4JC7A

Human ltc4 synthase in complex with product analogs - implications for enzyme catalysis
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
154
structure length
154
Chain Sequence
HHHHHHKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALALLVALAALGLLAHFLPAALRAALLGRLRTLLPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 60
structure length 154
sequence length 154
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4jc7A00
2UUHA 4J7TA 4YL1A 4YL3A 4YK5A 3B29A 3HKKA 4JCZA 2PNOA 4NTFA 3LEOA 5BQGA 2UUIA 4J7YA 3PCVA 4AL0A 4JC7A 5HV9A 4YL0A 5K0IA 4WABA 5BQHA 4NTBA 2Q7RA 4JRZA 2H8AA 3DWWA 5BQIA 4BPMA 4NTAA 4AL1A
chains in the Genus database with same CATH superfamily
4ONSA 4N4WA 3RIPA 4U5DE 2PF4E 5F5FA 3JCUQ 3SNHA 3SZRA 5JSLA 4LDQA 1M2VA 1VOMA 2ZPAA 4YL3A 5DVWA 5FZTA 2X0CA 3SXZA 3ZG1A 5L0CA 1LE2A 3LEVA 4EIYA 3H2UA 2KSFA 4O6MA 1WASA 2H7BA 2IBFA 4MVZA 2F22A 3DD7A 2FFHA 3JT1A 4C3EA 4EWCA 1WOLA 1D1CA 1YYJA 2NPUA 3NG1A 3DAGA 4E0HA 3SXYA 5HV9A 3DE9A 2J7PA 4YL0A 3GANA 3B0VC 4N6HA 5KYWB 2J9VA 2HSBA 2Z15A 4JVSA 1OR3A 2P7VA 3GEHA 3GWLA 3PDMP 2J0WA 3JRMO 4U5FE 4QDLA 3V5ZA 2YLDA 2OJQA 3U0CA 2HV6A 1J8MF 2P61A 2OU6A 5AC5A 1LM3B 2YZSA 3RW0A 3ZQVA 2VCAA 2J46A 1QSPA 3ABLC 4GQHA 4O6YA 3U8PA 2A6EF 5KYNA 2IXMA 1JR8A 1T6UA 3TD7A 3A9CA 4J32B 4YWQA 4FAPB 3KKBA 1VLSA 2R7OA 3RQGA 3RVZA 4Z9IA 1Q0GA 5DS5A 2L6FA 2ETSA 1M2OA 4CDAA 5E3CA 2CDQA 2P1AA 1H9TA 3JZ0A 2HV7A 2B0JA 1MQVA 4I1MA 1E85A 1TWHA 1I4ZA 1ZU5A 4YJWA 1W2WA 2PP4A 2ZXPA 1H6GA 4YT4A 1S05A 1E2XA 2J7PD 3DWWA 3TOMA 3UNGC 4LACB 3POVA 2IXPA 4U5GA 3ASOC 3OA1A 2JD3A 1CPQA 1ORYA 2RD9A 1L7CA 3EH2A 1Q0MA 4EUKB 3I4UA 2PFDA 1IW7F 3IQCA 1Y6DA 1E84A 3UGOA 2Q3TA 4GYTA 5E3AA 1OCOC 3IQ5A 1Z5ZA 1D1AA 3H65A 1H7IA 2KGOA 3RH3A 2DB4A 2UUIA 2XLEA 1ZU4A 1BR2A 5DQZA 4JTCB 4AL0A 1KTMA 2V3CC 1LIHA 4R32A 4D4NA 2L7AA 2NSGA 1NZEA 4K7BA 3K7DA 4Q7CA 1SR2A 4DBQA 4J30B 1HW1A 1C17M 1QVXA 1DOWA 1RKCA 2HZ8A 3C8ZA 4I44A 2IXOA 3MYIA 1PCXA 2YHSA 2H7VC 2Y69C 4JEAA 3HNKA 1GM5A 1L3PA 1U89A 1YDIA 2AWCA 1EA8A 3NYMA 1FAPB 3OEOA 1UG7A 3T6BA 3FHDA 2IXNA 3EGXA 1IZMA 1V55C 2XM4A 2AWYA 2P6VA 4JTAB 5TJ5E 3TQOA 4JURI 1AEPA 2YVKA 2NUTA 2QTVA 5B3SC 2I15A 3EZHA 4MNDA 1ZHZA 3QZCA 3JTLO 1F1MA 1LS1A 1RJ9A 1MMAA 1ZVZA 3LAYA 1TFOB 2HJMA 2HSQA 3FMSA 3ITFA 4G78A 4P9FA 3N2ZB 4CSAC 1O3UA 2R03A 2YL3A 1M2VB 5E2QA 4CSAA 4WABA 3OWTA 4Q5SF 3L1MA 3ATPA 3NMJA 1SYQA 1RKEA 3G4ZA 4JJFA 4CBEA 1MMNA 1RMVA 3SYNA 2DYSC 3GEEA 3ZTMA 4MVUA 2EINC 2ZXWC 3JRTA 4DVYP 4OIOF 2G3VA 2R7XA 3LLIA 3AOUA 3J06A 3AG4C 3AGTA 3KYIA 3IEEA 2A1DD 1QPUA 3AG2C 2ZXRA 3KYJA 3LLKA 3WODF 3Q7GA 1MNEA 4WGYA 1PV3A 4NY3A 1K04A 2YQYA 1A41A 2YL1A 3DM5A 4MTOA 3B71A 2L6GA 3IQTA 4XPWA 2J8WA 1M6TA 3EG9A 4J7YA 3I5QA 1S7ZA 1ZHXA 3R7CA 2R02A 4Q4ZF 2J9UA 4DRJB 3NMKA 4BJ6A 5CI8A 4MVQA 3DI5A 2PX0A 5A6JA 2Y3GA 1XWJA 3EGDA 2VCCA 2VH3A 4YT8A 1WN0A 2M64A 1JOGA 2W4MA 2Y3BA 1GQAA 2BE5F 2J9WA 2M4EA 2YL7A 2NUPA 2ZD9A 4JZAA 3U5SA 5B3IA 5L0GA 3V5YA 2UUHA 5F28E 4P6IC 3SEOA 1NSGB 2EPKX 3T9OA 2ASRA 1VYIA 3DMDA 3F47A 3NRHA 3RQFA 1XZQA 5A6KA 4ZLCA 2CYDA 1JAFA 3FOOA 2OOCA 2XL4A 3CSKA 4P9TA 4NTFA 4LDRA 1TWAA 2B0HA 3LEOA 3O6XA 3ZVRA 1ZHTA 3ZDLA 1A7DA 1I5NA 3ASNC 1WTYA 2YWAA 3ZQYA 4DVZA 2YKZA 1YA9A 3PMRA 2GDCA 2FAPB 3KL4A 4XLNF 4MVRA 1LPEA 1H9GA 3CQZA 4YT2A 4IAOA 1OCRC 1FNTc 3WAQA 1FTSA 3DKAA 2D5RB 4HFKB 3CEXA 1LVKA 5L0JA 3IPMO 2LP4A 3TJ5A 3VRCA 3I5PA 4GEHA 4EBKA 4DBRA 4A4AA 2WVOA 1WWPA 2NSFA 3QVZA 4HEAJ 4BJ5C 4IRUA 4AK9A 4C7OA 1A0BA 4U5BE 4U5CE 3MLGA 3WHNA 2R7RA 1YJGA 1Z63A 3B29A 3HKKA 4IAQA 2PNOA 2V26A 1HE1A 3DJUB 1U6HA 4JCZA 5T3TA 4CS9C 1HW2A 5BQGA 2J9BA 4FESA 2CW0F 2X51A 4CS9A 2Y3DA 4LERA 3EGXB 1HMOA 3FOPA 3DZAA 3UR3C 1JPJA 3BEHA 1Z6AA 2HJ3A 1NBBA 2NUTB 1G4WR 1R5ID 1TWGA 4IARA 4PK4A 2G3KA 2DGJA 4KNWA 3W8IA 2GWWA 3U2MA 2IYLD 1RJ9B 4YT5A 2EPLX 1K40A 4A2NB 2LIGA 2Q4FA 4N06A 3NKDA 4ER9A 5L3VA 2R7SA 2KK1A 2OKUA 5DLJA 1YA7O 5FCLA 4F4BA 2XXAA 1FFTC 1VLTA 1Q0DA 2LQGA 5DS6A 5BUOA 3US6A 3NYLA 1YZCA 4EBBA 2R7TA 2EPOA 1RKEB 4ZLDA 2C04A 5AC4A 2VCBA 4G7ZF 5JT4A 2AVKA 1HE9A 3W2VA 1NFNA 1ZYRF 2EIKC 3TJ6A 5JRAA 4JC7A 4OIRF 2CGEA 2YLGA 2Q00A 5A6AA 1G5ZA 4HFFB 3GM3A 4MVMA 4JJGA 4CS8C 1V4AA 1FFHA 4IWBA 3AGUA 3EG9B 5JVEA 4AL1A 1NLXA 1TWCA 4KI2A 2YRFA 2XS8A 3LNRA 1CGME 2PX3A 1BBHA 1WGWA 4PJLA 3T4RA 2LD6A 4OD4A 4YK5A 4Z9JA 3TULA 1G8XA 2OJED 3C18A 3EGDB 1FMWA 1A7VA 3LS1A 4LLCA 4OD5A 4C3DA 5L0HA 1OR2A 1T5OA 2HMZA 1C02A 1OXBA 2HFIA 3A11A 3PCVA 4PFOA 3UMKA 4UDVA 4Z9HA 1ZW2A 2NUPB 5HSWA 2ICWG 2I8BA 4E7SA 3NYJA 4ANJA 3H2VA 1D0ZA 1NU7D 1SMYF 3B9QA 4PJJA 1NFOA 2J45A 4JIOA 4O79A 3EFOA 3AG3C 3C63A 5IY5C 3EJNA 4CS7A 2FGYA 2YL0A 4W8KA 4XWJA 2ZXOA 3CAXA 4NQFA 1D1BA 2XRHA 1RCPA 2L81A 1OW7A 3EQLF 3DM9B 3M79A 1XZPA 1KU2A 1K05A 3NKEA 4JCHA 1YAUO 3DJNB 3SXKA 3S90A 4KNVA 4XEVA 5D91A 2A0BA 3FAPB 2WZLA 4CJOA 3NMIA 3QW0A 3O39A 1B68A 4KC9A 4IJJA 4AX2A 3TOLA 1OKKA 2Q9AA 2VC9A 2R7VA 1LE4A 5D92A 2XLWA 2Q9BA 5KYUA 4EHPA 3GORA 5T3WA 3L34A 3M1CB 4MS2A 3LNMB 3CZ6A 4IGGA 1EI7A 2W4BA 3KMIA 2MYSA 4MTFA 5T1DB 1DOVA 1SZIA 4C7OB 4E0IA 1R4TA 4DXWA 5L0IA 3EHNA 4G7OF 2H7OA 5BQHA 2A69F 4YN0B 3FDQA 2H8AA 4PACA 2W45A 3VF0A 5E33A 3ZTZA 3B0UX 1WATA 3AQBA 2R9RB 2KQ9A 1U0BB 2XSEA 3R2PA 4O7GA 2BL2A 2W9YA 1N1CA 1V54C 2OCCC 2LFFA 2LSEA 3S84A 2GFHA 4E7ZA 1Z23A 3BRJA 1ST6A 1JMWA 4N6CA 3SXMA 2YEVA 1ZHWA 1FMVA 2R25A 4JEBA 4DOZA 4CIHA 3HNIA 1CGNA 4B6IA 1ZZPA 3E9VA 1YVIA 2YLIA 1OKKD 1JRAA 3EHMA 2A6HF 3FVYA 3L8JA 4LDKA 2XXAB 5B1AC 4QI0A 1EQ1A 3HJCA 3U3FA 3S28A 2NG1A 3K33A 1YYXA 4BJ1A 4MQ9F 5B1BC 4XEKA 2DI3A 1HMDA 1I4YA 2CCYA 2EIMC 4I1OB 3Q7LA 2XM0A 4FWVA 2HMQA 3ZC4A 5JP7A 2TMVP 2EPNA 4JTDB 2PBEA 2Y39A 5CI9A 3K66A 2KC3A 1TR2A 3HLZA 1LS4A 1ZW3A 3GWNA 5KYYA 4HE8D 3ECSA 1RXQA 2QUPA 3DXJF 4PJNA 4YL1A 1PD1A 2P0NA 3AJMA 4E17A 1QLEC 2LCHA 4BJ5A 1OXKA 3PHF2 1GS9A 2MHRA 3M4BA 1YZAA 1MNDA 5A6BA 3RKOF 2OG2A 3UMHA 4AE4A 1JPNA 3GEIA 3GODA 1APCA 3U2LA 3DE8A 1EKYA 3S0XA 5EHHA 3EZIA 5DQTA 5GPGB 3C8GA 4G0HA 2KW3C 3JSEO 3ZIBA 4JRZA 2WL8A 1D0XA 4ULVA 3O55A 4RDAA 1KNYA 4OIQF 4H4KC 4WJ0A 1SF8A 3SP1A 4D4XA 4EBJA 4BPMA 3ABMC 4CX9A 4MVSA 2EIJC 2HS5A 4U5EE 1PD0A 3L0IA 1TKNA 3K1HA 4DRIB 5KYXA 1O5HA 2AU5A 5L3QA 3M15A 4OINF 1OW8A 3EFOB 2Y3HA 3IQ6A 1CGOA 256BA 3DAFA 3HTKC 3GM2A 1OCZC 1QKRA 1VYKA 3X2QC 3K1IC 1LKXA 4MW3A 1A7EA 1HY5A 2HKVA 2JPUA 1MMGA 3JYHA 3K1IA 3EH1A 3MYFA 4XPXA 3NDBB 2XLHA 5A6BD 1VB5A 1M56C 2R7UA 2J0XA 1BZ4A 4MVOA 1T9KA 1GGQA 3LESA 4U9EA 4WGZA 2WVQA 2GAQA 2QE9A 3QVYA 3IHUA 3W8HA 3C7JA 3C8GD 2O9XA 3U3BA 4O6NA 1VK5A 3LS0A 5KYUB 2IOQA 4OIPF 2JX0A 3M4CA 4EKWA 3U9MA 4XLPF 2GA0A 4CS8A 4I3MA 3RVYA 3X1OA 3GM1A 4JE9A 4LLEA 2EPMX 3VYWA 2OEVA 3G50A 5JUAA 1UFBA 4K0DA 4BG0A 5KYWA 4XTKA 1VTMP 3Q6MA 1T6QA 5L0FA 5A69A 1E83A 1TQGA 3WG7C 2E87A 5DS4A 4NCQA 3UGPA 3U9JA 2MWQA 2BC5A 2AP3A 4BJTA 5EGYA 4DRHB 1LI7A 4RBNA 3KH2A 3LJBA 2XS1A 3S29A 3UMIA 2WZFA 3RFYA 3K6BA 4G7HF 1BR4A 3FXHA 4PFPA 4CDYA 4CJGA 4QI2A 1T01A 4MTGA 2XLVA 4BEJA 3VM6A 2DYRC 1O87A 4W8PA 2WZGA 4NTBA 4XEFA 2Q7RA 1LI5A 1Q0KA 3V7OA 5JS5A 3RF3A 1CPRA 2A68F 2VB6A 2WB7A 1YARO 4PR9A 2QNLA 1YLMA 3VAYA 4RD9A 1ORJA 5COFA 3RQEA 3E70C 1G4US 1E86A 2LFDA 3QTHA 3MBGA 1Z7Qc 5JLIA 4J7TA 2R05A 3HNJA 3TK0A 3L8IA 4MW8A 4M63A 3S9OA 3JYYA 3O10A 2CNWA 2XL8A 3V5XA 4K1OA 1D0YA 1QZXA 1Y4CA 3MFNA 3U8VA 4PJMA 2QY9A 1ZHYA 4BEMJ 1NU9C 2C03A 2LK4A 3Q6NA 3ZSUA 1NG1A 1BR1A 5KYYB 1OQCA 3W2WA 1Z3IX 4NC3A 5K0IA 4CIPA 2XLMA 3ABKC 3HNLA 3LUTB 3FAJA 5COMA 5EK0A 3S27A 2R7QA 1VMAA 3T6GB 1J8YF 2D4UA 2KJGA 1BDJB 4U9DA 2OEXA 4KBLA 4ULWA 5BQIA 3AG1C 4NTAA 4U5HA 4AE4B 2WVNA 1QQ3A 2EILC 3T6JA 3ZWIA 3N0TA 3QMKA 2L6HA 2R7WA 5AGFA 3C8GB 3C62A 2G62A 3EPVA 3F46A 1V74B 1T6IA 4DJ9A 5L0DA 4IB4A 4XPYA 1TFKB 4H54A 4XQ1A 4CDVA 4BJ6C 2QLAA 2CNWD 1C03A 1OW6A 3RYLA 2KYHA 2RSEB 5F5HA 4E18A 2HUJA 2XL6A 3N24A 3JSZA 5COGA 4JKVA 4L6RA 5KYXB 1FR0A 1MMDA 3B0PA 2A0UA 1OCCC 2L9JA 4JW1A 4FX5A 1AUEA 5CIVA 2XLDA 1ORSC 2OQMA 3KPHA 2XLOA 2KNHA 3MX3A 4X0RA 1M57C 3W4YA 2IM8A 1AVOB 3QW1A 3G4XA 4C3BA 1Q0FA 3AQCA 2Q9CA 2VASA
chains in the Genus database with same CATH topology
2UUHA 4J7TA 4YL1A 4YL3A 4YK5A 3B29A 3HKKA 4JCZA 2PNOA 4NTFA 3LEOA 5BQGA 2UUIA 4J7YA 3PCVA 4AL0A 4JC7A 5HV9A 4YL0A 5K0IA 4WABA 5BQHA 4NTBA 2Q7RA 4JRZA 2H8AA 3DWWA 5BQIA 4BPMA 4NTAA 4AL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUH A;  4J7T A;  4YL1 A;  4YL3 A;  4YK5 A;  3B29 A;  3HKK A;  4JCZ A;  2PNO A;  4NTF A;  3LEO A;  5BQG A;  2UUI A;  4J7Y A;  3PCV A;  4AL0 A;  4JC7 A;  5HV9 A;  4YL0 A;  5K0I A;  4WAB A;  5BQH A;  4NTB A;  2Q7R A;  4JRZ A;  2H8A A;  3DWW A;  5BQI A;  4BPM A;  4NTA A;  4AL1 A; 
#chains in the Genus database with same CATH topology
 4ONS A;  4N4W A;  3RIP A;  4U5D E;  2PF4 E;  5F5F A;  3JCU Q;  3SNH A;  3SZR A;  5JSL A;  4LDQ A;  1M2V A;  1VOM A;  2ZPA A;  4YL3 A;  5DVW A;  5FZT A;  2X0C A;  3SXZ A;  3ZG1 A;  5L0C A;  1LE2 A;  3LEV A;  4EIY A;  3H2U A;  2KSF A;  4O6M A;  1WAS A;  2H7B A;  2IBF A;  4MVZ A;  2F22 A;  3DD7 A;  2FFH A;  3JT1 A;  4C3E A;  4EWC A;  1WOL A;  1D1C A;  1YYJ A;  2NPU A;  3NG1 A;  3DAG A;  4E0H A;  3SXY A;  5HV9 A;  3DE9 A;  2J7P A;  4YL0 A;  3GAN A;  3B0V C;  4N6H A;  5KYW B;  2J9V A;  2HSB A;  2Z15 A;  4JVS A;  1OR3 A;  2P7V A;  3GEH A;  3GWL A;  3PDM P;  2J0W A;  3JRM O;  4U5F E;  4QDL A;  3V5Z A;  2YLD A;  2OJQ A;  3U0C A;  2HV6 A;  1J8M F;  2P61 A;  2OU6 A;  5AC5 A;  1LM3 B;  2YZS A;  3RW0 A;  3ZQV A;  2VCA A;  2J46 A;  1QSP A;  3ABL C;  4GQH A;  4O6Y A;  3U8P A;  2A6E F;  5KYN A;  2IXM A;  1JR8 A;  1T6U A;  3TD7 A;  3A9C A;  4J32 B;  4YWQ A;  4FAP B;  3KKB A;  1VLS A;  2R7O A;  3RQG A;  3RVZ A;  4Z9I A;  1Q0G A;  5DS5 A;  2L6F A;  2ETS A;  1M2O A;  4CDA A;  5E3C A;  2CDQ A;  2P1A A;  1H9T A;  3JZ0 A;  2HV7 A;  2B0J A;  1MQV A;  4I1M A;  1E85 A;  1TWH A;  1I4Z A;  1ZU5 A;  4YJW A;  1W2W A;  2PP4 A;  2ZXP A;  1H6G A;  4YT4 A;  1S05 A;  1E2X A;  2J7P D;  3DWW A;  3TOM A;  3UNG C;  4LAC B;  3POV A;  2IXP A;  4U5G A;  3ASO C;  3OA1 A;  2JD3 A;  1CPQ A;  1ORY A;  2RD9 A;  1L7C A;  3EH2 A;  1Q0M A;  4EUK B;  3I4U A;  2PFD A;  1IW7 F;  3IQC A;  1Y6D A;  1E84 A;  3UGO A;  2Q3T A;  4GYT A;  5E3A A;  1OCO C;  3IQ5 A;  1Z5Z A;  1D1A A;  3H65 A;  1H7I A;  2KGO A;  3RH3 A;  2DB4 A;  2UUI A;  2XLE A;  1ZU4 A;  1BR2 A;  5DQZ A;  4JTC B;  4AL0 A;  1KTM A;  2V3C C;  1LIH A;  4R32 A;  4D4N A;  2L7A A;  2NSG A;  1NZE A;  4K7B A;  3K7D A;  4Q7C A;  1SR2 A;  4DBQ A;  4J30 B;  1HW1 A;  1C17 M;  1QVX A;  1DOW A;  1RKC A;  2HZ8 A;  3C8Z A;  4I44 A;  2IXO A;  3MYI A;  1PCX A;  2YHS A;  2H7V C;  2Y69 C;  4JEA A;  3HNK A;  1GM5 A;  1L3P A;  1U89 A;  1YDI A;  2AWC A;  1EA8 A;  3NYM A;  1FAP B;  3OEO A;  1UG7 A;  3T6B A;  3FHD A;  2IXN A;  3EGX A;  1IZM A;  1V55 C;  2XM4 A;  2AWY A;  2P6V A;  4JTA B;  5TJ5 E;  3TQO A;  4JUR I;  1AEP A;  2YVK A;  2NUT A;  2QTV A;  5B3S C;  2I15 A;  3EZH A;  4MND A;  1ZHZ A;  3QZC A;  3JTL O;  1F1M A;  1LS1 A;  1RJ9 A;  1MMA A;  1ZVZ A;  3LAY A;  1TFO B;  2HJM A;  2HSQ A;  3FMS A;  3ITF A;  4G78 A;  4P9F A;  3N2Z B;  4CSA C;  1O3U A;  2R03 A;  2YL3 A;  1M2V B;  5E2Q A;  4CSA A;  4WAB A;  3OWT A;  4Q5S F;  3L1M A;  3ATP A;  3NMJ A;  1SYQ A;  1RKE A;  3G4Z A;  4JJF A;  4CBE A;  1MMN A;  1RMV A;  3SYN A;  2DYS C;  3GEE A;  3ZTM A;  4MVU A;  2EIN C;  2ZXW C;  3JRT A;  4DVY P;  4OIO F;  2G3V A;  2R7X A;  3LLI A;  3AOU A;  3J06 A;  3AG4 C;  3AGT A;  3KYI A;  3IEE A;  2A1D D;  1QPU A;  3AG2 C;  2ZXR A;  3KYJ A;  3LLK A;  3WOD F;  3Q7G A;  1MNE A;  4WGY A;  1PV3 A;  4NY3 A;  1K04 A;  2YQY A;  1A41 A;  2YL1 A;  3DM5 A;  4MTO A;  3B71 A;  2L6G A;  3IQT A;  4XPW A;  2J8W A;  1M6T A;  3EG9 A;  4J7Y A;  3I5Q A;  1S7Z A;  1ZHX A;  3R7C A;  2R02 A;  4Q4Z F;  2J9U A;  4DRJ B;  3NMK A;  4BJ6 A;  5CI8 A;  4MVQ A;  3DI5 A;  2PX0 A;  5A6J A;  2Y3G A;  1XWJ A;  3EGD A;  2VCC A;  2VH3 A;  4YT8 A;  1WN0 A;  2M64 A;  1JOG A;  2W4M A;  2Y3B A;  1GQA A;  2BE5 F;  2J9W A;  2M4E A;  2YL7 A;  2NUP A;  2ZD9 A;  4JZA A;  3U5S A;  5B3I A;  5L0G A;  3V5Y A;  2UUH A;  5F28 E;  4P6I C;  3SEO A;  1NSG B;  2EPK X;  3T9O A;  2ASR A;  1VYI A;  3DMD A;  3F47 A;  3NRH A;  3RQF A;  1XZQ A;  5A6K A;  4ZLC A;  2CYD A;  1JAF A;  3FOO A;  2OOC A;  2XL4 A;  3CSK A;  4P9T A;  4NTF A;  4LDR A;  1TWA A;  2B0H A;  3LEO A;  3O6X A;  3ZVR A;  1ZHT A;  3ZDL A;  1A7D A;  1I5N A;  3ASN C;  1WTY A;  2YWA A;  3ZQY A;  4DVZ A;  2YKZ A;  1YA9 A;  3PMR A;  2GDC A;  2FAP B;  3KL4 A;  4XLN F;  4MVR A;  1LPE A;  1H9G A;  3CQZ A;  4YT2 A;  4IAO A;  1OCR C;  1FNT c;  3WAQ A;  1FTS A;  3DKA A;  2D5R B;  4HFK B;  3CEX A;  1LVK A;  5L0J A;  3IPM O;  2LP4 A;  3TJ5 A;  3VRC A;  3I5P A;  4GEH A;  4EBK A;  4DBR A;  4A4A A;  2WVO A;  1WWP A;  2NSF A;  3QVZ A;  4HEA J;  4BJ5 C;  4IRU A;  4AK9 A;  4C7O A;  1A0B A;  4U5B E;  4U5C E;  3MLG A;  3WHN A;  2R7R A;  1YJG A;  1Z63 A;  3B29 A;  3HKK A;  4IAQ A;  2PNO A;  2V26 A;  1HE1 A;  3DJU B;  1U6H A;  4JCZ A;  5T3T A;  4CS9 C;  1HW2 A;  5BQG A;  2J9B A;  4FES A;  2CW0 F;  2X51 A;  4CS9 A;  2Y3D A;  4LER A;  3EGX B;  1HMO A;  3FOP A;  3DZA A;  3UR3 C;  1JPJ A;  3BEH A;  1Z6A A;  2HJ3 A;  1NBB A;  2NUT B;  1G4W R;  1R5I D;  1TWG A;  4IAR A;  4PK4 A;  2G3K A;  2DGJ A;  4KNW A;  3W8I A;  2GWW A;  3U2M A;  2IYL D;  1RJ9 B;  4YT5 A;  2EPL X;  1K40 A;  4A2N B;  2LIG A;  2Q4F A;  4N06 A;  3NKD A;  4ER9 A;  5L3V A;  2R7S A;  2KK1 A;  2OKU A;  5DLJ A;  1YA7 O;  5FCL A;  4F4B A;  2XXA A;  1FFT C;  1VLT A;  1Q0D A;  2LQG A;  5DS6 A;  5BUO A;  3US6 A;  3NYL A;  1YZC A;  4EBB A;  2R7T A;  2EPO A;  1RKE B;  4ZLD A;  2C04 A;  5AC4 A;  2VCB A;  4G7Z F;  5JT4 A;  2AVK A;  1HE9 A;  3W2V A;  1NFN A;  1ZYR F;  2EIK C;  3TJ6 A;  5JRA A;  4JC7 A;  4OIR F;  2CGE A;  2YLG A;  2Q00 A;  5A6A A;  1G5Z A;  4HFF B;  3GM3 A;  4MVM A;  4JJG A;  4CS8 C;  1V4A A;  1FFH A;  4IWB A;  3AGU A;  3EG9 B;  5JVE A;  4AL1 A;  1NLX A;  1TWC A;  4KI2 A;  2YRF A;  2XS8 A;  3LNR A;  1CGM E;  2PX3 A;  1BBH A;  1WGW A;  4PJL A;  3T4R A;  2LD6 A;  4OD4 A;  4YK5 A;  4Z9J A;  3TUL A;  1G8X A;  2OJE D;  3C18 A;  3EGD B;  1FMW A;  1A7V A;  3LS1 A;  4LLC A;  4OD5 A;  4C3D A;  5L0H A;  1OR2 A;  1T5O A;  2HMZ A;  1C02 A;  1OXB A;  2HFI A;  3A11 A;  3PCV A;  4PFO A;  3UMK A;  4UDV A;  4Z9H A;  1ZW2 A;  2NUP B;  5HSW A;  2ICW G;  2I8B A;  4E7S A;  3NYJ A;  4ANJ A;  3H2V A;  1D0Z A;  1NU7 D;  1SMY F;  3B9Q A;  4PJJ A;  1NFO A;  2J45 A;  4JIO A;  4O79 A;  3EFO A;  3AG3 C;  3C63 A;  5IY5 C;  3EJN A;  4CS7 A;  2FGY A;  2YL0 A;  4W8K A;  4XWJ A;  2ZXO A;  3CAX A;  4NQF A;  1D1B A;  2XRH A;  1RCP A;  2L81 A;  1OW7 A;  3EQL F;  3DM9 B;  3M79 A;  1XZP A;  1KU2 A;  1K05 A;  3NKE A;  4JCH A;  1YAU O;  3DJN B;  3SXK A;  3S90 A;  4KNV A;  4XEV A;  5D91 A;  2A0B A;  3FAP B;  2WZL A;  4CJO A;  3NMI A;  3QW0 A;  3O39 A;  1B68 A;  4KC9 A;  4IJJ A;  4AX2 A;  3TOL A;  1OKK A;  2Q9A A;  2VC9 A;  2R7V A;  1LE4 A;  5D92 A;  2XLW A;  2Q9B A;  5KYU A;  4EHP A;  3GOR A;  5T3W A;  3L34 A;  3M1C B;  4MS2 A;  3LNM B;  3CZ6 A;  4IGG A;  1EI7 A;  2W4B A;  3KMI A;  2MYS A;  4MTF A;  5T1D B;  1DOV A;  1SZI A;  4C7O B;  4E0I A;  1R4T A;  4DXW A;  5L0I A;  3EHN A;  4G7O F;  2H7O A;  5BQH A;  2A69 F;  4YN0 B;  3FDQ A;  2H8A A;  4PAC A;  2W45 A;  3VF0 A;  5E33 A;  3ZTZ A;  3B0U X;  1WAT A;  3AQB A;  2R9R B;  2KQ9 A;  1U0B B;  2XSE A;  3R2P A;  4O7G A;  2BL2 A;  2W9Y A;  1N1C A;  1V54 C;  2OCC C;  2LFF A;  2LSE A;  3S84 A;  2GFH A;  4E7Z A;  1Z23 A;  3BRJ A;  1ST6 A;  1JMW A;  4N6C A;  3SXM A;  2YEV A;  1ZHW A;  1FMV A;  2R25 A;  4JEB A;  4DOZ A;  4CIH A;  3HNI A;  1CGN A;  4B6I A;  1ZZP A;  3E9V A;  1YVI A;  2YLI A;  1OKK D;  1JRA A;  3EHM A;  2A6H F;  3FVY A;  3L8J A;  4LDK A;  2XXA B;  5B1A C;  4QI0 A;  1EQ1 A;  3HJC A;  3U3F A;  3S28 A;  2NG1 A;  3K33 A;  1YYX A;  4BJ1 A;  4MQ9 F;  5B1B C;  4XEK A;  2DI3 A;  1HMD A;  1I4Y A;  2CCY A;  2EIM C;  4I1O B;  3Q7L A;  2XM0 A;  4FWV A;  2HMQ A;  3ZC4 A;  5JP7 A;  2TMV P;  2EPN A;  4JTD B;  2PBE A;  2Y39 A;  5CI9 A;  3K66 A;  2KC3 A;  1TR2 A;  3HLZ A;  1LS4 A;  1ZW3 A;  3GWN A;  5KYY A;  4HE8 D;  3ECS A;  1RXQ A;  2QUP A;  3DXJ F;  4PJN A;  4YL1 A;  1PD1 A;  2P0N A;  3AJM A;  4E17 A;  1QLE C;  2LCH A;  4BJ5 A;  1OXK A;  3PHF 2;  1GS9 A;  2MHR A;  3M4B A;  1YZA A;  1MND A;  5A6B A;  3RKO F;  2OG2 A;  3UMH A;  4AE4 A;  1JPN A;  3GEI A;  3GOD A;  1APC A;  3U2L A;  3DE8 A;  1EKY A;  3S0X A;  5EHH A;  3EZI A;  5DQT A;  5GPG B;  3C8G A;  4G0H A;  2KW3 C;  3JSE O;  3ZIB A;  4JRZ A;  2WL8 A;  1D0X A;  4ULV A;  3O55 A;  4RDA A;  1KNY A;  4OIQ F;  4H4K C;  4WJ0 A;  1SF8 A;  3SP1 A;  4D4X A;  4EBJ A;  4BPM A;  3ABM C;  4CX9 A;  4MVS A;  2EIJ C;  2HS5 A;  4U5E E;  1PD0 A;  3L0I A;  1TKN A;  3K1H A;  4DRI B;  5KYX A;  1O5H A;  2AU5 A;  5L3Q A;  3M15 A;  4OIN F;  1OW8 A;  3EFO B;  2Y3H A;  3IQ6 A;  1CGO A;  256B A;  3DAF A;  3HTK C;  3GM2 A;  1OCZ C;  1QKR A;  1VYK A;  3X2Q C;  3K1I C;  1LKX A;  4MW3 A;  1A7E A;  1HY5 A;  2HKV A;  2JPU A;  1MMG A;  3JYH A;  3K1I A;  3EH1 A;  3MYF A;  4XPX A;  3NDB B;  2XLH A;  5A6B D;  1VB5 A;  1M56 C;  2R7U A;  2J0X A;  1BZ4 A;  4MVO A;  1T9K A;  1GGQ A;  3LES A;  4U9E A;  4WGZ A;  2WVQ A;  2GAQ A;  2QE9 A;  3QVY A;  3IHU A;  3W8H A;  3C7J A;  3C8G D;  2O9X A;  3U3B A;  4O6N A;  1VK5 A;  3LS0 A;  5KYU B;  2IOQ A;  4OIP F;  2JX0 A;  3M4C A;  4EKW A;  3U9M A;  4XLP F;  2GA0 A;  4CS8 A;  4I3M A;  3RVY A;  3X1O A;  3GM1 A;  4JE9 A;  4LLE A;  2EPM X;  3VYW A;  2OEV A;  3G50 A;  5JUA A;  1UFB A;  4K0D A;  4BG0 A;  5KYW A;  4XTK A;  1VTM P;  3Q6M A;  1T6Q A;  5L0F A;  5A69 A;  1E83 A;  1TQG A;  3WG7 C;  2E87 A;  5DS4 A;  4NCQ A;  3UGP A;  3U9J A;  2MWQ A;  2BC5 A;  2AP3 A;  4BJT A;  5EGY A;  4DRH B;  1LI7 A;  4RBN A;  3KH2 A;  3LJB A;  2XS1 A;  3S29 A;  3UMI A;  2WZF A;  3RFY A;  3K6B A;  4G7H F;  1BR4 A;  3FXH A;  4PFP A;  4CDY A;  4CJG A;  4QI2 A;  1T01 A;  4MTG A;  2XLV A;  4BEJ A;  3VM6 A;  2DYR C;  1O87 A;  4W8P A;  2WZG A;  4NTB A;  4XEF A;  2Q7R A;  1LI5 A;  1Q0K A;  3V7O A;  5JS5 A;  3RF3 A;  1CPR A;  2A68 F;  2VB6 A;  2WB7 A;  1YAR O;  4PR9 A;  2QNL A;  1YLM A;  3VAY A;  4RD9 A;  1ORJ A;  5COF A;  3RQE A;  3E70 C;  1G4U S;  1E86 A;  2LFD A;  3QTH A;  3MBG A;  1Z7Q c;  5JLI A;  4J7T A;  2R05 A;  3HNJ A;  3TK0 A;  3L8I A;  4MW8 A;  4M63 A;  3S9O A;  3JYY A;  3O10 A;  2CNW A;  2XL8 A;  3V5X A;  4K1O A;  1D0Y A;  1QZX A;  1Y4C A;  3MFN A;  3U8V A;  4PJM A;  2QY9 A;  1ZHY A;  4BEM J;  1NU9 C;  2C03 A;  2LK4 A;  3Q6N A;  3ZSU A;  1NG1 A;  1BR1 A;  5KYY B;  1OQC A;  3W2W A;  1Z3I X;  4NC3 A;  5K0I A;  4CIP A;  2XLM A;  3ABK C;  3HNL A;  3LUT B;  3FAJ A;  5COM A;  5EK0 A;  3S27 A;  2R7Q A;  1VMA A;  3T6G B;  1J8Y F;  2D4U A;  2KJG A;  1BDJ B;  4U9D A;  2OEX A;  4KBL A;  4ULW A;  5BQI A;  3AG1 C;  4NTA A;  4U5H A;  4AE4 B;  2WVN A;  1QQ3 A;  2EIL C;  3T6J A;  3ZWI A;  3N0T A;  3QMK A;  2L6H A;  2R7W A;  5AGF A;  3C8G B;  3C62 A;  2G62 A;  3EPV A;  3F46 A;  1V74 B;  1T6I A;  4DJ9 A;  5L0D A;  4IB4 A;  4XPY A;  1TFK B;  4H54 A;  4XQ1 A;  4CDV A;  4BJ6 C;  2QLA A;  2CNW D;  1C03 A;  1OW6 A;  3RYL A;  2KYH A;  2RSE B;  5F5H A;  4E18 A;  2HUJ A;  2XL6 A;  3N24 A;  3JSZ A;  5COG A;  4JKV A;  4L6R A;  5KYX B;  1FR0 A;  1MMD A;  3B0P A;  2A0U A;  1OCC C;  2L9J A;  4JW1 A;  4FX5 A;  1AUE A;  5CIV A;  2XLD A;  1ORS C;  2OQM A;  3KPH A;  2XLO A;  2KNH A;  3MX3 A;  4X0R A;  1M57 C;  3W4Y A;  2IM8 A;  1AVO B;  3QW1 A;  3G4X A;  4C3B A;  1Q0F A;  3AQC A;  2Q9C A;  2VAS A; 
#chains in the Genus database with same CATH homology
 2UUH A;  4J7T A;  4YL1 A;  4YL3 A;  4YK5 A;  3B29 A;  3HKK A;  4JCZ A;  2PNO A;  4NTF A;  3LEO A;  5BQG A;  2UUI A;  4J7Y A;  3PCV A;  4AL0 A;  4JC7 A;  5HV9 A;  4YL0 A;  5K0I A;  4WAB A;  5BQH A;  4NTB A;  2Q7R A;  4JRZ A;  2H8A A;  3DWW A;  5BQI A;  4BPM A;  4NTA A;  4AL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...