3ZTZA

Cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound l16g variant at 1.05 a resolution: unrestraint refinement
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSAGTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 51
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3ztzA00
1MQVA 5JUAA 2XLVA 1RCPA 4CJGA 1E86A 2YL0A 2XL8A 1E83A 4CJOA 1LM3B 4CX9A 2BC5A 1YYXA 3M79A 1CGOA 5JT4A 4IARA 2XM0A 4CDAA 5B3IA 1QPUA 1CPQA 1E84A 3FOOA 3QW0A 4WGZA 4IB4A 3IQ5A 3C62A 2YLDA 4D4XA 5JS5A 1GQAA 2YLIA 3HNLA 3ZTMA 5JP7A 2YL1A 3U8PA 1EKYA 3VRCA 4U9EA 2XM4A 4D4NA 4ER9A 3ZTZA 3QVZA 4JKVA 4JE9A 2XLDA 2XLEA 1S05A 1BBHA 256BA 3M4CA 4EIYA 5JSLA 3HNIA 3TOMA 2YL7A 2XLMA 3DE9A 2XLHA 2CCYA 3FOPA 1YZCA 1A7VA 3HNJA 3NMKA 3NMJA 4CDYA 1APCA 3DE8A 4N4WA 3C63A 1YZAA 4NC3A 1E85A 3HNKA 4WGYA 3IQ6A 1CGNA 3L1MA 3ZWIA 1YYJA 3ZQYA 5JLIA 4L6RA 3QVYA 2YKZA 4N6HA 3ZQVA 2YL3A 5JRAA 5JVEA 1NBBA 2J9BA 5AGFA 2XLOA 1QQ3A 2J8WA 2QLAA 3NMIA 3TOLA 1M6TA 3M15A 2XLWA 4CIPA 4JEBA 1CPRA 3M4BA 4IAQA 4JEAA 4CDVA 3QW1A 2XL6A 4U9DA 1JAFA 4ULVA 2YLGA
chains in the Genus database with same CATH superfamily
4XEVA 2IXPA 2Q00A 1RCPA 1H9GA 2J7PA 3DJUB 4CJGA 4YT8A 2EINC 2XXAB 1MNEA 1FMWA 4Z9HA 2A1DD 2E87A 3A11A 4PJMA 2NUPA 2YVKA 2KK1A 2H7OA 3ATPA 4CSAC 3MBGA 2BC5A 3MYIA 3Q7LA 4O7GA 3O55A 1I4ZA 2NPUA 1MMGA 1OKKD 2P61A 3WODF 3TQOA 1D0XA 1C17M 5L0HA 4JW1A 1OKKA 1I4YA 4GYTA 2A68F 2IBFA 4IARA 4EBJA 1OR3A 1D1BA 4E18A 1SYQA 5KYUB 4CDAA 3DM9B 1U0BB 2J9UA 2XS1A 3K33A 2NUTA 4BJ5C 4H54A 2IYLD 4IAOA 3S9OA 1ZHYA 4BJTA 2XXAA 3RFYA 3RYLA 4K7BA 3T6BA 3RQEA 1VOMA 2XSEA 3LS0A 3EHMA 3RIPA 4YWQA 3AG4C 3ECSA 3TJ6A 2KJGA 2ZXWC 1FFHA 3V5ZA 4BPMA 4I1OB 2Q3TA 1V4AA 2HS5A 1NU7D 2L9JA 4IRUA 2Y39A 3B29A 4A2NB 5B3SC 2Y3GA 3CAXA 4PR9A 4C3BA 3N0TA 1WATA 2LK4A 2YWAA 4XTKA 2DB4A 3KL4A 4EUKB 3L0IA 3PHF2 1YJGA 5KYUA 1LS1A 3S90A 3G4XA 4BJ1A 1AUEA 4ER9A 2OQMA 1LI7A 1ORJA 4IWBA 1UFBA 3NRHA 2QTVA 2VC9A 2XLDA 1TQGA 2LFFA 3K1HA 2EPLX 1BBHA 1J8MF 4KNVA 2F22A 3GEIA 2VH3A 3MLGA 3KPHA 3M4CA 4YL3A 2ZPAA 4OD4A 3L8IA 3LLKA 1F1MA 2H7VC 1C03A 3HNIA 1D1AA 3E70C 1ZVZA 3O39A 1Q0DA 3LNRA 2W4MA 1LE2A 4Q4ZF 2I15A 5EGYA 1KTMA 3R7CA 5BQGA 2CW0F 2CCYA 3U3FA 3B0UX 3FHDA 2EIJC 1YZCA 2WZFA 2R7XA 3ZVRA 2KGOA 4W8KA 3U2LA 4CDYA 2ICWG 1NG1A 3SP1A 3U8VA 4N4WA 3C63A 2RD9A 2JPUA 2IXNA 3FAJA 1ZHWA 4NC3A 1E85A 3V5XA 3EQLF 3M1CB 3KYIA 5IY5C 3AQBA 1D0YA 3ABKC 3FXHA 3CQZA 4MW3A 3L1MA 4OIQF 1A0BA 3U2MA 3K1IA 1SR2A 2A0UA 3OA1A 1ZZPA 2EILC 4LDKA 4DJ9A 1KU2A 3DWWA 3W8IA 4K0DA 1WN0A 2Q7RA 5FCLA 3X2QC 1YAUO 3NKEA 1JMWA 1GM5A 4ZLDA 1YVIA 1MNDA 3NG1A 2Y69C 3DI5A 3SNHA 2H8AA 2DYSC 5DS4A 2LQGA 3LEVA 3F46A 5L0DA 2J9BA 4XLPF 1OCOC 4MTOA 3RQFA 3C8GD 3JZ0A 2UUHA 1J8YF 3H2VA 3MX3A 3R2PA 1U6HA 2AP3A 2ZXPA 3KKBA 2DI3A 1O87A 3NMIA 1TWHA 3C8GA 3ZC4A 4ANJA 5A69A 2FFHA 3AJMA 1CPRA 1T9KA 4JEAA 2NSFA 3QW1A 5DLJA 1RJ9B 4CS8A 3S29A 2PNOA 4OIRF 5DS5A 4U9DA 3HJCA 2YLGA 2OJQA 1MQVA 5JUAA 4YJWA 1FNTc 3B0VC 3RW0A 2XL8A 4U5EE 4EWCA 3LS1A 1G4US 2ETSA 2LSEA 1LM3B 1LIHA 5L0CA 2M4EA 2Q9CA 1A7DA 4J7TA 1WTYA 2A6EF 1ZW3A 2NG1A 1BR2A 3O6XA 3MYFA 3JT1A 3QTHA 1NZEA 4GEHA 3W2WA 4E7ZA 1ZU4A 3DXJF 3O10A 3CSKA 4B6IA 1W2WA 3N2ZB 1T5OA 2GAQA 2XL4A 2DGJA 1Q0KA 3TK0A 3T6JA 4MS2A 4NQFA 3SZRA 4BJ6A 1CGME 1QPUA 1D0ZA 2EPOA 1CPQA 1AEPA 4U5BE 1FFTC 1M2VB 5BQHA 3FOOA 3UGOA 4P9FA 3OWTA 1Z6AA 4U5HA 3UNGC 1JPJA 2VASA 1VB5A 5D91A 5E33A 4KC9A 4OINF 3FMSA 5COMA 3ZIBA 4LERA 4C3EA 2PP4A 2WB7A 2EPKX 2CGEA 2HSBA 1ZHXA 1M57C 3JTLO 3S27A 4DBQA 1OW7A 3K7DA 3VRCA 4U9EA 4CIHA 1BR4A 3X1OA 1TWCA 2OG2A 3V7OA 3AG3C 2IM8A 2CDQA 2EPNA 3EJNA 1M2VA 3QVZA 3DAGA 4JJGA 1Z23A 4LDRA 1VK5A 2OEVA 2R7VA 4JE9A 1FR0A 3SYNA 3NDBB 3EGDB 2R7TA 1NLXA 2P1AA 3H2UA 3RVZA 4YT4A 1K04A 2J46A 3AGUA 3GANA 1LE4A 1NFOA 3FAPB 2L7AA 3RQGA 3JSEO 3Q6NA 1TFOB 4JTCB 3VAYA 3F47A 2ZXOA 5A6BD 3OEOA 2H7BA 4GQHA 2XLHA 3FDQA 4E7SA 2VCAA 2MYSA 3CEXA 4JCHA 3ITFA 1R4TA 1APCA 3NYJA 4HEAJ 3DE8A 4G0HA 1TWGA 4PFPA 1YZAA 4LACB 4BEMJ 3GEEA 1GGQA 3EGDA 1RXQA 2G3VA 3B9QA 5CI8A 3AGTA 2X0CA 3AG1C 4XEFA 2NSGA 2HUJA 4FESA 1V74B 1XWJA 4PACA 2IXMA 2KC3A 1NFNA 4O79A 2B0HA 2Q4FA 2R7RA 1MMDA 5JLIA 5GPGB 2YHSA 2YKZA 4XEKA 4CS7A 3TD7A 5E2QA 3L34A 1KNYA 4N6HA 4P6IC 3ZQVA 4UDVA 1L3PA 2YL3A 5A6AA 5FZTA 5A6JA 3K66A 1I5NA 4X0RA 5CIVA 2CNWD 1NBBA 3IQTA 1DOVA 4Q5SF 1MMAA 4XLNF 3ASNC 2PFDA 4J7YA 1OW8A 2FGYA 4EHPA 4O6NA 3Q7GA 4H4KC 4FWVA 2IXOA 2LCHA 3ZDLA 2VCBA 3TOLA 4CSAA 2OCCC 1OR2A 4JEBA 4LDQA 4N6CA 4IAQA 1QKRA 5KYYA 2M64A 3VM6A 3IHUA 3JYYA 2R03A 3HLZA 2YEVA 2Y3HA 4I44A 3C8GB 5L0GA 1VLTA 1TWAA 3GWLA 5L0JA 2QE9A 1V55C 3BEHA 3LAYA 2QUPA 4KBLA 2GDCA 2J0XA 5F28E 4AE4A 1E86A 2R05A 2YL0A 1ZW2A 4NTFA 4CJOA 1ZU5A 1E83A 2OEXA 1O5HA 3IQCA 4BJ5A 3JRMO 2W9YA 4JCZA 4DBRA 1HE1A 5T3WA 2KNHA 1H9TA 4NCQA 4MVUA 2G3KA 4DVYP 3EHNA 4YL0A 4E0HA 1Z63A 1YYXA 4G7OF 1G4WR 1CGOA 1JR8A 2KQ9A 3US6A 4CS9C 1BR1A 2P7VA 5COFA 4C3DA 1ZHTA 4IGGA 2VCCA 3EFOA 3LUTB 1OW6A 4E0IA 3POVA 4DRJB 2R7UA 4G7ZF 2XRHA 1AVOB 2AU5A 4MQ9F 3JRTA 3KYJA 1ORYA 5HV9A 1FTSA 2OKUA 1E84A 3JSZA 1T6IA 2CYDA 2HMZA 2HSQA 3EH1A 3QW0A 5F5HA 4MW8A 4I1MA 4DVZA 4AK9A 2B0JA 5T1DB 2WZLA 4IB4A 1G8XA 4O6MA 3HKKA 1FAPB 1Y6DA 2WVOA 2RSEB 1Z5ZA 2YLDA 4JJFA 4D4XA 2ZD9A 5JS5A 1FMVA 1GQAA 2L6HA 2ZXRA 1JPNA 1EA8A 5TJ5E 5JP7A 2YL1A 2AVKA 2I8BA 2IOQA 4JC7A 3U8PA 4DRHB 3C7JA 4LLEA 2R7SA 3B0PA 2HMQA 1JRAA 5L0IA 1HE9A 4EBKA 3GEHA 2XM4A 1YA7O 3UMIA 4AX2A 5KYNA 4D4NA 5E3CA 2OU6A 3U5SA 1R5ID 1L7CA 3ZTZA 1K05A 5DQZA 4MVOA 2LD6A 1Q0MA 3G50A 4LLCA 2LFDA 4JKVA 4MVMA 5B1AC 3LLIA 3GWNA 5T3TA 2HKVA 2XLEA 1S05A 1WASA 1DOWA 3DZAA 1D1CA 2GFHA 3GM1A 1ST6A 4WABA 2AWYA 3WAQA 2YRFA 1VMAA 256BA 4DOZA 2HFIA 1ZYRF 2UUIA 4Z9JA 4EIYA 1RKCA 2J45A 2L81A 2Z15A 3QZCA 2HZ8A 2W4BA 5JSLA 3W4YA 1LS4A 3EG9B 3TOMA 4R32A 4MVZA 4EBBA 2Y3DA 3DE9A 4QDLA 4JURI 3SXMA 4W8PA 2Y3BA 1Z3IX 2G62A 1SMYF 2Q9BA 4AL0A 2A0BA 2R25A 3FOPA 4PFOA 1A7VA 5L3QA 1H7IA 3DM5A 1EQ1A 3NMJA 2KSFA 4KI2A 4I3MA 2ASRA 2MWQA 3G4ZA 3LJBA 3EZIA 1G5ZA 1O3UA 4DRIB 5BUOA 5B1BC 4ONSA 2LP4A 2KYHA 3WG7C 3HNKA 1JOGA 1XZPA 2R7OA 1S7ZA 3AG2C 3EGXA 4U5FE 2MHRA 4WGYA 3W2VA 5AC4A 1HW2A 3AQCA 3ZWIA 4DXWA 2J9VA 3GM2A 1QLEC 1TFKB 3T4RA 3TJ5A 3EG9A 4MVQA 3ZQYA 4MVSA 4BEJA 2P0NA 4L6RA 4RDAA 1YARO 2OOCA 4AL1A 3UMHA 1M2OA 1TR2A 2PX0A 3GM3A 3ABMC 3C18A 4Z9IA 3S28A 3PMRA 4PJJA 3B71A 4YT2A 5JRAA 4OIOF 2LIGA 3WHNA 2C03A 1VYKA 4BG0A 5A6BA 2HJMA 5DVWA 2X51A 2A69F 3K1IC 4RD9A 2XLOA 5CI9A 3PCVA 1QQ3A 3RH3A 3A9CA 4HE8D 1U89A 4YN0B 3ZSUA 1EI7A 4ZLCA 3RKOF 4JTDB 2V3CC 2XL6A 1Q0GA 3DJNB 3I5PA 3U3BA 4FAPB 5JT4A 1LVKA 2QNLA 2J0WA 4ULVA 5KYYB 1NU9C 4U5GA 5KYWB 3EPVA 2XLVA 1PD1A 3Q6MA 3UR3C 3DAFA 2R7QA 4M63A 2L6GA 4K1OA 2HJ3A 1HMDA 1LPEA 4N06A 5F5FA 4YT5A 1BDJB 2YZSA 4CX9A 4EKWA 2P6VA 4G7HF 3I4UA 3SXKA 4AE4B 4NTAA 3C8ZA 4HFKB 3RVYA 5BQIA 3M79A 4PJNA 4CS8C 1WGWA 3U0CA 2CNWA 4O6YA 1C02A 5E3AA 2XM0A 2R9RB 1SZIA 2AWCA 5B3IA 4RBNA 3TULA 5KYXB 2O9XA 3SXYA 1T01A 1QSPA 1A41A 3RF3A 3EFOB 5KYWA 1OXKA 4KNWA 4WJ0A 2PF4E 3W8HA 2YQYA 3GODA 1PV3A 4WGZA 4MTGA 2FAPB 4ULWA 2TMVP 3IQ5A 3PDMP 3C62A 4C7OB 2R02A 1NSGB 2BL2A 3DD7A 1VTMP 4OD5A 2V26A 3ABLC 1YDIA 2GWWA 2YLIA 4XQ1A 4E17A 3DMDA 3HNLA 2EIKC 3ZTMA 3L8JA 3NYMA 3LEOA 4BJ6C 3NKDA 4PJLA 1IW7F 2J9WA 2W45A 1Z7Qc 1EKYA 3BRJA 1V54C 1OCCC 5DS6A 5L3VA 3T9OA 3UMKA 3LNMB 3DKAA 3N24A 1ORSC 1PCXA 2PX3A 3EZHA 5DQTA 5KYXA 5EK0A 4PK4A 1YLMA 4OIPF 1M56C 2PBEA 4MNDA 2WL8A 4U5CE 4CBEA 4JTAB 3QMKA 3VYWA 1ZHZA 4C7OA 1VYIA 2D4UA 3E9VA 1BZ4A 1T6UA 2KW3C 2QY9A 1OXBA 1WWPA 3KH2A 3SEOA 2WZGA 2YL7A 5K0IA 2XLMA 1LKXA 2XS8A 4J30B 2WVNA 1GS9A 4QI2A 3MFNA 2JX0A 3JCUQ 4XPYA 2VB6A 1QVXA 4G78A 3EH2A 3AOUA 2D5RB 1LI5A 3JYHA 3HNJA 2HV7A 3NYLA 2HV6A 1Q0FA 3NMKA 4MVRA 3KMIA 3U9MA 5L0FA 3T6GB 4FX5A 4YK5A 1YA9A 3LESA 3V5YA 1UG7A 1RKEB 3HTKC 5AC5A 1OQCA 4U5DE 4XPWA 2DYRC 3U9JA 3VF0A 3IEEA 1N1CA 1HY5A 3IQ6A 1CGNA 1OCZC 1YYJA 1WOLA 2WVQA 2BE5F 4P9TA 5D92A 1MMNA 3EGXB 2L6FA 2JD3A 3UGPA 3ASOC 1HMOA 3ZG1A 4A4AA 1H6GA 3QVYA 4NTBA 1HW1A 1XZQA 1IZMA 1SF8A 4JRZA 1QZXA 1TKNA 4QI0A 1RMVA 4IJJA 4F4BA 1Y4CA 3I5QA 4XPXA 3FVYA 5JVEA 3H65A 3GORA 5EHHA 2EPMX 3S84A 3J06A 3CZ6A 2NUPB 1VLSA 1E2XA 1RKEA 4XWJA 4HFFB 4J32B 4MTFA 4Q7CA 5AGFA 5A6KA 5HSWA 2Q9AA 4JIOA 1T6QA 2J8WA 2GA0A 1RJ9A 2QLAA 1K40A 3IPMO 1M6TA 4JZAA 3K6BA 1B68A 2A6HF 2XLWA 3M15A 4CIPA 3S0XA 4YL1A 2OJED 3M4BA 1OCRC 4CDVA 2R7WA 4NY3A 4JVSA 1A7EA 1PD0A 5COGA 2C04A 3SXZA 4CS9A 2J7PD 1JAFA 2EIMC 2NUTB
chains in the Genus database with same CATH topology
1MQVA 5JUAA 2XLVA 1RCPA 4CJGA 1E86A 2YL0A 2XL8A 1E83A 4CJOA 1LM3B 4CX9A 2BC5A 1YYXA 3M79A 1CGOA 5JT4A 4IARA 2XM0A 4CDAA 5B3IA 1QPUA 1CPQA 1E84A 3FOOA 3QW0A 4WGZA 4IB4A 3IQ5A 3C62A 2YLDA 4D4XA 5JS5A 1GQAA 2YLIA 3HNLA 3ZTMA 5JP7A 2YL1A 3U8PA 1EKYA 3VRCA 4U9EA 2XM4A 4D4NA 4ER9A 3ZTZA 3QVZA 4JKVA 4JE9A 2XLDA 2XLEA 1S05A 1BBHA 256BA 3M4CA 4EIYA 5JSLA 3HNIA 3TOMA 2YL7A 2XLMA 3DE9A 2XLHA 2CCYA 3FOPA 1YZCA 1A7VA 3HNJA 3NMKA 3NMJA 4CDYA 1APCA 3DE8A 4N4WA 3C63A 1YZAA 4NC3A 1E85A 3HNKA 4WGYA 3IQ6A 1CGNA 3L1MA 3ZWIA 1YYJA 3ZQYA 5JLIA 4L6RA 3QVYA 2YKZA 4N6HA 3ZQVA 2YL3A 5JRAA 5JVEA 1NBBA 2J9BA 5AGFA 2XLOA 1QQ3A 2J8WA 2QLAA 3NMIA 3TOLA 1M6TA 3M15A 2XLWA 4CIPA 4JEBA 1CPRA 3M4BA 4IAQA 4JEAA 4CDVA 3QW1A 2XL6A 4U9DA 1JAFA 4ULVA 2YLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MQV A;  5JUA A;  2XLV A;  1RCP A;  4CJG A;  1E86 A;  2YL0 A;  2XL8 A;  1E83 A;  4CJO A;  1LM3 B;  4CX9 A;  2BC5 A;  1YYX A;  3M79 A;  1CGO A;  5JT4 A;  4IAR A;  2XM0 A;  4CDA A;  5B3I A;  1QPU A;  1CPQ A;  1E84 A;  3FOO A;  3QW0 A;  4WGZ A;  4IB4 A;  3IQ5 A;  3C62 A;  2YLD A;  4D4X A;  5JS5 A;  1GQA A;  2YLI A;  3HNL A;  3ZTM A;  5JP7 A;  2YL1 A;  3U8P A;  1EKY A;  3VRC A;  4U9E A;  2XM4 A;  4D4N A;  4ER9 A;  3ZTZ A;  3QVZ A;  4JKV A;  4JE9 A;  2XLD A;  2XLE A;  1S05 A;  1BBH A;  256B A;  3M4C A;  4EIY A;  5JSL A;  3HNI A;  3TOM A;  2YL7 A;  2XLM A;  3DE9 A;  2XLH A;  2CCY A;  3FOP A;  1YZC A;  1A7V A;  3HNJ A;  3NMK A;  3NMJ A;  4CDY A;  1APC A;  3DE8 A;  4N4W A;  3C63 A;  1YZA A;  4NC3 A;  1E85 A;  3HNK A;  4WGY A;  3IQ6 A;  1CGN A;  3L1M A;  3ZWI A;  1YYJ A;  3ZQY A;  5JLI A;  4L6R A;  3QVY A;  2YKZ A;  4N6H A;  3ZQV A;  2YL3 A;  5JRA A;  5JVE A;  1NBB A;  2J9B A;  5AGF A;  2XLO A;  1QQ3 A;  2J8W A;  2QLA A;  3NMI A;  3TOL A;  1M6T A;  3M15 A;  2XLW A;  4CIP A;  4JEB A;  1CPR A;  3M4B A;  4IAQ A;  4JEA A;  4CDV A;  3QW1 A;  2XL6 A;  4U9D A;  1JAF A;  4ULV A;  2YLG A; 
#chains in the Genus database with same CATH topology
 4XEV A;  2IXP A;  2Q00 A;  1RCP A;  1H9G A;  2J7P A;  3DJU B;  4CJG A;  4YT8 A;  2EIN C;  2XXA B;  1MNE A;  1FMW A;  4Z9H A;  2A1D D;  2E87 A;  3A11 A;  4PJM A;  2NUP A;  2YVK A;  2KK1 A;  2H7O A;  3ATP A;  4CSA C;  3MBG A;  2BC5 A;  3MYI A;  3Q7L A;  4O7G A;  3O55 A;  1I4Z A;  2NPU A;  1MMG A;  1OKK D;  2P61 A;  3WOD F;  3TQO A;  1D0X A;  1C17 M;  5L0H A;  4JW1 A;  1OKK A;  1I4Y A;  4GYT A;  2A68 F;  2IBF A;  4IAR A;  4EBJ A;  1OR3 A;  1D1B A;  4E18 A;  1SYQ A;  5KYU B;  4CDA A;  3DM9 B;  1U0B B;  2J9U A;  2XS1 A;  3K33 A;  2NUT A;  4BJ5 C;  4H54 A;  2IYL D;  4IAO A;  3S9O A;  1ZHY A;  4BJT A;  2XXA A;  3RFY A;  3RYL A;  4K7B A;  3T6B A;  3RQE A;  1VOM A;  2XSE A;  3LS0 A;  3EHM A;  3RIP A;  4YWQ A;  3AG4 C;  3ECS A;  3TJ6 A;  2KJG A;  2ZXW C;  1FFH A;  3V5Z A;  4BPM A;  4I1O B;  2Q3T A;  1V4A A;  2HS5 A;  1NU7 D;  2L9J A;  4IRU A;  2Y39 A;  3B29 A;  4A2N B;  5B3S C;  2Y3G A;  3CAX A;  4PR9 A;  4C3B A;  3N0T A;  1WAT A;  2LK4 A;  2YWA A;  4XTK A;  2DB4 A;  3KL4 A;  4EUK B;  3L0I A;  3PHF 2;  1YJG A;  5KYU A;  1LS1 A;  3S90 A;  3G4X A;  4BJ1 A;  1AUE A;  4ER9 A;  2OQM A;  1LI7 A;  1ORJ A;  4IWB A;  1UFB A;  3NRH A;  2QTV A;  2VC9 A;  2XLD A;  1TQG A;  2LFF A;  3K1H A;  2EPL X;  1BBH A;  1J8M F;  4KNV A;  2F22 A;  3GEI A;  2VH3 A;  3MLG A;  3KPH A;  3M4C A;  4YL3 A;  2ZPA A;  4OD4 A;  3L8I A;  3LLK A;  1F1M A;  2H7V C;  1C03 A;  3HNI A;  1D1A A;  3E70 C;  1ZVZ A;  3O39 A;  1Q0D A;  3LNR A;  2W4M A;  1LE2 A;  4Q4Z F;  2I15 A;  5EGY A;  1KTM A;  3R7C A;  5BQG A;  2CW0 F;  2CCY A;  3U3F A;  3B0U X;  3FHD A;  2EIJ C;  1YZC A;  2WZF A;  2R7X A;  3ZVR A;  2KGO A;  4W8K A;  3U2L A;  4CDY A;  2ICW G;  1NG1 A;  3SP1 A;  3U8V A;  4N4W A;  3C63 A;  2RD9 A;  2JPU A;  2IXN A;  3FAJ A;  1ZHW A;  4NC3 A;  1E85 A;  3V5X A;  3EQL F;  3M1C B;  3KYI A;  5IY5 C;  3AQB A;  1D0Y A;  3ABK C;  3FXH A;  3CQZ A;  4MW3 A;  3L1M A;  4OIQ F;  1A0B A;  3U2M A;  3K1I A;  1SR2 A;  2A0U A;  3OA1 A;  1ZZP A;  2EIL C;  4LDK A;  4DJ9 A;  1KU2 A;  3DWW A;  3W8I A;  4K0D A;  1WN0 A;  2Q7R A;  5FCL A;  3X2Q C;  1YAU O;  3NKE A;  1JMW A;  1GM5 A;  4ZLD A;  1YVI A;  1MND A;  3NG1 A;  2Y69 C;  3DI5 A;  3SNH A;  2H8A A;  2DYS C;  5DS4 A;  2LQG A;  3LEV A;  3F46 A;  5L0D A;  2J9B A;  4XLP F;  1OCO C;  4MTO A;  3RQF A;  3C8G D;  3JZ0 A;  2UUH A;  1J8Y F;  3H2V A;  3MX3 A;  3R2P A;  1U6H A;  2AP3 A;  2ZXP A;  3KKB A;  2DI3 A;  1O87 A;  3NMI A;  1TWH A;  3C8G A;  3ZC4 A;  4ANJ A;  5A69 A;  2FFH A;  3AJM A;  1CPR A;  1T9K A;  4JEA A;  2NSF A;  3QW1 A;  5DLJ A;  1RJ9 B;  4CS8 A;  3S29 A;  2PNO A;  4OIR F;  5DS5 A;  4U9D A;  3HJC A;  2YLG A;  2OJQ A;  1MQV A;  5JUA A;  4YJW A;  1FNT c;  3B0V C;  3RW0 A;  2XL8 A;  4U5E E;  4EWC A;  3LS1 A;  1G4U S;  2ETS A;  2LSE A;  1LM3 B;  1LIH A;  5L0C A;  2M4E A;  2Q9C A;  1A7D A;  4J7T A;  1WTY A;  2A6E F;  1ZW3 A;  2NG1 A;  1BR2 A;  3O6X A;  3MYF A;  3JT1 A;  3QTH A;  1NZE A;  4GEH A;  3W2W A;  4E7Z A;  1ZU4 A;  3DXJ F;  3O10 A;  3CSK A;  4B6I A;  1W2W A;  3N2Z B;  1T5O A;  2GAQ A;  2XL4 A;  2DGJ A;  1Q0K A;  3TK0 A;  3T6J A;  4MS2 A;  4NQF A;  3SZR A;  4BJ6 A;  1CGM E;  1QPU A;  1D0Z A;  2EPO A;  1CPQ A;  1AEP A;  4U5B E;  1FFT C;  1M2V B;  5BQH A;  3FOO A;  3UGO A;  4P9F A;  3OWT A;  1Z6A A;  4U5H A;  3UNG C;  1JPJ A;  2VAS A;  1VB5 A;  5D91 A;  5E33 A;  4KC9 A;  4OIN F;  3FMS A;  5COM A;  3ZIB A;  4LER A;  4C3E A;  2PP4 A;  2WB7 A;  2EPK X;  2CGE A;  2HSB A;  1ZHX A;  1M57 C;  3JTL O;  3S27 A;  4DBQ A;  1OW7 A;  3K7D A;  3VRC A;  4U9E A;  4CIH A;  1BR4 A;  3X1O A;  1TWC A;  2OG2 A;  3V7O A;  3AG3 C;  2IM8 A;  2CDQ A;  2EPN A;  3EJN A;  1M2V A;  3QVZ A;  3DAG A;  4JJG A;  1Z23 A;  4LDR A;  1VK5 A;  2OEV A;  2R7V A;  4JE9 A;  1FR0 A;  3SYN A;  3NDB B;  3EGD B;  2R7T A;  1NLX A;  2P1A A;  3H2U A;  3RVZ A;  4YT4 A;  1K04 A;  2J46 A;  3AGU A;  3GAN A;  1LE4 A;  1NFO A;  3FAP B;  2L7A A;  3RQG A;  3JSE O;  3Q6N A;  1TFO B;  4JTC B;  3VAY A;  3F47 A;  2ZXO A;  5A6B D;  3OEO A;  2H7B A;  4GQH A;  2XLH A;  3FDQ A;  4E7S A;  2VCA A;  2MYS A;  3CEX A;  4JCH A;  3ITF A;  1R4T A;  1APC A;  3NYJ A;  4HEA J;  3DE8 A;  4G0H A;  1TWG A;  4PFP A;  1YZA A;  4LAC B;  4BEM J;  3GEE A;  1GGQ A;  3EGD A;  1RXQ A;  2G3V A;  3B9Q A;  5CI8 A;  3AGT A;  2X0C A;  3AG1 C;  4XEF A;  2NSG A;  2HUJ A;  4FES A;  1V74 B;  1XWJ A;  4PAC A;  2IXM A;  2KC3 A;  1NFN A;  4O79 A;  2B0H A;  2Q4F A;  2R7R A;  1MMD A;  5JLI A;  5GPG B;  2YHS A;  2YKZ A;  4XEK A;  4CS7 A;  3TD7 A;  5E2Q A;  3L34 A;  1KNY A;  4N6H A;  4P6I C;  3ZQV A;  4UDV A;  1L3P A;  2YL3 A;  5A6A A;  5FZT A;  5A6J A;  3K66 A;  1I5N A;  4X0R A;  5CIV A;  2CNW D;  1NBB A;  3IQT A;  1DOV A;  4Q5S F;  1MMA A;  4XLN F;  3ASN C;  2PFD A;  4J7Y A;  1OW8 A;  2FGY A;  4EHP A;  4O6N A;  3Q7G A;  4H4K C;  4FWV A;  2IXO A;  2LCH A;  3ZDL A;  2VCB A;  3TOL A;  4CSA A;  2OCC C;  1OR2 A;  4JEB A;  4LDQ A;  4N6C A;  4IAQ A;  1QKR A;  5KYY A;  2M64 A;  3VM6 A;  3IHU A;  3JYY A;  2R03 A;  3HLZ A;  2YEV A;  2Y3H A;  4I44 A;  3C8G B;  5L0G A;  1VLT A;  1TWA A;  3GWL A;  5L0J A;  2QE9 A;  1V55 C;  3BEH A;  3LAY A;  2QUP A;  4KBL A;  2GDC A;  2J0X A;  5F28 E;  4AE4 A;  1E86 A;  2R05 A;  2YL0 A;  1ZW2 A;  4NTF A;  4CJO A;  1ZU5 A;  1E83 A;  2OEX A;  1O5H A;  3IQC A;  4BJ5 A;  3JRM O;  2W9Y A;  4JCZ A;  4DBR A;  1HE1 A;  5T3W A;  2KNH A;  1H9T A;  4NCQ A;  4MVU A;  2G3K A;  4DVY P;  3EHN A;  4YL0 A;  4E0H A;  1Z63 A;  1YYX A;  4G7O F;  1G4W R;  1CGO A;  1JR8 A;  2KQ9 A;  3US6 A;  4CS9 C;  1BR1 A;  2P7V A;  5COF A;  4C3D A;  1ZHT A;  4IGG A;  2VCC A;  3EFO A;  3LUT B;  1OW6 A;  4E0I A;  3POV A;  4DRJ B;  2R7U A;  4G7Z F;  2XRH A;  1AVO B;  2AU5 A;  4MQ9 F;  3JRT A;  3KYJ A;  1ORY A;  5HV9 A;  1FTS A;  2OKU A;  1E84 A;  3JSZ A;  1T6I A;  2CYD A;  2HMZ A;  2HSQ A;  3EH1 A;  3QW0 A;  5F5H A;  4MW8 A;  4I1M A;  4DVZ A;  4AK9 A;  2B0J A;  5T1D B;  2WZL A;  4IB4 A;  1G8X A;  4O6M A;  3HKK A;  1FAP B;  1Y6D A;  2WVO A;  2RSE B;  1Z5Z A;  2YLD A;  4JJF A;  4D4X A;  2ZD9 A;  5JS5 A;  1FMV A;  1GQA A;  2L6H A;  2ZXR A;  1JPN A;  1EA8 A;  5TJ5 E;  5JP7 A;  2YL1 A;  2AVK A;  2I8B A;  2IOQ A;  4JC7 A;  3U8P A;  4DRH B;  3C7J A;  4LLE A;  2R7S A;  3B0P A;  2HMQ A;  1JRA A;  5L0I A;  1HE9 A;  4EBK A;  3GEH A;  2XM4 A;  1YA7 O;  3UMI A;  4AX2 A;  5KYN A;  4D4N A;  5E3C A;  2OU6 A;  3U5S A;  1R5I D;  1L7C A;  3ZTZ A;  1K05 A;  5DQZ A;  4MVO A;  2LD6 A;  1Q0M A;  3G50 A;  4LLC A;  2LFD A;  4JKV A;  4MVM A;  5B1A C;  3LLI A;  3GWN A;  5T3T A;  2HKV A;  2XLE A;  1S05 A;  1WAS A;  1DOW A;  3DZA A;  1D1C A;  2GFH A;  3GM1 A;  1ST6 A;  4WAB A;  2AWY A;  3WAQ A;  2YRF A;  1VMA A;  256B A;  4DOZ A;  2HFI A;  1ZYR F;  2UUI A;  4Z9J A;  4EIY A;  1RKC A;  2J45 A;  2L81 A;  2Z15 A;  3QZC A;  2HZ8 A;  2W4B A;  5JSL A;  3W4Y A;  1LS4 A;  3EG9 B;  3TOM A;  4R32 A;  4MVZ A;  4EBB A;  2Y3D A;  3DE9 A;  4QDL A;  4JUR I;  3SXM A;  4W8P A;  2Y3B A;  1Z3I X;  2G62 A;  1SMY F;  2Q9B A;  4AL0 A;  2A0B A;  2R25 A;  3FOP A;  4PFO A;  1A7V A;  5L3Q A;  1H7I A;  3DM5 A;  1EQ1 A;  3NMJ A;  2KSF A;  4KI2 A;  4I3M A;  2ASR A;  2MWQ A;  3G4Z A;  3LJB A;  3EZI A;  1G5Z A;  1O3U A;  4DRI B;  5BUO A;  5B1B C;  4ONS A;  2LP4 A;  2KYH A;  3WG7 C;  3HNK A;  1JOG A;  1XZP A;  2R7O A;  1S7Z A;  3AG2 C;  3EGX A;  4U5F E;  2MHR A;  4WGY A;  3W2V A;  5AC4 A;  1HW2 A;  3AQC A;  3ZWI A;  4DXW A;  2J9V A;  3GM2 A;  1QLE C;  1TFK B;  3T4R A;  3TJ5 A;  3EG9 A;  4MVQ A;  3ZQY A;  4MVS A;  4BEJ A;  2P0N A;  4L6R A;  4RDA A;  1YAR O;  2OOC A;  4AL1 A;  3UMH A;  1M2O A;  1TR2 A;  2PX0 A;  3GM3 A;  3ABM C;  3C18 A;  4Z9I A;  3S28 A;  3PMR A;  4PJJ A;  3B71 A;  4YT2 A;  5JRA A;  4OIO F;  2LIG A;  3WHN A;  2C03 A;  1VYK A;  4BG0 A;  5A6B A;  2HJM A;  5DVW A;  2X51 A;  2A69 F;  3K1I C;  4RD9 A;  2XLO A;  5CI9 A;  3PCV A;  1QQ3 A;  3RH3 A;  3A9C A;  4HE8 D;  1U89 A;  4YN0 B;  3ZSU A;  1EI7 A;  4ZLC A;  3RKO F;  4JTD B;  2V3C C;  2XL6 A;  1Q0G A;  3DJN B;  3I5P A;  3U3B A;  4FAP B;  5JT4 A;  1LVK A;  2QNL A;  2J0W A;  4ULV A;  5KYY B;  1NU9 C;  4U5G A;  5KYW B;  3EPV A;  2XLV A;  1PD1 A;  3Q6M A;  3UR3 C;  3DAF A;  2R7Q A;  4M63 A;  2L6G A;  4K1O A;  2HJ3 A;  1HMD A;  1LPE A;  4N06 A;  5F5F A;  4YT5 A;  1BDJ B;  2YZS A;  4CX9 A;  4EKW A;  2P6V A;  4G7H F;  3I4U A;  3SXK A;  4AE4 B;  4NTA A;  3C8Z A;  4HFK B;  3RVY A;  5BQI A;  3M79 A;  4PJN A;  4CS8 C;  1WGW A;  3U0C A;  2CNW A;  4O6Y A;  1C02 A;  5E3A A;  2XM0 A;  2R9R B;  1SZI A;  2AWC A;  5B3I A;  4RBN A;  3TUL A;  5KYX B;  2O9X A;  3SXY A;  1T01 A;  1QSP A;  1A41 A;  3RF3 A;  3EFO B;  5KYW A;  1OXK A;  4KNW A;  4WJ0 A;  2PF4 E;  3W8H A;  2YQY A;  3GOD A;  1PV3 A;  4WGZ A;  4MTG A;  2FAP B;  4ULW A;  2TMV P;  3IQ5 A;  3PDM P;  3C62 A;  4C7O B;  2R02 A;  1NSG B;  2BL2 A;  3DD7 A;  1VTM P;  4OD5 A;  2V26 A;  3ABL C;  1YDI A;  2GWW A;  2YLI A;  4XQ1 A;  4E17 A;  3DMD A;  3HNL A;  2EIK C;  3ZTM A;  3L8J A;  3NYM A;  3LEO A;  4BJ6 C;  3NKD A;  4PJL A;  1IW7 F;  2J9W A;  2W45 A;  1Z7Q c;  1EKY A;  3BRJ A;  1V54 C;  1OCC C;  5DS6 A;  5L3V A;  3T9O A;  3UMK A;  3LNM B;  3DKA A;  3N24 A;  1ORS C;  1PCX A;  2PX3 A;  3EZH A;  5DQT A;  5KYX A;  5EK0 A;  4PK4 A;  1YLM A;  4OIP F;  1M56 C;  2PBE A;  4MND A;  2WL8 A;  4U5C E;  4CBE A;  4JTA B;  3QMK A;  3VYW A;  1ZHZ A;  4C7O A;  1VYI A;  2D4U A;  3E9V A;  1BZ4 A;  1T6U A;  2KW3 C;  2QY9 A;  1OXB A;  1WWP A;  3KH2 A;  3SEO A;  2WZG A;  2YL7 A;  5K0I A;  2XLM A;  1LKX A;  2XS8 A;  4J30 B;  2WVN A;  1GS9 A;  4QI2 A;  3MFN A;  2JX0 A;  3JCU Q;  4XPY A;  2VB6 A;  1QVX A;  4G78 A;  3EH2 A;  3AOU A;  2D5R B;  1LI5 A;  3JYH A;  3HNJ A;  2HV7 A;  3NYL A;  2HV6 A;  1Q0F A;  3NMK A;  4MVR A;  3KMI A;  3U9M A;  5L0F A;  3T6G B;  4FX5 A;  4YK5 A;  1YA9 A;  3LES A;  3V5Y A;  1UG7 A;  1RKE B;  3HTK C;  5AC5 A;  1OQC A;  4U5D E;  4XPW A;  2DYR C;  3U9J A;  3VF0 A;  3IEE A;  1N1C A;  1HY5 A;  3IQ6 A;  1CGN A;  1OCZ C;  1YYJ A;  1WOL A;  2WVQ A;  2BE5 F;  4P9T A;  5D92 A;  1MMN A;  3EGX B;  2L6F A;  2JD3 A;  3UGP A;  3ASO C;  1HMO A;  3ZG1 A;  4A4A A;  1H6G A;  3QVY A;  4NTB A;  1HW1 A;  1XZQ A;  1IZM A;  1SF8 A;  4JRZ A;  1QZX A;  1TKN A;  4QI0 A;  1RMV A;  4IJJ A;  4F4B A;  1Y4C A;  3I5Q A;  4XPX A;  3FVY A;  5JVE A;  3H65 A;  3GOR A;  5EHH A;  2EPM X;  3S84 A;  3J06 A;  3CZ6 A;  2NUP B;  1VLS A;  1E2X A;  1RKE A;  4XWJ A;  4HFF B;  4J32 B;  4MTF A;  4Q7C A;  5AGF A;  5A6K A;  5HSW A;  2Q9A A;  4JIO A;  1T6Q A;  2J8W A;  2GA0 A;  1RJ9 A;  2QLA A;  1K40 A;  3IPM O;  1M6T A;  4JZA A;  3K6B A;  1B68 A;  2A6H F;  2XLW A;  3M15 A;  4CIP A;  3S0X A;  4YL1 A;  2OJE D;  3M4B A;  1OCR C;  4CDV A;  2R7W A;  4NY3 A;  4JVS A;  1A7E A;  1PD0 A;  5COG A;  2C04 A;  3SXZ A;  4CS9 A;  2J7P D;  1JAF A;  2EIM C;  2NUT B; 
#chains in the Genus database with same CATH homology
 1MQV A;  5JUA A;  2XLV A;  1RCP A;  4CJG A;  1E86 A;  2YL0 A;  2XL8 A;  1E83 A;  4CJO A;  1LM3 B;  4CX9 A;  2BC5 A;  1YYX A;  3M79 A;  1CGO A;  5JT4 A;  4IAR A;  2XM0 A;  4CDA A;  5B3I A;  1QPU A;  1CPQ A;  1E84 A;  3FOO A;  3QW0 A;  4WGZ A;  4IB4 A;  3IQ5 A;  3C62 A;  2YLD A;  4D4X A;  5JS5 A;  1GQA A;  2YLI A;  3HNL A;  3ZTM A;  5JP7 A;  2YL1 A;  3U8P A;  1EKY A;  3VRC A;  4U9E A;  2XM4 A;  4D4N A;  4ER9 A;  3ZTZ A;  3QVZ A;  4JKV A;  4JE9 A;  2XLD A;  2XLE A;  1S05 A;  1BBH A;  256B A;  3M4C A;  4EIY A;  5JSL A;  3HNI A;  3TOM A;  2YL7 A;  2XLM A;  3DE9 A;  2XLH A;  2CCY A;  3FOP A;  1YZC A;  1A7V A;  3HNJ A;  3NMK A;  3NMJ A;  4CDY A;  1APC A;  3DE8 A;  4N4W A;  3C63 A;  1YZA A;  4NC3 A;  1E85 A;  3HNK A;  4WGY A;  3IQ6 A;  1CGN A;  3L1M A;  3ZWI A;  1YYJ A;  3ZQY A;  5JLI A;  4L6R A;  3QVY A;  2YKZ A;  4N6H A;  3ZQV A;  2YL3 A;  5JRA A;  5JVE A;  1NBB A;  2J9B A;  5AGF A;  2XLO A;  1QQ3 A;  2J8W A;  2QLA A;  3NMI A;  3TOL A;  1M6T A;  3M15 A;  2XLW A;  4CIP A;  4JEB A;  1CPR A;  3M4B A;  4IAQ A;  4JEA A;  4CDV A;  3QW1 A;  2XL6 A;  4U9D A;  1JAF A;  4ULV A;  2YLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...