4JC7A

Human ltc4 synthase in complex with product analogs - implications for enzyme catalysis
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
154
structure length
154
Chain Sequence
HHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALALLVALAALGLLAHFLPAALRAALLGRLRTLLPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 60
structure length 154
sequence length 154
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4jc7A00
4JCZA 4JRZA 3B29A 5HV9A 4AL0A 5K0IA 3HKKA 2H8AA 4JC7A 2PNOA 5BQIA 2UUHA 5BQGA 3PCVA 4YL3A 4NTAA 4YL0A 2UUIA 4WABA 5BQHA 2Q7RA 4YL1A 4AL1A 3DWWA 4BPMA 4NTFA 3LEOA 4YK5A 4NTBA 4J7YA 4J7TA
chains in the Genus database with same CATH superfamily
1M2OA 3FOOA 3ZVRA 2FAPB 1CGOA 5T3TA 2F22A 1DOWA 1E86A 3UGOA 1KTMA 1AEPA 1H7IA 2R7RA 1SMYF 3LAYA 3J06A 2CDQA 1H9TA 5F5FA 2HKVA 2PX0A 4EBKA 3UR3C 3T9OA 4C3DA 1VLSA 1T6QA 2M4EA 2J0XA 1LI7A 2VCCA 5JLIA 2KC3A 1NFOA 2EINC 1C17M 1HY5A 3K1IA 4G7OF 1MMGA 1YYJA 2XLHA 3LEOA 1M2VA 4LDRA 4H54A 2LIGA 2VB6A 3ZWIA 4NTBA 3F47A 4MVZA 3M4BA 3NRHA 1Z23A 1OR3A 4CDVA 2YEVA 1TFOB 3GODA 4O6NA 3Q7GA 2A6HF 2W4BA 1SR2A 1YZAA 2AVKA 4I44A 1Z7Qc 2LK4A 4N06A 1ORJA 2HUJA 4J32B 3JTLO 1A7DA 2NSGA 3ASNC 1S7ZA 4MVOA 4KC9A 1RJ9B 1Q0KA 5JVEA 2OU6A 1JMWA 5AC5A 3WODF 2W9YA 3C18A 4MVSA 2HJ3A 4Q7CA 3QTHA 4CS7A 1XZQA 2GAQA 3B9QA 2RD9A 1NU9C 4ER9A 4G7HF 2J9VA 4PJMA 2Q4FA 2HMQA 1M6TA 4YJWA 1LE4A 4I3MA 3W2WA 1HMDA 4BJ5A 1YAUO 3IPMO 1MQVA 2J8WA 3RQFA 2EPOA 2X51A 3T4RA 5DS4A 1U0BB 3EGXB 4LERA 1V74B 3AQBA 2G3KA 5KYUB 4C7OB 2XS1A 2YL0A 3H65A 1MNDA 1OCCC 2BL2A 3N24A 3PHF2 2HZ8A 2R7UA 5HV9A 4D4NA 3NKEA 2NUTB 3MLGA 2W4MA 2A6EF 5K0IA 4JCHA 5BQIA 3DD7A 2A68F 1T01A 1OXKA 4MVMA 1AUEA 2XLVA 3U2LA 2XXAB 1LPEA 1FTSA 3CSKA 2WZGA 3JRTA 1VTMP 1OQCA 4K7BA 5IY5C 3W4YA 1ZHWA 2R7TA 2HV6A 2ASRA 2L6HA 1OCOC 1QPUA 4QI2A 3AG1C 3O39A 3LUTB 2R7WA 1GM5A 4DBQA 3U9MA 3DJNB 1D1AA 2IBFA 4IB4A 5KYXB 3ZG1A 5DS5A 1DOVA 3ABMC 4YK5A 1LE2A 4CS9A 1ORYA 4WGZA 2H7VC 3L8IA 3NYJA 3QVZA 3ZSUA 1FR0A 1RKEA 3EH1A 1SYQA 1LVKA 4JURI 2IXNA 3US6A 2B0HA 3GWNA 4AL0A 4CJOA 3B0UX 1T6UA 3U8VA 1G4US 3CEXA 2H7BA 1MMNA 1QVXA 2EIKC 1APCA 4OINF 5DS6A 4CX9A 3A9CA 1A41A 1LI5A 2NSFA 2WVQA 3DMDA 1FFTC 3NG1A 1O3UA 2CCYA 2LFDA 4XEVA 3T6GB 1B68A 2DYRC 3EG9A 4JTCB 2UUIA 2LCHA 2OKUA 3RH3A 3VRCA 2FFHA 4RDAA 3DWWA 2CNWD 1PD0A 2OJED 3C8ZA 1BR4A 4G0HA 3H2UA 3U2MA 4PJLA 1Q0DA 4C7OA 2L6GA 5T1DB 1KU2A 1V55C 2HV7A 3AGTA 3OWTA 4PJJA 2BE5F 3GANA 2R02A 1LKXA 4E17A 3EGDA 2ZXPA 3RQEA 5EK0A 2PP4A 2JX0A 4WJ0A 1D0XA 4U5GA 3RQGA 2IYLD 4IWBA 2LQGA 1ZYRF 3SXYA 2H7OA 3DZAA 3AG2C 3JRMO 4CJGA 5A6KA 4E0IA 4JVSA 2VASA 1T9KA 5A6BD 5DQZA 4JIOA 1JPJA 1SF8A 2IXMA 3ASOC 4NTAA 3W2VA 4RD9A 1Z5ZA 4CIHA 2ZD9A 2M64A 5E3CA 1LM3B 2J9UA 2QUPA 4CS8A 2YL3A 1ZVZA 4DRIB 2MHRA 2CNWA 2AWYA 3TJ5A 2Y69C 4BEMJ 4DRHB 3M15A 2D4UA 2IXPA 3K66A 2NPUA 1E85A 4P9FA 3LNRA 2QTVA 3JZ0A 3QVYA 4IARA 1OCRC 1HE1A 2HFIA 3EJNA 4J30B 4D4XA 1YVIA 3L8JA 3RW0A 2PX3A 3S29A 4CS8C 3SXKA 3RIPA 3MBGA 3KYJA 3VYWA 4MTGA 3I4UA 2IXOA 2DGJA 3N2ZB 3K1HA 1J8MF 3IQCA 3Q7LA 2J7PD 3PCVA 2J0WA 1EQ1A 4NCQA 5A6BA 1EI7A 1FMVA 3LLIA 3VM6A 2J9BA 2DB4A 2I15A 1C02A 4JZAA 4U5CE 4MVUA 1H9GA 3SEOA 2KK1A 1I5NA 4JEBA 2XL6A 2XLEA 2YLGA 3HLZA 3NKDA 4AL1A 5JRAA 4XLPF 1YDIA 4XPWA 1O87A 3SYNA 4CSAC 5JUAA 2XM4A 2OEXA 3K33A 5FCLA 1GGQA 1WOLA 1D1BA 3C7JA 2YZSA 1ZZPA 4U9DA 4DXWA 5HSWA 4F4BA 3V5XA 1YZCA 2QLAA 1GS9A 1QQ3A 4XQ1A 2J9WA 2ZXOA 3DJUB 1YJGA 2YL7A 3DI5A 3QW0A 2D5RB 2DI3A 1Z6AA 1CPQA 2JD3A 2KGOA 4O7GA 2EIJC 3E9VA 2J7PA 1RJ9A 3RKOF 2QNLA 3LLKA 3FAJA 2VC9A 2TMVP 2XS8A 3IHUA 3G50A 4U5FE 4R32A 2WL8A 2A0UA 1PCXA 2YLIA 5EGYA 3I5PA 1Q0MA 2Z15A 3POVA 3MX3A 2R7OA 3L1MA 3NMKA 4PACA 4U9EA 3SP1A 1LS1A 1ZHZA 3K6BA 1BR1A 4MQ9F 5L0JA 2XLMA 4XPYA 1QLEC 1C03A 2EPLX 2ZPAA 1Z3IX 3DM9B 3JYHA 5DVWA 3EHNA 3VF0A 3GM3A 3H2VA 3RFYA 3M79A 2C03A 2KJGA 2NUPB 3EGXA 4JC7A 3TK0A 4OIRF 5L0FA 5KYUA 3JSZA 5COMA 3EFOB 4BJ1A 3UNGC 1TR2A 1G5ZA 2GA0A 3HNIA 2O9XA 2R25A 3HNJA 2YLDA 2NUTA 2WB7A 1WWPA 4GEHA 4WGYA 4MW8A 3DAFA 4AK9A 4FAPB 5CI9A 3WAQA 1BDJB 4ZLDA 4EUKB 1VB5A 2DYSC 4Z9IA 2Q7RA 2P61A 3DKAA 3GWLA 3S28A 4EWCA 2XXAA 3RF3A 1JAFA 1FAPB 1HW2A 1F1MA 1VOMA 1AVOB 3LS1A 2LP4A 1UFBA 2OG2A 1D0YA 3E70C 5KYXA 3O10A 3EZHA 4CBEA 3NYMA 3IQTA 2HSBA 5CIVA 1FNTc 3FHDA 2H8AA 3X1OA 1QKRA 1LIHA 1HMOA 2E87A 1RXQA 3LNMB 2MYSA 3NMIA 3GORA 1YA9A 4GQHA 3GEEA 4A4AA 4I1MA 3C8GB 1WASA 4FWVA 2KSFA 3OA1A 3WHNA 2R03A 1ZW2A 1ZW3A 2IOQA 1YARO 4AE4B 4CDAA 2KQ9A 2CGEA 2R7QA 1RKEB 1NBBA 4BG0A 4OD5A 1S05A 3R2PA 5T3WA 5KYNA 4Q5SF 1BR2A 5COGA 4QDLA 4MNDA 1EKYA 2XLWA 2V3CC 4HFKB 2HS5A 3HNKA 3ATPA 2L9JA 2J46A 4E18A 1JRAA 4KBLA 2P0NA 3I5QA 2FGYA 2XL4A 5D91A 3ZQYA 1D0ZA 3PDMP 1A7VA 1N1CA 2OEVA 3TOLA 4BJ6C 2P6VA 3DM5A 3GM2A 3ZDLA 3JT1A 2Q3TA 1NG1A 1VMAA 1XZPA 2CW0F 2EIMC 2I8BA 1M57C 2LSEA 4P9TA 4QI0A 3RVZA 3U5SA 1Q0FA 3IEEA 1E2XA 1I4YA 2XRHA 2JPUA 3KPHA 4O6YA 4O79A 3CZ6A 4DVYP 4E7ZA 2NG1A 1TWAA 3NMJA 3EZIA 4LDKA 5BQHA 3M1CB 2R05A 2X0CA 3MYFA 4K1OA 3FVYA 2KW3C 2A0BA 3KL4A 4CDYA 1U89A 2PBEA 2W45A 4BPMA 4YWQA 4Q4ZF 3S27A 4PR9A 4NC3A 3TULA 1PV3A 3DE8A 1A0BA 3FOPA 1K05A 5KYYB 3S84A 1PD1A 4NQFA 4MTOA 2XSEA 1FFHA 4W8KA 1VK5A 4JRZA 2HJMA 4MVQA 3AGUA 4YT4A 5JS5A 2CYDA 3L0IA 2Y3BA 3PMRA 1HW1A 1ZU5A 4HEAJ 5KYWB 5A6AA 3HTKC 1G8XA 5L3VA 1NU7D 2ICWG 1E83A 3W8IA 1MNEA 1YLMA 1KNYA 3O55A 4XWJA 3QW1A 4B6IA 2L6FA 3FXHA 3U9JA 4DVZA 2ZXWC 2YKZA 1NFNA 3TD7A 3TJ6A 1IW7F 2VCBA 4AX2A 3Q6MA 4BJTA 4LLCA 4E0HA 4CSAA 1RCPA 3MFNA 5A6JA 3AOUA 3F46A 1OKKD 4HFFB 1RMVA 1OXBA 2YVKA 5D92A 4PFPA 1L7CA 1TKNA 3KH2A 4J7YA 3UMHA 2YWAA 4RBNA 3T6JA 4IAQA 1U6HA 2OQMA 3ITFA 2XLDA 3B71A 1OW8A 3LJBA 4KI2A 1ZHYA 2IM8A 4XTKA 5L0HA 3SXMA 1FMWA 3A11A 3HKKA 2OOCA 1BBHA 3EPVA 4EKWA 2ZXRA 5F28E 5JT4A 4DOZA 1OW6A 2AWCA 1VYIA 5L0CA 4ZLCA 1LS4A 4ULWA 1I4ZA 4IJJA 5L3QA 1MMDA 2XM0A 5E3AA 4JKVA 1EA8A 3ABLC 2A1DD 5EHHA 2Q9BA 3K7DA 5F5HA 1M2VB 1WN0A 2YL1A 4FESA 4ONSA 4YL3A 2VCAA 4NY3A 1VYKA 2YRFA 3OEOA 3HJCA 4CIPA 2AP3A 3FAPB 1OR2A 4DRJB 3R7CA 3WG7C 3UMKA 1TWHA 2LD6A 3FDQA 1O5HA 4IGGA 2V26A 2Y39A 1OKKA 1Y6DA 2B0JA 3K1IC 2BC5A 256BA 2XL8A 2MWQA 2Q9CA 2YHSA 2C04A 3DAGA 4MS2A 4Z9JA 3LEVA 1JPNA 1H6GA 2PFDA 1TWGA 4U5EE 3CAXA 3ZTZA 1VLTA 1NZEA 3IQ6A 5B3IA 4JCZA 1ZHTA 4LLEA 4PJNA 2P1AA 3X2QC 4U5DE 1WATA 1TFKB 1NSGB 1R5ID 5E2QA 1ZHXA 2UUHA 2WZLA 5FZTA 1BZ4A 1V54C 2KYHA 3QZCA 5BQGA 4ANJA 4UDVA 3AJMA 2L7AA 5B1BC 1J8YF 2HMZA 4C3BA 3S0XA 3V5ZA 2VH3A 2QY9A 4LACB 2Y3DA 3GEHA 2NUPA 2G3VA 3LS0A 1GQAA 3RVYA 1SZIA 3S9OA 3T6BA 3UMIA 1R4TA 1TWCA 4XEKA 4OD4A 3EQLF 4G7ZF 4WABA 1T6IA 3ABKC 3EFOA 2GWWA 1G4WR 3C8GD 1E84A 4HE8D 3SXZA 3NDBB 2OCCC 2PF4E 2A69F 4MVRA 3U0CA 3IQ5A 1QZXA 4BJ5C 4YT8A 4ULVA 5JSLA 2J45A 3VAYA 4EIYA 4OIPF 3B29A 3EH2A 3DE9A 5DQTA 3JSEO 1ST6A 5E33A 2GDCA 3V5YA 2Y3GA 3BRJA 4N4WA 4XLNF 4PK4A 3SZRA 1CGME 4OIOF 4MW3A 4YT2A 3HNLA 4A2NB 5L0GA 2AU5A 1K04A 2G62A 2R7VA 4K0DA 1QSPA 3DXJF 1YA7O 3C63A 3GEIA 4JW1A 5JP7A 1L3PA 4XPXA 5BUOA 2EILC 3JYYA 3U3BA 1M56C 2YQYA 3C8GA 4NTFA 3V7OA 1Q0GA 5L0IA 4AE4A 4EHPA 4DBRA 3ZC4A 3C62A 1OW7A 3ZQVA 4EBJA 4E7SA 3BEHA 5L0DA 1Z63A 4CS9C 4C3EA 3L34A 4BJ6A 4M63A 4H4KC 3N0TA 1HE9A 3ZIBA 3TQOA 3NYLA 3U3FA 1CPRA 2PNOA 4N6CA 4BEJA 3EG9B 1W2WA 4U5BE 1JR8A 3LESA 2QE9A 4P6IC 4JE9A 3KMIA 4IRUA 1WGWA 4PFOA 1XWJA 3G4XA 1ZU4A 3CQZA 3M4CA 4FX5A 4YL0A 2HSQA 3UGPA 3EHMA 5AC4A 4MTFA 4YL1A 4YT5A 1A7EA 3AG4C 4YN0B 2WVNA 3EGDB 4EBBA 1UG7A 3KYIA 4G78A 4JJGA 3AG3C 5A69A 4OIQF 5GPGB 1OCZC 3W8HA 2KNHA 4W8PA 5TJ5E 4IAOA 2WZFA 3JCUQ 3U8PA 2R7XA 5AGFA 4U5HA 1RKCA 2LFFA 2XLOA 5B1AC 2EPKX 3S90A 2OJQA 1CGNA 4L6RA 4O6MA 1D1CA 3QMKA 4GYTA 4N6HA 1V4AA 4KNVA 5KYYA 3B0VC 3B0PA 2RSEB 1JOGA 1Y4CA 4JJFA 1TQGA 1WTYA 3GM1A 1T5OA 2L81A 3MYIA 3RYLA 3TOMA 4JEAA 4XEFA 5DLJA 2R7SA 4LDQA 4X0RA 3Q6NA 3KKBA 4DJ9A 2P7VA 3SNHA 2Q00A 5KYWA 5B3SC 2R9RB 1K40A 2Y3HA 3O6XA 2Q9AA 3FMSA 4Z9HA 2EPMX 4KNWA 2ETSA 5CI8A 3ZTMA 3AQCA 5COFA 2GFHA 1ORSC 1NLXA 1IZMA 1MMAA 1YYXA 4I1OB 4J7TA 4JTDB 2WVOA 4JTAB 2EPNA 3ECSA 3G4ZA
chains in the Genus database with same CATH topology
4JCZA 4JRZA 3B29A 5HV9A 4AL0A 5K0IA 3HKKA 2H8AA 4JC7A 2PNOA 5BQIA 2UUHA 5BQGA 3PCVA 4YL3A 4NTAA 4YL0A 2UUIA 4WABA 5BQHA 2Q7RA 4YL1A 4AL1A 3DWWA 4BPMA 4NTFA 3LEOA 4YK5A 4NTBA 4J7YA 4J7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JCZ A;  4JRZ A;  3B29 A;  5HV9 A;  4AL0 A;  5K0I A;  3HKK A;  2H8A A;  4JC7 A;  2PNO A;  5BQI A;  2UUH A;  5BQG A;  3PCV A;  4YL3 A;  4NTA A;  4YL0 A;  2UUI A;  4WAB A;  5BQH A;  2Q7R A;  4YL1 A;  4AL1 A;  3DWW A;  4BPM A;  4NTF A;  3LEO A;  4YK5 A;  4NTB A;  4J7Y A;  4J7T A; 
#chains in the Genus database with same CATH topology
 1M2O A;  3FOO A;  3ZVR A;  2FAP B;  1CGO A;  5T3T A;  2F22 A;  1DOW A;  1E86 A;  3UGO A;  1KTM A;  1AEP A;  1H7I A;  2R7R A;  1SMY F;  3LAY A;  3J06 A;  2CDQ A;  1H9T A;  5F5F A;  2HKV A;  2PX0 A;  4EBK A;  3UR3 C;  3T9O A;  4C3D A;  1VLS A;  1T6Q A;  2M4E A;  2J0X A;  1LI7 A;  2VCC A;  5JLI A;  2KC3 A;  1NFO A;  2EIN C;  1C17 M;  1HY5 A;  3K1I A;  4G7O F;  1MMG A;  1YYJ A;  2XLH A;  3LEO A;  1M2V A;  4LDR A;  4H54 A;  2LIG A;  2VB6 A;  3ZWI A;  4NTB A;  3F47 A;  4MVZ A;  3M4B A;  3NRH A;  1Z23 A;  1OR3 A;  4CDV A;  2YEV A;  1TFO B;  3GOD A;  4O6N A;  3Q7G A;  2A6H F;  2W4B A;  1SR2 A;  1YZA A;  2AVK A;  4I44 A;  1Z7Q c;  2LK4 A;  4N06 A;  1ORJ A;  2HUJ A;  4J32 B;  3JTL O;  1A7D A;  2NSG A;  3ASN C;  1S7Z A;  4MVO A;  4KC9 A;  1RJ9 B;  1Q0K A;  5JVE A;  2OU6 A;  1JMW A;  5AC5 A;  3WOD F;  2W9Y A;  3C18 A;  4MVS A;  2HJ3 A;  4Q7C A;  3QTH A;  4CS7 A;  1XZQ A;  2GAQ A;  3B9Q A;  2RD9 A;  1NU9 C;  4ER9 A;  4G7H F;  2J9V A;  4PJM A;  2Q4F A;  2HMQ A;  1M6T A;  4YJW A;  1LE4 A;  4I3M A;  3W2W A;  1HMD A;  4BJ5 A;  1YAU O;  3IPM O;  1MQV A;  2J8W A;  3RQF A;  2EPO A;  2X51 A;  3T4R A;  5DS4 A;  1U0B B;  3EGX B;  4LER A;  1V74 B;  3AQB A;  2G3K A;  5KYU B;  4C7O B;  2XS1 A;  2YL0 A;  3H65 A;  1MND A;  1OCC C;  2BL2 A;  3N24 A;  3PHF 2;  2HZ8 A;  2R7U A;  5HV9 A;  4D4N A;  3NKE A;  2NUT B;  3MLG A;  2W4M A;  2A6E F;  5K0I A;  4JCH A;  5BQI A;  3DD7 A;  2A68 F;  1T01 A;  1OXK A;  4MVM A;  1AUE A;  2XLV A;  3U2L A;  2XXA B;  1LPE A;  1FTS A;  3CSK A;  2WZG A;  3JRT A;  1VTM P;  1OQC A;  4K7B A;  5IY5 C;  3W4Y A;  1ZHW A;  2R7T A;  2HV6 A;  2ASR A;  2L6H A;  1OCO C;  1QPU A;  4QI2 A;  3AG1 C;  3O39 A;  3LUT B;  2R7W A;  1GM5 A;  4DBQ A;  3U9M A;  3DJN B;  1D1A A;  2IBF A;  4IB4 A;  5KYX B;  3ZG1 A;  5DS5 A;  1DOV A;  3ABM C;  4YK5 A;  1LE2 A;  4CS9 A;  1ORY A;  4WGZ A;  2H7V C;  3L8I A;  3NYJ A;  3QVZ A;  3ZSU A;  1FR0 A;  1RKE A;  3EH1 A;  1SYQ A;  1LVK A;  4JUR I;  2IXN A;  3US6 A;  2B0H A;  3GWN A;  4AL0 A;  4CJO A;  3B0U X;  1T6U A;  3U8V A;  1G4U S;  3CEX A;  2H7B A;  1MMN A;  1QVX A;  2EIK C;  1APC A;  4OIN F;  5DS6 A;  4CX9 A;  3A9C A;  1A41 A;  1LI5 A;  2NSF A;  2WVQ A;  3DMD A;  1FFT C;  3NG1 A;  1O3U A;  2CCY A;  2LFD A;  4XEV A;  3T6G B;  1B68 A;  2DYR C;  3EG9 A;  4JTC B;  2UUI A;  2LCH A;  2OKU A;  3RH3 A;  3VRC A;  2FFH A;  4RDA A;  3DWW A;  2CNW D;  1PD0 A;  2OJE D;  3C8Z A;  1BR4 A;  4G0H A;  3H2U A;  3U2M A;  4PJL A;  1Q0D A;  4C7O A;  2L6G A;  5T1D B;  1KU2 A;  1V55 C;  2HV7 A;  3AGT A;  3OWT A;  4PJJ A;  2BE5 F;  3GAN A;  2R02 A;  1LKX A;  4E17 A;  3EGD A;  2ZXP A;  3RQE A;  5EK0 A;  2PP4 A;  2JX0 A;  4WJ0 A;  1D0X A;  4U5G A;  3RQG A;  2IYL D;  4IWB A;  2LQG A;  1ZYR F;  3SXY A;  2H7O A;  3DZA A;  3AG2 C;  3JRM O;  4CJG A;  5A6K A;  4E0I A;  4JVS A;  2VAS A;  1T9K A;  5A6B D;  5DQZ A;  4JIO A;  1JPJ A;  1SF8 A;  2IXM A;  3ASO C;  4NTA A;  3W2V A;  4RD9 A;  1Z5Z A;  4CIH A;  2ZD9 A;  2M64 A;  5E3C A;  1LM3 B;  2J9U A;  2QUP A;  4CS8 A;  2YL3 A;  1ZVZ A;  4DRI B;  2MHR A;  2CNW A;  2AWY A;  3TJ5 A;  2Y69 C;  4BEM J;  4DRH B;  3M15 A;  2D4U A;  2IXP A;  3K66 A;  2NPU A;  1E85 A;  4P9F A;  3LNR A;  2QTV A;  3JZ0 A;  3QVY A;  4IAR A;  1OCR C;  1HE1 A;  2HFI A;  3EJN A;  4J30 B;  4D4X A;  1YVI A;  3L8J A;  3RW0 A;  2PX3 A;  3S29 A;  4CS8 C;  3SXK A;  3RIP A;  3MBG A;  3KYJ A;  3VYW A;  4MTG A;  3I4U A;  2IXO A;  2DGJ A;  3N2Z B;  3K1H A;  1J8M F;  3IQC A;  3Q7L A;  2J7P D;  3PCV A;  2J0W A;  1EQ1 A;  4NCQ A;  5A6B A;  1EI7 A;  1FMV A;  3LLI A;  3VM6 A;  2J9B A;  2DB4 A;  2I15 A;  1C02 A;  4JZA A;  4U5C E;  4MVU A;  1H9G A;  3SEO A;  2KK1 A;  1I5N A;  4JEB A;  2XL6 A;  2XLE A;  2YLG A;  3HLZ A;  3NKD A;  4AL1 A;  5JRA A;  4XLP F;  1YDI A;  4XPW A;  1O87 A;  3SYN A;  4CSA C;  5JUA A;  2XM4 A;  2OEX A;  3K33 A;  5FCL A;  1GGQ A;  1WOL A;  1D1B A;  3C7J A;  2YZS A;  1ZZP A;  4U9D A;  4DXW A;  5HSW A;  4F4B A;  3V5X A;  1YZC A;  2QLA A;  1GS9 A;  1QQ3 A;  4XQ1 A;  2J9W A;  2ZXO A;  3DJU B;  1YJG A;  2YL7 A;  3DI5 A;  3QW0 A;  2D5R B;  2DI3 A;  1Z6A A;  1CPQ A;  2JD3 A;  2KGO A;  4O7G A;  2EIJ C;  3E9V A;  2J7P A;  1RJ9 A;  3RKO F;  2QNL A;  3LLK A;  3FAJ A;  2VC9 A;  2TMV P;  2XS8 A;  3IHU A;  3G50 A;  4U5F E;  4R32 A;  2WL8 A;  2A0U A;  1PCX A;  2YLI A;  5EGY A;  3I5P A;  1Q0M A;  2Z15 A;  3POV A;  3MX3 A;  2R7O A;  3L1M A;  3NMK A;  4PAC A;  4U9E A;  3SP1 A;  1LS1 A;  1ZHZ A;  3K6B A;  1BR1 A;  4MQ9 F;  5L0J A;  2XLM A;  4XPY A;  1QLE C;  1C03 A;  2EPL X;  2ZPA A;  1Z3I X;  3DM9 B;  3JYH A;  5DVW A;  3EHN A;  3VF0 A;  3GM3 A;  3H2V A;  3RFY A;  3M79 A;  2C03 A;  2KJG A;  2NUP B;  3EGX A;  4JC7 A;  3TK0 A;  4OIR F;  5L0F A;  5KYU A;  3JSZ A;  5COM A;  3EFO B;  4BJ1 A;  3UNG C;  1TR2 A;  1G5Z A;  2GA0 A;  3HNI A;  2O9X A;  2R25 A;  3HNJ A;  2YLD A;  2NUT A;  2WB7 A;  1WWP A;  4GEH A;  4WGY A;  4MW8 A;  3DAF A;  4AK9 A;  4FAP B;  5CI9 A;  3WAQ A;  1BDJ B;  4ZLD A;  4EUK B;  1VB5 A;  2DYS C;  4Z9I A;  2Q7R A;  2P61 A;  3DKA A;  3GWL A;  3S28 A;  4EWC A;  2XXA A;  3RF3 A;  1JAF A;  1FAP B;  1HW2 A;  1F1M A;  1VOM A;  1AVO B;  3LS1 A;  2LP4 A;  1UFB A;  2OG2 A;  1D0Y A;  3E70 C;  5KYX A;  3O10 A;  3EZH A;  4CBE A;  3NYM A;  3IQT A;  2HSB A;  5CIV A;  1FNT c;  3FHD A;  2H8A A;  3X1O A;  1QKR A;  1LIH A;  1HMO A;  2E87 A;  1RXQ A;  3LNM B;  2MYS A;  3NMI A;  3GOR A;  1YA9 A;  4GQH A;  3GEE A;  4A4A A;  4I1M A;  3C8G B;  1WAS A;  4FWV A;  2KSF A;  3OA1 A;  3WHN A;  2R03 A;  1ZW2 A;  1ZW3 A;  2IOQ A;  1YAR O;  4AE4 B;  4CDA A;  2KQ9 A;  2CGE A;  2R7Q A;  1RKE B;  1NBB A;  4BG0 A;  4OD5 A;  1S05 A;  3R2P A;  5T3W A;  5KYN A;  4Q5S F;  1BR2 A;  5COG A;  4QDL A;  4MND A;  1EKY A;  2XLW A;  2V3C C;  4HFK B;  2HS5 A;  3HNK A;  3ATP A;  2L9J A;  2J46 A;  4E18 A;  1JRA A;  4KBL A;  2P0N A;  3I5Q A;  2FGY A;  2XL4 A;  5D91 A;  3ZQY A;  1D0Z A;  3PDM P;  1A7V A;  1N1C A;  2OEV A;  3TOL A;  4BJ6 C;  2P6V A;  3DM5 A;  3GM2 A;  3ZDL A;  3JT1 A;  2Q3T A;  1NG1 A;  1VMA A;  1XZP A;  2CW0 F;  2EIM C;  2I8B A;  1M57 C;  2LSE A;  4P9T A;  4QI0 A;  3RVZ A;  3U5S A;  1Q0F A;  3IEE A;  1E2X A;  1I4Y A;  2XRH A;  2JPU A;  3KPH A;  4O6Y A;  4O79 A;  3CZ6 A;  4DVY P;  4E7Z A;  2NG1 A;  1TWA A;  3NMJ A;  3EZI A;  4LDK A;  5BQH A;  3M1C B;  2R05 A;  2X0C A;  3MYF A;  4K1O A;  3FVY A;  2KW3 C;  2A0B A;  3KL4 A;  4CDY A;  1U89 A;  2PBE A;  2W45 A;  4BPM A;  4YWQ A;  4Q4Z F;  3S27 A;  4PR9 A;  4NC3 A;  3TUL A;  1PV3 A;  3DE8 A;  1A0B A;  3FOP A;  1K05 A;  5KYY B;  3S84 A;  1PD1 A;  4NQF A;  4MTO A;  2XSE A;  1FFH A;  4W8K A;  1VK5 A;  4JRZ A;  2HJM A;  4MVQ A;  3AGU A;  4YT4 A;  5JS5 A;  2CYD A;  3L0I A;  2Y3B A;  3PMR A;  1HW1 A;  1ZU5 A;  4HEA J;  5KYW B;  5A6A A;  3HTK C;  1G8X A;  5L3V A;  1NU7 D;  2ICW G;  1E83 A;  3W8I A;  1MNE A;  1YLM A;  1KNY A;  3O55 A;  4XWJ A;  3QW1 A;  4B6I A;  2L6F A;  3FXH A;  3U9J A;  4DVZ A;  2ZXW C;  2YKZ A;  1NFN A;  3TD7 A;  3TJ6 A;  1IW7 F;  2VCB A;  4AX2 A;  3Q6M A;  4BJT A;  4LLC A;  4E0H A;  4CSA A;  1RCP A;  3MFN A;  5A6J A;  3AOU A;  3F46 A;  1OKK D;  4HFF B;  1RMV A;  1OXB A;  2YVK A;  5D92 A;  4PFP A;  1L7C A;  1TKN A;  3KH2 A;  4J7Y A;  3UMH A;  2YWA A;  4RBN A;  3T6J A;  4IAQ A;  1U6H A;  2OQM A;  3ITF A;  2XLD A;  3B71 A;  1OW8 A;  3LJB A;  4KI2 A;  1ZHY A;  2IM8 A;  4XTK A;  5L0H A;  3SXM A;  1FMW A;  3A11 A;  3HKK A;  2OOC A;  1BBH A;  3EPV A;  4EKW A;  2ZXR A;  5F28 E;  5JT4 A;  4DOZ A;  1OW6 A;  2AWC A;  1VYI A;  5L0C A;  4ZLC A;  1LS4 A;  4ULW A;  1I4Z A;  4IJJ A;  5L3Q A;  1MMD A;  2XM0 A;  5E3A A;  4JKV A;  1EA8 A;  3ABL C;  2A1D D;  5EHH A;  2Q9B A;  3K7D A;  5F5H A;  1M2V B;  1WN0 A;  2YL1 A;  4FES A;  4ONS A;  4YL3 A;  2VCA A;  4NY3 A;  1VYK A;  2YRF A;  3OEO A;  3HJC A;  4CIP A;  2AP3 A;  3FAP B;  1OR2 A;  4DRJ B;  3R7C A;  3WG7 C;  3UMK A;  1TWH A;  2LD6 A;  3FDQ A;  1O5H A;  4IGG A;  2V26 A;  2Y39 A;  1OKK A;  1Y6D A;  2B0J A;  3K1I C;  2BC5 A;  256B A;  2XL8 A;  2MWQ A;  2Q9C A;  2YHS A;  2C04 A;  3DAG A;  4MS2 A;  4Z9J A;  3LEV A;  1JPN A;  1H6G A;  2PFD A;  1TWG A;  4U5E E;  3CAX A;  3ZTZ A;  1VLT A;  1NZE A;  3IQ6 A;  5B3I A;  4JCZ A;  1ZHT A;  4LLE A;  4PJN A;  2P1A A;  3X2Q C;  4U5D E;  1WAT A;  1TFK B;  1NSG B;  1R5I D;  5E2Q A;  1ZHX A;  2UUH A;  2WZL A;  5FZT A;  1BZ4 A;  1V54 C;  2KYH A;  3QZC A;  5BQG A;  4ANJ A;  4UDV A;  3AJM A;  2L7A A;  5B1B C;  1J8Y F;  2HMZ A;  4C3B A;  3S0X A;  3V5Z A;  2VH3 A;  2QY9 A;  4LAC B;  2Y3D A;  3GEH A;  2NUP A;  2G3V A;  3LS0 A;  1GQA A;  3RVY A;  1SZI A;  3S9O A;  3T6B A;  3UMI A;  1R4T A;  1TWC A;  4XEK A;  4OD4 A;  3EQL F;  4G7Z F;  4WAB A;  1T6I A;  3ABK C;  3EFO A;  2GWW A;  1G4W R;  3C8G D;  1E84 A;  4HE8 D;  3SXZ A;  3NDB B;  2OCC C;  2PF4 E;  2A69 F;  4MVR A;  3U0C A;  3IQ5 A;  1QZX A;  4BJ5 C;  4YT8 A;  4ULV A;  5JSL A;  2J45 A;  3VAY A;  4EIY A;  4OIP F;  3B29 A;  3EH2 A;  3DE9 A;  5DQT A;  3JSE O;  1ST6 A;  5E33 A;  2GDC A;  3V5Y A;  2Y3G A;  3BRJ A;  4N4W A;  4XLN F;  4PK4 A;  3SZR A;  1CGM E;  4OIO F;  4MW3 A;  4YT2 A;  3HNL A;  4A2N B;  5L0G A;  2AU5 A;  1K04 A;  2G62 A;  2R7V A;  4K0D A;  1QSP A;  3DXJ F;  1YA7 O;  3C63 A;  3GEI A;  4JW1 A;  5JP7 A;  1L3P A;  4XPX A;  5BUO A;  2EIL C;  3JYY A;  3U3B A;  1M56 C;  2YQY A;  3C8G A;  4NTF A;  3V7O A;  1Q0G A;  5L0I A;  4AE4 A;  4EHP A;  4DBR A;  3ZC4 A;  3C62 A;  1OW7 A;  3ZQV A;  4EBJ A;  4E7S A;  3BEH A;  5L0D A;  1Z63 A;  4CS9 C;  4C3E A;  3L34 A;  4BJ6 A;  4M63 A;  4H4K C;  3N0T A;  1HE9 A;  3ZIB A;  3TQO A;  3NYL A;  3U3F A;  1CPR A;  2PNO A;  4N6C A;  4BEJ A;  3EG9 B;  1W2W A;  4U5B E;  1JR8 A;  3LES A;  2QE9 A;  4P6I C;  4JE9 A;  3KMI A;  4IRU A;  1WGW A;  4PFO A;  1XWJ A;  3G4X A;  1ZU4 A;  3CQZ A;  3M4C A;  4FX5 A;  4YL0 A;  2HSQ A;  3UGP A;  3EHM A;  5AC4 A;  4MTF A;  4YL1 A;  4YT5 A;  1A7E A;  3AG4 C;  4YN0 B;  2WVN A;  3EGD B;  4EBB A;  1UG7 A;  3KYI A;  4G78 A;  4JJG A;  3AG3 C;  5A69 A;  4OIQ F;  5GPG B;  1OCZ C;  3W8H A;  2KNH A;  4W8P A;  5TJ5 E;  4IAO A;  2WZF A;  3JCU Q;  3U8P A;  2R7X A;  5AGF A;  4U5H A;  1RKC A;  2LFF A;  2XLO A;  5B1A C;  2EPK X;  3S90 A;  2OJQ A;  1CGN A;  4L6R A;  4O6M A;  1D1C A;  3QMK A;  4GYT A;  4N6H A;  1V4A A;  4KNV A;  5KYY A;  3B0V C;  3B0P A;  2RSE B;  1JOG A;  1Y4C A;  4JJF A;  1TQG A;  1WTY A;  3GM1 A;  1T5O A;  2L81 A;  3MYI A;  3RYL A;  3TOM A;  4JEA A;  4XEF A;  5DLJ A;  2R7S A;  4LDQ A;  4X0R A;  3Q6N A;  3KKB A;  4DJ9 A;  2P7V A;  3SNH A;  2Q00 A;  5KYW A;  5B3S C;  2R9R B;  1K40 A;  2Y3H A;  3O6X A;  2Q9A A;  3FMS A;  4Z9H A;  2EPM X;  4KNW A;  2ETS A;  5CI8 A;  3ZTM A;  3AQC A;  5COF A;  2GFH A;  1ORS C;  1NLX A;  1IZM A;  1MMA A;  1YYX A;  4I1O B;  4J7T A;  4JTD B;  2WVO A;  4JTA B;  2EPN A;  3ECS A;  3G4Z A; 
#chains in the Genus database with same CATH homology
 4JCZ A;  4JRZ A;  3B29 A;  5HV9 A;  4AL0 A;  5K0I A;  3HKK A;  2H8A A;  4JC7 A;  2PNO A;  5BQI A;  2UUH A;  5BQG A;  3PCV A;  4YL3 A;  4NTA A;  4YL0 A;  2UUI A;  4WAB A;  5BQH A;  2Q7R A;  4YL1 A;  4AL1 A;  3DWW A;  4BPM A;  4NTF A;  3LEO A;  4YK5 A;  4NTB A;  4J7Y A;  4J7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...