3EHMA

Structure of bt1043
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
510
structure length
510
Chain Sequence
PLKYGARFMNMQQRVIPIGSPSLTTGPGNDLQNTDLISSGNYIGYFGNNNNWGFNNEANWNFTDSRMNYAYQNFYSQIFLPWNEIYEIAKDSDSPSEQAILEIANIVRNIAWLRATDVFGPIAYNSAGDGSIAPKFDSQEVVYRSMLADLSKSVELLNTISYSVMAQYDLIYNGNVQNWVKLANSLMLRIVVRVHFIDETLAKEYITKALDPKNGGVIEDISSEAKIKSSDKMPLLNSMLASVNEYNETRMGATIWGYLDGYKDPRLSAYFTEGTYGSGSWAQTGYFPVAPTNSKSKSETSYSAKFASRPKVDSNSPLYWFRASETYFLKAEAALYNLIGGDPKTFYEQGINISFQEQGVSGVATYLSGTGKPTGLTGSNYKYGTYNHDLSIGNTSPKWDDYTGNLSKQEEQLQKIITQKYLALYPNAVEAWTEYRRTGFPYLMKPMDEAAPGRIGASIEDCRVPERFRFAPTAYNSNPNMAEIPTLLGGGDIGATKLWWVRSNRPKQPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SusD homolog
publication title Structure of a SusD homologue, BT1043, involved in mucin O-glycan utilization in a prominent human gut symbiont.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
total genus 180
structure length 510
sequence length 510
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12741 SusD-like Susd and RagB outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ehmA03
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ehmA01
3FDHA 5J90A 3CK9A 3CK8A 3HDXA 3MX3A 3JYSA 3OTNA 3CK7A 5E76A 5FQ8A 4F53A 3CKCA 3P1UA 3KEZA 3EJNA 3GZSA 3I4GA 3MYVA 3JQ0A 3MCXA 3EHMA 3CGHA 3IV0A 4PUCA 4F7AA 5E75A 4L7TA 3JQ1A 3CKBA 5T3RA 3QNKA 3SGHA 3NQPA 3L22A 5FQ4A 4MRUA 3SNXA 5FQ6A 5FQ7A 3LEWA 4LERA 5T4YA 3EHNA 4Q69A 5LX8A
chains in the Genus database with same CATH superfamily
2L6GA 4GZDA 1V55C 3D9HA 4OIPF 3SO8A 3B7SA 1RCPA 4GYWA 3U3BA 3DJUB 4GYTA 3AOUA 3E30A 1OWLA 3ULEG 3CHOA 1RJ9B 4KNVA 3U9MA 4Z9JA 4B8CB 4BETA 3NYJA 5FZTA 1N4PA 2L6BA 2DYRE 3AU4A 4P9FA 4IYPA 1TJFA 4NIKA 3LVQE 3ZU7B 3SHFA 2WB2A 4DVZA 4HLEA 2XM0A 4H4KC 4UWKA 2WXKA 3J5PA 3FUKA 4HORA 4KT6B 1SR2A 1ZHTA 2LO6A 3JUEA 2F0YA 4U9DA 5AENA 1H0AA 2MWQA 1M56C 1Z5ZA 4WNEA 2AVPA 2Y3GA 2KCLA 4L23A 3HXEA 2LIGA 3ISMC 1WATA 2HV6A 1ZZPA 4CDMA 2HJ3A 2NYJA 1PAQA 4WGZA 3LY8A 4NRHB 3UX4A 3D9IA 1Q0MA 3FUIA 3TL5A 2R7WA 1XNFA 4BG0A 2WXOA 4JZAA 3UGPA 3PHF2 1LS4A 3U4TA 2EILE 2VSXE 3G2VA 4XX5A 2QUPA 1JWFA 4Q96A 1NFIE 2EPLX 4ANUA 3RQFA 1VDYA 2YWAA 3IQ5A 1JCSA 1MJ0A 3PS6A 2DGJA 4HXIA 2WXQA 2I15A 4FP7A 3Q6MA 1N4RA 1YYHA 3I3NA 1AWCB 2RFAA 3CK8A 3VAYA 4G24A 3L08A 5L3VA 3RO3A 2G3KA 4PUCA 3TXMA 2VH3A 2J08A 5KJNA 3OXGA 1IXVA 5KJLA 4PS8A 1X5BA 3NMKA 1ZVZA 2OU6A 2GRQB 5LCWJ 2YINA 5ENOD 2A69F 3PUKA 5BUZA 3B7UX 4QI0A 3SXYA 4OIRF 2GRPB 2IONA 5CCMA 1PD1A 1TNUA 2OKUA 3R9MA 1D0YA 3FAJA 1ZB1A 1JPJA 4PJNA 4PJLA 4EZLA 1E7VA 3T6GB 1NBBA 2Q9CA 2XGSA 256BA 3TJ6A 1DOWA 3U8PA 3NMJA 4CIPA 2J8WA 3ZPJA 2QTVA 3DD7A 4BSZB 3SXZA 5B3SE 3O48A 2CCYA 2KZTA 2J07A 3L17A 4D10C 2L9JA 2JLBA 3HG0D 3UM1A 4K03A 2X6KA 3OWTA 1O3UA 1KT1A 5L0DA 2PNNA 5COGA 3FULA 1JUQA 2YQ8A 5COMA 3TG4A 2YLDA 1ORYA 5LOZA 3AG1C 3UGOA 4JKVA 3ZN3A 1GM5A 3JQ1A 5AIJA 1TJCA 1LF8A 1D8EA 1A0BA 1B89A 1NSGB 2YEVA 5BQHA 2C2LA 2G3VA 2MRIA 1JRAA 4UUCA 1MMGA 1Q0KA 4L6RA 4CRWA 3HNJA 2HR2A 4N06A 4H54A 3D9OA 3EFOB 4XEKA 5KYXA 4GMRA 5CI8A 4O6NA 3SBTB 4HS2A 5EKQD 4YL1A 2EPKX 2R03A 4BJ6C 1F1MA 5FINA 1IHGA 1CGNA 4JTAB 3TGOA 2NUPB 5JJ6A 3W4YA 5L0IA 3L13A 2Y69C 3AQBA 1TNOA 1I5NA 1QBQA 3N71A 2YQYA 1AEPA 4GAAA 1WASA 4EHMA 4DX2A 1HMDA 4UQYA 4LDRA 2JD3A 1MMNA 4O6FA 5B1AE 1BI7B 3ZVVA 2I9CA 2OQMA 4MVMA 1WGWA 4JHRA 3C7JA 1JWGA 1WTYA 5F5FA 3TOMA 5L0FA 3C18A 4UI9J 4IJJA 1YLMA 3WG7C 2WVQA 3NG1A 3CSKA 2HE0A 3RRMB 2Q3TA 1CGOA 2AWYA 4I3MA 4EQFA 3TK0A 2A5UA 2P9SG 1UN8A 2MHKA 4G7ZF 3RH3A 1LKXA 1IKND 4U04A 4I2WA 2R7UA 3ASHA 3FUHA 2A6EF 1VTMP 2ETAA 3PUJA 3K6BA 4K1OA 3GEEA 2L7AA 4IB4A 2OVBA 2M4EA 4H7YA 5LCWC 3CKCA 4MLPA 3CVNA 3CHSA 5JHAA 5KYUB 3I4GA 1JPNA 4B89A 4TUUA 3DSSA 3SFZA 3SP1A 3BG0B 4LLCA 1SW6A 4E7SA 2F8XK 3UMKA 2HMQA 3HYMB 3MGBA 3N0TA 4B93B 2BF0X 3Q73A 5A6AA 5J90A 2A4ZA 1BR1A 2FF4A 3C63A 3LJBA 5CBNA 4GZCA 3ZYKA 2HUJA 1H9GA 1G8XA 3H65A 3V5YA 4HFKB 4PFOA 5CMYA 3CZ6A 2LCHA 1N9AA 4JZYA 3AS8A 4XZ4A 3R9AB 5BV0A 4WNFA 4N6CA 2J4DA 2J7PD 2PBEA 3FUNA 1NFOA 4U5EE 3FUEA 3EH1A 3T5VA 3O55A 3TJ5A 2WXNA 4GTVA 1H19A 1AVOB 3H2VA 5E75A 4N2QA 3LDZA 3F6QA 1E8WA 2WXGA 1XWJA 3ZXSA 3B95A 4ILGA 3M4BA 1M57C 4GA1A 3LYAA 3EZIA 5D92A 1FVFA 4UQXA 3TAXA 3E34A 3MYIA 1H2VC 1H9TA 1UJJA 4DRJB 2B0HA 2XLEA 2IEJA 2ZGDA 3CVLA 2XCBA 3ONKA 3ZYLA 4XLPF 4DLOA 3S9OA 2IF4A 5KYWA 3EQLF 3RKOF 1KLXA 3V2XA 1FAPB 1UW4B 4O1OA 3GM1A 4OVVA 4J0UA 1LPEA 1QVXA 1UG3A 4YDWA 2Q9AA 1AP7A 4YT4A 4UI9C 4G0HA 2IBFA 4JW1A 4CCAA 2DYRC 4ABNA 1EA8A 4J7TA 2W9YA 3PH0C 4I43A 2KW3C 3RF3A 1OW6A 3EHMA 3CGHA 4B6IA 4EBKA 1S0PA 2J46A 2R7TA 3EUVA 2WQHA 1VB5A 4E7ZA 1ZHWA 2O9XA 4DRIB 2XS1A 2XLDA 5KNHD 4UI9K 3PZ4A 2R7QA 2LUHA 2I2OA 2QNLA 4N2SA 4GZ6A 3B9QA 3JYSA 5E76A 4JEUA 2R02A 3AGUA 2WXLA 1QNFA 3U66A 3GYZA 1OWNA 1ST6A 2GRMA 3OA1A 4HI9A 3ULYA 1J8MF 1C03A 1JMWA 4L7TA 3RO2A 2LSVA 1TFKB 4XQ1A 4HFFB 4XPWA 4NACA 1WN0A 5CEAA 1Q0DA 2V4LA 3RIPA 1ELWA 3Q4AB 4Z68A 5D0OD 2WPVA 3POVA 2EILC 3JSZA 2MYSA 2PF4E 3U9JA 4I44A 1EKYA 4L2LA 4N5QA 4AIFA 3U2MA 1HE9A 4P9TA 1EYHA 1UOHA 4XE0A 1HU3A 3CEQA 3JSEO 1FTSA 1T9KA 2V26A 1D1AA 2XQ0A 3VRCA 2GA0A 2V5QC 2XXAA 5CHEE 2KQ9A 4U5DE 5J08A 1KPSB 1M6TA 3O6XA 2G62A 4CDNA 2WVNA 4GEHA 1MQSA 3QJZA 1MYOA 4LERA 3S28A 4Q94A 2A0UA 3W2WA 4FLBA 3D9LA 4BT8A 4DX7D 1TQGA 1BZ4A 3RSEG 3EPVA 3PZ1A 4MS2A 5EHHA 1H6PA 2CHWA 5EDSA 1ZHZA 1I4ZA 3QB2A 1YVIA 4MS6A 5A6KA 4WABA 3KSQA 4CSAA 1A7DA 3FU5A 3O39A 3GORA 4NCQA 1FR0A 3VTYA 2NPUA 1IQRA 1E96B 4CEMA 4JHJA 2V8SE 4KNWA 2H8AA 3S90A 5C2YA 3OTNA 2EQXA 3HXDA 1SYQA 3KEZA 2P6VA 1FFHA 1OXBA 3DSVA 2V4HC 3G2UA 4C3DA 1FCHA 2J49A 2D5RB 3CAXA 4C3EA 2M64A 3UQ3A 2Y1LE 3V30A 1BI8B 2YLGA 3FH5A 3Q75A 3FTSA 1NLXA 2IO3C 5JSLA 3ULQA 4ATGA 2WXPA 2AVKA 4I9EA 4PDXA 1GGQA 4A63B 1OUVA 5A6BA 1JCRA 2PM7A 4FJYA 2PZIA 1JAFA 2NC9A 1SA5A 3UMHA 2VGXB 1INZA 1DNPA 4I9CA 1WDYA 4X8QA 2XS8A 3QTHA 3NQPA 4DI3A 2LQGA 4IARA 3O10A 4K7BA 3WODF 1NU7D 3SZ7A 5CERB 2YZSA 2XRHA 1U6HA 3CVVA 3S27A 1QPUA 4AJWA 3N2ZB 1MNEA 2IXNA 4Q4ZF 3D3MA 1QLEC 2R7VA 1Z6TA 5B1AC 5HRYA 4GYYA 2XPYA 2KGOA 1TN6A 3R7RA 4DK5A 4QFVA 2LP4A 3N24A 1KZOA 4JE9A 4MNDA 3JXIA 2X6FA 3UKUG 3ASFA 3T9OA 2XL4A 3P1UA 3TJPA 1FMVA 3S7JA 3HJCA 3B7RL 1HO8A 2B0JA 4L2YA 1YJGA 1OCRE 4OAVB 4LACB 2I1KA 3QNKA 5E2QA 3CHRA 2ASRA 4J6IA 3SGHA 4BTAA 4B94A 3SXKA 3DE8A 3X2QE 1H7IA 3T6BA 4BFRA 2XM4A 4URKA 2IM8A 4DX6D 3E32A 3DPYA 3V7OA 2VTBA 3RQEA 4KVOA 4E18A 2E87A 4AY6A 4BJ5C 3A11A 3VM6A 1BR4A 2EIKE 2BC5A 4APFA 1XZPA 3T8MA 5DS5A 1SZAA 3IV0A 2P9UG 2OCCE 3FU6A 5FZQA 4C7OB 5HV9A 2JEKA 4ULWA 1Z3YA 2GFHA 2ETSA 4DLQA 5C1DA 2V5FA 4OVUA 2AXZA 5BQIA 3ZHEB 2WQ6A 2CG2A 2J8SD 2KSFA 3PMRA 3ZVRA 1P5QA 2NUTB 5BNWA 2AXUA 2WQ7A 2YHEA 3CV0A 4GMJA 1G4WR 4U7EB 3HNLA 3U9WA 5CEDB 5GPGB 4U07A 5EX0A 3KEAA 3ZIBA 1O87A 3W8HA 2NG1A 3B7TA 3HKKA 3V79K 1HMOA 1VLTA 2KM4A 2OJQA 3HHMA 3Q7LA 2J7PA 5AN8A 4J30B 3LVRE 3ZYQA 4ME2A 4M7CA 5G04J 2A6HF 2VYIA 4XI9A 4HOUA 3LESA 4JEAA 1Y6IA 1ZU2A 4J8EA 4NY3A 4CDYA 4GQHA 5E3CA 4KZ0A 3IEEA 1GS9A 2P0NA 4EBJA 3SD5A 2LFFA 1E8YA 3FUJA 1T5OA 2OJED 3TOLA 2H6GA 2VGYA 2BUGA 2WXIA 3DM9B 3MEKA 4FU3A 4YJWA 4WNGA 1OW8A 3F46A 1GW6A 1KU2A 2YRFA 3AJIA 3TG5A 3JYYA 3ZQVA 3TQOA 3NF1A 1N94A 3Q79A 3QARA 1PY1A 2X38A 5CRVA 1C02A 2VSOE 1RKCA 4XEIG 2P61A 3RAUA 2WXHA 4WWOA 3K7DA 3U5SA 4BEJA 4AL0A 3M79A 2AP3A 4XEFA 1GQAA 1TR2A 4EUKB 3ZSUA 4IAOA 2WL8A 4P6IC 3PDNA 2XLWA 3PEVB 4PH4B 3CIAA 3K33A 4ACLA 3EZHA 2HMZA 4AP2A 2HYZA 4UWFA 4G78A 1APCA 1LM3B 4MVQA 1MX2A 3NOGD 3C8GD 4ZLCA 5EX3A 4RLYA 1KTMA 1OWOA 5KNGA 5IY5C 4M3OA 3B13A 2VCCA 5G55A 4NTAA 3LNMB 3U0CA 1TFOB 3BUAA 3UTMA 3FHEA 1MNDA 3IQCA 1MQVA 5JP7A 4NTBA 4U5GA 1CGME 3PEUB 4RQIA 5FJYA 5EYLA 2YHSA 4LEUA 4KVMA 3TWUA 3ONLA 4JXTA 1BPOA 1D1CA 1OCZE 4WAFA 2RFMA 3PE3A 1OXKA 2JABA 4G1TA 5D0QD 2OVFA 3E37A 4G11A 4AE4A 3S0XA 1OY3D 4NQ0A 2ZXOA 2AJAA 4ATZD 3ZTMA 5DS6A 1H6OA 2VSYA 3JXJA 2KK1A 2OOEA 2J9WA 3C3QA 1G4US 3S2AA 4UDVA 1N0RA 1V54E 4GPMA 2P58C 2KC3A 3FEXA 3QK0A 1WY6A 4TXRA 3UNGC 2P9LG 4WWPA 2GRNB 2YL7A 3O4ZA 3ZNGA 4EBAG 4JCHA 1YZCA 1Q0GA 5AQAA 3FUFA 1U3DA 1XZQA 4JTDB 4DRHB 4DRXE 3D9JA 5A6BD 3SI5A 3DI5A 5G04C 2C04A 3ASNE 2IXPA 1BU9A 2XPIA 1K1BA 2E2EA 4A3TA 4LNBA 1BDJB 3GEHA 3FFLA 4J8SA 5D66A 4JB8P 3K1IC 4KI2A 4X0RA 4XTKA 2XPZA 3DSXA 2HJMA 2NSZA 3MX3A 4YDEA 4KYOB 2WVIA 4C9BB 4CT0A 2FO1E 4PJMA 2XEVA 2WMOA 3B0UX 4KMOA 3PZDA 2FI7A 1RZ4A 5CCLA 4WGYA 3KSLA 2UUHA 3ASOE 5FWQA 3AG4C 5A7DB 4XKCA 4U5HA 2XENA 3PE4A 2IY0C 5ITZF 5KWDA 1HW2A 5A6CA 4K5AB 5D91A 2EIME 3M15A 3Q78A 3G4ZA 3A9CA 3AQCA 2MHRA 4P29A 2XSEA 2DBAA 4NQFA 1N0QA 3PNLB 2EPOA 4I1MA 2TMVP 2IJGX 2R2LA 2R9RB 1JOGA 4DBRA 5BV1A 2UWJG 5HI7A 1RKEA 3TULA 1SF8A 4JIOA 3V5XA 1S7ZA 4PS3A 3G4XA 3KYJA 2ICWG 2IOLA 4AV7A 3ABME 4JL0A 2GRRB 3QC1A 3D9KA 5JHBA 3DRAA 3K9IA 5FQ8A 1TWHA 1RXQA 3CHPA 3NYMA 3ZTZA 1S05A 2YVKA 4G8KA 1BD8A 4MVSA 1LI5A 4DI4A 4CJOA 3NZUA 4ANJA 5F28E 1N95A 1ZHYA 2JPUA 2WXMA 2EIJE 2WXJA 2DB4A 2UUIA 1E84A 2DYSE 2KATA 1EQ1A 1ZHXA 2J9UA 4ILIA 3RFYA 4V3IA 4XEVA 1UJKA 5BPPA 2HO1A 1O1TA 1KNYA 3MV2B 4A55A 4RVBA 1IHBA 3SFYA 4FC8A 3GM3A 3QVYA 3MCXA 2HSBA 4TRQA 1O1RA 3NAWA 5EIDA 4ILHB 3S7FA 2PM6A 4OYSA 3EH2A 5KCMA 2F37A 1Y8MA 1Z7Qc 5DQTA 4BSXA 4PR9A 1DCEA 2FEZA 3TWWA 4XPYA 5DS4A 4MVZA 3RRUA 1NU9C 5KYXB 2R5SA 3PZ3A 3UMIA 3FTZA 1OCRC 4GYOA 5BXUA 3Q7GA 1ZU4A 2J9QA 2CW0F 4PS7A 2VSNA 1D0XA 1O1SA 1OR2A 5JUAA 4DJ9A 2XZDG 3X2QC 1NL4A 3LPZA 4U8HA 3ABLE 4FJZA 1L3PA 2P9NG 3DXKG 2VC9A 4OIQF 3CVYA 4OD5A 5EIBE 3DEPA 4GTOA 3FOOA 1I4YA 4HRMB 2DZNA 5KJKA 5HSWA 3CQGB 1M2VA 2XL6A 2OCCC 2LSEA 2WM9A 1IZMA 3WAQA 3IXEA 4YL0A 3CLJA 2J9BA 3UR3C 2DWZA 3ZGQA 4CS8C 1U3CA 3LXUX 2BTDA 5T8IA 2CNWA 4EBBA 3ASGA 2WMNA 3DMDA 1Z23A 4D4XA 3AG3E 1HE8A 4CT4A 3MV3B 2AXVA 3PRZA 2R7RA 1ZW2A 4MBGA 4DJAA 4DPRA 4A1GA 3IKOB 5DBKA 4FULA 2V3CC 2P9PG 3BG1B 1NFNA 4HRLA 1E2XA 3HXCA 3PDMP 5EILA 4A1SA 4XWJA 1E86A 5DVWA 4BJ1A 2ZIRA 3JYHA 2WZFA 2WZGA 5BW8C 4A3VA 2Q4FA 2OEWA 3G50A 4EWCA 1E8XA 3CVUA 4U63A 4BEPA 3ZYMA 2ONDA 2Y3BA 2VASA 2L0IA 3ESKA 5A69A 1ELKA 4ULVA 3CKBA 4N3CA 5K0IA 1MZCA 3KH2A 2PQRA 1A7EA 4GTRA 4N39A 2ZU6B 4JA7A 4HRNA 5CECB 4JJFA 2PX0A 3EHNA 5G2NA 2P1AA 4BX9A 4Z9HA 4R7LA 4ANVA 5HQ8A 3NOCD 4EBAA 3LEVA 1TNZA 5E3AA 2L81A 4CDAA 4O1PA 3IPMO 5JJ7A 3OAWA 3CVXA 4E0HA 1C17M 4KZCA 3JRTA 5DIZA 2PQNA 3EG9B 1DVPA 3C8ZA 1LIHA 1N52A 4BERA 1YDIA 2X6JA 2LK4A 3QDNA 3RK6A 2QY7A 3CSTA 4G23A 2Q00A 2ETCA 5B1BE 3R7CA 2H7OA 4FHJA 3EGDA 3HIZA 4FX5A 1D1BA 1K1AA 3MKQA 2B6CA 1OWMA 2ILRA 3MYVA 4Y6WA 3DZAA 5JMND 3GWLA 4N5CA 1NI1A 1WM5A 1YA0A 4XPXA 4UWHA 3OXFA 1LVKA 4O79A 1OCOE 3IHYA 4ER9A 2Q7RA 1AUEA 1H2TC 3ZEFA 3L8IA 2XLMA 4I6JA 3EIQC 3Q5MA 3C8GA 3S7DA 4BJ6A 2OG2A 2ZXWE 3S7BA 1LI7A 4A4AA 2LAHA 3ASDA 1OWPA 2P7VA 1KT0A 3HLZA 1OCZC 1Z5SC 5ENPD 1YAUO 1O5MA 2UY1A 4KBLA 4O7GA 4R32A 2R17C 4YVOA 3FUDA 4WNDA 3SNHA 3ZW3A 2H7VC 3B0VC 1G5ZA 5KYYB 2Y3DA 4QQIA 3ESLA 4CGVA 5AGFA 5BQGA 3Q7AA 4O60A 5B3SC 2XRZA 1ZBPA 5T3TA 2X51A 4MVRA 1V54C 3G2TA 2ZXPA 3QW0A 2FAPB 1LD8A 3JQ0A 3NDBB 3QW1A 1FMWA 4E17A 3FTWA 2LNIA 4IAQA 1UFBA 1K3ZD 3UIPC 5CBOA 2RD9A 3US6A 4JURI 3PCVA 5FT9A 3UIOC 4J8DA 4YN0B 3HRAA 5BUOA 4CS7A 3ASNC 3DXJF 5L0JA 4MQ9F 5LX8A 3CQCB 3HVEA 5LFAA 3KYIA 2BEDA 3GM2A 3TWTA 1TKNA 4NURA 3PREA 4G26A 4AEZC 1NG1A 5KJMA 3CQZA 3JCUQ 3NKEA 4AM9A 3ML9A 1H6GA 4CDRA 2HZ8A 3W8IA 1IW7F 3TWXA 3C72A 5DQZA 2L9BA 1T01A 3SY2A 3UM0A 4AVXA 4MTOA 2DIWA 2RKKA 3KL4A 3HXFA 3F47A 1HY5A 3QWWA 3ASOC 5COFA 2J09A 1O5HA 5AARA 2GWWA 2R25A 4J7YA 2R7XA 4JTCB 5AQ7A 3T4RA 2R59A 1D0ZA 3SFXA 3TWRA 1U0BB 2EIMC 2KJGA 4HI8A 4GMLA 2GGFA 2CDQA 3NZSA 4MTFA 2EINE 4Q7CA 4JEHA 1Y4CA 1RJ9A 4BEMJ 2IXOA 3ABKE 2YNQA 5TJ5E 1BLXB 3U64A 3Q9NC 1WOLA 3AS5A 2RD0A 5EK0A 4W8KA 1N54A 2MOWA 4GB9A 3ABMC 5H7PA 2HV7A 2OOCA 4ANWA 3EU5A 4O6MA 2M63A 3M1CB 4JCZA 4NC3A 3B0PA 5CIVA 4MRUA 1K40A 3ITFA 4N3AA 3GODA 3ZDLA 3T5XA 4ONSA 4CS9C 4G7HF 4G7OF 2YLIA 4I2ZA 5ANRA 4ZFHA 3FHDA 1RW2A 1TWCA 4QDLA 3FVYA 5A23A 2EIJC 1HW1A 3V5ZA 1E8ZA 2DYSC 3DM5A 2FULA 5JA4D 2QZAA 4YWQA 3JRMO 2HFIA 1G3NB 5FTPA 4K5BA 2CNWD 5AC4A 4ACKA 4JC7A 3FTYA 3ZXPA 3DEOA 1OQCA 3FAPB 4EZJA 2QFCA 3T6JA 3TWSA 1DC2A 3Q7FA 1IYGA 2A5EA 5ENTD 1L7CA 1MMAA 3AJMA 5A6JA 2QYJA 4GTPA 4IULA 4XLNF 1N1CA 1M2OA 4J7WA 1HS6A 4AK9A 3S29A 4ZLDA 5DLJA 1BBHA 4M63A 1HXIA 2LAIA 3BEHA 3ZQYA 3LUTB 2Q7FA 3KAEA 4B0ZA 2A68F 3NB2A 3L34A 2P9IG 3AAAC 1HG2A 3ABLC 2P2CP 1S63A 3CVQA 2D4UA 3EGXB 1HZ4A 4U95D 4TXQA 4UQZA 2I8BA 1SZ9A 3CHMA 1UN9A 4U0ZA 4I6EA 1CPQA 3C3OA 1JR8A 4EHPA 3KMIA 3ECSA 3QZCA 3ENEA 3I5QA 3UUXA 3UINC 4YNDA 2DZOA 2AWCA 4DX1A 1V4AA 4YT2A 3KPHA 3V31A 3NRHA 2W4BA 2CHZA 3MZLB 3CHQA 1V74B 3Q15A 3ATPA 3FEYA 4C3BA 1Q0FA 2C0MA 3AG3C 4KBQA 3EHRA 4C48B 3D9MA 1MX4A 4GTTA 2H7BA 2KCVA 2XLHA 4K0RA 4LG6A 4HVBA 2Y4UA 4IN3B 4CGWA 5ARFA 1OXJA 2LD6A 3BQOA 5G05J 3HXBA 4FA6A 3ZRHA 3LY9A 2W4MA 2X3MA 1YCSB 3B29A 1R5ID 4LCTA 3FUMA 2IOSA 2VTBB 3SNXA 5EGYA 4XIFA 1W2WA 2HKVA 3RVZA 2XEEA 5CMWA 3X1OA 2CFZA 2J0WA 2YL0A 4GCOA 4HOQA 5T3WA 3SEOA 3QKYA 3FDQA 4PACA 5FCLA 3URZA 1YA9A 1OCCE 1FNTc 3CVWA 1LS1A 1QQ3A 4OINF 5AJLA 3EFOA 3C5RA 4LRZA 3I4UA 3DE9A 1PD0A 3HTKC 2RSEB 3APFA 5CI9A 4GA0A 1N4SA 4G25A 1HH8A 4E85A 3FP3A 4D4NA 3DKAA 2B0OE 2NSFA 3VLEA 4Q69A 3AGTA 4GTQA 3C3RA 2NUPA 4KXKB 3RU0A 1JPLA 3GW4A 2AWIA 3DAFA 2HS5A 3W2VA 4FWVA 3PZ2A 4FHKA 2FBNA 3BEEA 3DJNB 1E83A 4YT8A 5B1BC 2KBXA 5M72A 2VCAA 1QQEA 1IQUA 4CJGA 2CG3A 3JZ0A 1BR2A 2GRLA 3I5PA 4AX2A 3U3FA 4RSYA 4ZHBA 2GAQA 2J9VA 2YKZA 4APOA 5BT1A 1ZW3A 1MX6A 2XGOA 1OW7A 3SXMA 5L0HA 1PV3A 2FGYA 2XHEA 4AXHA 5JJTA 1OCOC 1QZ2A 3MBGA 3AG2E 4DX5D 4GTMA 1HF8A 2LXLA 2JX0A 4I1AA 4HOTA 1YA7O 3B7BA 2XGMA 2ZGGA 5ENQD 2ZXWC 3MLGA 3J5QB 3TD7A 1LE4A 2BE5F 1W3BA 5KYUA 3LEOA 3DAGA 3E33A 3SBSA 1L5JA 3UXGA 1EPUA 4MW3A 2WXFA 1A17A 1XGWA 5ENNA 4IRUA 3LJ3A 5JRAA 2OEVA 4H7XA 1D9SA 4DXWA 4U8VD 2P9KG 4OD4A 2R7OA 2Y4TA 3E70C 1DCQA 1EDUA 3K66A 3RRNB 3WXXA 2PX3A 5G05C 1SQMA 2PP4A 3L1MA 1DOVA 4I1OB 2E0IA 3OXLA 1SA4A 3U8VA 4JA9A 3L0IA 1LTXA 4HNAD 1A5EA 3L9TA 4U9EA 5L3QA 3RJVA 3OEOA 1ELRA 3L8JA 4B8AA 4F7AA 4CS9A 2EPNA 5JT4A 1U2VG 3IEGA 1SZIA 1OKKA 2QC9A 2XCCA 1N11A 2WZLA 2GDCA 1NA0A 5JS5A 3FTUA 1T6IA 3UKRG 3KKBA 3LLIA 5FQ7A 4BJ5A 2VB6A 4GTSA 3VYWA 3E4BA 4AE4B 4LSZE 2VJ8A 4N3BA 3V2OA 4BY6A 4CSAC 1TNBA 2L6HA 4TXPA 3QVZA 2CHXA 3VLDA 1Z63A 1HFAA 1R4TA 1J8YF 3EJNA 2KZTB 2Y39A 3DSUA 2DI3A 3L82A 4N4WA 1UG7A 4JPSA 3LJNA 2H6HA 3ML8A 2QE9A 3UT8A 4G2VA 1S70B 4GZ3A 2ZXRA 4U5FE 5E33A 2ETBA 4ANXA 2R7SA 3RKVA 4HBDA 4JC8A 5EYPF 4A2NB 3G2WA 1YYXA 5JLIA 1ZU5A 2EINC 4GPKA 3CEXA 3JT1A 3RQGA 2IOQA 2Q9BA 1NZNA 3ABKC 2J45A 3FH8A 3KD7A 3QMKA 4JEBA 1WG0A 3FTXA 5FIOA 4J8YA 4RDAA 1H2UA 4LDQA 4L1BA 1Z3IX 1WWPA 5AC5A 2NXPA 1T6UA 2EPMX 4CIHA 3TWVA 2PFDA 2L6FA 4RBNA 3GWNA 3GZ2A 5CRUA 2PL2A 3FXHA 4GZ5A 3LS0A 2KC7A 3LCAA 1V55E 3ZKJA 3U2LA 1FT1A 2EIKC 1VOMA 1CPRA 3RIBA 3FU3A 3JUIA 2WXRA 3Q47B 3QAQA 3Q9UC 2LFDA 5T4YA 4MW8A 1T6QA 3EG9A 4GU5A 4XKBA 2XRYA 3AS4A 3ZIMA 4MVOA 1WAO1 4DUIA 4YVQC 1RKEB 2L6JA 2RG8A 3FOPA 1N4QA 5T1DB 2XZTG 4W9RA 3NYLA 3UPVA 3ZWIA 3LS8A 1JCQA 3TXNA 4BT9A 2IQCA 1FVHA 2WVOA 3RYLA 4UWLA 3T9KA 4U5BE 3ZG1A 3TWQA 3IQ6A 4HLLA 4TV3A 1Q2ZA 4YDYA 3BRJA 4HFGA 1TN8A 1KZPA 3QWPA 2KNHA 2WB7A 4BJTA 4EECA 4E6HA 2VGEA 4BPMA 4GA2A 3HNKA 3I4RB 3BU8A 1FT2A 3NBNB 1YARO 3W9FA 2ZPAA 3LS1A 3QWVA 4IGGA 3P2BA 4WUYA 2Y0BG 4RG9A 3PNTB 3WHNA 3NMIA 2Z15A 1TR4A 4XI0A 1K04A 1HG5A 2AU5A 2YHCA 3D9PA 4TUMA 2XL8A 4MVUA 5KYYA 1LD7A 3RVYA 4OAUC 2DVWA 4EIYA 1OR3A 4RD9A 3UM2A 3SF4A 5AAOA 2CGEA 3VF0A 4Y6CA 3ZC4A 4FAPB 3MA5A 5L0GA 3Q49B 1MMDA 1U89A 5BXOA 2HM8A 3C62A 1VMAA 5EN5D 1VYKA 2QYUA 4K0DA 3Q6NA 1TWGA 3S84A 4F1PA 3GANA 1NA3A 5IY5E 3LY7A 3R2PA 5JVEA 4CX9A 4W8PA 4U0SA 1A7VA 1Z3XA 2I1JA 3EU9A 2KCKA 4HB5A 2XLOA 3CVPA 1EI7A 4J32B 3DSTA 2QY9A 3JTLO 2ZISA 5FZSA 4MKTA 3K1IA 1M2VB 3D9NA 5HS0A 3SQVA 4G8LA 2X6HA 2YL1A 1Z6AA 1E7UA 1X81A 3IHUA 4KC9A 2BKGA 4DVYP 2VGXA 3C98A 3GEIA 1OCCC 1ORSC 4CDVA 3EIJA 3SZRA 5AQ9A 2V0PA 4LLEA 5KYWB 4U96D 2KXPC 4CBEA 1S64A 3RW0A 2J4BA 2KYHA 4Q5SF 2XEHA 3DSWA 2LXMA 1TYQG 1QKRA 5ARGA 3IBEA 1MHQA 5T3RA 2IO2C 4JVSA 2C03A 2AW6A 5FQ4A 2X0CA 3M4CA 4LNUD 3MFNA 3LEWA 2H6FA 3QOUA 4BESA 1B68A 4AY5A 3DWLG 3L6AA 4BTBA 3AG1E 3IHVA 4J8FA 4DBQA 2IU1A 3W9GA 3FMSA 2A1DD 1HX8A 3PVLA 1EF1C 4AL1A 5ANLA 4Z9IA 3DPDA 3UM3A 1FPPA 4I17A 3SYNA 4FADA 4U5CE 3MKRA 3LNRA 5KBAA 4N6HA 1QSPA 3DBSA 5LP0A 1ORJA 3NKDA 5F5HA 3AG2C 3HNIA 1SVXA 3L22A 4IWBA 3LLKA 5FQ6A 3FH7A 1OKKD 3GZ1A 3EHQA 4YL3A 1Y6DA 1A41A 1K8KG 5FZRA 5AJDA 3L16A 2YL3A 1FFTC 2DCPA 2HSQA 3DWWA 3AG4E 2H6IA 3HDXA 4EKWA 2J0XA 3U3WA 4JJGA 4JRZA 2Y69E 4BX8A 1HE1A 5D2MC 1NZEA 4AOFA 1RMVA 4MTGA 2A0BA 5KYNA 3LKUA 1NP7A 1QYMA 3UI2A 4NTFA 1H6KA 3FTVA 3EGDB 2IYLD 3MKQB 4QI2A 4C7OA 4F3VA 3WG7E 2I6HA 2XXAB 4L9PA 2F8YA 3UT4A 3ZHEA 4U0UA 3UT7A 1TEZA 2IFUA 4LDKA 4JD2G 3VLFA 2NSGA 2NUTA 3G2SA 4PFPA 3APCA 3APDA 3JCKC 4GCNA 2QLAA 2W45A 4CYMD 3C8GB 5L0CA 5AYWD 2GROB 2C0LA 5ENRD 3R7QA 2XLVA 3VTXA 3ZUVB 2LSUA 3CR3A 1VK5A 2ZD9A 2MYOA 1YZAA 1YMPA 3MJWA 3IQTA 3EGXA 4F6RD 1E85A 2UY1B 5AQBA 4C0MA 2VQ2A 4U8YD 4PJJA 1YYJA 4YDOA 4HE8D 3AU5A 3DXMG 3MYFA 5ENSD 2Y3HA 4LNGA 1VYIA 2X6IA 1LE2A 3T8KA 1K05A 3B71A 4UWGA 3EDTB 4CS8A 4F4BA 4PK4A 1QZXA 2IXMA 4JHKA 3KS2A 3FDHA 4EPZA 2Y3AA 4CZ2D 4OIOF 4WJ0A 4K5CA 2OV8A 3H2UA 3GZSA 1OT8A 1ZYRF 4I6GA 3LAYA 1E90A 5HKPA 2L0TB 2BL2A 3HVEB 4O6YA 1VLSA 3CSFA 3FWVA 3FY4A 2OEXA 3UMVA 4F1SA 4YT5A 3L54A 4RG6A 3ZFWA 2VCBA 3CK9A 2R05A 4FESA 2FO7A 3CK7A 4F53A 2FFHA 4WWNA 1TNYA 5B3IA 4E0IA 1TN7A 4LUNU 3FU0A 2PNOA 4DOZA 2CFUA 4HQDA 2CYDA 4EZKA 3J06A 4HEAJ 4FLHA 3E9VA 2GW1A 3K1HA 2BKKB 1PC2A 4C0EA 4YK5A 1TWAA 4BWRA 1PCXA 4HOSA 1SMYF 2F22A 1D8DA
chains in the Genus database with same CATH topology
4GZDA 1V55C 4OIPF 3B7SA 4GYWA 3DJUB 4GYTA 1OWLA 3CHOA 1RJ9B 4KNVA 4B8CB 3NYJA 3AU4A 4IYPA 1TJFA 3LVQE 3SHFA 2WB2A 4DVZA 4HLEA 4UWKA 4H4KC 2WXKA 3FUKA 4HORA 4KT6B 1ZHTA 2LO6A 5AENA 1H0AA 2MWQA 1M56C 1Z5ZA 4WNEA 2AVPA 2Y3GA 2KCLA 4L23A 2HV6A 4CDMA 1PAQA 3LY8A 4NRHB 3UX4A 3D9IA 3FUIA 3TL5A 2R7WA 1XNFA 4BG0A 2WXOA 4JZAA 3UGPA 3PHF2 3U4TA 2VSXE 3G2VA 4XX5A 1JWFA 4Q96A 4ANUA 1VDYA 3PS6A 2DGJA 4HXIA 2WXQA 4FP7A 3Q6MA 3I3NA 3CK8A 3VAYA 4G24A 3L08A 5L3VA 3RO3A 2G3KA 4PUCA 3TXMA 2VH3A 2J08A 5KJNA 3OXGA 5KJLA 4PS8A 1X5BA 5LCWJ 2YINA 2A69F 3PUKA 5BUZA 3B7UX 4QI0A 4OIRF 2IONA 5CCMA 1PD1A 1D0YA 3FAJA 1JPJA 4PJNA 4PJLA 4EZLA 1E7VA 2Q9CA 2XGSA 3ZPJA 2QTVA 3DD7A 3O48A 2KZTA 2J07A 3L17A 4D10C 2L9JA 2JLBA 4K03A 2X6KA 3OWTA 1KT1A 3FULA 1JUQA 2YQ8A 3TG4A 5LOZA 3AG1C 3UGOA 3ZN3A 5AIJA 3JQ1A 1TJCA 1LF8A 1B89A 2MRIA 2YEVA 2C2LA 2G3VA 1MMGA 4CRWA 2HR2A 4N06A 3D9OA 3EFOB 5KYXA 5CI8A 4O6NA 3SBTB 4HS2A 5EKQD 4BJ6C 1IHGA 3TGOA 2NUPB 5JJ6A 3L13A 2Y69C 3AQBA 3N71A 4GAAA 4UQYA 2JD3A 1MMNA 4O6FA 3ZVVA 2I9CA 4JHRA 1WGWA 1JWGA 5F5FA 4UI9J 4IJJA 3WG7C 2WVQA 3NG1A 3CSKA 3RRMB 2Q3TA 4I3MA 4EQFA 2A5UA 1UN8A 2MHKA 4G7ZF 3RH3A 1LKXA 4U04A 4I2WA 2R7UA 3ASHA 3FUHA 2A6EF 3PUJA 3K6BA 2OVBA 2M4EA 4H7YA 5LCWC 3CKCA 4MLPA 3CVNA 3CHSA 5JHAA 5KYUB 3I4GA 1JPNA 4B89A 4TUUA 3SFZA 3SP1A 3BG0B 4LLCA 4E7SA 3UMKA 3HYMB 3MGBA 3N0TA 2BF0X 5J90A 2A4ZA 1BR1A 2FF4A 3LJBA 4GZCA 3ZYKA 1G8XA 3H65A 4HFKB 4PFOA 5CMYA 3CZ6A 4JZYA 3AS8A 4XZ4A 3R9AB 5BV0A 4WNFA 2J4DA 2J7PD 3FUNA 4U5EE 3FUEA 3EH1A 3T5VA 2WXNA 1H19A 5E75A 4N2QA 3LDZA 1E8WA 2WXGA 3ZXSA 4ILGA 1M57C 4GA1A 3LYAA 3EZIA 5D92A 1FVFA 4UQXA 3TAXA 1H2VC 1UJJA 3CVLA 3ONKA 2XCBA 3ZYLA 4XLPF 4DLOA 2IF4A 5KYWA 3EQLF 3RKOF 1KLXA 1UW4B 4OVVA 4J0UA 1UG3A 2Q9AA 4YT4A 4UI9C 4G0HA 4JW1A 4CCAA 2DYRC 4ABNA 2W9YA 3PH0C 4I43A 2KW3C 3EHMA 3CGHA 4B6IA 1S0PA 2J46A 2R7TA 2WQHA 4E7ZA 1ZHWA 2O9XA 4UI9K 2R7QA 2I2OA 4N2SA 4GZ6A 3B9QA 3JYSA 5E76A 4JEUA 2WXLA 1QNFA 3U66A 3GYZA 1OWNA 1ST6A 2GRMA 3OA1A 1J8MF 4L7TA 3RO2A 2LSVA 4HFFB 4NACA 2V4LA 3RIPA 1ELWA 3Q4AB 5D0OD 2WPVA 3POVA 2EILC 3JSZA 2MYSA 2PF4E 4L2LA 4I44A 4AIFA 1EYHA 4XE0A 1HU3A 3CEQA 1FTSA 2V26A 1D1AA 2XQ0A 2XXAA 5CHEE 2KQ9A 4U5DE 5J08A 3O6XA 2G62A 4CDNA 2WVNA 4GEHA 1MQSA 3QJZA 4LERA 3S28A 4Q94A 3W2WA 4FLBA 3D9LA 4BT8A 3EPVA 5EHHA 2CHWA 5EDSA 1ZHZA 3QB2A 4MS6A 4CSAA 3FU5A 3O39A 3VTYA 1IQRA 1E96B 4CEMA 4JHJA 2V8SE 4KNWA 5C2YA 3OTNA 2EQXA 3KEZA 2P6VA 1FFHA 3G2UA 4C3DA 1FCHA 2J49A 2D5RB 4C3EA 3UQ3A 3FH5A 3FTSA 3ULQA 4ATGA 2WXPA 4I9EA 4PDXA 1OUVA 2PM7A 4FJYA 2PZIA 2NC9A 3UMHA 2VGXB 1INZA 1DNPA 4I9CA 3NQPA 4DI3A 4K7BA 3WODF 1NU7D 3SZ7A 2YZSA 2XRHA 3CVVA 3S27A 4AJWA 3N2ZB 1MNEA 2IXNA 4Q4ZF 3D3MA 1QLEC 2R7VA 1Z6TA 5B1AC 4GYYA 2XPYA 2KGOA 3R7RA 4DK5A 4QFVA 3N24A 4MNDA 2X6FA 3ASFA 2XL4A 3P1UA 3TJPA 1FMVA 3S7JA 3HJCA 3B7RL 1HO8A 2B0JA 4L2YA 4LACB 2I1KA 3QNKA 5E2QA 3CHRA 4J6IA 3SGHA 4BTAA 4B94A 3T6BA 4BFRA 4URKA 3V7OA 2VTBA 4KVOA 2E87A 4AY6A 4BJ5C 1BR4A 4APFA 3T8MA 5DS5A 1SZAA 3IV0A 3FU6A 5FZQA 4C7OB 2JEKA 4ULWA 1Z3YA 2GFHA 4DLQA 5C1DA 2V5FA 4OVUA 2AXZA 3ZHEB 2WQ6A 2CG2A 3PMRA 3ZVRA 1P5QA 2NUTB 5BNWA 2AXUA 2WQ7A 2YHEA 3CV0A 4GMJA 3U9WA 4U07A 5EX0A 3ZIBA 1O87A 3W8HA 2NG1A 3B7TA 2KM4A 3HHMA 3Q7LA 2J7PA 4J30B 3LVRE 3ZYQA 4ME2A 5G04J 2A6HF 2VYIA 4XI9A 4HOUA 3LESA 1Y6IA 1ZU2A 4J8EA 4NY3A 5E3CA 4KZ0A 3IEEA 3SD5A 1E8YA 3FUJA 2VGYA 2BUGA 2WXIA 3DM9B 3MEKA 4FU3A 4YJWA 4WNGA 3F46A 1GW6A 1KU2A 3TG5A 3NF1A 3QARA 1PY1A 2X38A 2VSOE 2WXHA 4WWOA 3K7DA 4BEJA 1TR2A 3ZSUA 4IAOA 2WL8A 4P6IC 3PDNA 3PEVB 4PH4B 3CIAA 3K33A 4ACLA 3EZHA 4AP2A 2HYZA 4UWFA 4ZLCA 5EX3A 1OWOA 5IY5C 4M3OA 3B13A 5G55A 3FHEA 1MNDA 4U5GA 3PEUB 5FJYA 4KVMA 2YHSA 4LEUA 3ONLA 4JXTA 1BPOA 1D1CA 4WAFA 3PE3A 4G1TA 5D0QD 2OVFA 4G11A 4AE4A 3S0XA 4NQ0A 2ZXOA 5DS6A 2VSYA 2OOEA 2J9WA 3S2AA 2P58C 3FEXA 3QK0A 1WY6A 3UNGC 4WWPA 3O4ZA 4EBAG 4JCHA 3FUFA 1U3DA 3D9JA 3SI5A 5G04C 2C04A 2IXPA 2XPIA 2E2EA 4A3TA 3FFLA 4J8SA 3K1IC 4KI2A 4X0RA 4XTKA 2XPZA 2NSZA 3MX3A 4KYOB 2WVIA 4C9BB 4CT0A 4PJMA 2XEVA 2WMOA 3B0UX 4KMOA 3PZDA 2FI7A 5CCLA 5FWQA 3AG4C 5A7DB 4XKCA 4U5HA 3PE4A 5A6CA 5D91A 3AQCA 4P29A 2XSEA 2DBAA 3PNLB 4I1MA 2IJGX 4DBRA 5BV1A 2UWJG 5HI7A 1SF8A 1S7ZA 4PS3A 2IOLA 4AV7A 4JL0A 3QC1A 3D9KA 5JHBA 3K9IA 5FQ8A 1TWHA 3CHPA 3NYMA 4DI4A 3NZUA 4ANJA 1ZHYA 2WXMA 2WXJA 2KATA 1ZHXA 2J9UA 4ILIA 3RFYA 4V3IA 1UJKA 5BPPA 2HO1A 3MV2B 4A55A 4RVBA 4FC8A 3MCXA 4TRQA 4ILHB 3S7FA 2PM6A 4OYSA 3EH2A 5KCMA 1Y8MA 5DQTA 4BSXA 2FEZA 3RRUA 5DS4A 1NU9C 5KYXB 2R5SA 3UMIA 3FTZA 1OCRC 4GYOA 3Q7GA 1ZU4A 2J9QA 2CW0F 4PS7A 2VSNA 1D0XA 4U8HA 3LPZA 3X2QC 4FJZA 4OIQF 3CVYA 4OD5A 5KJKA 5HSWA 3CQGB 1M2VA 2OCCC 2LSEA 2WM9A 1IZMA 3CLJA 3UR3C 3ZGQA 4CS8C 1U3CA 3LXUX 2BTDA 5T8IA 2CNWA 4EBBA 3ASGA 2WMNA 3DMDA 1Z23A 4CT4A 1HE8A 3MV3B 2AXVA 3PRZA 2R7RA 4DJAA 4DPRA 4A1GA 3IKOB 5DBKA 4FULA 2V3CC 3BG1B 4A1SA 4XWJA 5DVWA 4BJ1A 3JYHA 2WZFA 2WZGA 5BW8C 4A3VA 4EWCA 1E8XA 3CVUA 4U63A 3ZYMA 2ONDA 2Y3BA 2VASA 2L0IA 3ESKA 1ELKA 3CKBA 4N3CA 3KH2A 2PQRA 4N39A 2ZU6B 4JA7A 4JJFA 2PX0A 3EHNA 5G2NA 4BX9A 4R7LA 4ANVA 5HQ8A 4EBAA 3LEVA 5E3AA 2L81A 5JJ7A 3OAWA 3CVXA 4KZCA 3JRTA 5DIZA 2PQNA 3EG9B 1DVPA 1N52A 2X6JA 3QDNA 3RK6A 2QY7A 3CSTA 4G23A 2H7OA 4FHJA 3EGDA 3HIZA 4FX5A 1D1BA 3MKQA 1OWMA 2ILRA 3MYVA 4Y6WA 3DZAA 4N5CA 1WM5A 1YA0A 4UWHA 3OXFA 1LVKA 4O79A 3IHYA 1H2TC 3ZEFA 4I6JA 3EIQC 3Q5MA 3S7DA 4BJ6A 2OG2A 3S7BA 2LAHA 3ASDA 1OWPA 2P7VA 1KT0A 3HLZA 1OCZC 2UY1A 4KBLA 4O7GA 2R17C 4YVOA 3FUDA 4WNDA 3SNHA 3ZW3A 2H7VC 3B0VC 5KYYB 2Y3DA 3ESLA 4CGVA 2XRZA 5B3SC 1ZBPA 5T3TA 2X51A 1V54C 3G2TA 2ZXPA 3JQ0A 3NDBB 1FMWA 3FTWA 2LNIA 4JURI 5FT9A 4J8DA 4YN0B 5BUOA 4CS7A 3ASNC 3DXJF 4MQ9F 5LX8A 3CQCB 3HVEA 5LFAA 1TKNA 4NURA 3PREA 4G26A 4AEZC 1NG1A 5KJMA 3CQZA 3JCUQ 3NKEA 4AM9A 3ML9A 4CDRA 3W8IA 1IW7F 5DQZA 2L9BA 4AVXA 2DIWA 3KL4A 3F47A 3QWWA 3ASOC 2J09A 1O5HA 2R7XA 3T4RA 2R59A 1D0ZA 2EIMC 2KJGA 4GMLA 2GGFA 2CDQA 3NZSA 4Q7CA 4JEHA 1RJ9A 2IXOA 2YNQA 3U64A 3AS5A 2RD0A 4W8KA 1N54A 2MOWA 4GB9A 3ABMC 2HV7A 4ANWA 4O6MA 2M63A 3M1CB 3B0PA 4MRUA 3ITFA 4N3AA 3GODA 3T5XA 4CS9C 4G7HF 4G7OF 4I2ZA 5ANRA 3FHDA 1TWCA 4QDLA 3FVYA 5A23A 2EIJC 1E8ZA 2DYSC 3DM5A 2FULA 4YWQA 5FTPA 2CNWD 4ACKA 3FTYA 4EZJA 2QFCA 3T6JA 1IYGA 1MMAA 4IULA 4XLNF 1N1CA 1M2OA 1HS6A 4AK9A 3S29A 4ZLDA 5DLJA 4M63A 1HXIA 2LAIA 2Q7FA 3KAEA 4B0ZA 2A68F 3L34A 1HG2A 3ABLC 3CVQA 3EGXB 1HZ4A 4UQZA 2I8BA 1SZ9A 3CHMA 1UN9A 4U0ZA 4I6EA 3KMIA 3ECSA 3QZCA 3ENEA 3I5QA 3UUXA 4YNDA 4YT2A 3NRHA 2W4BA 2CHZA 3MZLB 3CHQA 3Q15A 3FEYA 4C3BA 2C0MA 3AG3C 4KBQA 3D9MA 2H7BA 2KCVA 4K0RA 4HVBA 2Y4UA 4IN3B 4CGWA 5ARFA 5G05J 4FA6A 3ZRHA 3LY9A 2W4MA 2X3MA 4LCTA 3FUMA 2IOSA 2VTBB 3SNXA 5EGYA 4XIFA 1W2WA 5CMWA 3X1OA 2CFZA 2J0WA 4GCOA 4HOQA 5T3WA 3SEOA 3QKYA 3FDQA 5FCLA 3URZA 3CVWA 1LS1A 4OINF 5AJLA 3EFOA 4LRZA 3I4UA 1PD0A 3HTKC 3APFA 5CI9A 4GA0A 4G25A 1HH8A 4E85A 3FP3A 3VLEA 4Q69A 2NUPA 4KXKB 3RU0A 1JPLA 3GW4A 2AWIA 3DAFA 3W2VA 4FWVA 4FHKA 2FBNA 3BEEA 3DJNB 4YT8A 5B1BC 5M72A 1QQEA 1IQUA 2CG3A 1BR2A 2GRLA 3I5PA 4AX2A 4RSYA 2J9VA 4APOA 5BT1A 2XGOA 2FGYA 2XHEA 4AXHA 5JJTA 1OCOC 1QZ2A 1HF8A 4I1AA 4HOTA 2XGMA 2ZXWC 3MLGA 3TD7A 2BE5F 1W3BA 5KYUA 3DAGA 3SBSA 1L5JA 1EPUA 2WXFA 1A17A 1XGWA 5ENNA 4IRUA 3LJ3A 4H7XA 4OD4A 2R7OA 2Y4TA 3E70C 1EDUA 3K66A 3RRNB 3WXXA 2PX3A 5G05C 1SQMA 2PP4A 4I1OB 2E0IA 3OXLA 4JA9A 3L0IA 5L3QA 3RJVA 3OEOA 1ELRA 4B8AA 4F7AA 4CS9A 3IEGA 1SZIA 1OKKA 2XCCA 2WZLA 1NA0A 3FTUA 3KKBA 3LLIA 5FQ7A 4BJ5A 2VB6A 3VYWA 3E4BA 4AE4B 2VJ8A 4N3BA 4BY6A 4CSAC 2CHXA 3VLDA 1Z63A 1HFAA 1J8YF 3EJNA 2KZTB 2Y39A 4JPSA 3ML8A 3UT8A 4G2VA 4GZ3A 2ZXRA 4U5FE 5E33A 4ANXA 2R7SA 3RKVA 4JC8A 4A2NB 3G2WA 1ZU5A 2EINC 4GPKA 3JT1A 2IOQA 2Q9BA 1NZNA 3ABKC 2J45A 3FH8A 3KD7A 3QMKA 3FTXA 4RDAA 1H2UA 4L1BA 1Z3IX 2NXPA 4CIHA 2PFDA 4RBNA 3GZ2A 2PL2A 4GZ5A 3LS0A 2KC7A 3LCAA 2EIKC 1VOMA 3RIBA 3FU3A 3JUIA 2WXRA 3Q47B 3QAQA 5T4YA 3EG9A 4GU5A 4XKBA 2XRYA 3AS4A 3ZIMA 1WAO1 4YVQC 2L6JA 2RG8A 5T1DB 4W9RA 3NYLA 3UPVA 3LS8A 3TXNA 4BT9A 2IQCA 1FVHA 2WVOA 4UWLA 3RYLA 4U5BE 3ZG1A 4TV3A 4HFGA 3QWPA 2KNHA 2WB7A 4BJTA 4EECA 4E6HA 4GA2A 3I4RB 2ZPAA 3LS1A 3QWVA 3P2BA 4WUYA 4RG9A 3PNTB 2Z15A 4XI0A 1HG5A 3D9PA 2YHCA 5KYYA 4RD9A 3SF4A 2CGEA 4Y6CA 3ZC4A 3MA5A 3Q49B 1MMDA 2HM8A 1VMAA 1VYKA 4K0DA 3Q6NA 1TWGA 3GANA 1NA3A 3LY7A 4U0SA 1Z3XA 2I1JA 2KCKA 3CVPA 4J32B 2QY9A 5FZSA 4MKTA 1M2VB 3D9NA 2X6HA 1Z6AA 1E7UA 4KC9A 4DVYP 2VGXA 3C98A 1OCCC 3EIJA 3SZRA 2V0PA 4LLEA 5KYWB 4CBEA 2J4BA 4Q5SF 5ARGA 3IBEA 1MHQA 5T3RA 4JVSA 2C03A 2AW6A 5FQ4A 3LEWA 3QOUA 4AY5A 3L6AA 4BTBA 3IHVA 4J8FA 4DBQA 2IU1A 2A1DD 1HX8A 3PVLA 1EF1C 5ANLA 3DPDA 4I17A 3SYNA 4FADA 4U5CE 3MKRA 3LNRA 3DBSA 5LP0A 3NKDA 5F5HA 3AG2C 3L22A 4IWBA 3LLKA 5FQ6A 3FH7A 1OKKD 3GZ1A 5FZRA 5AJDA 3L16A 1FFTC 2DCPA 3HDXA 2J0XA 3U3WA 4JJGA 4BX8A 1NZEA 4AOFA 5KYNA 3LKUA 1NP7A 1H6KA 3FTVA 3EGDB 2IYLD 3MKQB 4QI2A 4C7OA 4F3VA 2I6HA 2XXAB 3UT4A 3ZHEA 4U0UA 3UT7A 1TEZA 2IFUA 3VLFA 2NUTA 3G2SA 4PFPA 3APCA 3APDA 3JCKC 4GCNA 2W45A 5AYWD 2C0LA 3R7QA 3VTXA 2LSUA 3CR3A 1VK5A 3MJWA 3EGXA 2UY1B 4C0MA 2VQ2A 4PJJA 4HE8D 3AU5A 2Y3HA 1VYIA 2X6IA 4UWGA 3EDTB 4CS8A 4F4BA 4PK4A 1QZXA 2IXMA 4JHKA 3KS2A 3FDHA 4EPZA 2Y3AA 4OIOF 4WJ0A 2OV8A 3GZSA 1ZYRF 4I6GA 3LAYA 1E90A 2L0TB 3HVEB 4O6YA 3CSFA 3FWVA 3FY4A 3UMVA 4F1SA 4YT5A 3L54A 4RG6A 3ZFWA 3CK9A 4FESA 2FO7A 3CK7A 4F53A 2FFHA 4WWNA 4LUNU 3FU0A 2CFUA 4DOZA 4EZKA 4HEAJ 4FLHA 3E9VA 2GW1A 3K1HA 1PC2A 4C0EA 1TWAA 4BWRA 1PCXA 4HOSA 1SMYF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FDH A;  5J90 A;  3CK9 A;  3CK8 A;  3HDX A;  3MX3 A;  3JYS A;  3OTN A;  3CK7 A;  5E76 A;  5FQ8 A;  4F53 A;  3CKC A;  3P1U A;  3KEZ A;  3EJN A;  3GZS A;  3I4G A;  3MYV A;  3JQ0 A;  3MCX A;  3EHM A;  3CGH A;  3IV0 A;  4PUC A;  4F7A A;  5E75 A;  4L7T A;  3JQ1 A;  3CKB A;  5T3R A;  3QNK A;  3SGH A;  3NQP A;  3L22 A;  5FQ4 A;  4MRU A;  3SNX A;  5FQ6 A;  5FQ7 A;  3LEW A;  4LER A;  5T4Y A;  3EHN A;  4Q69 A;  5LX8 A; 
#chains in the Genus database with same CATH topology
 2L6G A;  4GZD A;  1V55 C;  3D9H A;  4OIP F;  3SO8 A;  3B7S A;  1RCP A;  4GYW A;  3U3B A;  3DJU B;  4GYT A;  3AOU A;  3E30 A;  1OWL A;  3ULE G;  3CHO A;  1RJ9 B;  4KNV A;  3U9M A;  4Z9J A;  4B8C B;  4BET A;  3NYJ A;  5FZT A;  1N4P A;  2L6B A;  2DYR E;  3AU4 A;  4P9F A;  4IYP A;  1TJF A;  4NIK A;  3LVQ E;  3ZU7 B;  3SHF A;  2WB2 A;  4DVZ A;  4HLE A;  2XM0 A;  4H4K C;  4UWK A;  2WXK A;  3J5P A;  3FUK A;  4HOR A;  4KT6 B;  1SR2 A;  1ZHT A;  2LO6 A;  3JUE A;  2F0Y A;  4U9D A;  5AEN A;  1H0A A;  2MWQ A;  1M56 C;  1Z5Z A;  4WNE A;  2AVP A;  2Y3G A;  2KCL A;  4L23 A;  3HXE A;  2LIG A;  3ISM C;  1WAT A;  2HV6 A;  1ZZP A;  4CDM A;  2HJ3 A;  2NYJ A;  1PAQ A;  4WGZ A;  3LY8 A;  4NRH B;  3UX4 A;  3D9I A;  1Q0M A;  3FUI A;  3TL5 A;  2R7W A;  1XNF A;  4BG0 A;  2WXO A;  4JZA A;  3UGP A;  3PHF 2;  1LS4 A;  3U4T A;  2EIL E;  2VSX E;  3G2V A;  4XX5 A;  2QUP A;  1JWF A;  4Q96 A;  1NFI E;  2EPL X;  4ANU A;  3RQF A;  1VDY A;  2YWA A;  3IQ5 A;  1JCS A;  1MJ0 A;  3PS6 A;  2DGJ A;  4HXI A;  2WXQ A;  2I15 A;  4FP7 A;  3Q6M A;  1N4R A;  1YYH A;  3I3N A;  1AWC B;  2RFA A;  3CK8 A;  3VAY A;  4G24 A;  3L08 A;  5L3V A;  3RO3 A;  2G3K A;  4PUC A;  3TXM A;  2VH3 A;  2J08 A;  5KJN A;  3OXG A;  1IXV A;  5KJL A;  4PS8 A;  1X5B A;  3NMK A;  1ZVZ A;  2OU6 A;  2GRQ B;  5LCW J;  2YIN A;  5ENO D;  2A69 F;  3PUK A;  5BUZ A;  3B7U X;  4QI0 A;  3SXY A;  4OIR F;  2GRP B;  2ION A;  5CCM A;  1PD1 A;  1TNU A;  2OKU A;  3R9M A;  1D0Y A;  3FAJ A;  1ZB1 A;  1JPJ A;  4PJN A;  4PJL A;  4EZL A;  1E7V A;  3T6G B;  1NBB A;  2Q9C A;  2XGS A;  256B A;  3TJ6 A;  1DOW A;  3U8P A;  3NMJ A;  4CIP A;  2J8W A;  3ZPJ A;  2QTV A;  3DD7 A;  4BSZ B;  3SXZ A;  5B3S E;  3O48 A;  2CCY A;  2KZT A;  2J07 A;  3L17 A;  4D10 C;  2L9J A;  2JLB A;  3HG0 D;  3UM1 A;  4K03 A;  2X6K A;  3OWT A;  1O3U A;  1KT1 A;  5L0D A;  2PNN A;  5COG A;  3FUL A;  1JUQ A;  2YQ8 A;  5COM A;  3TG4 A;  2YLD A;  1ORY A;  5LOZ A;  3AG1 C;  3UGO A;  4JKV A;  3ZN3 A;  1GM5 A;  3JQ1 A;  5AIJ A;  1TJC A;  1LF8 A;  1D8E A;  1A0B A;  1B89 A;  1NSG B;  2YEV A;  5BQH A;  2C2L A;  2G3V A;  2MRI A;  1JRA A;  4UUC A;  1MMG A;  1Q0K A;  4L6R A;  4CRW A;  3HNJ A;  2HR2 A;  4N06 A;  4H54 A;  3D9O A;  3EFO B;  4XEK A;  5KYX A;  4GMR A;  5CI8 A;  4O6N A;  3SBT B;  4HS2 A;  5EKQ D;  4YL1 A;  2EPK X;  2R03 A;  4BJ6 C;  1F1M A;  5FIN A;  1IHG A;  1CGN A;  4JTA B;  3TGO A;  2NUP B;  5JJ6 A;  3W4Y A;  5L0I A;  3L13 A;  2Y69 C;  3AQB A;  1TNO A;  1I5N A;  1QBQ A;  3N71 A;  2YQY A;  1AEP A;  4GAA A;  1WAS A;  4EHM A;  4DX2 A;  1HMD A;  4UQY A;  4LDR A;  2JD3 A;  1MMN A;  4O6F A;  5B1A E;  1BI7 B;  3ZVV A;  2I9C A;  2OQM A;  4MVM A;  1WGW A;  4JHR A;  3C7J A;  1JWG A;  1WTY A;  5F5F A;  3TOM A;  5L0F A;  3C18 A;  4UI9 J;  4IJJ A;  1YLM A;  3WG7 C;  2WVQ A;  3NG1 A;  3CSK A;  2HE0 A;  3RRM B;  2Q3T A;  1CGO A;  2AWY A;  4I3M A;  4EQF A;  3TK0 A;  2A5U A;  2P9S G;  1UN8 A;  2MHK A;  4G7Z F;  3RH3 A;  1LKX A;  1IKN D;  4U04 A;  4I2W A;  2R7U A;  3ASH A;  3FUH A;  2A6E F;  1VTM P;  2ETA A;  3PUJ A;  3K6B A;  4K1O A;  3GEE A;  2L7A A;  4IB4 A;  2OVB A;  2M4E A;  4H7Y A;  5LCW C;  3CKC A;  4MLP A;  3CVN A;  3CHS A;  5JHA A;  5KYU B;  3I4G A;  1JPN A;  4B89 A;  4TUU A;  3DSS A;  3SFZ A;  3SP1 A;  3BG0 B;  4LLC A;  1SW6 A;  4E7S A;  2F8X K;  3UMK A;  2HMQ A;  3HYM B;  3MGB A;  3N0T A;  4B93 B;  2BF0 X;  3Q73 A;  5A6A A;  5J90 A;  2A4Z A;  1BR1 A;  2FF4 A;  3C63 A;  3LJB A;  5CBN A;  4GZC A;  3ZYK A;  2HUJ A;  1H9G A;  1G8X A;  3H65 A;  3V5Y A;  4HFK B;  4PFO A;  5CMY A;  3CZ6 A;  2LCH A;  1N9A A;  4JZY A;  3AS8 A;  4XZ4 A;  3R9A B;  5BV0 A;  4WNF A;  4N6C A;  2J4D A;  2J7P D;  2PBE A;  3FUN A;  1NFO A;  4U5E E;  3FUE A;  3EH1 A;  3T5V A;  3O55 A;  3TJ5 A;  2WXN A;  4GTV A;  1H19 A;  1AVO B;  3H2V A;  5E75 A;  4N2Q A;  3LDZ A;  3F6Q A;  1E8W A;  2WXG A;  1XWJ A;  3ZXS A;  3B95 A;  4ILG A;  3M4B A;  1M57 C;  4GA1 A;  3LYA A;  3EZI A;  5D92 A;  1FVF A;  4UQX A;  3TAX A;  3E34 A;  3MYI A;  1H2V C;  1H9T A;  1UJJ A;  4DRJ B;  2B0H A;  2XLE A;  2IEJ A;  2ZGD A;  3CVL A;  2XCB A;  3ONK A;  3ZYL A;  4XLP F;  4DLO A;  3S9O A;  2IF4 A;  5KYW A;  3EQL F;  3RKO F;  1KLX A;  3V2X A;  1FAP B;  1UW4 B;  4O1O A;  3GM1 A;  4OVV A;  4J0U A;  1LPE A;  1QVX A;  1UG3 A;  4YDW A;  2Q9A A;  1AP7 A;  4YT4 A;  4UI9 C;  4G0H A;  2IBF A;  4JW1 A;  4CCA A;  2DYR C;  4ABN A;  1EA8 A;  4J7T A;  2W9Y A;  3PH0 C;  4I43 A;  2KW3 C;  3RF3 A;  1OW6 A;  3EHM A;  3CGH A;  4B6I A;  4EBK A;  1S0P A;  2J46 A;  2R7T A;  3EUV A;  2WQH A;  1VB5 A;  4E7Z A;  1ZHW A;  2O9X A;  4DRI B;  2XS1 A;  2XLD A;  5KNH D;  4UI9 K;  3PZ4 A;  2R7Q A;  2LUH A;  2I2O A;  2QNL A;  4N2S A;  4GZ6 A;  3B9Q A;  3JYS A;  5E76 A;  4JEU A;  2R02 A;  3AGU A;  2WXL A;  1QNF A;  3U66 A;  3GYZ A;  1OWN A;  1ST6 A;  2GRM A;  3OA1 A;  4HI9 A;  3ULY A;  1J8M F;  1C03 A;  1JMW A;  4L7T A;  3RO2 A;  2LSV A;  1TFK B;  4XQ1 A;  4HFF B;  4XPW A;  4NAC A;  1WN0 A;  5CEA A;  1Q0D A;  2V4L A;  3RIP A;  1ELW A;  3Q4A B;  4Z68 A;  5D0O D;  2WPV A;  3POV A;  2EIL C;  3JSZ A;  2MYS A;  2PF4 E;  3U9J A;  4I44 A;  1EKY A;  4L2L A;  4N5Q A;  4AIF A;  3U2M A;  1HE9 A;  4P9T A;  1EYH A;  1UOH A;  4XE0 A;  1HU3 A;  3CEQ A;  3JSE O;  1FTS A;  1T9K A;  2V26 A;  1D1A A;  2XQ0 A;  3VRC A;  2GA0 A;  2V5Q C;  2XXA A;  5CHE E;  2KQ9 A;  4U5D E;  5J08 A;  1KPS B;  1M6T A;  3O6X A;  2G62 A;  4CDN A;  2WVN A;  4GEH A;  1MQS A;  3QJZ A;  1MYO A;  4LER A;  3S28 A;  4Q94 A;  2A0U A;  3W2W A;  4FLB A;  3D9L A;  4BT8 A;  4DX7 D;  1TQG A;  1BZ4 A;  3RSE G;  3EPV A;  3PZ1 A;  4MS2 A;  5EHH A;  1H6P A;  2CHW A;  5EDS A;  1ZHZ A;  1I4Z A;  3QB2 A;  1YVI A;  4MS6 A;  5A6K A;  4WAB A;  3KSQ A;  4CSA A;  1A7D A;  3FU5 A;  3O39 A;  3GOR A;  4NCQ A;  1FR0 A;  3VTY A;  2NPU A;  1IQR A;  1E96 B;  4CEM A;  4JHJ A;  2V8S E;  4KNW A;  2H8A A;  3S90 A;  5C2Y A;  3OTN A;  2EQX A;  3HXD A;  1SYQ A;  3KEZ A;  2P6V A;  1FFH A;  1OXB A;  3DSV A;  2V4H C;  3G2U A;  4C3D A;  1FCH A;  2J49 A;  2D5R B;  3CAX A;  4C3E A;  2M64 A;  3UQ3 A;  2Y1L E;  3V30 A;  1BI8 B;  2YLG A;  3FH5 A;  3Q75 A;  3FTS A;  1NLX A;  2IO3 C;  5JSL A;  3ULQ A;  4ATG A;  2WXP A;  2AVK A;  4I9E A;  4PDX A;  1GGQ A;  4A63 B;  1OUV A;  5A6B A;  1JCR A;  2PM7 A;  4FJY A;  2PZI A;  1JAF A;  2NC9 A;  1SA5 A;  3UMH A;  2VGX B;  1INZ A;  1DNP A;  4I9C A;  1WDY A;  4X8Q A;  2XS8 A;  3QTH A;  3NQP A;  4DI3 A;  2LQG A;  4IAR A;  3O10 A;  4K7B A;  3WOD F;  1NU7 D;  3SZ7 A;  5CER B;  2YZS A;  2XRH A;  1U6H A;  3CVV A;  3S27 A;  1QPU A;  4AJW A;  3N2Z B;  1MNE A;  2IXN A;  4Q4Z F;  3D3M A;  1QLE C;  2R7V A;  1Z6T A;  5B1A C;  5HRY A;  4GYY A;  2XPY A;  2KGO A;  1TN6 A;  3R7R A;  4DK5 A;  4QFV A;  2LP4 A;  3N24 A;  1KZO A;  4JE9 A;  4MND A;  3JXI A;  2X6F A;  3UKU G;  3ASF A;  3T9O A;  2XL4 A;  3P1U A;  3TJP A;  1FMV A;  3S7J A;  3HJC A;  3B7R L;  1HO8 A;  2B0J A;  4L2Y A;  1YJG A;  1OCR E;  4OAV B;  4LAC B;  2I1K A;  3QNK A;  5E2Q A;  3CHR A;  2ASR A;  4J6I A;  3SGH A;  4BTA A;  4B94 A;  3SXK A;  3DE8 A;  3X2Q E;  1H7I A;  3T6B A;  4BFR A;  2XM4 A;  4URK A;  2IM8 A;  4DX6 D;  3E32 A;  3DPY A;  3V7O A;  2VTB A;  3RQE A;  4KVO A;  4E18 A;  2E87 A;  4AY6 A;  4BJ5 C;  3A11 A;  3VM6 A;  1BR4 A;  2EIK E;  2BC5 A;  4APF A;  1XZP A;  3T8M A;  5DS5 A;  1SZA A;  3IV0 A;  2P9U G;  2OCC E;  3FU6 A;  5FZQ A;  4C7O B;  5HV9 A;  2JEK A;  4ULW A;  1Z3Y A;  2GFH A;  2ETS A;  4DLQ A;  5C1D A;  2V5F A;  4OVU A;  2AXZ A;  5BQI A;  3ZHE B;  2WQ6 A;  2CG2 A;  2J8S D;  2KSF A;  3PMR A;  3ZVR A;  1P5Q A;  2NUT B;  5BNW A;  2AXU A;  2WQ7 A;  2YHE A;  3CV0 A;  4GMJ A;  1G4W R;  4U7E B;  3HNL A;  3U9W A;  5CED B;  5GPG B;  4U07 A;  5EX0 A;  3KEA A;  3ZIB A;  1O87 A;  3W8H A;  2NG1 A;  3B7T A;  3HKK A;  3V79 K;  1HMO A;  1VLT A;  2KM4 A;  2OJQ A;  3HHM A;  3Q7L A;  2J7P A;  5AN8 A;  4J30 B;  3LVR E;  3ZYQ A;  4ME2 A;  4M7C A;  5G04 J;  2A6H F;  2VYI A;  4XI9 A;  4HOU A;  3LES A;  4JEA A;  1Y6I A;  1ZU2 A;  4J8E A;  4NY3 A;  4CDY A;  4GQH A;  5E3C A;  4KZ0 A;  3IEE A;  1GS9 A;  2P0N A;  4EBJ A;  3SD5 A;  2LFF A;  1E8Y A;  3FUJ A;  1T5O A;  2OJE D;  3TOL A;  2H6G A;  2VGY A;  2BUG A;  2WXI A;  3DM9 B;  3MEK A;  4FU3 A;  4YJW A;  4WNG A;  1OW8 A;  3F46 A;  1GW6 A;  1KU2 A;  2YRF A;  3AJI A;  3TG5 A;  3JYY A;  3ZQV A;  3TQO A;  3NF1 A;  1N94 A;  3Q79 A;  3QAR A;  1PY1 A;  2X38 A;  5CRV A;  1C02 A;  2VSO E;  1RKC A;  4XEI G;  2P61 A;  3RAU A;  2WXH A;  4WWO A;  3K7D A;  3U5S A;  4BEJ A;  4AL0 A;  3M79 A;  2AP3 A;  4XEF A;  1GQA A;  1TR2 A;  4EUK B;  3ZSU A;  4IAO A;  2WL8 A;  4P6I C;  3PDN A;  2XLW A;  3PEV B;  4PH4 B;  3CIA A;  3K33 A;  4ACL A;  3EZH A;  2HMZ A;  4AP2 A;  2HYZ A;  4UWF A;  4G78 A;  1APC A;  1LM3 B;  4MVQ A;  1MX2 A;  3NOG D;  3C8G D;  4ZLC A;  5EX3 A;  4RLY A;  1KTM A;  1OWO A;  5KNG A;  5IY5 C;  4M3O A;  3B13 A;  2VCC A;  5G55 A;  4NTA A;  3LNM B;  3U0C A;  1TFO B;  3BUA A;  3UTM A;  3FHE A;  1MND A;  3IQC A;  1MQV A;  5JP7 A;  4NTB A;  4U5G A;  1CGM E;  3PEU B;  4RQI A;  5FJY A;  5EYL A;  2YHS A;  4LEU A;  4KVM A;  3TWU A;  3ONL A;  4JXT A;  1BPO A;  1D1C A;  1OCZ E;  4WAF A;  2RFM A;  3PE3 A;  1OXK A;  2JAB A;  4G1T A;  5D0Q D;  2OVF A;  3E37 A;  4G11 A;  4AE4 A;  3S0X A;  1OY3 D;  4NQ0 A;  2ZXO A;  2AJA A;  4ATZ D;  3ZTM A;  5DS6 A;  1H6O A;  2VSY A;  3JXJ A;  2KK1 A;  2OOE A;  2J9W A;  3C3Q A;  1G4U S;  3S2A A;  4UDV A;  1N0R A;  1V54 E;  4GPM A;  2P58 C;  2KC3 A;  3FEX A;  3QK0 A;  1WY6 A;  4TXR A;  3UNG C;  2P9L G;  4WWP A;  2GRN B;  2YL7 A;  3O4Z A;  3ZNG A;  4EBA G;  4JCH A;  1YZC A;  1Q0G A;  5AQA A;  3FUF A;  1U3D A;  1XZQ A;  4JTD B;  4DRH B;  4DRX E;  3D9J A;  5A6B D;  3SI5 A;  3DI5 A;  5G04 C;  2C04 A;  3ASN E;  2IXP A;  1BU9 A;  2XPI A;  1K1B A;  2E2E A;  4A3T A;  4LNB A;  1BDJ B;  3GEH A;  3FFL A;  4J8S A;  5D66 A;  4JB8 P;  3K1I C;  4KI2 A;  4X0R A;  4XTK A;  2XPZ A;  3DSX A;  2HJM A;  2NSZ A;  3MX3 A;  4YDE A;  4KYO B;  2WVI A;  4C9B B;  4CT0 A;  2FO1 E;  4PJM A;  2XEV A;  2WMO A;  3B0U X;  4KMO A;  3PZD A;  2FI7 A;  1RZ4 A;  5CCL A;  4WGY A;  3KSL A;  2UUH A;  3ASO E;  5FWQ A;  3AG4 C;  5A7D B;  4XKC A;  4U5H A;  2XEN A;  3PE4 A;  2IY0 C;  5ITZ F;  5KWD A;  1HW2 A;  5A6C A;  4K5A B;  5D91 A;  2EIM E;  3M15 A;  3Q78 A;  3G4Z A;  3A9C A;  3AQC A;  2MHR A;  4P29 A;  2XSE A;  2DBA A;  4NQF A;  1N0Q A;  3PNL B;  2EPO A;  4I1M A;  2TMV P;  2IJG X;  2R2L A;  2R9R B;  1JOG A;  4DBR A;  5BV1 A;  2UWJ G;  5HI7 A;  1RKE A;  3TUL A;  1SF8 A;  4JIO A;  3V5X A;  1S7Z A;  4PS3 A;  3G4X A;  3KYJ A;  2ICW G;  2IOL A;  4AV7 A;  3ABM E;  4JL0 A;  2GRR B;  3QC1 A;  3D9K A;  5JHB A;  3DRA A;  3K9I A;  5FQ8 A;  1TWH A;  1RXQ A;  3CHP A;  3NYM A;  3ZTZ A;  1S05 A;  2YVK A;  4G8K A;  1BD8 A;  4MVS A;  1LI5 A;  4DI4 A;  4CJO A;  3NZU A;  4ANJ A;  5F28 E;  1N95 A;  1ZHY A;  2JPU A;  2WXM A;  2EIJ E;  2WXJ A;  2DB4 A;  2UUI A;  1E84 A;  2DYS E;  2KAT A;  1EQ1 A;  1ZHX A;  2J9U A;  4ILI A;  3RFY A;  4V3I A;  4XEV A;  1UJK A;  5BPP A;  2HO1 A;  1O1T A;  1KNY A;  3MV2 B;  4A55 A;  4RVB A;  1IHB A;  3SFY A;  4FC8 A;  3GM3 A;  3QVY A;  3MCX A;  2HSB A;  4TRQ A;  1O1R A;  3NAW A;  5EID A;  4ILH B;  3S7F A;  2PM6 A;  4OYS A;  3EH2 A;  5KCM A;  2F37 A;  1Y8M A;  1Z7Q c;  5DQT A;  4BSX A;  4PR9 A;  1DCE A;  2FEZ A;  3TWW A;  4XPY A;  5DS4 A;  4MVZ A;  3RRU A;  1NU9 C;  5KYX B;  2R5S A;  3PZ3 A;  3UMI A;  3FTZ A;  1OCR C;  4GYO A;  5BXU A;  3Q7G A;  1ZU4 A;  2J9Q A;  2CW0 F;  4PS7 A;  2VSN A;  1D0X A;  1O1S A;  1OR2 A;  5JUA A;  4DJ9 A;  2XZD G;  3X2Q C;  1NL4 A;  3LPZ A;  4U8H A;  3ABL E;  4FJZ A;  1L3P A;  2P9N G;  3DXK G;  2VC9 A;  4OIQ F;  3CVY A;  4OD5 A;  5EIB E;  3DEP A;  4GTO A;  3FOO A;  1I4Y A;  4HRM B;  2DZN A;  5KJK A;  5HSW A;  3CQG B;  1M2V A;  2XL6 A;  2OCC C;  2LSE A;  2WM9 A;  1IZM A;  3WAQ A;  3IXE A;  4YL0 A;  3CLJ A;  2J9B A;  3UR3 C;  2DWZ A;  3ZGQ A;  4CS8 C;  1U3C A;  3LXU X;  2BTD A;  5T8I A;  2CNW A;  4EBB A;  3ASG A;  2WMN A;  3DMD A;  1Z23 A;  4D4X A;  3AG3 E;  1HE8 A;  4CT4 A;  3MV3 B;  2AXV A;  3PRZ A;  2R7R A;  1ZW2 A;  4MBG A;  4DJA A;  4DPR A;  4A1G A;  3IKO B;  5DBK A;  4FUL A;  2V3C C;  2P9P G;  3BG1 B;  1NFN A;  4HRL A;  1E2X A;  3HXC A;  3PDM P;  5EIL A;  4A1S A;  4XWJ A;  1E86 A;  5DVW A;  4BJ1 A;  2ZIR A;  3JYH A;  2WZF A;  2WZG A;  5BW8 C;  4A3V A;  2Q4F A;  2OEW A;  3G50 A;  4EWC A;  1E8X A;  3CVU A;  4U63 A;  4BEP A;  3ZYM A;  2OND A;  2Y3B A;  2VAS A;  2L0I A;  3ESK A;  5A69 A;  1ELK A;  4ULV A;  3CKB A;  4N3C A;  5K0I A;  1MZC A;  3KH2 A;  2PQR A;  1A7E A;  4GTR A;  4N39 A;  2ZU6 B;  4JA7 A;  4HRN A;  5CEC B;  4JJF A;  2PX0 A;  3EHN A;  5G2N A;  2P1A A;  4BX9 A;  4Z9H A;  4R7L A;  4ANV A;  5HQ8 A;  3NOC D;  4EBA A;  3LEV A;  1TNZ A;  5E3A A;  2L81 A;  4CDA A;  4O1P A;  3IPM O;  5JJ7 A;  3OAW A;  3CVX A;  4E0H A;  1C17 M;  4KZC A;  3JRT A;  5DIZ A;  2PQN A;  3EG9 B;  1DVP A;  3C8Z A;  1LIH A;  1N52 A;  4BER A;  1YDI A;  2X6J A;  2LK4 A;  3QDN A;  3RK6 A;  2QY7 A;  3CST A;  4G23 A;  2Q00 A;  2ETC A;  5B1B E;  3R7C A;  2H7O A;  4FHJ A;  3EGD A;  3HIZ A;  4FX5 A;  1D1B A;  1K1A A;  3MKQ A;  2B6C A;  1OWM A;  2ILR A;  3MYV A;  4Y6W A;  3DZA A;  5JMN D;  3GWL A;  4N5C A;  1NI1 A;  1WM5 A;  1YA0 A;  4XPX A;  4UWH A;  3OXF A;  1LVK A;  4O79 A;  1OCO E;  3IHY A;  4ER9 A;  2Q7R A;  1AUE A;  1H2T C;  3ZEF A;  3L8I A;  2XLM A;  4I6J A;  3EIQ C;  3Q5M A;  3C8G A;  3S7D A;  4BJ6 A;  2OG2 A;  2ZXW E;  3S7B A;  1LI7 A;  4A4A A;  2LAH A;  3ASD A;  1OWP A;  2P7V A;  1KT0 A;  3HLZ A;  1OCZ C;  1Z5S C;  5ENP D;  1YAU O;  1O5M A;  2UY1 A;  4KBL A;  4O7G A;  4R32 A;  2R17 C;  4YVO A;  3FUD A;  4WND A;  3SNH A;  3ZW3 A;  2H7V C;  3B0V C;  1G5Z A;  5KYY B;  2Y3D A;  4QQI A;  3ESL A;  4CGV A;  5AGF A;  5BQG A;  3Q7A A;  4O60 A;  5B3S C;  2XRZ A;  1ZBP A;  5T3T A;  2X51 A;  4MVR A;  1V54 C;  3G2T A;  2ZXP A;  3QW0 A;  2FAP B;  1LD8 A;  3JQ0 A;  3NDB B;  3QW1 A;  1FMW A;  4E17 A;  3FTW A;  2LNI A;  4IAQ A;  1UFB A;  1K3Z D;  3UIP C;  5CBO A;  2RD9 A;  3US6 A;  4JUR I;  3PCV A;  5FT9 A;  3UIO C;  4J8D A;  4YN0 B;  3HRA A;  5BUO A;  4CS7 A;  3ASN C;  3DXJ F;  5L0J A;  4MQ9 F;  5LX8 A;  3CQC B;  3HVE A;  5LFA A;  3KYI A;  2BED A;  3GM2 A;  3TWT A;  1TKN A;  4NUR A;  3PRE A;  4G26 A;  4AEZ C;  1NG1 A;  5KJM A;  3CQZ A;  3JCU Q;  3NKE A;  4AM9 A;  3ML9 A;  1H6G A;  4CDR A;  2HZ8 A;  3W8I A;  1IW7 F;  3TWX A;  3C72 A;  5DQZ A;  2L9B A;  1T01 A;  3SY2 A;  3UM0 A;  4AVX A;  4MTO A;  2DIW A;  2RKK A;  3KL4 A;  3HXF A;  3F47 A;  1HY5 A;  3QWW A;  3ASO C;  5COF A;  2J09 A;  1O5H A;  5AAR A;  2GWW A;  2R25 A;  4J7Y A;  2R7X A;  4JTC B;  5AQ7 A;  3T4R A;  2R59 A;  1D0Z A;  3SFX A;  3TWR A;  1U0B B;  2EIM C;  2KJG A;  4HI8 A;  4GML A;  2GGF A;  2CDQ A;  3NZS A;  4MTF A;  2EIN E;  4Q7C A;  4JEH A;  1Y4C A;  1RJ9 A;  4BEM J;  2IXO A;  3ABK E;  2YNQ A;  5TJ5 E;  1BLX B;  3U64 A;  3Q9N C;  1WOL A;  3AS5 A;  2RD0 A;  5EK0 A;  4W8K A;  1N54 A;  2MOW A;  4GB9 A;  3ABM C;  5H7P A;  2HV7 A;  2OOC A;  4ANW A;  3EU5 A;  4O6M A;  2M63 A;  3M1C B;  4JCZ A;  4NC3 A;  3B0P A;  5CIV A;  4MRU A;  1K40 A;  3ITF A;  4N3A A;  3GOD A;  3ZDL A;  3T5X A;  4ONS A;  4CS9 C;  4G7H F;  4G7O F;  2YLI A;  4I2Z A;  5ANR A;  4ZFH A;  3FHD A;  1RW2 A;  1TWC A;  4QDL A;  3FVY A;  5A23 A;  2EIJ C;  1HW1 A;  3V5Z A;  1E8Z A;  2DYS C;  3DM5 A;  2FUL A;  5JA4 D;  2QZA A;  4YWQ A;  3JRM O;  2HFI A;  1G3N B;  5FTP A;  4K5B A;  2CNW D;  5AC4 A;  4ACK A;  4JC7 A;  3FTY A;  3ZXP A;  3DEO A;  1OQC A;  3FAP B;  4EZJ A;  2QFC A;  3T6J A;  3TWS A;  1DC2 A;  3Q7F A;  1IYG A;  2A5E A;  5ENT D;  1L7C A;  1MMA A;  3AJM A;  5A6J A;  2QYJ A;  4GTP A;  4IUL A;  4XLN F;  1N1C A;  1M2O A;  4J7W A;  1HS6 A;  4AK9 A;  3S29 A;  4ZLD A;  5DLJ A;  1BBH A;  4M63 A;  1HXI A;  2LAI A;  3BEH A;  3ZQY A;  3LUT B;  2Q7F A;  3KAE A;  4B0Z A;  2A68 F;  3NB2 A;  3L34 A;  2P9I G;  3AAA C;  1HG2 A;  3ABL C;  2P2C P;  1S63 A;  3CVQ A;  2D4U A;  3EGX B;  1HZ4 A;  4U95 D;  4TXQ A;  4UQZ A;  2I8B A;  1SZ9 A;  3CHM A;  1UN9 A;  4U0Z A;  4I6E A;  1CPQ A;  3C3O A;  1JR8 A;  4EHP A;  3KMI A;  3ECS A;  3QZC A;  3ENE A;  3I5Q A;  3UUX A;  3UIN C;  4YND A;  2DZO A;  2AWC A;  4DX1 A;  1V4A A;  4YT2 A;  3KPH A;  3V31 A;  3NRH A;  2W4B A;  2CHZ A;  3MZL B;  3CHQ A;  1V74 B;  3Q15 A;  3ATP A;  3FEY A;  4C3B A;  1Q0F A;  2C0M A;  3AG3 C;  4KBQ A;  3EHR A;  4C48 B;  3D9M A;  1MX4 A;  4GTT A;  2H7B A;  2KCV A;  2XLH A;  4K0R A;  4LG6 A;  4HVB A;  2Y4U A;  4IN3 B;  4CGW A;  5ARF A;  1OXJ A;  2LD6 A;  3BQO A;  5G05 J;  3HXB A;  4FA6 A;  3ZRH A;  3LY9 A;  2W4M A;  2X3M A;  1YCS B;  3B29 A;  1R5I D;  4LCT A;  3FUM A;  2IOS A;  2VTB B;  3SNX A;  5EGY A;  4XIF A;  1W2W A;  2HKV A;  3RVZ A;  2XEE A;  5CMW A;  3X1O A;  2CFZ A;  2J0W A;  2YL0 A;  4GCO A;  4HOQ A;  5T3W A;  3SEO A;  3QKY A;  3FDQ A;  4PAC A;  5FCL A;  3URZ A;  1YA9 A;  1OCC E;  1FNT c;  3CVW A;  1LS1 A;  1QQ3 A;  4OIN F;  5AJL A;  3EFO A;  3C5R A;  4LRZ A;  3I4U A;  3DE9 A;  1PD0 A;  3HTK C;  2RSE B;  3APF A;  5CI9 A;  4GA0 A;  1N4S A;  4G25 A;  1HH8 A;  4E85 A;  3FP3 A;  4D4N A;  3DKA A;  2B0O E;  2NSF A;  3VLE A;  4Q69 A;  3AGT A;  4GTQ A;  3C3R A;  2NUP A;  4KXK B;  3RU0 A;  1JPL A;  3GW4 A;  2AWI A;  3DAF A;  2HS5 A;  3W2V A;  4FWV A;  3PZ2 A;  4FHK A;  2FBN A;  3BEE A;  3DJN B;  1E83 A;  4YT8 A;  5B1B C;  2KBX A;  5M72 A;  2VCA A;  1QQE A;  1IQU A;  4CJG A;  2CG3 A;  3JZ0 A;  1BR2 A;  2GRL A;  3I5P A;  4AX2 A;  3U3F A;  4RSY A;  4ZHB A;  2GAQ A;  2J9V A;  2YKZ A;  4APO A;  5BT1 A;  1ZW3 A;  1MX6 A;  2XGO A;  1OW7 A;  3SXM A;  5L0H A;  1PV3 A;  2FGY A;  2XHE A;  4AXH A;  5JJT A;  1OCO C;  1QZ2 A;  3MBG A;  3AG2 E;  4DX5 D;  4GTM A;  1HF8 A;  2LXL A;  2JX0 A;  4I1A A;  4HOT A;  1YA7 O;  3B7B A;  2XGM A;  2ZGG A;  5ENQ D;  2ZXW C;  3MLG A;  3J5Q B;  3TD7 A;  1LE4 A;  2BE5 F;  1W3B A;  5KYU A;  3LEO A;  3DAG A;  3E33 A;  3SBS A;  1L5J A;  3UXG A;  1EPU A;  4MW3 A;  2WXF A;  1A17 A;  1XGW A;  5ENN A;  4IRU A;  3LJ3 A;  5JRA A;  2OEV A;  4H7X A;  1D9S A;  4DXW A;  4U8V D;  2P9K G;  4OD4 A;  2R7O A;  2Y4T A;  3E70 C;  1DCQ A;  1EDU A;  3K66 A;  3RRN B;  3WXX A;  2PX3 A;  5G05 C;  1SQM A;  2PP4 A;  3L1M A;  1DOV A;  4I1O B;  2E0I A;  3OXL A;  1SA4 A;  3U8V A;  4JA9 A;  3L0I A;  1LTX A;  4HNA D;  1A5E A;  3L9T A;  4U9E A;  5L3Q A;  3RJV A;  3OEO A;  1ELR A;  3L8J A;  4B8A A;  4F7A A;  4CS9 A;  2EPN A;  5JT4 A;  1U2V G;  3IEG A;  1SZI A;  1OKK A;  2QC9 A;  2XCC A;  1N11 A;  2WZL A;  2GDC A;  1NA0 A;  5JS5 A;  3FTU A;  1T6I A;  3UKR G;  3KKB A;  3LLI A;  5FQ7 A;  4BJ5 A;  2VB6 A;  4GTS A;  3VYW A;  3E4B A;  4AE4 B;  4LSZ E;  2VJ8 A;  4N3B A;  3V2O A;  4BY6 A;  4CSA C;  1TNB A;  2L6H A;  4TXP A;  3QVZ A;  2CHX A;  3VLD A;  1Z63 A;  1HFA A;  1R4T A;  1J8Y F;  3EJN A;  2KZT B;  2Y39 A;  3DSU A;  2DI3 A;  3L82 A;  4N4W A;  1UG7 A;  4JPS A;  3LJN A;  2H6H A;  3ML8 A;  2QE9 A;  3UT8 A;  4G2V A;  1S70 B;  4GZ3 A;  2ZXR A;  4U5F E;  5E33 A;  2ETB A;  4ANX A;  2R7S A;  3RKV A;  4HBD A;  4JC8 A;  5EYP F;  4A2N B;  3G2W A;  1YYX A;  5JLI A;  1ZU5 A;  2EIN C;  4GPK A;  3CEX A;  3JT1 A;  3RQG A;  2IOQ A;  2Q9B A;  1NZN A;  3ABK C;  2J45 A;  3FH8 A;  3KD7 A;  3QMK A;  4JEB A;  1WG0 A;  3FTX A;  5FIO A;  4J8Y A;  4RDA A;  1H2U A;  4LDQ A;  4L1B A;  1Z3I X;  1WWP A;  5AC5 A;  2NXP A;  1T6U A;  2EPM X;  4CIH A;  3TWV A;  2PFD A;  2L6F A;  4RBN A;  3GWN A;  3GZ2 A;  5CRU A;  2PL2 A;  3FXH A;  4GZ5 A;  3LS0 A;  2KC7 A;  3LCA A;  1V55 E;  3ZKJ A;  3U2L A;  1FT1 A;  2EIK C;  1VOM A;  1CPR A;  3RIB A;  3FU3 A;  3JUI A;  2WXR A;  3Q47 B;  3QAQ A;  3Q9U C;  2LFD A;  5T4Y A;  4MW8 A;  1T6Q A;  3EG9 A;  4GU5 A;  4XKB A;  2XRY A;  3AS4 A;  3ZIM A;  4MVO A;  1WAO 1;  4DUI A;  4YVQ C;  1RKE B;  2L6J A;  2RG8 A;  3FOP A;  1N4Q A;  5T1D B;  2XZT G;  4W9R A;  3NYL A;  3UPV A;  3ZWI A;  3LS8 A;  1JCQ A;  3TXN A;  4BT9 A;  2IQC A;  1FVH A;  2WVO A;  3RYL A;  4UWL A;  3T9K A;  4U5B E;  3ZG1 A;  3TWQ A;  3IQ6 A;  4HLL A;  4TV3 A;  1Q2Z A;  4YDY A;  3BRJ A;  4HFG A;  1TN8 A;  1KZP A;  3QWP A;  2KNH A;  2WB7 A;  4BJT A;  4EEC A;  4E6H A;  2VGE A;  4BPM A;  4GA2 A;  3HNK A;  3I4R B;  3BU8 A;  1FT2 A;  3NBN B;  1YAR O;  3W9F A;  2ZPA A;  3LS1 A;  3QWV A;  4IGG A;  3P2B A;  4WUY A;  2Y0B G;  4RG9 A;  3PNT B;  3WHN A;  3NMI A;  2Z15 A;  1TR4 A;  4XI0 A;  1K04 A;  1HG5 A;  2AU5 A;  2YHC A;  3D9P A;  4TUM A;  2XL8 A;  4MVU A;  5KYY A;  1LD7 A;  3RVY A;  4OAU C;  2DVW A;  4EIY A;  1OR3 A;  4RD9 A;  3UM2 A;  3SF4 A;  5AAO A;  2CGE A;  3VF0 A;  4Y6C A;  3ZC4 A;  4FAP B;  3MA5 A;  5L0G A;  3Q49 B;  1MMD A;  1U89 A;  5BXO A;  2HM8 A;  3C62 A;  1VMA A;  5EN5 D;  1VYK A;  2QYU A;  4K0D A;  3Q6N A;  1TWG A;  3S84 A;  4F1P A;  3GAN A;  1NA3 A;  5IY5 E;  3LY7 A;  3R2P A;  5JVE A;  4CX9 A;  4W8P A;  4U0S A;  1A7V A;  1Z3X A;  2I1J A;  3EU9 A;  2KCK A;  4HB5 A;  2XLO A;  3CVP A;  1EI7 A;  4J32 B;  3DST A;  2QY9 A;  3JTL O;  2ZIS A;  5FZS A;  4MKT A;  3K1I A;  1M2V B;  3D9N A;  5HS0 A;  3SQV A;  4G8L A;  2X6H A;  2YL1 A;  1Z6A A;  1E7U A;  1X81 A;  3IHU A;  4KC9 A;  2BKG A;  4DVY P;  2VGX A;  3C98 A;  3GEI A;  1OCC C;  1ORS C;  4CDV A;  3EIJ A;  3SZR A;  5AQ9 A;  2V0P A;  4LLE A;  5KYW B;  4U96 D;  2KXP C;  4CBE A;  1S64 A;  3RW0 A;  2J4B A;  2KYH A;  4Q5S F;  2XEH A;  3DSW A;  2LXM A;  1TYQ G;  1QKR A;  5ARG A;  3IBE A;  1MHQ A;  5T3R A;  2IO2 C;  4JVS A;  2C03 A;  2AW6 A;  5FQ4 A;  2X0C A;  3M4C A;  4LNU D;  3MFN A;  3LEW A;  2H6F A;  3QOU A;  4BES A;  1B68 A;  4AY5 A;  3DWL G;  3L6A A;  4BTB A;  3AG1 E;  3IHV A;  4J8F A;  4DBQ A;  2IU1 A;  3W9G A;  3FMS A;  2A1D D;  1HX8 A;  3PVL A;  1EF1 C;  4AL1 A;  5ANL A;  4Z9I A;  3DPD A;  3UM3 A;  1FPP A;  4I17 A;  3SYN A;  4FAD A;  4U5C E;  3MKR A;  3LNR A;  5KBA A;  4N6H A;  1QSP A;  3DBS A;  5LP0 A;  1ORJ A;  3NKD A;  5F5H A;  3AG2 C;  3HNI A;  1SVX A;  3L22 A;  4IWB A;  3LLK A;  5FQ6 A;  3FH7 A;  1OKK D;  3GZ1 A;  3EHQ A;  4YL3 A;  1Y6D A;  1A41 A;  1K8K G;  5FZR A;  5AJD A;  3L16 A;  2YL3 A;  1FFT C;  2DCP A;  2HSQ A;  3DWW A;  3AG4 E;  2H6I A;  3HDX A;  4EKW A;  2J0X A;  3U3W A;  4JJG A;  4JRZ A;  2Y69 E;  4BX8 A;  1HE1 A;  5D2M C;  1NZE A;  4AOF A;  1RMV A;  4MTG A;  2A0B A;  5KYN A;  3LKU A;  1NP7 A;  1QYM A;  3UI2 A;  4NTF A;  1H6K A;  3FTV A;  3EGD B;  2IYL D;  3MKQ B;  4QI2 A;  4C7O A;  4F3V A;  3WG7 E;  2I6H A;  2XXA B;  4L9P A;  2F8Y A;  3UT4 A;  3ZHE A;  4U0U A;  3UT7 A;  1TEZ A;  2IFU A;  4LDK A;  4JD2 G;  3VLF A;  2NSG A;  2NUT A;  3G2S A;  4PFP A;  3APC A;  3APD A;  3JCK C;  4GCN A;  2QLA A;  2W45 A;  4CYM D;  3C8G B;  5L0C A;  5AYW D;  2GRO B;  2C0L A;  5ENR D;  3R7Q A;  2XLV A;  3VTX A;  3ZUV B;  2LSU A;  3CR3 A;  1VK5 A;  2ZD9 A;  2MYO A;  1YZA A;  1YMP A;  3MJW A;  3IQT A;  3EGX A;  4F6R D;  1E85 A;  2UY1 B;  5AQB A;  4C0M A;  2VQ2 A;  4U8Y D;  4PJJ A;  1YYJ A;  4YDO A;  4HE8 D;  3AU5 A;  3DXM G;  3MYF A;  5ENS D;  2Y3H A;  4LNG A;  1VYI A;  2X6I A;  1LE2 A;  3T8K A;  1K05 A;  3B71 A;  4UWG A;  3EDT B;  4CS8 A;  4F4B A;  4PK4 A;  1QZX A;  2IXM A;  4JHK A;  3KS2 A;  3FDH A;  4EPZ A;  2Y3A A;  4CZ2 D;  4OIO F;  4WJ0 A;  4K5C A;  2OV8 A;  3H2U A;  3GZS A;  1OT8 A;  1ZYR F;  4I6G A;  3LAY A;  1E90 A;  5HKP A;  2L0T B;  2BL2 A;  3HVE B;  4O6Y A;  1VLS A;  3CSF A;  3FWV A;  3FY4 A;  2OEX A;  3UMV A;  4F1S A;  4YT5 A;  3L54 A;  4RG6 A;  3ZFW A;  2VCB A;  3CK9 A;  2R05 A;  4FES A;  2FO7 A;  3CK7 A;  4F53 A;  2FFH A;  4WWN A;  1TNY A;  5B3I A;  4E0I A;  1TN7 A;  4LUN U;  3FU0 A;  2PNO A;  4DOZ A;  2CFU A;  4HQD A;  2CYD A;  4EZK A;  3J06 A;  4HEA J;  4FLH A;  3E9V A;  2GW1 A;  3K1H A;  2BKK B;  1PC2 A;  4C0E A;  4YK5 A;  1TWA A;  4BWR A;  1PCX A;  4HOS A;  1SMY F;  2F22 A;  1D8D A; 
#chains in the Genus database with same CATH homology
 4GZD A;  1V55 C;  4OIP F;  3B7S A;  4GYW A;  3DJU B;  4GYT A;  1OWL A;  3CHO A;  1RJ9 B;  4KNV A;  4B8C B;  3NYJ A;  3AU4 A;  4IYP A;  1TJF A;  3LVQ E;  3SHF A;  2WB2 A;  4DVZ A;  4HLE A;  4UWK A;  4H4K C;  2WXK A;  3FUK A;  4HOR A;  4KT6 B;  1ZHT A;  2LO6 A;  5AEN A;  1H0A A;  2MWQ A;  1M56 C;  1Z5Z A;  4WNE A;  2AVP A;  2Y3G A;  2KCL A;  4L23 A;  2HV6 A;  4CDM A;  1PAQ A;  3LY8 A;  4NRH B;  3UX4 A;  3D9I A;  3FUI A;  3TL5 A;  2R7W A;  1XNF A;  4BG0 A;  2WXO A;  4JZA A;  3UGP A;  3PHF 2;  3U4T A;  2VSX E;  3G2V A;  4XX5 A;  1JWF A;  4Q96 A;  4ANU A;  1VDY A;  3PS6 A;  2DGJ A;  4HXI A;  2WXQ A;  4FP7 A;  3Q6M A;  3I3N A;  3CK8 A;  3VAY A;  4G24 A;  3L08 A;  5L3V A;  3RO3 A;  2G3K A;  4PUC A;  3TXM A;  2VH3 A;  2J08 A;  5KJN A;  3OXG A;  5KJL A;  4PS8 A;  1X5B A;  5LCW J;  2YIN A;  2A69 F;  3PUK A;  5BUZ A;  3B7U X;  4QI0 A;  4OIR F;  2ION A;  5CCM A;  1PD1 A;  1D0Y A;  3FAJ A;  1JPJ A;  4PJN A;  4PJL A;  4EZL A;  1E7V A;  2Q9C A;  2XGS A;  3ZPJ A;  2QTV A;  3DD7 A;  3O48 A;  2KZT A;  2J07 A;  3L17 A;  4D10 C;  2L9J A;  2JLB A;  4K03 A;  2X6K A;  3OWT A;  1KT1 A;  3FUL A;  1JUQ A;  2YQ8 A;  3TG4 A;  5LOZ A;  3AG1 C;  3UGO A;  3ZN3 A;  5AIJ A;  3JQ1 A;  1TJC A;  1LF8 A;  1B89 A;  2MRI A;  2YEV A;  2C2L A;  2G3V A;  1MMG A;  4CRW A;  2HR2 A;  4N06 A;  3D9O A;  3EFO B;  5KYX A;  5CI8 A;  4O6N A;  3SBT B;  4HS2 A;  5EKQ D;  4BJ6 C;  1IHG A;  3TGO A;  2NUP B;  5JJ6 A;  3L13 A;  2Y69 C;  3AQB A;  3N71 A;  4GAA A;  4UQY A;  2JD3 A;  1MMN A;  4O6F A;  3ZVV A;  2I9C A;  4JHR A;  1WGW A;  1JWG A;  5F5F A;  4UI9 J;  4IJJ A;  3WG7 C;  2WVQ A;  3NG1 A;  3CSK A;  3RRM B;  2Q3T A;  4I3M A;  4EQF A;  2A5U A;  1UN8 A;  2MHK A;  4G7Z F;  3RH3 A;  1LKX A;  4U04 A;  4I2W A;  2R7U A;  3ASH A;  3FUH A;  2A6E F;  3PUJ A;  3K6B A;  2OVB A;  2M4E A;  4H7Y A;  5LCW C;  3CKC A;  4MLP A;  3CVN A;  3CHS A;  5JHA A;  5KYU B;  3I4G A;  1JPN A;  4B89 A;  4TUU A;  3SFZ A;  3SP1 A;  3BG0 B;  4LLC A;  4E7S A;  3UMK A;  3HYM B;  3MGB A;  3N0T A;  2BF0 X;  5J90 A;  2A4Z A;  1BR1 A;  2FF4 A;  3LJB A;  4GZC A;  3ZYK A;  1G8X A;  3H65 A;  4HFK B;  4PFO A;  5CMY A;  3CZ6 A;  4JZY A;  3AS8 A;  4XZ4 A;  3R9A B;  5BV0 A;  4WNF A;  2J4D A;  2J7P D;  3FUN A;  4U5E E;  3FUE A;  3EH1 A;  3T5V A;  2WXN A;  1H19 A;  5E75 A;  4N2Q A;  3LDZ A;  1E8W A;  2WXG A;  3ZXS A;  4ILG A;  1M57 C;  4GA1 A;  3LYA A;  3EZI A;  5D92 A;  1FVF A;  4UQX A;  3TAX A;  1H2V C;  1UJJ A;  3CVL A;  3ONK A;  2XCB A;  3ZYL A;  4XLP F;  4DLO A;  2IF4 A;  5KYW A;  3EQL F;  3RKO F;  1KLX A;  1UW4 B;  4OVV A;  4J0U A;  1UG3 A;  2Q9A A;  4YT4 A;  4UI9 C;  4G0H A;  4JW1 A;  4CCA A;  2DYR C;  4ABN A;  2W9Y A;  3PH0 C;  4I43 A;  2KW3 C;  3EHM A;  3CGH A;  4B6I A;  1S0P A;  2J46 A;  2R7T A;  2WQH A;  4E7Z A;  1ZHW A;  2O9X A;  4UI9 K;  2R7Q A;  2I2O A;  4N2S A;  4GZ6 A;  3B9Q A;  3JYS A;  5E76 A;  4JEU A;  2WXL A;  1QNF A;  3U66 A;  3GYZ A;  1OWN A;  1ST6 A;  2GRM A;  3OA1 A;  1J8M F;  4L7T A;  3RO2 A;  2LSV A;  4HFF B;  4NAC A;  2V4L A;  3RIP A;  1ELW A;  3Q4A B;  5D0O D;  2WPV A;  3POV A;  2EIL C;  3JSZ A;  2MYS A;  2PF4 E;  4L2L A;  4I44 A;  4AIF A;  1EYH A;  4XE0 A;  1HU3 A;  3CEQ A;  1FTS A;  2V26 A;  1D1A A;  2XQ0 A;  2XXA A;  5CHE E;  2KQ9 A;  4U5D E;  5J08 A;  3O6X A;  2G62 A;  4CDN A;  2WVN A;  4GEH A;  1MQS A;  3QJZ A;  4LER A;  3S28 A;  4Q94 A;  3W2W A;  4FLB A;  3D9L A;  4BT8 A;  3EPV A;  5EHH A;  2CHW A;  5EDS A;  1ZHZ A;  3QB2 A;  4MS6 A;  4CSA A;  3FU5 A;  3O39 A;  3VTY A;  1IQR A;  1E96 B;  4CEM A;  4JHJ A;  2V8S E;  4KNW A;  5C2Y A;  3OTN A;  2EQX A;  3KEZ A;  2P6V A;  1FFH A;  3G2U A;  4C3D A;  1FCH A;  2J49 A;  2D5R B;  4C3E A;  3UQ3 A;  3FH5 A;  3FTS A;  3ULQ A;  4ATG A;  2WXP A;  4I9E A;  4PDX A;  1OUV A;  2PM7 A;  4FJY A;  2PZI A;  2NC9 A;  3UMH A;  2VGX B;  1INZ A;  1DNP A;  4I9C A;  3NQP A;  4DI3 A;  4K7B A;  3WOD F;  1NU7 D;  3SZ7 A;  2YZS A;  2XRH A;  3CVV A;  3S27 A;  4AJW A;  3N2Z B;  1MNE A;  2IXN A;  4Q4Z F;  3D3M A;  1QLE C;  2R7V A;  1Z6T A;  5B1A C;  4GYY A;  2XPY A;  2KGO A;  3R7R A;  4DK5 A;  4QFV A;  3N24 A;  4MND A;  2X6F A;  3ASF A;  2XL4 A;  3P1U A;  3TJP A;  1FMV A;  3S7J A;  3HJC A;  3B7R L;  1HO8 A;  2B0J A;  4L2Y A;  4LAC B;  2I1K A;  3QNK A;  5E2Q A;  3CHR A;  4J6I A;  3SGH A;  4BTA A;  4B94 A;  3T6B A;  4BFR A;  4URK A;  3V7O A;  2VTB A;  4KVO A;  2E87 A;  4AY6 A;  4BJ5 C;  1BR4 A;  4APF A;  3T8M A;  5DS5 A;  1SZA A;  3IV0 A;  3FU6 A;  5FZQ A;  4C7O B;  2JEK A;  4ULW A;  1Z3Y A;  2GFH A;  4DLQ A;  5C1D A;  2V5F A;  4OVU A;  2AXZ A;  3ZHE B;  2WQ6 A;  2CG2 A;  3PMR A;  3ZVR A;  1P5Q A;  2NUT B;  5BNW A;  2AXU A;  2WQ7 A;  2YHE A;  3CV0 A;  4GMJ A;  3U9W A;  4U07 A;  5EX0 A;  3ZIB A;  1O87 A;  3W8H A;  2NG1 A;  3B7T A;  2KM4 A;  3HHM A;  3Q7L A;  2J7P A;  4J30 B;  3LVR E;  3ZYQ A;  4ME2 A;  5G04 J;  2A6H F;  2VYI A;  4XI9 A;  4HOU A;  3LES A;  1Y6I A;  1ZU2 A;  4J8E A;  4NY3 A;  5E3C A;  4KZ0 A;  3IEE A;  3SD5 A;  1E8Y A;  3FUJ A;  2VGY A;  2BUG A;  2WXI A;  3DM9 B;  3MEK A;  4FU3 A;  4YJW A;  4WNG A;  3F46 A;  1GW6 A;  1KU2 A;  3TG5 A;  3NF1 A;  3QAR A;  1PY1 A;  2X38 A;  2VSO E;  2WXH A;  4WWO A;  3K7D A;  4BEJ A;  1TR2 A;  3ZSU A;  4IAO A;  2WL8 A;  4P6I C;  3PDN A;  3PEV B;  4PH4 B;  3CIA A;  3K33 A;  4ACL A;  3EZH A;  4AP2 A;  2HYZ A;  4UWF A;  4ZLC A;  5EX3 A;  1OWO A;  5IY5 C;  4M3O A;  3B13 A;  5G55 A;  3FHE A;  1MND A;  4U5G A;  3PEU B;  5FJY A;  4KVM A;  2YHS A;  4LEU A;  3ONL A;  4JXT A;  1BPO A;  1D1C A;  4WAF A;  3PE3 A;  4G1T A;  5D0Q D;  2OVF A;  4G11 A;  4AE4 A;  3S0X A;  4NQ0 A;  2ZXO A;  5DS6 A;  2VSY A;  2OOE A;  2J9W A;  3S2A A;  2P58 C;  3FEX A;  3QK0 A;  1WY6 A;  3UNG C;  4WWP A;  3O4Z A;  4EBA G;  4JCH A;  3FUF A;  1U3D A;  3D9J A;  3SI5 A;  5G04 C;  2C04 A;  2IXP A;  2XPI A;  2E2E A;  4A3T A;  3FFL A;  4J8S A;  3K1I C;  4KI2 A;  4X0R A;  4XTK A;  2XPZ A;  2NSZ A;  3MX3 A;  4KYO B;  2WVI A;  4C9B B;  4CT0 A;  4PJM A;  2XEV A;  2WMO A;  3B0U X;  4KMO A;  3PZD A;  2FI7 A;  5CCL A;  5FWQ A;  3AG4 C;  5A7D B;  4XKC A;  4U5H A;  3PE4 A;  5A6C A;  5D91 A;  3AQC A;  4P29 A;  2XSE A;  2DBA A;  3PNL B;  4I1M A;  2IJG X;  4DBR A;  5BV1 A;  2UWJ G;  5HI7 A;  1SF8 A;  1S7Z A;  4PS3 A;  2IOL A;  4AV7 A;  4JL0 A;  3QC1 A;  3D9K A;  5JHB A;  3K9I A;  5FQ8 A;  1TWH A;  3CHP A;  3NYM A;  4DI4 A;  3NZU A;  4ANJ A;  1ZHY A;  2WXM A;  2WXJ A;  2KAT A;  1ZHX A;  2J9U A;  4ILI A;  3RFY A;  4V3I A;  1UJK A;  5BPP A;  2HO1 A;  3MV2 B;  4A55 A;  4RVB A;  4FC8 A;  3MCX A;  4TRQ A;  4ILH B;  3S7F A;  2PM6 A;  4OYS A;  3EH2 A;  5KCM A;  1Y8M A;  5DQT A;  4BSX A;  2FEZ A;  3RRU A;  5DS4 A;  1NU9 C;  5KYX B;  2R5S A;  3UMI A;  3FTZ A;  1OCR C;  4GYO A;  3Q7G A;  1ZU4 A;  2J9Q A;  2CW0 F;  4PS7 A;  2VSN A;  1D0X A;  4U8H A;  3LPZ A;  3X2Q C;  4FJZ A;  4OIQ F;  3CVY A;  4OD5 A;  5KJK A;  5HSW A;  3CQG B;  1M2V A;  2OCC C;  2LSE A;  2WM9 A;  1IZM A;  3CLJ A;  3UR3 C;  3ZGQ A;  4CS8 C;  1U3C A;  3LXU X;  2BTD A;  5T8I A;  2CNW A;  4EBB A;  3ASG A;  2WMN A;  3DMD A;  1Z23 A;  4CT4 A;  1HE8 A;  3MV3 B;  2AXV A;  3PRZ A;  2R7R A;  4DJA A;  4DPR A;  4A1G A;  3IKO B;  5DBK A;  4FUL A;  2V3C C;  3BG1 B;  4A1S A;  4XWJ A;  5DVW A;  4BJ1 A;  3JYH A;  2WZF A;  2WZG A;  5BW8 C;  4A3V A;  4EWC A;  1E8X A;  3CVU A;  4U63 A;  3ZYM A;  2OND A;  2Y3B A;  2VAS A;  2L0I A;  3ESK A;  1ELK A;  3CKB A;  4N3C A;  3KH2 A;  2PQR A;  4N39 A;  2ZU6 B;  4JA7 A;  4JJF A;  2PX0 A;  3EHN A;  5G2N A;  4BX9 A;  4R7L A;  4ANV A;  5HQ8 A;  4EBA A;  3LEV A;  5E3A A;  2L81 A;  5JJ7 A;  3OAW A;  3CVX A;  4KZC A;  3JRT A;  5DIZ A;  2PQN A;  3EG9 B;  1DVP A;  1N52 A;  2X6J A;  3QDN A;  3RK6 A;  2QY7 A;  3CST A;  4G23 A;  2H7O A;  4FHJ A;  3EGD A;  3HIZ A;  4FX5 A;  1D1B A;  3MKQ A;  1OWM A;  2ILR A;  3MYV A;  4Y6W A;  3DZA A;  4N5C A;  1WM5 A;  1YA0 A;  4UWH A;  3OXF A;  1LVK A;  4O79 A;  3IHY A;  1H2T C;  3ZEF A;  4I6J A;  3EIQ C;  3Q5M A;  3S7D A;  4BJ6 A;  2OG2 A;  3S7B A;  2LAH A;  3ASD A;  1OWP A;  2P7V A;  1KT0 A;  3HLZ A;  1OCZ C;  2UY1 A;  4KBL A;  4O7G A;  2R17 C;  4YVO A;  3FUD A;  4WND A;  3SNH A;  3ZW3 A;  2H7V C;  3B0V C;  5KYY B;  2Y3D A;  3ESL A;  4CGV A;  2XRZ A;  5B3S C;  1ZBP A;  5T3T A;  2X51 A;  1V54 C;  3G2T A;  2ZXP A;  3JQ0 A;  3NDB B;  1FMW A;  3FTW A;  2LNI A;  4JUR I;  5FT9 A;  4J8D A;  4YN0 B;  5BUO A;  4CS7 A;  3ASN C;  3DXJ F;  4MQ9 F;  5LX8 A;  3CQC B;  3HVE A;  5LFA A;  1TKN A;  4NUR A;  3PRE A;  4G26 A;  4AEZ C;  1NG1 A;  5KJM A;  3CQZ A;  3JCU Q;  3NKE A;  4AM9 A;  3ML9 A;  4CDR A;  3W8I A;  1IW7 F;  5DQZ A;  2L9B A;  4AVX A;  2DIW A;  3KL4 A;  3F47 A;  3QWW A;  3ASO C;  2J09 A;  1O5H A;  2R7X A;  3T4R A;  2R59 A;  1D0Z A;  2EIM C;  2KJG A;  4GML A;  2GGF A;  2CDQ A;  3NZS A;  4Q7C A;  4JEH A;  1RJ9 A;  2IXO A;  2YNQ A;  3U64 A;  3AS5 A;  2RD0 A;  4W8K A;  1N54 A;  2MOW A;  4GB9 A;  3ABM C;  2HV7 A;  4ANW A;  4O6M A;  2M63 A;  3M1C B;  3B0P A;  4MRU A;  3ITF A;  4N3A A;  3GOD A;  3T5X A;  4CS9 C;  4G7H F;  4G7O F;  4I2Z A;  5ANR A;  3FHD A;  1TWC A;  4QDL A;  3FVY A;  5A23 A;  2EIJ C;  1E8Z A;  2DYS C;  3DM5 A;  2FUL A;  4YWQ A;  5FTP A;  2CNW D;  4ACK A;  3FTY A;  4EZJ A;  2QFC A;  3T6J A;  1IYG A;  1MMA A;  4IUL A;  4XLN F;  1N1C A;  1M2O A;  1HS6 A;  4AK9 A;  3S29 A;  4ZLD A;  5DLJ A;  4M63 A;  1HXI A;  2LAI A;  2Q7F A;  3KAE A;  4B0Z A;  2A68 F;  3L34 A;  1HG2 A;  3ABL C;  3CVQ A;  3EGX B;  1HZ4 A;  4UQZ A;  2I8B A;  1SZ9 A;  3CHM A;  1UN9 A;  4U0Z A;  4I6E A;  3KMI A;  3ECS A;  3QZC A;  3ENE A;  3I5Q A;  3UUX A;  4YND A;  4YT2 A;  3NRH A;  2W4B A;  2CHZ A;  3MZL B;  3CHQ A;  3Q15 A;  3FEY A;  4C3B A;  2C0M A;  3AG3 C;  4KBQ A;  3D9M A;  2H7B A;  2KCV A;  4K0R A;  4HVB A;  2Y4U A;  4IN3 B;  4CGW A;  5ARF A;  5G05 J;  4FA6 A;  3ZRH A;  3LY9 A;  2W4M A;  2X3M A;  4LCT A;  3FUM A;  2IOS A;  2VTB B;  3SNX A;  5EGY A;  4XIF A;  1W2W A;  5CMW A;  3X1O A;  2CFZ A;  2J0W A;  4GCO A;  4HOQ A;  5T3W A;  3SEO A;  3QKY A;  3FDQ A;  5FCL A;  3URZ A;  3CVW A;  1LS1 A;  4OIN F;  5AJL A;  3EFO A;  4LRZ A;  3I4U A;  1PD0 A;  3HTK C;  3APF A;  5CI9 A;  4GA0 A;  4G25 A;  1HH8 A;  4E85 A;  3FP3 A;  3VLE A;  4Q69 A;  2NUP A;  4KXK B;  3RU0 A;  1JPL A;  3GW4 A;  2AWI A;  3DAF A;  3W2V A;  4FWV A;  4FHK A;  2FBN A;  3BEE A;  3DJN B;  4YT8 A;  5B1B C;  5M72 A;  1QQE A;  1IQU A;  2CG3 A;  1BR2 A;  2GRL A;  3I5P A;  4AX2 A;  4RSY A;  2J9V A;  4APO A;  5BT1 A;  2XGO A;  2FGY A;  2XHE A;  4AXH A;  5JJT A;  1OCO C;  1QZ2 A;  1HF8 A;  4I1A A;  4HOT A;  2XGM A;  2ZXW C;  3MLG A;  3TD7 A;  2BE5 F;  1W3B A;  5KYU A;  3DAG A;  3SBS A;  1L5J A;  1EPU A;  2WXF A;  1A17 A;  1XGW A;  5ENN A;  4IRU A;  3LJ3 A;  4H7X A;  4OD4 A;  2R7O A;  2Y4T A;  3E70 C;  1EDU A;  3K66 A;  3RRN B;  3WXX A;  2PX3 A;  5G05 C;  1SQM A;  2PP4 A;  4I1O B;  2E0I A;  3OXL A;  4JA9 A;  3L0I A;  5L3Q A;  3RJV A;  3OEO A;  1ELR A;  4B8A A;  4F7A A;  4CS9 A;  3IEG A;  1SZI A;  1OKK A;  2XCC A;  2WZL A;  1NA0 A;  3FTU A;  3KKB A;  3LLI A;  5FQ7 A;  4BJ5 A;  2VB6 A;  3VYW A;  3E4B A;  4AE4 B;  2VJ8 A;  4N3B A;  4BY6 A;  4CSA C;  2CHX A;  3VLD A;  1Z63 A;  1HFA A;  1J8Y F;  3EJN A;  2KZT B;  2Y39 A;  4JPS A;  3ML8 A;  3UT8 A;  4G2V A;  4GZ3 A;  2ZXR A;  4U5F E;  5E33 A;  4ANX A;  2R7S A;  3RKV A;  4JC8 A;  4A2N B;  3G2W A;  1ZU5 A;  2EIN C;  4GPK A;  3JT1 A;  2IOQ A;  2Q9B A;  1NZN A;  3ABK C;  2J45 A;  3FH8 A;  3KD7 A;  3QMK A;  3FTX A;  4RDA A;  1H2U A;  4L1B A;  1Z3I X;  2NXP A;  4CIH A;  2PFD A;  4RBN A;  3GZ2 A;  2PL2 A;  4GZ5 A;  3LS0 A;  2KC7 A;  3LCA A;  2EIK C;  1VOM A;  3RIB A;  3FU3 A;  3JUI A;  2WXR A;  3Q47 B;  3QAQ A;  5T4Y A;  3EG9 A;  4GU5 A;  4XKB A;  2XRY A;  3AS4 A;  3ZIM A;  1WAO 1;  4YVQ C;  2L6J A;  2RG8 A;  5T1D B;  4W9R A;  3NYL A;  3UPV A;  3LS8 A;  3TXN A;  4BT9 A;  2IQC A;  1FVH A;  2WVO A;  4UWL A;  3RYL A;  4U5B E;  3ZG1 A;  4TV3 A;  4HFG A;  3QWP A;  2KNH A;  2WB7 A;  4BJT A;  4EEC A;  4E6H A;  4GA2 A;  3I4R B;  2ZPA A;  3LS1 A;  3QWV A;  3P2B A;  4WUY A;  4RG9 A;  3PNT B;  2Z15 A;  4XI0 A;  1HG5 A;  3D9P A;  2YHC A;  5KYY A;  4RD9 A;  3SF4 A;  2CGE A;  4Y6C A;  3ZC4 A;  3MA5 A;  3Q49 B;  1MMD A;  2HM8 A;  1VMA A;  1VYK A;  4K0D A;  3Q6N A;  1TWG A;  3GAN A;  1NA3 A;  3LY7 A;  4U0S A;  1Z3X A;  2I1J A;  2KCK A;  3CVP A;  4J32 B;  2QY9 A;  5FZS A;  4MKT A;  1M2V B;  3D9N A;  2X6H A;  1Z6A A;  1E7U A;  4KC9 A;  4DVY P;  2VGX A;  3C98 A;  1OCC C;  3EIJ A;  3SZR A;  2V0P A;  4LLE A;  5KYW B;  4CBE A;  2J4B A;  4Q5S F;  5ARG A;  3IBE A;  1MHQ A;  5T3R A;  4JVS A;  2C03 A;  2AW6 A;  5FQ4 A;  3LEW A;  3QOU A;  4AY5 A;  3L6A A;  4BTB A;  3IHV A;  4J8F A;  4DBQ A;  2IU1 A;  2A1D D;  1HX8 A;  3PVL A;  1EF1 C;  5ANL A;  3DPD A;  4I17 A;  3SYN A;  4FAD A;  4U5C E;  3MKR A;  3LNR A;  3DBS A;  5LP0 A;  3NKD A;  5F5H A;  3AG2 C;  3L22 A;  4IWB A;  3LLK A;  5FQ6 A;  3FH7 A;  1OKK D;  3GZ1 A;  5FZR A;  5AJD A;  3L16 A;  1FFT C;  2DCP A;  3HDX A;  2J0X A;  3U3W A;  4JJG A;  4BX8 A;  1NZE A;  4AOF A;  5KYN A;  3LKU A;  1NP7 A;  1H6K A;  3FTV A;  3EGD B;  2IYL D;  3MKQ B;  4QI2 A;  4C7O A;  4F3V A;  2I6H A;  2XXA B;  3UT4 A;  3ZHE A;  4U0U A;  3UT7 A;  1TEZ A;  2IFU A;  3VLF A;  2NUT A;  3G2S A;  4PFP A;  3APC A;  3APD A;  3JCK C;  4GCN A;  2W45 A;  5AYW D;  2C0L A;  3R7Q A;  3VTX A;  2LSU A;  3CR3 A;  1VK5 A;  3MJW A;  3EGX A;  2UY1 B;  4C0M A;  2VQ2 A;  4PJJ A;  4HE8 D;  3AU5 A;  2Y3H A;  1VYI A;  2X6I A;  4UWG A;  3EDT B;  4CS8 A;  4F4B A;  4PK4 A;  1QZX A;  2IXM A;  4JHK A;  3KS2 A;  3FDH A;  4EPZ A;  2Y3A A;  4OIO F;  4WJ0 A;  2OV8 A;  3GZS A;  1ZYR F;  4I6G A;  3LAY A;  1E90 A;  2L0T B;  3HVE B;  4O6Y A;  3CSF A;  3FWV A;  3FY4 A;  3UMV A;  4F1S A;  4YT5 A;  3L54 A;  4RG6 A;  3ZFW A;  3CK9 A;  4FES A;  2FO7 A;  3CK7 A;  4F53 A;  2FFH A;  4WWN A;  4LUN U;  3FU0 A;  2CFU A;  4DOZ A;  4EZK A;  4HEA J;  4FLH A;  3E9V A;  2GW1 A;  3K1H A;  1PC2 A;  4C0E A;  1TWA A;  4BWR A;  1PCX A;  4HOS A;  1SMY F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...