3EHMA

Structure of bt1043
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
510
structure length
510
Chain Sequence
PLKYGARFMNMQQRVIPIGSPSLTTGPGNDLQNTDLISSGNYIGYFGNNNNWGFNNEANWNFTDSRMNYAYQNFYSQIFLPWNEIYEIAKDSDSPSEQAILEIANIVRNIAWLRATDVFGPIAYNSAGDGSIAPKFDSQEVVYRSMLADLSKSVELLNTISYSVMAQYDLIYNGNVQNWVKLANSLMLRIVVRVHFIDETLAKEYITKALDPKNGGVIEDISSEAKIKSSDKMPLLNSMLASVNEYNETRMGATIWGYLDGYKDPRLSAYFTEGTYGSGSWAQTGYFPVAPTNSKSKSETSYSAKFASRPKVDSNSPLYWFRASETYFLKAEAALYNLIGGDPKTFYEQGINISFQEQGVSGVATYLSGTGKPTGLTGSNYKYGTYNHDLSIGNTSPKWDDYTGNLSKQEEQLQKIITQKYLALYPNAVEAWTEYRRTGFPYLMKPMDEAAPGRIGASIEDCRVPERFRFAPTAYNSNPNMAEIPTLLGGGDIGATKLWWVRSNRPKQPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a SusD homologue, BT1043, involved in mucin O-glycan utilization in a prominent human gut symbiont.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
molecule keywords SusD homolog
total genus 180
structure length 510
sequence length 510
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12741 SusD-like Susd and RagB outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.840 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ehmA03
1.25.40.390 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ehmA01
5FQ6A 3CKBA 3OTNA 3MYVA 5E75A 3KEZA 5T4YA 4LERA 3NQPA 3SNXA 3EHNA 5J90A 3CKCA 3EHMA 3EJNA 4F53A 3JYSA 3I4GA 3HDXA 3L22A 3MCXA 3SGHA 3GZSA 3IV0A 4MRUA 3FDHA 3CK8A 3CK9A 3LEWA 3CGHA 5FQ7A 5LX8A 5FQ4A 3MX3A 3JQ1A 5FQ8A 3P1UA 4L7TA 3QNKA 4F7AA 5T3RA 4Q69A 5E76A 3JQ0A 4PUCA 3CK7A
chains in the Genus database with same CATH superfamily
4YDEA 3GWNA 3JZ0A 3UX4A 4OIPF 3FUHA 2JABA 5D66A 4Z68A 5L0FA 4EZLA 1Y4CA 1FT1A 2DCPA 1M2VB 2AW6A 1K3ZD 3ECSA 1ELWA 4YDWA 3W2VA 4GTOA 2NUPA 4I9CA 4WWNA 4ABNA 4U95D 2WMNA 1PV3A 1SZ9A 1H2VC 3GW4A 2OKUA 3VM6A 1L7CA 4JC8A 1NL4A 1GQAA 2M4EA 1SVXA 1ZU2A 4GZ5A 4PJLA 4JB8P 3H2VA 4CDYA 1H0AA 3IQTA 3MYIA 4P9TA 4UUCA 5CMWA 1VK5A 3ZYQA 4DBRA 2IOSA 2G62A 4B6IA 1HU3A 2R7VA 5KJMA 3N0TA 4AVXA 3EPVA 4Q4ZF 3C3QA 2I1JA 2HV6A 4KMOA 2P9PG 4CYMD 1GGQA 1X81A 1E90A 3AU4A 5B3IA 3CVQA 3MEKA 3PUJA 3UNGC 1LF8A 4U5CE 5JSLA 4D4NA 3D9MA 4AE4A 5AJDA 2Z15A 1E8XA 2RFAA 5C2YA 1HH8A 3KAEA 1FFTC 4HRNA 1YVIA 2ZIRA 1FVFA 2BTDA 2V5QC 3RF3A 2L0TB 2QFCA 5HSWA 1KT0A 4GA1A 4B94A 1MZCA 4AEZC 4HOTA 1ZHTA 3RFYA 2NXPA 3L0IA 3PNLB 3P2BA 5CRUA 5T3RA 3UKUG 4YVOA 2ZXWE 3VTXA 2GW1A 4LLEA 1TN8A 1OW8A 1U0BB 1IQRA 3TD7A 3D3MA 1D8DA 4EECA 4U9EA 3ISMC 5ARFA 2BC5A 1U2VG 4J7TA 3M4BA 1B89A 2ETSA 1WGWA 4XPWA 4BTBA 3H65A 3ZTMA 4U5BE 2YL1A 1KT1A 3T5XA 2XL4A 3CQGB 5KCMA 3EH2A 2OCCE 1TJCA 4N3AA 3W4YA 4DJAA 3W8HA 4JCZA 4A4AA 3ZYKA 4G2VA 3I5QA 3AS8A 1O5HA 1KZPA 4JEBA 3DM5A 3E4BA 4D10C 2EIKE 4I2ZA 1MNEA 4TXQA 4DX5D 3FOPA 4BY6A 3GWLA 3Q7AA 2WVOA 1CPRA 4O1OA 1N94A 3EIJA 2XPZA 2VSNA 3DPYA 1MX4A 1W2WA 4XKBA 4UDVA 2J8SD 1E86A 4HB5A 3K6BA 4N4WA 3MV2B 3WAQA 3SHFA 2GDCA 2ZXPA 3JSZA 4BEMJ 5DQZA 4G25A 3DMDA 5BT1A 1Y6IA 4KYOB 4KBQA 4GYYA 1LVKA 2E87A 2Q4FA 1ZHZA 3DAGA 2L81A 2NG1A 1IXVA 3D9HA 5AQBA 3UIOC 4YL1A 4H4KC 2A5EA 1H9GA 3N71A 2IEJA 3VRCA 3W2WA 3SBSA 4MTFA 5L0DA 4KZ0A 3FUJA 1LE2A 2KJGA 4XWJA 2H6GA 2J8WA 2KXPC 4MW8A 3ZUVB 2OEWA 3JYYA 4UI9K 1KU2A 2MHKA 4NC3A 4JHJA 3V5YA 3EHRA 3FXHA 5BQGA 4DLQA 3B95A 1QKRA 2H6HA 3IV0A 1Z6TA 3RO2A 1N4RA 4FWVA 3CVVA 2CG2A 3CGHA 4KVMA 4AXHA 5A69A 5M72A 3NDBB 3GM3A 2LAHA 3KPHA 3FU6A 3X2QC 1IKND 3V5ZA 4GYWA 3TK0A 2LO6A 2R05A 4GAAA 3DI5A 4J7WA 3ZNGA 1CGME 1OCZE 1A41A 4XEKA 3NQPA 2DYSE 2GRQB 4BETA 3SXZA 3FTXA 4CT4A 4CBEA 5G55A 3AGTA 5COMA 3S84A 3C72A 3LCAA 4OAVB 3APFA 1JOGA 3S29A 3QDNA 3U64A 2VB6A 5A6JA 2WQHA 3ASNE 3D9KA 2Y0BG 2YINA 4GPMA 3O39A 3U8VA 2KSFA 2B0JA 2EPNA 2R7OA 4B8CB 4GZCA 1MQVA 3ASGA 1WG0A 4XX5A 1U3CA 1S64A 2QY9A 2PM7A 2PBEA 2Y3AA 1MMGA 2L6FA 2FEZA 3QW1A 1OR3A 2R7QA 2IQCA 5AQ9A 1SF8A 3LY8A 3AG4C 3KSLA 4FAPB 2UY1B 3CSFA 3TWWA 3L13A 4WGYA 2CNWA 1FPPA 2PX0A 4P6IC 4DRIB 4TXPA 4JZYA 1HF8A 1NSGB 2R7SA 3KH2A 5T1DB 4ME2A 5CMYA 4I1MA 4OINF 3P1UA 5G04C 1NFOA 3IPMO 4L1BA 2IXNA 1BLXB 1ST6A 1RJ9A 1TWCA 2OQMA 4TUMA 2AWCA 3SBTB 4HFFB 1NI1A 3IHYA 2EQXA 2BE5F 2YVKA 4HRLA 2LXMA 4JEAA 5CBNA 4OVVA 4GEHA 1T6QA 4B8AA 2P9LG 3ONKA 3FHEA 5JMND 1EPUA 1WWPA 3CHPA 3ABKC 5HRYA 3NBNB 4E85A 3A11A 3FH7A 5FZSA 2X6IA 3KYJA 1GM5A 3HXFA 5EILA 1T6IA 2DGJA 3NAWA 5G2NA 4UWLA 2YZSA 3FUFA 3Q9UC 2J0XA 4XIFA 2WPVA 1O87A 1JCRA 4NQFA 4MW3A 5KYYB 4JCHA 2R5SA 4JJFA 2RD9A 2FF4A 2WZGA 3CSTA 5A6AA 5CCMA 4WNDA 5A6BD 2UUIA 5D91A 2XEHA 4K5BA 2P0NA 2A5UA 3LS1A 4P9FA 2JEKA 3HNLA 4CDVA 3U9JA 3FUMA 3Q4AB 1K05A 2WXQA 2L6JA 2GRRB 2OJED 4LERA 2F0YA 3PS6A 4GA2A 1ORJA 3G4XA 4G7ZF 5B3SE 3R2PA 2NYJA 3EDTB 2GRNB 1RJ9B 4DBQA 1DOWA 2I8BA 3ASDA 3IEGA 3L1MA 5IY5C 3PDMP 4OIOF 3KKBA 4CSAA 1J8MF 1Z6AA 3ML8A 4Q96A 4V3IA 4JEHA 1WTYA 3HXDA 3DBSA 2NSGA 3TL5A 3G2TA 1Y6DA 5L0JA 4PUCA 1Z5ZA 2PZIA 5E3AA 3DM9B 1JCQA 3UKRG 4GA0A 5EX3A 3FH8A 2J4BA 1Q0KA 2MYOA 3VLDA 1M6TA 4OVUA 3O6XA 3UPVA 3Q6NA 4E18A 2WVIA 4AY5A 2ZXOA 3DAFA 5CHEE 1VYIA 4GTTA 3SO8A 4I9EA 2P9SG 3PDNA 2X6KA 3RYLA 3LJBA 1DVPA 2Y3BA 3SFZA 2XENA 4DVZA 3B7SA 1Q0GA 4R7LA 5L0IA 1NLXA 1JAFA 3JRTA 3LKUA 3CHRA 3NOCD 3BG0B 3PZ2A 2DBAA 4N5QA 2EPKX 2PL2A 4AV7A 3RQGA 2PQRA 3JYHA 1LM3B 1MMNA 3D9PA 2V5FA 4YVQC 4YJWA 5JJTA 3E34A 2RG8A 3S28A 2LQGA 5ENOD 1F1MA 4I1OB 3NYMA 4XE0A 4I6JA 3L8IA 2H6IA 3ZIBA 1YA7O 4PS7A 2H7OA 3DSSA 2XPYA 4A3TA 4BT9A 4JIOA 4QI2A 1TYQG 2HV7A 2J09A 4CS8C 2KK1A 1OCZC 4F4BA 4CSAC 3DEPA 4JD2G 4DK5A 1I4YA 3WG7E 3ZGQA 3CAXA 5A6KA 3LNMB 4DX7D 4HFGA 3TJPA 5KYXB 4L2YA 1R5ID 3CKBA 2DYRE 3CEXA 5H7PA 4J8YA 4AK9A 5EN5D 3UM3A 5E3CA 4U96D 3TGOA 4LDKA 1B68A 3BG1B 2R7UA 3GEIA 3FTWA 3FDQA 3DXKG 1V4AA 2XLDA 2ICWG 3FEYA 2RKKA 4CGVA 1YLMA 1E84A 4BEJA 2KCKA 4U7EB 2UUHA 2P1AA 4LRZA 1PC2A 2J9UA 2CHWA 2VQ2A 2V4LA 3W9FA 1HO8A 2E0IA 4HXIA 4EBAG 2IO2C 2R03A 2XGMA 3AQBA 2XS8A 4U8VD 1YJGA 3PE3A 3UT8A 3L22A 1HG5A 3UXGA 1OXBA 3DSTA 4XEFA 5ENQD 2ZXWC 1FNTc 1AP7A 1ZW3A 3V2OA 1QSPA 2DZNA 3LVRE 4CZ2D 3H2UA 5G05J 2C03A 4XLNF 3RSEG 3N24A 4J7YA 1TR4A 1TWHA 3HYMB 4JXTA 3SNHA 4JHKA 3JCUQ 1EYHA 3ZW3A 3IQ6A 5EGYA 2OEVA 3SNXA 2LK4A 3DJNB 1VTMP 1OY3D 2VSOE 1N11A 3ENEA 1TN7A 3IKOB 5HKPA 3C8ZA 2OOEA 4C0EA 2L9BA 2KW3C 2WQ6A 2EIMC 3DWLG 2OU6A 3SFYA 1LI5A 3NRHA 5AGFA 3Q9NC 3B13A 3O55A 3C3RA 1TFOB 3FTSA 5ENPD 2EPOA 3U66A 2XRZA 4LSZE 3ZHEA 3PHF2 5AAOA 4A63B 1ZHYA 4N6HA 4I43A 3QWWA 2XQ0A 2H7BA 4LNGA 1V74B 2J7PD 2YL7A 4OD5A 4UI9C 2W9YA 3OXGA 2XZDG 3G2VA 1NU9C 2A1DD 2J49A 3SXYA 4FESA 1FVHA 1C03A 1H6OA 2Y3DA 5JA4D 1FFHA 3AU5A 1O1TA 3C98A 1BR1A 3EHNA 3WG7C 2YWAA 5AENA 4C3DA 1NFIE 4EBJA 5F28E 4CGWA 4LNUD 3I3NA 4O60A 4DRJB 1QVXA 4B93B 3GM1A 5T3WA 2FI7A 4LLCA 1E83A 3RKVA 3O48A 4ZHBA 4HNAD 3FUIA 1VLTA 1AUEA 3ZC4A 2IOLA 2PM6A 4UQZA 1TR2A 2KM4A 3V7OA 3R7RA 4ATGA 1YARO 4ANWA 3MLGA 2GROB 4AOFA 2L6GA 1ZU5A 2J45A 3EGXA 2VTBA 4N2SA 2P2CP 1KTMA 3ZVRA 1EF1C 3B71A 3GODA 4GZ6A 4JA7A 4GMJA 2HSQA 1M2OA 4MRUA 3ULEG 2ZGDA 1J8YF 4HOQA 1UG3A 2V0PA 1ZHWA 2R7RA 2P9KG 4FA6A 4Q69A 3SF4A 3AG2C 4A55A 3TWTA 3IHUA 1WN0A 2GA0A 2RD0A 2VSYA 3PEVB 3FU0A 3ASHA 4R32A 1JCSA 3FY4A 1JPNA 3ULQA 4X0RA 3ULYA 3GZ2A 1OCOE 4CT0A 1NP7A 2X6JA 3FH5A 3FHDA 3PEUB 4DX6D 2B6CA 4M3OA 2J9WA 3Q78A 3T4RA 2I1KA 1G3NB 4G26A 3G2UA 3HXEA 1OCRC 4IWBA 3ZRHA 2IFUA 2WXHA 3HKKA 1P5QA 3FVYA 3DSVA 4P29A 1JWFA 4MVMA 3BEEA 4IB4A 2BEDA 4GTQA 2XS1A 4GCNA 1JUQA 4RG6A 5FZQA 1D1CA 1WM5A 3TWQA 3JUEA 3AG3C 2FFHA 3G2SA 2LNIA 2LSUA 2XSEA 3RKOF 2XGOA 2MWQA 2IYLD 5ENNA 3CK9A 2VTBB 1HY5A 3B0PA 2HZ8A 2DYRC 1ZZPA 5B3SC 2A0BA 5DS6A 4DX1A 2C0MA 1RKEB 2CHZA 5T3TA 3SP1A 2P58C 2EIME 4AX2A 2ETCA 4O79A 4N3BA 1Z3XA 4QDLA 3ASFA 2OVFA 3LXUX 3VYWA 2EINC 5BQIA 1ORSC 3PZDA 1Q0DA 4HVBA 3EFOA 2RSEB 3D9IA 3RU0A 4NTFA 4DXWA 1KZOA 3SYNA 3Q15A 3QTHA 1WOLA 1JR8A 4RQIA 1PY1A 4I2WA 4CEMA 4XKCA 1ZVZA 2IY0C 2A6EF 2HM8A 4N3CA 5DS5A 1DOVA 2VCCA 1APCA 3SFXA 1OW7A 4C7OA 1U6HA 2KC3A 2AU5A 2J9BA 4WNEA 1BD8A 1V55E 2GWWA 3LNRA 3QWPA 1OCCC 1TNUA 1UW4B 3LLKA 4G78A 4WUYA 3ZVVA 3K1HA 3G50A 2XEEA 4DJ9A 1QZXA 1DCQA 1MMDA 2IXMA 4A2NB 1HZ4A 3HXBA 5KNGA 4GTSA 3HXCA 1H2TC 1T01A 3L54A 4HQDA 3TG5A 3B0VC 2JPUA 2RFMA 1TN6A 3L6AA 1D0YA 3FUKA 3EU9A 5JJ6A 3PUKA 2QY7A 3GZ1A 2XLWA 1S0PA 3EGDB 2GAQA 1RKEA 1C17M 1Q0MA 1UN9A 3NYLA 3ONLA 1Q0FA 1FTSA 3U2LA 1HXIA 4BJTA 4AP2A 1E96B 4EHPA 3QKYA 5EX0A 3V30A 3KS2A 2Y39A 3QNKA 2IO3C 3OAWA 1HFAA 4N2QA 3ZSUA 4MBGA 4XTKA 2AXVA 4EQFA 5DLJA 4C9BB 3ASOE 1JRAA 1ORYA 3UMHA 1E8YA 4I6EA 4O6FA 4EUKB 3DXJF 4IRUA 3AG2E 2PQNA 1D0XA 3ESLA 1N0RA 1QQEA 3QARA 3POVA 3QW0A 1BR2A 2EPMX 2B0OE 2I6HA 1K1AA 2UWJG 3U3WA 1N0QA 3SEOA 4YL3A 2P6VA 2D4UA 3MKQB 4KZCA 5EYPF 2VGXB 5BNWA 4MQ9F 2AWIA 1QQ3A 1TNOA 2ZXRA 3AJMA 4ATZD 1VYKA 4B0ZA 4IARA 4BERA 3LESA 2YLGA 5CRVA 3E70C 4O7GA 1E7VA 3MCXA 3C8GA 3M15A 1DC2A 1OKKD 3M1CB 1TEZA 3IQ5A 3T9KA 2I9CA 256BA 4EPZA 1Z23A 3DKAA 3EGDA 4PACA 2C04A 4ANXA 3MJWA 1SZAA 4RDAA 3W8IA 2FAPB 3PMRA 4EBAA 5BXUA 3K9IA 2J46A 3K66A 5L0HA 4IN3B 3S2AA 1C02A 1QYMA 1S05A 5A6CA 4BTAA 5D0OD 3VTYA 1TKNA 3FTYA 4MNDA 2J4DA 2P9NG 1FMVA 4NRHB 5G05C 4U5GA 4BJ1A 2EIKC 3NYJA 1HE8A 4FADA 4XQ1A 4ULWA 5ENSD 3MZLB 1YA9A 1BPOA 2AWYA 3CEQA 4I3MA 3KMIA 1ELKA 1VOMA 1TJFA 3HVEB 3MKQA 4BFRA 2WZLA 3UM0A 4K7BA 3DE8A 4IAOA 2M64A 4KBLA 4H54A 3TOMA 1FMWA 3MX3A 1OWLA 3MYFA 2HKVA 2QE9A 5CCLA 2XRHA 4YT2A 2LUHA 3PVLA 3T6BA 2QUPA 1E85A 2IBFA 2BUGA 4PJNA 5JP7A 4IJJA 1ELRA 4RLYA 3L17A 1PD1A 2KZTA 2X6FA 4GQHA 4J30B 1SA5A 1YDIA 4BX8A 2F8XK 3ZFWA 3DPDA 3R9MA 4CDRA 2H6FA 3WHNA 3S9OA 3ZQVA 3LY7A 4FJYA 2AP3A 5EIDA 3A9CA 2LSVA 2EILE 2X3MA 4BEPA 3GEHA 4JL0A 1MYOA 4G0HA 4J32B 3DSXA 3FFLA 2C0LA 3NKDA 3DXMG 1BI7B 4Q5SF 2HMZA 1A7VA 1OW6A 2CNWD 2WVNA 4UWFA 1TQGA 3JRMO 2CFZA 1LPEA 4YT8A 4G7HF 4UI9J 2IF4A 1YYXA 2ZGGA 3UINC 4O6YA 5F5FA 2Y4TA 4DLOA 2FO1E 4MTOA 2DYSC 4LCTA 3U5SA 4YWQA 4AE4B 1OWOA 3HRAA 3NMKA 2J9QA 3DRAA 4N5CA 5AJLA 1MNDA 3JQ0A 3ABLE 1N9AA 1FAPB 1KLXA 2VC9A 5EDSA 4HE8D 2Y1LE 1SQMA 1Z3YA 3TXNA 3ML9A 2CGEA 4AJWA 4OIQF 3LVQE 3GORA 2AJAA 3Q75A 4U63A 4UWHA 3IQCA 3NB2A 4PFOA 2WXJA 3RQFA 4BSZB 2W4MA 5KYWB 4HI8A 3JXJA 3QVZA 4CJGA 2KZTB 5TJ5E 1GS9A 2VCBA 4URKA 2Q9CA 1QBQA 1VB5A 2Q9AA 1BU9A 5DIZA 4GU5A 3MA5A 4BX9A 5HQ8A 4OD4A 3MGBA 2NUTB 2OG2A 1V54E 4PH4B 4N6CA 5FT9A 1NA3A 2KGOA 2Q9BA 4JJGA 4ER9A 5KNHD 3ABKE 4X8QA 3OXFA 2HO1A 3T8KA 3LEWA 4W8KA 2Y4UA 5FWQA 4MTGA 1D1BA 4J8SA 4GTPA 1EA8A 2Y3HA 2VASA 1MMAA 4U0UA 4U8YD 1I5NA 3K33A 1NZNA 4ZLDA 2WXLA 2G3VA 3QJZA 1OWNA 3TWVA 1AWCB 4G8LA 3Q47B 1NA0A 3R9AB 3LLIA 4IULA 1A17A 1SYQA 1BR4A 2NSFA 1IHGA 4G8KA 1LD7A 4LDQA 3KL4A 4TRQA 1GW6A 4W9RA 1I4ZA 4Q7CA 3JCKC 1M2VA 3S7DA 5A6BA 5DVWA 2F22A 2XCCA 2WM9A 2AXZA 3L9TA 5DBKA 2P9IG 2G3KA 4RBNA 1HX8A 4K5CA 3JXIA 4J8DA 1YAUO 1HG2A 3HIZA 2NUTA 3US6A 3D9LA 2YL0A 2XM0A 3C7JA 1XWJA 3TQOA 3MBGA 4K0DA 3ZKJA 5L0GA 2KQ9A 2EIJC 2Y69C 3C62A 3BU8A 4L2LA 1SA4A 5BUZA 4Z9IA 1LIHA 3LJ3A 3I5PA 5T8IA 4CS9C 4I6GA 4E0IA 1FT2A 3SY2A 1K8KG 1H6GA 4H7XA 4JRZA 2DWZA 5CIVA 2MHRA 4DRHB 3OXLA 4KC9A 2J07A 4G7OF 3U9MA 4QQIA 2PF4E 3TWUA 1OKKA 2V26A 5ITZF 2HMQA 3EJNA 3CR3A 1MQSA 3T5VA 5K0IA 3DEOA 2HS5A 2GGFA 5CEDB 3FTZA 4CIPA 3HJCA 2X51A 4GTVA 5JVEA 1JWGA 2XL8A 5L3VA 5FTPA 2CYDA 5GPGB 4KNWA 1D1AA 3M79A 1EQ1A 3B7RL 1YCSB 4HOUA 3AG4E 2Y69E 1A7EA 4FLBA 4BJ6A 4XEIG 4YNDA 3AG1E 3FWVA 1A5EA 5CEAA 2OVBA 3ZDLA 5JLIA 2WMOA 3QC1A 4BJ5C 2PP4A 3I4GA 3UMKA 2DZOA 5E33A 4PDXA 4N39A 1OXKA 3WXXA 4ILHB 4K0RA 1FR0A 3J06A 5C1DA 1OCOC 1L5JA 2CCYA 3UI2A 3EU5A 3UMVA 3NG1A 5EK0A 4A1GA 1OUVA 2OJQA 5T4YA 3UM1A 2OOCA 3TAXA 1OWPA 4LG6A 5AYWD 4MS2A 2Q7RA 2BL2A 3JYSA 1H6KA 4XI0A 2HJ3A 3ESKA 2J0WA 4EIYA 4LNBA 5B1AE 3AOUA 3TOLA 3ZEFA 4F6RD 2XM4A 3PCVA 4GMLA 5F5HA 3C18A 3RK6A 3ASOC 5B1BC 2PNOA 4L6RA 3RH3A 5KYYA 3OA1A 1TWAA 1LI7A 3K1IA 3KEAA 3S27A 2R9RB 4CIHA 4BWRA 3DZAA 2IM8A 1N54A 4F53A 3SGHA 2X0CA 2Q00A 2LP4A 2L7AA 1O1SA 3E33A 4HI9A 4FULA 4ULVA 1MX2A 1PAQA 4F1PA 5FQ8A 3JSEO 5KJKA 3ITFA 4O6MA 2HJMA 1KPSB 2XCBA 2LFFA 5J90A 2DB4A 1WASA 3V31A 1D8EA 5COGA 3UUXA 3S90A 4ILGA 4GZDA 3OWTA 3CZ6A 1WATA 4APFA 3CHOA 3AJIA 2XLHA 4UQXA 4O1PA 1EI7A 4LEUA 2VGEA 1QPUA 1OR2A 3CVWA 1RKCA 2QYUA 4OAUC 4K1OA 4E7SA 1ZHXA 3TWRA 2BKKB 2P7VA 3B0UX 2NC9A 3QB2A 4FHKA 5ENRD 4F7AA 1LKXA 1PD0A 1YMPA 2GRMA 4EWCA 4MKTA 4CJOA 2C2LA 1S7ZA 3CSKA 5BW8C 4AM9A 5BPPA 5D0QD 1BDJB 1UJJA 2J08A 4CS7A 2LAIA 4J8FA 2F8YA 3LUTB 2KCLA 3O4ZA 2R02A 4ONSA 4QI0A 5HI7A 4ACKA 1CGOA 1Z7Qc 2XLEA 2UY1A 2PX3A 4KT6B 5BXOA 1ZU4A 3RO3A 3PREA 3RRUA 1IZMA 2FGYA 3R7CA 2QTVA 4JC7A 2CW0F 1S70B 1N52A 4U9DA 4G1TA 1OCRE 1SW6A 3MFNA 1SR2A 2LXLA 2L6HA 5AQ7A 2R7XA 4M7CA 5COFA 4B89A 2YHCA 1KNYA 1H19A 4ANVA 3ATPA 1LTXA 1QNFA 3J5QB 3VLFA 3KYIA 4DI3A 3HTKC 2ILRA 2A68F 3ZWIA 1WDYA 3CV0A 3ZN3A 4C0MA 4GYTA 2WQ7A 3FAJA 3EZHA 1N4PA 4BPMA 4AL1A 4EBKA 3ZXPA 2WXGA 3UR3C 2JLBA 4QFVA 4CDMA 4C3EA 4A3VA 1SMYF 4EHMA 3GZSA 1PCXA 3HNIA 4JHRA 3CHMA 3U9WA 3CVPA 2I15A 2R7TA 5FJYA 2QYJA 3AAAC 4WAFA 4GCOA 1L3PA 4AL0A 4KNVA 4G24A 3MV3B 3DJUB 5ARGA 2KYHA 2IOQA 1U3DA 3X1OA 2WB7A 3DSUA 5JS5A 1LS4A 2R17C 2R25A 2GFHA 2YHEA 3QOUA 4XZ4A 1OWMA 3FUDA 1Z3IX 3U3BA 3EG9A 4ZLCA 2X38A 4NURA 3F47A 5HS0A 4MVUA 3WODF 3X2QE 2ASRA 4D4XA 3HNKA 3EIQC 4FC8A 3LAYA 1VLSA 4Z9HA 2DVWA 4MVZA 2ONDA 5EKQD 3B7TA 2HR2A 2BF0X 2KATA 2HUJA 3Q7FA 3BRJA 4NY3A 3G4ZA 3VF0A 5D92A 2BKGA 1K04A 5FZTA 2WXNA 4WWPA 3T8MA 3OEOA 1XGWA 1UJKA 3TULA 2LFDA 3N2ZB 2VGYA 3KSQA 2YRFA 5KWDA 1E2XA 2B0HA 2LIGA 4JTCB 3DSWA 4CDAA 1HS6A 5G04J 1Y8MA 2XPIA 5L0CA 2Q7FA 1E8WA 1DCEA 1N4QA 3PZ1A 3ZHEB 1N4SA 1OCCE 5EHHA 5AC4A 3NMIA 3ZTZA 5LOZA 1E7UA 4BSXA 4HS2A 3EG9B 1JMWA 5KBAA 5J08A 1ZB1A 5AQAA 3CHQA 5IY5E 3L82A 2WXOA 3RVZA 3ZIMA 2LSEA 4FX5A 4WJ0A 2EILC 1H6PA 2V3CC 5LP0A 3BQOA 4TUUA 5JHBA 1ZW2A 5BV0A 2I2OA 2HE0A 4DOZA 4DX2A 2R7WA 3LEOA 3CVYA 3B9QA 2KCVA 2X6HA 4WNFA 3LYAA 1AVOB 1S63A 3HNJA 2ZPAA 1WAO1 4NQ0A 3ZQYA 3OTNA 3AS4A 4NCQA 4I1AA 2LD6A 5FIOA 3C8GD 5ANLA 3QK0A 1A7DA 5KYNA 4OYSA 4Q94A 3E32A 1X5BA 1W3BA 2XEVA 5KYXA 3S7JA 1IYGA 4JW1A 3C5RA 4I17A 3BUAA 5FQ7A 3SZ7A 2XZTG 5JT4A 3EGXB 4E0HA 2IXPA 3AG3E 3QVYA 3I4RB 3Q7GA 3QAQA 3CQZA 4U5FE 5DQTA 3NZUA 1YYHA 4A1SA 4O6NA 3IHVA 2WVQA 3AGUA 2HSBA 4BT8A 2YQYA 4LACB 2HYZA 4GPKA 3E30A 3EHQA 5KYUB 2TMVP 3TXMA 1RZ4A 2J9VA 1Q2ZA 4JURI 3HHMA 5FQ4A 1RW2A 3JQ1A 4PR9A 1D0ZA 3QZCA 4U04A 2Y3GA 2Q3TA 2IXOA 2V8SE 2VYIA 4JKVA 4JA9A 4L9PA 2WXIA 1N1CA 3LEVA 4RG9A 1EKYA 3CQCB 3FEXA 3DE9A 2WXFA 5DS4A 2D5RB 4Y6CA 1T9KA 3TJ6A 4K03A 4MVSA 1MX6A 1EDUA 2R2LA 4GYOA 3SZRA 3S7BA 2HFIA 4OIRF 3Q6MA 2J7PA 1HMDA 4XEVA 4E17A 4EKWA 2QLAA 1VDYA 3KD7A 3L34A 1XZPA 5A23A 3L16A 3JTLO 4U0ZA 3D9JA 4E7ZA 3FULA 3V5XA 3PZ3A 5L3QA 1NFNA 2ETAA 2XRYA 3J5PA 3TG4A 1AEPA 4U07A 3EFOB 4C48B 3F46A 2DIWA 4CCAA 1ZYRF 2P61A 5KYUA 1WY6A 3EUVA 4CX9A 5FQ6A 5AIJA 3MYVA 2H7VC 2VSXE 1G5ZA 4UWKA 3PRZA 1M56C 3CIAA 4IAQA 3R7QA 3URZA 1UOHA 4MLPA 3UIPC 4KVOA 1HE1A 1Z5SC 1HW1A 1Z63A 1QZ2A 1R4TA 4FU3A 4C7OB 4ANJA 1OXJA 1HE9A 4HORA 5FZRA 2IJGX 4XI9A 3FAPB 3IBEA 2EIJE 3EQLF 2O9XA 3ZU7B 3ABMC 3LY9A 5E76A 3NKEA 3U0CA 3RRNB 2XXAB 4J0UA 4XLPF 3T6GB 1BI8B 3RVYA 2GRPB 4FP7A 5D2MC 1HW2A 3V2XA 1H2UA 4DVYP 1K1BA 4RD9A 4HEAJ 3FDHA 3Q73A 2WB2A 3RRMB 4F3VA 4BJ6C 4G23A 1U89A 3B7BA 5EYLA 2PFDA 3C3OA 3LS8A 4F1SA 4N06A 2L6BA 3SQVA 2F37A 2MRIA 4DPRA 2NSZA 5CI9A 3ZXSA 1MJ0A 5A7DB 3S0XA 3RIBA 2A6HF 4YL0A 3UT4A 3VLEA 5E2QA 3RW0A 2VJ8A 1IHBA 2WXPA 4UQYA 5BV1A 3CKCA 1BBHA 4H7YA 3UMIA 4CDNA 3HG0D 3TJ5A 1RCPA 3ABME 4NIKA 3SI5A 3BEHA 3DD7A 5ANRA 3U8PA 3EZIA 5EIBE 3L8JA 3SXKA 2YLIA 4J8EA 3E9VA 4TXRA 3Q5MA 4PK4A 3RQEA 4XPYA 5AC5A 5KJLA 3GM2A 4IGGA 2ETBA 2YLDA 5CECB 5E75A 3UQ3A 3ZPJA 3W9GA 1CPQA 4U8HA 5KJNA 2PNNA 2NPUA 1NBBA 2WZFA 3GEEA 2MOWA 4BESA 3FU5A 2XXAA 4AY6A 2EINE 3HLZA 4JE9A 3ABLC 4WABA 4JPSA 3PE4A 4G11A 3CVUA 1NZEA 3FUEA 4PJMA 1XZQA 4HLEA 4PS3A 4E6HA 3C8GB 2H8AA 3UM2A 4JZAA 4GZ3A 3CK7A 4EZKA 4MVRA 3KEZA 3EHMA 1LD8A 5B1BE 3EH1A 1JPLA 3QWVA 2FO7A 2WXKA 1LE4A 1MHQA 4HOSA 4WWOA 5FCLA 1E8ZA 1XNFA 2WXMA 3TWSA 5JJ7A 4DRXE 1UN8A 4YDOA 2KNHA 3FMSA 2IONA 3CK8A 3RAUA 3NOGD 1RMVA 3G2WA 3QMKA 3FTVA 4CS9A 3AQCA 1K40A 3RJVA 2DI3A 3ZG1A 4HRMB 2CFUA 2AXUA 4ZFHA 4KXKB 5CI8A 2W45A 3FOOA 4FLHA 2QC9A 3U3FA 3U4TA 2VH3A 3I4UA 3ASNC 2AVKA 1TNZA 3MKRA 2CDQA 1UFBA 2JX0A 4DUIA 5LCWC 3D9OA 3PNTB 1H7IA 3U2MA 2A0UA 1IQUA 2QZAA 3CVNA 2YQ8A 1OQCA 1V55C 3LDZA 5AN8A 1IW7F 2EPLX 3FU3A 4I44A 4KI2A 3TWXA 3UGPA 3JUIA 4LDRA 4Y6WA 2YKZA 4U5EE 3PZ4A 1YZCA 2MYSA 5JRAA 1JPJA 1T5OA 1FCHA 4W8PA 5JUAA 1TFKB 4RVBA 3GANA 4LUNU 1DNPA 2A4ZA 1QLEC 1M57C 2L9JA 2IU1A 4FHJA 4JTAB 3F6QA 2CG3A 2WXRA 4L23A 4M63A 5LFAA 4HFKB 3O10A 2OV8A 3PH0C 3JT1A 2YEVA 4AIFA 4K5AB 3DWWA 5LCWJ 4FJZA 4MVOA 1TWGA 3NMJA 4GTMA 2XL6A 2FULA 3K7DA 1N95A 4JVSA 3SD5A 3FTUA 4YN0B 3IXEA 1O1RA 2AVPA 5CERB 3UTMA 4Z9JA 3CVLA 1G8XA 1NU7D 3SXMA 4YDYA 2JD3A 2XLOA 2A69F 1OT8A 2GRLA 1SZIA 4BG0A 4PFPA 1TNBA 2M63A 3FUNA 1TNYA 3FP3A 3ZYLA 1INZA 3GYZA 3L08A 3VAYA 3D9NA 4HLLA 4MVQA 4BJ5A 5JHAA 2YNQA 2XLVA 3K1IC 4L7TA 1A0BA 4MS6A 1YYJA 1VMAA 3RIPA 5ENTD 4GTRA 5BQHA 4TV3A 3T9OA 3CLJA 4ILIA 4HBDA 4U0SA 3UT7A 2YL3A 1O3UA 2KC7A 4XPXA 2VGXA 5CBOA 1G4WR 2R59A 4CS8A 3NZSA 2VCAA 4DI4A 3LJNA 4ANUA 3CHSA 4IYPA 3IEEA 1O5MA 2V4HC 3LPZA 4J6IA 2L0IA 3S7FA 1ZBPA 3APDA 1YZAA 4PJJA 1G4US 1BZ4A 1NG1A 2KBXA 4JEUA 5KYWA 1H9TA 2NUPB 2OEXA 2LCHA 2CHXA 2FBNA 3APCA 3UGOA 4GB9A 3AS5A 1LS1A 3E37A 3C63A 3B7UX 4UWGA 4APOA 5LX8A 1UG7A 5FINA 2XHEA 3AG1C 2W4BA 4NTBA 1RXQA 5B1AC 4CRWA 4YT4A 3V79K 2XGSA 3M4CA 3Q79A 4WGZA 1D9SA 1T6UA 4U5DE 4EZJA 4YK5A 2WL8A 2E2EA 1CGNA 2OCCC 3CVXA 4GMRA 2ZD9A 3HDXA 4C3BA 4PS8A 4JTDB 4EBBA 4WNGA 1YA0A 2ZISA 4NACA 3Q7LA 2YHSA 3LS0A 5HV9A 1HMOA 2ZU6B 4YT5A 3NF1A 3T6JA 3B29A 4NTAA 1V54C 5BUOA 3Q49B 4RSYA 3HVEA 3ZYMA 4U5HA 2XLMA 4ACLA 5AARA 2P9UG 2QNLA
chains in the Genus database with same CATH topology
3UX4A 4OIPF 3FUHA 4EZLA 2DCPA 1M2VB 2AW6A 3ECSA 1ELWA 3W2VA 2NUPA 4I9CA 4WWNA 4ABNA 2WMNA 1SZ9A 1H2VC 3GW4A 4JC8A 2M4EA 1ZU2A 4GZ5A 4PJLA 1H0AA 5CMWA 1VK5A 3ZYQA 4DBRA 2IOSA 2G62A 4B6IA 1HU3A 2R7VA 5KJMA 3N0TA 4AVXA 3EPVA 4Q4ZF 2I1JA 2HV6A 4KMOA 3AU4A 3MEKA 1E90A 3CVQA 3PUJA 3UNGC 1LF8A 4U5CE 3D9MA 4AE4A 5AJDA 2Z15A 1E8XA 5C2YA 1HH8A 3KAEA 1FFTC 1FVFA 2BTDA 2L0TB 2QFCA 5HSWA 1KT0A 4GA1A 4B94A 4HOTA 4AEZC 3P2BA 1ZHTA 3RFYA 3L0IA 2NXPA 3PNLB 5T3RA 4YVOA 3VTXA 2GW1A 4LLEA 1IQRA 3TD7A 3D3MA 4EECA 5ARFA 1B89A 1WGWA 4BTBA 3H65A 4U5BE 1KT1A 3T5XA 2XL4A 3CQGB 5KCMA 3EH2A 1TJCA 4N3AA 4DJAA 3W8HA 3ZYKA 4G2VA 3I5QA 3AS8A 1O5HA 3DM5A 3E4BA 4D10C 4I2ZA 1MNEA 4BY6A 2WVOA 3EIJA 2XPZA 2VSNA 1W2WA 4XKBA 3K6BA 3MV2B 3SHFA 2ZXPA 3JSZA 5DQZA 4G25A 3DMDA 5BT1A 1Y6IA 4KYOB 4KBQA 4GYYA 1LVKA 2E87A 1ZHZA 3DAGA 2L81A 2NG1A 4H4KC 3N71A 3W2WA 3SBSA 4KZ0A 3FUJA 2KJGA 4XWJA 4UI9K 1KU2A 2MHKA 4JHJA 4DLQA 3IV0A 1Z6TA 3RO2A 4FWVA 3CVVA 2CG2A 3CGHA 4KVMA 4AXHA 5M72A 3NDBB 2LAHA 3FU6A 3X2QC 4GYWA 2LO6A 4GAAA 3NQPA 3FTXA 4CT4A 4CBEA 5G55A 3LCAA 3APFA 3S29A 3QDNA 3U64A 2VB6A 2WQHA 3D9KA 2YINA 3O39A 2B0JA 2R7OA 4B8CB 4GZCA 3ASGA 4XX5A 1U3CA 2QY9A 2PM7A 2Y3AA 1MMGA 2FEZA 2R7QA 2IQCA 1SF8A 3LY8A 3AG4C 2UY1B 3CSFA 3L13A 2CNWA 2PX0A 4P6IC 4JZYA 1HF8A 2R7SA 3KH2A 5T1DB 4ME2A 5CMYA 4I1MA 4OINF 3P1UA 5G04C 4L1BA 2IXNA 1ST6A 1RJ9A 1TWCA 3SBTB 4HFFB 3IHYA 2EQXA 2BE5F 4OVVA 4GEHA 4B8AA 3ONKA 3FHEA 1EPUA 3CHPA 3ABKC 4E85A 3FH7A 5FZSA 2X6IA 2DGJA 5G2NA 4UWLA 2YZSA 3FUFA 2J0XA 4XIFA 2WPVA 1O87A 5KYYB 4JCHA 2R5SA 4JJFA 2FF4A 2WZGA 3CSTA 5CCMA 4WNDA 5D91A 2A5UA 3LS1A 2JEKA 3FUMA 3Q4AB 2WXQA 2L6JA 4LERA 3PS6A 4GA2A 4G7ZF 3EDTB 1RJ9B 4DBQA 2I8BA 3ASDA 3IEGA 5IY5C 4OIOF 3KKBA 4CSAA 1J8MF 1Z6AA 3ML8A 4Q96A 4V3IA 4JEHA 3DBSA 3TL5A 3G2TA 4PUCA 1Z5ZA 2PZIA 5E3AA 3DM9B 4GA0A 5EX3A 3FH8A 2J4BA 3VLDA 4OVUA 3O6XA 3UPVA 3Q6NA 2WVIA 4AY5A 2ZXOA 5CHEE 3DAFA 1VYIA 4I9EA 3PDNA 2X6KA 3RYLA 3LJBA 1DVPA 2Y3BA 3SFZA 4DVZA 3B7SA 4R7LA 3JRTA 3LKUA 3CHRA 3BG0B 2DBAA 2PL2A 4AV7A 2PQRA 3JYHA 1MMNA 3D9PA 2V5FA 4YVQC 4YJWA 5JJTA 2RG8A 3S28A 4I1OB 3NYMA 4XE0A 4I6JA 3ZIBA 4PS7A 2H7OA 2XPYA 4A3TA 4BT9A 4QI2A 2HV7A 2J09A 4CS8C 1OCZC 4F4BA 4CSAC 4DK5A 3ZGQA 4HFGA 3TJPA 5KYXB 4L2YA 3CKBA 4AK9A 5E3CA 3TGOA 3BG1B 2R7UA 3FTWA 3FDQA 3FEYA 4CGVA 4BEJA 2KCKA 4LRZA 1PC2A 2J9UA 2CHWA 2VQ2A 2V4LA 1HO8A 2E0IA 4HXIA 4EBAG 2XGMA 3AQBA 3PE3A 3UT8A 3L22A 1HG5A 2ZXWC 3LVRE 5G05J 2C03A 4XLNF 3N24A 1TWHA 3HYMB 4JXTA 3SNHA 4JHKA 3JCUQ 1EYHA 3ZW3A 5EGYA 3SNXA 3DJNB 2VSOE 3IKOB 3ENEA 2OOEA 4C0EA 2L9BA 2KW3C 2WQ6A 2EIMC 3NRHA 3B13A 3FTSA 3U66A 2XRZA 3ZHEA 3PHF2 1ZHYA 4I43A 3QWWA 2XQ0A 2H7BA 2J7PD 4OD5A 4UI9C 2W9YA 3OXGA 3G2VA 1NU9C 2A1DD 2J49A 4FESA 1FVHA 2Y3DA 1FFHA 3AU5A 3C98A 1BR1A 3EHNA 3WG7C 5AENA 4C3DA 4CGWA 3I3NA 2FI7A 5T3WA 4LLCA 3RKVA 3O48A 3FUIA 3ZC4A 2IOLA 2PM6A 4UQZA 1TR2A 2KM4A 3V7OA 3R7RA 4ATGA 4ANWA 3MLGA 4AOFA 1ZU5A 2J45A 3EGXA 2VTBA 4N2SA 3ZVRA 1EF1C 3GODA 4GZ6A 4JA7A 4GMJA 1M2OA 4MRUA 1J8YF 4HOQA 1UG3A 2V0PA 1ZHWA 2R7RA 4FA6A 4Q69A 3SF4A 3AG2C 4A55A 2RD0A 2VSYA 3PEVB 3FU0A 3ASHA 3FY4A 1JPNA 3ULQA 4X0RA 3GZ2A 4CT0A 1NP7A 2X6JA 3FH5A 3FHDA 3PEUB 4M3OA 2J9WA 3T4RA 2I1KA 4G26A 3G2UA 1OCRC 4IWBA 3ZRHA 2IFUA 2WXHA 1P5QA 3FVYA 4P29A 1JWFA 3BEEA 4GCNA 1JUQA 4RG6A 5FZQA 1D1CA 1WM5A 3AG3C 2FFHA 3G2SA 2XGOA 2LNIA 2XSEA 3RKOF 2LSUA 2MWQA 2IYLD 5ENNA 3CK9A 2VTBB 3B0PA 2DYRC 5B3SC 5DS6A 2C0MA 2CHZA 5T3TA 3SP1A 2P58C 4AX2A 4N3BA 4O79A 1Z3XA 4QDLA 3ASFA 2OVFA 3LXUX 3VYWA 2EINC 3PZDA 4HVBA 3EFOA 3D9IA 3RU0A 3SYNA 3Q15A 1PY1A 4I2WA 4CEMA 4XKCA 2A6EF 2HM8A 4N3CA 5DS5A 4C7OA 4WNEA 3LNRA 3QWPA 1OCCC 1UW4B 3LLKA 4WUYA 3ZVVA 3K1HA 1QZXA 1MMDA 2IXMA 4A2NB 1HZ4A 1H2TC 3L54A 3TG5A 3B0VC 3L6AA 1D0YA 3FUKA 5JJ6A 3PUKA 2QY7A 3GZ1A 1S0PA 3EGDB 1UN9A 3NYLA 3ONLA 1FTSA 1HXIA 4BJTA 4AP2A 1E96B 3QKYA 5EX0A 3KS2A 2Y39A 3QNKA 3OAWA 1HFAA 4N2QA 3ZSUA 4XTKA 2AXVA 4EQFA 5DLJA 4C9BB 3UMHA 1E8YA 4I6EA 4O6FA 3DXJF 4IRUA 2PQNA 1D0XA 3ESLA 1QQEA 3QARA 3POVA 1BR2A 3U3WA 2I6HA 2UWJG 3SEOA 2P6VA 3MKQB 4KZCA 2VGXB 5BNWA 4MQ9F 2AWIA 2ZXRA 4B0ZA 1VYKA 3LESA 3E70C 4O7GA 1E7VA 3MCXA 1OKKD 3M1CB 1TEZA 2I9CA 4EPZA 1Z23A 3EGDA 2C04A 4ANXA 3MJWA 1SZAA 4RDAA 3W8IA 3PMRA 4EBAA 3K9IA 2J46A 3K66A 4IN3B 3S2AA 5A6CA 4BTAA 5D0OD 3VTYA 1TKNA 3FTYA 4MNDA 2J4DA 1FMVA 4NRHB 5G05C 4U5GA 4BJ1A 2EIKC 3NYJA 1HE8A 4FADA 4ULWA 3MZLB 1BPOA 3CEQA 4I3MA 3KMIA 1ELKA 1VOMA 1TJFA 3HVEB 3MKQA 4BFRA 2WZLA 4K7BA 4IAOA 4KBLA 1FMWA 3MX3A 1OWLA 5CCLA 2XRHA 4YT2A 3PVLA 3T6BA 2BUGA 4PJNA 4IJJA 1ELRA 3L17A 1PD1A 2KZTA 2X6FA 4J30B 4BX8A 3ZFWA 3DPDA 4CDRA 3LY7A 4FJYA 2LSVA 2X3MA 4JL0A 4G0HA 4J32B 3FFLA 2C0LA 3NKDA 4Q5SF 2CNWD 4UWFA 2WVNA 2CFZA 4UI9J 4YT8A 4G7HF 2IF4A 4O6YA 5F5FA 2Y4TA 4DLOA 2DYSC 4LCTA 4YWQA 4AE4B 1OWOA 2J9QA 4N5CA 5AJLA 3JQ0A 1MNDA 1KLXA 5EDSA 4HE8D 1SQMA 1Z3YA 3TXNA 3ML9A 2CGEA 4AJWA 4OIQF 3LVQE 4U63A 4UWHA 4PFOA 2WXJA 2W4MA 5KYWB 2KZTB 4URKA 2Q9CA 2Q9AA 5DIZA 4GU5A 3MA5A 4BX9A 5HQ8A 4OD4A 3MGBA 2NUTB 2OG2A 4PH4B 5FT9A 1NA3A 2KGOA 2Q9BA 4JJGA 3OXFA 2HO1A 3LEWA 4W8KA 2Y4UA 5FWQA 1D1BA 4J8SA 2Y3HA 2VASA 1MMAA 4U0UA 3K33A 1NZNA 4ZLDA 2WXLA 2G3VA 3QJZA 1OWNA 3Q47B 1NA0A 3R9AB 3LLIA 4IULA 1A17A 1BR4A 1IHGA 3KL4A 4TRQA 1GW6A 4W9RA 4Q7CA 3JCKC 1M2VA 3S7DA 5DVWA 2XCCA 2WM9A 2AXZA 5DBKA 2G3KA 4RBNA 1HX8A 4J8DA 1HG2A 3HIZA 2NUTA 3D9LA 4K0DA 2KQ9A 2EIJC 2Y69C 4L2LA 5BUZA 3LJ3A 3I5PA 5T8IA 4CS9C 4I6GA 4H7XA 3OXLA 4KC9A 2J07A 4G7OF 2PF4E 1OKKA 2V26A 3EJNA 3CR3A 1MQSA 3T5VA 2GGFA 3FTZA 3HJCA 2X51A 1JWGA 5L3VA 5FTPA 4KNWA 1D1AA 3B7RL 4HOUA 4FLBA 4BJ6A 4YNDA 3FWVA 2OVBA 2WMOA 3QC1A 4BJ5C 2PP4A 3I4GA 3UMKA 5E33A 4PDXA 4N39A 3WXXA 4ILHB 4K0RA 5C1DA 1OCOC 1L5JA 3UMVA 3NG1A 4A1GA 1OUVA 5T4YA 3TAXA 1OWPA 5AYWD 3JYSA 1H6KA 4XI0A 3ESKA 2J0WA 3ZEFA 4GMLA 5F5HA 3RK6A 3ASOC 5B1BC 3RH3A 5KYYA 3OA1A 1TWAA 3S27A 4CIHA 4BWRA 3DZAA 1N54A 4F53A 3SGHA 4FULA 1PAQA 5FQ8A 5KJKA 3ITFA 4O6MA 2XCBA 5J90A 3UUXA 4ILGA 4GZDA 3OWTA 3CZ6A 4APFA 3CHOA 4UQXA 4LEUA 3CVWA 4E7SA 1ZHXA 2P7VA 3B0UX 2NC9A 3QB2A 4FHKA 4F7AA 1LKXA 1PD0A 2GRMA 4EWCA 4MKTA 2C2LA 1S7ZA 3CSKA 5BW8C 4AM9A 5BPPA 5D0QD 1UJJA 2J08A 4CS7A 4J8FA 2LAIA 2KCLA 3O4ZA 4QI0A 5HI7A 4ACKA 2UY1A 2PX3A 4KT6B 1ZU4A 3RO3A 3PREA 3RRUA 1IZMA 2FGYA 2QTVA 2CW0F 1N52A 4G1TA 2R7XA 4B89A 2YHCA 1H19A 4ANVA 1QNFA 3VLFA 4DI3A 3HTKC 2ILRA 2A68F 3CV0A 3ZN3A 4C0MA 4GYTA 2WQ7A 3FAJA 3EZHA 2WXGA 3UR3C 2JLBA 4QFVA 4CDMA 4C3EA 4A3VA 1SMYF 3GZSA 1PCXA 4JHRA 3CHMA 3U9WA 3CVPA 2R7TA 5FJYA 4WAFA 4GCOA 4KNVA 4G24A 3MV3B 3DJUB 5ARGA 2IOQA 1U3DA 3X1OA 2WB7A 2R17C 2GFHA 2YHEA 3QOUA 4XZ4A 1OWMA 3FUDA 1Z3IX 3EG9A 4ZLCA 2X38A 4NURA 3F47A 3WODF 3EIQC 4FC8A 3LAYA 5EKQD 2ONDA 3B7TA 2HR2A 2BF0X 2KATA 4NY3A 5D92A 2WXNA 4WWPA 3T8MA 3OEOA 1XGWA 1UJKA 3N2ZB 2VGYA 1HS6A 5G04J 1Y8MA 2XPIA 2Q7FA 1E8WA 3ZHEB 5EHHA 5LOZA 1E7UA 4BSXA 4HS2A 3EG9B 5J08A 3CHQA 2WXOA 3ZIMA 2LSEA 4FX5A 4WJ0A 2EILC 2V3CC 5LP0A 4TUUA 5JHBA 5BV0A 2I2OA 4DOZA 2R7WA 3CVYA 3B9QA 2KCVA 2X6HA 4WNFA 3LYAA 2ZPAA 1WAO1 4NQ0A 3OTNA 3AS4A 4I1AA 5ANLA 3QK0A 5KYNA 4OYSA 4Q94A 1X5BA 1W3BA 2XEVA 5KYXA 3S7JA 1IYGA 4JW1A 4I17A 5FQ7A 3SZ7A 3EGXB 2IXPA 3I4RB 3Q7GA 3QAQA 3CQZA 4U5FE 5DQTA 3NZUA 4A1SA 4O6NA 3IHVA 2WVQA 4BT8A 4LACB 2HYZA 4GPKA 5KYUB 3TXMA 2J9VA 4JURI 3HHMA 5FQ4A 3JQ1A 1D0ZA 3QZCA 4U04A 2Y3GA 2Q3TA 2IXOA 2V8SE 2VYIA 4JA9A 2WXIA 1N1CA 3LEVA 4RG9A 3CQCB 3FEXA 2WXFA 5DS4A 2D5RB 4Y6CA 4K03A 1EDUA 4GYOA 3SZRA 3S7BA 4OIRF 3Q6MA 2J7PA 1VDYA 3KD7A 3L34A 5A23A 3L16A 4U0ZA 3D9JA 4E7ZA 3FULA 5L3QA 2XRYA 3TG4A 4U07A 3EFOB 3F46A 2DIWA 4CCAA 1ZYRF 5KYUA 1WY6A 5FQ6A 5AIJA 3MYVA 2H7VC 2VSXE 4UWKA 3PRZA 1M56C 3CIAA 3R7QA 3URZA 4MLPA 4KVOA 1Z63A 1QZ2A 4FU3A 4C7OB 4ANJA 4HORA 5FZRA 2IJGX 4XI9A 3IBEA 3EQLF 2O9XA 3ABMC 3LY9A 5E76A 3NKEA 3RRNB 2XXAB 4J0UA 4XLPF 4FP7A 1H2UA 4DVYP 4RD9A 4HEAJ 3FDHA 2WB2A 3RRMB 4F3VA 4BJ6C 4G23A 2PFDA 3LS8A 4F1SA 4N06A 2MRIA 4DPRA 2NSZA 5CI9A 3ZXSA 5A7DB 3S0XA 3RIBA 2A6HF 3UT4A 3VLEA 5E2QA 2VJ8A 2WXPA 4UQYA 5BV1A 3CKCA 4H7YA 3UMIA 4CDNA 3SI5A 3DD7A 5ANRA 3EZIA 4J8EA 3E9VA 3Q5MA 4PK4A 5KJLA 5E75A 3UQ3A 3ZPJA 4U8HA 5KJNA 2WZFA 2MOWA 3FU5A 2XXAA 4AY6A 3HLZA 3ABLC 4JPSA 3PE4A 4G11A 3CVUA 1NZEA 3FUEA 4PJMA 4HLEA 4PS3A 4E6HA 4JZAA 4GZ3A 3CK7A 4EZKA 3KEZA 3EHMA 3EH1A 1JPLA 3QWVA 2FO7A 2WXKA 4HOSA 1MHQA 4WWOA 5FCLA 1E8ZA 1XNFA 2WXMA 5JJ7A 1UN8A 2KNHA 2IONA 3CK8A 3G2WA 3QMKA 3FTVA 4CS9A 3AQCA 3RJVA 3ZG1A 2CFUA 2AXUA 4KXKB 5CI8A 2W45A 4FLHA 3U4TA 2VH3A 3I4UA 3ASNC 3MKRA 2CDQA 5LCWC 3D9OA 3PNTB 1IQUA 3CVNA 2YQ8A 1V55C 3LDZA 1IW7F 3FU3A 4I44A 4KI2A 3UGPA 3JUIA 4Y6WA 4U5EE 2MYSA 1JPJA 1FCHA 4RVBA 3GANA 4LUNU 1DNPA 2A4ZA 1QLEC 1M57C 2L9JA 2IU1A 4FHJA 2CG3A 2WXRA 4L23A 4M63A 5LFAA 4HFKB 2OV8A 3PH0C 3JT1A 2YEVA 4AIFA 5LCWJ 4FJZA 1TWGA 2FULA 3K7DA 4JVSA 3SD5A 3FTUA 4YN0B 2AVPA 3CVLA 1G8XA 1NU7D 2JD3A 2GRLA 2A69F 1SZIA 4BG0A 4PFPA 2M63A 3FUNA 3FP3A 3ZYLA 1INZA 3GYZA 3L08A 3VAYA 3D9NA 4BJ5A 5JHAA 2YNQA 3K1IC 4L7TA 4MS6A 1VMAA 3RIPA 4TV3A 3CLJA 4ILIA 4U0SA 3UT7A 2KC7A 2VGXA 2R59A 4CS8A 3NZSA 4DI4A 4ANUA 3CHSA 4IYPA 3IEEA 3LPZA 4J6IA 2L0IA 3S7FA 1ZBPA 3APDA 4PJJA 1NG1A 4JEUA 5KYWA 2NUPB 2CHXA 2FBNA 3APCA 3UGOA 4GB9A 3AS5A 1LS1A 3B7UX 4APOA 4UWGA 5LX8A 2XHEA 3AG1C 2W4BA 5B1AC 4CRWA 4YT4A 2XGSA 4U5DE 4EZJA 2WL8A 2E2EA 2OCCC 3CVXA 3HDXA 4C3BA 4PS8A 4WNGA 4EBBA 1YA0A 4NACA 3Q7LA 2YHSA 3LS0A 2ZU6B 4YT5A 3NF1A 3T6JA 1V54C 4RSYA 5BUOA 3Q49B 3HVEA 3ZYMA 4U5HA 4ACLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FQ6 A;  3CKB A;  3OTN A;  3MYV A;  5E75 A;  3KEZ A;  5T4Y A;  4LER A;  3NQP A;  3SNX A;  3EHN A;  5J90 A;  3CKC A;  3EHM A;  3EJN A;  4F53 A;  3JYS A;  3I4G A;  3HDX A;  3L22 A;  3MCX A;  3SGH A;  3GZS A;  3IV0 A;  4MRU A;  3FDH A;  3CK8 A;  3CK9 A;  3LEW A;  3CGH A;  5FQ7 A;  5LX8 A;  5FQ4 A;  3MX3 A;  3JQ1 A;  5FQ8 A;  3P1U A;  4L7T A;  3QNK A;  4F7A A;  5T3R A;  4Q69 A;  5E76 A;  3JQ0 A;  4PUC A;  3CK7 A; 
#chains in the Genus database with same CATH topology
 4YDE A;  3GWN A;  3JZ0 A;  3UX4 A;  4OIP F;  3FUH A;  2JAB A;  5D66 A;  4Z68 A;  5L0F A;  4EZL A;  1Y4C A;  1FT1 A;  2DCP A;  1M2V B;  2AW6 A;  1K3Z D;  3ECS A;  1ELW A;  4YDW A;  3W2V A;  4GTO A;  2NUP A;  4I9C A;  4WWN A;  4ABN A;  4U95 D;  2WMN A;  1PV3 A;  1SZ9 A;  1H2V C;  3GW4 A;  2OKU A;  3VM6 A;  1L7C A;  4JC8 A;  1NL4 A;  1GQA A;  2M4E A;  1SVX A;  1ZU2 A;  4GZ5 A;  4PJL A;  4JB8 P;  3H2V A;  4CDY A;  1H0A A;  3IQT A;  3MYI A;  4P9T A;  4UUC A;  5CMW A;  1VK5 A;  3ZYQ A;  4DBR A;  2IOS A;  2G62 A;  4B6I A;  1HU3 A;  2R7V A;  5KJM A;  3N0T A;  4AVX A;  3EPV A;  4Q4Z F;  3C3Q A;  2I1J A;  2HV6 A;  4KMO A;  2P9P G;  4CYM D;  1GGQ A;  1X81 A;  1E90 A;  3AU4 A;  5B3I A;  3CVQ A;  3MEK A;  3PUJ A;  3UNG C;  1LF8 A;  4U5C E;  5JSL A;  4D4N A;  3D9M A;  4AE4 A;  5AJD A;  2Z15 A;  1E8X A;  2RFA A;  5C2Y A;  1HH8 A;  3KAE A;  1FFT C;  4HRN A;  1YVI A;  2ZIR A;  1FVF A;  2BTD A;  2V5Q C;  3RF3 A;  2L0T B;  2QFC A;  5HSW A;  1KT0 A;  4GA1 A;  4B94 A;  1MZC A;  4AEZ C;  4HOT A;  1ZHT A;  3RFY A;  2NXP A;  3L0I A;  3PNL B;  3P2B A;  5CRU A;  5T3R A;  3UKU G;  4YVO A;  2ZXW E;  3VTX A;  2GW1 A;  4LLE A;  1TN8 A;  1OW8 A;  1U0B B;  1IQR A;  3TD7 A;  3D3M A;  1D8D A;  4EEC A;  4U9E A;  3ISM C;  5ARF A;  2BC5 A;  1U2V G;  4J7T A;  3M4B A;  1B89 A;  2ETS A;  1WGW A;  4XPW A;  4BTB A;  3H65 A;  3ZTM A;  4U5B E;  2YL1 A;  1KT1 A;  3T5X A;  2XL4 A;  3CQG B;  5KCM A;  3EH2 A;  2OCC E;  1TJC A;  4N3A A;  3W4Y A;  4DJA A;  3W8H A;  4JCZ A;  4A4A A;  3ZYK A;  4G2V A;  3I5Q A;  3AS8 A;  1O5H A;  1KZP A;  4JEB A;  3DM5 A;  3E4B A;  4D10 C;  2EIK E;  4I2Z A;  1MNE A;  4TXQ A;  4DX5 D;  3FOP A;  4BY6 A;  3GWL A;  3Q7A A;  2WVO A;  1CPR A;  4O1O A;  1N94 A;  3EIJ A;  2XPZ A;  2VSN A;  3DPY A;  1MX4 A;  1W2W A;  4XKB A;  4UDV A;  2J8S D;  1E86 A;  4HB5 A;  3K6B A;  4N4W A;  3MV2 B;  3WAQ A;  3SHF A;  2GDC A;  2ZXP A;  3JSZ A;  4BEM J;  5DQZ A;  4G25 A;  3DMD A;  5BT1 A;  1Y6I A;  4KYO B;  4KBQ A;  4GYY A;  1LVK A;  2E87 A;  2Q4F A;  1ZHZ A;  3DAG A;  2L81 A;  2NG1 A;  1IXV A;  3D9H A;  5AQB A;  3UIO C;  4YL1 A;  4H4K C;  2A5E A;  1H9G A;  3N71 A;  2IEJ A;  3VRC A;  3W2W A;  3SBS A;  4MTF A;  5L0D A;  4KZ0 A;  3FUJ A;  1LE2 A;  2KJG A;  4XWJ A;  2H6G A;  2J8W A;  2KXP C;  4MW8 A;  3ZUV B;  2OEW A;  3JYY A;  4UI9 K;  1KU2 A;  2MHK A;  4NC3 A;  4JHJ A;  3V5Y A;  3EHR A;  3FXH A;  5BQG A;  4DLQ A;  3B95 A;  1QKR A;  2H6H A;  3IV0 A;  1Z6T A;  3RO2 A;  1N4R A;  4FWV A;  3CVV A;  2CG2 A;  3CGH A;  4KVM A;  4AXH A;  5A69 A;  5M72 A;  3NDB B;  3GM3 A;  2LAH A;  3KPH A;  3FU6 A;  3X2Q C;  1IKN D;  3V5Z A;  4GYW A;  3TK0 A;  2LO6 A;  2R05 A;  4GAA A;  3DI5 A;  4J7W A;  3ZNG A;  1CGM E;  1OCZ E;  1A41 A;  4XEK A;  3NQP A;  2DYS E;  2GRQ B;  4BET A;  3SXZ A;  3FTX A;  4CT4 A;  4CBE A;  5G55 A;  3AGT A;  5COM A;  3S84 A;  3C72 A;  3LCA A;  4OAV B;  3APF A;  1JOG A;  3S29 A;  3QDN A;  3U64 A;  2VB6 A;  5A6J A;  2WQH A;  3ASN E;  3D9K A;  2Y0B G;  2YIN A;  4GPM A;  3O39 A;  3U8V A;  2KSF A;  2B0J A;  2EPN A;  2R7O A;  4B8C B;  4GZC A;  1MQV A;  3ASG A;  1WG0 A;  4XX5 A;  1U3C A;  1S64 A;  2QY9 A;  2PM7 A;  2PBE A;  2Y3A A;  1MMG A;  2L6F A;  2FEZ A;  3QW1 A;  1OR3 A;  2R7Q A;  2IQC A;  5AQ9 A;  1SF8 A;  3LY8 A;  3AG4 C;  3KSL A;  4FAP B;  2UY1 B;  3CSF A;  3TWW A;  3L13 A;  4WGY A;  2CNW A;  1FPP A;  2PX0 A;  4P6I C;  4DRI B;  4TXP A;  4JZY A;  1HF8 A;  1NSG B;  2R7S A;  3KH2 A;  5T1D B;  4ME2 A;  5CMY A;  4I1M A;  4OIN F;  3P1U A;  5G04 C;  1NFO A;  3IPM O;  4L1B A;  2IXN A;  1BLX B;  1ST6 A;  1RJ9 A;  1TWC A;  2OQM A;  4TUM A;  2AWC A;  3SBT B;  4HFF B;  1NI1 A;  3IHY A;  2EQX A;  2BE5 F;  2YVK A;  4HRL A;  2LXM A;  4JEA A;  5CBN A;  4OVV A;  4GEH A;  1T6Q A;  4B8A A;  2P9L G;  3ONK A;  3FHE A;  5JMN D;  1EPU A;  1WWP A;  3CHP A;  3ABK C;  5HRY A;  3NBN B;  4E85 A;  3A11 A;  3FH7 A;  5FZS A;  2X6I A;  3KYJ A;  1GM5 A;  3HXF A;  5EIL A;  1T6I A;  2DGJ A;  3NAW A;  5G2N A;  4UWL A;  2YZS A;  3FUF A;  3Q9U C;  2J0X A;  4XIF A;  2WPV A;  1O87 A;  1JCR A;  4NQF A;  4MW3 A;  5KYY B;  4JCH A;  2R5S A;  4JJF A;  2RD9 A;  2FF4 A;  2WZG A;  3CST A;  5A6A A;  5CCM A;  4WND A;  5A6B D;  2UUI A;  5D91 A;  2XEH A;  4K5B A;  2P0N A;  2A5U A;  3LS1 A;  4P9F A;  2JEK A;  3HNL A;  4CDV A;  3U9J A;  3FUM A;  3Q4A B;  1K05 A;  2WXQ A;  2L6J A;  2GRR B;  2OJE D;  4LER A;  2F0Y A;  3PS6 A;  4GA2 A;  1ORJ A;  3G4X A;  4G7Z F;  5B3S E;  3R2P A;  2NYJ A;  3EDT B;  2GRN B;  1RJ9 B;  4DBQ A;  1DOW A;  2I8B A;  3ASD A;  3IEG A;  3L1M A;  5IY5 C;  3PDM P;  4OIO F;  3KKB A;  4CSA A;  1J8M F;  1Z6A A;  3ML8 A;  4Q96 A;  4V3I A;  4JEH A;  1WTY A;  3HXD A;  3DBS A;  2NSG A;  3TL5 A;  3G2T A;  1Y6D A;  5L0J A;  4PUC A;  1Z5Z A;  2PZI A;  5E3A A;  3DM9 B;  1JCQ A;  3UKR G;  4GA0 A;  5EX3 A;  3FH8 A;  2J4B A;  1Q0K A;  2MYO A;  3VLD A;  1M6T A;  4OVU A;  3O6X A;  3UPV A;  3Q6N A;  4E18 A;  2WVI A;  4AY5 A;  2ZXO A;  3DAF A;  5CHE E;  1VYI A;  4GTT A;  3SO8 A;  4I9E A;  2P9S G;  3PDN A;  2X6K A;  3RYL A;  3LJB A;  1DVP A;  2Y3B A;  3SFZ A;  2XEN A;  4DVZ A;  3B7S A;  1Q0G A;  4R7L A;  5L0I A;  1NLX A;  1JAF A;  3JRT A;  3LKU A;  3CHR A;  3NOC D;  3BG0 B;  3PZ2 A;  2DBA A;  4N5Q A;  2EPK X;  2PL2 A;  4AV7 A;  3RQG A;  2PQR A;  3JYH A;  1LM3 B;  1MMN A;  3D9P A;  2V5F A;  4YVQ C;  4YJW A;  5JJT A;  3E34 A;  2RG8 A;  3S28 A;  2LQG A;  5ENO D;  1F1M A;  4I1O B;  3NYM A;  4XE0 A;  4I6J A;  3L8I A;  2H6I A;  3ZIB A;  1YA7 O;  4PS7 A;  2H7O A;  3DSS A;  2XPY A;  4A3T A;  4BT9 A;  4JIO A;  4QI2 A;  1TYQ G;  2HV7 A;  2J09 A;  4CS8 C;  2KK1 A;  1OCZ C;  4F4B A;  4CSA C;  3DEP A;  4JD2 G;  4DK5 A;  1I4Y A;  3WG7 E;  3ZGQ A;  3CAX A;  5A6K A;  3LNM B;  4DX7 D;  4HFG A;  3TJP A;  5KYX B;  4L2Y A;  1R5I D;  3CKB A;  2DYR E;  3CEX A;  5H7P A;  4J8Y A;  4AK9 A;  5EN5 D;  3UM3 A;  5E3C A;  4U96 D;  3TGO A;  4LDK A;  1B68 A;  3BG1 B;  2R7U A;  3GEI A;  3FTW A;  3FDQ A;  3DXK G;  1V4A A;  2XLD A;  2ICW G;  3FEY A;  2RKK A;  4CGV A;  1YLM A;  1E84 A;  4BEJ A;  2KCK A;  4U7E B;  2UUH A;  2P1A A;  4LRZ A;  1PC2 A;  2J9U A;  2CHW A;  2VQ2 A;  2V4L A;  3W9F A;  1HO8 A;  2E0I A;  4HXI A;  4EBA G;  2IO2 C;  2R03 A;  2XGM A;  3AQB A;  2XS8 A;  4U8V D;  1YJG A;  3PE3 A;  3UT8 A;  3L22 A;  1HG5 A;  3UXG A;  1OXB A;  3DST A;  4XEF A;  5ENQ D;  2ZXW C;  1FNT c;  1AP7 A;  1ZW3 A;  3V2O A;  1QSP A;  2DZN A;  3LVR E;  4CZ2 D;  3H2U A;  5G05 J;  2C03 A;  4XLN F;  3RSE G;  3N24 A;  4J7Y A;  1TR4 A;  1TWH A;  3HYM B;  4JXT A;  3SNH A;  4JHK A;  3JCU Q;  1EYH A;  3ZW3 A;  3IQ6 A;  5EGY A;  2OEV A;  3SNX A;  2LK4 A;  3DJN B;  1VTM P;  1OY3 D;  2VSO E;  1N11 A;  3ENE A;  1TN7 A;  3IKO B;  5HKP A;  3C8Z A;  2OOE A;  4C0E A;  2L9B A;  2KW3 C;  2WQ6 A;  2EIM C;  3DWL G;  2OU6 A;  3SFY A;  1LI5 A;  3NRH A;  5AGF A;  3Q9N C;  3B13 A;  3O55 A;  3C3R A;  1TFO B;  3FTS A;  5ENP D;  2EPO A;  3U66 A;  2XRZ A;  4LSZ E;  3ZHE A;  3PHF 2;  5AAO A;  4A63 B;  1ZHY A;  4N6H A;  4I43 A;  3QWW A;  2XQ0 A;  2H7B A;  4LNG A;  1V74 B;  2J7P D;  2YL7 A;  4OD5 A;  4UI9 C;  2W9Y A;  3OXG A;  2XZD G;  3G2V A;  1NU9 C;  2A1D D;  2J49 A;  3SXY A;  4FES A;  1FVH A;  1C03 A;  1H6O A;  2Y3D A;  5JA4 D;  1FFH A;  3AU5 A;  1O1T A;  3C98 A;  1BR1 A;  3EHN A;  3WG7 C;  2YWA A;  5AEN A;  4C3D A;  1NFI E;  4EBJ A;  5F28 E;  4CGW A;  4LNU D;  3I3N A;  4O60 A;  4DRJ B;  1QVX A;  4B93 B;  3GM1 A;  5T3W A;  2FI7 A;  4LLC A;  1E83 A;  3RKV A;  3O48 A;  4ZHB A;  4HNA D;  3FUI A;  1VLT A;  1AUE A;  3ZC4 A;  2IOL A;  2PM6 A;  4UQZ A;  1TR2 A;  2KM4 A;  3V7O A;  3R7R A;  4ATG A;  1YAR O;  4ANW A;  3MLG A;  2GRO B;  4AOF A;  2L6G A;  1ZU5 A;  2J45 A;  3EGX A;  2VTB A;  4N2S A;  2P2C P;  1KTM A;  3ZVR A;  1EF1 C;  3B71 A;  3GOD A;  4GZ6 A;  4JA7 A;  4GMJ A;  2HSQ A;  1M2O A;  4MRU A;  3ULE G;  2ZGD A;  1J8Y F;  4HOQ A;  1UG3 A;  2V0P A;  1ZHW A;  2R7R A;  2P9K G;  4FA6 A;  4Q69 A;  3SF4 A;  3AG2 C;  4A55 A;  3TWT A;  3IHU A;  1WN0 A;  2GA0 A;  2RD0 A;  2VSY A;  3PEV B;  3FU0 A;  3ASH A;  4R32 A;  1JCS A;  3FY4 A;  1JPN A;  3ULQ A;  4X0R A;  3ULY A;  3GZ2 A;  1OCO E;  4CT0 A;  1NP7 A;  2X6J A;  3FH5 A;  3FHD A;  3PEU B;  4DX6 D;  2B6C A;  4M3O A;  2J9W A;  3Q78 A;  3T4R A;  2I1K A;  1G3N B;  4G26 A;  3G2U A;  3HXE A;  1OCR C;  4IWB A;  3ZRH A;  2IFU A;  2WXH A;  3HKK A;  1P5Q A;  3FVY A;  3DSV A;  4P29 A;  1JWF A;  4MVM A;  3BEE A;  4IB4 A;  2BED A;  4GTQ A;  2XS1 A;  4GCN A;  1JUQ A;  4RG6 A;  5FZQ A;  1D1C A;  1WM5 A;  3TWQ A;  3JUE A;  3AG3 C;  2FFH A;  3G2S A;  2LNI A;  2LSU A;  2XSE A;  3RKO F;  2XGO A;  2MWQ A;  2IYL D;  5ENN A;  3CK9 A;  2VTB B;  1HY5 A;  3B0P A;  2HZ8 A;  2DYR C;  1ZZP A;  5B3S C;  2A0B A;  5DS6 A;  4DX1 A;  2C0M A;  1RKE B;  2CHZ A;  5T3T A;  3SP1 A;  2P58 C;  2EIM E;  4AX2 A;  2ETC A;  4O79 A;  4N3B A;  1Z3X A;  4QDL A;  3ASF A;  2OVF A;  3LXU X;  3VYW A;  2EIN C;  5BQI A;  1ORS C;  3PZD A;  1Q0D A;  4HVB A;  3EFO A;  2RSE B;  3D9I A;  3RU0 A;  4NTF A;  4DXW A;  1KZO A;  3SYN A;  3Q15 A;  3QTH A;  1WOL A;  1JR8 A;  4RQI A;  1PY1 A;  4I2W A;  4CEM A;  4XKC A;  1ZVZ A;  2IY0 C;  2A6E F;  2HM8 A;  4N3C A;  5DS5 A;  1DOV A;  2VCC A;  1APC A;  3SFX A;  1OW7 A;  4C7O A;  1U6H A;  2KC3 A;  2AU5 A;  2J9B A;  4WNE A;  1BD8 A;  1V55 E;  2GWW A;  3LNR A;  3QWP A;  1OCC C;  1TNU A;  1UW4 B;  3LLK A;  4G78 A;  4WUY A;  3ZVV A;  3K1H A;  3G50 A;  2XEE A;  4DJ9 A;  1QZX A;  1DCQ A;  1MMD A;  2IXM A;  4A2N B;  1HZ4 A;  3HXB A;  5KNG A;  4GTS A;  3HXC A;  1H2T C;  1T01 A;  3L54 A;  4HQD A;  3TG5 A;  3B0V C;  2JPU A;  2RFM A;  1TN6 A;  3L6A A;  1D0Y A;  3FUK A;  3EU9 A;  5JJ6 A;  3PUK A;  2QY7 A;  3GZ1 A;  2XLW A;  1S0P A;  3EGD B;  2GAQ A;  1RKE A;  1C17 M;  1Q0M A;  1UN9 A;  3NYL A;  3ONL A;  1Q0F A;  1FTS A;  3U2L A;  1HXI A;  4BJT A;  4AP2 A;  1E96 B;  4EHP A;  3QKY A;  5EX0 A;  3V30 A;  3KS2 A;  2Y39 A;  3QNK A;  2IO3 C;  3OAW A;  1HFA A;  4N2Q A;  3ZSU A;  4MBG A;  4XTK A;  2AXV A;  4EQF A;  5DLJ A;  4C9B B;  3ASO E;  1JRA A;  1ORY A;  3UMH A;  1E8Y A;  4I6E A;  4O6F A;  4EUK B;  3DXJ F;  4IRU A;  3AG2 E;  2PQN A;  1D0X A;  3ESL A;  1N0R A;  1QQE A;  3QAR A;  3POV A;  3QW0 A;  1BR2 A;  2EPM X;  2B0O E;  2I6H A;  1K1A A;  2UWJ G;  3U3W A;  1N0Q A;  3SEO A;  4YL3 A;  2P6V A;  2D4U A;  3MKQ B;  4KZC A;  5EYP F;  2VGX B;  5BNW A;  4MQ9 F;  2AWI A;  1QQ3 A;  1TNO A;  2ZXR A;  3AJM A;  4ATZ D;  1VYK A;  4B0Z A;  4IAR A;  4BER A;  3LES A;  2YLG A;  5CRV A;  3E70 C;  4O7G A;  1E7V A;  3MCX A;  3C8G A;  3M15 A;  1DC2 A;  1OKK D;  3M1C B;  1TEZ A;  3IQ5 A;  3T9K A;  2I9C A;  256B A;  4EPZ A;  1Z23 A;  3DKA A;  3EGD A;  4PAC A;  2C04 A;  4ANX A;  3MJW A;  1SZA A;  4RDA A;  3W8I A;  2FAP B;  3PMR A;  4EBA A;  5BXU A;  3K9I A;  2J46 A;  3K66 A;  5L0H A;  4IN3 B;  3S2A A;  1C02 A;  1QYM A;  1S05 A;  5A6C A;  4BTA A;  5D0O D;  3VTY A;  1TKN A;  3FTY A;  4MND A;  2J4D A;  2P9N G;  1FMV A;  4NRH B;  5G05 C;  4U5G A;  4BJ1 A;  2EIK C;  3NYJ A;  1HE8 A;  4FAD A;  4XQ1 A;  4ULW A;  5ENS D;  3MZL B;  1YA9 A;  1BPO A;  2AWY A;  3CEQ A;  4I3M A;  3KMI A;  1ELK A;  1VOM A;  1TJF A;  3HVE B;  3MKQ A;  4BFR A;  2WZL A;  3UM0 A;  4K7B A;  3DE8 A;  4IAO A;  2M64 A;  4KBL A;  4H54 A;  3TOM A;  1FMW A;  3MX3 A;  1OWL A;  3MYF A;  2HKV A;  2QE9 A;  5CCL A;  2XRH A;  4YT2 A;  2LUH A;  3PVL A;  3T6B A;  2QUP A;  1E85 A;  2IBF A;  2BUG A;  4PJN A;  5JP7 A;  4IJJ A;  1ELR A;  4RLY A;  3L17 A;  1PD1 A;  2KZT A;  2X6F A;  4GQH A;  4J30 B;  1SA5 A;  1YDI A;  4BX8 A;  2F8X K;  3ZFW A;  3DPD A;  3R9M A;  4CDR A;  2H6F A;  3WHN A;  3S9O A;  3ZQV A;  3LY7 A;  4FJY A;  2AP3 A;  5EID A;  3A9C A;  2LSV A;  2EIL E;  2X3M A;  4BEP A;  3GEH A;  4JL0 A;  1MYO A;  4G0H A;  4J32 B;  3DSX A;  3FFL A;  2C0L A;  3NKD A;  3DXM G;  1BI7 B;  4Q5S F;  2HMZ A;  1A7V A;  1OW6 A;  2CNW D;  2WVN A;  4UWF A;  1TQG A;  3JRM O;  2CFZ A;  1LPE A;  4YT8 A;  4G7H F;  4UI9 J;  2IF4 A;  1YYX A;  2ZGG A;  3UIN C;  4O6Y A;  5F5F A;  2Y4T A;  4DLO A;  2FO1 E;  4MTO A;  2DYS C;  4LCT A;  3U5S A;  4YWQ A;  4AE4 B;  1OWO A;  3HRA A;  3NMK A;  2J9Q A;  3DRA A;  4N5C A;  5AJL A;  1MND A;  3JQ0 A;  3ABL E;  1N9A A;  1FAP B;  1KLX A;  2VC9 A;  5EDS A;  4HE8 D;  2Y1L E;  1SQM A;  1Z3Y A;  3TXN A;  3ML9 A;  2CGE A;  4AJW A;  4OIQ F;  3LVQ E;  3GOR A;  2AJA A;  3Q75 A;  4U63 A;  4UWH A;  3IQC A;  3NB2 A;  4PFO A;  2WXJ A;  3RQF A;  4BSZ B;  2W4M A;  5KYW B;  4HI8 A;  3JXJ A;  3QVZ A;  4CJG A;  2KZT B;  5TJ5 E;  1GS9 A;  2VCB A;  4URK A;  2Q9C A;  1QBQ A;  1VB5 A;  2Q9A A;  1BU9 A;  5DIZ A;  4GU5 A;  3MA5 A;  4BX9 A;  5HQ8 A;  4OD4 A;  3MGB A;  2NUT B;  2OG2 A;  1V54 E;  4PH4 B;  4N6C A;  5FT9 A;  1NA3 A;  2KGO A;  2Q9B A;  4JJG A;  4ER9 A;  5KNH D;  3ABK E;  4X8Q A;  3OXF A;  2HO1 A;  3T8K A;  3LEW A;  4W8K A;  2Y4U A;  5FWQ A;  4MTG A;  1D1B A;  4J8S A;  4GTP A;  1EA8 A;  2Y3H A;  2VAS A;  1MMA A;  4U0U A;  4U8Y D;  1I5N A;  3K33 A;  1NZN A;  4ZLD A;  2WXL A;  2G3V A;  3QJZ A;  1OWN A;  3TWV A;  1AWC B;  4G8L A;  3Q47 B;  1NA0 A;  3R9A B;  3LLI A;  4IUL A;  1A17 A;  1SYQ A;  1BR4 A;  2NSF A;  1IHG A;  4G8K A;  1LD7 A;  4LDQ A;  3KL4 A;  4TRQ A;  1GW6 A;  4W9R A;  1I4Z A;  4Q7C A;  3JCK C;  1M2V A;  3S7D A;  5A6B A;  5DVW A;  2F22 A;  2XCC A;  2WM9 A;  2AXZ A;  3L9T A;  5DBK A;  2P9I G;  2G3K A;  4RBN A;  1HX8 A;  4K5C A;  3JXI A;  4J8D A;  1YAU O;  1HG2 A;  3HIZ A;  2NUT A;  3US6 A;  3D9L A;  2YL0 A;  2XM0 A;  3C7J A;  1XWJ A;  3TQO A;  3MBG A;  4K0D A;  3ZKJ A;  5L0G A;  2KQ9 A;  2EIJ C;  2Y69 C;  3C62 A;  3BU8 A;  4L2L A;  1SA4 A;  5BUZ A;  4Z9I A;  1LIH A;  3LJ3 A;  3I5P A;  5T8I A;  4CS9 C;  4I6G A;  4E0I A;  1FT2 A;  3SY2 A;  1K8K G;  1H6G A;  4H7X A;  4JRZ A;  2DWZ A;  5CIV A;  2MHR A;  4DRH B;  3OXL A;  4KC9 A;  2J07 A;  4G7O F;  3U9M A;  4QQI A;  2PF4 E;  3TWU A;  1OKK A;  2V26 A;  5ITZ F;  2HMQ A;  3EJN A;  3CR3 A;  1MQS A;  3T5V A;  5K0I A;  3DEO A;  2HS5 A;  2GGF A;  5CED B;  3FTZ A;  4CIP A;  3HJC A;  2X51 A;  4GTV A;  5JVE A;  1JWG A;  2XL8 A;  5L3V A;  5FTP A;  2CYD A;  5GPG B;  4KNW A;  1D1A A;  3M79 A;  1EQ1 A;  3B7R L;  1YCS B;  4HOU A;  3AG4 E;  2Y69 E;  1A7E A;  4FLB A;  4BJ6 A;  4XEI G;  4YND A;  3AG1 E;  3FWV A;  1A5E A;  5CEA A;  2OVB A;  3ZDL A;  5JLI A;  2WMO A;  3QC1 A;  4BJ5 C;  2PP4 A;  3I4G A;  3UMK A;  2DZO A;  5E33 A;  4PDX A;  4N39 A;  1OXK A;  3WXX A;  4ILH B;  4K0R A;  1FR0 A;  3J06 A;  5C1D A;  1OCO C;  1L5J A;  2CCY A;  3UI2 A;  3EU5 A;  3UMV A;  3NG1 A;  5EK0 A;  4A1G A;  1OUV A;  2OJQ A;  5T4Y A;  3UM1 A;  2OOC A;  3TAX A;  1OWP A;  4LG6 A;  5AYW D;  4MS2 A;  2Q7R A;  2BL2 A;  3JYS A;  1H6K A;  4XI0 A;  2HJ3 A;  3ESK A;  2J0W A;  4EIY A;  4LNB A;  5B1A E;  3AOU A;  3TOL A;  3ZEF A;  4F6R D;  2XM4 A;  3PCV A;  4GML A;  5F5H A;  3C18 A;  3RK6 A;  3ASO C;  5B1B C;  2PNO A;  4L6R A;  3RH3 A;  5KYY A;  3OA1 A;  1TWA A;  1LI7 A;  3K1I A;  3KEA A;  3S27 A;  2R9R B;  4CIH A;  4BWR A;  3DZA A;  2IM8 A;  1N54 A;  4F53 A;  3SGH A;  2X0C A;  2Q00 A;  2LP4 A;  2L7A A;  1O1S A;  3E33 A;  4HI9 A;  4FUL A;  4ULV A;  1MX2 A;  1PAQ A;  4F1P A;  5FQ8 A;  3JSE O;  5KJK A;  3ITF A;  4O6M A;  2HJM A;  1KPS B;  2XCB A;  2LFF A;  5J90 A;  2DB4 A;  1WAS A;  3V31 A;  1D8E A;  5COG A;  3UUX A;  3S90 A;  4ILG A;  4GZD A;  3OWT A;  3CZ6 A;  1WAT A;  4APF A;  3CHO A;  3AJI A;  2XLH A;  4UQX A;  4O1P A;  1EI7 A;  4LEU A;  2VGE A;  1QPU A;  1OR2 A;  3CVW A;  1RKC A;  2QYU A;  4OAU C;  4K1O A;  4E7S A;  1ZHX A;  3TWR A;  2BKK B;  2P7V A;  3B0U X;  2NC9 A;  3QB2 A;  4FHK A;  5ENR D;  4F7A A;  1LKX A;  1PD0 A;  1YMP A;  2GRM A;  4EWC A;  4MKT A;  4CJO A;  2C2L A;  1S7Z A;  3CSK A;  5BW8 C;  4AM9 A;  5BPP A;  5D0Q D;  1BDJ B;  1UJJ A;  2J08 A;  4CS7 A;  2LAI A;  4J8F A;  2F8Y A;  3LUT B;  2KCL A;  3O4Z A;  2R02 A;  4ONS A;  4QI0 A;  5HI7 A;  4ACK A;  1CGO A;  1Z7Q c;  2XLE A;  2UY1 A;  2PX3 A;  4KT6 B;  5BXO A;  1ZU4 A;  3RO3 A;  3PRE A;  3RRU A;  1IZM A;  2FGY A;  3R7C A;  2QTV A;  4JC7 A;  2CW0 F;  1S70 B;  1N52 A;  4U9D A;  4G1T A;  1OCR E;  1SW6 A;  3MFN A;  1SR2 A;  2LXL A;  2L6H A;  5AQ7 A;  2R7X A;  4M7C A;  5COF A;  4B89 A;  2YHC A;  1KNY A;  1H19 A;  4ANV A;  3ATP A;  1LTX A;  1QNF A;  3J5Q B;  3VLF A;  3KYI A;  4DI3 A;  3HTK C;  2ILR A;  2A68 F;  3ZWI A;  1WDY A;  3CV0 A;  3ZN3 A;  4C0M A;  4GYT A;  2WQ7 A;  3FAJ A;  3EZH A;  1N4P A;  4BPM A;  4AL1 A;  4EBK A;  3ZXP A;  2WXG A;  3UR3 C;  2JLB A;  4QFV A;  4CDM A;  4C3E A;  4A3V A;  1SMY F;  4EHM A;  3GZS A;  1PCX A;  3HNI A;  4JHR A;  3CHM A;  3U9W A;  3CVP A;  2I15 A;  2R7T A;  5FJY A;  2QYJ A;  3AAA C;  4WAF A;  4GCO A;  1L3P A;  4AL0 A;  4KNV A;  4G24 A;  3MV3 B;  3DJU B;  5ARG A;  2KYH A;  2IOQ A;  1U3D A;  3X1O A;  2WB7 A;  3DSU A;  5JS5 A;  1LS4 A;  2R17 C;  2R25 A;  2GFH A;  2YHE A;  3QOU A;  4XZ4 A;  1OWM A;  3FUD A;  1Z3I X;  3U3B A;  3EG9 A;  4ZLC A;  2X38 A;  4NUR A;  3F47 A;  5HS0 A;  4MVU A;  3WOD F;  3X2Q E;  2ASR A;  4D4X A;  3HNK A;  3EIQ C;  4FC8 A;  3LAY A;  1VLS A;  4Z9H A;  2DVW A;  4MVZ A;  2OND A;  5EKQ D;  3B7T A;  2HR2 A;  2BF0 X;  2KAT A;  2HUJ A;  3Q7F A;  3BRJ A;  4NY3 A;  3G4Z A;  3VF0 A;  5D92 A;  2BKG A;  1K04 A;  5FZT A;  2WXN A;  4WWP A;  3T8M A;  3OEO A;  1XGW A;  1UJK A;  3TUL A;  2LFD A;  3N2Z B;  2VGY A;  3KSQ A;  2YRF A;  5KWD A;  1E2X A;  2B0H A;  2LIG A;  4JTC B;  3DSW A;  4CDA A;  1HS6 A;  5G04 J;  1Y8M A;  2XPI A;  5L0C A;  2Q7F A;  1E8W A;  1DCE A;  1N4Q A;  3PZ1 A;  3ZHE B;  1N4S A;  1OCC E;  5EHH A;  5AC4 A;  3NMI A;  3ZTZ A;  5LOZ A;  1E7U A;  4BSX A;  4HS2 A;  3EG9 B;  1JMW A;  5KBA A;  5J08 A;  1ZB1 A;  5AQA A;  3CHQ A;  5IY5 E;  3L82 A;  2WXO A;  3RVZ A;  3ZIM A;  2LSE A;  4FX5 A;  4WJ0 A;  2EIL C;  1H6P A;  2V3C C;  5LP0 A;  3BQO A;  4TUU A;  5JHB A;  1ZW2 A;  5BV0 A;  2I2O A;  2HE0 A;  4DOZ A;  4DX2 A;  2R7W A;  3LEO A;  3CVY A;  3B9Q A;  2KCV A;  2X6H A;  4WNF A;  3LYA A;  1AVO B;  1S63 A;  3HNJ A;  2ZPA A;  1WAO 1;  4NQ0 A;  3ZQY A;  3OTN A;  3AS4 A;  4NCQ A;  4I1A A;  2LD6 A;  5FIO A;  3C8G D;  5ANL A;  3QK0 A;  1A7D A;  5KYN A;  4OYS A;  4Q94 A;  3E32 A;  1X5B A;  1W3B A;  2XEV A;  5KYX A;  3S7J A;  1IYG A;  4JW1 A;  3C5R A;  4I17 A;  3BUA A;  5FQ7 A;  3SZ7 A;  2XZT G;  5JT4 A;  3EGX B;  4E0H A;  2IXP A;  3AG3 E;  3QVY A;  3I4R B;  3Q7G A;  3QAQ A;  3CQZ A;  4U5F E;  5DQT A;  3NZU A;  1YYH A;  4A1S A;  4O6N A;  3IHV A;  2WVQ A;  3AGU A;  2HSB A;  4BT8 A;  2YQY A;  4LAC B;  2HYZ A;  4GPK A;  3E30 A;  3EHQ A;  5KYU B;  2TMV P;  3TXM A;  1RZ4 A;  2J9V A;  1Q2Z A;  4JUR I;  3HHM A;  5FQ4 A;  1RW2 A;  3JQ1 A;  4PR9 A;  1D0Z A;  3QZC A;  4U04 A;  2Y3G A;  2Q3T A;  2IXO A;  2V8S E;  2VYI A;  4JKV A;  4JA9 A;  4L9P A;  2WXI A;  1N1C A;  3LEV A;  4RG9 A;  1EKY A;  3CQC B;  3FEX A;  3DE9 A;  2WXF A;  5DS4 A;  2D5R B;  4Y6C A;  1T9K A;  3TJ6 A;  4K03 A;  4MVS A;  1MX6 A;  1EDU A;  2R2L A;  4GYO A;  3SZR A;  3S7B A;  2HFI A;  4OIR F;  3Q6M A;  2J7P A;  1HMD A;  4XEV A;  4E17 A;  4EKW A;  2QLA A;  1VDY A;  3KD7 A;  3L34 A;  1XZP A;  5A23 A;  3L16 A;  3JTL O;  4U0Z A;  3D9J A;  4E7Z A;  3FUL A;  3V5X A;  3PZ3 A;  5L3Q A;  1NFN A;  2ETA A;  2XRY A;  3J5P A;  3TG4 A;  1AEP A;  4U07 A;  3EFO B;  4C48 B;  3F46 A;  2DIW A;  4CCA A;  1ZYR F;  2P61 A;  5KYU A;  1WY6 A;  3EUV A;  4CX9 A;  5FQ6 A;  5AIJ A;  3MYV A;  2H7V C;  2VSX E;  1G5Z A;  4UWK A;  3PRZ A;  1M56 C;  3CIA A;  4IAQ A;  3R7Q A;  3URZ A;  1UOH A;  4MLP A;  3UIP C;  4KVO A;  1HE1 A;  1Z5S C;  1HW1 A;  1Z63 A;  1QZ2 A;  1R4T A;  4FU3 A;  4C7O B;  4ANJ A;  1OXJ A;  1HE9 A;  4HOR A;  5FZR A;  2IJG X;  4XI9 A;  3FAP B;  3IBE A;  2EIJ E;  3EQL F;  2O9X A;  3ZU7 B;  3ABM C;  3LY9 A;  5E76 A;  3NKE A;  3U0C A;  3RRN B;  2XXA B;  4J0U A;  4XLP F;  3T6G B;  1BI8 B;  3RVY A;  2GRP B;  4FP7 A;  5D2M C;  1HW2 A;  3V2X A;  1H2U A;  4DVY P;  1K1B A;  4RD9 A;  4HEA J;  3FDH A;  3Q73 A;  2WB2 A;  3RRM B;  4F3V A;  4BJ6 C;  4G23 A;  1U89 A;  3B7B A;  5EYL A;  2PFD A;  3C3O A;  3LS8 A;  4F1S A;  4N06 A;  2L6B A;  3SQV A;  2F37 A;  2MRI A;  4DPR A;  2NSZ A;  5CI9 A;  3ZXS A;  1MJ0 A;  5A7D B;  3S0X A;  3RIB A;  2A6H F;  4YL0 A;  3UT4 A;  3VLE A;  5E2Q A;  3RW0 A;  2VJ8 A;  1IHB A;  2WXP A;  4UQY A;  5BV1 A;  3CKC A;  1BBH A;  4H7Y A;  3UMI A;  4CDN A;  3HG0 D;  3TJ5 A;  1RCP A;  3ABM E;  4NIK A;  3SI5 A;  3BEH A;  3DD7 A;  5ANR A;  3U8P A;  3EZI A;  5EIB E;  3L8J A;  3SXK A;  2YLI A;  4J8E A;  3E9V A;  4TXR A;  3Q5M A;  4PK4 A;  3RQE A;  4XPY A;  5AC5 A;  5KJL A;  3GM2 A;  4IGG A;  2ETB A;  2YLD A;  5CEC B;  5E75 A;  3UQ3 A;  3ZPJ A;  3W9G A;  1CPQ A;  4U8H A;  5KJN A;  2PNN A;  2NPU A;  1NBB A;  2WZF A;  3GEE A;  2MOW A;  4BES A;  3FU5 A;  2XXA A;  4AY6 A;  2EIN E;  3HLZ A;  4JE9 A;  3ABL C;  4WAB A;  4JPS A;  3PE4 A;  4G11 A;  3CVU A;  1NZE A;  3FUE A;  4PJM A;  1XZQ A;  4HLE A;  4PS3 A;  4E6H A;  3C8G B;  2H8A A;  3UM2 A;  4JZA A;  4GZ3 A;  3CK7 A;  4EZK A;  4MVR A;  3KEZ A;  3EHM A;  1LD8 A;  5B1B E;  3EH1 A;  1JPL A;  3QWV A;  2FO7 A;  2WXK A;  1LE4 A;  1MHQ A;  4HOS A;  4WWO A;  5FCL A;  1E8Z A;  1XNF A;  2WXM A;  3TWS A;  5JJ7 A;  4DRX E;  1UN8 A;  4YDO A;  2KNH A;  3FMS A;  2ION A;  3CK8 A;  3RAU A;  3NOG D;  1RMV A;  3G2W A;  3QMK A;  3FTV A;  4CS9 A;  3AQC A;  1K40 A;  3RJV A;  2DI3 A;  3ZG1 A;  4HRM B;  2CFU A;  2AXU A;  4ZFH A;  4KXK B;  5CI8 A;  2W45 A;  3FOO A;  4FLH A;  2QC9 A;  3U3F A;  3U4T A;  2VH3 A;  3I4U A;  3ASN C;  2AVK A;  1TNZ A;  3MKR A;  2CDQ A;  1UFB A;  2JX0 A;  4DUI A;  5LCW C;  3D9O A;  3PNT B;  1H7I A;  3U2M A;  2A0U A;  1IQU A;  2QZA A;  3CVN A;  2YQ8 A;  1OQC A;  1V55 C;  3LDZ A;  5AN8 A;  1IW7 F;  2EPL X;  3FU3 A;  4I44 A;  4KI2 A;  3TWX A;  3UGP A;  3JUI A;  4LDR A;  4Y6W A;  2YKZ A;  4U5E E;  3PZ4 A;  1YZC A;  2MYS A;  5JRA A;  1JPJ A;  1T5O A;  1FCH A;  4W8P A;  5JUA A;  1TFK B;  4RVB A;  3GAN A;  4LUN U;  1DNP A;  2A4Z A;  1QLE C;  1M57 C;  2L9J A;  2IU1 A;  4FHJ A;  4JTA B;  3F6Q A;  2CG3 A;  2WXR A;  4L23 A;  4M63 A;  5LFA A;  4HFK B;  3O10 A;  2OV8 A;  3PH0 C;  3JT1 A;  2YEV A;  4AIF A;  4K5A B;  3DWW A;  5LCW J;  4FJZ A;  4MVO A;  1TWG A;  3NMJ A;  4GTM A;  2XL6 A;  2FUL A;  3K7D A;  1N95 A;  4JVS A;  3SD5 A;  3FTU A;  4YN0 B;  3IXE A;  1O1R A;  2AVP A;  5CER B;  3UTM A;  4Z9J A;  3CVL A;  1G8X A;  1NU7 D;  3SXM A;  4YDY A;  2JD3 A;  2XLO A;  2A69 F;  1OT8 A;  2GRL A;  1SZI A;  4BG0 A;  4PFP A;  1TNB A;  2M63 A;  3FUN A;  1TNY A;  3FP3 A;  3ZYL A;  1INZ A;  3GYZ A;  3L08 A;  3VAY A;  3D9N A;  4HLL A;  4MVQ A;  4BJ5 A;  5JHA A;  2YNQ A;  2XLV A;  3K1I C;  4L7T A;  1A0B A;  4MS6 A;  1YYJ A;  1VMA A;  3RIP A;  5ENT D;  4GTR A;  5BQH A;  4TV3 A;  3T9O A;  3CLJ A;  4ILI A;  4HBD A;  4U0S A;  3UT7 A;  2YL3 A;  1O3U A;  2KC7 A;  4XPX A;  2VGX A;  5CBO A;  1G4W R;  2R59 A;  4CS8 A;  3NZS A;  2VCA A;  4DI4 A;  3LJN A;  4ANU A;  3CHS A;  4IYP A;  3IEE A;  1O5M A;  2V4H C;  3LPZ A;  4J6I A;  2L0I A;  3S7F A;  1ZBP A;  3APD A;  1YZA A;  4PJJ A;  1G4U S;  1BZ4 A;  1NG1 A;  2KBX A;  4JEU A;  5KYW A;  1H9T A;  2NUP B;  2OEX A;  2LCH A;  2CHX A;  2FBN A;  3APC A;  3UGO A;  4GB9 A;  3AS5 A;  1LS1 A;  3E37 A;  3C63 A;  3B7U X;  4UWG A;  4APO A;  5LX8 A;  1UG7 A;  5FIN A;  2XHE A;  3AG1 C;  2W4B A;  4NTB A;  1RXQ A;  5B1A C;  4CRW A;  4YT4 A;  3V79 K;  2XGS A;  3M4C A;  3Q79 A;  4WGZ A;  1D9S A;  1T6U A;  4U5D E;  4EZJ A;  4YK5 A;  2WL8 A;  2E2E A;  1CGN A;  2OCC C;  3CVX A;  4GMR A;  2ZD9 A;  3HDX A;  4C3B A;  4PS8 A;  4JTD B;  4EBB A;  4WNG A;  1YA0 A;  2ZIS A;  4NAC A;  3Q7L A;  2YHS A;  3LS0 A;  5HV9 A;  1HMO A;  2ZU6 B;  4YT5 A;  3NF1 A;  3T6J A;  3B29 A;  4NTA A;  1V54 C;  5BUO A;  3Q49 B;  4RSY A;  3HVE A;  3ZYM A;  4U5H A;  2XLM A;  4ACL A;  5AAR A;  2P9U G;  2QNL A; 
#chains in the Genus database with same CATH homology
 3UX4 A;  4OIP F;  3FUH A;  4EZL A;  2DCP A;  1M2V B;  2AW6 A;  3ECS A;  1ELW A;  3W2V A;  2NUP A;  4I9C A;  4WWN A;  4ABN A;  2WMN A;  1SZ9 A;  1H2V C;  3GW4 A;  4JC8 A;  2M4E A;  1ZU2 A;  4GZ5 A;  4PJL A;  1H0A A;  5CMW A;  1VK5 A;  3ZYQ A;  4DBR A;  2IOS A;  2G62 A;  4B6I A;  1HU3 A;  2R7V A;  5KJM A;  3N0T A;  4AVX A;  3EPV A;  4Q4Z F;  2I1J A;  2HV6 A;  4KMO A;  3AU4 A;  3MEK A;  1E90 A;  3CVQ A;  3PUJ A;  3UNG C;  1LF8 A;  4U5C E;  3D9M A;  4AE4 A;  5AJD A;  2Z15 A;  1E8X A;  5C2Y A;  1HH8 A;  3KAE A;  1FFT C;  1FVF A;  2BTD A;  2L0T B;  2QFC A;  5HSW A;  1KT0 A;  4GA1 A;  4B94 A;  4HOT A;  4AEZ C;  3P2B A;  1ZHT A;  3RFY A;  3L0I A;  2NXP A;  3PNL B;  5T3R A;  4YVO A;  3VTX A;  2GW1 A;  4LLE A;  1IQR A;  3TD7 A;  3D3M A;  4EEC A;  5ARF A;  1B89 A;  1WGW A;  4BTB A;  3H65 A;  4U5B E;  1KT1 A;  3T5X A;  2XL4 A;  3CQG B;  5KCM A;  3EH2 A;  1TJC A;  4N3A A;  4DJA A;  3W8H A;  3ZYK A;  4G2V A;  3I5Q A;  3AS8 A;  1O5H A;  3DM5 A;  3E4B A;  4D10 C;  4I2Z A;  1MNE A;  4BY6 A;  2WVO A;  3EIJ A;  2XPZ A;  2VSN A;  1W2W A;  4XKB A;  3K6B A;  3MV2 B;  3SHF A;  2ZXP A;  3JSZ A;  5DQZ A;  4G25 A;  3DMD A;  5BT1 A;  1Y6I A;  4KYO B;  4KBQ A;  4GYY A;  1LVK A;  2E87 A;  1ZHZ A;  3DAG A;  2L81 A;  2NG1 A;  4H4K C;  3N71 A;  3W2W A;  3SBS A;  4KZ0 A;  3FUJ A;  2KJG A;  4XWJ A;  4UI9 K;  1KU2 A;  2MHK A;  4JHJ A;  4DLQ A;  3IV0 A;  1Z6T A;  3RO2 A;  4FWV A;  3CVV A;  2CG2 A;  3CGH A;  4KVM A;  4AXH A;  5M72 A;  3NDB B;  2LAH A;  3FU6 A;  3X2Q C;  4GYW A;  2LO6 A;  4GAA A;  3NQP A;  3FTX A;  4CT4 A;  4CBE A;  5G55 A;  3LCA A;  3APF A;  3S29 A;  3QDN A;  3U64 A;  2VB6 A;  2WQH A;  3D9K A;  2YIN A;  3O39 A;  2B0J A;  2R7O A;  4B8C B;  4GZC A;  3ASG A;  4XX5 A;  1U3C A;  2QY9 A;  2PM7 A;  2Y3A A;  1MMG A;  2FEZ A;  2R7Q A;  2IQC A;  1SF8 A;  3LY8 A;  3AG4 C;  2UY1 B;  3CSF A;  3L13 A;  2CNW A;  2PX0 A;  4P6I C;  4JZY A;  1HF8 A;  2R7S A;  3KH2 A;  5T1D B;  4ME2 A;  5CMY A;  4I1M A;  4OIN F;  3P1U A;  5G04 C;  4L1B A;  2IXN A;  1ST6 A;  1RJ9 A;  1TWC A;  3SBT B;  4HFF B;  3IHY A;  2EQX A;  2BE5 F;  4OVV A;  4GEH A;  4B8A A;  3ONK A;  3FHE A;  1EPU A;  3CHP A;  3ABK C;  4E85 A;  3FH7 A;  5FZS A;  2X6I A;  2DGJ A;  5G2N A;  4UWL A;  2YZS A;  3FUF A;  2J0X A;  4XIF A;  2WPV A;  1O87 A;  5KYY B;  4JCH A;  2R5S A;  4JJF A;  2FF4 A;  2WZG A;  3CST A;  5CCM A;  4WND A;  5D91 A;  2A5U A;  3LS1 A;  2JEK A;  3FUM A;  3Q4A B;  2WXQ A;  2L6J A;  4LER A;  3PS6 A;  4GA2 A;  4G7Z F;  3EDT B;  1RJ9 B;  4DBQ A;  2I8B A;  3ASD A;  3IEG A;  5IY5 C;  4OIO F;  3KKB A;  4CSA A;  1J8M F;  1Z6A A;  3ML8 A;  4Q96 A;  4V3I A;  4JEH A;  3DBS A;  3TL5 A;  3G2T A;  4PUC A;  1Z5Z A;  2PZI A;  5E3A A;  3DM9 B;  4GA0 A;  5EX3 A;  3FH8 A;  2J4B A;  3VLD A;  4OVU A;  3O6X A;  3UPV A;  3Q6N A;  2WVI A;  4AY5 A;  2ZXO A;  5CHE E;  3DAF A;  1VYI A;  4I9E A;  3PDN A;  2X6K A;  3RYL A;  3LJB A;  1DVP A;  2Y3B A;  3SFZ A;  4DVZ A;  3B7S A;  4R7L A;  3JRT A;  3LKU A;  3CHR A;  3BG0 B;  2DBA A;  2PL2 A;  4AV7 A;  2PQR A;  3JYH A;  1MMN A;  3D9P A;  2V5F A;  4YVQ C;  4YJW A;  5JJT A;  2RG8 A;  3S28 A;  4I1O B;  3NYM A;  4XE0 A;  4I6J A;  3ZIB A;  4PS7 A;  2H7O A;  2XPY A;  4A3T A;  4BT9 A;  4QI2 A;  2HV7 A;  2J09 A;  4CS8 C;  1OCZ C;  4F4B A;  4CSA C;  4DK5 A;  3ZGQ A;  4HFG A;  3TJP A;  5KYX B;  4L2Y A;  3CKB A;  4AK9 A;  5E3C A;  3TGO A;  3BG1 B;  2R7U A;  3FTW A;  3FDQ A;  3FEY A;  4CGV A;  4BEJ A;  2KCK A;  4LRZ A;  1PC2 A;  2J9U A;  2CHW A;  2VQ2 A;  2V4L A;  1HO8 A;  2E0I A;  4HXI A;  4EBA G;  2XGM A;  3AQB A;  3PE3 A;  3UT8 A;  3L22 A;  1HG5 A;  2ZXW C;  3LVR E;  5G05 J;  2C03 A;  4XLN F;  3N24 A;  1TWH A;  3HYM B;  4JXT A;  3SNH A;  4JHK A;  3JCU Q;  1EYH A;  3ZW3 A;  5EGY A;  3SNX A;  3DJN B;  2VSO E;  3IKO B;  3ENE A;  2OOE A;  4C0E A;  2L9B A;  2KW3 C;  2WQ6 A;  2EIM C;  3NRH A;  3B13 A;  3FTS A;  3U66 A;  2XRZ A;  3ZHE A;  3PHF 2;  1ZHY A;  4I43 A;  3QWW A;  2XQ0 A;  2H7B A;  2J7P D;  4OD5 A;  4UI9 C;  2W9Y A;  3OXG A;  3G2V A;  1NU9 C;  2A1D D;  2J49 A;  4FES A;  1FVH A;  2Y3D A;  1FFH A;  3AU5 A;  3C98 A;  1BR1 A;  3EHN A;  3WG7 C;  5AEN A;  4C3D A;  4CGW A;  3I3N A;  2FI7 A;  5T3W A;  4LLC A;  3RKV A;  3O48 A;  3FUI A;  3ZC4 A;  2IOL A;  2PM6 A;  4UQZ A;  1TR2 A;  2KM4 A;  3V7O A;  3R7R A;  4ATG A;  4ANW A;  3MLG A;  4AOF A;  1ZU5 A;  2J45 A;  3EGX A;  2VTB A;  4N2S A;  3ZVR A;  1EF1 C;  3GOD A;  4GZ6 A;  4JA7 A;  4GMJ A;  1M2O A;  4MRU A;  1J8Y F;  4HOQ A;  1UG3 A;  2V0P A;  1ZHW A;  2R7R A;  4FA6 A;  4Q69 A;  3SF4 A;  3AG2 C;  4A55 A;  2RD0 A;  2VSY A;  3PEV B;  3FU0 A;  3ASH A;  3FY4 A;  1JPN A;  3ULQ A;  4X0R A;  3GZ2 A;  4CT0 A;  1NP7 A;  2X6J A;  3FH5 A;  3FHD A;  3PEU B;  4M3O A;  2J9W A;  3T4R A;  2I1K A;  4G26 A;  3G2U A;  1OCR C;  4IWB A;  3ZRH A;  2IFU A;  2WXH A;  1P5Q A;  3FVY A;  4P29 A;  1JWF A;  3BEE A;  4GCN A;  1JUQ A;  4RG6 A;  5FZQ A;  1D1C A;  1WM5 A;  3AG3 C;  2FFH A;  3G2S A;  2XGO A;  2LNI A;  2XSE A;  3RKO F;  2LSU A;  2MWQ A;  2IYL D;  5ENN A;  3CK9 A;  2VTB B;  3B0P A;  2DYR C;  5B3S C;  5DS6 A;  2C0M A;  2CHZ A;  5T3T A;  3SP1 A;  2P58 C;  4AX2 A;  4N3B A;  4O79 A;  1Z3X A;  4QDL A;  3ASF A;  2OVF A;  3LXU X;  3VYW A;  2EIN C;  3PZD A;  4HVB A;  3EFO A;  3D9I A;  3RU0 A;  3SYN A;  3Q15 A;  1PY1 A;  4I2W A;  4CEM A;  4XKC A;  2A6E F;  2HM8 A;  4N3C A;  5DS5 A;  4C7O A;  4WNE A;  3LNR A;  3QWP A;  1OCC C;  1UW4 B;  3LLK A;  4WUY A;  3ZVV A;  3K1H A;  1QZX A;  1MMD A;  2IXM A;  4A2N B;  1HZ4 A;  1H2T C;  3L54 A;  3TG5 A;  3B0V C;  3L6A A;  1D0Y A;  3FUK A;  5JJ6 A;  3PUK A;  2QY7 A;  3GZ1 A;  1S0P A;  3EGD B;  1UN9 A;  3NYL A;  3ONL A;  1FTS A;  1HXI A;  4BJT A;  4AP2 A;  1E96 B;  3QKY A;  5EX0 A;  3KS2 A;  2Y39 A;  3QNK A;  3OAW A;  1HFA A;  4N2Q A;  3ZSU A;  4XTK A;  2AXV A;  4EQF A;  5DLJ A;  4C9B B;  3UMH A;  1E8Y A;  4I6E A;  4O6F A;  3DXJ F;  4IRU A;  2PQN A;  1D0X A;  3ESL A;  1QQE A;  3QAR A;  3POV A;  1BR2 A;  3U3W A;  2I6H A;  2UWJ G;  3SEO A;  2P6V A;  3MKQ B;  4KZC A;  2VGX B;  5BNW A;  4MQ9 F;  2AWI A;  2ZXR A;  4B0Z A;  1VYK A;  3LES A;  3E70 C;  4O7G A;  1E7V A;  3MCX A;  1OKK D;  3M1C B;  1TEZ A;  2I9C A;  4EPZ A;  1Z23 A;  3EGD A;  2C04 A;  4ANX A;  3MJW A;  1SZA A;  4RDA A;  3W8I A;  3PMR A;  4EBA A;  3K9I A;  2J46 A;  3K66 A;  4IN3 B;  3S2A A;  5A6C A;  4BTA A;  5D0O D;  3VTY A;  1TKN A;  3FTY A;  4MND A;  2J4D A;  1FMV A;  4NRH B;  5G05 C;  4U5G A;  4BJ1 A;  2EIK C;  3NYJ A;  1HE8 A;  4FAD A;  4ULW A;  3MZL B;  1BPO A;  3CEQ A;  4I3M A;  3KMI A;  1ELK A;  1VOM A;  1TJF A;  3HVE B;  3MKQ A;  4BFR A;  2WZL A;  4K7B A;  4IAO A;  4KBL A;  1FMW A;  3MX3 A;  1OWL A;  5CCL A;  2XRH A;  4YT2 A;  3PVL A;  3T6B A;  2BUG A;  4PJN A;  4IJJ A;  1ELR A;  3L17 A;  1PD1 A;  2KZT A;  2X6F A;  4J30 B;  4BX8 A;  3ZFW A;  3DPD A;  4CDR A;  3LY7 A;  4FJY A;  2LSV A;  2X3M A;  4JL0 A;  4G0H A;  4J32 B;  3FFL A;  2C0L A;  3NKD A;  4Q5S F;  2CNW D;  4UWF A;  2WVN A;  2CFZ A;  4UI9 J;  4YT8 A;  4G7H F;  2IF4 A;  4O6Y A;  5F5F A;  2Y4T A;  4DLO A;  2DYS C;  4LCT A;  4YWQ A;  4AE4 B;  1OWO A;  2J9Q A;  4N5C A;  5AJL A;  3JQ0 A;  1MND A;  1KLX A;  5EDS A;  4HE8 D;  1SQM A;  1Z3Y A;  3TXN A;  3ML9 A;  2CGE A;  4AJW A;  4OIQ F;  3LVQ E;  4U63 A;  4UWH A;  4PFO A;  2WXJ A;  2W4M A;  5KYW B;  2KZT B;  4URK A;  2Q9C A;  2Q9A A;  5DIZ A;  4GU5 A;  3MA5 A;  4BX9 A;  5HQ8 A;  4OD4 A;  3MGB A;  2NUT B;  2OG2 A;  4PH4 B;  5FT9 A;  1NA3 A;  2KGO A;  2Q9B A;  4JJG A;  3OXF A;  2HO1 A;  3LEW A;  4W8K A;  2Y4U A;  5FWQ A;  1D1B A;  4J8S A;  2Y3H A;  2VAS A;  1MMA A;  4U0U A;  3K33 A;  1NZN A;  4ZLD A;  2WXL A;  2G3V A;  3QJZ A;  1OWN A;  3Q47 B;  1NA0 A;  3R9A B;  3LLI A;  4IUL A;  1A17 A;  1BR4 A;  1IHG A;  3KL4 A;  4TRQ A;  1GW6 A;  4W9R A;  4Q7C A;  3JCK C;  1M2V A;  3S7D A;  5DVW A;  2XCC A;  2WM9 A;  2AXZ A;  5DBK A;  2G3K A;  4RBN A;  1HX8 A;  4J8D A;  1HG2 A;  3HIZ A;  2NUT A;  3D9L A;  4K0D A;  2KQ9 A;  2EIJ C;  2Y69 C;  4L2L A;  5BUZ A;  3LJ3 A;  3I5P A;  5T8I A;  4CS9 C;  4I6G A;  4H7X A;  3OXL A;  4KC9 A;  2J07 A;  4G7O F;  2PF4 E;  1OKK A;  2V26 A;  3EJN A;  3CR3 A;  1MQS A;  3T5V A;  2GGF A;  3FTZ A;  3HJC A;  2X51 A;  1JWG A;  5L3V A;  5FTP A;  4KNW A;  1D1A A;  3B7R L;  4HOU A;  4FLB A;  4BJ6 A;  4YND A;  3FWV A;  2OVB A;  2WMO A;  3QC1 A;  4BJ5 C;  2PP4 A;  3I4G A;  3UMK A;  5E33 A;  4PDX A;  4N39 A;  3WXX A;  4ILH B;  4K0R A;  5C1D A;  1OCO C;  1L5J A;  3UMV A;  3NG1 A;  4A1G A;  1OUV A;  5T4Y A;  3TAX A;  1OWP A;  5AYW D;  3JYS A;  1H6K A;  4XI0 A;  3ESK A;  2J0W A;  3ZEF A;  4GML A;  5F5H A;  3RK6 A;  3ASO C;  5B1B C;  3RH3 A;  5KYY A;  3OA1 A;  1TWA A;  3S27 A;  4CIH A;  4BWR A;  3DZA A;  1N54 A;  4F53 A;  3SGH A;  4FUL A;  1PAQ A;  5FQ8 A;  5KJK A;  3ITF A;  4O6M A;  2XCB A;  5J90 A;  3UUX A;  4ILG A;  4GZD A;  3OWT A;  3CZ6 A;  4APF A;  3CHO A;  4UQX A;  4LEU A;  3CVW A;  4E7S A;  1ZHX A;  2P7V A;  3B0U X;  2NC9 A;  3QB2 A;  4FHK A;  4F7A A;  1LKX A;  1PD0 A;  2GRM A;  4EWC A;  4MKT A;  2C2L A;  1S7Z A;  3CSK A;  5BW8 C;  4AM9 A;  5BPP A;  5D0Q D;  1UJJ A;  2J08 A;  4CS7 A;  4J8F A;  2LAI A;  2KCL A;  3O4Z A;  4QI0 A;  5HI7 A;  4ACK A;  2UY1 A;  2PX3 A;  4KT6 B;  1ZU4 A;  3RO3 A;  3PRE A;  3RRU A;  1IZM A;  2FGY A;  2QTV A;  2CW0 F;  1N52 A;  4G1T A;  2R7X A;  4B89 A;  2YHC A;  1H19 A;  4ANV A;  1QNF A;  3VLF A;  4DI3 A;  3HTK C;  2ILR A;  2A68 F;  3CV0 A;  3ZN3 A;  4C0M A;  4GYT A;  2WQ7 A;  3FAJ A;  3EZH A;  2WXG A;  3UR3 C;  2JLB A;  4QFV A;  4CDM A;  4C3E A;  4A3V A;  1SMY F;  3GZS A;  1PCX A;  4JHR A;  3CHM A;  3U9W A;  3CVP A;  2R7T A;  5FJY A;  4WAF A;  4GCO A;  4KNV A;  4G24 A;  3MV3 B;  3DJU B;  5ARG A;  2IOQ A;  1U3D A;  3X1O A;  2WB7 A;  2R17 C;  2GFH A;  2YHE A;  3QOU A;  4XZ4 A;  1OWM A;  3FUD A;  1Z3I X;  3EG9 A;  4ZLC A;  2X38 A;  4NUR A;  3F47 A;  3WOD F;  3EIQ C;  4FC8 A;  3LAY A;  5EKQ D;  2OND A;  3B7T A;  2HR2 A;  2BF0 X;  2KAT A;  4NY3 A;  5D92 A;  2WXN A;  4WWP A;  3T8M A;  3OEO A;  1XGW A;  1UJK A;  3N2Z B;  2VGY A;  1HS6 A;  5G04 J;  1Y8M A;  2XPI A;  2Q7F A;  1E8W A;  3ZHE B;  5EHH A;  5LOZ A;  1E7U A;  4BSX A;  4HS2 A;  3EG9 B;  5J08 A;  3CHQ A;  2WXO A;  3ZIM A;  2LSE A;  4FX5 A;  4WJ0 A;  2EIL C;  2V3C C;  5LP0 A;  4TUU A;  5JHB A;  5BV0 A;  2I2O A;  4DOZ A;  2R7W A;  3CVY A;  3B9Q A;  2KCV A;  2X6H A;  4WNF A;  3LYA A;  2ZPA A;  1WAO 1;  4NQ0 A;  3OTN A;  3AS4 A;  4I1A A;  5ANL A;  3QK0 A;  5KYN A;  4OYS A;  4Q94 A;  1X5B A;  1W3B A;  2XEV A;  5KYX A;  3S7J A;  1IYG A;  4JW1 A;  4I17 A;  5FQ7 A;  3SZ7 A;  3EGX B;  2IXP A;  3I4R B;  3Q7G A;  3QAQ A;  3CQZ A;  4U5F E;  5DQT A;  3NZU A;  4A1S A;  4O6N A;  3IHV A;  2WVQ A;  4BT8 A;  4LAC B;  2HYZ A;  4GPK A;  5KYU B;  3TXM A;  2J9V A;  4JUR I;  3HHM A;  5FQ4 A;  3JQ1 A;  1D0Z A;  3QZC A;  4U04 A;  2Y3G A;  2Q3T A;  2IXO A;  2V8S E;  2VYI A;  4JA9 A;  2WXI A;  1N1C A;  3LEV A;  4RG9 A;  3CQC B;  3FEX A;  2WXF A;  5DS4 A;  2D5R B;  4Y6C A;  4K03 A;  1EDU A;  4GYO A;  3SZR A;  3S7B A;  4OIR F;  3Q6M A;  2J7P A;  1VDY A;  3KD7 A;  3L34 A;  5A23 A;  3L16 A;  4U0Z A;  3D9J A;  4E7Z A;  3FUL A;  5L3Q A;  2XRY A;  3TG4 A;  4U07 A;  3EFO B;  3F46 A;  2DIW A;  4CCA A;  1ZYR F;  5KYU A;  1WY6 A;  5FQ6 A;  5AIJ A;  3MYV A;  2H7V C;  2VSX E;  4UWK A;  3PRZ A;  1M56 C;  3CIA A;  3R7Q A;  3URZ A;  4MLP A;  4KVO A;  1Z63 A;  1QZ2 A;  4FU3 A;  4C7O B;  4ANJ A;  4HOR A;  5FZR A;  2IJG X;  4XI9 A;  3IBE A;  3EQL F;  2O9X A;  3ABM C;  3LY9 A;  5E76 A;  3NKE A;  3RRN B;  2XXA B;  4J0U A;  4XLP F;  4FP7 A;  1H2U A;  4DVY P;  4RD9 A;  4HEA J;  3FDH A;  2WB2 A;  3RRM B;  4F3V A;  4BJ6 C;  4G23 A;  2PFD A;  3LS8 A;  4F1S A;  4N06 A;  2MRI A;  4DPR A;  2NSZ A;  5CI9 A;  3ZXS A;  5A7D B;  3S0X A;  3RIB A;  2A6H F;  3UT4 A;  3VLE A;  5E2Q A;  2VJ8 A;  2WXP A;  4UQY A;  5BV1 A;  3CKC A;  4H7Y A;  3UMI A;  4CDN A;  3SI5 A;  3DD7 A;  5ANR A;  3EZI A;  4J8E A;  3E9V A;  3Q5M A;  4PK4 A;  5KJL A;  5E75 A;  3UQ3 A;  3ZPJ A;  4U8H A;  5KJN A;  2WZF A;  2MOW A;  3FU5 A;  2XXA A;  4AY6 A;  3HLZ A;  3ABL C;  4JPS A;  3PE4 A;  4G11 A;  3CVU A;  1NZE A;  3FUE A;  4PJM A;  4HLE A;  4PS3 A;  4E6H A;  4JZA A;  4GZ3 A;  3CK7 A;  4EZK A;  3KEZ A;  3EHM A;  3EH1 A;  1JPL A;  3QWV A;  2FO7 A;  2WXK A;  4HOS A;  1MHQ A;  4WWO A;  5FCL A;  1E8Z A;  1XNF A;  2WXM A;  5JJ7 A;  1UN8 A;  2KNH A;  2ION A;  3CK8 A;  3G2W A;  3QMK A;  3FTV A;  4CS9 A;  3AQC A;  3RJV A;  3ZG1 A;  2CFU A;  2AXU A;  4KXK B;  5CI8 A;  2W45 A;  4FLH A;  3U4T A;  2VH3 A;  3I4U A;  3ASN C;  3MKR A;  2CDQ A;  5LCW C;  3D9O A;  3PNT B;  1IQU A;  3CVN A;  2YQ8 A;  1V55 C;  3LDZ A;  1IW7 F;  3FU3 A;  4I44 A;  4KI2 A;  3UGP A;  3JUI A;  4Y6W A;  4U5E E;  2MYS A;  1JPJ A;  1FCH A;  4RVB A;  3GAN A;  4LUN U;  1DNP A;  2A4Z A;  1QLE C;  1M57 C;  2L9J A;  2IU1 A;  4FHJ A;  2CG3 A;  2WXR A;  4L23 A;  4M63 A;  5LFA A;  4HFK B;  2OV8 A;  3PH0 C;  3JT1 A;  2YEV A;  4AIF A;  5LCW J;  4FJZ A;  1TWG A;  2FUL A;  3K7D A;  4JVS A;  3SD5 A;  3FTU A;  4YN0 B;  2AVP A;  3CVL A;  1G8X A;  1NU7 D;  2JD3 A;  2GRL A;  2A69 F;  1SZI A;  4BG0 A;  4PFP A;  2M63 A;  3FUN A;  3FP3 A;  3ZYL A;  1INZ A;  3GYZ A;  3L08 A;  3VAY A;  3D9N A;  4BJ5 A;  5JHA A;  2YNQ A;  3K1I C;  4L7T A;  4MS6 A;  1VMA A;  3RIP A;  4TV3 A;  3CLJ A;  4ILI A;  4U0S A;  3UT7 A;  2KC7 A;  2VGX A;  2R59 A;  4CS8 A;  3NZS A;  4DI4 A;  4ANU A;  3CHS A;  4IYP A;  3IEE A;  3LPZ A;  4J6I A;  2L0I A;  3S7F A;  1ZBP A;  3APD A;  4PJJ A;  1NG1 A;  4JEU A;  5KYW A;  2NUP B;  2CHX A;  2FBN A;  3APC A;  3UGO A;  4GB9 A;  3AS5 A;  1LS1 A;  3B7U X;  4APO A;  4UWG A;  5LX8 A;  2XHE A;  3AG1 C;  2W4B A;  5B1A C;  4CRW A;  4YT4 A;  2XGS A;  4U5D E;  4EZJ A;  2WL8 A;  2E2E A;  2OCC C;  3CVX A;  3HDX A;  4C3B A;  4PS8 A;  4WNG A;  4EBB A;  1YA0 A;  4NAC A;  3Q7L A;  2YHS A;  3LS0 A;  2ZU6 B;  4YT5 A;  3NF1 A;  3T6J A;  1V54 C;  4RSY A;  5BUO A;  3Q49 B;  3HVE A;  3ZYM A;  4U5H A;  4ACL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...