1HY5A

Crystal structure of the catalytic domain of yope-yersinia pestis gap effector protein.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
120
structure length
120
Chain Sequence
TSFSDSIKQLAAETLPKYMQQLNSLDAEMLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTIGGAASAYVASGVDLTQAANEIKGLAQQMQKLLSLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords YERSINIA PESTIS VIRULENCE PROTEIN YOPE
publication title Crystal structure of the Yersinia pestis GTPase activator YopE.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Toxin
total genus 37
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03545 YopE Yersinia virulence determinant (YopE)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.260 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Virulence factor YopE uncharacterised domain 1hy5A00
1G4WR 1HE1A 1R4TA 1G4US 1HY5A 1HE9A
chains in the Genus database with same CATH superfamily
4U5EE 4HEAJ 3ZG1A 3EFOB 1FMVA 4KNVA 3MBGA 3U8VA 2EIKC 2PF4E 3MYIA 2YWAA 3MYFA 4AX2A 2A1DD 3ZVRA 4EBJA 3PDMP 1RKCA 2WB7A 2XLEA 3ABMC 3FAJA 3I5PA 3NMIA 4CJOA 3PCVA 3CAXA 1LI5A 1QVXA 2HSBA 2AP3A 3B9QA 3DE9A 3HKKA 4AE4B 4EBKA 2J9UA 2Y3BA 5BQHA 1EA8A 4XEVA 1OXKA 3EFOA 4J7TA 4DVYP 4XEKA 5HSWA 2EPOA 4U5HA 1J8YF 2Y3DA 4YL3A 2EPNA 2YLDA 2EIMC 2NUPA 4U5FE 1E86A 3S28A 2R7TA 1Q0DA 4DBQA 5BQGA 4BPMA 2OU6A 3EHNA 2VC9A 1QSPA 2IXOA 2VASA 1BR2A 2KJGA 3ECSA 2ASRA 3UNGC 1GGQA 2I8BA 3C63A 1CPRA 3MLGA 4YL0A 5DS4A 4O6MA 5EHHA 4DVZA 4JC7A 2AWCA 4PK4A 3ITFA 2AVKA 5KYWB 4I1OB 1FFTC 2ZXWC 2LQGA 3ABKC 4K0DA 2J46A 1MMGA 2KYHA 1RKEB 5L0FA 2P7VA 1D1AA 4ANJA 1Q0FA 2D4UA 2IOQA 2A0BA 3H65A 4U5CE 1OXBA 2XL6A 3GM1A 3W4YA 2R9RB 1QZXA 4MW3A 2Q00A 4U5GA 1BR1A 1LI7A 4EIYA 1V4AA 2BL2A 4CDAA 2HJMA 2EPLX 3GEIA 5KYWA 1D0XA 3GODA 3CEXA 5T1DB 5GPGB 3S29A 3IQ5A 4KI2A 2XM0A 5KYXA 3AQBA 3IEEA 3U0CA 2Q4FA 2L9JA 2P61A 4GEHA 4QI0A 1A7EA 1I5NA 1SF8A 5A6JA 4E0IA 3B71A 4XPYA 256BA 1PCXA 1HW2A 1YDIA 5D91A 4CIPA 3B29A 1I4ZA 2G3VA 2NG1A 2QE9A 1RMVA 1LS4A 2MHRA 4HE8D 3V7OA 3KYJA 4DOZA 1AEPA 4OIQF 3RVYA 3A11A 4CDVA 3U8PA 3CZ6A 4G7ZF 2W9YA 3TD7A 1K05A 1NU7D 3AG4C 3PHF2 2DB4A 4N06A 4XLNF 4FWVA 2CNWA 1YVIA 2KW3C 2XLHA 3S27A 4JE9A 5COMA 4CS9C 1JMWA 3IQTA 1RCPA 2OG2A 3SZRA 2F22A 5AGFA 4O79A 3ZIBA 1NU9C 3AQCA 3LEVA 4H54A 2YHSA 1XWJA 2OOCA 2BE5F 1UFBA 3HTKC 2HKVA 1VK5A 3GM3A 4XPWA 1M57C 1O3UA 3Q6MA 4LACB 4YL1A 3HLZA 4MVZA 5T3WA 3HNJA 5D92A 4HFFB 1Y4CA 1E2XA 1HY5A 2FAPB 1FR0A 2RSEB 1SYQA 3C8GB 2R7XA 3B0PA 1YLMA 3I5QA 3O10A 4G0HA 4ULVA 1JPNA 1MMAA 1DOWA 1O87A 3QMKA 1F1MA 5EGYA 5HV9A 3F47A 4RDAA 3UR3C 3V5ZA 4Q7CA 3UMIA 2LSEA 2VCCA 2WVNA 3G50A 1VYIA 3LS1A 2G62A 2UUIA 2A6EF 2VCAA 2XSEA 3RF3A 2C04A 2WVQA 3C8GA 1O5HA 1QLEC 1EI7A 4JKVA 3KMIA 1U89A 3EG9B 4JJFA 1G5ZA 3FDQA 4GYTA 5IY5C 4OD5A 1CPQA 3HNKA 4C3EA 3Q6NA 2X51A 2YEVA 1J8MF 1PD0A 4O6YA 2Q7RA 2KQ9A 1ZHTA 4NC3A 2P0NA 1OKKA 4PR9A 1IW7F 1D1BA 1TWAA 4J30B 3RIPA 4ZLDA 3JZ0A 4OINF 1FNTc 2A6HF 4E7SA 5CIVA 4XWJA 3T9OA 1MNEA 2J9VA 3NRHA 4MTOA 1N1CA 3B0UX 4JEBA 3K33A 3EG9A 4CS8A 1OR2A 1EKYA 3U3BA 1TFOB 1NLXA 3G4XA 3R7CA 1CGOA 3TOLA 1OW6A 1AVOB 2CYDA 1VLTA 3OA1A 5KYUB 3PMRA 1OW7A 2ZXOA 1ZU4A 5AC5A 2XS1A 2L6HA 2J7PA 1R4TA 1NSGB 4I44A 3E70C 4ONSA 3LESA 3DZAA 2W45A 2PNOA 2PX3A 3GORA 3JCUQ 3VF0A 3FOPA 4XLPF 1S7ZA 4K7BA 4O7GA 3U3FA 2NSFA 4R32A 2YRFA 5FCLA 2NUPB 1E84A 1C02A 1OCCC 5KYUA 3JSEO 2Y39A 4PFOA 3US6A 1OW8A 3IQ6A 1KNYA 2LD6A 1FTSA 2QUPA 2LK4A 2PFDA 2J9BA 1WTYA 2PBEA 4GQHA 1LIHA 2EPKX 1T6QA 1WOLA 2OKUA 4NTFA 2R7OA 2J9WA 5E3AA 4KNWA 2L81A 2Q3TA 1FFHA 2YZSA 3NKDA 3T6GB 5L3QA 3JYYA 1BZ4A 3DXJF 4PJNA 1T9KA 2R03A 2J8WA 3FXHA 4MVMA 4OIOF 3HNLA 3NKEA 1V54C 2L7AA 4WABA 2R7QA 2VH3A 5EK0A 5E2QA 5DQTA 3RQGA 1NFOA 4FX5A 1QKRA 3NYMA 4CBEA 3K1HA 4CDYA 5AC4A 2R7SA 2YL1A 2YKZA 3S9OA 4KC9A 3EHMA 3DI5A 2EPMX 4Z9JA 1A7DA 5L0DA 5A6KA 5KYXB 4LLEA 1YZCA 1H9TA 3LAYA 2YVKA 3BEHA 3U9MA 5BUOA 2HMZA 3ZTZA 4EUKB 4MVSA 3FHDA 3UMHA 3Q7LA 5JS5A 1WASA 4WGZA 1E83A 3UGPA 1T6IA 3U9JA 4AL0A 4P9FA 3TOMA 3V5XA 3DAFA 3NYLA 3JRMO 4JCHA 2XLWA 4YWQA 2NUTB 4YT5A 2DGJA 3TJ5A 1Q0KA 3X2QC 1V74B 2CGEA 1Q0GA 3L8IA 3ZC4A 2ZXPA 3RYLA 1DOVA 2AU5A 4ULWA 3EZIA 3ZQVA 3SEOA 4F4BA 3ZTMA 4I1MA 2GDCA 5L3VA 4DXWA 1G4US 2VB6A 3O6XA 4CIHA 4YJWA 2XLMA 5L0HA 2GAQA 1GM5A 2NUTA 1RXQA 4PJLA 2WL8A 2P1AA 1Q0MA 4K1OA 1T5OA 1FAPB 2GFHA 1Y6DA 2HSQA 4JIOA 2R7RA 3TULA 1QQ3A 1BR4A 2HZ8A 3JYHA 4O6NA 3JSZA 1T01A 3SNHA 1VTMP 1M2VB 3KH2A 3K66A 3O55A 2IXNA 2IBFA 3IPMO 2P6VA 1BDJB 4KBLA 4J32B 4MW8A 3UMKA 5A6BD 3SP1A 2JX0A 2UUHA 4ZLCA 4BJ5C 1ORYA 1GQAA 5E33A 2HMQA 1Z6AA 5JRAA 4CJGA 1LM3B 2XL8A 2L6FA 5B3SC 4G7HF 3NDBB 2Z15A 5B1BC 3LNRA 4NCQA 3WHNA 3CSKA 1M2VA 4LDQA 5KYNA 4MNDA 3EH1A 4BJ5A 2GWWA 3GWLA 4DRJB 5K0IA 3ZSUA 1M6TA 1I4YA 5DQZA 3C62A 3MFNA 4JVSA 4DRHB 3KKBA 2W4MA 2L6GA 2ZXRA 3C7JA 3FOOA 2ICWG 4E18A 1Z63A 2GA0A 2G3KA 4Q4ZF 4LERA 1M56C 5F5HA 3FVYA 2XM4A 2JPUA 2KSFA 2R7UA 4YK5A 2XL4A 1ZZPA 3KPHA 4MVUA 1MQVA 4E7ZA 2KK1A 1UG7A 4JTCB 2Y3GA 3ASNC 4XEFA 2OEVA 2Y69C 2HFIA 3W8HA 3S84A 4Z9IA 1WGWA 1YA7O 5B1AC 3DJUB 3DM5A 1YJGA 3TK0A 1LE4A 2OJED 3L34A 3VAYA 2CCYA 4CX9A 2R25A 3R2PA 4IB4A 1VYKA 3K6BA 1ZHZA 1U6HA 4MS2A 2DYRC 2KC3A 3RKOF 5JT4A 3A9CA 4P6IC 4G7OF 3H2VA 4MQ9F 2H7BA 5CI9A 3QZCA 3RVZA 2HUJA 3RQFA 1G4WR 5JVEA 3LLIA 3EJNA 2XLDA 4JCZA 5BQIA 4G78A 4FESA 1OCRC 1HMOA 2LP4A 3AG2C 2MWQA 2TMVP 2A68F 3AJMA 1ZW3A 3QW0A 4EKWA 3G4ZA 4C3DA 2HJ3A 1G8XA 3FMSA 4LDRA 3MX3A 1KTMA 2MYSA 2OCCC 1ZHXA 3B0VC 3AGTA 2R02A 1BBHA 3HNIA 4W8KA 4A4AA 1PD1A 1R5ID 3LNMB 2YL7A 2LFFA 2Q9AA 2YL3A 1Z5ZA 2J0WA 4U5DE 3BRJA 1YZAA 5JSLA 3O39A 3N24A 3M4BA 3RFYA 3GANA 3V5YA 1QPUA 3L0IA 4OD4A 4NQFA 4OIPF 1S05A 4EBBA 3U2LA 1NG1A 1CGNA 3S90A 1Z3IX 4Z9HA 2Q9CA 3AG3C 3Q7GA 3I4UA 4IARA 2PP4A 1JAFA 1H7IA 2A69F 3GM2A 3AG1C 1KU2A 2QNLA 2B0JA 2NPUA 4BJ6A 1AUEA 2QLAA 4IWBA 2ZPAA 1Z23A 1D0ZA 1A7VA 1RJ9B 3ABLC 3SXKA 3H2UA 4XPXA 4A2NB 3DMDA 3ZDLA 4PJJA 3LS0A 4WJ0A 2FGYA 4BJTA 5DS6A 1U0BB 3WG7C 4YT2A 4DRIB 1OCOC 1C17M 2H7OA 4WGYA 1OQCA 3EGDB 4NTAA 1WN0A 4CS7A 2H8AA 4D4XA 2OQMA 1ZVZA 2XRHA 1HMDA 1RJ9A 1TWCA 3E9VA 3WAQA 3DKAA 1VLSA 4JURI 4CS8C 3POVA 1CGME 4MTGA 3SYNA 1LKXA 2IXPA 3X1OA 2B0HA 3GEEA 3K7DA 2O9XA 2R7WA 1K40A 4IAQA 1GS9A 3AOUA 4J7YA 2E87A 4EWCA 3AGUA 2EILC 3EGDA 3LUTB 4E0HA 4BG0A 3EH2A 3K1IC 1TWGA 4AE4A 3C8ZA 4E17A 3C18A 1HE1A 1H6GA 2CNWD 1JOGA 2R05A 1L3PA 4M63A 4AK9A 2VCBA 4NY3A 3CQZA 1K04A 1YAUO 2DYSC 2XLVA 1SMYF 3GEHA 4PFPA 4IGGA 1TR2A 1YA9A 3K1IA 5DVWA 1D1CA 2DI3A 1NBBA 1MMNA 5FZTA 4JJGA 3UGOA 3F46A 4JZAA 2IYLD 2LIGA 2IM8A 1A0BA 3QVYA 3M1CB 4U5BE 4C3BA 3FAPB 1EQ1A 2D5RB 1YYJA 1W2WA 2KNHA 1JPJA 3JTLO 3DM9B 3KYIA 1H9GA 3N0TA 2W4BA 5T3TA 4OIRF 3ZWIA 2XLOA 1RKEA 3EZHA 4U9DA 3U5SA 4IRUA 2PX0A 4RD9A 3EPVA 3SXZA 4RBNA 4MVOA 1V55C 2YQYA 1MNDA 3ASOC 3JRTA 3QW1A 3EGXB 4MVRA 5COFA 1T6UA 2CW0F 3LEOA 3OWTA 3RW0A 4BEMJ 4ER9A 5E3CA 4EHPA 4FAPB 4YT8A 1ORJA 1D0YA 3W8IA 2HV6A 3NG1A 3VRCA 2BC5A 2WZLA 1L7CA 4D4NA 4QDLA 2FFHA 5DLJA 4C7OB 1E85A 1SZIA 2J45A 3C8GD 2M4EA 4MTFA 1HE9A 3DWWA 3KL4A 2Q9BA 4XTKA 1PV3A 4AL1A 4B6IA 2EIJC 3EGXA 3RQEA 5F5FA 5L0CA 3GWNA 1ORSC 1FMWA 3JT1A 1OCZC 4N6CA 1OKKD 4JTAB 4U9EA 2XS8A 1TWHA 1ZW2A 5TJ5E 3RH3A 3L1MA 2JD3A 4W8PA 4X0RA 1A41A 4C7OA 4JTDB 1Z7Qc 4JRZA 2RD9A 3LJBA 3IQCA 1ZHYA 2ETSA 2X0CA 5B3IA 1APCA 4QI2A 4CS9A 4N6HA 2WVOA 1ZHWA 1OR3A 3TJ6A 3S0XA 2YL0A 4P9TA 2QTVA 5KYYB 4CSAC 2XXAB 1TKNA 4YT4A 1WATA 1VOMA 3DJNB 2IXMA 2NSGA 2AWYA 4IAOA 3T6JA 4DBRA 5A6AA 3NYJA 1JR8A 2CDQA 2LFDA 3TQOA 5A6BA 4PJMA 2WZGA 2A0UA 1SR2A 2J7PD 3QVZA 3W2WA 1YYXA 4CSAA 2YLGA 4LDKA 2EINC 3VM6A 1XZPA 4DJ9A 3IHUA 3T6BA 2ZD9A 1NFNA 1JRAA 3LLKA 5KYYA 4H4KC 1VMAA 2OEXA 4PACA 2XXAA 2R7VA 4IJJA 4MVQA 3ATPA 4N4WA 3SXYA 4JEAA 3OEOA 2QY9A 1B68A 2KGOA 3EQLF 3M79A 4NTBA 1YARO 3HJCA 2Y3HA 2H7VC 3DD7A 4I3MA 5L0GA 1NZEA 1LVKA 1MMDA 3DAGA 4BEJA 1TQGA 1LS1A 5L0JA 4XQ1A 4YN0B 2V3CC 4BJ1A 3N2ZB 1IZMA 2M64A 1ZYRF 3U2MA 3M15A 3T4RA 5L0IA 1ZU5A 2WZFA 2YLIA 1ST6A 3L8JA 3M4CA 3NMKA 3W2VA 2J0XA 5DS5A 1TFKB 2C03A 3QTHA 4BJ6C 2OJQA 3J06A 1XZQA 3ZQYA 1C03A 2HS5A 1LE2A 2V26A 5CI8A 5A69A 3SXMA 1LPEA 3DE8A 5JUAA 5JLIA 1WWPA 4L6RA 4Q5SF 5JP7A 3VYWA 1HW1A 5F28E 4LLCA 4JW1A 4UDVA 2I15A 5COGA 2LCHA 3NMJA 2HV7A 4HFKB 3WODF 1VB5A 1M2OA
chains in the Genus database with same CATH topology
1G4WR 1HE1A 1R4TA 1G4US 1HY5A 1HE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G4W R;  1HE1 A;  1R4T A;  1G4U S;  1HY5 A;  1HE9 A; 
#chains in the Genus database with same CATH topology
 4U5E E;  4HEA J;  3ZG1 A;  3EFO B;  1FMV A;  4KNV A;  3MBG A;  3U8V A;  2EIK C;  2PF4 E;  3MYI A;  2YWA A;  3MYF A;  4AX2 A;  2A1D D;  3ZVR A;  4EBJ A;  3PDM P;  1RKC A;  2WB7 A;  2XLE A;  3ABM C;  3FAJ A;  3I5P A;  3NMI A;  4CJO A;  3PCV A;  3CAX A;  1LI5 A;  1QVX A;  2HSB A;  2AP3 A;  3B9Q A;  3DE9 A;  3HKK A;  4AE4 B;  4EBK A;  2J9U A;  2Y3B A;  5BQH A;  1EA8 A;  4XEV A;  1OXK A;  3EFO A;  4J7T A;  4DVY P;  4XEK A;  5HSW A;  2EPO A;  4U5H A;  1J8Y F;  2Y3D A;  4YL3 A;  2EPN A;  2YLD A;  2EIM C;  2NUP A;  4U5F E;  1E86 A;  3S28 A;  2R7T A;  1Q0D A;  4DBQ A;  5BQG A;  4BPM A;  2OU6 A;  3EHN A;  2VC9 A;  1QSP A;  2IXO A;  2VAS A;  1BR2 A;  2KJG A;  3ECS A;  2ASR A;  3UNG C;  1GGQ A;  2I8B A;  3C63 A;  1CPR A;  3MLG A;  4YL0 A;  5DS4 A;  4O6M A;  5EHH A;  4DVZ A;  4JC7 A;  2AWC A;  4PK4 A;  3ITF A;  2AVK A;  5KYW B;  4I1O B;  1FFT C;  2ZXW C;  2LQG A;  3ABK C;  4K0D A;  2J46 A;  1MMG A;  2KYH A;  1RKE B;  5L0F A;  2P7V A;  1D1A A;  4ANJ A;  1Q0F A;  2D4U A;  2IOQ A;  2A0B A;  3H65 A;  4U5C E;  1OXB A;  2XL6 A;  3GM1 A;  3W4Y A;  2R9R B;  1QZX A;  4MW3 A;  2Q00 A;  4U5G A;  1BR1 A;  1LI7 A;  4EIY A;  1V4A A;  2BL2 A;  4CDA A;  2HJM A;  2EPL X;  3GEI A;  5KYW A;  1D0X A;  3GOD A;  3CEX A;  5T1D B;  5GPG B;  3S29 A;  3IQ5 A;  4KI2 A;  2XM0 A;  5KYX A;  3AQB A;  3IEE A;  3U0C A;  2Q4F A;  2L9J A;  2P61 A;  4GEH A;  4QI0 A;  1A7E A;  1I5N A;  1SF8 A;  5A6J A;  4E0I A;  3B71 A;  4XPY A;  256B A;  1PCX A;  1HW2 A;  1YDI A;  5D91 A;  4CIP A;  3B29 A;  1I4Z A;  2G3V A;  2NG1 A;  2QE9 A;  1RMV A;  1LS4 A;  2MHR A;  4HE8 D;  3V7O A;  3KYJ A;  4DOZ A;  1AEP A;  4OIQ F;  3RVY A;  3A11 A;  4CDV A;  3U8P A;  3CZ6 A;  4G7Z F;  2W9Y A;  3TD7 A;  1K05 A;  1NU7 D;  3AG4 C;  3PHF 2;  2DB4 A;  4N06 A;  4XLN F;  4FWV A;  2CNW A;  1YVI A;  2KW3 C;  2XLH A;  3S27 A;  4JE9 A;  5COM A;  4CS9 C;  1JMW A;  3IQT A;  1RCP A;  2OG2 A;  3SZR A;  2F22 A;  5AGF A;  4O79 A;  3ZIB A;  1NU9 C;  3AQC A;  3LEV A;  4H54 A;  2YHS A;  1XWJ A;  2OOC A;  2BE5 F;  1UFB A;  3HTK C;  2HKV A;  1VK5 A;  3GM3 A;  4XPW A;  1M57 C;  1O3U A;  3Q6M A;  4LAC B;  4YL1 A;  3HLZ A;  4MVZ A;  5T3W A;  3HNJ A;  5D92 A;  4HFF B;  1Y4C A;  1E2X A;  1HY5 A;  2FAP B;  1FR0 A;  2RSE B;  1SYQ A;  3C8G B;  2R7X A;  3B0P A;  1YLM A;  3I5Q A;  3O10 A;  4G0H A;  4ULV A;  1JPN A;  1MMA A;  1DOW A;  1O87 A;  3QMK A;  1F1M A;  5EGY A;  5HV9 A;  3F47 A;  4RDA A;  3UR3 C;  3V5Z A;  4Q7C A;  3UMI A;  2LSE A;  2VCC A;  2WVN A;  3G50 A;  1VYI A;  3LS1 A;  2G62 A;  2UUI A;  2A6E F;  2VCA A;  2XSE A;  3RF3 A;  2C04 A;  2WVQ A;  3C8G A;  1O5H A;  1QLE C;  1EI7 A;  4JKV A;  3KMI A;  1U89 A;  3EG9 B;  4JJF A;  1G5Z A;  3FDQ A;  4GYT A;  5IY5 C;  4OD5 A;  1CPQ A;  3HNK A;  4C3E A;  3Q6N A;  2X51 A;  2YEV A;  1J8M F;  1PD0 A;  4O6Y A;  2Q7R A;  2KQ9 A;  1ZHT A;  4NC3 A;  2P0N A;  1OKK A;  4PR9 A;  1IW7 F;  1D1B A;  1TWA A;  4J30 B;  3RIP A;  4ZLD A;  3JZ0 A;  4OIN F;  1FNT c;  2A6H F;  4E7S A;  5CIV A;  4XWJ A;  3T9O A;  1MNE A;  2J9V A;  3NRH A;  4MTO A;  1N1C A;  3B0U X;  4JEB A;  3K33 A;  3EG9 A;  4CS8 A;  1OR2 A;  1EKY A;  3U3B A;  1TFO B;  1NLX A;  3G4X A;  3R7C A;  1CGO A;  3TOL A;  1OW6 A;  1AVO B;  2CYD A;  1VLT A;  3OA1 A;  5KYU B;  3PMR A;  1OW7 A;  2ZXO A;  1ZU4 A;  5AC5 A;  2XS1 A;  2L6H A;  2J7P A;  1R4T A;  1NSG B;  4I44 A;  3E70 C;  4ONS A;  3LES A;  3DZA A;  2W45 A;  2PNO A;  2PX3 A;  3GOR A;  3JCU Q;  3VF0 A;  3FOP A;  4XLP F;  1S7Z A;  4K7B A;  4O7G A;  3U3F A;  2NSF A;  4R32 A;  2YRF A;  5FCL A;  2NUP B;  1E84 A;  1C02 A;  1OCC C;  5KYU A;  3JSE O;  2Y39 A;  4PFO A;  3US6 A;  1OW8 A;  3IQ6 A;  1KNY A;  2LD6 A;  1FTS A;  2QUP A;  2LK4 A;  2PFD A;  2J9B A;  1WTY A;  2PBE A;  4GQH A;  1LIH A;  2EPK X;  1T6Q A;  1WOL A;  2OKU A;  4NTF A;  2R7O A;  2J9W A;  5E3A A;  4KNW A;  2L81 A;  2Q3T A;  1FFH A;  2YZS A;  3NKD A;  3T6G B;  5L3Q A;  3JYY A;  1BZ4 A;  3DXJ F;  4PJN A;  1T9K A;  2R03 A;  2J8W A;  3FXH A;  4MVM A;  4OIO F;  3HNL A;  3NKE A;  1V54 C;  2L7A A;  4WAB A;  2R7Q A;  2VH3 A;  5EK0 A;  5E2Q A;  5DQT A;  3RQG A;  1NFO A;  4FX5 A;  1QKR A;  3NYM A;  4CBE A;  3K1H A;  4CDY A;  5AC4 A;  2R7S A;  2YL1 A;  2YKZ A;  3S9O A;  4KC9 A;  3EHM A;  3DI5 A;  2EPM X;  4Z9J A;  1A7D A;  5L0D A;  5A6K A;  5KYX B;  4LLE A;  1YZC A;  1H9T A;  3LAY A;  2YVK A;  3BEH A;  3U9M A;  5BUO A;  2HMZ A;  3ZTZ A;  4EUK B;  4MVS A;  3FHD A;  3UMH A;  3Q7L A;  5JS5 A;  1WAS A;  4WGZ A;  1E83 A;  3UGP A;  1T6I A;  3U9J A;  4AL0 A;  4P9F A;  3TOM A;  3V5X A;  3DAF A;  3NYL A;  3JRM O;  4JCH A;  2XLW A;  4YWQ A;  2NUT B;  4YT5 A;  2DGJ A;  3TJ5 A;  1Q0K A;  3X2Q C;  1V74 B;  2CGE A;  1Q0G A;  3L8I A;  3ZC4 A;  2ZXP A;  3RYL A;  1DOV A;  2AU5 A;  4ULW A;  3EZI A;  3ZQV A;  3SEO A;  4F4B A;  3ZTM A;  4I1M A;  2GDC A;  5L3V A;  4DXW A;  1G4U S;  2VB6 A;  3O6X A;  4CIH A;  4YJW A;  2XLM A;  5L0H A;  2GAQ A;  1GM5 A;  2NUT A;  1RXQ A;  4PJL A;  2WL8 A;  2P1A A;  1Q0M A;  4K1O A;  1T5O A;  1FAP B;  2GFH A;  1Y6D A;  2HSQ A;  4JIO A;  2R7R A;  3TUL A;  1QQ3 A;  1BR4 A;  2HZ8 A;  3JYH A;  4O6N A;  3JSZ A;  1T01 A;  3SNH A;  1VTM P;  1M2V B;  3KH2 A;  3K66 A;  3O55 A;  2IXN A;  2IBF A;  3IPM O;  2P6V A;  1BDJ B;  4KBL A;  4J32 B;  4MW8 A;  3UMK A;  5A6B D;  3SP1 A;  2JX0 A;  2UUH A;  4ZLC A;  4BJ5 C;  1ORY A;  1GQA A;  5E33 A;  2HMQ A;  1Z6A A;  5JRA A;  4CJG A;  1LM3 B;  2XL8 A;  2L6F A;  5B3S C;  4G7H F;  3NDB B;  2Z15 A;  5B1B C;  3LNR A;  4NCQ A;  3WHN A;  3CSK A;  1M2V A;  4LDQ A;  5KYN A;  4MND A;  3EH1 A;  4BJ5 A;  2GWW A;  3GWL A;  4DRJ B;  5K0I A;  3ZSU A;  1M6T A;  1I4Y A;  5DQZ A;  3C62 A;  3MFN A;  4JVS A;  4DRH B;  3KKB A;  2W4M A;  2L6G A;  2ZXR A;  3C7J A;  3FOO A;  2ICW G;  4E18 A;  1Z63 A;  2GA0 A;  2G3K A;  4Q4Z F;  4LER A;  1M56 C;  5F5H A;  3FVY A;  2XM4 A;  2JPU A;  2KSF A;  2R7U A;  4YK5 A;  2XL4 A;  1ZZP A;  3KPH A;  4MVU A;  1MQV A;  4E7Z A;  2KK1 A;  1UG7 A;  4JTC B;  2Y3G A;  3ASN C;  4XEF A;  2OEV A;  2Y69 C;  2HFI A;  3W8H A;  3S84 A;  4Z9I A;  1WGW A;  1YA7 O;  5B1A C;  3DJU B;  3DM5 A;  1YJG A;  3TK0 A;  1LE4 A;  2OJE D;  3L34 A;  3VAY A;  2CCY A;  4CX9 A;  2R25 A;  3R2P A;  4IB4 A;  1VYK A;  3K6B A;  1ZHZ A;  1U6H A;  4MS2 A;  2DYR C;  2KC3 A;  3RKO F;  5JT4 A;  3A9C A;  4P6I C;  4G7O F;  3H2V A;  4MQ9 F;  2H7B A;  5CI9 A;  3QZC A;  3RVZ A;  2HUJ A;  3RQF A;  1G4W R;  5JVE A;  3LLI A;  3EJN A;  2XLD A;  4JCZ A;  5BQI A;  4G78 A;  4FES A;  1OCR C;  1HMO A;  2LP4 A;  3AG2 C;  2MWQ A;  2TMV P;  2A68 F;  3AJM A;  1ZW3 A;  3QW0 A;  4EKW A;  3G4Z A;  4C3D A;  2HJ3 A;  1G8X A;  3FMS A;  4LDR A;  3MX3 A;  1KTM A;  2MYS A;  2OCC C;  1ZHX A;  3B0V C;  3AGT A;  2R02 A;  1BBH A;  3HNI A;  4W8K A;  4A4A A;  1PD1 A;  1R5I D;  3LNM B;  2YL7 A;  2LFF A;  2Q9A A;  2YL3 A;  1Z5Z A;  2J0W A;  4U5D E;  3BRJ A;  1YZA A;  5JSL A;  3O39 A;  3N24 A;  3M4B A;  3RFY A;  3GAN A;  3V5Y A;  1QPU A;  3L0I A;  4OD4 A;  4NQF A;  4OIP F;  1S05 A;  4EBB A;  3U2L A;  1NG1 A;  1CGN A;  3S90 A;  1Z3I X;  4Z9H A;  2Q9C A;  3AG3 C;  3Q7G A;  3I4U A;  4IAR A;  2PP4 A;  1JAF A;  1H7I A;  2A69 F;  3GM2 A;  3AG1 C;  1KU2 A;  2QNL A;  2B0J A;  2NPU A;  4BJ6 A;  1AUE A;  2QLA A;  4IWB A;  2ZPA A;  1Z23 A;  1D0Z A;  1A7V A;  1RJ9 B;  3ABL C;  3SXK A;  3H2U A;  4XPX A;  4A2N B;  3DMD A;  3ZDL A;  4PJJ A;  3LS0 A;  4WJ0 A;  2FGY A;  4BJT A;  5DS6 A;  1U0B B;  3WG7 C;  4YT2 A;  4DRI B;  1OCO C;  1C17 M;  2H7O A;  4WGY A;  1OQC A;  3EGD B;  4NTA A;  1WN0 A;  4CS7 A;  2H8A A;  4D4X A;  2OQM A;  1ZVZ A;  2XRH A;  1HMD A;  1RJ9 A;  1TWC A;  3E9V A;  3WAQ A;  3DKA A;  1VLS A;  4JUR I;  4CS8 C;  3POV A;  1CGM E;  4MTG A;  3SYN A;  1LKX A;  2IXP A;  3X1O A;  2B0H A;  3GEE A;  3K7D A;  2O9X A;  2R7W A;  1K40 A;  4IAQ A;  1GS9 A;  3AOU A;  4J7Y A;  2E87 A;  4EWC A;  3AGU A;  2EIL C;  3EGD A;  3LUT B;  4E0H A;  4BG0 A;  3EH2 A;  3K1I C;  1TWG A;  4AE4 A;  3C8Z A;  4E17 A;  3C18 A;  1HE1 A;  1H6G A;  2CNW D;  1JOG A;  2R05 A;  1L3P A;  4M63 A;  4AK9 A;  2VCB A;  4NY3 A;  3CQZ A;  1K04 A;  1YAU O;  2DYS C;  2XLV A;  1SMY F;  3GEH A;  4PFP A;  4IGG A;  1TR2 A;  1YA9 A;  3K1I A;  5DVW A;  1D1C A;  2DI3 A;  1NBB A;  1MMN A;  5FZT A;  4JJG A;  3UGO A;  3F46 A;  4JZA A;  2IYL D;  2LIG A;  2IM8 A;  1A0B A;  3QVY A;  3M1C B;  4U5B E;  4C3B A;  3FAP B;  1EQ1 A;  2D5R B;  1YYJ A;  1W2W A;  2KNH A;  1JPJ A;  3JTL O;  3DM9 B;  3KYI A;  1H9G A;  3N0T A;  2W4B A;  5T3T A;  4OIR F;  3ZWI A;  2XLO A;  1RKE A;  3EZH A;  4U9D A;  3U5S A;  4IRU A;  2PX0 A;  4RD9 A;  3EPV A;  3SXZ A;  4RBN A;  4MVO A;  1V55 C;  2YQY A;  1MND A;  3ASO C;  3JRT A;  3QW1 A;  3EGX B;  4MVR A;  5COF A;  1T6U A;  2CW0 F;  3LEO A;  3OWT A;  3RW0 A;  4BEM J;  4ER9 A;  5E3C A;  4EHP A;  4FAP B;  4YT8 A;  1ORJ A;  1D0Y A;  3W8I A;  2HV6 A;  3NG1 A;  3VRC A;  2BC5 A;  2WZL A;  1L7C A;  4D4N A;  4QDL A;  2FFH A;  5DLJ A;  4C7O B;  1E85 A;  1SZI A;  2J45 A;  3C8G D;  2M4E A;  4MTF A;  1HE9 A;  3DWW A;  3KL4 A;  2Q9B A;  4XTK A;  1PV3 A;  4AL1 A;  4B6I A;  2EIJ C;  3EGX A;  3RQE A;  5F5F A;  5L0C A;  3GWN A;  1ORS C;  1FMW A;  3JT1 A;  1OCZ C;  4N6C A;  1OKK D;  4JTA B;  4U9E A;  2XS8 A;  1TWH A;  1ZW2 A;  5TJ5 E;  3RH3 A;  3L1M A;  2JD3 A;  4W8P A;  4X0R A;  1A41 A;  4C7O A;  4JTD B;  1Z7Q c;  4JRZ A;  2RD9 A;  3LJB A;  3IQC A;  1ZHY A;  2ETS A;  2X0C A;  5B3I A;  1APC A;  4QI2 A;  4CS9 A;  4N6H A;  2WVO A;  1ZHW A;  1OR3 A;  3TJ6 A;  3S0X A;  2YL0 A;  4P9T A;  2QTV A;  5KYY B;  4CSA C;  2XXA B;  1TKN A;  4YT4 A;  1WAT A;  1VOM A;  3DJN B;  2IXM A;  2NSG A;  2AWY A;  4IAO A;  3T6J A;  4DBR A;  5A6A A;  3NYJ A;  1JR8 A;  2CDQ A;  2LFD A;  3TQO A;  5A6B A;  4PJM A;  2WZG A;  2A0U A;  1SR2 A;  2J7P D;  3QVZ A;  3W2W A;  1YYX A;  4CSA A;  2YLG A;  4LDK A;  2EIN C;  3VM6 A;  1XZP A;  4DJ9 A;  3IHU A;  3T6B A;  2ZD9 A;  1NFN A;  1JRA A;  3LLK A;  5KYY A;  4H4K C;  1VMA A;  2OEX A;  4PAC A;  2XXA A;  2R7V A;  4IJJ A;  4MVQ A;  3ATP A;  4N4W A;  3SXY A;  4JEA A;  3OEO A;  2QY9 A;  1B68 A;  2KGO A;  3EQL F;  3M79 A;  4NTB A;  1YAR O;  3HJC A;  2Y3H A;  2H7V C;  3DD7 A;  4I3M A;  5L0G A;  1NZE A;  1LVK A;  1MMD A;  3DAG A;  4BEJ A;  1TQG A;  1LS1 A;  5L0J A;  4XQ1 A;  4YN0 B;  2V3C C;  4BJ1 A;  3N2Z B;  1IZM A;  2M64 A;  1ZYR F;  3U2M A;  3M15 A;  3T4R A;  5L0I A;  1ZU5 A;  2WZF A;  2YLI A;  1ST6 A;  3L8J A;  3M4C A;  3NMK A;  3W2V A;  2J0X A;  5DS5 A;  1TFK B;  2C03 A;  3QTH A;  4BJ6 C;  2OJQ A;  3J06 A;  1XZQ A;  3ZQY A;  1C03 A;  2HS5 A;  1LE2 A;  2V26 A;  5CI8 A;  5A69 A;  3SXM A;  1LPE A;  3DE8 A;  5JUA A;  5JLI A;  1WWP A;  4L6R A;  4Q5S F;  5JP7 A;  3VYW A;  1HW1 A;  5F28 E;  4LLC A;  4JW1 A;  4UDV A;  2I15 A;  5COG A;  2LCH A;  3NMJ A;  2HV7 A;  4HFK B;  3WOD F;  1VB5 A;  1M2O A; 
#chains in the Genus database with same CATH homology
 1G4W R;  1HE1 A;  1R4T A;  1G4U S;  1HY5 A;  1HE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...