3ZTZA

Cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound l16g variant at 1.05 a resolution: unrestraint refinement
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSAGTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 51
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3ztzA00
4N6HA 1NBBA 4L6RA 3ZWIA 5JSLA 1CPRA 3TOMA 4JE9A 4D4NA 2XL8A 1S05A 2XM4A 3NMJA 3HNJA 1A7VA 1EKYA 1M6TA 4IAQA 3ZTZA 1APCA 3QVYA 2XLOA 4JKVA 5JLIA 4WGYA 1E84A 1YZCA 1E86A 4CDVA 3DE9A 2YL0A 3M79A 3NMKA 5JT4A 1BBHA 4CX9A 3FOPA 1RCPA 1YYJA 4ULVA 4ER9A 4JEBA 4IB4A 2YKZA 4EIYA 1MQVA 1CGNA 1YYXA 1JAFA 2J8WA 4U9EA 2YLDA 256BA 4CJGA 4CJOA 2XM0A 2YL7A 3M15A 4JEAA 4D4XA 3L1MA 2YL3A 1YZAA 3NMIA 2XLVA 2BC5A 4IARA 2J9BA 5JP7A 4CDYA 1E83A 1CGOA 3HNIA 4WGZA 1QPUA 3QW0A 5JRAA 3C63A 3HNKA 4U9DA 5B3IA 3TOLA 2XL6A 2XLWA 1QQ3A 4CDAA 3QW1A 3ZQVA 3FOOA 1GQAA 3M4BA 2YL1A 1CPQA 4NC3A 2QLAA 5JS5A 2XLHA 2YLIA 3C62A 2CCYA 4N4WA 3M4CA 3ZTMA 1LM3B 3IQ6A 2YLGA 4CIPA 3QVZA 5JUAA 3VRCA 3DE8A 3HNLA 3ZQYA 1E85A 3U8PA 2XLEA 2XLMA 2XLDA 3IQ5A 5AGFA 5JVEA
chains in the Genus database with same CATH superfamily
4C7OA 2LQGA 4EHPA 2DGJA 1HW2A 4MTGA 1A0BA 2LCHA 2YVKA 3JSEO 4IAOA 1CPRA 3KL4A 2R7UA 1M2VA 1T01A 1WN0A 2XL8A 3HTKC 4C7OB 3DJUB 1NLXA 3C18A 5IY5C 2OJQA 4W8KA 1HMOA 4Z9HA 2LFDA 3NMJA 2HZ8A 3TD7A 3JYHA 3I5QA 4K7BA 1D1AA 1M2VB 2NSFA 2OQMA 4XPWA 4M63A 5E3CA 3S29A 3VYWA 2LIGA 1M6TA 4K1OA 1I4YA 2IBFA 4E0HA 4MVUA 5GPGB 5CI8A 3US6A 3EG9A 4BJ1A 1MMAA 4JKVA 3V5ZA 5B1BC 4DRJB 3AG2C 4OD4A 3OWTA 5T3TA 2LK4A 3H2UA 3EGXA 1YZCA 3S0XA 3TJ5A 5A6BA 2OOCA 3DE9A 4CDVA 3PHF2 3AQBA 3NMKA 5JT4A 1O3UA 3QTHA 4CX9A 3FOPA 2NG1A 3LEOA 3Q7GA 1WWPA 4WJ0A 1RCPA 4MS2A 3EGXB 3IQTA 4JEBA 5KYWB 4CS9A 1JRAA 4XPYA 3SYNA 1ZVZA 3W8HA 1K04A 2HMQA 3B9QA 1YA7O 1M56C 3DXJF 1HMDA 2VCAA 1GS9A 2J8WA 4U9EA 1ZU4A 256BA 1Q0DA 2J9VA 3RVZA 1VK5A 4NCQA 1U6HA 5EK0A 4I44A 2Y69C 1W2WA 5AC4A 2CW0F 4N6CA 1M2OA 2YL7A 2D5RB 2Q4FA 4JVSA 2BL2A 1FNTc 4CSAC 2NUTB 4UDVA 4JEAA 3EHMA 3EPVA 3JT1A 5EHHA 5DQZA 2OJED 1YZAA 3ASNC 4OIQF 2BC5A 1VYIA 2WVQA 2Y3HA 2J9BA 1QVXA 3DJNB 3JRMO 2A69F 1GM5A 4CDYA 4MVOA 1E83A 5T3WA 2XRHA 1YDIA 1LI7A 3GM3A 3VM6A 1NZEA 3IHUA 4WGZA 3ZVRA 5BQIA 2EPMX 1Q0GA 1ST6A 2HS5A 2IXNA 4OIPF 3JZ0A 3UGPA 3KYJA 2G62A 3U2MA 3K6BA 1TFOB 2BE5F 2EPKX 1MMGA 1V55C 2KNHA 3FVYA 3AGUA 4MVZA 3ZC4A 1SZIA 1ZW2A 4MTFA 2GDCA 3K66A 1O5HA 1XZQA 2EIMC 2JD3A 2P61A 2KYHA 5COMA 4AL1A 1OXBA 2XLWA 3EJNA 4I1MA 1LKXA 4DVYP 1ZHZA 4YL0A 1OKKA 3UMIA 3ZQVA 5DQTA 4BJ6A 1AUEA 1H9TA 3T6JA 2Q7RA 2AP3A 2RSEB 2W4MA 4DJ9A 3C7JA 5DS5A 2R7XA 1PD0A 1H6GA 5FZTA 2A0UA 2V3CC 2XLHA 2M64A 2W45A 2IOQA 4YK5A 1ORJA 2EIJC 5E3AA 1OQCA 2J7PD 3DM5A 1C02A 2H7OA 1I4ZA 3NG1A 3S27A 1MNDA 2VC9A 4BJ5C 3QVZA 2A6EF 4PJJA 2YEVA 5JUAA 3W2WA 1KNYA 1L3PA 2AWYA 2L6GA 2GWWA 1PCXA 2EINC 3LNRA 3ZQYA 2ZXOA 5BQGA 2RD9A 2PF4E 3U8VA 4BEMJ 4JW1A 5B3SC 2P6VA 2KJGA 2EPOA 2XLMA 3ATPA 2QNLA 3HKKA 2XLDA 2LFFA 3IQ5A 1YA9A 5AGFA 5COFA 2XSEA 2XS8A 1OR3A 4N06A 4Q7CA 3LNMB 4P6IC 1XWJA 1RJ9A 3TJ6A 2CNWA 3C8GD 5DS4A 2GFHA 4N6HA 1SF8A 2C04A 2EPNA 2ZPAA 2OEVA 5JSLA 1OR2A 3TOMA 4KI2A 4LERA 1MMNA 4JE9A 3SZRA 3RQFA 5D92A 3TULA 1AEPA 1QLEC 2R7RA 3B0VC 3LEVA 2OG2A 2PBEA 4EWCA 3KPHA 1MMDA 5COGA 1EQ1A 1Q0MA 2XM4A 4H4KC 3JRTA 1EKYA 1D0ZA 3HNJA 4QI0A 4C3DA 5F5HA 4MQ9F 3G50A 5KYNA 4CIPA 3DZAA 3AG3C 3U0CA 1OCOC 3K1IC 3QVYA 3F46A 1U89A 3DAGA 2VCBA 3ZG1A 4WGYA 4XQ1A 1C17M 3RW0A 2QY9A 4CS8A 3GM1A 4ZLCA 3U3FA 1H9GA 1HY5A 2A0BA 2OU6A 4DVZA 3WHNA 1NFNA 2VB6A 1A7DA 2VASA 1Z7Qc 2GAQA 4LDKA 3UMKA 3MLGA 4Q4ZF 2YHSA 4ULVA 4AX2A 2E87A 1CGME 1OCZC 2I15A 3ASOC 3QZCA 2MHRA 5E2QA 3T9OA 3JSZA 1Q0KA 2YKZA 3AG4C 4EIYA 1B68A 1MQVA 2P0NA 3CAXA 2WZFA 1YYXA 1JAFA 2CYDA 2L6HA 1OW7A 2PFDA 1QSPA 2YLDA 3EH2A 3LAYA 3N24A 4PJNA 4E7SA 5DLJA 1VOMA 5L3VA 1FFHA 2EPLX 4EKWA 4OIOF 2IXOA 3S84A 4P9FA 4PJLA 2KW3C 3NDBB 4D4XA 2J9UA 3ZIBA 1S7ZA 2W4BA 4X0RA 3NMIA 2R05A 2XLVA 1RKEA 3CEXA 4IARA 2OEXA 1ZYRF 5JP7A 5KYWA 4MW8A 2W9YA 3AJMA 1CGOA 1RXQA 3B71A 3TK0A 4C3BA 1SYQA 3UR3C 1RKEB 4J30B 3U2LA 1KU2A 2Y3BA 2J0WA 1I5NA 4YL3A 4NY3A 5B1AC 3RYLA 3DM9B 3HNKA 2NUTA 2KC3A 5L0DA 5L0CA 3JTLO 2L81A 1NG1A 2R7SA 2ICWG 3TOLA 3C8ZA 4Q5SF 2XL6A 4E17A 5DVWA 2CDQA 1BZ4A 1YLMA 4G7OF 4CS9C 3FXHA 3U9JA 3GM2A 4LDRA 3UMHA 3WG7C 4O6MA 4CDAA 3KH2A 3GANA 1IW7F 4P9TA 1ORYA 2A6HF 2YZSA 3GEHA 1RKCA 4YT8A 1Q0FA 1C03A 3GORA 3EHNA 3TQOA 3UNGC 1D0XA 1T6IA 1D1CA 2XL4A 3KYIA 4G78A 1V54C 1TWCA 3ABMC 3AOUA 3C8GA 1G4US 3C62A 3LESA 4NTFA 1ZZPA 2CCYA 3RFYA 1K40A 1IZMA 2KQ9A 1WOLA 3GWNA 3LLIA 3SXZA 1TR2A 5A69A 1LM3B 1VLSA 1G8XA 3ECSA 2HFIA 4JURI 3RH3A 5CIVA 2PP4A 3ABKC 3EQLF 3C8GB 1TWHA 1E85A 2R02A 1PV3A 4XEFA 5EGYA 2XXAA 3WAQA 2H7VC 1ZW3A 3K1HA 4XLNF 2EIKC 3BEHA 1LS4A 5JVEA 2HV7A 2WVNA 4XLPF 1RMVA 2IYLD 2YRFA 3VAYA 4DBRA 1N1CA 1FAPB 4HE8D 1UFBA 3N2ZB 2XXAB 1JPNA 3EH1A 1LPEA 1M57C 3IQCA 3ZWIA 4YT2A 4U5DE 1R5ID 2P1AA 3PMRA 4D4NA 4O6YA 3POVA 2TMVP 2CGEA 4DBQA 2FAPB 4XTKA 1D0YA 3SNHA 1VLTA 1A7EA 2Q9CA 4OD5A 3V5XA 3LUTB 3M1CB 4O6NA 3V7OA 4EUKB 5A6BD 2ETSA 1A7VA 1ZHYA 4PK4A 4XEKA 3VF0A 5AC5A 4G7ZF 4BPMA 1OXKA 2H8AA 4IAQA 4JZAA 2NUPA 2XS1A 4YL1A 3SEOA 3ZTZA 4BJ6C 5T1DB 3R2PA 4J32B 2QE9A 4E18A 2IXMA 4FWVA 5KYUA 2Y3DA 1LIHA 2HMZA 3JCUQ 4Z9JA 2J0XA 2WZLA 1E84A 1E86A 4KC9A 4MVSA 4JC7A 2NUPB 3ABLC 3M79A 3RVYA 5L0IA 5HSWA 3SXMA 1BBHA 1JOGA 2B0JA 1V74B 3Q7LA 5KYUB 2ZXRA 4CIHA 1PD1A 5E33A 1MNEA 3NYMA 4JRZA 5L0GA 4FAPB 4IB4A 4MNDA 1BR2A 1R4TA 1SR2A 4MVRA 1WASA 3NYLA 4FX5A 3ITFA 1DOVA 1K05A 3KMIA 4PR9A 5FCLA 1CGNA 4O7GA 5HV9A 3U3BA 4QI2A 1KTMA 4LACB 3L0IA 2HJ3A 3CQZA 1UG7A 2KK1A 3JYYA 4EBJA 4CJOA 2MYSA 3U5SA 1WTYA 3AGTA 4LLEA 5A6AA 2XM0A 2Q00A 2YQYA 4HFFB 2J46A 4I1OB 1WGWA 1LVKA 3L1MA 2YL3A 4O79A 4ANJA 2IXPA 4GYTA 3CZ6A 4EBBA 1ZHTA 3L8IA 2VCCA 1ORSC 1H7IA 2A1DD 4JCHA 2R9RB 5F28E 4OIRF 4AE4B 4CS7A 2J9WA 3CSKA 4XPXA 1TWGA 3T6BA 4CBEA 2DYSC 3GODA 3NKDA 2DB4A 2M4EA 4MTOA 1NFOA 4PFPA 4RBNA 2LSEA 4CS8C 1HW1A 4I3MA 4JTCB 2L9JA 3C63A 3MBGA 4JJFA 3B0PA 2OKUA 4JJGA 3X2QC 5BUOA 2KSFA 1OKKD 1BR1A 3EZIA 4U9DA 1VB5A 1J8MF 2Y39A 2WZGA 3OA1A 4U5BE 5CI9A 3RF3A 2IM8A 4QDLA 1FMVA 3ZSUA 4YJWA 2H7BA 2YWAA 2HUJA 3K33A 2OCCC 3M4BA 4A2NB 1VMAA 3T4RA 3AG1C 2MWQA 3H2VA 2QLAA 1JMWA 4DOZA 4A4AA 4F4BA 1TQGA 3NYJA 1LS1A 1E2XA 4J7TA 4NTAA 1Z3IX 4ZLDA 2GA0A 3MX3A 4MVMA 3B0UX 3M4CA 5A6JA 2LP4A 1EI7A 1YAUO 2ZXWC 3EZHA 2YLGA 3I4UA 3IQ6A 2CNWD 2O9XA 2PNOA 4BJTA 2HSBA 2HJMA 3VRCA 4DRHB 3I5PA 3HNLA 5L3QA 2J45A 4HEAJ 1Z5ZA 4ONSA 4G7HF 2Q9BA 2R7TA 3O10A 1VYKA 4J7YA 3U8PA 4AL0A 2X0CA 1HE9A 2J7PA 1LE4A 3DWWA 3F47A 3QMKA 3RQGA 5K0IA 2UUHA 3MYIA 4YT4A 3EG9B 4XWJA 2Q9AA 4H54A 3S90A 1NBBA 4L6RA 1TWAA 4CSAA 3L34A 2R25A 1U0BB 2ASRA 3X1OA 3J06A 4OINF 4C3EA 2WVOA 1S05A 3V5YA 3SXYA 4WABA 4U5GA 4FESA 3NRHA 2JX0A 2X51A 2AVKA 2C03A 3HLZA 3S9OA 5DS6A 4IWBA 1T6UA 3LS1A 5L0FA 5KYYA 1DOWA 3A9CA 1APCA 3R7CA 2LD6A 1Z23A 2XLOA 1T9KA 1QKRA 1JR8A 1GGQA 5JLIA 4R32A 3RIPA 3E70C 5D91A 1OCCC 2AU5A 4YWQA 5L0JA 5KYYB 2YL0A 2AWCA 4EBKA 3AQCA 1VTMP 4BG0A 3G4ZA 2QTVA 3ZDLA 1OCRC 1QZXA 3MFNA 1YYJA 2B0HA 2V26A 4ULWA 4Z9IA 3W4YA 4MW3A 3W8IA 4ER9A 3S28A 4DRIB 3HJCA 2Q3TA 4PJMA 3PDMP 2PX0A 2F22A 4LDQA 4K0DA 2JPUA 3BRJA 2FGYA 4U5CE 3K7DA 4AK9A 3H65A 2WB7A 3DI5A 2A68F 3A11A 4CJGA 4JIOA 3FDQA 1LI5A 1L7CA 3DD7A 3FMSA 4RD9A 4YT5A 2NPUA 2KGOA 3GEIA 4U5HA 2P7VA 3E9VA 3Q6NA 3O55A 4W8PA 4YN0B 4JCZA 3M15A 4JTDB 5BQHA 3O39A 4IRUA 3GEEA 5F5FA 2R7QA 2ZXPA 5L0HA 1WATA 2EILC 1ZHXA 2R7OA 3RQEA 3L8JA 3OEOA 3MYFA 3B29A 4GEHA 4BJ5A 3IEEA 2FFHA 2G3VA 4BEJA 3W2VA 2HV6A 1G5ZA 3HNIA 1HE1A 2DI3A 1J8YF 2VH3A 3U9MA 2PX3A 1A41A 1OW6A 1ZHWA 1TFKB 1EA8A 3GWLA 3EFOA 3PCVA 2G3KA 4KNVA 1QPUA 2DYRC 4U5FE 3G4XA 4KNWA 4XEVA 3QW0A 3RKOF 2I8BA 5JRAA 1T5OA 1ZU5A 1YARO 3Q6MA 1YVIA 3EFOB 3DAFA 1Y4CA 5B3IA 1FR0A 1V4AA 3O6XA 2L6FA 2D4UA 3SP1A 5A6KA 1O87A 3UGOA 4HFKB 1JPJA 3WODF 5KYXA 4AE4A 1TKNA 3EGDA 1Y6DA 3DMDA 4LLCA 1D1BA 4NQFA 3LJBA 3N0TA 1QQ3A 2L7AA 3QW1A 4E0IA 5TJ5E 4E7ZA 1Z6AA 2Z15A 1FTSA 3IPMO 3FOOA 1GQAA 1BR4A 3DKAA 3K1IA 2HSQA 4KBLA 2YL1A 5KYXB 3EGDB 1CPQA 1RJ9B 1NSGB 4NC3A 4DXWA 4RDAA 1NU7D 4U5EE 2R7WA 4GQHA 1AVOB 3FHDA 3NKEA 4JTAB 5JS5A 2YLIA 4NTBA 3T6GB 3FAJA 1BDJB 2WL8A 4N4WA 2QUPA 4MVQA 4IJJA 3ZTMA 2UUIA 3KKBA 4B6IA 4IGGA 1T6QA 3LLKA 2R7VA 1FFTC 2Y3GA 2HKVA 1F1MA 3DE8A 1SMYF 4PFOA 1Z63A 1NU9C 1FMWA 2R03A 3FAPB 2NSGA 2XLEA 3LS0A 1XZPA 3SXKA 1YJGA 1G4WR 2ZD9A 4PACA 1OW8A 4G0HA 1LE2A
chains in the Genus database with same CATH topology
4N6HA 1NBBA 4L6RA 3ZWIA 5JSLA 1CPRA 3TOMA 4JE9A 4D4NA 2XL8A 1S05A 2XM4A 3NMJA 3HNJA 1A7VA 1EKYA 1M6TA 4IAQA 3ZTZA 1APCA 3QVYA 2XLOA 4JKVA 5JLIA 4WGYA 1E84A 1YZCA 1E86A 4CDVA 3DE9A 2YL0A 3M79A 3NMKA 5JT4A 1BBHA 4CX9A 3FOPA 1RCPA 1YYJA 4ULVA 4ER9A 4JEBA 4IB4A 2YKZA 4EIYA 1MQVA 1CGNA 1YYXA 1JAFA 2J8WA 4U9EA 2YLDA 256BA 4CJGA 4CJOA 2XM0A 2YL7A 3M15A 4JEAA 4D4XA 3L1MA 2YL3A 1YZAA 3NMIA 2XLVA 2BC5A 4IARA 2J9BA 5JP7A 4CDYA 1E83A 1CGOA 3HNIA 4WGZA 1QPUA 3QW0A 5JRAA 3C63A 3HNKA 4U9DA 5B3IA 3TOLA 2XL6A 2XLWA 1QQ3A 4CDAA 3QW1A 3ZQVA 3FOOA 1GQAA 3M4BA 2YL1A 1CPQA 4NC3A 2QLAA 5JS5A 2XLHA 2YLIA 3C62A 2CCYA 4N4WA 3M4CA 3ZTMA 1LM3B 3IQ6A 2YLGA 4CIPA 3QVZA 5JUAA 3VRCA 3DE8A 3HNLA 3ZQYA 1E85A 3U8PA 2XLEA 2XLMA 2XLDA 3IQ5A 5AGFA 5JVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6H A;  1NBB A;  4L6R A;  3ZWI A;  5JSL A;  1CPR A;  3TOM A;  4JE9 A;  4D4N A;  2XL8 A;  1S05 A;  2XM4 A;  3NMJ A;  3HNJ A;  1A7V A;  1EKY A;  1M6T A;  4IAQ A;  3ZTZ A;  1APC A;  3QVY A;  2XLO A;  4JKV A;  5JLI A;  4WGY A;  1E84 A;  1YZC A;  1E86 A;  4CDV A;  3DE9 A;  2YL0 A;  3M79 A;  3NMK A;  5JT4 A;  1BBH A;  4CX9 A;  3FOP A;  1RCP A;  1YYJ A;  4ULV A;  4ER9 A;  4JEB A;  4IB4 A;  2YKZ A;  4EIY A;  1MQV A;  1CGN A;  1YYX A;  1JAF A;  2J8W A;  4U9E A;  2YLD A;  256B A;  4CJG A;  4CJO A;  2XM0 A;  2YL7 A;  3M15 A;  4JEA A;  4D4X A;  3L1M A;  2YL3 A;  1YZA A;  3NMI A;  2XLV A;  2BC5 A;  4IAR A;  2J9B A;  5JP7 A;  4CDY A;  1E83 A;  1CGO A;  3HNI A;  4WGZ A;  1QPU A;  3QW0 A;  5JRA A;  3C63 A;  3HNK A;  4U9D A;  5B3I A;  3TOL A;  2XL6 A;  2XLW A;  1QQ3 A;  4CDA A;  3QW1 A;  3ZQV A;  3FOO A;  1GQA A;  3M4B A;  2YL1 A;  1CPQ A;  4NC3 A;  2QLA A;  5JS5 A;  2XLH A;  2YLI A;  3C62 A;  2CCY A;  4N4W A;  3M4C A;  3ZTM A;  1LM3 B;  3IQ6 A;  2YLG A;  4CIP A;  3QVZ A;  5JUA A;  3VRC A;  3DE8 A;  3HNL A;  3ZQY A;  1E85 A;  3U8P A;  2XLE A;  2XLM A;  2XLD A;  3IQ5 A;  5AGF A;  5JVE A; 
#chains in the Genus database with same CATH topology
 4C7O A;  2LQG A;  4EHP A;  2DGJ A;  1HW2 A;  4MTG A;  1A0B A;  2LCH A;  2YVK A;  3JSE O;  4IAO A;  1CPR A;  3KL4 A;  2R7U A;  1M2V A;  1T01 A;  1WN0 A;  2XL8 A;  3HTK C;  4C7O B;  3DJU B;  1NLX A;  3C18 A;  5IY5 C;  2OJQ A;  4W8K A;  1HMO A;  4Z9H A;  2LFD A;  3NMJ A;  2HZ8 A;  3TD7 A;  3JYH A;  3I5Q A;  4K7B A;  1D1A A;  1M2V B;  2NSF A;  2OQM A;  4XPW A;  4M63 A;  5E3C A;  3S29 A;  3VYW A;  2LIG A;  1M6T A;  4K1O A;  1I4Y A;  2IBF A;  4E0H A;  4MVU A;  5GPG B;  5CI8 A;  3US6 A;  3EG9 A;  4BJ1 A;  1MMA A;  4JKV A;  3V5Z A;  5B1B C;  4DRJ B;  3AG2 C;  4OD4 A;  3OWT A;  5T3T A;  2LK4 A;  3H2U A;  3EGX A;  1YZC A;  3S0X A;  3TJ5 A;  5A6B A;  2OOC A;  3DE9 A;  4CDV A;  3PHF 2;  3AQB A;  3NMK A;  5JT4 A;  1O3U A;  3QTH A;  4CX9 A;  3FOP A;  2NG1 A;  3LEO A;  3Q7G A;  1WWP A;  4WJ0 A;  1RCP A;  4MS2 A;  3EGX B;  3IQT A;  4JEB A;  5KYW B;  4CS9 A;  1JRA A;  4XPY A;  3SYN A;  1ZVZ A;  3W8H A;  1K04 A;  2HMQ A;  3B9Q A;  1YA7 O;  1M56 C;  3DXJ F;  1HMD A;  2VCA A;  1GS9 A;  2J8W A;  4U9E A;  1ZU4 A;  256B A;  1Q0D A;  2J9V A;  3RVZ A;  1VK5 A;  4NCQ A;  1U6H A;  5EK0 A;  4I44 A;  2Y69 C;  1W2W A;  5AC4 A;  2CW0 F;  4N6C A;  1M2O A;  2YL7 A;  2D5R B;  2Q4F A;  4JVS A;  2BL2 A;  1FNT c;  4CSA C;  2NUT B;  4UDV A;  4JEA A;  3EHM A;  3EPV A;  3JT1 A;  5EHH A;  5DQZ A;  2OJE D;  1YZA A;  3ASN C;  4OIQ F;  2BC5 A;  1VYI A;  2WVQ A;  2Y3H A;  2J9B A;  1QVX A;  3DJN B;  3JRM O;  2A69 F;  1GM5 A;  4CDY A;  4MVO A;  1E83 A;  5T3W A;  2XRH A;  1YDI A;  1LI7 A;  3GM3 A;  3VM6 A;  1NZE A;  3IHU A;  4WGZ A;  3ZVR A;  5BQI A;  2EPM X;  1Q0G A;  1ST6 A;  2HS5 A;  2IXN A;  4OIP F;  3JZ0 A;  3UGP A;  3KYJ A;  2G62 A;  3U2M A;  3K6B A;  1TFO B;  2BE5 F;  2EPK X;  1MMG A;  1V55 C;  2KNH A;  3FVY A;  3AGU A;  4MVZ A;  3ZC4 A;  1SZI A;  1ZW2 A;  4MTF A;  2GDC A;  3K66 A;  1O5H A;  1XZQ A;  2EIM C;  2JD3 A;  2P61 A;  2KYH A;  5COM A;  4AL1 A;  1OXB A;  2XLW A;  3EJN A;  4I1M A;  1LKX A;  4DVY P;  1ZHZ A;  4YL0 A;  1OKK A;  3UMI A;  3ZQV A;  5DQT A;  4BJ6 A;  1AUE A;  1H9T A;  3T6J A;  2Q7R A;  2AP3 A;  2RSE B;  2W4M A;  4DJ9 A;  3C7J A;  5DS5 A;  2R7X A;  1PD0 A;  1H6G A;  5FZT A;  2A0U A;  2V3C C;  2XLH A;  2M64 A;  2W45 A;  2IOQ A;  4YK5 A;  1ORJ A;  2EIJ C;  5E3A A;  1OQC A;  2J7P D;  3DM5 A;  1C02 A;  2H7O A;  1I4Z A;  3NG1 A;  3S27 A;  1MND A;  2VC9 A;  4BJ5 C;  3QVZ A;  2A6E F;  4PJJ A;  2YEV A;  5JUA A;  3W2W A;  1KNY A;  1L3P A;  2AWY A;  2L6G A;  2GWW A;  1PCX A;  2EIN C;  3LNR A;  3ZQY A;  2ZXO A;  5BQG A;  2RD9 A;  2PF4 E;  3U8V A;  4BEM J;  4JW1 A;  5B3S C;  2P6V A;  2KJG A;  2EPO A;  2XLM A;  3ATP A;  2QNL A;  3HKK A;  2XLD A;  2LFF A;  3IQ5 A;  1YA9 A;  5AGF A;  5COF A;  2XSE A;  2XS8 A;  1OR3 A;  4N06 A;  4Q7C A;  3LNM B;  4P6I C;  1XWJ A;  1RJ9 A;  3TJ6 A;  2CNW A;  3C8G D;  5DS4 A;  2GFH A;  4N6H A;  1SF8 A;  2C04 A;  2EPN A;  2ZPA A;  2OEV A;  5JSL A;  1OR2 A;  3TOM A;  4KI2 A;  4LER A;  1MMN A;  4JE9 A;  3SZR A;  3RQF A;  5D92 A;  3TUL A;  1AEP A;  1QLE C;  2R7R A;  3B0V C;  3LEV A;  2OG2 A;  2PBE A;  4EWC A;  3KPH A;  1MMD A;  5COG A;  1EQ1 A;  1Q0M A;  2XM4 A;  4H4K C;  3JRT A;  1EKY A;  1D0Z A;  3HNJ A;  4QI0 A;  4C3D A;  5F5H A;  4MQ9 F;  3G50 A;  5KYN A;  4CIP A;  3DZA A;  3AG3 C;  3U0C A;  1OCO C;  3K1I C;  3QVY A;  3F46 A;  1U89 A;  3DAG A;  2VCB A;  3ZG1 A;  4WGY A;  4XQ1 A;  1C17 M;  3RW0 A;  2QY9 A;  4CS8 A;  3GM1 A;  4ZLC A;  3U3F A;  1H9G A;  1HY5 A;  2A0B A;  2OU6 A;  4DVZ A;  3WHN A;  1NFN A;  2VB6 A;  1A7D A;  2VAS A;  1Z7Q c;  2GAQ A;  4LDK A;  3UMK A;  3MLG A;  4Q4Z F;  2YHS A;  4ULV A;  4AX2 A;  2E87 A;  1CGM E;  1OCZ C;  2I15 A;  3ASO C;  3QZC A;  2MHR A;  5E2Q A;  3T9O A;  3JSZ A;  1Q0K A;  2YKZ A;  3AG4 C;  4EIY A;  1B68 A;  1MQV A;  2P0N A;  3CAX A;  2WZF A;  1YYX A;  1JAF A;  2CYD A;  2L6H A;  1OW7 A;  2PFD A;  1QSP A;  2YLD A;  3EH2 A;  3LAY A;  3N24 A;  4PJN A;  4E7S A;  5DLJ A;  1VOM A;  5L3V A;  1FFH A;  2EPL X;  4EKW A;  4OIO F;  2IXO A;  3S84 A;  4P9F A;  4PJL A;  2KW3 C;  3NDB B;  4D4X A;  2J9U A;  3ZIB A;  1S7Z A;  2W4B A;  4X0R A;  3NMI A;  2R05 A;  2XLV A;  1RKE A;  3CEX A;  4IAR A;  2OEX A;  1ZYR F;  5JP7 A;  5KYW A;  4MW8 A;  2W9Y A;  3AJM A;  1CGO A;  1RXQ A;  3B71 A;  3TK0 A;  4C3B A;  1SYQ A;  3UR3 C;  1RKE B;  4J30 B;  3U2L A;  1KU2 A;  2Y3B A;  2J0W A;  1I5N A;  4YL3 A;  4NY3 A;  5B1A C;  3RYL A;  3DM9 B;  3HNK A;  2NUT A;  2KC3 A;  5L0D A;  5L0C A;  3JTL O;  2L81 A;  1NG1 A;  2R7S A;  2ICW G;  3TOL A;  3C8Z A;  4Q5S F;  2XL6 A;  4E17 A;  5DVW A;  2CDQ A;  1BZ4 A;  1YLM A;  4G7O F;  4CS9 C;  3FXH A;  3U9J A;  3GM2 A;  4LDR A;  3UMH A;  3WG7 C;  4O6M A;  4CDA A;  3KH2 A;  3GAN A;  1IW7 F;  4P9T A;  1ORY A;  2A6H F;  2YZS A;  3GEH A;  1RKC A;  4YT8 A;  1Q0F A;  1C03 A;  3GOR A;  3EHN A;  3TQO A;  3UNG C;  1D0X A;  1T6I A;  1D1C A;  2XL4 A;  3KYI A;  4G78 A;  1V54 C;  1TWC A;  3ABM C;  3AOU A;  3C8G A;  1G4U S;  3C62 A;  3LES A;  4NTF A;  1ZZP A;  2CCY A;  3RFY A;  1K40 A;  1IZM A;  2KQ9 A;  1WOL A;  3GWN A;  3LLI A;  3SXZ A;  1TR2 A;  5A69 A;  1LM3 B;  1VLS A;  1G8X A;  3ECS A;  2HFI A;  4JUR I;  3RH3 A;  5CIV A;  2PP4 A;  3ABK C;  3EQL F;  3C8G B;  1TWH A;  1E85 A;  2R02 A;  1PV3 A;  4XEF A;  5EGY A;  2XXA A;  3WAQ A;  2H7V C;  1ZW3 A;  3K1H A;  4XLN F;  2EIK C;  3BEH A;  1LS4 A;  5JVE A;  2HV7 A;  2WVN A;  4XLP F;  1RMV A;  2IYL D;  2YRF A;  3VAY A;  4DBR A;  1N1C A;  1FAP B;  4HE8 D;  1UFB A;  3N2Z B;  2XXA B;  1JPN A;  3EH1 A;  1LPE A;  1M57 C;  3IQC A;  3ZWI A;  4YT2 A;  4U5D E;  1R5I D;  2P1A A;  3PMR A;  4D4N A;  4O6Y A;  3POV A;  2TMV P;  2CGE A;  4DBQ A;  2FAP B;  4XTK A;  1D0Y A;  3SNH A;  1VLT A;  1A7E A;  2Q9C A;  4OD5 A;  3V5X A;  3LUT B;  3M1C B;  4O6N A;  3V7O A;  4EUK B;  5A6B D;  2ETS A;  1A7V A;  1ZHY A;  4PK4 A;  4XEK A;  3VF0 A;  5AC5 A;  4G7Z F;  4BPM A;  1OXK A;  2H8A A;  4IAQ A;  4JZA A;  2NUP A;  2XS1 A;  4YL1 A;  3SEO A;  3ZTZ A;  4BJ6 C;  5T1D B;  3R2P A;  4J32 B;  2QE9 A;  4E18 A;  2IXM A;  4FWV A;  5KYU A;  2Y3D A;  1LIH A;  2HMZ A;  3JCU Q;  4Z9J A;  2J0X A;  2WZL A;  1E84 A;  1E86 A;  4KC9 A;  4MVS A;  4JC7 A;  2NUP B;  3ABL C;  3M79 A;  3RVY A;  5L0I A;  5HSW A;  3SXM A;  1BBH A;  1JOG A;  2B0J A;  1V74 B;  3Q7L A;  5KYU B;  2ZXR A;  4CIH A;  1PD1 A;  5E33 A;  1MNE A;  3NYM A;  4JRZ A;  5L0G A;  4FAP B;  4IB4 A;  4MND A;  1BR2 A;  1R4T A;  1SR2 A;  4MVR A;  1WAS A;  3NYL A;  4FX5 A;  3ITF A;  1DOV A;  1K05 A;  3KMI A;  4PR9 A;  5FCL A;  1CGN A;  4O7G A;  5HV9 A;  3U3B A;  4QI2 A;  1KTM A;  4LAC B;  3L0I A;  2HJ3 A;  3CQZ A;  1UG7 A;  2KK1 A;  3JYY A;  4EBJ A;  4CJO A;  2MYS A;  3U5S A;  1WTY A;  3AGT A;  4LLE A;  5A6A A;  2XM0 A;  2Q00 A;  2YQY A;  4HFF B;  2J46 A;  4I1O B;  1WGW A;  1LVK A;  3L1M A;  2YL3 A;  4O79 A;  4ANJ A;  2IXP A;  4GYT A;  3CZ6 A;  4EBB A;  1ZHT A;  3L8I A;  2VCC A;  1ORS C;  1H7I A;  2A1D D;  4JCH A;  2R9R B;  5F28 E;  4OIR F;  4AE4 B;  4CS7 A;  2J9W A;  3CSK A;  4XPX A;  1TWG A;  3T6B A;  4CBE A;  2DYS C;  3GOD A;  3NKD A;  2DB4 A;  2M4E A;  4MTO A;  1NFO A;  4PFP A;  4RBN A;  2LSE A;  4CS8 C;  1HW1 A;  4I3M A;  4JTC B;  2L9J A;  3C63 A;  3MBG A;  4JJF A;  3B0P A;  2OKU A;  4JJG A;  3X2Q C;  5BUO A;  2KSF A;  1OKK D;  1BR1 A;  3EZI A;  4U9D A;  1VB5 A;  1J8M F;  2Y39 A;  2WZG A;  3OA1 A;  4U5B E;  5CI9 A;  3RF3 A;  2IM8 A;  4QDL A;  1FMV A;  3ZSU A;  4YJW A;  2H7B A;  2YWA A;  2HUJ A;  3K33 A;  2OCC C;  3M4B A;  4A2N B;  1VMA A;  3T4R A;  3AG1 C;  2MWQ A;  3H2V A;  2QLA A;  1JMW A;  4DOZ A;  4A4A A;  4F4B A;  1TQG A;  3NYJ A;  1LS1 A;  1E2X A;  4J7T A;  4NTA A;  1Z3I X;  4ZLD A;  2GA0 A;  3MX3 A;  4MVM A;  3B0U X;  3M4C A;  5A6J A;  2LP4 A;  1EI7 A;  1YAU O;  2ZXW C;  3EZH A;  2YLG A;  3I4U A;  3IQ6 A;  2CNW D;  2O9X A;  2PNO A;  4BJT A;  2HSB A;  2HJM A;  3VRC A;  4DRH B;  3I5P A;  3HNL A;  5L3Q A;  2J45 A;  4HEA J;  1Z5Z A;  4ONS A;  4G7H F;  2Q9B A;  2R7T A;  3O10 A;  1VYK A;  4J7Y A;  3U8P A;  4AL0 A;  2X0C A;  1HE9 A;  2J7P A;  1LE4 A;  3DWW A;  3F47 A;  3QMK A;  3RQG A;  5K0I A;  2UUH A;  3MYI A;  4YT4 A;  3EG9 B;  4XWJ A;  2Q9A A;  4H54 A;  3S90 A;  1NBB A;  4L6R A;  1TWA A;  4CSA A;  3L34 A;  2R25 A;  1U0B B;  2ASR A;  3X1O A;  3J06 A;  4OIN F;  4C3E A;  2WVO A;  1S05 A;  3V5Y A;  3SXY A;  4WAB A;  4U5G A;  4FES A;  3NRH A;  2JX0 A;  2X51 A;  2AVK A;  2C03 A;  3HLZ A;  3S9O A;  5DS6 A;  4IWB A;  1T6U A;  3LS1 A;  5L0F A;  5KYY A;  1DOW A;  3A9C A;  1APC A;  3R7C A;  2LD6 A;  1Z23 A;  2XLO A;  1T9K A;  1QKR A;  1JR8 A;  1GGQ A;  5JLI A;  4R32 A;  3RIP A;  3E70 C;  5D91 A;  1OCC C;  2AU5 A;  4YWQ A;  5L0J A;  5KYY B;  2YL0 A;  2AWC A;  4EBK A;  3AQC A;  1VTM P;  4BG0 A;  3G4Z A;  2QTV A;  3ZDL A;  1OCR C;  1QZX A;  3MFN A;  1YYJ A;  2B0H A;  2V26 A;  4ULW A;  4Z9I A;  3W4Y A;  4MW3 A;  3W8I A;  4ER9 A;  3S28 A;  4DRI B;  3HJC A;  2Q3T A;  4PJM A;  3PDM P;  2PX0 A;  2F22 A;  4LDQ A;  4K0D A;  2JPU A;  3BRJ A;  2FGY A;  4U5C E;  3K7D A;  4AK9 A;  3H65 A;  2WB7 A;  3DI5 A;  2A68 F;  3A11 A;  4CJG A;  4JIO A;  3FDQ A;  1LI5 A;  1L7C A;  3DD7 A;  3FMS A;  4RD9 A;  4YT5 A;  2NPU A;  2KGO A;  3GEI A;  4U5H A;  2P7V A;  3E9V A;  3Q6N A;  3O55 A;  4W8P A;  4YN0 B;  4JCZ A;  3M15 A;  4JTD B;  5BQH A;  3O39 A;  4IRU A;  3GEE A;  5F5F A;  2R7Q A;  2ZXP A;  5L0H A;  1WAT A;  2EIL C;  1ZHX A;  2R7O A;  3RQE A;  3L8J A;  3OEO A;  3MYF A;  3B29 A;  4GEH A;  4BJ5 A;  3IEE A;  2FFH A;  2G3V A;  4BEJ A;  3W2V A;  2HV6 A;  1G5Z A;  3HNI A;  1HE1 A;  2DI3 A;  1J8Y F;  2VH3 A;  3U9M A;  2PX3 A;  1A41 A;  1OW6 A;  1ZHW A;  1TFK B;  1EA8 A;  3GWL A;  3EFO A;  3PCV A;  2G3K A;  4KNV A;  1QPU A;  2DYR C;  4U5F E;  3G4X A;  4KNW A;  4XEV A;  3QW0 A;  3RKO F;  2I8B A;  5JRA A;  1T5O A;  1ZU5 A;  1YAR O;  3Q6M A;  1YVI A;  3EFO B;  3DAF A;  1Y4C A;  5B3I A;  1FR0 A;  1V4A A;  3O6X A;  2L6F A;  2D4U A;  3SP1 A;  5A6K A;  1O87 A;  3UGO A;  4HFK B;  1JPJ A;  3WOD F;  5KYX A;  4AE4 A;  1TKN A;  3EGD A;  1Y6D A;  3DMD A;  4LLC A;  1D1B A;  4NQF A;  3LJB A;  3N0T A;  1QQ3 A;  2L7A A;  3QW1 A;  4E0I A;  5TJ5 E;  4E7Z A;  1Z6A A;  2Z15 A;  1FTS A;  3IPM O;  3FOO A;  1GQA A;  1BR4 A;  3DKA A;  3K1I A;  2HSQ A;  4KBL A;  2YL1 A;  5KYX B;  3EGD B;  1CPQ A;  1RJ9 B;  1NSG B;  4NC3 A;  4DXW A;  4RDA A;  1NU7 D;  4U5E E;  2R7W A;  4GQH A;  1AVO B;  3FHD A;  3NKE A;  4JTA B;  5JS5 A;  2YLI A;  4NTB A;  3T6G B;  3FAJ A;  1BDJ B;  2WL8 A;  4N4W A;  2QUP A;  4MVQ A;  4IJJ A;  3ZTM A;  2UUI A;  3KKB A;  4B6I A;  4IGG A;  1T6Q A;  3LLK A;  2R7V A;  1FFT C;  2Y3G A;  2HKV A;  1F1M A;  3DE8 A;  1SMY F;  4PFO A;  1Z63 A;  1NU9 C;  1FMW A;  2R03 A;  3FAP B;  2NSG A;  2XLE A;  3LS0 A;  1XZP A;  3SXK A;  1YJG A;  1G4W R;  2ZD9 A;  4PAC A;  1OW8 A;  4G0H A;  1LE2 A; 
#chains in the Genus database with same CATH homology
 4N6H A;  1NBB A;  4L6R A;  3ZWI A;  5JSL A;  1CPR A;  3TOM A;  4JE9 A;  4D4N A;  2XL8 A;  1S05 A;  2XM4 A;  3NMJ A;  3HNJ A;  1A7V A;  1EKY A;  1M6T A;  4IAQ A;  3ZTZ A;  1APC A;  3QVY A;  2XLO A;  4JKV A;  5JLI A;  4WGY A;  1E84 A;  1YZC A;  1E86 A;  4CDV A;  3DE9 A;  2YL0 A;  3M79 A;  3NMK A;  5JT4 A;  1BBH A;  4CX9 A;  3FOP A;  1RCP A;  1YYJ A;  4ULV A;  4ER9 A;  4JEB A;  4IB4 A;  2YKZ A;  4EIY A;  1MQV A;  1CGN A;  1YYX A;  1JAF A;  2J8W A;  4U9E A;  2YLD A;  256B A;  4CJG A;  4CJO A;  2XM0 A;  2YL7 A;  3M15 A;  4JEA A;  4D4X A;  3L1M A;  2YL3 A;  1YZA A;  3NMI A;  2XLV A;  2BC5 A;  4IAR A;  2J9B A;  5JP7 A;  4CDY A;  1E83 A;  1CGO A;  3HNI A;  4WGZ A;  1QPU A;  3QW0 A;  5JRA A;  3C63 A;  3HNK A;  4U9D A;  5B3I A;  3TOL A;  2XL6 A;  2XLW A;  1QQ3 A;  4CDA A;  3QW1 A;  3ZQV A;  3FOO A;  1GQA A;  3M4B A;  2YL1 A;  1CPQ A;  4NC3 A;  2QLA A;  5JS5 A;  2XLH A;  2YLI A;  3C62 A;  2CCY A;  4N4W A;  3M4C A;  3ZTM A;  1LM3 B;  3IQ6 A;  2YLG A;  4CIP A;  3QVZ A;  5JUA A;  3VRC A;  3DE8 A;  3HNL A;  3ZQY A;  1E85 A;  3U8P A;  2XLE A;  2XLM A;  2XLD A;  3IQ5 A;  5AGF A;  5JVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...