4JC7A

Human ltc4 synthase in complex with product analogs - implications for enzyme catalysis
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
154
structure length
154
Chain Sequence
b'HHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALALLVALAALGLLAHFLPAALRAALLGRLRTLLPW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 60
structure length 154
sequence length 154
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4jc7A00
4JC7A 5HV9A 4JCZA 5K0IA 4J7YA 3HKKA 4JRZA 4NTAA 4YL1A 2H8AA 4NTFA 2UUIA 4YL0A 3B29A 4YK5A 2PNOA 4AL1A 5BQIA 4YL3A 4AL0A 3PCVA 2UUHA 4NTBA 4BPMA 2Q7RA 5BQGA 5BQHA 3LEOA 3DWWA 4J7TA 4WABA
chains in the Genus database with same CATH superfamily
3H2UA 3RF3A 3Q7LA 4BJ6A 4L6RA 4WJ0A 1I4YA 1LM3B 1VB5A 4JJFA 2J7PA 4JKVA 5AC4A 2Q3TA 4I44A 5GPGB 2R7SA 3JT1A 1HY5A 4MQ9F 3SNHA 5B3IA 3EG9B 2MWQA 2OJQA 1GS9A 4FX5A 2L6HA 2YLDA 3B29A 3S9OA 3AG2C 2EIMC 3DAGA 2CYDA 3QVZA 3RVYA 3IQ6A 4XQ1A 1T6IA 1FR0A 3FOPA 1T6UA 1AEPA 1OXKA 1WGWA 4LDRA 2DB4A 3U3FA 1HE1A 1T9KA 4JTAB 2LFFA 1Z23A 2L6GA 2M4EA 1AUEA 2YLGA 3EHMA 3QZCA 3TOLA 3W4YA 2NUTB 1OCCC 1APCA 1HMDA 4P9FA 5JS5A 1WN0A 4MW3A 2HS5A 2GWWA 3K7DA 4RBNA 2WVQA 5B1AC 3F47A 2ETSA 3GANA 1QVXA 2L7AA 3DAFA 2OJED 4MVSA 5AGFA 4Z9JA 1VTMP 1YJGA 4JCZA 2R7VA 4CX9A 4YWQA 1M2VA 3KH2A 4OINF 1RKEA 3LEVA 2OKUA 3NKEA 5T3WA 5A6BD 1GGQA 1LIHA 1JMWA 1OQCA 4DOZA 3CEXA 4YT2A 3S29A 4MVRA 4DVZA 1ZHZA 1EI7A 3LNMB 1HMOA 2DYSC 3DE9A 3Q6MA 3RVZA 5L0JA 4OIQF 3SP1A 3C8GD 2G62A 5E3AA 1M2VB 2R7RA 2EPNA 2ZXOA 5JP7A 1IZMA 1Y4CA 3DD7A 1RMVA 1OCRC 5JUAA 3X2QC 1YAUO 4J32B 1V74B 1SYQA 4AX2A 5L0GA 3PMRA 4UDVA 4DRHB 1YVIA 4MNDA 1JPNA 2C03A 4JC7A 3ABLC 4O6MA 3VRCA 4BJTA 256BA 1QPUA 3HKKA 2J9UA 3O55A 4JRZA 1WATA 5KYUA 1TQGA 3ZQYA 4NTAA 2GFHA 3J06A 2FGYA 1FMWA 2XS1A 3E70C 4K1OA 4MTOA 2IXMA 4D4NA 3EPVA 1LPEA 1M6TA 1UG7A 4PK4A 1IW7F 2DI3A 2R7WA 2CW0F 1C02A 2EPOA 1ZHWA 3VAYA 4I1OB 1WASA 4NCQA 3GWLA 1D1AA 1G4WR 1T5OA 3DI5A 3SXZA 2LCHA 3HNKA 4NTBA 1ZW3A 3K66A 3DE8A 1J8YF 3RFYA 1KU2A 3HJCA 3B0UX 2R7OA 1GQAA 3JTLO 1U0BB 4KBLA 4MVQA 4C7OB 4ER9A 2KW3C 4E7SA 1YA7O 2OOCA 1D0XA 3ASOC 5FCLA 2YQYA 1A7DA 3IQTA 4WABA 3DM5A 4ULVA 5IY5C 2H7BA 3LLIA 4YJWA 2ICWG 3UMHA 1G5ZA 1PD0A 4C3EA 4FAPB 3EGDA 4JCHA 1MMDA 1Q0FA 4GQHA 4K7BA 3R7CA 3T9OA 2H8AA 4G7HF 1LE2A 4JEBA 5L3VA 2XL6A 4YL0A 5KYYB 3JRMO 4XWJA 2PNOA 2P1AA 3FVYA 4MVOA 2YEVA 1VLTA 2EINC 1I5NA 2PX0A 3FAPB 4AK9A 1H9GA 2YL0A 3G4ZA 3T6BA 4C3DA 1R4TA 3PCVA 3EGDB 3C8GB 3B0VC 1EQ1A 1RCPA 1Z63A 4E0HA 3MLGA 1BDJB 2Q9AA 1JPJA 4M63A 1NU9C 4HE8D 1YZCA 1ZW2A 2G3VA 4H54A 1TFOB 3KL4A 4IAOA 2L6FA 3ITFA 4XPXA 1B68A 2P6VA 2IXOA 3HNLA 1LI5A 3ZG1A 1ST6A 3AGUA 3U9MA 4BJ5C 1HW2A 1D1BA 4U5HA 3US6A 1O5HA 3ZQVA 2PX3A 2Q9BA 1QQ3A 2R02A 2VC9A 3IQCA 4AE4A 3TQOA 4IB4A 3MX3A 2JX0A 2WVNA 1Q0KA 2CDQA 1M57C 4XLPF 4BJ5A 4U9DA 4W8KA 1FFHA 5JRAA 1LVKA 2YL7A 4AL0A 2Q9CA 2J46A 2LQGA 2XSEA 4YT8A 3U2MA 3MYIA 3LJBA 3C7JA 4PJLA 3EG9A 1Q0GA 4MTGA 1SMYF 4H4KC 1YA9A 3LAYA 3K1HA 4XEKA 2ZXPA 1CGME 1NFNA 2IYLD 4XEFA 3ABKC 2RD9A 3RH3A 3KPHA 5COMA 4OD5A 5L0DA 5F5HA 4PR9A 1JOGA 3NMIA 4QI0A 5BUOA 2R25A 1OW6A 5A6AA 4QI2A 4C3BA 5B1BC 2PP4A 2EPKX 2Y3GA 3HNIA 3NMJA 4FWVA 3VF0A 1E2XA 2NUTA 3EH1A 3HTKC 2XM0A 4DVYP 4I1MA 1DOVA 4O7GA 2NPUA 4RDAA 4GEHA 4EBKA 4D4XA 4ZLDA 2HSBA 4G0HA 1TKNA 3AGTA 4XTKA 4IRUA 3HLZA 1VLSA 3C63A 3FOOA 3QW0A 2VASA 4KNWA 3S84A 2FFHA 4CJOA 1JRAA 2ZD9A 1I4ZA 2QUPA 3IQ5A 1NLXA 3ZTMA 2LK4A 1U6HA 2BE5F 2KSFA 4JE9A 3DWWA 4JIOA 2I8BA 5KYWA 1ZU5A 2QY9A 5A6KA 2WZLA 4DXWA 2Y3BA 2P0NA 4E18A 2W4BA 4JJGA 5A6JA 2A6HF 1T01A 2A1DD 1TWGA 1OW7A 1E83A 1OCZC 2LIGA 2R9RB 3F46A 2TMVP 3JYHA 3EHNA 2RSEB 4MTFA 2NSFA 3Q7GA 3K6BA 1D0ZA 2PBEA 2M64A 5KYWB 4GYTA 3OWTA 3LS1A 3KMIA 4AL1A 3WAQA 3GEEA 2L81A 5JT4A 1VYIA 1H7IA 3NYMA 1M2OA 3VYWA 4EUKB 4F4BA 2BC5A 1OCOC 4E7ZA 4NC3A 5CI8A 4BG0A 1HW1A 2L9JA 1GM5A 1Z5ZA 1OKKD 4LLEA 4PFOA 5D91A 2Y3HA 3SXMA 2V3CC 1VMAA 2R7XA 5K0IA 4MS2A 3S90A 1MMGA 3EZHA 1A41A 3DZAA 4PJNA 3UR3C 1EKYA 2A0UA 1LS4A 4R32A 3O10A 2HMZA 3LS0A 1V55C 5CI9A 1LKXA 4CBEA 1U89A 4Q4ZF 4BJ1A 2XS8A 4C7OA 4BEMJ 5BQIA 1QSPA 3M4CA 1RXQA 2I15A 2HV7A 4OIPF 2YVKA 1D1CA 4MVUA 3TULA 1WOLA 2HJ3A 3RKOF 3T4RA 5BQHA 2A68F 5FZTA 3W8HA 1ZHXA 3L8JA 3I5QA 2EPMX 2YKZA 4ZLCA 3DJUB 2Y39A 2DGJA 1BR4A 1QZXA 5KYYA 2CCYA 4DRIB 4U5GA 5A6BA 3L34A 4OIOF 1ZYRF 4NY3A 2R05A 3NKDA 1ZHTA 3WG7C 1RJ9B 1MQVA 2XLWA 3TD7A 4HFKB 3C8GA 2KJGA 3S28A 3M79A 3U8VA 3AG4C 4CDYA 3W2WA 1K05A 3O6XA 4P6IC 1BZ4A 3GEHA 2XLMA 2YLIA 4OD4A 2AWYA 2GA0A 1YDIA 4PACA 4XEVA 3C18A 2HUJA 4YN0B 2Q00A 3SXKA 1DOWA 3V5ZA 2HJMA 5DQZA 3UMIA 3U3BA 1ZVZA 5F5FA 5COFA 5L0HA 1TFKB 1UFBA 2J9VA 4CSAC 2E87A 1V54C 2VCAA 2J0XA 2LFDA 3BEHA 3G4XA 1YYJA 2R7QA 3KKBA 4E17A 3DXJF 1N1CA 1T6QA 2D4UA 3A9CA 3N0TA 4N6CA 5COGA 3GM1A 3KYJA 4N6HA 4CSAA 2AU5A 1YARO 2J45A 2V26A 4Z9IA 2A69F 2Y69C 3RQFA 2HMQA 4G78A 1OW8A 4IARA 2J7PD 1ORYA 3EQLF 4U5DE 2ZPAA 2H7OA 3AJMA 2Q4FA 2XLDA 4XPWA 4EHPA 1ZZPA 2W4MA 5L0IA 3ZIBA 5EK0A 1C03A 2HFIA 2IM8A 5JLIA 1XZQA 1Z6AA 2GDCA 3SZRA 1TR2A 2X51A 2UUHA 4W8PA 3HNJA 4PJJA 4K0DA 2VCBA 4U5BE 4E0IA 1L3PA 4EIYA 3NDBB 2P61A 1WWPA 2OQMA 4NQFA 2XLOA 4I3MA 3T6JA 3N2ZB 2CNWD 3EFOA 1S7ZA 2W9YA 3AOUA 2IXNA 4EWCA 4CIHA 2BL2A 2VH3A 3K33A 3GWNA 2X0CA 2B0HA 3N24A 5DS5A 1QLEC 3FXHA 1MMNA 4A4AA 3IHUA 2R03A 4U5EE 2UUIA 4LDQA 2PFDA 1LS1A 1BR2A 2J8WA 2DYRC 1NBBA 1V4AA 5JSLA 5B3SC 3B0PA 3EFOB 1VOMA 1K04A 1ZHYA 2YZSA 4BEJA 3ASNC 2GAQA 1TWAA 5A69A 2ZXWC 4IAQA 1Y6DA 3UMKA 3GM3A 5BQGA 3TOMA 2IXPA 4O6YA 3ZVRA 2NUPA 1JR8A 1O87A 3L0IA 3R2PA 2XLEA 3V5YA 4DJ9A 1NU7D 2A6EF 3U5SA 4EBJA 2YL3A 1VK5A 1WTYA 3DKAA 3UGPA 2YRFA 5T1DB 1FAPB 5HV9A 4IJJA 1G4US 2QNLA 4LERA 3S27A 5DQTA 1FTSA 1W2WA 1RKCA 1NSGB 5D92A 1Z3IX 5EHHA 3EH2A 2F22A 3MYFA 5KYXB 1OR2A 3H65A 4B6IA 2WZFA 2B0JA 3FDQA 1R5ID 1SF8A 2NUPB 2WL8A 3GM2A 3LNRA 5KYNA 1E84A 3ZDLA 4XLNF 2H7VC 2KNHA 4YK5A 3RW0A 4A2NB 1HE9A 1CGOA 3KYIA 1L7CA 2LD6A 4DRJB 4G7OF 1FFTC 3UGOA 3QMKA 1ORSC 5E3CA 3ZSUA 3QTHA 4IWBA 1YLMA 2CNWA 3I5PA 2JPUA 3NYLA 3V5XA 5TJ5E 4BPMA 4Q5SF 3CAXA 2KYHA 3L8IA 4QDLA 2LP4A 3OEOA 1CPRA 3H2VA 4U5CE 2A0BA 4KC9A 1H6GA 2IBFA 1G8XA 3EGXA 3JYYA 4DBRA 3B9QA 2FAPB 5AC5A 2G3KA 2W45A 4XPYA 2XXAA 4NTFA 4J30B 1K40A 1A0BA 2HZ8A 1J8MF 2D5RB 4G7ZF 3AQBA 5DS6A 4LACB 2J9BA 3LLKA 4HEAJ 4N4WA 3NG1A 2MHRA 3WODF 3EGXB 2AP3A 2XLHA 4MVMA 3MFNA 1KNYA 3M4BA 1RKEB 4JTCB 4RD9A 3U2LA 4ANJA 4EBBA 2NG1A 1NG1A 1RJ9A 3M1CB 3W8IA 3JZ0A 5L0CA 2XXAB 1FMVA 1XZPA 3CSKA 1EA8A 1MNDA 3SYNA 1MMAA 4FESA 3LEOA 3AG1C 1TWHA 2EILC 3ZTZA 3CQZA 5CIVA 3K1IC 4Q7CA 4ONSA 1E85A 3DM9B 4U9EA 4J7YA 1A7VA 4O79A 3RQEA 1NZEA 3EZIA 3W2VA 4YL1A 4JEAA 3C8ZA 2KK1A 3C62A 4N06A 4DBQA 3I4UA 3UNGC 2J0WA 1OXBA 4CS9C 3OA1A 3K1IA 3U9JA 2HV6A 3MBGA 1YYXA 3ATPA 5KYUB 1TWCA 2OG2A 1PCXA 3JSEO 3M15A 4LDKA 3V7OA 2JD3A 1Q0MA 1QKRA 3Q6NA 2CGEA 3CZ6A 2QTVA 4CDAA 4ULWA 2J9WA 1VYKA 3QW1A 4HFFB 3TJ5A 1OKKA 2Q7RA 3NMKA 4CS9A 2NSGA 3LUTB 4X0RA 1SZIA 3RYLA 3S0XA 2OEXA 3FMSA 2VB6A 3L1MA 5F28E 5DS4A 2VCCA 1KTMA 3VM6A 5DVWA 4MVZA 4CS7A 4EKWA 1MNEA 1ORJA 2MYSA 3NRHA 3U8PA 1E86A 4WGZA 1AVOB 2R7TA 3JRTA 3WHNA 2Y3DA 2KQ9A 2ZXRA 1H9TA 3SEOA 2OEVA 2WB7A 3A11A 3ECSA 3QVYA 4JURI 3ZC4A 4CS8C 2XLVA 1XWJA 3PDMP 1F1MA 1BBHA 4MW8A 3TJ6A 1C17M 3GEIA 2R7UA 1Z7Qc 3U0CA 4YL3A 3RIPA 2Z15A 1D0YA 2EIJC 1A7EA 2P7VA 1Q0DA 3PHF2 2KGOA 2YL1A 2LSEA 3IEEA 4JW1A 4WGYA 5E33A 2WZGA 3ZWIA 4JZAA 3LESA 3O39A 4CS8A 3E9VA 4O6NA 4PFPA 5E2QA 3SXYA 3DJNB 2OU6A 2QLAA 4PJMA 2YWAA 3DMDA 3IPMO 4U5FE 1LI7A 3TK0A 5L0FA 2XL4A 1YZAA 1PD1A 2YHSA 2QE9A 1SR2A 5L3QA 2PF4E 1JAFA 3FHDA 2KC3A 4KI2A 1PV3A 2AVKA 2O9XA 3RQGA 2C04A 2EPLX 1O3UA 1CPQA 4LLCA 2EIKC 1ZU4A 2ASRA 2IOQA 3BRJA 2XRHA 4YT4A 3AG3C 3NYJA 4OIRF 4JVSA 4CJGA 4IGGA 4YT5A 3JCUQ 4KNVA 5DLJA 3G50A 3B71A 2WVOA 3EJNA 3FAJA 5EGYA 3GODA 2AWCA 1CGNA 3POVA 5HSWA 4AE4B 4Z9HA 3AQCA 3GORA 2HSQA 4P9TA 3X1OA 4BJ6C 3JSZA 1NFOA 1FNTc 1BR1A 2OCCC 2XL8A 2HKVA 3ABMC 5JVEA 2XM4A 3T6GB 4CDVA 1OR3A 5KYXA 5T3TA 4JTDB 1LE4A 4CIPA 1S05A 4J7TA 1M56C
chains in the Genus database with same CATH topology
4JC7A 5HV9A 4JCZA 5K0IA 4J7YA 3HKKA 4JRZA 4NTAA 4YL1A 2H8AA 4NTFA 2UUIA 4YL0A 3B29A 4YK5A 2PNOA 4AL1A 5BQIA 4YL3A 4AL0A 3PCVA 2UUHA 4NTBA 4BPMA 2Q7RA 5BQGA 5BQHA 3LEOA 3DWWA 4J7TA 4WABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JC7 A;  5HV9 A;  4JCZ A;  5K0I A;  4J7Y A;  3HKK A;  4JRZ A;  4NTA A;  4YL1 A;  2H8A A;  4NTF A;  2UUI A;  4YL0 A;  3B29 A;  4YK5 A;  2PNO A;  4AL1 A;  5BQI A;  4YL3 A;  4AL0 A;  3PCV A;  2UUH A;  4NTB A;  4BPM A;  2Q7R A;  5BQG A;  5BQH A;  3LEO A;  3DWW A;  4J7T A;  4WAB A; 
#chains in the Genus database with same CATH topology
 3H2U A;  3RF3 A;  3Q7L A;  4BJ6 A;  4L6R A;  4WJ0 A;  1I4Y A;  1LM3 B;  1VB5 A;  4JJF A;  2J7P A;  4JKV A;  5AC4 A;  2Q3T A;  4I44 A;  5GPG B;  2R7S A;  3JT1 A;  1HY5 A;  4MQ9 F;  3SNH A;  5B3I A;  3EG9 B;  2MWQ A;  2OJQ A;  1GS9 A;  4FX5 A;  2L6H A;  2YLD A;  3B29 A;  3S9O A;  3AG2 C;  2EIM C;  3DAG A;  2CYD A;  3QVZ A;  3RVY A;  3IQ6 A;  4XQ1 A;  1T6I A;  1FR0 A;  3FOP A;  1T6U A;  1AEP A;  1OXK A;  1WGW A;  4LDR A;  2DB4 A;  3U3F A;  1HE1 A;  1T9K A;  4JTA B;  2LFF A;  1Z23 A;  2L6G A;  2M4E A;  1AUE A;  2YLG A;  3EHM A;  3QZC A;  3TOL A;  3W4Y A;  2NUT B;  1OCC C;  1APC A;  1HMD A;  4P9F A;  5JS5 A;  1WN0 A;  4MW3 A;  2HS5 A;  2GWW A;  3K7D A;  4RBN A;  2WVQ A;  5B1A C;  3F47 A;  2ETS A;  3GAN A;  1QVX A;  2L7A A;  3DAF A;  2OJE D;  4MVS A;  5AGF A;  4Z9J A;  1VTM P;  1YJG A;  4JCZ A;  2R7V A;  4CX9 A;  4YWQ A;  1M2V A;  3KH2 A;  4OIN F;  1RKE A;  3LEV A;  2OKU A;  3NKE A;  5T3W A;  5A6B D;  1GGQ A;  1LIH A;  1JMW A;  1OQC A;  4DOZ A;  3CEX A;  4YT2 A;  3S29 A;  4MVR A;  4DVZ A;  1ZHZ A;  1EI7 A;  3LNM B;  1HMO A;  2DYS C;  3DE9 A;  3Q6M A;  3RVZ A;  5L0J A;  4OIQ F;  3SP1 A;  3C8G D;  2G62 A;  5E3A A;  1M2V B;  2R7R A;  2EPN A;  2ZXO A;  5JP7 A;  1IZM A;  1Y4C A;  3DD7 A;  1RMV A;  1OCR C;  5JUA A;  3X2Q C;  1YAU O;  4J32 B;  1V74 B;  1SYQ A;  4AX2 A;  5L0G A;  3PMR A;  4UDV A;  4DRH B;  1YVI A;  4MND A;  1JPN A;  2C03 A;  4JC7 A;  3ABL C;  4O6M A;  3VRC A;  4BJT A;  256B A;  1QPU A;  3HKK A;  2J9U A;  3O55 A;  4JRZ A;  1WAT A;  5KYU A;  1TQG A;  3ZQY A;  4NTA A;  2GFH A;  3J06 A;  2FGY A;  1FMW A;  2XS1 A;  3E70 C;  4K1O A;  4MTO A;  2IXM A;  4D4N A;  3EPV A;  1LPE A;  1M6T A;  1UG7 A;  4PK4 A;  1IW7 F;  2DI3 A;  2R7W A;  2CW0 F;  1C02 A;  2EPO A;  1ZHW A;  3VAY A;  4I1O B;  1WAS A;  4NCQ A;  3GWL A;  1D1A A;  1G4W R;  1T5O A;  3DI5 A;  3SXZ A;  2LCH A;  3HNK A;  4NTB A;  1ZW3 A;  3K66 A;  3DE8 A;  1J8Y F;  3RFY A;  1KU2 A;  3HJC A;  3B0U X;  2R7O A;  1GQA A;  3JTL O;  1U0B B;  4KBL A;  4MVQ A;  4C7O B;  4ER9 A;  2KW3 C;  4E7S A;  1YA7 O;  2OOC A;  1D0X A;  3ASO C;  5FCL A;  2YQY A;  1A7D A;  3IQT A;  4WAB A;  3DM5 A;  4ULV A;  5IY5 C;  2H7B A;  3LLI A;  4YJW A;  2ICW G;  3UMH A;  1G5Z A;  1PD0 A;  4C3E A;  4FAP B;  3EGD A;  4JCH A;  1MMD A;  1Q0F A;  4GQH A;  4K7B A;  3R7C A;  3T9O A;  2H8A A;  4G7H F;  1LE2 A;  4JEB A;  5L3V A;  2XL6 A;  4YL0 A;  5KYY B;  3JRM O;  4XWJ A;  2PNO A;  2P1A A;  3FVY A;  4MVO A;  2YEV A;  1VLT A;  2EIN C;  1I5N A;  2PX0 A;  3FAP B;  4AK9 A;  1H9G A;  2YL0 A;  3G4Z A;  3T6B A;  4C3D A;  1R4T A;  3PCV A;  3EGD B;  3C8G B;  3B0V C;  1EQ1 A;  1RCP A;  1Z63 A;  4E0H A;  3MLG A;  1BDJ B;  2Q9A A;  1JPJ A;  4M63 A;  1NU9 C;  4HE8 D;  1YZC A;  1ZW2 A;  2G3V A;  4H54 A;  1TFO B;  3KL4 A;  4IAO A;  2L6F A;  3ITF A;  4XPX A;  1B68 A;  2P6V A;  2IXO A;  3HNL A;  1LI5 A;  3ZG1 A;  1ST6 A;  3AGU A;  3U9M A;  4BJ5 C;  1HW2 A;  1D1B A;  4U5H A;  3US6 A;  1O5H A;  3ZQV A;  2PX3 A;  2Q9B A;  1QQ3 A;  2R02 A;  2VC9 A;  3IQC A;  4AE4 A;  3TQO A;  4IB4 A;  3MX3 A;  2JX0 A;  2WVN A;  1Q0K A;  2CDQ A;  1M57 C;  4XLP F;  4BJ5 A;  4U9D A;  4W8K A;  1FFH A;  5JRA A;  1LVK A;  2YL7 A;  4AL0 A;  2Q9C A;  2J46 A;  2LQG A;  2XSE A;  4YT8 A;  3U2M A;  3MYI A;  3LJB A;  3C7J A;  4PJL A;  3EG9 A;  1Q0G A;  4MTG A;  1SMY F;  4H4K C;  1YA9 A;  3LAY A;  3K1H A;  4XEK A;  2ZXP A;  1CGM E;  1NFN A;  2IYL D;  4XEF A;  3ABK C;  2RD9 A;  3RH3 A;  3KPH A;  5COM A;  4OD5 A;  5L0D A;  5F5H A;  4PR9 A;  1JOG A;  3NMI A;  4QI0 A;  5BUO A;  2R25 A;  1OW6 A;  5A6A A;  4QI2 A;  4C3B A;  5B1B C;  2PP4 A;  2EPK X;  2Y3G A;  3HNI A;  3NMJ A;  4FWV A;  3VF0 A;  1E2X A;  2NUT A;  3EH1 A;  3HTK C;  2XM0 A;  4DVY P;  4I1M A;  1DOV A;  4O7G A;  2NPU A;  4RDA A;  4GEH A;  4EBK A;  4D4X A;  4ZLD A;  2HSB A;  4G0H A;  1TKN A;  3AGT A;  4XTK A;  4IRU A;  3HLZ A;  1VLS A;  3C63 A;  3FOO A;  3QW0 A;  2VAS A;  4KNW A;  3S84 A;  2FFH A;  4CJO A;  1JRA A;  2ZD9 A;  1I4Z A;  2QUP A;  3IQ5 A;  1NLX A;  3ZTM A;  2LK4 A;  1U6H A;  2BE5 F;  2KSF A;  4JE9 A;  3DWW A;  4JIO A;  2I8B A;  5KYW A;  1ZU5 A;  2QY9 A;  5A6K A;  2WZL A;  4DXW A;  2Y3B A;  2P0N A;  4E18 A;  2W4B A;  4JJG A;  5A6J A;  2A6H F;  1T01 A;  2A1D D;  1TWG A;  1OW7 A;  1E83 A;  1OCZ C;  2LIG A;  2R9R B;  3F46 A;  2TMV P;  3JYH A;  3EHN A;  2RSE B;  4MTF A;  2NSF A;  3Q7G A;  3K6B A;  1D0Z A;  2PBE A;  2M64 A;  5KYW B;  4GYT A;  3OWT A;  3LS1 A;  3KMI A;  4AL1 A;  3WAQ A;  3GEE A;  2L81 A;  5JT4 A;  1VYI A;  1H7I A;  3NYM A;  1M2O A;  3VYW A;  4EUK B;  4F4B A;  2BC5 A;  1OCO C;  4E7Z A;  4NC3 A;  5CI8 A;  4BG0 A;  1HW1 A;  2L9J A;  1GM5 A;  1Z5Z A;  1OKK D;  4LLE A;  4PFO A;  5D91 A;  2Y3H A;  3SXM A;  2V3C C;  1VMA A;  2R7X A;  5K0I A;  4MS2 A;  3S90 A;  1MMG A;  3EZH A;  1A41 A;  3DZA A;  4PJN A;  3UR3 C;  1EKY A;  2A0U A;  1LS4 A;  4R32 A;  3O10 A;  2HMZ A;  3LS0 A;  1V55 C;  5CI9 A;  1LKX A;  4CBE A;  1U89 A;  4Q4Z F;  4BJ1 A;  2XS8 A;  4C7O A;  4BEM J;  5BQI A;  1QSP A;  3M4C A;  1RXQ A;  2I15 A;  2HV7 A;  4OIP F;  2YVK A;  1D1C A;  4MVU A;  3TUL A;  1WOL A;  2HJ3 A;  3RKO F;  3T4R A;  5BQH A;  2A68 F;  5FZT A;  3W8H A;  1ZHX A;  3L8J A;  3I5Q A;  2EPM X;  2YKZ A;  4ZLC A;  3DJU B;  2Y39 A;  2DGJ A;  1BR4 A;  1QZX A;  5KYY A;  2CCY A;  4DRI B;  4U5G A;  5A6B A;  3L34 A;  4OIO F;  1ZYR F;  4NY3 A;  2R05 A;  3NKD A;  1ZHT A;  3WG7 C;  1RJ9 B;  1MQV A;  2XLW A;  3TD7 A;  4HFK B;  3C8G A;  2KJG A;  3S28 A;  3M79 A;  3U8V A;  3AG4 C;  4CDY A;  3W2W A;  1K05 A;  3O6X A;  4P6I C;  1BZ4 A;  3GEH A;  2XLM A;  2YLI A;  4OD4 A;  2AWY A;  2GA0 A;  1YDI A;  4PAC A;  4XEV A;  3C18 A;  2HUJ A;  4YN0 B;  2Q00 A;  3SXK A;  1DOW A;  3V5Z A;  2HJM A;  5DQZ A;  3UMI A;  3U3B A;  1ZVZ A;  5F5F A;  5COF A;  5L0H A;  1TFK B;  1UFB A;  2J9V A;  4CSA C;  2E87 A;  1V54 C;  2VCA A;  2J0X A;  2LFD A;  3BEH A;  3G4X A;  1YYJ A;  2R7Q A;  3KKB A;  4E17 A;  3DXJ F;  1N1C A;  1T6Q A;  2D4U A;  3A9C A;  3N0T A;  4N6C A;  5COG A;  3GM1 A;  3KYJ A;  4N6H A;  4CSA A;  2AU5 A;  1YAR O;  2J45 A;  2V26 A;  4Z9I A;  2A69 F;  2Y69 C;  3RQF A;  2HMQ A;  4G78 A;  1OW8 A;  4IAR A;  2J7P D;  1ORY A;  3EQL F;  4U5D E;  2ZPA A;  2H7O A;  3AJM A;  2Q4F A;  2XLD A;  4XPW A;  4EHP A;  1ZZP A;  2W4M A;  5L0I A;  3ZIB A;  5EK0 A;  1C03 A;  2HFI A;  2IM8 A;  5JLI A;  1XZQ A;  1Z6A A;  2GDC A;  3SZR A;  1TR2 A;  2X51 A;  2UUH A;  4W8P A;  3HNJ A;  4PJJ A;  4K0D A;  2VCB A;  4U5B E;  4E0I A;  1L3P A;  4EIY A;  3NDB B;  2P61 A;  1WWP A;  2OQM A;  4NQF A;  2XLO A;  4I3M A;  3T6J A;  3N2Z B;  2CNW D;  3EFO A;  1S7Z A;  2W9Y A;  3AOU A;  2IXN A;  4EWC A;  4CIH A;  2BL2 A;  2VH3 A;  3K33 A;  3GWN A;  2X0C A;  2B0H A;  3N24 A;  5DS5 A;  1QLE C;  3FXH A;  1MMN A;  4A4A A;  3IHU A;  2R03 A;  4U5E E;  2UUI A;  4LDQ A;  2PFD A;  1LS1 A;  1BR2 A;  2J8W A;  2DYR C;  1NBB A;  1V4A A;  5JSL A;  5B3S C;  3B0P A;  3EFO B;  1VOM A;  1K04 A;  1ZHY A;  2YZS A;  4BEJ A;  3ASN C;  2GAQ A;  1TWA A;  5A69 A;  2ZXW C;  4IAQ A;  1Y6D A;  3UMK A;  3GM3 A;  5BQG A;  3TOM A;  2IXP A;  4O6Y A;  3ZVR A;  2NUP A;  1JR8 A;  1O87 A;  3L0I A;  3R2P A;  2XLE A;  3V5Y A;  4DJ9 A;  1NU7 D;  2A6E F;  3U5S A;  4EBJ A;  2YL3 A;  1VK5 A;  1WTY A;  3DKA A;  3UGP A;  2YRF A;  5T1D B;  1FAP B;  5HV9 A;  4IJJ A;  1G4U S;  2QNL A;  4LER A;  3S27 A;  5DQT A;  1FTS A;  1W2W A;  1RKC A;  1NSG B;  5D92 A;  1Z3I X;  5EHH A;  3EH2 A;  2F22 A;  3MYF A;  5KYX B;  1OR2 A;  3H65 A;  4B6I A;  2WZF A;  2B0J A;  3FDQ A;  1R5I D;  1SF8 A;  2NUP B;  2WL8 A;  3GM2 A;  3LNR A;  5KYN A;  1E84 A;  3ZDL A;  4XLN F;  2H7V C;  2KNH A;  4YK5 A;  3RW0 A;  4A2N B;  1HE9 A;  1CGO A;  3KYI A;  1L7C A;  2LD6 A;  4DRJ B;  4G7O F;  1FFT C;  3UGO A;  3QMK A;  1ORS C;  5E3C A;  3ZSU A;  3QTH A;  4IWB A;  1YLM A;  2CNW A;  3I5P A;  2JPU A;  3NYL A;  3V5X A;  5TJ5 E;  4BPM A;  4Q5S F;  3CAX A;  2KYH A;  3L8I A;  4QDL A;  2LP4 A;  3OEO A;  1CPR A;  3H2V A;  4U5C E;  2A0B A;  4KC9 A;  1H6G A;  2IBF A;  1G8X A;  3EGX A;  3JYY A;  4DBR A;  3B9Q A;  2FAP B;  5AC5 A;  2G3K A;  2W45 A;  4XPY A;  2XXA A;  4NTF A;  4J30 B;  1K40 A;  1A0B A;  2HZ8 A;  1J8M F;  2D5R B;  4G7Z F;  3AQB A;  5DS6 A;  4LAC B;  2J9B A;  3LLK A;  4HEA J;  4N4W A;  3NG1 A;  2MHR A;  3WOD F;  3EGX B;  2AP3 A;  2XLH A;  4MVM A;  3MFN A;  1KNY A;  3M4B A;  1RKE B;  4JTC B;  4RD9 A;  3U2L A;  4ANJ A;  4EBB A;  2NG1 A;  1NG1 A;  1RJ9 A;  3M1C B;  3W8I A;  3JZ0 A;  5L0C A;  2XXA B;  1FMV A;  1XZP A;  3CSK A;  1EA8 A;  1MND A;  3SYN A;  1MMA A;  4FES A;  3LEO A;  3AG1 C;  1TWH A;  2EIL C;  3ZTZ A;  3CQZ A;  5CIV A;  3K1I C;  4Q7C A;  4ONS A;  1E85 A;  3DM9 B;  4U9E A;  4J7Y A;  1A7V A;  4O79 A;  3RQE A;  1NZE A;  3EZI A;  3W2V A;  4YL1 A;  4JEA A;  3C8Z A;  2KK1 A;  3C62 A;  4N06 A;  4DBQ A;  3I4U A;  3UNG C;  2J0W A;  1OXB A;  4CS9 C;  3OA1 A;  3K1I A;  3U9J A;  2HV6 A;  3MBG A;  1YYX A;  3ATP A;  5KYU B;  1TWC A;  2OG2 A;  1PCX A;  3JSE O;  3M15 A;  4LDK A;  3V7O A;  2JD3 A;  1Q0M A;  1QKR A;  3Q6N A;  2CGE A;  3CZ6 A;  2QTV A;  4CDA A;  4ULW A;  2J9W A;  1VYK A;  3QW1 A;  4HFF B;  3TJ5 A;  1OKK A;  2Q7R A;  3NMK A;  4CS9 A;  2NSG A;  3LUT B;  4X0R A;  1SZI A;  3RYL A;  3S0X A;  2OEX A;  3FMS A;  2VB6 A;  3L1M A;  5F28 E;  5DS4 A;  2VCC A;  1KTM A;  3VM6 A;  5DVW A;  4MVZ A;  4CS7 A;  4EKW A;  1MNE A;  1ORJ A;  2MYS A;  3NRH A;  3U8P A;  1E86 A;  4WGZ A;  1AVO B;  2R7T A;  3JRT A;  3WHN A;  2Y3D A;  2KQ9 A;  2ZXR A;  1H9T A;  3SEO A;  2OEV A;  2WB7 A;  3A11 A;  3ECS A;  3QVY A;  4JUR I;  3ZC4 A;  4CS8 C;  2XLV A;  1XWJ A;  3PDM P;  1F1M A;  1BBH A;  4MW8 A;  3TJ6 A;  1C17 M;  3GEI A;  2R7U A;  1Z7Q c;  3U0C A;  4YL3 A;  3RIP A;  2Z15 A;  1D0Y A;  2EIJ C;  1A7E A;  2P7V A;  1Q0D A;  3PHF 2;  2KGO A;  2YL1 A;  2LSE A;  3IEE A;  4JW1 A;  4WGY A;  5E33 A;  2WZG A;  3ZWI A;  4JZA A;  3LES A;  3O39 A;  4CS8 A;  3E9V A;  4O6N A;  4PFP A;  5E2Q A;  3SXY A;  3DJN B;  2OU6 A;  2QLA A;  4PJM A;  2YWA A;  3DMD A;  3IPM O;  4U5F E;  1LI7 A;  3TK0 A;  5L0F A;  2XL4 A;  1YZA A;  1PD1 A;  2YHS A;  2QE9 A;  1SR2 A;  5L3Q A;  2PF4 E;  1JAF A;  3FHD A;  2KC3 A;  4KI2 A;  1PV3 A;  2AVK A;  2O9X A;  3RQG A;  2C04 A;  2EPL X;  1O3U A;  1CPQ A;  4LLC A;  2EIK C;  1ZU4 A;  2ASR A;  2IOQ A;  3BRJ A;  2XRH A;  4YT4 A;  3AG3 C;  3NYJ A;  4OIR F;  4JVS A;  4CJG A;  4IGG A;  4YT5 A;  3JCU Q;  4KNV A;  5DLJ A;  3G50 A;  3B71 A;  2WVO A;  3EJN A;  3FAJ A;  5EGY A;  3GOD A;  2AWC A;  1CGN A;  3POV A;  5HSW A;  4AE4 B;  4Z9H A;  3AQC A;  3GOR A;  2HSQ A;  4P9T A;  3X1O A;  4BJ6 C;  3JSZ A;  1NFO A;  1FNT c;  1BR1 A;  2OCC C;  2XL8 A;  2HKV A;  3ABM C;  5JVE A;  2XM4 A;  3T6G B;  4CDV A;  1OR3 A;  5KYX A;  5T3T A;  4JTD B;  1LE4 A;  4CIP A;  1S05 A;  4J7T A;  1M56 C; 
#chains in the Genus database with same CATH homology
 4JC7 A;  5HV9 A;  4JCZ A;  5K0I A;  4J7Y A;  3HKK A;  4JRZ A;  4NTA A;  4YL1 A;  2H8A A;  4NTF A;  2UUI A;  4YL0 A;  3B29 A;  4YK5 A;  2PNO A;  4AL1 A;  5BQI A;  4YL3 A;  4AL0 A;  3PCV A;  2UUH A;  4NTB A;  4BPM A;  2Q7R A;  5BQG A;  5BQH A;  3LEO A;  3DWW A;  4J7T A;  4WAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...