ZA 3RH3A 2R7OA 4BJ6A 3JUIA 3CHSA 1HF8A 4TRQA 5KYXA 4JEUA 4LLCA 1HU3A 3FFLA 3CVUA 2P7VA 3UGPA 4FADA 1ZHYA 4K7BA 2YEVA 2IU1A 3LS8A 2FEZA 3SP1A 1Y8MA 4JURI 4ANWA 1FFTC 3GZSA 3FTSA 3OEOA 4JJFA 1WM5A 2PM6A 4E85A 1VK5A 4TV3A 2Y4UA 2YHSA 4NY3A 3NF1A 4IULA 3G2TA 1E8WA 4N5CA 2I8BA 4WUYA 3OA1A 3APCA 4WNDA 2IXNA 2OVBA 5T3WA 5FJYA 3T4RA 4I9CA 3U66A 3FUNA 4ANVA 3K7DA 4C0EA 4G25A 4BT8A 5FQ8A 2I2OA 2KCKA 2LAIA 3LEVA 5IY5C 5DS5A 1KT1A 3VTXA 4I2WA 2Q9BA 1M57C 5T8IA 2J7PA 4WAFA 2JD3A 3B0UX 4EBAG 2DBAA 2VSYA 3VLFA 2WXQA 3ZYMA 2MOWA 5FT9A 1ZU2A 2CG2A 3FWVA 2WXIA 4CDNA 4UQYA 4PS8A 2YZSA 3EH2A 4RVBA 4EWCA 3GYZA 3TAXA 4LERA 3FTUA 4CS7A 4NQ0A 3Q5MA 3LY8A 3EHMA 4GZ5A 2Z15A 3CVVA 3CVLA 5CI8A 3MKQB 3T6JA 3G2VA 4JHKA 3MLGA 2FFHA 1TWGA 4RBNA 3NZUA 1KU2A 2VB6A 1QZ2A 3S7DA 4ZLDA 3K33A 4N3BA 4PUCA 2PF4E 3QJZA 1HXIA 4ILIA 2PX0A 5D0QD 1UW4B 3QNKA 1INZA 2R17C 3B0PA 2ZXPA 3HVEA 4J6IA 3MV2B 2KQ9A 3T5XA 3VLDA 2X6FA 2I1JA 3PS6A 3SGHA 3ZYLA 2Y3HA 1DNPA 4YVOA 1H2VC 1ZHZA 4FC8A 3RU0A 3LLIA 2AXZA 4CRWA 4FP7A 4E6HA 4BEJA 4BJ6C 1BPOA 3RJVA 2VH3A 2J4BA 4L23A 3T8MA 1LS1A 4BJ5C 1E7UA 3BG1B 4N3CA 1FVFA 3ZFWA 2AXUA 5G04C 5KYWB 2VSXE 3CR3A 2J09A 4FX5A 3RRUA 4TUUA 1ZU5A 3Q6NA 1E7VA 2XXAA 4CIHA 3U3WA 3VYWA 4KBLA 3ZSUA 4BFRA 3LLKA 3FDHA 3D9MA 3GZ1A 5KCMA 2UWJG 1OKKA 1QNFA 3U64A 4U0SA 4FHJA 3G2UA 4KVOA 4E7SA 3DPDA 3POVA 4Q7CA 4Q94A 4YT8A 4HE8D 2UY1A 3ABLC 2J9UA 3CSTA 2R7WA 4JVSA 4F7AA 1QLEC 5G05C 3UPVA 3EFOA 3GANA 3MJWA 4APOA 2LAHA 4B8AA 1JPLA 2AWIA 1SMYF 4ANJA 4I3MA 4CT0A 4DLQA 5KYNA 2J9QA 1LVKA 3ZHEA 3S29A 4APFA 4H7YA 5AJLA 1V55C 4ATGA 3NG1A 3FDQA 4JA9A 5G04J 3CKBA 4OIPF 4EPZA 2IYLD 4DVZA 3AQCA 2R7QA 2C0LA 1WAO1 3SBSA 2DCPA 2DYRC 3MKRA 2WXHA 4O7GA 2WB7A 5DQTA 4LUNU 1UJJA 2A6EF 3TG5A 1UN9A 1JWFA 2A5UA 4RG9A 1ZHWA 2IOSA 2CG3A 4GA2A 5KYUB 3LPZA 3AG1C 1YA0A 4FESA 4GEHA 3D3MA 1IZMA 3S7FA 2VGYA 2BE5F 3JQ1A 5KJKA 2B0JA 2L81A 4F4BA 3UUXA 1E96B 4H7XA 4JPSA 1JPJA 3OAWA 2ZXWC 3APFA 3ZGQA 1NA3A 2W4BA 3L17A 4JHJA 1NU9C 2LO6A 4ACLA 1M2VB 2R7SA 3S27A 3PNTB 4CDRA 3LAYA 2XPYA 4JW1A 2JEKA 4CSAA 4NACA 4W9RA 4CEMA 3L16A 5B3SC 2IOQA 2IXPA 5JJ6A 3E4BA 4GMLA 2WQ7A 1J8MF 1V54C 4FJYA 3TG4A 4GYOA 5F5FA 3B7RL 3U9WA 3SNHA 3ESLA 3QWVA 2KATA 5AYWD 2WXRA 1SZAA 3ML9A 2QTVA 5E33A 4J30B 4UWHA 1QZXA 1W2WA 2XL4A 3VLEA 4A1GA 3EHNA 2R7XA 2UY1B 3EIQC 4CT4A 2R5SA 2XCBA 4KZ0A 2Y69C 1XNFA 4QDLA 1D0ZA 3WG7C 1KT0A 2OCCC 3DXJF 1E8YA 3S7BA 4JA7A 2VTBA 2J0XA 4AE4A 3FUMA 4U5DE 2OG2A 2XCCA 3CKCA 4KNWA 3L08A 2ZU6B 4U07A 1OCCC 4C3EA 4BY6A 3QMKA 1EYHA 2XSEA 4K0DA 2WXNA 3MGBA 3F47A 4OIRF 4RG6A 2G3VA 3ZRHA 5G05J 3ZVRA 4XI9A 3X2QC 5A23A 1ZHTA 3VTYA 3DM9B 3AU5A 1SF8A 2J9WA 5BUZA 1FMWA 2FULA 2XPIA 4RD9A 3QWPA 5BV1A 1N52A 3H65A 3IKOB 2PL2A 3SZ7A 2WXFA 4NURA 3CK8A 4WWPA 3RK6A 3QOUA 5EX0A 4I9EA 3MX3A 4JZAA 4XE0A 4A55A 1H2TC 4WJ0A 1TWAA 1XGWA 1TJCA 5E76A 4I6EA 4AE4B 3DAFA 1TR2A 3Q49B 3AG4C 3F46A 2HYZA 2I1KA 1OCOC 1NG1A 1WGWA 4FLBA 2J08A 4LEUA 2WQHA 3CIAA 4HXIA 4PFPA 1NZNA 3WXXA 4AY6A 4GZ6A 1U3CA 3FUEA 4XI0A 4G7HF 2WL8A 2X51A 3CVYA 1HX8A 3NYLA 4EZLA 1HG5A 4KMOA 4WWNA 4I6JA 2IOLA 3PVLA 2VQ2A 3JQ0A 5FWQA 2V3CC 3RIPA 2Y4TA 2CDQA 3EZIA 3UT7A 4U8HA 4GYWA 5T3RA 1D1BA 3S28A 3ASDA 2GGFA 1SZ9A 2WZGA 5ARGA 3SF4A 4AP2A 2PX3A 3QARA 3ZW3A 4WNEA 5ENNA 3RFYA 3B7TA 4J0UA 3OWTA 1OCRC 3BEEA 4GMJA 4R7LA 5DS4A 2CNWD 3FUDA 3FHDA 3AG3C 2FF4A 4FWVA 3TJPA 2LSEA 3LJBA 3MEKA 4BJ1A 3OXGA 2KNHA 3JYHA 4ME2A 4CS9C 3D9KA 2E2EA 2LSUA 1D0YA 4DLOA 4BJTA 2X6KA 4O79A 3CVXA 1MNDA 4C3DA 3DD7A 3AS5A 4QI0A 4PK4A 1PAQA 4K03A 2Q7FA 4GCNA 2H7BA 4GA0A 2L9JA 3KEZA 4G1TA 5FQ4A 2IXMA 5BW8C 4AVXA 5BNWA 4U0UA 1OWNA 4J8FA 2WMOA 1PCXA 4B94A 5HQ8A 1NZEA 1Z3XA 5FQ7A 3ESKA 2PQRA 3Q47B 1HO8A 4BG0A 3CLJA 2J4DA 4IRUA 3FTYA 3UMHA 5B1AC 3QZCA 2WXMA 4GZDA 5EDSA 4IJJA 2VGXB 1KLXA 5KYYB 2DIWA 2WXOA 3ZPJA 1Z6AA 4HS2A 4AOFA 2PQNA 3QB2A 3NRHA 4L7TA 1O87A 4HLEA 2VSNA 4EECA 1H6KA 1QQEA 2YINA 3ASFA 1Z23A 3LY7A 4O6NA 5J08A 2PP4A 1H0AA 5E3AA 3LVQE 2Q9AA 4BWRA 2DGJA 3LKUA 2EINC 4JEHA 2CFUA 4UWFA 3V7OA 2WXLA 2HM8A 3TXNA 3G2SA 3S7JA 3N0TA 2OOEA 3ZYQA 4YT5A 2BF0X 4AV7A 4LACB 1RJ9B 4D10C 1HFAA 5C2YA 4GU5A 3TXMA 3UR3C 2L9BA 5T1DB 5KYWA 3LVRE 3AQBA 5KYYA 4GB9A 3LESA 5DIZA 1VYIA 2R7UA 3E9VA 3LDZA 3MKQA 1FTSA 3PRZA 1E8XA 2G62A 3CVWA 4A3VA 2X6HA 3B7UX 4DJAA 4XTKA 3HTKC 3SI5A 3HJCA 4MNDA 4XX5A 4B6IA 3CV0A 1L5JA 4Q69A 4I1AA 3W2VA 3E70C 3JT1A 2VGXA 2WPVA 4YT4A 3SZRA 3W2WA 3FAJA 4JXTA 1FMVA 1VOMA 3K66A 4ILHB 2CHXA 2WXJA 3MYVA 1ZHXA 3EZHA 2WXPA 2BTDA 3FP3A 4F3VA 3ZIMA 3ONKA 4C7OA 4OVVA 4UI9K 3KKBA 2LSVA 4PJMA 2V26A 3IBEA 2VSOE 1D1AA 2X3MA 2EIMC 4CS8C 2IXOA 5L3QA 4U5FE 1OWLA 4OYSA 2KGOA 4HFFB 3CK9A 4CS8A 4UQZA 4URKA 3FUIA 3HYMB 3FTVA 1Z6TA 2X6JA 2FBNA 3CHRA 2J0WA 2CFZA 5JHBA 2L6JA 1D0XA 4KXKB 4EQFA 3Q7GA 3KL4A 4HOSA 3OXLA 2PM7A 3BG0B 3D9NA 3HVEB 2EIJC 4AIFA 3ZYKA 5LFAA 3MV3B 5CMWA 3D9LA 3JSZA 4AY5A 3ITFA 4QFVA 2J7PD 4AXHA 2MRIA 3ZN3A 4LRZA 1A17A 3CHMA 3K6BA 4MQ9F 4W8KA 2V5FA 2IQCA 5A6CA 1BR2A 3DJNB 2MYSA 3DAGA 2Y3BA 1IYGA 4N3AA 3TL5A 2FO7A 2A4ZA 1UJKA 3Q7LA 3G2WA 3KMIA 2YQ8A 5BV0A 1Z3YA 2A68F 4Y6WA 3FH5A 4X0RA 3FU0A 5KYUA 4Q5SF 1PC2A 2GRLA 3FVYA 4AJWA 3O4ZA 4N2SA 2WVNA 5LCWC 2EQXA 3EGDB 1M2VA 3O39A 5L3VA 3UX4A 3PE4A 3PMRA 3QC1A 4FA6A 4DK5A 4Q96A 2P58C 5EGYA 4WWOA 4JCHA 2MWQA 4U5GA 4E7ZA 2CNWA 3CVQA 3UNGC 3DM5A 4MKTA 1OKKD 3P1UA 2WZFA 3EH1A 3ZIBA 2CHWA 2A6HF 2O9XA 2KZTA 3ZXSA 3FTWA 4DVYP 2KCVA 4UWGA 2DYSC 5EKQD 5E2QA 3UT4A 4J8DA 5DVWA 3PUKA 3O6XA 4YWQA 1ELRA 2KJGA 4GYTA 1HE8A 1OUVA 4AX2A 4A3TA 4G7ZF 4XLPF 1NP7A 2HO1A 5HI7A 1Z3IX 3EIJA 5T3TA 4UWKA 1MQSA 2Y39A 1OCZC 3WODF 4G7OF 1P5QA 3I4GA 2WXKA 3KH2A 3ZEFA 4O6FA 2M4EA 4P29A 2XRZA 4U5BE 4ANUA 1Z5ZA 2H7VC 2NUPB 2CGEA 3L13A 2ZXRA 3SHFA 3PHF2 3CSFA 3LNRA 4I1OB 4JJGA 4CDMA 4ULWA 5A7DB 2WVQA 3T5VA 3B13A 5JJTA 2VTBB 2NC9A 5HSWA 4XWJA 5BUOA 2M63A 5C1DA 4PS7A 4XIFA 1EPUA 2XXAB 4UWLA 2I9CA 1TWHA 4BJ5A 2XGMA 2FI7A 4IWBA 4GPKA 3HIZA 4F1SA 4EZKA 4I44A 3MCXA 1WY6A 1OWMA 2WVIA 2R7VA 2Y3AA 5AENA 1DVPA 4RSYA 3CHPA 4WNFA 2NUTA 2JLBA 3SBTB 2NUPA 5KYXB 4B8CB 2KC7A 4N39A 3ZC4A 2EILC 3VAYA 3ABKC 3FU5A 2BUGA 1ZBPA 1OWPA 1GW6A 3AS4A 1IW7F 1JUQA 3FUFA 2EIKC 5DLJA 1NA0A 5D0OD 3GODA 3UT8A 3SEOA 3MA5A 2ONDA 3HHMA 2YHCA 1MNEA 3ABMC 4CSAC 3L6AA 1D1CA 4GAAA 2XRHA 1PD1A 3S0XA 2XPZA 1X5BA 4XLNF 2KZTB 5CMYA 4PS3A 2HV6A 3UGOA 4K0RA 5F5HA 3PNLB 2C04A 3FTXA 4CGVA 3URZA 4HOTA 2E0IA 2NUTB 1FVHA 3K1HA 2H7OA 2GRMA 4U0ZA 4OINF 4B89A 2LNIA 1ELWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JYS A;  3NQP A;  5LX8 A;  3GZS A;  3CK8 A;  3JQ1 A;  3HDX A;  5T3R A;  3EHM A;  4MRU A;  5FQ7 A;  3MX3 A;  3EHN A;  3FDH A;  3I4G A;  3L22 A;  3JQ0 A;  3IV0 A;  3MYV A;  3MCX A;  4F7A A;  3CGH A;  3CKC A;  4F53 A;  3SNX A;  4PUC A;  3P1U A;  3LEW A;  5FQ6 A;  4L7T A;  3CK9 A;  5FQ8 A;  4Q69 A;  5E76 A;  3CKB A;  5E75 A;  3KEZ A;  3SGH A;  5T4Y A;  3QNK A;  5J90 A;  5FQ4 A;  3CK7 A;  3EJN A;  3OTN A;  4LER A; 
#chains in the Genus database with same CATH topology
 4U5H A;  2VAS A;  2P61 A;  1U2V G;  3AJM A;  3HLZ A;  1FT2 A;  2XRY A;  3AS8 A;  3F6Q A;  3K1I C;  5FZS A;  3W4Y A;  1PD0 A;  4UI9 C;  3IV0 A;  4U8Y D;  1M56 C;  1M6T A;  3GEI A;  4BES A;  1ZW3 A;  2XM0 A;  3U4T A;  4FLH A;  4MVZ A;  5HRY A;  3LEW A;  3QDN A;  3NKE A;  2MHK A;  1YJG A;  4P9F A;  4JTD B;  4LLE A;  4EKW A;  2XEE A;  2XHE A;  3C3R A;  4XPY A;  2R7T A;  5D91 A;  1PY1 A;  4EBB A;  2Q3T A;  4J7W A;  1BU9 A;  3DST A;  1VLS A;  1O1R A;  3AG4 E;  4A2N B;  3PEV B;  3D9P A;  1OCO E;  2IF4 A;  3UIP C;  5LX8 A;  1RJ9 A;  2LQG A;  4KYO B;  2J9V A;  3I3N A;  3Q73 A;  1HG2 A;  4UI9 J;  2EPM X;  3UMK A;  2J9B A;  4CDY A;  2QLA A;  3DXK G;  5DS6 A;  1DC2 A;  1JPN A;  3H2V A;  2Y3D A;  2XLD A;  5AC4 A;  2YHE A;  4PJJ A;  2XGO A;  3LXU X;  2V0P A;  1S7Z A;  5KNG A;  2V8S E;  4Q4Z F;  1Q0K A;  2QY9 A;  1L3P A;  4DI3 A;  2ETC A;  3SXZ A;  2GFH A;  4TXR A;  4XKB A;  4U63 A;  5L0I A;  2A1D D;  1VTM P;  5BT1 A;  5B1A E;  2AXV A;  3FUJ A;  2Y3G A;  4XEK A;  5EIL A;  4KC9 A;  2NSZ A;  4B0Z A;  3RW0 A;  2R7R A;  3FH8 A;  3TWU A;  4KI2 A;  4KZC A;  3IHU A;  4IAO A;  2VC9 A;  1N4S A;  3FHE A;  4YT2 A;  2AVP A;  1TEZ A;  1E86 A;  2XLE A;  5BXU A;  4EBA A;  2F37 A;  4OVU A;  3A11 A;  3ASO C;  2QYJ A;  1KZP A;  2L6F A;  4Z68 A;  3DBS A;  1VMA A;  3V5Z A;  1E85 A;  1XZQ A;  4G24 A;  3X1O A;  3ML8 A;  3S2A A;  4ULV A;  3I5Q A;  4PR9 A;  3FUK A;  4C9B B;  3ECS A;  3NYJ A;  1LM3 B;  2ZXO A;  2J07 A;  2VJ8 A;  2FGY A;  3RVZ A;  3ASH A;  4R32 A;  4CZ2 D;  5KJM A;  3Q4A B;  1SYQ A;  4L2Y A;  3TOM A;  3FAP B;  2P6V A;  4MS2 A;  2OV8 A;  2KCL A;  2PZI A;  2R9R B;  3US6 A;  1LKX A;  2C03 A;  2PNO A;  3JYS A;  5ENS D;  2QFC A;  3MZL B;  2OEW A;  3TGO A;  3J5Q B;  1LF8 A;  3D9O A;  4TUM A;  3IQ6 A;  2XEH A;  4YDW A;  1WAT A;  2XS1 A;  1TNZ A;  1IQR A;  4CYM D;  3B9Q A;  2M64 A;  3CQG B;  1LTX A;  2KW3 C;  1CPQ A;  4JL0 A;  5A6B A;  5T4Y A;  3KD7 A;  2HE0 A;  4L9P A;  2B6C A;  3EJN A;  5FZQ A;  3K1I A;  2ZPA A;  5EX3 A;  3RAU A;  1E84 A;  1NU7 D;  2RD0 A;  1YYJ A;  2H8A A;  1ZVZ A;  4NTB A;  2YL0 A;  1SW6 A;  4C3B A;  3PE3 A;  2PFD A;  4HOQ A;  1NI1 A;  3SNX A;  2L0T B;  1ZYR F;  4G26 A;  1HS6 A;  2DI3 A;  1EDU A;  4ATZ D;  5J90 A;  2LFD A;  4L1B A;  5DBK A;  4GYY A;  4BX9 A;  3CVN A;  1AEP A;  5AQA A;  3LYA A;  1CPR A;  1KPS B;  4K5B A;  4XEI G;  3AOU A;  4DPR A;  1BR4 A;  4ZHB A;  1RKE B;  5LP0 A;  3N24 A;  4YN0 B;  3L22 A;  3M4C A;  4DRH B;  1UG3 A;  2AP3 A;  4PJN A;  1MMG A;  4F53 A;  5KJL A;  4I1M A;  4OIO F;  2L6G A;  2WQ6 A;  2L0I A;  3B95 A;  5ARF A;  3N71 A;  3OXF A;  4B93 B;  2WM9 A;  1MHQ A;  3Q79 A;  3N2Z B;  4G11 A;  3PZD A;  1W3B A;  3FU6 A;  3I5P A;  2F22 A;  4CBE A;  2J49 A;  2XQ0 A;  3QWW A;  1IQU A;  2H6G A;  3L8I A;  2WZL A;  4ZLC A;  4AK9 A;  1IHG A;  3I4U A;  1FCH A;  5G2N A;  4HB5 A;  5E3C A;  2I6H A;  3APD A;  3ZHE B;  3RKV A;  4ABN A;  4M7C A;  1L7C A;  5BPP A;  4IB4 A;  2J45 A;  3ULQ A;  2ILR A;  3TWQ A;  3RIB A;  3ZG1 A;  4KNV A;  3GW4 A;  5JJ7 A;  2YNQ A;  2IFU A;  3M15 A;  4D4X A;  4ZFH A;  4HOU A;  1OW7 A;  2YLG A;  4Z9J A;  1RMV A;  2KYH A;  1J8Y F;  3L54 A;  4KVM A;  4FHK A;  1IXV A;  1E8Z A;  3SD5 A;  4O6M A;  2J46 A;  3FH7 A;  3EGX B;  5AIJ A;  3RRM B;  3LJ3 A;  3M1C B;  1OT8 A;  3U9M A;  1VYK A;  2RG8 A;  3E33 A;  5CED B;  3CGH A;  4HFG A;  3KAE A;  3M4B A;  3AG2 C;  4JRZ A;  5CRU A;  3HXD A;  3EFO B;  4DRX E;  2DZN A;  3AG1 E;  3CHO A;  5KNH D;  4RDA A;  2OEX A;  5CI9 A;  3B7S A;  3UM0 A;  2P9L G;  2CHZ A;  4P9T A;  4IN3 B;  1HH8 A;  1ORS C;  1H2U A;  3FXH A;  3ZVV A;  4WNG A;  4Y6C A;  3MBG A;  4PDX A;  2HR2 A;  3CAX A;  3FEX A;  3C18 A;  4OIQ F;  4C7O B;  4I6G A;  2NG1 A;  4H4K C;  3K9I A;  4BT9 A;  4UQX A;  5CCM A;  3B71 A;  4J32 B;  2Y1L E;  5DQZ A;  3CZ6 A;  3JUE A;  3QKY A;  3VM6 A;  1JWG A;  3EDT B;  3QAQ A;  3W8H A;  3CHQ A;  3L34 A;  1JRA A;  2E87 A;  3C8G D;  2GW1 A;  3IEG A;  1O5M A;  3CQZ A;  2NXP A;  3AU4 A;  1OWO A;  4HOR A;  4YVQ C;  2V4L A;  3GWN A;  3VF0 A;  3B29 A;  1TJF A;  4O1P A;  4PFO A;  2R59 A;  4U04 A;  1BR1 A;  1B89 A;  1YYH A;  5AGF A;  4L6R A;  4GZC A;  1H6O A;  3P2B A;  3TWW A;  2KM4 A;  4JHR A;  3IQT A;  5JHA A;  4J8S A;  1SQM A;  3IEE A;  5ANL A;  4U5E E;  3C98 A;  3BU8 A;  4J8E A;  3RO3 A;  4ILG A;  3R9A B;  4XEV A;  3DMD A;  2P0N A;  3PZ1 A;  4DX2 A;  3HDX A;  3JCK C;  2OVF A;  3U9J A;  1SR2 A;  3IHY A;  4N06 A;  1U0B B;  3BRJ A;  4DOZ A;  1OXJ A;  4HEA J;  3BQO A;  3PEU B;  4E17 A;  4GZ3 A;  3MFN A;  3CVP A;  2D5R B;  4OD4 A;  3LEO A;  4I43 A;  3R7Q A;  1FFH A;  2HKV A;  2EIJ E;  5E75 A;  2X38 A;  5KJN A;  3BEH A;  4EHM A;  3PCV A;  4QI2 A;  1ELK A;  4GCO A;  2X6I A;  1N1C A;  1N54 A;  1OCZ E;  3DJU B;  5LCW J;  3LS0 A;  4G0H A;  4HFK B;  3U2L A;  2W4M A;  4NQF A;  3TD7 A;  3D9I A;  2LIG A;  3LS1 A;  1G5Z A;  4MRU A;  3R7R A;  3ONL A;  4FUL A;  3SFZ A;  4O6Y A;  1JR8 A;  1Y6I A;  4DBR A;  1UN8 A;  2HZ8 A;  5CCL A;  3RKO F;  2QE9 A;  2WVO A;  1H9T A;  2GRO B;  1TKN A;  3O48 A;  3W8I A;  1TWC A;  2WXG A;  3JCU Q;  3EPV A;  3L0I A;  3NZS A;  4CCA A;  3A9C A;  5G55 A;  3CQC B;  1YYX A;  4PH4 B;  5AAO A;  3EGX A;  4XKC A;  5AJD A;  4CJO A;  3KS2 A;  3PUJ A;  2Q9C A;  3EG9 B;  3D9J A;  3R9M A;  1FPP A;  3DZA A;  1T9K A;  2G3K A;  2GAQ A;  2XEV A;  5COG A;  3FY4 A;  5FTP A;  3JRT A;  3C3Q A;  3CSK A;  3LY9 A;  1S0P A;  2VYI A;  1LD7 A;  1U6H A;  3PDN A;  4V3I A;  4GTQ A;  5JMN D;  4GPM A;  5COM A;  4BTB A;  1MMD A;  4JC8 A;  3B0V C;  4ANX A;  3PZ2 A;  1A7E A;  2EPK X;  3E30 A;  3Q9U C;  1SVX A;  3O55 A;  4BSX A;  3UMI A;  2C0M A;  2HV7 A;  4EBJ A;  4L2L A;  4JTC B;  4XZ4 A;  1U3D A;  1AVO B;  5FCL A;  4OD5 A;  4G2V A;  1MMN A;  3CEQ A;  4BX8 A;  2I15 A;  3TQO A;  3RYL A;  4QQI A;  2RKK A;  2AWY A;  2CW0 F;  5AQ7 A;  4WGY A;  2KBX A;  3WAQ A;  2QUP A;  2ION A;  3OTN A;  3Q6M A;  4UDV A;  4U5C E;  1ST6 A;  4YL0 A;  1JCS A;  2L7A A;  3EQL F;  4YND A;  1NBB A;  5CEC B;  1H7I A;  1H6G A;  4KT6 B;  3FEY A;  3EGD A;  3GZ2 A;  2QY7 A;  3ABK E;  5EN5 D;  4JZY A;  2A69 F;  3JXJ A;  1HZ4 A;  1VDY A;  2W9Y A;  1SZI A;  3IHV A;  2P9K G;  4JEB A;  5CHE E;  1ZU4 A;  3Q15 A;  4GTV A;  2YVK A;  1BDJ B;  3NDB B;  3FUL A;  1Z63 A;  4FU3 A;  1LS4 A;  3LCA A;  2H6F A;  2UUH A;  4P6I C;  4DBQ A;  2XGS A;  2XZD G;  4HVB A;  4JE9 A;  3U8P A;  3ZWI A;  5FQ6 A;  4DX6 D;  4PJL A;  2QZA A;  4Z9I A;  4A1S A;  2XEN A;  4F1P A;  3DWW A;  4GA1 A;  4AEZ C;  1TFK B;  5FZR A;  4MS6 A;  3EG9 A;  4MVM A;  1NLX A;  1T6U A;  3NYM A;  1G8X A;  3ENE A;  2AW6 A;  3ISM C;  1R5I D;  4C0M A;  5D92 A;  3IXE A;  2OQM A;  4IYP A;  1CGN A;  1MMA A;  2OCC E;  1M2O A;  3ASN C;  3DSV A;  1E90 A;  1O5H A;  4DX5 D;  3NKD A;  2WB2 A;  4G23 A;  1QPU A;  4DI4 A;  4KBQ A;  4AM9 A;  2V4H C;  3UTM A;  2W45 A;  1ZB1 A;  1EI7 A;  3CK7 A;  3PRE A;  3PZ4 A;  3IQ5 A;  4NRH B;  5JS5 A;  4YJW A;  4I17 A;  3RO2 A;  5B1B C;  1OCC E;  4CS9 A;  3T6B A;  4CGW A;  3FTZ A;  4EZJ A;  2IJG X;  5LOZ A;  3ASG A;  2F8X K;  3PH0 C;  5EHH A;  5ANR A;  2P9I G;  4YDY A;  1DCE A;  3RRN B;  3I4R B;  5M72 A;  1HMD A;  4LCT A;  1H19 A;  3QK0 A;  4N2Q A;  4BTA A;  3SYN A;  1XZP A;  3UMV A;  3FU3 A;  4M63 A;  5HV9 A;  3FUH A;  5B3I A;  4FJZ A;  2C2L A;  2WMN A;  4M3O A;  4YK5 A;  1YZC A;  4G78 A;  1WDY A;  3NQP A;  5B1B E;  4MLP A;  3UQ3 A;  5FIN A;  3WHN A;  2J8W A;  1UFB A;  4ACK A;  1EF1 C;  4I2Z A;  3UIO C;  3RH3 A;  5JVE A;  2R7O A;  4BJ6 A;  3JUI A;  3CHS A;  1HF8 A;  4TRQ A;  2HMZ A;  5KYX A;  4JEU A;  1ZZP A;  2YQY A;  4LLC A;  1HU3 A;  3FFL A;  3CVU A;  2P7V A;  3TOL A;  3UGP A;  4FAD A;  2JPU A;  2HJ3 A;  1ZHY A;  4K7B A;  4AL0 A;  2YEV A;  4G8K A;  2KXP C;  3HG0 D;  2LFF A;  2YLI A;  2IU1 A;  1UOH A;  3LS8 A;  2FEZ A;  2HJM A;  3SP1 A;  1Y8M A;  1EKY A;  1BBH A;  4JUR I;  3C8Z A;  5CRV A;  2EIK E;  3HKK A;  1Z5S C;  4ANW A;  1FFT C;  3GZS A;  3FTS A;  1A5E A;  1MX2 A;  3OEO A;  4JJF A;  4MTG A;  4LDR A;  4X8Q A;  2ASR A;  1K1B A;  3UKR G;  1WM5 A;  3RQG A;  2PM6 A;  4E85 A;  1VK5 A;  4TV3 A;  2NPU A;  2EIL E;  2Y4U A;  4J7T A;  2YL7 A;  2YHS A;  4NY3 A;  3NF1 A;  4IUL A;  3G4Z A;  4MVO A;  3G2T A;  3S90 A;  3U2M A;  1E8W A;  4N5C A;  1ORJ A;  1WN0 A;  2I8B A;  4WUY A;  3OA1 A;  3APC A;  5ENT D;  4WND A;  2KK1 A;  2IXN A;  2OVB A;  4GTR A;  5T3W A;  5FJY A;  3DEP A;  1Q0D A;  3T4R A;  1N4Q A;  4I9C A;  3U66 A;  3FUN A;  4ANV A;  3K7D A;  4C0E A;  4G25 A;  5L0C A;  4BT8 A;  5FQ8 A;  2I2O A;  2KCK A;  2EIN E;  2LAI A;  3LEV A;  5IY5 C;  5DS5 A;  1KT1 A;  3VTX A;  4I2W A;  2Q9B A;  3AGT A;  3TWT A;  1M57 C;  5T8I A;  2J7P A;  4WAF A;  2JD3 A;  5JP7 A;  3B0U X;  2BKK B;  4EBA G;  2DBA A;  2VSY A;  3VLF A;  2TMV P;  2WXQ A;  3ZYM A;  2MOW A;  5FT9 A;  3NOG D;  3UI2 A;  2Q7R A;  1ZU2 A;  2IO2 C;  2CG2 A;  3FWV A;  3U3F A;  2WXI A;  4CDN A;  4UQY A;  4PS8 A;  2YZS A;  3EH2 A;  3NMJ A;  4RVB A;  4EWC A;  3GYZ A;  3TAX A;  4LER A;  3FTU A;  4GTM A;  4U9E A;  4CS7 A;  4NQ0 A;  3Q5M A;  1K1A A;  3HNK A;  5A6K A;  3LY8 A;  3NAW A;  2Q00 A;  3EHM A;  4GZ5 A;  2Z15 A;  1O1T A;  3CVV A;  3PZ3 A;  3CVL A;  3C5R A;  1NFI E;  5CI8 A;  3MKQ B;  3T6J A;  3G2V A;  4JHK A;  1T01 A;  3Q7A A;  5ITZ F;  3MLG A;  2FFH A;  1TWG A;  4H54 A;  4RBN A;  3NZU A;  2EPL X;  5D66 A;  2F8Y A;  1KU2 A;  1E2X A;  1QBQ A;  2R03 A;  2VB6 A;  2DZO A;  1QZ2 A;  5AN8 A;  3S7D A;  4ZLD A;  3K33 A;  2MYO A;  4GTO A;  2BL2 A;  4U9D A;  1N0R A;  2QC9 A;  3SXY A;  4N3B A;  4PUC A;  2PF4 E;  4OAU C;  2OEV A;  3QJZ A;  1HXI A;  4ILI A;  2PX0 A;  5D0Q D;  3U5S A;  1UW4 B;  3QNK A;  5A6B D;  1N9A A;  3JRM O;  5L0D A;  1INZ A;  4XPW A;  3KSQ A;  2R17 C;  3B0P A;  1Y4C A;  2ZXP A;  3HVE A;  4J6I A;  1I4Y A;  4IAQ A;  5A6J A;  4HQD A;  3FOP A;  3MV2 B;  2KQ9 A;  1YCS B;  3T5X A;  1RKC A;  5COF A;  3VLD A;  2X6F A;  2I1J A;  1HE9 A;  3PS6 A;  5L0J A;  4XEF A;  2BED A;  3SGH A;  3ZYL A;  2Y3H A;  1DNP A;  3B7B A;  4YVO A;  1HW2 A;  1H2V C;  1ZHZ A;  1N95 A;  4FC8 A;  3RU0 A;  3LLI A;  2AXZ A;  4CRW A;  4FP7 A;  1Z7Q c;  4LNU D;  4DXW A;  4E6H A;  4BEJ A;  2MHR A;  4BJ6 C;  1BPO A;  3RJV A;  3R2P A;  2DB4 A;  4HLL A;  1MJ0 A;  2YWA A;  2VH3 A;  3ZNG A;  2J4B A;  4L23 A;  3T8M A;  1RKE A;  1LS1 A;  4BJ5 C;  1E7U A;  2YRF A;  3BG1 B;  4N3C A;  1FVF A;  3DSU A;  3ZFW A;  2AXU A;  5G04 C;  5KYW B;  2VSX E;  3CR3 A;  2J09 A;  4FX5 A;  3RRU A;  4TUU A;  1ZU5 A;  3Q6N A;  1E7V A;  4HRM B;  5TJ5 E;  2XXA A;  4CIH A;  3U3W A;  3GM3 A;  3VYW A;  5F28 E;  2P9S G;  5JT4 A;  4KBL A;  3ZSU A;  4BFR A;  1WAS A;  3LLK A;  3FDH A;  3D9M A;  3GZ1 A;  5KCM A;  2UWJ G;  3EHR A;  1TN6 A;  1OKK A;  1QNF A;  2VCC A;  4RQI A;  3U64 A;  4U0S A;  4FHJ A;  3G2U A;  2A0U A;  3E37 A;  4KVO A;  1A7V A;  4E7S A;  3DPD A;  3POV A;  4Q7C A;  4Q94 A;  4YT8 A;  1C02 A;  2LK4 A;  4HE8 D;  3TWV A;  3DE9 A;  5H7P A;  3FOO A;  2UY1 A;  3ABL C;  2J9U A;  3CST A;  2KC3 A;  2R7W A;  4GQH A;  4JVS A;  4CDV A;  4F7A A;  1QLE C;  3UKU G;  5G05 C;  3UPV A;  3EFO A;  3GAN A;  3TUL A;  3MJW A;  4APO A;  2LAH A;  4B8A A;  1JPL A;  2AWI A;  1EA8 A;  1SMY F;  4ANJ A;  1S05 A;  1NL4 A;  2QNL A;  4I3M A;  2BC5 A;  4CT0 A;  4E0H A;  3UM2 A;  1SA5 A;  4DLQ A;  1OR2 A;  5KYN A;  2PBE A;  1LVK A;  2J9Q A;  3ZHE A;  3J5P A;  2L6B A;  1OR3 A;  3V79 K;  2DYR E;  4JC7 A;  3S29 A;  2GRN B;  2OKU A;  4APF A;  4H7Y A;  5AJL A;  1V55 C;  4ATG A;  3NG1 A;  3FDQ A;  4JA9 A;  4LDK A;  5G04 J;  3U3B A;  1D9S A;  3CKB A;  1RXQ A;  4OIP F;  4EPZ A;  2IYL D;  4DVZ A;  3AQC A;  2R7Q A;  3DE8 A;  2C0L A;  1ELW A;  3V2X A;  3TJ6 A;  1WAO 1;  3SBS A;  2DCP A;  2OOC A;  2DYR C;  3MKR A;  4GTT A;  2WXH A;  4O7G A;  3KPH A;  2WB7 A;  1YMP A;  5FIO A;  5DQT A;  2XLW A;  2HUJ A;  4LSZ E;  4LUN U;  1UJJ A;  2A6E F;  4K5C A;  2P1A A;  1UN9 A;  3TG5 A;  3Q7F A;  2EIM E;  1JWF A;  3NMK A;  4NTF A;  2A5U A;  4RG9 A;  1ZHW A;  5EIB E;  3L8J A;  3EU9 A;  3C8G A;  1N0Q A;  2IOS A;  5L0F A;  2CG3 A;  4GA2 A;  2HSQ A;  5KYU B;  5L0H A;  1HY5 A;  5AAR A;  1I5N A;  3LPZ A;  4K1O A;  3KYJ A;  3AG1 C;  1YA0 A;  4FES A;  4GEH A;  1Q0M A;  3NBN B;  1MZC A;  3D3M A;  1IZM A;  4JB8 P;  2BKG A;  3S7F A;  2VGY A;  1G4W R;  2AU5 A;  2RFA A;  1TNB A;  4EUK B;  3ZKJ A;  2BE5 F;  2XS8 A;  3JQ1 A;  4GMR A;  2B0J A;  5KJK A;  3QVY A;  1CGO A;  2L81 A;  4F4B A;  3UUX A;  2ZD9 A;  3TK0 A;  1E96 B;  4H7X A;  4JPS A;  1JPJ A;  3OAW A;  2ZXW C;  3APF A;  3ZGQ A;  1NA3 A;  3DRA A;  2W4B A;  4YDO A;  3L17 A;  4JHJ A;  2LXL A;  1N4P A;  1NU9 C;  1TNY A;  2LO6 A;  4ACL A;  1M2V B;  2R7S A;  3S27 A;  3PNT B;  4CDR A;  3QW0 A;  3LAY A;  1D8E A;  2GA0 A;  2XPY A;  4JW1 A;  2JEK A;  4CSA A;  4NAC A;  4W9R A;  1I4Z A;  4CEM A;  3L16 A;  1D8D A;  5B3S C;  2IOQ A;  2IXP A;  5JJ6 A;  3E4B A;  4GML A;  3DI5 A;  2WQ7 A;  1T5O A;  5EID A;  1J8M F;  1V54 C;  4FJY A;  3TG4 A;  3DXM G;  3BUA A;  4GYO A;  2YLD A;  3V30 A;  5F5F A;  3JXI A;  4IGG A;  4MVU A;  3B7R L;  1JOG A;  3U9W A;  3SNH A;  3ESL A;  1OW8 A;  2GWW A;  3ZQV A;  1YDI A;  2Y69 E;  3QWV A;  2KAT A;  3ZXP A;  1QKR A;  3HXF A;  5AYW D;  2DVW A;  2WXR A;  1SZA A;  3C63 A;  3ML9 A;  3L82 A;  2QTV A;  3G4X A;  4LDQ A;  2ICW G;  5E33 A;  5B3S E;  2OU6 A;  4J30 B;  4UWH A;  1QZX A;  1W2W A;  2XL4 A;  3VLE A;  4A1G A;  3EHN A;  4DJ9 A;  2R7X A;  5AC5 A;  2UY1 B;  1AWC B;  2QYU A;  3EIQ C;  4CT4 A;  3U8V A;  2NSF A;  1B68 A;  2YKZ A;  1OY3 D;  1JAF A;  2R5S A;  4JD2 G;  2XCB A;  4KZ0 A;  2Y69 C;  1XNF A;  4QDL A;  3DSX A;  1YAU O;  1D0Z A;  3WG7 C;  1KT0 A;  2OCC C;  4BER A;  3RQE A;  3DXJ F;  1E8Y A;  3ASN E;  3S7B A;  4JA7 A;  1KTM A;  3WG7 E;  2J0X A;  2VTB A;  3DKA A;  3GEE A;  4AE4 A;  4DX1 A;  3FUM A;  3HRA A;  4N6C A;  4U5D E;  2OG2 A;  2RD9 A;  4YL3 A;  2P9N G;  2XCC A;  3CKC A;  1MX4 A;  1T6I A;  5ENQ D;  5JSL A;  5BQH A;  3ABM E;  4KNW A;  3L08 A;  2ZU6 B;  4U07 A;  3V31 A;  4FAP B;  1OCC C;  4EHP A;  5EYP F;  4C3E A;  3C62 A;  4BY6 A;  3QMK A;  1EYH A;  2XSE A;  4K0D A;  2WXN A;  3MGB A;  3F47 A;  4HBD A;  1K40 A;  4OIR F;  4RG6 A;  3TWR A;  5BXO A;  2G3V A;  3NMI A;  1LE4 A;  3ZRH A;  1K8K G;  5A6A A;  5G05 J;  3ZVR A;  4XI9 A;  2ETS A;  3X2Q C;  3NB2 A;  5A23 A;  1ZHT A;  3VTY A;  3DM9 B;  1MX6 A;  3AU5 A;  4DUI A;  1SF8 A;  2XM4 A;  2J9W A;  3G50 A;  4XPX A;  5BUZ A;  4AL1 A;  1FMW A;  3MYF A;  2FUL A;  2XPI A;  4RD9 A;  4BEM J;  3QWP A;  5BV1 A;  2JX0 A;  1N52 A;  3H65 A;  3IKO B;  2PL2 A;  3SZ7 A;  2WXF A;  3AAA C;  4NUR A;  3CK8 A;  1QVX A;  2LXM A;  2J8S D;  4WWP A;  3RK6 A;  3QOU A;  3EUV A;  5EX0 A;  3X2Q E;  4I9E A;  3MX3 A;  4JZA A;  4JKV A;  5CBO A;  4F6R D;  1KNY A;  4XE0 A;  4A55 A;  1H2T C;  4HRL A;  4DX7 D;  4WJ0 A;  1TWA A;  1XGW A;  1N94 A;  1TJC A;  1TNU A;  5E76 A;  1YAR O;  4I6E A;  4AE4 B;  3DAF A;  1TR2 A;  2F0Y A;  4JCZ A;  2EPO A;  3Q49 B;  3SXM A;  3AG4 C;  3UM3 A;  3F46 A;  2HYZ A;  5AQB A;  2I1K A;  1OCO C;  1NG1 A;  1WGW A;  4FLB A;  2J08 A;  4LEU A;  2WQH A;  3CIA A;  4HXI A;  1TQG A;  1WOL A;  4PFP A;  1NZN A;  4LG6 A;  2IM8 A;  3WXX A;  3EU5 A;  4AY6 A;  4GZ6 A;  1U3C A;  3FUE A;  4XI0 A;  4JTA B;  4G7H F;  2WL8 A;  4EIY A;  2X51 A;  4D4N A;  3NOC D;  1Y6D A;  3DWL G;  3CVY A;  1LIH A;  1HX8 A;  3D9H A;  3NYL A;  2ZIS A;  4EZL A;  1HG5 A;  2RSE B;  2ETB A;  4KMO A;  4WWN A;  4BPM A;  4I6J A;  4NCQ A;  2IOL A;  3PVL A;  2VQ2 A;  5CER B;  4NC3 A;  3JQ0 A;  2R02 A;  5FWQ A;  2V3C C;  4MTF A;  3C7J A;  3HXB A;  5JA4 D;  3RIP A;  3V5Y A;  5EYL A;  2Y4T A;  2CDQ A;  3EZI A;  2D4U A;  5BQG A;  1FNT c;  1LI7 A;  3UT7 A;  2ETA A;  4U8H A;  4GYW A;  1GQA A;  5T3R A;  5A69 A;  1D1B A;  3S28 A;  3ASD A;  2GGF A;  3LNM B;  1SZ9 A;  4TXP A;  2WZG A;  1GGQ A;  3UIN C;  5ARG A;  3SF4 A;  3DEO A;  4AP2 A;  2PX3 A;  2VCA A;  3QAR A;  3ZW3 A;  4WNE A;  5ENN A;  3RFY A;  3B7T A;  4J0U A;  3OWT A;  1OCR C;  3BEE A;  4GMJ A;  4R7L A;  4RLY A;  5DS4 A;  3H2U A;  2CNW D;  3FUD A;  3FHD A;  5HKP A;  4YL1 A;  3AG3 C;  4WAB A;  1YA7 O;  4WGZ A;  2FF4 A;  1EQ1 A;  4FWV A;  3TJP A;  2LSE A;  3LJB A;  2NYJ A;  3MEK A;  4BJ1 A;  3OXG A;  2KNH A;  4BSZ B;  3JYH A;  1S63 A;  4ME2 A;  4CS9 C;  2XLV A;  3D9K A;  4J7Y A;  2E2E A;  2LSU A;  1O3U A;  1OCR E;  1AP7 A;  2EPN A;  4DRI B;  1D0Y A;  1AUE A;  3AG3 E;  2A0B A;  4BJT A;  2B0O E;  2YL1 A;  2X6K A;  4O79 A;  4ONS A;  2KSF A;  4DLO A;  3CVX A;  1MND A;  4C3D A;  4U7E B;  3DD7 A;  1YVI A;  4CJG A;  1GM5 A;  3IQC A;  4JIO A;  2RFM A;  3AS5 A;  1QYM A;  4QI0 A;  4PK4 A;  1PAQ A;  1NFO A;  1VB5 A;  2Q7F A;  4K03 A;  3VRC A;  4GCN A;  2H7B A;  4GA0 A;  2L9J A;  3KEZ A;  4G1T A;  5FQ4 A;  2IXM A;  5BW8 C;  4AVX A;  5BNW A;  4U0U A;  1OWN A;  2Q4F A;  4J8F A;  2WMO A;  1PCX A;  4B94 A;  3CEX A;  5HQ8 A;  1NZE A;  1Z3X A;  5FQ7 A;  3ESK A;  2PQR A;  3ZU7 B;  3Q47 B;  1BLX B;  1QQ3 A;  3ZTM A;  1PV3 A;  1HO8 A;  4BG0 A;  3CLJ A;  1E83 A;  2J4D A;  4IRU A;  3GEH A;  3FTY A;  3UMH A;  5B1A C;  3QZC A;  5ENR D;  2P9P G;  2WXM A;  4GZD A;  3HNJ A;  3HXE A;  5EDS A;  3LJN A;  1H6P A;  4IJJ A;  2VGX B;  1KLX A;  2UUI A;  5KYY B;  2DIW A;  2WXO A;  3ZUV B;  3ZPJ A;  1OXB A;  4EBK A;  1Z6A A;  3GOR A;  4HS2 A;  3M79 A;  2PQN A;  3L9T A;  4AOF A;  4J8Y A;  3QB2 A;  3NRH A;  3C8G B;  2AWC A;  3Q75 A;  5BQI A;  2GRQ B;  2PNN A;  2DWZ A;  4L7T A;  3SY2 A;  1O87 A;  4HLE A;  2VSN A;  4U95 D;  2LD6 A;  4EEC A;  1H6K A;  5JLI A;  1QQE A;  4MW3 A;  5K0I A;  4E18 A;  2YIN A;  4G8L A;  3ASF A;  1Z23 A;  3LY7 A;  4O6N A;  5J08 A;  2PP4 A;  1H0A A;  3T6G B;  5E3A A;  3KSL A;  3LVQ E;  3IPM O;  2Q9A A;  1BZ4 A;  2XZT G;  1TYQ G;  3QW1 A;  4TXQ A;  4BWR A;  2DGJ A;  3LKU A;  2EIN C;  1BI7 B;  4JEH A;  2CFU A;  4UWF A;  3V7O A;  1MQV A;  2H6H A;  3TJ5 A;  2WXL A;  4N6H A;  2HM8 A;  3TXN A;  5KBA A;  3G2S A;  2AVK A;  1G3N B;  1APC A;  3N0T A;  2OOE A;  3S7J A;  3ZYQ A;  2GRR B;  4YT5 A;  2BF0 X;  4AV7 A;  4LAC B;  3MYI A;  1RJ9 B;  3AGU A;  4C48 B;  3TWX A;  2YL3 A;  4D10 C;  2HS5 A;  3HXC A;  4JEA A;  1HFA A;  5C2Y A;  4GU5 A;  3TXM A;  3UXG A;  1DOW A;  3UR3 C;  2L9B A;  4GTP A;  5T1D B;  5D2M C;  1KZO A;  5KYW A;  3LVR E;  3AQB A;  5KYY A;  5IY5 E;  1MYO A;  3LES A;  4GB9 A;  2P9U G;  5DIZ A;  1VYI A;  2R7U A;  3E9V A;  3LDZ A;  3MKQ A;  1FTS A;  3PRZ A;  1E8X A;  2G62 A;  2R05 A;  3HNI A;  4MVR A;  3CVW A;  4A3V A;  2X6H A;  1HMO A;  3JZ0 A;  3B7U X;  4DJA A;  4XTK A;  3HTK C;  3SI5 A;  3HJC A;  4MND A;  4XX5 A;  1WTY A;  4B6I A;  2VGE A;  5ENP D;  1FAP B;  3CV0 A;  1L5J A;  4Q69 A;  4I1A A;  4MVS A;  4A4A A;  1FT1 A;  3DSW A;  3W2V A;  3E70 C;  3JT1 A;  3ZDL A;  2VGX A;  2XLH A;  3FMS A;  2WPV A;  4YT4 A;  3SZR A;  3W2W A;  3FAJ A;  3DPY A;  4JXT A;  1FMV A;  1VOM A;  3K66 A;  4ILH B;  4MVQ A;  2CHX A;  2WXJ A;  3MYV A;  1ZHX A;  3EZH A;  2WXP A;  2X0C A;  2BTD A;  3FP3 A;  2B0H A;  1A41 A;  4F3V A;  1UG7 A;  3ZIM A;  3ONK A;  1G4U S;  2XL8 A;  3O10 A;  4C7O A;  4OVV A;  4UI9 K;  3GWL A;  3KKB A;  2LSV A;  1WG0 A;  4PJM A;  1XWJ A;  2V26 A;  1FR0 A;  4O60 A;  3IBE A;  1QSP A;  2VSO E;  1D1A A;  1NFN A;  1HW1 A;  1BD8 A;  2X3M A;  2EIM C;  4CS8 C;  2IXO A;  3ATP A;  5L3Q A;  4CX9 A;  4U5F E;  4YDE A;  1OWL A;  4OYS A;  1NSG B;  2KGO A;  4HFF B;  2ZIR A;  4E0I A;  3CK9 A;  4CS8 A;  3J06 A;  2DYS E;  2ZGD A;  1TFO B;  5JUA A;  4UQZ A;  4URK A;  2IO3 C;  3FUI A;  3HYM B;  3FTV A;  4HRN A;  1Z6T A;  2X6J A;  2FBN A;  1N11 A;  2J0W A;  3S9O A;  1V55 E;  2CFZ A;  3CHR A;  1BI8 B;  5JHB A;  2L6J A;  1D0X A;  4KXK B;  3SQV A;  3RSE G;  1JMW A;  1IHB A;  4EQF A;  1K3Z D;  4LNB A;  1YZA A;  3Q7G A;  3KL4 A;  2GRP B;  1ZW2 A;  3JTL O;  2A5E A;  4HOS A;  3OXL A;  3JYY A;  4HI9 A;  1TNO A;  2PM7 A;  2L6H A;  3BG0 B;  3D9N A;  1GS9 A;  3HVE B;  2EIJ C;  3AG2 E;  4AIF A;  3ZYK A;  3EHQ A;  4O1O A;  5LFA A;  3MV3 B;  5CMW A;  256B A;  4CIP A;  3D9L A;  3JSZ A;  1V74 B;  4AY5 A;  5HS0 A;  3ITF A;  4QFV A;  4NTA A;  2R25 A;  2J7P D;  4AXH A;  2LP4 A;  4LNG A;  2MRI A;  3ZN3 A;  4LRZ A;  2FAP B;  1A17 A;  1LI5 A;  3CHM A;  3K6B A;  4MQ9 F;  4W8K A;  2V5F A;  2XLM A;  2IQC A;  4MBG A;  5A6C A;  1BR2 A;  2IBF A;  2VCB A;  3DJN B;  2MYS A;  4Z9H A;  1DCQ A;  1HE1 A;  3DAG A;  3ULE G;  2Y3B A;  1F1M A;  1YLM A;  1RZ4 A;  1V4A A;  3V5X A;  1IYG A;  1LE2 A;  4N3A A;  3HNL A;  3TL5 A;  2FO7 A;  3RF3 A;  2A4Z A;  1UJK A;  3Q7L A;  5JRA A;  4CDA A;  3T8K A;  3DSS A;  3G2W A;  3KMI A;  2YQ8 A;  3SFX A;  5BV0 A;  1Z3Y A;  2A68 F;  3JSE O;  4Y6W A;  3SO8 A;  5CBN A;  3FH5 A;  3ABL E;  4X0R A;  3FU0 A;  2JAB A;  5KYU A;  4Q5S F;  2GDC A;  1PC2 A;  2GRL A;  3FVY A;  3E32 A;  4AJW A;  4GTS A;  1LPE A;  3O4Z A;  2P2C P;  2XLO A;  4N2S A;  2CCY A;  2WVN A;  5LCW C;  2EQX A;  2LCH A;  3EGD B;  1M2V A;  3O39 A;  5L3V A;  1Q0G A;  3UX4 A;  3PE4 A;  3C3O A;  3PMR A;  3QC1 A;  4FA6 A;  4DK5 A;  2LUH A;  5AQ9 A;  4Q96 A;  5EK0 A;  2P58 C;  5EGY A;  1C03 A;  4WWO A;  4JCH A;  2MWQ A;  4U5G A;  4E7Z A;  2CNW A;  3CVQ A;  3UNG C;  3DM5 A;  3QVZ A;  3C72 A;  4MKT A;  1OKK D;  3RVY A;  2WZF A;  3EH1 A;  3ZIB A;  2R2L A;  3P1U A;  2CHW A;  2A6H F;  4MTO A;  2O9X A;  2KZT A;  1JCR A;  3ZXS A;  3FTW A;  4DVY P;  4U96 D;  2KCV A;  4UWG A;  2DYS C;  5EKQ D;  5E2Q A;  3UT4 A;  4J8D A;  3PDM P;  5DVW A;  3PUK A;  3O6X A;  3ZQY A;  4YWQ A;  1ELR A;  2KJG A;  4ER9 A;  4GYT A;  1HE8 A;  1OUV A;  4AX2 A;  3UM1 A;  2AJA A;  4A3T A;  4G7Z F;  1H9G A;  1U89 A;  3Q78 A;  1RCP A;  1SA4 A;  2ZGG A;  3R7C A;  3SFY A;  1NP7 A;  1OW6 A;  4XLP F;  2HO1 A;  2CYD A;  3GM1 A;  4XQ1 A;  4U8V D;  5HI7 A;  1YA9 A;  1Z3I X;  3EIJ A;  5T3T A;  4UWK A;  1X81 A;  1MQS A;  5CIV A;  2Y39 A;  1OCZ C;  3WOD F;  4G7O F;  1P5Q A;  3I4G A;  4A63 B;  4BEP A;  2WXK A;  3KH2 A;  3ZEF A;  5FZT A;  4O6F A;  4OAV B;  1OQC A;  2M4E A;  4N5Q A;  4P29 A;  2XRZ A;  2HFI A;  4U5B E;  1TN8 A;  4ANU A;  1Z5Z A;  2H7V C;  2OJQ A;  2NUP B;  2CGE A;  4DRJ B;  3KYI A;  3L13 A;  1TN7 A;  2ZXR A;  2FO1 E;  3SHF A;  3PHF 2;  3AJI A;  3CSF A;  3LNR A;  4I1O B;  4JJG A;  4CDM A;  4ULW A;  5A7D B;  2WVQ A;  3T5V A;  3B13 A;  1A7D A;  3Q9N C;  3QTH A;  5JJT A;  1K04 A;  1R4T A;  2VTB B;  1K05 A;  2ZXW E;  2NC9 A;  5HSW A;  4XWJ A;  5BUO A;  2M63 A;  5C1D A;  3RQF A;  4PS7 A;  1VLT A;  4XIF A;  5KWD A;  1S64 A;  3TWS A;  1EPU A;  2XXA B;  2XL6 A;  1OXK A;  3ZTZ A;  4UWL A;  3KEA A;  3V2O A;  2I9C A;  1TWH A;  4BJ5 A;  2XGM A;  2FI7 A;  4IWB A;  4GPK A;  3HIZ A;  1IKN D;  4F1S A;  1WWP A;  4EZK A;  4I44 A;  1TR4 A;  1Q2Z A;  3MCX A;  1WY6 A;  1V54 E;  1OWM A;  2WVI A;  2R7V A;  2Y3A A;  4HNA D;  1O1S A;  5AEN A;  1DVP A;  4N4W A;  4RSY A;  3CHP A;  4WNF A;  2NUT A;  1ORY A;  2JLB A;  3SBT B;  2NUP A;  1T6Q A;  5KYX B;  4B8C B;  1CGM E;  2IEJ A;  1DOV A;  3LUT B;  2HMQ A;  3ULY A;  2KC7 A;  1RW2 A;  4N39 A;  3ZC4 A;  2EIL C;  3W9F A;  4IAR A;  3VAY A;  3ABK C;  3FU5 A;  3ASO E;  5ENO D;  2BUG A;  4BET A;  1ZBP A;  1OWP A;  1GW6 A;  3AS4 A;  4PAC A;  1IW7 F;  1JUQ A;  3FUF A;  2EIK C;  5DLJ A;  5CEA A;  1NA0 A;  5D0O D;  3GOD A;  4NIK A;  1LD8 A;  3UT8 A;  3SEO A;  2NSG A;  3MA5 A;  4MW8 A;  2OND A;  3HHM A;  2YHC A;  1MNE A;  3ABM C;  4CSA C;  1C17 M;  3L6A A;  2Y0B G;  2IY0 C;  1D1C A;  4GAA A;  4HI8 A;  5L0G A;  2HSB A;  2XRH A;  3T9O A;  1PD1 A;  3S0X A;  2XPZ A;  1X5B A;  4XLN F;  3S84 A;  2KZT B;  5CMY A;  2OJE D;  3GM2 A;  3L1M A;  4PS3 A;  2HV6 A;  3UGO A;  4K0R A;  5F5H A;  1S70 B;  3PNL B;  3E34 A;  3W9G A;  2C04 A;  3FTX A;  4K5A B;  3U0C A;  4CGV A;  3URZ A;  4W8P A;  5GPG B;  1A0B A;  4HOT A;  2V5Q C;  4UUC A;  2E0I A;  2NUT B;  3SXK A;  3T9K A;  1Q0F A;  2H6I A;  1FVH A;  3K1H A;  2H7O A;  2GRM A;  4U0Z A;  4OIN F;  4B89 A;  2LNI A;  1N4R A;  1JCQ A; 
#chains in the Genus database with same CATH homology
 4U5H A;  2VAS A;  3HLZ A;  2XRY A;  3AS8 A;  3K1I C;  5FZS A;  1PD0 A;  4UI9 C;  3IV0 A;  1M56 C;  3U4T A;  4FLH A;  3LEW A;  3QDN A;  3NKE A;  2MHK A;  4LLE A;  2XHE A;  2R7T A;  5D91 A;  1PY1 A;  4EBB A;  2Q3T A;  4A2N B;  3PEV B;  3D9P A;  2IF4 A;  5LX8 A;  1RJ9 A;  4KYO B;  2J9V A;  3I3N A;  1HG2 A;  4UI9 J;  3UMK A;  5DS6 A;  1JPN A;  2Y3D A;  2YHE A;  4PJJ A;  2XGO A;  3LXU X;  2V0P A;  1S7Z A;  2V8S E;  4Q4Z F;  2QY9 A;  4DI3 A;  2GFH A;  4XKB A;  4U63 A;  2A1D D;  5BT1 A;  2AXV A;  3FUJ A;  2Y3G A;  4KC9 A;  2NSZ A;  4B0Z A;  2R7R A;  3FH8 A;  4KI2 A;  4KZC A;  4IAO A;  3FHE A;  4YT2 A;  2AVP A;  1TEZ A;  4EBA A;  4OVU A;  3ASO C;  3DBS A;  1VMA A;  4G24 A;  3X1O A;  3ML8 A;  3S2A A;  3I5Q A;  3FUK A;  4C9B B;  3ECS A;  3NYJ A;  2ZXO A;  2J07 A;  2VJ8 A;  2FGY A;  3ASH A;  5KJM A;  3Q4A B;  4L2Y A;  2P6V A;  2OV8 A;  2KCL A;  2PZI A;  1LKX A;  2C03 A;  3JYS A;  2QFC A;  3MZL B;  3TGO A;  1LF8 A;  3D9O A;  1IQR A;  3B9Q A;  3CQG B;  2KW3 C;  4JL0 A;  5T4Y A;  3KD7 A;  3EJN A;  5FZQ A;  2ZPA A;  5EX3 A;  1NU7 D;  2RD0 A;  4C3B A;  3PE3 A;  2PFD A;  4HOQ A;  3SNX A;  2L0T B;  1ZYR F;  4G26 A;  1HS6 A;  1EDU A;  5J90 A;  4L1B A;  5DBK A;  4GYY A;  4BX9 A;  3CVN A;  3LYA A;  4DPR A;  1BR4 A;  5LP0 A;  3N24 A;  4YN0 B;  3L22 A;  1UG3 A;  4F53 A;  4PJN A;  1MMG A;  5KJL A;  4I1M A;  4OIO F;  2WQ6 A;  2L0I A;  5ARF A;  3N71 A;  3OXF A;  2WM9 A;  1MHQ A;  3N2Z B;  4G11 A;  3PZD A;  1W3B A;  3FU6 A;  3I5P A;  4CBE A;  2J49 A;  2XQ0 A;  3QWW A;  1IQU A;  2WZL A;  4ZLC A;  4AK9 A;  1IHG A;  3I4U A;  1FCH A;  5G2N A;  5E3C A;  2I6H A;  3APD A;  3ZHE B;  3RKV A;  4ABN A;  5BPP A;  2J45 A;  3ULQ A;  2ILR A;  3RIB A;  3ZG1 A;  4KNV A;  3GW4 A;  5JJ7 A;  2YNQ A;  2IFU A;  4HOU A;  1J8Y F;  3L54 A;  4KVM A;  4FHK A;  1E8Z A;  3SD5 A;  4O6M A;  2J46 A;  3FH7 A;  3EGX B;  5AIJ A;  3RRM B;  3LJ3 A;  3M1C B;  1VYK A;  2RG8 A;  3CGH A;  4HFG A;  3KAE A;  3AG2 C;  3EFO B;  3CHO A;  4RDA A;  5CI9 A;  3B7S A;  2CHZ A;  4IN3 B;  1HH8 A;  1H2U A;  3ZVV A;  4WNG A;  4Y6C A;  4PDX A;  2HR2 A;  3FEX A;  4OIQ F;  4C7O B;  4I6G A;  2NG1 A;  4H4K C;  3K9I A;  4BT9 A;  4UQX A;  5CCM A;  4J32 B;  5DQZ A;  3CZ6 A;  3QKY A;  1JWG A;  3EDT B;  3QAQ A;  3W8H A;  3CHQ A;  3L34 A;  2E87 A;  3IEG A;  2GW1 A;  3CQZ A;  2NXP A;  3AU4 A;  1OWO A;  4HOR A;  4YVQ C;  2V4L A;  1TJF A;  4PFO A;  2R59 A;  4U04 A;  1BR1 A;  1B89 A;  4GZC A;  3P2B A;  2KM4 A;  4JHR A;  5JHA A;  4J8S A;  1SQM A;  3IEE A;  5ANL A;  4U5E E;  3C98 A;  4J8E A;  3RO3 A;  4ILG A;  3R9A B;  3DMD A;  3HDX A;  3JCK C;  2OVF A;  3IHY A;  4N06 A;  4DOZ A;  3PEU B;  4HEA J;  4GZ3 A;  3CVP A;  2D5R B;  4OD4 A;  4I43 A;  3R7Q A;  1FFH A;  5E75 A;  2X38 A;  5KJN A;  4QI2 A;  1ELK A;  4GCO A;  2X6I A;  1N1C A;  1N54 A;  3DJU B;  5LCW J;  3LS0 A;  4G0H A;  4HFK B;  2W4M A;  3TD7 A;  3D9I A;  3LS1 A;  4MRU A;  3R7R A;  3ONL A;  4FUL A;  3SFZ A;  4O6Y A;  1Y6I A;  4DBR A;  1UN8 A;  5CCL A;  3RKO F;  2WVO A;  1TKN A;  3O48 A;  3W8I A;  1TWC A;  2WXG A;  3JCU Q;  3EPV A;  3L0I A;  3NZS A;  4CCA A;  5G55 A;  3CQC B;  4PH4 B;  3EGX A;  4XKC A;  5AJD A;  3KS2 A;  3PUJ A;  2Q9C A;  3EG9 B;  3D9J A;  3DZA A;  2G3K A;  5FTP A;  2XEV A;  3FY4 A;  3JRT A;  3CSK A;  3LY9 A;  1S0P A;  2VYI A;  3PDN A;  4V3I A;  4BTB A;  1MMD A;  4JC8 A;  3B0V C;  4ANX A;  4BSX A;  3UMI A;  2C0M A;  2HV7 A;  4L2L A;  4XZ4 A;  1U3D A;  5FCL A;  4OD5 A;  4G2V A;  1MMN A;  3CEQ A;  4BX8 A;  3RYL A;  2CW0 F;  2ION A;  3OTN A;  3Q6M A;  4U5C E;  1ST6 A;  3EQL F;  4YND A;  4KT6 B;  3FEY A;  3EGD A;  3GZ2 A;  2QY7 A;  4JZY A;  2A69 F;  1HZ4 A;  1VDY A;  2W9Y A;  1SZI A;  3IHV A;  5CHE E;  1ZU4 A;  3Q15 A;  3NDB B;  3FUL A;  1Z63 A;  4FU3 A;  3LCA A;  4P6I C;  4DBQ A;  2XGS A;  4HVB A;  5FQ6 A;  4PJL A;  4A1S A;  4GA1 A;  4AEZ C;  5FZR A;  4MS6 A;  3EG9 A;  3NYM A;  1G8X A;  3ENE A;  2AW6 A;  4C0M A;  5D92 A;  4IYP A;  1MMA A;  1M2O A;  3ASN C;  1E90 A;  1O5H A;  3NKD A;  2WB2 A;  4G23 A;  4DI4 A;  4KBQ A;  4AM9 A;  2W45 A;  3CK7 A;  3PRE A;  4NRH B;  4YJW A;  4I17 A;  3RO2 A;  5B1B C;  4CS9 A;  3T6B A;  4CGW A;  3FTZ A;  4EZJ A;  2IJG X;  5LOZ A;  3ASG A;  3PH0 C;  5EHH A;  5ANR A;  3RRN B;  3I4R B;  5M72 A;  4LCT A;  1H19 A;  3QK0 A;  4N2Q A;  4BTA A;  3SYN A;  3UMV A;  3FU3 A;  4M63 A;  3FUH A;  4FJZ A;  2C2L A;  2WMN A;  4M3O A;  3NQP A;  4MLP A;  3UQ3 A;  4ACK A;  1EF1 C;  4I2Z A;  3RH3 A;  2R7O A;  4BJ6 A;  3JUI A;  3CHS A;  1HF8 A;  4TRQ A;  5KYX A;  4JEU A;  4LLC A;  1HU3 A;  3FFL A;  3CVU A;  2P7V A;  3UGP A;  4FAD A;  1ZHY A;  4K7B A;  2YEV A;  2IU1 A;  3LS8 A;  2FEZ A;  3SP1 A;  1Y8M A;  4JUR I;  4ANW A;  1FFT C;  3GZS A;  3FTS A;  3OEO A;  4JJF A;  1WM5 A;  2PM6 A;  4E85 A;  1VK5 A;  4TV3 A;  2Y4U A;  2YHS A;  4NY3 A;  3NF1 A;  4IUL A;  3G2T A;  1E8W A;  4N5C A;  2I8B A;  4WUY A;  3OA1 A;  3APC A;  4WND A;  2IXN A;  2OVB A;  5T3W A;  5FJY A;  3T4R A;  4I9C A;  3U66 A;  3FUN A;  4ANV A;  3K7D A;  4C0E A;  4G25 A;  4BT8 A;  5FQ8 A;  2I2O A;  2KCK A;  2LAI A;  3LEV A;  5IY5 C;  5DS5 A;  1KT1 A;  3VTX A;  4I2W A;  2Q9B A;  1M57 C;  5T8I A;  2J7P A;  4WAF A;  2JD3 A;  3B0U X;  4EBA G;  2DBA A;  2VSY A;  3VLF A;  2WXQ A;  3ZYM A;  2MOW A;  5FT9 A;  1ZU2 A;  2CG2 A;  3FWV A;  2WXI A;  4CDN A;  4UQY A;  4PS8 A;  2YZS A;  3EH2 A;  4RVB A;  4EWC A;  3GYZ A;  3TAX A;  4LER A;  3FTU A;  4CS7 A;  4NQ0 A;  3Q5M A;  3LY8 A;  3EHM A;  4GZ5 A;  2Z15 A;  3CVV A;  3CVL A;  5CI8 A;  3MKQ B;  3T6J A;  3G2V A;  4JHK A;  3MLG A;  2FFH A;  1TWG A;  4RBN A;  3NZU A;  1KU2 A;  2VB6 A;  1QZ2 A;  3S7D A;  4ZLD A;  3K33 A;  4N3B A;  4PUC A;  2PF4 E;  3QJZ A;  1HXI A;  4ILI A;  2PX0 A;  5D0Q D;  1UW4 B;  3QNK A;  1INZ A;  2R17 C;  3B0P A;  2ZXP A;  3HVE A;  4J6I A;  3MV2 B;  2KQ9 A;  3T5X A;  3VLD A;  2X6F A;  2I1J A;  3PS6 A;  3SGH A;  3ZYL A;  2Y3H A;  1DNP A;  4YVO A;  1H2V C;  1ZHZ A;  4FC8 A;  3RU0 A;  3LLI A;  2AXZ A;  4CRW A;  4FP7 A;  4E6H A;  4BEJ A;  4BJ6 C;  1BPO A;  3RJV A;  2VH3 A;  2J4B A;  4L23 A;  3T8M A;  1LS1 A;  4BJ5 C;  1E7U A;  3BG1 B;  4N3C A;  1FVF A;  3ZFW A;  2AXU A;  5G04 C;  5KYW B;  2VSX E;  3CR3 A;  2J09 A;  4FX5 A;  3RRU A;  4TUU A;  1ZU5 A;  3Q6N A;  1E7V A;  2XXA A;  4CIH A;  3U3W A;  3VYW A;  4KBL A;  3ZSU A;  4BFR A;  3LLK A;  3FDH A;  3D9M A;  3GZ1 A;  5KCM A;  2UWJ G;  1OKK A;  1QNF A;  3U64 A;  4U0S A;  4FHJ A;  3G2U A;  4KVO A;  4E7S A;  3DPD A;  3POV A;  4Q7C A;  4Q94 A;  4YT8 A;  4HE8 D;  2UY1 A;  3ABL C;  2J9U A;  3CST A;  2R7W A;  4JVS A;  4F7A A;  1QLE C;  5G05 C;  3UPV A;  3EFO A;  3GAN A;  3MJW A;  4APO A;  2LAH A;  4B8A A;  1JPL A;  2AWI A;  1SMY F;  4ANJ A;  4I3M A;  4CT0 A;  4DLQ A;  5KYN A;  2J9Q A;  1LVK A;  3ZHE A;  3S29 A;  4APF A;  4H7Y A;  5AJL A;  1V55 C;  4ATG A;  3NG1 A;  3FDQ A;  4JA9 A;  5G04 J;  3CKB A;  4OIP F;  4EPZ A;  2IYL D;  4DVZ A;  3AQC A;  2R7Q A;  2C0L A;  1WAO 1;  3SBS A;  2DCP A;  2DYR C;  3MKR A;  2WXH A;  4O7G A;  2WB7 A;  5DQT A;  4LUN U;  1UJJ A;  2A6E F;  3TG5 A;  1UN9 A;  1JWF A;  2A5U A;  4RG9 A;  1ZHW A;  2IOS A;  2CG3 A;  4GA2 A;  5KYU B;  3LPZ A;  3AG1 C;  1YA0 A;  4FES A;  4GEH A;  3D3M A;  1IZM A;  3S7F A;  2VGY A;  2BE5 F;  3JQ1 A;  5KJK A;  2B0J A;  2L81 A;  4F4B A;  3UUX A;  1E96 B;  4H7X A;  4JPS A;  1JPJ A;  3OAW A;  2ZXW C;  3APF A;  3ZGQ A;  1NA3 A;  2W4B A;  3L17 A;  4JHJ A;  1NU9 C;  2LO6 A;  4ACL A;  1M2V B;  2R7S A;  3S27 A;  3PNT B;  4CDR A;  3LAY A;  2XPY A;  4JW1 A;  2JEK A;  4CSA A;  4NAC A;  4W9R A;  4CEM A;  3L16 A;  5B3S C;  2IOQ A;  2IXP A;  5JJ6 A;  3E4B A;  4GML A;  2WQ7 A;  1J8M F;  1V54 C;  4FJY A;  3TG4 A;  4GYO A;  5F5F A;  3B7R L;  3U9W A;  3SNH A;  3ESL A;  3QWV A;  2KAT A;  5AYW D;  2WXR A;  1SZA A;  3ML9 A;  2QTV A;  5E33 A;  4J30 B;  4UWH A;  1QZX A;  1W2W A;  2XL4 A;  3VLE A;  4A1G A;  3EHN A;  2R7X A;  2UY1 B;  3EIQ C;  4CT4 A;  2R5S A;  2XCB A;  4KZ0 A;  2Y69 C;  1XNF A;  4QDL A;  1D0Z A;  3WG7 C;  1KT0 A;  2OCC C;  3DXJ F;  1E8Y A;  3S7B A;  4JA7 A;  2VTB A;  2J0X A;  4AE4 A;  3FUM A;  4U5D E;  2OG2 A;  2XCC A;  3CKC A;  4KNW A;  3L08 A;  2ZU6 B;  4U07 A;  1OCC C;  4C3E A;  4BY6 A;  3QMK A;  1EYH A;  2XSE A;  4K0D A;  2WXN A;  3MGB A;  3F47 A;  4OIR F;  4RG6 A;  2G3V A;  3ZRH A;  5G05 J;  3ZVR A;  4XI9 A;  3X2Q C;  5A23 A;  1ZHT A;  3VTY A;  3DM9 B;  3AU5 A;  1SF8 A;  2J9W A;  5BUZ A;  1FMW A;  2FUL A;  2XPI A;  4RD9 A;  3QWP A;  5BV1 A;  1N52 A;  3H65 A;  3IKO B;  2PL2 A;  3SZ7 A;  2WXF A;  4NUR A;  3CK8 A;  4WWP A;  3RK6 A;  3QOU A;  5EX0 A;  4I9E A;  3MX3 A;  4JZA A;  4XE0 A;  4A55 A;  1H2T C;  4WJ0 A;  1TWA A;  1XGW A;  1TJC A;  5E76 A;  4I6E A;  4AE4 B;  3DAF A;  1TR2 A;  3Q49 B;  3AG4 C;  3F46 A;  2HYZ A;  2I1K A;  1OCO C;  1NG1 A;  1WGW A;  4FLB A;  2J08 A;  4LEU A;  2WQH A;  3CIA A;  4HXI A;  4PFP A;  1NZN A;  3WXX A;  4AY6 A;  4GZ6 A;  1U3C A;  3FUE A;  4XI0 A;  4G7H F;  2WL8 A;  2X51 A;  3CVY A;  1HX8 A;  3NYL A;  4EZL A;  1HG5 A;  4KMO A;  4WWN A;  4I6J A;  2IOL A;  3PVL A;  2VQ2 A;  3JQ0 A;  5FWQ A;  2V3C C;  3RIP A;  2Y4T A;  2CDQ A;  3EZI A;  3UT7 A;  4U8H A;  4GYW A;  5T3R A;  1D1B A;  3S28 A;  3ASD A;  2GGF A;  1SZ9 A;  2WZG A;  5ARG A;  3SF4 A;  4AP2 A;  2PX3 A;  3QAR A;  3ZW3 A;  4WNE A;  5ENN A;  3RFY A;  3B7T A;  4J0U A;  3OWT A;  1OCR C;  3BEE A;  4GMJ A;  4R7L A;  5DS4 A;  2CNW D;  3FUD A;  3FHD A;  3AG3 C;  2FF4 A;  4FWV A;  3TJP A;  2LSE A;  3LJB A;  3MEK A;  4BJ1 A;  3OXG A;  2KNH A;  3JYH A;  4ME2 A;  4CS9 C;  3D9K A;  2E2E A;  2LSU A;  1D0Y A;  4DLO A;  4BJT A;  2X6K A;  4O79 A;  3CVX A;  1MND A;  4C3D A;  3DD7 A;  3AS5 A;  4QI0 A;  4PK4 A;  1PAQ A;  4K03 A;  2Q7F A;  4GCN A;  2H7B A;  4GA0 A;  2L9J A;  3KEZ A;  4G1T A;  5FQ4 A;  2IXM A;  5BW8 C;  4AVX A;  5BNW A;  4U0U A;  1OWN A;  4J8F A;  2WMO A;  1PCX A;  4B94 A;  5HQ8 A;  1NZE A;  1Z3X A;  5FQ7 A;  3ESK A;  2PQR A;  3Q47 B;  1HO8 A;  4BG0 A;  3CLJ A;  2J4D A;  4IRU A;  3FTY A;  3UMH A;  5B1A C;  3QZC A;  2WXM A;  4GZD A;  5EDS A;  4IJJ A;  2VGX B;  1KLX A;  5KYY B;  2DIW A;  2WXO A;  3ZPJ A;  1Z6A A;  4HS2 A;  4AOF A;  2PQN A;  3QB2 A;  3NRH A;  4L7T A;  1O87 A;  4HLE A;  2VSN A;  4EEC A;  1H6K A;  1QQE A;  2YIN A;  3ASF A;  1Z23 A;  3LY7 A;  4O6N A;  5J08 A;  2PP4 A;  1H0A A;  5E3A A;  3LVQ E;  2Q9A A;  4BWR A;  2DGJ A;  3LKU A;  2EIN C;  4JEH A;  2CFU A;  4UWF A;  3V7O A;  2WXL A;  2HM8 A;  3TXN A;  3G2S A;  3S7J A;  3N0T A;  2OOE A;  3ZYQ A;  4YT5 A;  2BF0 X;  4AV7 A;  4LAC B;  1RJ9 B;  4D10 C;  1HFA A;  5C2Y A;  4GU5 A;  3TXM A;  3UR3 C;  2L9B A;  5T1D B;  5KYW A;  3LVR E;  3AQB A;  5KYY A;  4GB9 A;  3LES A;  5DIZ A;  1VYI A;  2R7U A;  3E9V A;  3LDZ A;  3MKQ A;  1FTS A;  3PRZ A;  1E8X A;  2G62 A;  3CVW A;  4A3V A;  2X6H A;  3B7U X;  4DJA A;  4XTK A;  3HTK C;  3SI5 A;  3HJC A;  4MND A;  4XX5 A;  4B6I A;  3CV0 A;  1L5J A;  4Q69 A;  4I1A A;  3W2V A;  3E70 C;  3JT1 A;  2VGX A;  2WPV A;  4YT4 A;  3SZR A;  3W2W A;  3FAJ A;  4JXT A;  1FMV A;  1VOM A;  3K66 A;  4ILH B;  2CHX A;  2WXJ A;  3MYV A;  1ZHX A;  3EZH A;  2WXP A;  2BTD A;  3FP3 A;  4F3V A;  3ZIM A;  3ONK A;  4C7O A;  4OVV A;  4UI9 K;  3KKB A;  2LSV A;  4PJM A;  2V26 A;  3IBE A;  2VSO E;  1D1A A;  2X3M A;  2EIM C;  4CS8 C;  2IXO A;  5L3Q A;  4U5F E;  1OWL A;  4OYS A;  2KGO A;  4HFF B;  3CK9 A;  4CS8 A;  4UQZ A;  4URK A;  3FUI A;  3HYM B;  3FTV A;  1Z6T A;  2X6J A;  2FBN A;  3CHR A;  2J0W A;  2CFZ A;  5JHB A;  2L6J A;  1D0X A;  4KXK B;  4EQF A;  3Q7G A;  3KL4 A;  4HOS A;  3OXL A;  2PM7 A;  3BG0 B;  3D9N A;  3HVE B;  2EIJ C;  4AIF A;  3ZYK A;  5LFA A;  3MV3 B;  5CMW A;  3D9L A;  3JSZ A;  4AY5 A;  3ITF A;  4QFV A;  2J7P D;  4AXH A;  2MRI A;  3ZN3 A;  4LRZ A;  1A17 A;  3CHM A;  3K6B A;  4MQ9 F;  4W8K A;  2V5F A;  2IQC A;  5A6C A;  1BR2 A;  3DJN B;  2MYS A;  3DAG A;  2Y3B A;  1IYG A;  4N3A A;  3TL5 A;  2FO7 A;  2A4Z A;  1UJK A;  3Q7L A;  3G2W A;  3KMI A;  2YQ8 A;  5BV0 A;  1Z3Y A;  2A68 F;  4Y6W A;  3FH5 A;  4X0R A;  3FU0 A;  5KYU A;  4Q5S F;  1PC2 A;  2GRL A;  3FVY A;  4AJW A;  3O4Z A;  4N2S A;  2WVN A;  5LCW C;  2EQX A;  3EGD B;  1M2V A;  3O39 A;  5L3V A;  3UX4 A;  3PE4 A;  3PMR A;  3QC1 A;  4FA6 A;  4DK5 A;  4Q96 A;  2P58 C;  5EGY A;  4WWO A;  4JCH A;  2MWQ A;  4U5G A;  4E7Z A;  2CNW A;  3CVQ A;  3UNG C;  3DM5 A;  4MKT A;  1OKK D;  3P1U A;  2WZF A;  3EH1 A;  3ZIB A;  2CHW A;  2A6H F;  2O9X A;  2KZT A;  3ZXS A;  3FTW A;  4DVY P;  2KCV A;  4UWG A;  2DYS C;  5EKQ D;  5E2Q A;  3UT4 A;  4J8D A;  5DVW A;  3PUK A;  3O6X A;  4YWQ A;  1ELR A;  2KJG A;  4GYT A;  1HE8 A;  1OUV A;  4AX2 A;  4A3T A;  4G7Z F;  4XLP F;  1NP7 A;  2HO1 A;  5HI7 A;  1Z3I X;  3EIJ A;  5T3T A;  4UWK A;  1MQS A;  2Y39 A;  1OCZ C;  3WOD F;  4G7O F;  1P5Q A;  3I4G A;  2WXK A;  3KH2 A;  3ZEF A;  4O6F A;  2M4E A;  4P29 A;  2XRZ A;  4U5B E;  4ANU A;  1Z5Z A;  2H7V C;  2NUP B;  2CGE A;  3L13 A;  2ZXR A;  3SHF A;  3PHF 2;  3CSF A;  3LNR A;  4I1O B;  4JJG A;  4CDM A;  4ULW A;  5A7D B;  2WVQ A;  3T5V A;  3B13 A;  5JJT A;  2VTB B;  2NC9 A;  5HSW A;  4XWJ A;  5BUO A;  2M63 A;  5C1D A;  4PS7 A;  4XIF A;  1EPU A;  2XXA B;  4UWL A;  2I9C A;  1TWH A;  4BJ5 A;  2XGM A;  2FI7 A;  4IWB A;  4GPK A;  3HIZ A;  4F1S A;  4EZK A;  4I44 A;  3MCX A;  1WY6 A;  1OWM A;  2WVI A;  2R7V A;  2Y3A A;  5AEN A;  1DVP A;  4RSY A;  3CHP A;  4WNF A;  2NUT A;  2JLB A;  3SBT B;  2NUP A;  5KYX B;  4B8C B;  2KC7 A;  4N39 A;  3ZC4 A;  2EIL C;  3VAY A;  3ABK C;  3FU5 A;  2BUG A;  1ZBP A;  1OWP A;  1GW6 A;  3AS4 A;  1IW7 F;  1JUQ A;  3FUF A;  2EIK C;  5DLJ A;  1NA0 A;  5D0O D;  3GOD A;  3UT8 A;  3SEO A;  3MA5 A;  2OND A;  3HHM A;  2YHC A;  1MNE A;  3ABM C;  4CSA C;  3L6A A;  1D1C A;  4GAA A;  2XRH A;  1PD1 A;  3S0X A;  2XPZ A;  1X5B A;  4XLN F;  2KZT B;  5CMY A;  4PS3 A;  2HV6 A;  3UGO A;  4K0R A;  5F5H A;  3PNL B;  2C04 A;  3FTX A;  4CGV A;  3URZ A;  4HOT A;  2E0I A;  2NUT B;  1FVH A;  3K1H A;  2H7O A;  2GRM A;  4U0Z A;  4OIN F;  4B89 A;  2LNI A;  1ELW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...