1HY5A

Crystal structure of the catalytic domain of yope-yersinia pestis gap effector protein.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
120
structure length
120
Chain Sequence
TSFSDSIKQLAAETLPKYMQQLNSLDAEMLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTIGGAASAYVASGVDLTQAANEIKGLAQQMQKLLSLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Toxin
molecule keywords YERSINIA PESTIS VIRULENCE PROTEIN YOPE
publication title Crystal structure of the Yersinia pestis GTPase activator YopE.
pubmed doi rcsb
source organism Yersinia pestis
total genus 37
structure length 120
sequence length 120
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03545 YopE Yersinia virulence determinant (YopE)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.260 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Virulence factor YopE uncharacterised domain 1hy5A00
1HE1A 1HE9A 1R4TA 1G4US 1G4WR 1HY5A
chains in the Genus database with same CATH superfamily
1I5NA 3RFYA 4OIQF 3ITFA 2YLIA 1OCOC 4DOZA 5BUOA 1ZHZA 1TWGA 3FMSA 1RMVA 3UNGC 3SZRA 1LPEA 4OINF 5L0IA 3PHF2 2L6HA 4KBLA 4XEKA 2R02A 2MHRA 1JRAA 2TMVP 5DS6A 5COGA 4WABA 1K04A 2H7OA 4D4XA 3AQBA 2YVKA 5EGYA 4ER9A 1VYIA 5F5HA 2CW0F 2GFHA 3E70C 2QLAA 4E7SA 5KYNA 3QVZA 1VTMP 2XRHA 2XM4A 3LS1A 3PMRA 1D0XA 1OW7A 4C3EA 1R4TA 2XLEA 3JZ0A 4IWBA 2XSEA 3KL4A 1PD1A 5HV9A 2OG2A 2L7AA 5FZTA 2KGOA 3SEOA 1G4US 1EA8A 5JRAA 3T4RA 4MVRA 1Z6AA 2YL0A 3U2LA 1E2XA 4MVQA 1FTSA 1G5ZA 3K1IC 1ZHTA 1OKKD 4YT4A 3B0PA 1JPNA 2HV7A 1ORSC 2PP4A 3MLGA 2XLVA 2YZSA 1F1MA 2HMQA 2YLGA 4PJJA 2ETSA 2IM8A 3KKBA 1WOLA 4NTFA 4U5GA 4RBNA 3I5QA 2KW3C 3EPVA 2X51A 3Q6MA 3VYWA 3MBGA 4IAQA 3WG7C 4DRJB 3TULA 2NPUA 2G3KA 4P6IC 3C62A 2WZFA 3KYJA 1S7ZA 1SF8A 3NMJA 1TWAA 1ZHYA 4O6MA 4DBRA 1ST6A 4JE9A 2C04A 2NSGA 4I1OB 4Q7CA 3W2VA 5B3IA 2J7PA 3RYLA 4ULWA 1HE1A 1RKEB 1WTYA 3HNIA 4LACB 5L0HA 1JMWA 1TFOB 2IYLD 2XLOA 4JTAB 5KYWB 3EHMA 3S90A 2XXAB 2YHSA 1FFTC 2VC9A 4PR9A 4XPWA 3ABLC 4YN0B 3EGXB 2LFDA 3FAPB 4LLCA 3CAXA 4KI2A 1QKRA 1Y4CA 1FR0A 1C17M 2B0JA 4EWCA 2B0HA 1FMVA 1RKEA 5JP7A 1KTMA 1FMWA 1L3PA 3EH1A 3NMIA 5D92A 1KNYA 5KYWA 2XXAA 3GEHA 1YZAA 1HMDA 2XM0A 5KYXB 5EHHA 3B0VC 3GORA 1Q0MA 1NU9C 3LLKA 3EGXA 2HUJA 3NYMA 1RXQA 3DKAA 3SYNA 3WAQA 2W9YA 4C3BA 4BJ5C 3UGOA 4NC3A 2WVQA 3G50A 2P0NA 1H9TA 2A6EF 3UMHA 1V54C 2Y3DA 4B6IA 3HLZA 4E17A 4CIPA 2ASRA 4DXWA 2KK1A 2XL4A 2EPKX 1YJGA 3JSZA 5KYXA 3M1CB 4HEAJ 2A0UA 4MTGA 1K40A 2XLHA 2WB7A 1HMOA 4G7ZF 3OEOA 5B1AC 3ZIBA 4AL1A 1G8XA 1L7CA 1YAUO 2AVKA 4O6NA 1KU2A 2LIGA 2OEVA 1Z5ZA 1NZEA 2A68F 5AC4A 1EI7A 4H4KC 3RQFA 3SXZA 1UG7A 2J9WA 3EZHA 4U5HA 2Z15A 256BA 1A41A 1OXKA 1QPUA 3DAFA 3IHUA 4JC7A 3NMKA 4QDLA 1E83A 2KC3A 4XEVA 4MVUA 3ZTZA 1CPQA 1VMAA 4XWJA 2QNLA 1APCA 1U0BB 5L0FA 4NCQA 3CSKA 4P9FA 1MMNA 1Q0KA 2D5RB 2OQMA 3KYIA 4DVYP 3AG3C 4JCHA 3RIPA 1T01A 2PNOA 4U9DA 3ZSUA 2P6VA 4J7YA 1YA7O 5JLIA 3G4ZA 1GGQA 3B0UX 2KJGA 5L0DA 3W4YA 3QZCA 3EG9B 2HV6A 2HMZA 3S0XA 3NDBB 2LD6A 3I4UA 3RH3A 4DBQA 3LS0A 1PV3A 2QY9A 3U8PA 3H2UA 2ZPAA 3M15A 2XS1A 2CNWD 1DOWA 2Y3GA 3LLIA 5D91A 3C18A 1H6GA 1YYXA 3G4XA 4OIRF 2LK4A 4BJ6C 2VH3A 4AK9A 5E2QA 4CDYA 3EG9A 2JX0A 3C8GD 5A69A 3S27A 5CIVA 4E7ZA 1QSPA 2L9JA 5DVWA 1RCPA 2OEXA 3AGUA 3K66A 3E9VA 3NRHA 2FAPB 3TQOA 2R25A 3T6BA 3LUTB 1Q0DA 3W2WA 5DQTA 1BZ4A 4AL0A 2Q7RA 1C02A 2OOCA 1H9GA 4G7HF 3PCVA 5HSWA 2XS8A 3ECSA 5DQZA 2M64A 4ZLCA 2IXOA 1S05A 4MQ9F 1LE2A 3NG1A 5K0IA 1V4AA 5BQHA 1NSGB 3T6JA 2ZXWC 4EIYA 1VK5A 4PJMA 3U9JA 4JJGA 3EHNA 3EGDB 4JJFA 5L0GA 3GWLA 3DM5A 3J06A 1A7EA 1O5HA 1O3UA 3BRJA 3H65A 2LSEA 2GAQA 3JTLO 3TJ6A 1Q0FA 1IZMA 2EIJC 4FWVA 3DWWA 4F4BA 2GDCA 2EPMX 5L0JA 3LNMB 4OD5A 3TJ5A 2R7RA 3WHNA 1M57C 3EGDA 3O39A 4M63A 5CI8A 3NYJA 3C7JA 4LDRA 4OIPF 5E3AA 3QW1A 2XLMA 4JURI 2HSQA 4IARA 1NLXA 3B9QA 1U89A 1EKYA 1N1CA 2HS5A 1C03A 4E18A 4YWQA 1T6UA 1WASA 1YLMA 2J9UA 3DXJF 5T1DB 1YYJA 3IQTA 4XLNF 1DOVA 2PX0A 1ZZPA 2OJQA 5A6KA 3DI5A 5BQIA 3U2MA 4PFOA 3LEVA 3K7DA 4MS2A 4U5EE 3RVZA 1Y6DA 2IOQA 2VCAA 3K33A 2KSFA 3PDMP 2V3CC 4JKVA 1GS9A 3B71A 3MFNA 1M2OA 2V26A 3X1OA 3DZAA 4RD9A 3A9CA 4IJJA 1LS4A 3GEEA 3N2ZB 2UUIA 3N24A 4W8PA 2NG1A 2YL3A 1GM5A 2BC5A 3JT1A 3Q7GA 3TOLA 2R7XA 3POVA 5A6JA 2NUTB 3GANA 4EHPA 3UGPA 3DE8A 2ZXOA 1NU7D 3U9MA 4Q4ZF 3F46A 2HFIA 3TOMA 1BR1A 4JVSA 3U3FA 1OW8A 4MNDA 2HZ8A 1LS1A 1RKCA 2VCBA 2QTVA 3HNLA 3N0TA 4A4AA 5B1BC 3V5XA 3O10A 1Z3IX 3ZDLA 1TR2A 2GA0A 1SZIA 4YL1A 2NUTA 1MNDA 3AG2C 4QI0A 2Q4FA 4C3DA 1WATA 2XLWA 1ZHWA 2W45A 2WL8A 3L1MA 3S28A 4UDVA 2G3VA 2PX3A 1OW6A 1CGOA 2IXPA 2ZXPA 3K1HA 3R2PA 3KH2A 3M4CA 4MVMA 5T3WA 3VAYA 2YL7A 2R7QA 1Q0GA 4K1OA 3ZTMA 4MW3A 2QE9A 4Z9JA 1HY5A 3O55A 1A7DA 4LERA 4U9EA 1ORYA 1QZXA 2BE5F 4CX9A 4EBBA 1OR2A 2PBEA 2PF4E 4JRZA 1HW2A 4BJ1A 4CDVA 3I5PA 3US6A 4CS9A 1D1BA 2LFFA 1WGWA 2Q9AA 1D0ZA 3HNJA 5BQGA 3TK0A 2AU5A 2HJ3A 4MVSA 4GYTA 1ZVZA 3L8IA 3M4BA 1TQGA 2A69F 2J8WA 3SXYA 3Q7LA 4BJ6A 1PD0A 4XLPF 2IXNA 1CPRA 5L3VA 4JTCB 1G4WR 4BJTA 4CS7A 4FAPB 3RW0A 4N6CA 3GM1A 2I8BA 1O87A 2F22A 3L0IA 4RDAA 3FXHA 2ZXRA 1YA9A 3T9OA 2KQ9A 2YRFA 4Q5SF 3UMKA 1OKKA 2L6FA 1MMDA 3C8ZA 1BR2A 2CYDA 2DI3A 2WZLA 3CZ6A 3LAYA 2J45A 4O6YA 3HNKA 4CBEA 1JR8A 3H2VA 5AGFA 1D0YA 2AWCA 1R5ID 3O6XA 2A0BA 4G78A 4N06A 3FOPA 4EBKA 5DS4A 5L3QA 3ZWIA 2I15A 2J9VA 4CSAA 4NY3A 1GQAA 4BPMA 1OCZC 3SXMA 1LKXA 1A7VA 4FESA 4IGGA 3DJNB 2A6HF 2LCHA 4KNVA 3S29A 3RQEA 3JYHA 3ABKC 4K0DA 4U5BE 2EPOA 5JT4A 2J7PD 2JPUA 4PJLA 2H8AA 4H54A 2IXMA 4CJOA 2FGYA 5E3CA 4ZLDA 4G7OF 1YARO 1MNEA 1T6IA 1XWJA 2AWYA 2EIMC 3DJUB 2E87A 2HKVA 1LE4A 1SMYF 2H7VC 5A6AA 3K6BA 4XTKA 1LI7A 3U0CA 3GWNA 2DYRC 5L0CA 3DE9A 1TWHA 1BR4A 1TWCA 3ZC4A 2P7VA 2H7BA 4JCZA 1WN0A 4MVZA 2KYHA 3JYYA 4MVOA 2X0CA 1JAFA 1SR2A 3JCUQ 1B68A 1FNTc 5EK0A 3NKEA 2ICWG 1VYKA 2AP3A 1NG1A 3A11A 3EH2A 1ZU4A 4XEFA 2L81A 1OCCC 1NBBA 1H7IA 1JOGA 4NTBA 1LM3B 4PK4A 4EKWA 2XLDA 1MQVA 2R7OA 2YEVA 1J8MF 3V5YA 4CS8A 1V74B 4GQHA 4J30B 4YT8A 2R7TA 1W2WA 4J7TA 2G62A 4OIOF 3FVYA 2M4EA 3Q6NA 1OR3A 2Q00A 1Z23A 3ZG1A 4U5DE 4YJWA 3HJCA 1RJ9A 2Q9BA 3CEXA 3DAGA 4U5FE 3SP1A 4DRHB 5AC5A 3LNRA 2PFDA 2R03A 3NKDA 4O7GA 2D4UA 3QW0A 3U3BA 3AG4C 3AQCA 3AG1C 4X0RA 5COMA 4EBJA 3L34A 2VASA 4CS9C 2HJMA 1ZYRF 3ZVRA 4HE8D 2NUPB 1U6HA 2P1AA 2W4MA 4DJ9A 3EFOB 3ABMC 3LESA 4KC9A 3RKOF 4A2NB 3S84A 1AUEA 4N4WA 1K05A 4GEHA 3JRTA 4J32B 1VLTA 3MYIA 1ZW3A 2A1DD 2O9XA 3IQ5A 1ZHXA 3F47A 4E0IA 2ZD9A 3MX3A 1TFKB 2MYSA 2NUPA 2R05A 4ONSA 4YL0A 5COFA 3EFOA 2YLDA 1M2VB 1NFOA 2RD9A 4FX5A 3LJBA 3B29A 3KMIA 4JTDB 1BBHA 4C7OB 3OA1A 1D1AA 3C8GB 1SYQA 3L8JA 5B3SC 2P61A 4JZAA 4DVZA 2QUPA 1QLEC 1TKNA 4ULVA 2VB6A 2L6GA 3JRMO 1XZPA 2Y39A 3GM3A 1M56C 2WZGA 2DYSC 3ATPA 3OWTA 4LDQA 2EIKC 2CNWA 4YT5A 4D4NA 4OD4A 2DGJA 2YWAA 2GWWA 4WGYA 2LP4A 4CDAA 4E0HA 1MMGA 1FFHA 1M2VA 2R9RB 4DRIB 1WWPA 2OKUA 4HFFB 5A6BD 1AEPA 4IAOA 3M79A 3C8GA 1E85A 4CSAC 4QI2A 4ANJA 1BDJB 3S9OA 4CIHA 2J46A 4PFPA 3CQZA 5JSLA 2LQGA 2DB4A 1QVXA 4C7OA 1YVIA 3AOUA 1AVOB 1HW1A 5T3TA 2FFHA 1T9KA 4LDKA 3W8HA 2CCYA 4XQ1A 2XL8A 2UUHA 3EQLF 4PJNA 1CGNA 2OJED 4IRUA 4PACA 2RSEB 1T6QA 4XPYA 2KNHA 2R7VA 4BEMJ 4P9TA 1LVKA 1HE9A 1CGME 1VOMA 2C03A 3IPMO 1D1CA 4IB4A 4AX2A 2J9BA 3DM9B 4R32A 1ORJA 2EINC 3U5SA 3ZQVA 5DLJA 1I4YA 1YZCA 2J0WA 1A0BA 1XZQA 1NFNA 2HSBA 1I4ZA 2Q9CA 3V7OA 2JD3A 1PCXA 2EILC 4KNWA 3W8IA 1V55C 3ASNC 4I3MA 3FDQA 4G0HA 4AE4B 3X2QC 3FAJA 4YL3A 3DMDA 1Z63A 3MYFA 3HTKC 2OU6A 3SNHA 3VF0A 5JVEA 5JUAA 1VLSA 3FHDA 5IY5C 3K1IA 5F28E 1E84A 2R7SA 4BG0A 3QMKA 1ZU5A 2XL6A 1UFBA 1OCRC 3JSEO 4W8KA 1OXBA 4N6HA 4NTAA 2J0XA 3QVYA 4Z9HA 3LEOA 1LI5A 4L6RA 2R7WA 4CS8C 2WVOA 3VM6A 3V5ZA 4AE4A 3ZQYA 2YKZA 4I1MA 1EQ1A 2EPLX 2OCCC 3TD7A 5F5FA 3EZIA 3WODF 4I44A 4MTOA 4CJGA 4K7BA 3IQ6A 5TJ5E 4JIOA 3C63A 2CGEA 2Y69C 3EJNA 4U5CE 1LIHA 1VB5A 4YT2A 2W4BA 2EPNA 3AJMA 3DD7A 3GM2A 4EUKB 1OQCA 5KYYB 3HKKA 4JW1A 5DS5A 2NSFA 1IW7F 4LLEA 3GODA 4JEBA 2BL2A 2CDQA 4O79A 3UR3C 2YL1A 4WJ0A 3SXKA 3U8VA 1E86A 3NYLA 4XPXA 5JS5A 3GEIA 4MTFA 5E33A 1MMAA 5FCLA 2Y3BA 3KPHA 4HFKB 5KYUB 1QQ3A 4NQFA 3T6GB 1M6TA 2MWQA 3BEHA 1ZW2A 4JEAA 1T5OA 3RQGA 3IEEA 5KYYA 1FAPB 2YQYA 1RJ9B 2VCCA 4BJ5A 3IQCA 2IBFA 2Y3HA 4Z9IA 5GPGB 3RF3A 3VRCA 5A6BA 2R7UA 4BEJA 3R7CA 1JPJA 2Q3TA 2WVNA 3QTHA 4WGZA 3RVYA 5KYUA 1Z7Qc 3FOOA 1J8YF 4YK5A 3UMIA 4MW8A 3ASOC 5CI9A 3AGTA 1YDIA
chains in the Genus database with same CATH topology
1HE1A 1HE9A 1R4TA 1G4US 1G4WR 1HY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HE1 A;  1HE9 A;  1R4T A;  1G4U S;  1G4W R;  1HY5 A; 
#chains in the Genus database with same CATH topology
 1I5N A;  3RFY A;  4OIQ F;  3ITF A;  2YLI A;  1OCO C;  4DOZ A;  5BUO A;  1ZHZ A;  1TWG A;  3FMS A;  1RMV A;  3UNG C;  3SZR A;  1LPE A;  4OIN F;  5L0I A;  3PHF 2;  2L6H A;  4KBL A;  4XEK A;  2R02 A;  2MHR A;  1JRA A;  2TMV P;  5DS6 A;  5COG A;  4WAB A;  1K04 A;  2H7O A;  4D4X A;  3AQB A;  2YVK A;  5EGY A;  4ER9 A;  1VYI A;  5F5H A;  2CW0 F;  2GFH A;  3E70 C;  2QLA A;  4E7S A;  5KYN A;  3QVZ A;  1VTM P;  2XRH A;  2XM4 A;  3LS1 A;  3PMR A;  1D0X A;  1OW7 A;  4C3E A;  1R4T A;  2XLE A;  3JZ0 A;  4IWB A;  2XSE A;  3KL4 A;  1PD1 A;  5HV9 A;  2OG2 A;  2L7A A;  5FZT A;  2KGO A;  3SEO A;  1G4U S;  1EA8 A;  5JRA A;  3T4R A;  4MVR A;  1Z6A A;  2YL0 A;  3U2L A;  1E2X A;  4MVQ A;  1FTS A;  1G5Z A;  3K1I C;  1ZHT A;  1OKK D;  4YT4 A;  3B0P A;  1JPN A;  2HV7 A;  1ORS C;  2PP4 A;  3MLG A;  2XLV A;  2YZS A;  1F1M A;  2HMQ A;  2YLG A;  4PJJ A;  2ETS A;  2IM8 A;  3KKB A;  1WOL A;  4NTF A;  4U5G A;  4RBN A;  3I5Q A;  2KW3 C;  3EPV A;  2X51 A;  3Q6M A;  3VYW A;  3MBG A;  4IAQ A;  3WG7 C;  4DRJ B;  3TUL A;  2NPU A;  2G3K A;  4P6I C;  3C62 A;  2WZF A;  3KYJ A;  1S7Z A;  1SF8 A;  3NMJ A;  1TWA A;  1ZHY A;  4O6M A;  4DBR A;  1ST6 A;  4JE9 A;  2C04 A;  2NSG A;  4I1O B;  4Q7C A;  3W2V A;  5B3I A;  2J7P A;  3RYL A;  4ULW A;  1HE1 A;  1RKE B;  1WTY A;  3HNI A;  4LAC B;  5L0H A;  1JMW A;  1TFO B;  2IYL D;  2XLO A;  4JTA B;  5KYW B;  3EHM A;  3S90 A;  2XXA B;  2YHS A;  1FFT C;  2VC9 A;  4PR9 A;  4XPW A;  3ABL C;  4YN0 B;  3EGX B;  2LFD A;  3FAP B;  4LLC A;  3CAX A;  4KI2 A;  1QKR A;  1Y4C A;  1FR0 A;  1C17 M;  2B0J A;  4EWC A;  2B0H A;  1FMV A;  1RKE A;  5JP7 A;  1KTM A;  1FMW A;  1L3P A;  3EH1 A;  3NMI A;  5D92 A;  1KNY A;  5KYW A;  2XXA A;  3GEH A;  1YZA A;  1HMD A;  2XM0 A;  5KYX B;  5EHH A;  3B0V C;  3GOR A;  1Q0M A;  1NU9 C;  3LLK A;  3EGX A;  2HUJ A;  3NYM A;  1RXQ A;  3DKA A;  3SYN A;  3WAQ A;  2W9Y A;  4C3B A;  4BJ5 C;  3UGO A;  4NC3 A;  2WVQ A;  3G50 A;  2P0N A;  1H9T A;  2A6E F;  3UMH A;  1V54 C;  2Y3D A;  4B6I A;  3HLZ A;  4E17 A;  4CIP A;  2ASR A;  4DXW A;  2KK1 A;  2XL4 A;  2EPK X;  1YJG A;  3JSZ A;  5KYX A;  3M1C B;  4HEA J;  2A0U A;  4MTG A;  1K40 A;  2XLH A;  2WB7 A;  1HMO A;  4G7Z F;  3OEO A;  5B1A C;  3ZIB A;  4AL1 A;  1G8X A;  1L7C A;  1YAU O;  2AVK A;  4O6N A;  1KU2 A;  2LIG A;  2OEV A;  1Z5Z A;  1NZE A;  2A68 F;  5AC4 A;  1EI7 A;  4H4K C;  3RQF A;  3SXZ A;  1UG7 A;  2J9W A;  3EZH A;  4U5H A;  2Z15 A;  256B A;  1A41 A;  1OXK A;  1QPU A;  3DAF A;  3IHU A;  4JC7 A;  3NMK A;  4QDL A;  1E83 A;  2KC3 A;  4XEV A;  4MVU A;  3ZTZ A;  1CPQ A;  1VMA A;  4XWJ A;  2QNL A;  1APC A;  1U0B B;  5L0F A;  4NCQ A;  3CSK A;  4P9F A;  1MMN A;  1Q0K A;  2D5R B;  2OQM A;  3KYI A;  4DVY P;  3AG3 C;  4JCH A;  3RIP A;  1T01 A;  2PNO A;  4U9D A;  3ZSU A;  2P6V A;  4J7Y A;  1YA7 O;  5JLI A;  3G4Z A;  1GGQ A;  3B0U X;  2KJG A;  5L0D A;  3W4Y A;  3QZC A;  3EG9 B;  2HV6 A;  2HMZ A;  3S0X A;  3NDB B;  2LD6 A;  3I4U A;  3RH3 A;  4DBQ A;  3LS0 A;  1PV3 A;  2QY9 A;  3U8P A;  3H2U A;  2ZPA A;  3M15 A;  2XS1 A;  2CNW D;  1DOW A;  2Y3G A;  3LLI A;  5D91 A;  3C18 A;  1H6G A;  1YYX A;  3G4X A;  4OIR F;  2LK4 A;  4BJ6 C;  2VH3 A;  4AK9 A;  5E2Q A;  4CDY A;  3EG9 A;  2JX0 A;  3C8G D;  5A69 A;  3S27 A;  5CIV A;  4E7Z A;  1QSP A;  2L9J A;  5DVW A;  1RCP A;  2OEX A;  3AGU A;  3K66 A;  3E9V A;  3NRH A;  2FAP B;  3TQO A;  2R25 A;  3T6B A;  3LUT B;  1Q0D A;  3W2W A;  5DQT A;  1BZ4 A;  4AL0 A;  2Q7R A;  1C02 A;  2OOC A;  1H9G A;  4G7H F;  3PCV A;  5HSW A;  2XS8 A;  3ECS A;  5DQZ A;  2M64 A;  4ZLC A;  2IXO A;  1S05 A;  4MQ9 F;  1LE2 A;  3NG1 A;  5K0I A;  1V4A A;  5BQH A;  1NSG B;  3T6J A;  2ZXW C;  4EIY A;  1VK5 A;  4PJM A;  3U9J A;  4JJG A;  3EHN A;  3EGD B;  4JJF A;  5L0G A;  3GWL A;  3DM5 A;  3J06 A;  1A7E A;  1O5H A;  1O3U A;  3BRJ A;  3H65 A;  2LSE A;  2GAQ A;  3JTL O;  3TJ6 A;  1Q0F A;  1IZM A;  2EIJ C;  4FWV A;  3DWW A;  4F4B A;  2GDC A;  2EPM X;  5L0J A;  3LNM B;  4OD5 A;  3TJ5 A;  2R7R A;  3WHN A;  1M57 C;  3EGD A;  3O39 A;  4M63 A;  5CI8 A;  3NYJ A;  3C7J A;  4LDR A;  4OIP F;  5E3A A;  3QW1 A;  2XLM A;  4JUR I;  2HSQ A;  4IAR A;  1NLX A;  3B9Q A;  1U89 A;  1EKY A;  1N1C A;  2HS5 A;  1C03 A;  4E18 A;  4YWQ A;  1T6U A;  1WAS A;  1YLM A;  2J9U A;  3DXJ F;  5T1D B;  1YYJ A;  3IQT A;  4XLN F;  1DOV A;  2PX0 A;  1ZZP A;  2OJQ A;  5A6K A;  3DI5 A;  5BQI A;  3U2M A;  4PFO A;  3LEV A;  3K7D A;  4MS2 A;  4U5E E;  3RVZ A;  1Y6D A;  2IOQ A;  2VCA A;  3K33 A;  2KSF A;  3PDM P;  2V3C C;  4JKV A;  1GS9 A;  3B71 A;  3MFN A;  1M2O A;  2V26 A;  3X1O A;  3DZA A;  4RD9 A;  3A9C A;  4IJJ A;  1LS4 A;  3GEE A;  3N2Z B;  2UUI A;  3N24 A;  4W8P A;  2NG1 A;  2YL3 A;  1GM5 A;  2BC5 A;  3JT1 A;  3Q7G A;  3TOL A;  2R7X A;  3POV A;  5A6J A;  2NUT B;  3GAN A;  4EHP A;  3UGP A;  3DE8 A;  2ZXO A;  1NU7 D;  3U9M A;  4Q4Z F;  3F46 A;  2HFI A;  3TOM A;  1BR1 A;  4JVS A;  3U3F A;  1OW8 A;  4MND A;  2HZ8 A;  1LS1 A;  1RKC A;  2VCB A;  2QTV A;  3HNL A;  3N0T A;  4A4A A;  5B1B C;  3V5X A;  3O10 A;  1Z3I X;  3ZDL A;  1TR2 A;  2GA0 A;  1SZI A;  4YL1 A;  2NUT A;  1MND A;  3AG2 C;  4QI0 A;  2Q4F A;  4C3D A;  1WAT A;  2XLW A;  1ZHW A;  2W45 A;  2WL8 A;  3L1M A;  3S28 A;  4UDV A;  2G3V A;  2PX3 A;  1OW6 A;  1CGO A;  2IXP A;  2ZXP A;  3K1H A;  3R2P A;  3KH2 A;  3M4C A;  4MVM A;  5T3W A;  3VAY A;  2YL7 A;  2R7Q A;  1Q0G A;  4K1O A;  3ZTM A;  4MW3 A;  2QE9 A;  4Z9J A;  1HY5 A;  3O55 A;  1A7D A;  4LER A;  4U9E A;  1ORY A;  1QZX A;  2BE5 F;  4CX9 A;  4EBB A;  1OR2 A;  2PBE A;  2PF4 E;  4JRZ A;  1HW2 A;  4BJ1 A;  4CDV A;  3I5P A;  3US6 A;  4CS9 A;  1D1B A;  2LFF A;  1WGW A;  2Q9A A;  1D0Z A;  3HNJ A;  5BQG A;  3TK0 A;  2AU5 A;  2HJ3 A;  4MVS A;  4GYT A;  1ZVZ A;  3L8I A;  3M4B A;  1TQG A;  2A69 F;  2J8W A;  3SXY A;  3Q7L A;  4BJ6 A;  1PD0 A;  4XLP F;  2IXN A;  1CPR A;  5L3V A;  4JTC B;  1G4W R;  4BJT A;  4CS7 A;  4FAP B;  3RW0 A;  4N6C A;  3GM1 A;  2I8B A;  1O87 A;  2F22 A;  3L0I A;  4RDA A;  3FXH A;  2ZXR A;  1YA9 A;  3T9O A;  2KQ9 A;  2YRF A;  4Q5S F;  3UMK A;  1OKK A;  2L6F A;  1MMD A;  3C8Z A;  1BR2 A;  2CYD A;  2DI3 A;  2WZL A;  3CZ6 A;  3LAY A;  2J45 A;  4O6Y A;  3HNK A;  4CBE A;  1JR8 A;  3H2V A;  5AGF A;  1D0Y A;  2AWC A;  1R5I D;  3O6X A;  2A0B A;  4G78 A;  4N06 A;  3FOP A;  4EBK A;  5DS4 A;  5L3Q A;  3ZWI A;  2I15 A;  2J9V A;  4CSA A;  4NY3 A;  1GQA A;  4BPM A;  1OCZ C;  3SXM A;  1LKX A;  1A7V A;  4FES A;  4IGG A;  3DJN B;  2A6H F;  2LCH A;  4KNV A;  3S29 A;  3RQE A;  3JYH A;  3ABK C;  4K0D A;  4U5B E;  2EPO A;  5JT4 A;  2J7P D;  2JPU A;  4PJL A;  2H8A A;  4H54 A;  2IXM A;  4CJO A;  2FGY A;  5E3C A;  4ZLD A;  4G7O F;  1YAR O;  1MNE A;  1T6I A;  1XWJ A;  2AWY A;  2EIM C;  3DJU B;  2E87 A;  2HKV A;  1LE4 A;  1SMY F;  2H7V C;  5A6A A;  3K6B A;  4XTK A;  1LI7 A;  3U0C A;  3GWN A;  2DYR C;  5L0C A;  3DE9 A;  1TWH A;  1BR4 A;  1TWC A;  3ZC4 A;  2P7V A;  2H7B A;  4JCZ A;  1WN0 A;  4MVZ A;  2KYH A;  3JYY A;  4MVO A;  2X0C A;  1JAF A;  1SR2 A;  3JCU Q;  1B68 A;  1FNT c;  5EK0 A;  3NKE A;  2ICW G;  1VYK A;  2AP3 A;  1NG1 A;  3A11 A;  3EH2 A;  1ZU4 A;  4XEF A;  2L81 A;  1OCC C;  1NBB A;  1H7I A;  1JOG A;  4NTB A;  1LM3 B;  4PK4 A;  4EKW A;  2XLD A;  1MQV A;  2R7O A;  2YEV A;  1J8M F;  3V5Y A;  4CS8 A;  1V74 B;  4GQH A;  4J30 B;  4YT8 A;  2R7T A;  1W2W A;  4J7T A;  2G62 A;  4OIO F;  3FVY A;  2M4E A;  3Q6N A;  1OR3 A;  2Q00 A;  1Z23 A;  3ZG1 A;  4U5D E;  4YJW A;  3HJC A;  1RJ9 A;  2Q9B A;  3CEX A;  3DAG A;  4U5F E;  3SP1 A;  4DRH B;  5AC5 A;  3LNR A;  2PFD A;  2R03 A;  3NKD A;  4O7G A;  2D4U A;  3QW0 A;  3U3B A;  3AG4 C;  3AQC A;  3AG1 C;  4X0R A;  5COM A;  4EBJ A;  3L34 A;  2VAS A;  4CS9 C;  2HJM A;  1ZYR F;  3ZVR A;  4HE8 D;  2NUP B;  1U6H A;  2P1A A;  2W4M A;  4DJ9 A;  3EFO B;  3ABM C;  3LES A;  4KC9 A;  3RKO F;  4A2N B;  3S84 A;  1AUE A;  4N4W A;  1K05 A;  4GEH A;  3JRT A;  4J32 B;  1VLT A;  3MYI A;  1ZW3 A;  2A1D D;  2O9X A;  3IQ5 A;  1ZHX A;  3F47 A;  4E0I A;  2ZD9 A;  3MX3 A;  1TFK B;  2MYS A;  2NUP A;  2R05 A;  4ONS A;  4YL0 A;  5COF A;  3EFO A;  2YLD A;  1M2V B;  1NFO A;  2RD9 A;  4FX5 A;  3LJB A;  3B29 A;  3KMI A;  4JTD B;  1BBH A;  4C7O B;  3OA1 A;  1D1A A;  3C8G B;  1SYQ A;  3L8J A;  5B3S C;  2P61 A;  4JZA A;  4DVZ A;  2QUP A;  1QLE C;  1TKN A;  4ULV A;  2VB6 A;  2L6G A;  3JRM O;  1XZP A;  2Y39 A;  3GM3 A;  1M56 C;  2WZG A;  2DYS C;  3ATP A;  3OWT A;  4LDQ A;  2EIK C;  2CNW A;  4YT5 A;  4D4N A;  4OD4 A;  2DGJ A;  2YWA A;  2GWW A;  4WGY A;  2LP4 A;  4CDA A;  4E0H A;  1MMG A;  1FFH A;  1M2V A;  2R9R B;  4DRI B;  1WWP A;  2OKU A;  4HFF B;  5A6B D;  1AEP A;  4IAO A;  3M79 A;  3C8G A;  1E85 A;  4CSA C;  4QI2 A;  4ANJ A;  1BDJ B;  3S9O A;  4CIH A;  2J46 A;  4PFP A;  3CQZ A;  5JSL A;  2LQG A;  2DB4 A;  1QVX A;  4C7O A;  1YVI A;  3AOU A;  1AVO B;  1HW1 A;  5T3T A;  2FFH A;  1T9K A;  4LDK A;  3W8H A;  2CCY A;  4XQ1 A;  2XL8 A;  2UUH A;  3EQL F;  4PJN A;  1CGN A;  2OJE D;  4IRU A;  4PAC A;  2RSE B;  1T6Q A;  4XPY A;  2KNH A;  2R7V A;  4BEM J;  4P9T A;  1LVK A;  1HE9 A;  1CGM E;  1VOM A;  2C03 A;  3IPM O;  1D1C A;  4IB4 A;  4AX2 A;  2J9B A;  3DM9 B;  4R32 A;  1ORJ A;  2EIN C;  3U5S A;  3ZQV A;  5DLJ A;  1I4Y A;  1YZC A;  2J0W A;  1A0B A;  1XZQ A;  1NFN A;  2HSB A;  1I4Z A;  2Q9C A;  3V7O A;  2JD3 A;  1PCX A;  2EIL C;  4KNW A;  3W8I A;  1V55 C;  3ASN C;  4I3M A;  3FDQ A;  4G0H A;  4AE4 B;  3X2Q C;  3FAJ A;  4YL3 A;  3DMD A;  1Z63 A;  3MYF A;  3HTK C;  2OU6 A;  3SNH A;  3VF0 A;  5JVE A;  5JUA A;  1VLS A;  3FHD A;  5IY5 C;  3K1I A;  5F28 E;  1E84 A;  2R7S A;  4BG0 A;  3QMK A;  1ZU5 A;  2XL6 A;  1UFB A;  1OCR C;  3JSE O;  4W8K A;  1OXB A;  4N6H A;  4NTA A;  2J0X A;  3QVY A;  4Z9H A;  3LEO A;  1LI5 A;  4L6R A;  2R7W A;  4CS8 C;  2WVO A;  3VM6 A;  3V5Z A;  4AE4 A;  3ZQY A;  2YKZ A;  4I1M A;  1EQ1 A;  2EPL X;  2OCC C;  3TD7 A;  5F5F A;  3EZI A;  3WOD F;  4I44 A;  4MTO A;  4CJG A;  4K7B A;  3IQ6 A;  5TJ5 E;  4JIO A;  3C63 A;  2CGE A;  2Y69 C;  3EJN A;  4U5C E;  1LIH A;  1VB5 A;  4YT2 A;  2W4B A;  2EPN A;  3AJM A;  3DD7 A;  3GM2 A;  4EUK B;  1OQC A;  5KYY B;  3HKK A;  4JW1 A;  5DS5 A;  2NSF A;  1IW7 F;  4LLE A;  3GOD A;  4JEB A;  2BL2 A;  2CDQ A;  4O79 A;  3UR3 C;  2YL1 A;  4WJ0 A;  3SXK A;  3U8V A;  1E86 A;  3NYL A;  4XPX A;  5JS5 A;  3GEI A;  4MTF A;  5E33 A;  1MMA A;  5FCL A;  2Y3B A;  3KPH A;  4HFK B;  5KYU B;  1QQ3 A;  4NQF A;  3T6G B;  1M6T A;  2MWQ A;  3BEH A;  1ZW2 A;  4JEA A;  1T5O A;  3RQG A;  3IEE A;  5KYY A;  1FAP B;  2YQY A;  1RJ9 B;  2VCC A;  4BJ5 A;  3IQC A;  2IBF A;  2Y3H A;  4Z9I A;  5GPG B;  3RF3 A;  3VRC A;  5A6B A;  2R7U A;  4BEJ A;  3R7C A;  1JPJ A;  2Q3T A;  2WVN A;  3QTH A;  4WGZ A;  3RVY A;  5KYU A;  1Z7Q c;  3FOO A;  1J8Y F;  4YK5 A;  3UMI A;  4MW8 A;  3ASO C;  5CI9 A;  3AGT A;  1YDI A; 
#chains in the Genus database with same CATH homology
 1HE1 A;  1HE9 A;  1R4T A;  1G4U S;  1G4W R;  1HY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...