4JC7A

Human ltc4 synthase in complex with product analogs - implications for enzyme catalysis
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
154
structure length
154
Chain Sequence
HHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALALLVALAALGLLAHFLPAALRAALLGRLRTLLPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
publication title Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 154
sequence length 154
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4jc7A00
5HV9A 3LEOA 2UUHA 4NTAA 5BQIA 3DWWA 2Q7RA 4JC7A 4AL0A 4AL1A 2UUIA 2PNOA 4J7TA 4YL1A 4JRZA 4J7YA 4YL0A 3HKKA 4YL3A 4BPMA 5BQHA 2H8AA 4YK5A 4NTBA 5K0IA 3PCVA 4NTFA 4WABA 5BQGA 3B29A 4JCZA
chains in the Genus database with same CATH superfamily
1HE1A 1L7CA 1MMAA 2Q9BA 4W8KA 3GANA 4PJJA 1NU9C 4FX5A 4XEVA 2XLOA 4AX2A 1U6HA 1ZHZA 1UFBA 2CGEA 2NUPB 3DJNB 3U3BA 2XLVA 4YN0B 3ABMC 3UGOA 1CGME 3C8GD 2J45A 1LPEA 1OCRC 3R2PA 4CSAA 2R25A 1GS9A 3U9MA 3CZ6A 2XXAB 2YVKA 4PACA 4U9DA 4JRZA 4IARA 1OR3A 4D4XA 3EGDA 3L8IA 4BEJA 4YL3A 3V7OA 4O7GA 3VAYA 2OCCC 1FFHA 2F22A 2GA0A 3ABKC 3FXHA 1H9TA 2ZXOA 1NFOA 1LI5A 2NUPA 2R9RB 2QUPA 1LM3B 2EPNA 4MVQA 1TWAA 4MVOA 1YA9A 2JPUA 1M56C 3JYYA 1Z7Qc 3ECSA 2WZLA 3X1OA 3B0UX 3IEEA 3V5XA 4XQ1A 2YWAA 4DXWA 3HTKC 2R7SA 1ZZPA 4GEHA 2IYLD 2NSFA 2VCAA 4LLCA 5BUOA 3GEHA 2CNWD 4JC7A 4YWQA 1FMVA 4PJNA 4MTGA 1OCOC 2XL6A 2J7PD 1TWCA 2EPMX 1E2XA 1ORSC 1QLEC 1Z23A 2UUIA 3ITFA 3GWLA 4XWJA 4AE4B 3LNMB 1YYJA 3NDBB 2G3VA 2YQYA 2LFDA 3QVZA 1TKNA 4DRJB 4OIOF 4YT2A 4EWCA 4MVMA 4HEAJ 2HKVA 4C7OB 2OKUA 2C04A 2A69F 3KH2A 1IZMA 2W4MA 3NG1A 4WJ0A 2J9WA 2R7VA 1FAPB 2P6VA 3T6BA 3EQLF 3FHDA 5BQGA 5L0IA 256BA 2R7TA 2KJGA 4OD4A 2LIGA 4NQFA 5CI8A 4C3DA 4EBKA 4HFKB 4AE4A 1SF8A 3W8HA 3M79A 3TQOA 4ULVA 2EPKX 2NUTB 3QVYA 3U8PA 2GDCA 4XEFA 4YT4A 4AL0A 5AC4A 2XRHA 2PNOA 4N06A 4NC3A 4RD9A 3MLGA 3AJMA 1MMGA 2P7VA 4PFOA 3T6JA 4BJ6A 3LJBA 5CIVA 2YL0A 2E87A 1E84A 1LVKA 2Q4FA 3A11A 3C18A 2B0JA 4PJLA 3UMHA 3M1CB 3GM1A 4JIOA 4LACB 5JLIA 1APCA 1YYXA 4U5BE 4CDVA 1TFOB 3B0PA 4JURI 2PP4A 4IJJA 2R05A 4IB4A 1D0XA 1RKCA 2NUTA 3SNHA 4BJTA 5KYUB 1W2WA 4I44A 5JSLA 1ZU5A 2XLWA 4EBJA 2Q9AA 3I5PA 3S29A 1PCXA 2PBEA 3LEOA 2V3CC 5L0HA 3S0XA 3EJNA 4CDYA 5L0DA 1YA7O 3K6BA 2I8BA 3L34A 2EPOA 3NYJA 5D91A 3AG2C 4JKVA 5F28E 3VYWA 4A4AA 4DVYP 4AK9A 2IXNA 2J0WA 4F4BA 2EIJC 5KYXA 3EZIA 1M2VB 3DAGA 2VCBA 2H7VC 2AWYA 2XLHA 4JW1A 4Q7CA 3W4YA 2HUJA 1A0BA 5KYUA 5A69A 4C3EA 3T4RA 4JJGA 2G3KA 2ETSA 3GWNA 3PDMP 3ZVRA 4Z9HA 2A6EF 3O55A 3T9OA 4DVZA 2CCYA 2EINC 1G4US 3GORA 4H54A 4G7ZF 1M6TA 2HV6A 4O6MA 3PHF2 1JPNA 2LK4A 4CS7A 1CPRA 4C7OA 2X0CA 1VK5A 5T3WA 4DJ9A 2A0UA 4CIHA 1BR4A 1UG7A 1M2VA 2PX0A 4K7BA 3UMIA 4R32A 1BR1A 1CGOA 2HMZA 2UUHA 2YL7A 1LS4A 1VMAA 1C17M 1V74B 4Q4ZF 4OINF 4MVSA 4E0HA 3K1IC 1G8XA 4BJ6C 4G0HA 4OIPF 1ZW2A 3O39A 3ZQVA 3WODF 3AG3C 3POVA 3M4CA 1QZXA 2CNWA 3FAJA 1I4ZA 2YHSA 1K05A 3AOUA 3K66A 2J7PA 3NKEA 4N6CA 3SXMA 5A6JA 2TMVP 4P9TA 2YKZA 4LLEA 1JOGA 5A6BA 5KYYB 1L3PA 2H8AA 1QPUA 4YK5A 4LDKA 3HLZA 3PCVA 3B0VC 2QNLA 2Q00A 1NU7D 2YLIA 3RVZA 2Q3TA 1TFKB 1WATA 4ZLDA 3X2QC 1M57C 1HMDA 1NFNA 1OKKD 1ZVZA 3GEIA 4E7SA 3C62A 1GM5A 1OW7A 2C03A 2P0NA 3MBGA 1XWJA 3IQ6A 4J32B 4LERA 3JRMO 2L6HA 2ZXWC 3DWWA 3RKOF 2JD3A 3ABLC 3KL4A 2HV7A 3JSZA 3OA1A 2A6HF 2DGJA 2L6GA 4ZLCA 1FR0A 3AG4C 2LD6A 2QLAA 4FESA 5DS5A 1IW7F 4XLNF 2OQMA 3SYNA 5B1AC 2ZD9A 1KU2A 3W2VA 3L8JA 1SZIA 1RKEB 4K0DA 1BR2A 4NTBA 3TD7A 2XL8A 3JCUQ 5T1DB 2RSEB 1FMWA 1CGNA 4I1OB 4IWBA 5CI9A 5T3TA 1PV3A 1Q0MA 2W45A 2MWQA 1MNEA 3MX3A 4IAOA 3G4XA 1CPQA 2WZFA 3CQZA 3MYFA 4CIPA 3RIPA 3U2LA 2Y3GA 5HV9A 3NRHA 2XXAA 3U8VA 2CDQA 2L7AA 2R7QA 2ZXPA 1K04A 1EA8A 4JCHA 4IGGA 4JVSA 2QY9A 3KMIA 1NLXA 5KYNA 1D1BA 4CS9A 2Y69C 3KYJA 4GQHA 2YEVA 3IHUA 4HFFB 3KPHA 2BC5A 4YL1A 3BRJA 4I1MA 2OG2A 1T9KA 2J46A 2XS1A 3LLKA 3QMKA 2WVQA 2DI3A 4CDAA 1K40A 1WOLA 2Y3DA 3LS0A 3RW0A 3V5YA 5FZTA 2P61A 4IAQA 1D0YA 4G7HF 3DKAA 3B9QA 3TJ6A 1BBHA 5JS5A 1T6IA 2XM0A 1WTYA 2Y3HA 2MHRA 3H2UA 2KQ9A 2HJMA 2WVOA 4U5FE 1T01A 4BG0A 1D1CA 2XLDA 2OU6A 3EFOB 4L6RA 2NPUA 4MW8A 3U2MA 2D5RB 1Z6AA 2PX3A 2KK1A 1LS1A 3EH2A 2IOQA 3HJCA 2OOCA 4J30B 3UMKA 3UR3C 4LDRA 4MQ9F 1YAUO 3NMKA 1V4AA 1TWGA 2OEXA 4B6IA 1ZHTA 4IRUA 2VC9A 1DOVA 1ORJA 2IM8A 1Q0KA 2LCHA 4Z9JA 2NG1A 3K1IA 4XPYA 1I4YA 2HJ3A 1LKXA 4W8PA 4OIQF 3RQGA 1RXQA 1ST6A 5F5FA 3G4ZA 2GAQA 2WVNA 1OQCA 4O79A 3HNLA 4JE9A 4PJMA 5E3AA 2KW3C 1LI7A 2ZXRA 3EFOA 3JZ0A 1WWPA 3CAXA 4C3BA 5B3IA 3DI5A 3C8GB 2M4EA 1WGWA 1NZEA 1HE9A 3JTLO 4PFPA 2WL8A 3GODA 2XM4A 4KI2A 4LDQA 4QDLA 3HNJA 4P9FA 4G7OF 4O6NA 1BDJB 2VASA 2YLGA 4CS9C 3EH1A 2AVKA 2V26A 5EGYA 5A6KA 2FAPB 1JRAA 3HNKA 1Z63A 3FVYA 1SMYF 4XPWA 3FOPA 3H2VA 1VB5A 3DXJF 4U5HA 3UNGC 5JUAA 2A68F 4KC9A 3VRCA 3SP1A 5COFA 1H6GA 3C8GA 4DRHB 2HMQA 4OIRF 4E18A 4Q5SF 4D4NA 3KKBA 4NY3A 2WZGA 5DQTA 1Y4CA 1WASA 2L9JA 4BPMA 1I5NA 5COGA 2KGOA 2DYSC 3TK0A 2L81A 2HSBA 1YVIA 3GEEA 2EIKC 2J8WA 1KNYA 2EIMC 3B29A 3ZQYA 1F1MA 4EKWA 5L0CA 1YLMA 3S90A 3NYLA 4CS8C 4DBQA 4UDVA 3NMIA 3OWTA 1WN0A 3JT1A 2ZPAA 1TR2A 3O6XA 4JEAA 2PF4E 3DZAA 3RH3A 4E0IA 1LIHA 3A9CA 3NKDA 1GGQA 4MW3A 4ANJA 5JVEA 1MNDA 3L0IA 4RBNA 3MYIA 2FGYA 1G5ZA 3Q7LA 4J7YA 5B3SC 3HKKA 2R7OA 3M4BA 1A7VA 3E9VA 5EHHA 5K0IA 2G62A 4NTFA 1XZPA 4YT8A 4PR9A 4U5DE 3LS1A 3IQ5A 1R4TA 4H4KC 3DE9A 4YT5A 2LQGA 3C63A 5JP7A 4MVZA 4BJ1A 3U0CA 1MMDA 3W2WA 4WGZA 2R03A 4CJGA 3DJUB 3PMRA 5AC5A 3J06A 4EIYA 3IQCA 4N4WA 3F46A 1A41A 1TQGA 1XZQA 2I15A 1OXBA 1OW6A 5COMA 5DS4A 2IXPA 3VF0A 3AQCA 2BE5F 3NMJA 2KC3A 2YLDA 1FNTc 1VYKA 1YDIA 3GM2A 3JRTA 1O3UA 3SZRA 4DBRA 5KYYA 1Z5ZA 1TWHA 5L3QA 1HY5A 1LE4A 3DM9B 3T6GB 1EQ1A 3KYIA 4MTFA 2XL4A 3RFYA 3VM6A 2R7UA 4ER9A 1N1CA 3FAPB 1OW8A 5F5HA 1JPJA 4E7ZA 3U3FA 2YL1A 1NSGB 3DMDA 3JSEO 1VOMA 2CYDA 4CX9A 2XSEA 4WABA 2BL2A 3ZC4A 2O9XA 1S05A 4JCZA 3U5SA 2R7RA 2WB7A 4MS2A 3AG1C 3BEHA 3H65A 4KBLA 3AQBA 4Z9IA 5EK0A 3SXYA 3W8IA 3WAQA 5DQZA 2R7XA 1H7IA 4XEKA 1PD0A 3FMSA 5DLJA 2P1AA 3LESA 5E33A 1A7EA 1YZAA 3Q7GA 3TOMA 1MMNA 2HFIA 4HE8D 1JMWA 2DB4A 3I5QA 4BJ5C 3QTHA 1QKRA 4XTKA 1RKEA 5TJ5E 1S7ZA 3RF3A 3R7CA 2DYRC 2IBFA 2XLEA 3EPVA 2KSFA 5FCLA 2RD9A 3Q6NA 3LLIA 5L3VA 4U5CE 3O10A 1FFTC 2OJQA 1Q0DA 5L0FA 3EHNA 5JT4A 5L0GA 2VB6A 1YJGA 4JZAA 4GYTA 2H7OA 2EPLX 2AU5A 3N24A 2XLMA 2L6FA 2AP3A 4YJWA 3SEOA 3L1MA 1J8MF 2MYSA 2GWWA 2J0XA 1OCZC 3K7DA 5BQIA 3AGTA 5DS6A 5HSWA 1A7DA 3ATPA 1T6UA 3F47A 4CS8A 2A1DD 1RMVA 1YARO 3NYMA 3SXKA 5A6BD 3G50A 3S9OA 1EI7A 2EILC 4M63A 4EBBA 1AVOB 2Q9CA 3US6A 4XLPF 3S84A 3ASNC 4MVUA 3FOOA 4YL0A 3ZDLA 3WG7C 3ZG1A 3U9JA 2YRFA 1ZHXA 3Q6MA 4EUKB 1NBBA 2A0BA 1RJ9B 1Y6DA 2YZSA 4BEMJ 2HS5A 2OJED 1U0BB 4JTCB 4U5GA 1JR8A 3IQTA 3ZTZA 5A6AA 4JTDB 3GM3A 1VLSA 1C03A 1ZHYA 2KNHA 2ICWG 3C7JA 1M2OA 5E2QA 4CSAC 4P6IC 4FAPB 1GQAA 1R5ID 3QW0A 4OD5A 1AEPA 4CJOA 1OKKA 3FDQA 2GFHA 3EGXB 3ZWIA 1RJ9A 3EG9B 4FWVA 3OEOA 4KNVA 3K33A 4NCQA 1ORYA 4E17A 1T5OA 3DE8A 1AUEA 1JAFA 1SYQA 1NG1A 1OR2A 2R02A 3EZHA 2LFFA 4N6HA 5KYWB 1O5HA 1T6QA 5KYXB 4DOZA 1B68A 4XPXA 2QE9A 3TULA 1VYIA 3I4UA 4KNWA 1SR2A 2W4BA 3LEVA 3WHNA 1Z3IX 2J9UA 2Y3BA 2QTVA 5D92A 3EHMA 1Q0GA 3DAFA 2CW0F 2NSGA 3EGXA 2IXOA 3EG9A 3S27A 1HMOA 1O87A 1OXKA 2AWCA 3JYHA 3QW1A 1U89A 1QSPA 3AGUA 3E70C 5GPGB 5E3CA 4EHPA 3RYLA 5KYWA 1ZHWA 3CEXA 2Q7RA 1EKYA 3DM5A 5AGFA 2J9BA 4JEBA 4WGYA 2LSEA 4A2NB 3RQEA 2PFDA 1HW1A 2VCCA 3ZSUA 5L0JA 1HW2A 4J7TA 4U5EE 1DOWA 4RDAA 3RVYA 2Y39A 3LAYA 4U9EA 2IXMA 2HSQA 4BJ5A 2D4UA 4I3MA 1Q0FA 1E83A 4QI2A 1LE2A 4QI0A 4ULWA 1VTMP 3S28A 3CSKA 3QZCA 2J9VA 3MFNA 1MQVA 1E86A 1KTMA 4PK4A 3N0TA 1E85A 5IY5C 4DRIB 2KYHA 1FTSA 2XS8A 1ZW3A 3LUTB 2R7WA 3M15A 3ZTMA 2B0HA 4X0RA 1VLTA 2ASRA 5JRAA 3IPMO 3TOLA 4NTAA 3ZIBA 3K1HA 4ONSA 3TJ5A 1ZU4A 2W9YA 3ASOC 4MTOA 4JJFA 1QQ3A 1PD1A 1ZYRF 4MNDA 4CBEA 4AL1A 3RQFA 3B71A 1H9GA 3HNIA 5B1BC 1RCPA 2YL3A 1D0ZA 1D1AA 4JTAB 2Z15A 2X51A 4MVRA 2JX0A 1C02A 3UGPA 2OEVA 4G78A 5BQHA 1YZCA 5DVWA 2H7BA 2M64A 1G4WR 3DD7A 1BZ4A 2VH3A 3N2ZB 1OCCC 1V54C 2HZ8A 4K1OA 4O6YA 3C8ZA 3V5ZA 1V55C 1QVXA 2LP4A 2FFHA 3EGDB 3SXZA 3LNRA 1J8YF
chains in the Genus database with same CATH topology
5HV9A 3LEOA 2UUHA 4NTAA 5BQIA 3DWWA 2Q7RA 4JC7A 4AL0A 4AL1A 2UUIA 2PNOA 4J7TA 4YL1A 4JRZA 4J7YA 4YL0A 3HKKA 4YL3A 4BPMA 5BQHA 2H8AA 4YK5A 4NTBA 5K0IA 3PCVA 4NTFA 4WABA 5BQGA 3B29A 4JCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HV9 A;  3LEO A;  2UUH A;  4NTA A;  5BQI A;  3DWW A;  2Q7R A;  4JC7 A;  4AL0 A;  4AL1 A;  2UUI A;  2PNO A;  4J7T A;  4YL1 A;  4JRZ A;  4J7Y A;  4YL0 A;  3HKK A;  4YL3 A;  4BPM A;  5BQH A;  2H8A A;  4YK5 A;  4NTB A;  5K0I A;  3PCV A;  4NTF A;  4WAB A;  5BQG A;  3B29 A;  4JCZ A; 
#chains in the Genus database with same CATH topology
 1HE1 A;  1L7C A;  1MMA A;  2Q9B A;  4W8K A;  3GAN A;  4PJJ A;  1NU9 C;  4FX5 A;  4XEV A;  2XLO A;  4AX2 A;  1U6H A;  1ZHZ A;  1UFB A;  2CGE A;  2NUP B;  3DJN B;  3U3B A;  2XLV A;  4YN0 B;  3ABM C;  3UGO A;  1CGM E;  3C8G D;  2J45 A;  1LPE A;  1OCR C;  3R2P A;  4CSA A;  2R25 A;  1GS9 A;  3U9M A;  3CZ6 A;  2XXA B;  2YVK A;  4PAC A;  4U9D A;  4JRZ A;  4IAR A;  1OR3 A;  4D4X A;  3EGD A;  3L8I A;  4BEJ A;  4YL3 A;  3V7O A;  4O7G A;  3VAY A;  2OCC C;  1FFH A;  2F22 A;  2GA0 A;  3ABK C;  3FXH A;  1H9T A;  2ZXO A;  1NFO A;  1LI5 A;  2NUP A;  2R9R B;  2QUP A;  1LM3 B;  2EPN A;  4MVQ A;  1TWA A;  4MVO A;  1YA9 A;  2JPU A;  1M56 C;  3JYY A;  1Z7Q c;  3ECS A;  2WZL A;  3X1O A;  3B0U X;  3IEE A;  3V5X A;  4XQ1 A;  2YWA A;  4DXW A;  3HTK C;  2R7S A;  1ZZP A;  4GEH A;  2IYL D;  2NSF A;  2VCA A;  4LLC A;  5BUO A;  3GEH A;  2CNW D;  4JC7 A;  4YWQ A;  1FMV A;  4PJN A;  4MTG A;  1OCO C;  2XL6 A;  2J7P D;  1TWC A;  2EPM X;  1E2X A;  1ORS C;  1QLE C;  1Z23 A;  2UUI A;  3ITF A;  3GWL A;  4XWJ A;  4AE4 B;  3LNM B;  1YYJ A;  3NDB B;  2G3V A;  2YQY A;  2LFD A;  3QVZ A;  1TKN A;  4DRJ B;  4OIO F;  4YT2 A;  4EWC A;  4MVM A;  4HEA J;  2HKV A;  4C7O B;  2OKU A;  2C04 A;  2A69 F;  3KH2 A;  1IZM A;  2W4M A;  3NG1 A;  4WJ0 A;  2J9W A;  2R7V A;  1FAP B;  2P6V A;  3T6B A;  3EQL F;  3FHD A;  5BQG A;  5L0I A;  256B A;  2R7T A;  2KJG A;  4OD4 A;  2LIG A;  4NQF A;  5CI8 A;  4C3D A;  4EBK A;  4HFK B;  4AE4 A;  1SF8 A;  3W8H A;  3M79 A;  3TQO A;  4ULV A;  2EPK X;  2NUT B;  3QVY A;  3U8P A;  2GDC A;  4XEF A;  4YT4 A;  4AL0 A;  5AC4 A;  2XRH A;  2PNO A;  4N06 A;  4NC3 A;  4RD9 A;  3MLG A;  3AJM A;  1MMG A;  2P7V A;  4PFO A;  3T6J A;  4BJ6 A;  3LJB A;  5CIV A;  2YL0 A;  2E87 A;  1E84 A;  1LVK A;  2Q4F A;  3A11 A;  3C18 A;  2B0J A;  4PJL A;  3UMH A;  3M1C B;  3GM1 A;  4JIO A;  4LAC B;  5JLI A;  1APC A;  1YYX A;  4U5B E;  4CDV A;  1TFO B;  3B0P A;  4JUR I;  2PP4 A;  4IJJ A;  2R05 A;  4IB4 A;  1D0X A;  1RKC A;  2NUT A;  3SNH A;  4BJT A;  5KYU B;  1W2W A;  4I44 A;  5JSL A;  1ZU5 A;  2XLW A;  4EBJ A;  2Q9A A;  3I5P A;  3S29 A;  1PCX A;  2PBE A;  3LEO A;  2V3C C;  5L0H A;  3S0X A;  3EJN A;  4CDY A;  5L0D A;  1YA7 O;  3K6B A;  2I8B A;  3L34 A;  2EPO A;  3NYJ A;  5D91 A;  3AG2 C;  4JKV A;  5F28 E;  3VYW A;  4A4A A;  4DVY P;  4AK9 A;  2IXN A;  2J0W A;  4F4B A;  2EIJ C;  5KYX A;  3EZI A;  1M2V B;  3DAG A;  2VCB A;  2H7V C;  2AWY A;  2XLH A;  4JW1 A;  4Q7C A;  3W4Y A;  2HUJ A;  1A0B A;  5KYU A;  5A69 A;  4C3E A;  3T4R A;  4JJG A;  2G3K A;  2ETS A;  3GWN A;  3PDM P;  3ZVR A;  4Z9H A;  2A6E F;  3O55 A;  3T9O A;  4DVZ A;  2CCY A;  2EIN C;  1G4U S;  3GOR A;  4H54 A;  4G7Z F;  1M6T A;  2HV6 A;  4O6M A;  3PHF 2;  1JPN A;  2LK4 A;  4CS7 A;  1CPR A;  4C7O A;  2X0C A;  1VK5 A;  5T3W A;  4DJ9 A;  2A0U A;  4CIH A;  1BR4 A;  1UG7 A;  1M2V A;  2PX0 A;  4K7B A;  3UMI A;  4R32 A;  1BR1 A;  1CGO A;  2HMZ A;  2UUH A;  2YL7 A;  1LS4 A;  1VMA A;  1C17 M;  1V74 B;  4Q4Z F;  4OIN F;  4MVS A;  4E0H A;  3K1I C;  1G8X A;  4BJ6 C;  4G0H A;  4OIP F;  1ZW2 A;  3O39 A;  3ZQV A;  3WOD F;  3AG3 C;  3POV A;  3M4C A;  1QZX A;  2CNW A;  3FAJ A;  1I4Z A;  2YHS A;  1K05 A;  3AOU A;  3K66 A;  2J7P A;  3NKE A;  4N6C A;  3SXM A;  5A6J A;  2TMV P;  4P9T A;  2YKZ A;  4LLE A;  1JOG A;  5A6B A;  5KYY B;  1L3P A;  2H8A A;  1QPU A;  4YK5 A;  4LDK A;  3HLZ A;  3PCV A;  3B0V C;  2QNL A;  2Q00 A;  1NU7 D;  2YLI A;  3RVZ A;  2Q3T A;  1TFK B;  1WAT A;  4ZLD A;  3X2Q C;  1M57 C;  1HMD A;  1NFN A;  1OKK D;  1ZVZ A;  3GEI A;  4E7S A;  3C62 A;  1GM5 A;  1OW7 A;  2C03 A;  2P0N A;  3MBG A;  1XWJ A;  3IQ6 A;  4J32 B;  4LER A;  3JRM O;  2L6H A;  2ZXW C;  3DWW A;  3RKO F;  2JD3 A;  3ABL C;  3KL4 A;  2HV7 A;  3JSZ A;  3OA1 A;  2A6H F;  2DGJ A;  2L6G A;  4ZLC A;  1FR0 A;  3AG4 C;  2LD6 A;  2QLA A;  4FES A;  5DS5 A;  1IW7 F;  4XLN F;  2OQM A;  3SYN A;  5B1A C;  2ZD9 A;  1KU2 A;  3W2V A;  3L8J A;  1SZI A;  1RKE B;  4K0D A;  1BR2 A;  4NTB A;  3TD7 A;  2XL8 A;  3JCU Q;  5T1D B;  2RSE B;  1FMW A;  1CGN A;  4I1O B;  4IWB A;  5CI9 A;  5T3T A;  1PV3 A;  1Q0M A;  2W45 A;  2MWQ A;  1MNE A;  3MX3 A;  4IAO A;  3G4X A;  1CPQ A;  2WZF A;  3CQZ A;  3MYF A;  4CIP A;  3RIP A;  3U2L A;  2Y3G A;  5HV9 A;  3NRH A;  2XXA A;  3U8V A;  2CDQ A;  2L7A A;  2R7Q A;  2ZXP A;  1K04 A;  1EA8 A;  4JCH A;  4IGG A;  4JVS A;  2QY9 A;  3KMI A;  1NLX A;  5KYN A;  1D1B A;  4CS9 A;  2Y69 C;  3KYJ A;  4GQH A;  2YEV A;  3IHU A;  4HFF B;  3KPH A;  2BC5 A;  4YL1 A;  3BRJ A;  4I1M A;  2OG2 A;  1T9K A;  2J46 A;  2XS1 A;  3LLK A;  3QMK A;  2WVQ A;  2DI3 A;  4CDA A;  1K40 A;  1WOL A;  2Y3D A;  3LS0 A;  3RW0 A;  3V5Y A;  5FZT A;  2P61 A;  4IAQ A;  1D0Y A;  4G7H F;  3DKA A;  3B9Q A;  3TJ6 A;  1BBH A;  5JS5 A;  1T6I A;  2XM0 A;  1WTY A;  2Y3H A;  2MHR A;  3H2U A;  2KQ9 A;  2HJM A;  2WVO A;  4U5F E;  1T01 A;  4BG0 A;  1D1C A;  2XLD A;  2OU6 A;  3EFO B;  4L6R A;  2NPU A;  4MW8 A;  3U2M A;  2D5R B;  1Z6A A;  2PX3 A;  2KK1 A;  1LS1 A;  3EH2 A;  2IOQ A;  3HJC A;  2OOC A;  4J30 B;  3UMK A;  3UR3 C;  4LDR A;  4MQ9 F;  1YAU O;  3NMK A;  1V4A A;  1TWG A;  2OEX A;  4B6I A;  1ZHT A;  4IRU A;  2VC9 A;  1DOV A;  1ORJ A;  2IM8 A;  1Q0K A;  2LCH A;  4Z9J A;  2NG1 A;  3K1I A;  4XPY A;  1I4Y A;  2HJ3 A;  1LKX A;  4W8P A;  4OIQ F;  3RQG A;  1RXQ A;  1ST6 A;  5F5F A;  3G4Z A;  2GAQ A;  2WVN A;  1OQC A;  4O79 A;  3HNL A;  4JE9 A;  4PJM A;  5E3A A;  2KW3 C;  1LI7 A;  2ZXR A;  3EFO A;  3JZ0 A;  1WWP A;  3CAX A;  4C3B A;  5B3I A;  3DI5 A;  3C8G B;  2M4E A;  1WGW A;  1NZE A;  1HE9 A;  3JTL O;  4PFP A;  2WL8 A;  3GOD A;  2XM4 A;  4KI2 A;  4LDQ A;  4QDL A;  3HNJ A;  4P9F A;  4G7O F;  4O6N A;  1BDJ B;  2VAS A;  2YLG A;  4CS9 C;  3EH1 A;  2AVK A;  2V26 A;  5EGY A;  5A6K A;  2FAP B;  1JRA A;  3HNK A;  1Z63 A;  3FVY A;  1SMY F;  4XPW A;  3FOP A;  3H2V A;  1VB5 A;  3DXJ F;  4U5H A;  3UNG C;  5JUA A;  2A68 F;  4KC9 A;  3VRC A;  3SP1 A;  5COF A;  1H6G A;  3C8G A;  4DRH B;  2HMQ A;  4OIR F;  4E18 A;  4Q5S F;  4D4N A;  3KKB A;  4NY3 A;  2WZG A;  5DQT A;  1Y4C A;  1WAS A;  2L9J A;  4BPM A;  1I5N A;  5COG A;  2KGO A;  2DYS C;  3TK0 A;  2L81 A;  2HSB A;  1YVI A;  3GEE A;  2EIK C;  2J8W A;  1KNY A;  2EIM C;  3B29 A;  3ZQY A;  1F1M A;  4EKW A;  5L0C A;  1YLM A;  3S90 A;  3NYL A;  4CS8 C;  4DBQ A;  4UDV A;  3NMI A;  3OWT A;  1WN0 A;  3JT1 A;  2ZPA A;  1TR2 A;  3O6X A;  4JEA A;  2PF4 E;  3DZA A;  3RH3 A;  4E0I A;  1LIH A;  3A9C A;  3NKD A;  1GGQ A;  4MW3 A;  4ANJ A;  5JVE A;  1MND A;  3L0I A;  4RBN A;  3MYI A;  2FGY A;  1G5Z A;  3Q7L A;  4J7Y A;  5B3S C;  3HKK A;  2R7O A;  3M4B A;  1A7V A;  3E9V A;  5EHH A;  5K0I A;  2G62 A;  4NTF A;  1XZP A;  4YT8 A;  4PR9 A;  4U5D E;  3LS1 A;  3IQ5 A;  1R4T A;  4H4K C;  3DE9 A;  4YT5 A;  2LQG A;  3C63 A;  5JP7 A;  4MVZ A;  4BJ1 A;  3U0C A;  1MMD A;  3W2W A;  4WGZ A;  2R03 A;  4CJG A;  3DJU B;  3PMR A;  5AC5 A;  3J06 A;  4EIY A;  3IQC A;  4N4W A;  3F46 A;  1A41 A;  1TQG A;  1XZQ A;  2I15 A;  1OXB A;  1OW6 A;  5COM A;  5DS4 A;  2IXP A;  3VF0 A;  3AQC A;  2BE5 F;  3NMJ A;  2KC3 A;  2YLD A;  1FNT c;  1VYK A;  1YDI A;  3GM2 A;  3JRT A;  1O3U A;  3SZR A;  4DBR A;  5KYY A;  1Z5Z A;  1TWH A;  5L3Q A;  1HY5 A;  1LE4 A;  3DM9 B;  3T6G B;  1EQ1 A;  3KYI A;  4MTF A;  2XL4 A;  3RFY A;  3VM6 A;  2R7U A;  4ER9 A;  1N1C A;  3FAP B;  1OW8 A;  5F5H A;  1JPJ A;  4E7Z A;  3U3F A;  2YL1 A;  1NSG B;  3DMD A;  3JSE O;  1VOM A;  2CYD A;  4CX9 A;  2XSE A;  4WAB A;  2BL2 A;  3ZC4 A;  2O9X A;  1S05 A;  4JCZ A;  3U5S A;  2R7R A;  2WB7 A;  4MS2 A;  3AG1 C;  3BEH A;  3H65 A;  4KBL A;  3AQB A;  4Z9I A;  5EK0 A;  3SXY A;  3W8I A;  3WAQ A;  5DQZ A;  2R7X A;  1H7I A;  4XEK A;  1PD0 A;  3FMS A;  5DLJ A;  2P1A A;  3LES A;  5E33 A;  1A7E A;  1YZA A;  3Q7G A;  3TOM A;  1MMN A;  2HFI A;  4HE8 D;  1JMW A;  2DB4 A;  3I5Q A;  4BJ5 C;  3QTH A;  1QKR A;  4XTK A;  1RKE A;  5TJ5 E;  1S7Z A;  3RF3 A;  3R7C A;  2DYR C;  2IBF A;  2XLE A;  3EPV A;  2KSF A;  5FCL A;  2RD9 A;  3Q6N A;  3LLI A;  5L3V A;  4U5C E;  3O10 A;  1FFT C;  2OJQ A;  1Q0D A;  5L0F A;  3EHN A;  5JT4 A;  5L0G A;  2VB6 A;  1YJG A;  4JZA A;  4GYT A;  2H7O A;  2EPL X;  2AU5 A;  3N24 A;  2XLM A;  2L6F A;  2AP3 A;  4YJW A;  3SEO A;  3L1M A;  1J8M F;  2MYS A;  2GWW A;  2J0X A;  1OCZ C;  3K7D A;  5BQI A;  3AGT A;  5DS6 A;  5HSW A;  1A7D A;  3ATP A;  1T6U A;  3F47 A;  4CS8 A;  2A1D D;  1RMV A;  1YAR O;  3NYM A;  3SXK A;  5A6B D;  3G50 A;  3S9O A;  1EI7 A;  2EIL C;  4M63 A;  4EBB A;  1AVO B;  2Q9C A;  3US6 A;  4XLP F;  3S84 A;  3ASN C;  4MVU A;  3FOO A;  4YL0 A;  3ZDL A;  3WG7 C;  3ZG1 A;  3U9J A;  2YRF A;  1ZHX A;  3Q6M A;  4EUK B;  1NBB A;  2A0B A;  1RJ9 B;  1Y6D A;  2YZS A;  4BEM J;  2HS5 A;  2OJE D;  1U0B B;  4JTC B;  4U5G A;  1JR8 A;  3IQT A;  3ZTZ A;  5A6A A;  4JTD B;  3GM3 A;  1VLS A;  1C03 A;  1ZHY A;  2KNH A;  2ICW G;  3C7J A;  1M2O A;  5E2Q A;  4CSA C;  4P6I C;  4FAP B;  1GQA A;  1R5I D;  3QW0 A;  4OD5 A;  1AEP A;  4CJO A;  1OKK A;  3FDQ A;  2GFH A;  3EGX B;  3ZWI A;  1RJ9 A;  3EG9 B;  4FWV A;  3OEO A;  4KNV A;  3K33 A;  4NCQ A;  1ORY A;  4E17 A;  1T5O A;  3DE8 A;  1AUE A;  1JAF A;  1SYQ A;  1NG1 A;  1OR2 A;  2R02 A;  3EZH A;  2LFF A;  4N6H A;  5KYW B;  1O5H A;  1T6Q A;  5KYX B;  4DOZ A;  1B68 A;  4XPX A;  2QE9 A;  3TUL A;  1VYI A;  3I4U A;  4KNW A;  1SR2 A;  2W4B A;  3LEV A;  3WHN A;  1Z3I X;  2J9U A;  2Y3B A;  2QTV A;  5D92 A;  3EHM A;  1Q0G A;  3DAF A;  2CW0 F;  2NSG A;  3EGX A;  2IXO A;  3EG9 A;  3S27 A;  1HMO A;  1O87 A;  1OXK A;  2AWC A;  3JYH A;  3QW1 A;  1U89 A;  1QSP A;  3AGU A;  3E70 C;  5GPG B;  5E3C A;  4EHP A;  3RYL A;  5KYW A;  1ZHW A;  3CEX A;  2Q7R A;  1EKY A;  3DM5 A;  5AGF A;  2J9B A;  4JEB A;  4WGY A;  2LSE A;  4A2N B;  3RQE A;  2PFD A;  1HW1 A;  2VCC A;  3ZSU A;  5L0J A;  1HW2 A;  4J7T A;  4U5E E;  1DOW A;  4RDA A;  3RVY A;  2Y39 A;  3LAY A;  4U9E A;  2IXM A;  2HSQ A;  4BJ5 A;  2D4U A;  4I3M A;  1Q0F A;  1E83 A;  4QI2 A;  1LE2 A;  4QI0 A;  4ULW A;  1VTM P;  3S28 A;  3CSK A;  3QZC A;  2J9V A;  3MFN A;  1MQV A;  1E86 A;  1KTM A;  4PK4 A;  3N0T A;  1E85 A;  5IY5 C;  4DRI B;  2KYH A;  1FTS A;  2XS8 A;  1ZW3 A;  3LUT B;  2R7W A;  3M15 A;  3ZTM A;  2B0H A;  4X0R A;  1VLT A;  2ASR A;  5JRA A;  3IPM O;  3TOL A;  4NTA A;  3ZIB A;  3K1H A;  4ONS A;  3TJ5 A;  1ZU4 A;  2W9Y A;  3ASO C;  4MTO A;  4JJF A;  1QQ3 A;  1PD1 A;  1ZYR F;  4MND A;  4CBE A;  4AL1 A;  3RQF A;  3B71 A;  1H9G A;  3HNI A;  5B1B C;  1RCP A;  2YL3 A;  1D0Z A;  1D1A A;  4JTA B;  2Z15 A;  2X51 A;  4MVR A;  2JX0 A;  1C02 A;  3UGP A;  2OEV A;  4G78 A;  5BQH A;  1YZC A;  5DVW A;  2H7B A;  2M64 A;  1G4W R;  3DD7 A;  1BZ4 A;  2VH3 A;  3N2Z B;  1OCC C;  1V54 C;  2HZ8 A;  4K1O A;  4O6Y A;  3C8Z A;  3V5Z A;  1V55 C;  1QVX A;  2LP4 A;  2FFH A;  3EGD B;  3SXZ A;  3LNR A;  1J8Y F; 
#chains in the Genus database with same CATH homology
 5HV9 A;  3LEO A;  2UUH A;  4NTA A;  5BQI A;  3DWW A;  2Q7R A;  4JC7 A;  4AL0 A;  4AL1 A;  2UUI A;  2PNO A;  4J7T A;  4YL1 A;  4JRZ A;  4J7Y A;  4YL0 A;  3HKK A;  4YL3 A;  4BPM A;  5BQH A;  2H8A A;  4YK5 A;  4NTB A;  5K0I A;  3PCV A;  4NTF A;  4WAB A;  5BQG A;  3B29 A;  4JCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...