3ZTZA

Cytochrome c prime from alcaligenes xylosoxidans: carbon monooxide bound l16g variant at 1.05 a resolution: unrestraint refinement
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
125
structure length
125
Chain Sequence
EFAKPEDAVKYRQSAGTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Carbon Monoxide Poisoning is Prevented by the Energy Costs of Conformational Changes in Gas- Binding Haemproteins.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 51
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2011-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3ztzA00
4N6HA 3ZWIA 1QQ3A 1MQVA 3QVYA 5JSLA 3U8PA 4WGYA 2J9BA 3VRCA 3TOLA 1CPRA 1S05A 4CDYA 4CDAA 3ZQYA 2XLEA 1CPQA 2XM4A 4ULVA 3ZQVA 4L6RA 3HNJA 2XLVA 4D4XA 5JUAA 2YKZA 4N4WA 3HNKA 2YL3A 1E83A 1YYXA 2YLDA 3ZTMA 1E86A 1LM3B 5AGFA 5B3IA 256BA 2XLHA 2J8WA 4CJOA 1E85A 3DE8A 3HNLA 4WGZA 4IARA 4CIPA 4U9DA 2XL6A 4JEAA 1GQAA 4CDVA 1YZCA 3IQ5A 4CX9A 3C62A 3HNIA 3L1MA 5JLIA 1EKYA 4CJGA 1YZAA 3M79A 2XL8A 3FOPA 3NMIA 5JRAA 2YLGA 3TOMA 1BBHA 3QVZA 3M4BA 2XLOA 1A7VA 2BC5A 3M4CA 3FOOA 5JVEA 1NBBA 1QPUA 4D4NA 4ER9A 4JEBA 2XLWA 1JAFA 5JP7A 4NC3A 2QLAA 4IB4A 4EIYA 2XLMA 3NMKA 5JS5A 3IQ6A 5JT4A 2YL0A 3QW0A 1RCPA 2XM0A 2XLDA 3M15A 1CGNA 3ZTZA 4IAQA 1APCA 1CGOA 1E84A 3C63A 4JE9A 3NMJA 1YYJA 2YL7A 2CCYA 4JKVA 2YL1A 2YLIA 4U9EA 1M6TA 3QW1A 3DE9A
chains in the Genus database with same CATH superfamily
3LLIA 4XEVA 1RKCA 4HE8D 2WZFA 2Q9BA 2PFDA 4P6IC 2J7PD 2O9XA 3ZWIA 1QQ3A 2JD3A 3CEXA 4OIRF 3S84A 5KYXB 3U8PA 1Y6DA 2WVQA 5AC4A 2HSQA 3EH2A 4AE4A 4NTAA 1Z7Qc 2JPUA 2A0BA 3X2QC 2IXPA 2VCBA 3EG9B 2G3KA 1YJGA 3I5QA 3TJ5A 1FNTc 4CDYA 1D1CA 4CDAA 3ZQYA 3B9QA 5FCLA 1QZXA 2VASA 3N2ZB 2XM4A 2B0HA 1H9TA 5IY5C 3O6XA 5A6BD 3ZQVA 2VC9A 2L7AA 4BJ5C 1WTYA 1F1MA 1VLTA 3V5ZA 4XWJA 4N4WA 3AQBA 2YL3A 5KYUB 3J06A 3UMHA 1YYXA 3TD7A 3RW0A 1ZW3A 4K0DA 1E86A 2AU5A 2NSFA 1U6HA 4W8PA 4LLEA 4Q5SF 3SXKA 1MMDA 2EPMX 3K1IC 4I1MA 1BR2A 256BA 1NFOA 2HFIA 2OQMA 2XLHA 2Y3HA 4C7OB 3NYLA 4CS8C 4JTDB 2A6EF 4BJ6A 2P7VA 3NYJA 4PACA 3AG4C 2PX3A 4JVSA 3EZHA 5DS4A 4MW3A 4IARA 4KC9A 1NSGB 1OR2A 3GEEA 4U9DA 1W2WA 3ABKC 4EHPA 2AVKA 3KMIA 4JJFA 4MVZA 4WJ0A 4DVYP 2KK1A 4MQ9F 3SXMA 3LS0A 5E3CA 1JRAA 4CX9A 3C62A 3C8GB 2AP3A 2WL8A 2ZXOA 4FWVA 3U3FA 2XL8A 3RKOF 2R7QA 4PJMA 2HV6A 2YLGA 3IHUA 3F46A 3AOUA 3UR3C 3L0IA 4BJTA 3FVYA 2R7VA 1VB5A 2IXMA 5AC5A 3E70C 2DYRC 1FR0A 2A69F 4BG0A 4YWQA 5L0DA 3I4UA 4AX2A 3NRHA 3HTKC 3K7DA 1IZMA 2YZSA 3FOOA 4FESA 3VF0A 2HS5A 1JPJA 3DWWA 3DZAA 3FAJA 1K40A 2XLWA 3HLZA 2X51A 2QE9A 3N0TA 3NYMA 4IJJA 5JP7A 3U3BA 3U9JA 2X0CA 2XS1A 3KL4A 1ZVZA 3F47A 3SNHA 1C17M 4NQFA 2W45A 1OKKA 1BZ4A 3HJCA 3Q6MA 3S27A 2FGYA 2IXNA 1KNYA 3KYJA 3OWTA 3S28A 2KJGA 4B6IA 3X1OA 1JOGA 4YT5A 5FZTA 4A4AA 4LACB 2J0XA 2MYSA 1PV3A 4MTOA 4XPXA 4WABA 5JS5A 2HJMA 2YQYA 1N1CA 4JJGA 4JCZA 4XQ1A 1TWAA 2GAQA 1G4WR 3QZCA 2KNHA 4U5DE 3RVYA 3TULA 2H7OA 4N6CA 1S7ZA 4GEHA 3UGPA 2EPKX 2CNWD 4IAQA 1BDJB 1I4YA 2Y69C 5BQGA 1M2VB 2YHSA 1ZU5A 2HMQA 1ZHZA 1C02A 3RF3A 2OCCC 1KTMA 1ZHWA 1CGOA 3LEOA 1TR2A 1RXQA 1O5HA 4H54A 3RQFA 3U2LA 3WAQA 2M64A 2NUPB 5L0JA 5KYWB 1RJ9A 2GA0A 1MMAA 3CQZA 1ZZPA 2CCYA 4G7HF 4JKVA 4G0HA 3SZRA 1YA9A 1U89A 2L6HA 2JX0A 3MYFA 3O55A 4IRUA 4O7GA 1BR4A 3QW1A 3DE9A 2OU6A 1TWHA 3KH2A 3KKBA 4LDKA 4PJLA 4DOZA 3QVYA 3AGUA 1V4AA 2QUPA 1GS9A 4W8KA 3US6A 3Q6NA 5A69A 1AUEA 1NU9C 2R9RB 4WGYA 4XPYA 2J9BA 3QTHA 3VRCA 3RQGA 1OQCA 5L0FA 4C3DA 4XPWA 3LNRA 5DLJA 4CSAA 3T9OA 2J9VA 5L0HA 4DRIB 3VAYA 3UGOA 1JR8A 1CPQA 3GWNA 4E7SA 5EGYA 1T01A 2LIGA 2XS8A 3EFOB 4J30B 3GM3A 1L3PA 5E3AA 1M2OA 2A0UA 2YEVA 1SR2A 2R7OA 1C03A 3C8ZA 3JSEO 4D4XA 2R7SA 2KSFA 2QY9A 4MVUA 1TFOB 2W4BA 4MVOA 3TQOA 3DM9B 1H6GA 1LI7A 4J7TA 1E2XA 5HSWA 2XXAA 5L3VA 2EIMC 2XRHA 3AG3C 3FMSA 3EHMA 1R5ID 2BE5F 3O39A 3EGDB 3T6JA 1J8YF 2P0NA 3R7CA 3TK0A 2J8WA 2IXOA 4XLNF 3T6BA 3C7JA 3LJBA 4JW1A 2WVNA 2HMZA 1OW6A 4NCQA 4PR9A 1T5OA 2DYSC 3DE8A 3HNLA 4GYTA 4QDLA 2Z15A 4YL1A 4DBQA 2ZD9A 2AWCA 4A2NB 4CIHA 1NU7D 1M57C 3Q7GA 1A41A 1ST6A 2GWWA 2R05A 1A7EA 2LCHA 4JEAA 4MVQA 3W8IA 3L8JA 4R32A 3G4ZA 3U2MA 3ZSUA 3SEOA 2YVKA 2WZGA 3IQCA 3IQ5A 2KGOA 5E2QA 3RIPA 3MLGA 3S29A 3T6GB 1L7CA 2A68F 3ASOC 3RFYA 1VTMP 1VMAA 3HNIA 5JLIA 3FAPB 4G7ZF 1YZAA 3M79A 3JTLO 4OIQF 1EI7A 2I8BA 1OCCC 2J0WA 5BQIA 4BPMA 5JRAA 1Q0DA 1HMOA 2CGEA 3WODF 3RYLA 2CDQA 3DD7A 2VB6A 4G78A 3QVZA 3W2WA 2XL4A 3EH1A 5B1BC 4YN0B 3WG7C 3R2PA 5COGA 1A0BA 2L9JA 3HKKA 3M4CA 4MTGA 4CS7A 4JC7A 1NBBA 1QPUA 3W4YA 2J9WA 2LQGA 1D0ZA 3S90A 1TWGA 1OKKD 4N06A 4EBJA 4NC3A 1HE9A 4OINF 1ZHXA 2NG1A 1OCRC 2R7XA 4HEAJ 5F28E 4EIYA 1HW2A 4MVMA 5T3WA 3BRJA 2E87A 1T6IA 2QTVA 3K66A 3NMKA 3LLKA 4U5GA 1SZIA 4KNVA 2IM8A 2NUTA 4CS9A 3GEIA 4O6MA 1RCPA 4QI0A 3GM1A 1CGNA 2LFDA 3M15A 3V5XA 3AG1C 3V7OA 1APCA 2A6HF 2C03A 4I1OB 1YLMA 3AGTA 3H65A 5EK0A 3U8VA 4AK9A 3ABMC 4LERA 4JE9A 1V55C 3NMJA 2HSBA 3DAFA 1YA7O 2YL7A 2OKUA 3DXJF 2YL1A 2ZXWC 3U9MA 2YLIA 3DM5A 3ECSA 1FTSA 4MVSA 4HFKB 4MS2A 2C04A 5KYNA 4DRHB 2ASRA 3NMIA 3QW0A 2XLDA 2Q7RA 3VM6A 3DMDA 2UUHA 3EZIA 1YARO 3PDMP 2M4EA 1FMVA 4U5BE 2Q3TA 3SP1A 1RKEB 2A1DD 4PFPA 5JSLA 3IEEA 1NLXA 3OEOA 1YDIA 1D0YA 1TFKB 2GFHA 3JYYA 3B0PA 3TOLA 3NDBB 4OD5A 5L0IA 1R4TA 3SXYA 4AL0A 4Z9HA 4BJ6C 3C8GA 4C3EA 2Q9AA 5B1AC 1CPRA 1LPEA 2DI3A 1A7DA 4Z9IA 2EILC 2XLEA 3EJNA 3A11A 4IGGA 2EPLX 3G50A 4XLPF 2MHRA 4ULVA 4CBEA 3UMIA 3CAXA 1Q0FA 1V54C 3HNJA 2RSEB 3H2VA 2VCCA 2D4UA 5HV9A 2F22A 5JUAA 2YKZA 4K1OA 1T6QA 1MMGA 3HNKA 4I44A 3NKEA 4DVZA 5L3QA 1OCZC 2YLDA 3ZTMA 4CS9C 3GODA 2UUIA 1MNEA 1TKNA 1DOWA 1SF8A 3PCVA 5BUOA 5B3IA 4YT8A 1G4US 4Q7CA 3G4XA 3EGXB 3H2UA 1V74B 4MW8A 2KC3A 2ZXPA 2XXAB 5KYXA 4ONSA 3W2VA 4WGZA 3B71A 4U5CE 3U0CA 2XL6A 3DKAA 3KPHA 1XZQA 4JIOA 1SYQA 3ATPA 1GQAA 1WASA 4XTKA 1M56C 3DJNB 4XEKA 2CW0F 2J9UA 4AE4B 3S0XA 2LK4A 1M2VA 5F5FA 1MMNA 2ZXRA 3L1MA 4JTCB 2R25A 5T3TA 1EKYA 1KU2A 4CJGA 3FDQA 2NUPA 5DQZA 5KYWA 2P61A 3BEHA 4O6YA 4OIOF 4BEMJ 4DXWA 3K1IA 1TQGA 4P9TA 1UFBA 3TOMA 1ORYA 2J45A 2YRFA 4K7BA 1NFNA 3M4BA 4LDRA 5DS5A 1NZEA 2V26A 1K05A 2MWQA 1A7VA 2BC5A 3JSZA 3L8IA 3DI5A 5B3SC 5JVEA 4E17A 2PNOA 4D4NA 2CYDA 4JEBA 1Y4CA 2P1AA 1VYKA 1SMYF 3S9OA 3AG2C 1G8XA 1U0BB 2FFHA 3POVA 1LE2A 4ZLDA 4YL3A 1LS1A 4IB4A 3L34A 5D91A 3GWLA 3AJMA 4BEJA 4G7OF 4MVRA 1Q0MA 2HZ8A 3LS1A 2L81A 3ZIBA 3V5YA 2Q4FA 3JYHA 3CSKA 3PHF2 3NG1A 3GANA 2YL0A 1QLEC 1WGWA 2GDCA 1JPNA 1QVXA 3NKDA 4PK4A 4UDVA 2R02A 2XM0A 4JZAA 2DGJA 3MBGA 2Q00A 3M1CB 5KYYA 1T6UA 2D5RB 3EFOA 4E7ZA 4MTFA 5GPGB 5DVWA 2H8AA 1LI5A 3JCUQ 1EA8A 1QKRA 4E0HA 4RBNA 1Z6AA 1RMVA 1GGQA 1UG7A 2NUTB 3FXHA 1FAPB 3K33A 4CSAC 1YYJA 3CZ6A 4LDQA 4O6NA 1YAUO 2TMVP 2EIKC 3DAGA 4J32B 5T1DB 1PD1A 3ZC4A 2Y3BA 3EGDA 3EPVA 3B0VC 2HUJA 4JURI 3LAYA 2NSGA 1T9KA 3GM2A 4U9EA 1M6TA 4PJNA 1B68A 1G5ZA 1VOMA 4BJ1A 2R7UA 1ZU4A 3EG9A 4YK5A 4N6HA 4ZLCA 2R7RA 2Y3GA 4IWBA 4NY3A 1MQVA 5E33A 1K04A 1FMWA 1H9GA 3C18A 1Q0GA 1Z63A 4YT4A 3MYIA 3B0UX 3KYIA 2J46A 2J7PA 1HMDA 2Y39A 3JRTA 1OR3A 1FFTC 2OJQA 3C8GD 3IQTA 1VYIA 3ASNC 2OEVA 2Y3DA 3O10A 1O87A 1LVKA 3ABLC 4DBRA 3LUTB 4LLCA 2WVOA 2PP4A 4U5FE 3LNMB 1S05A 3LEVA 1IW7F 2AWYA 5KYUA 2OJED 4EWCA 1OW8A 2QNLA 2R7WA 3ITFA 2OEXA 4YJWA 2P6VA 3QMKA 1D0XA 2EIJC 2PX0A 4E18A 2W9YA 4L6RA 1JMWA 1WWPA 2XLVA 2ZPAA 3DJUB 4AL1A 4C7OA 3E9VA 3MX3A 1HE1A 2R03A 3JZ0A 1NG1A 2FAPB 5COMA 4KNWA 4YT2A 5A6BA 1E83A 2OG2A 4NTFA 2L6GA 1RJ9B 3I5PA 1I5NA 2HV7A 3RVZA 1LM3B 5AGFA 1XWJA 1ZHYA 1TWCA 3A9CA 4GQHA 4X0RA 5BQHA 4Z9JA 5TJ5E 4Q4ZF 1ZW2A 3GEHA 2XSEA 1AVOB 2R7TA 1D1AA 2KQ9A 1WOLA 4FAPB 4P9FA 3OA1A 2W4MA 4CJOA 5DQTA 2IBFA 1E85A 2WB7A 1ZYRF 1Z5ZA 3JT1A 2Q9CA 1O3UA 1WATA 4YL0A 4C3BA 4CIPA 1LS4A 3T4RA 4DRJB 3UNGC 5COFA 5CIVA 3TJ6A 4HFFB 1AEPA 2I15A 4RD9A 1XZPA 3K6BA 1J8MF 3RH3A 5A6KA 2YWAA 3UMKA 4CDVA 1YZCA 3FHDA 2PF4E 3PMRA 3GORA 3MFNA 2PBEA 1I4ZA 2H7BA 2HKVA 4U5HA 3FOPA 5F5HA 4OD4A 1BR1A 1PCXA 4RDAA 2B0JA 4IAOA 4U5EE 1CGME 3B29A 1BBHA 5CI9A 2LSEA 3EHNA 1PD0A 5DS6A 5L0GA 4J7YA 2XLOA 3WHNA 2KW3C 3N24A 4E0IA 2VCAA 2IOQA 1ORJA 2HJ3A 3Q7LA 2EINC 4MNDA 4F4BA 2LFFA 2RD9A 2H7VC 3IPMO 4JCHA 1VK5A 2IYLD 2V3CC 4ER9A 5L0CA 2G3VA 1QSPA 1JAFA 2OOCA 4XEFA 4FX5A 4H4KC 4PJJA 2KYHA 3ZDLA 1LIHA 4PFOA 1RKEA 4QI2A 2QLAA 2DB4A 1OXBA 1GM5A 2WZLA 3SXZA 4I3MA 1ORSC 3RQEA 4ANJA 1ZHTA 1Q0KA 2XLMA 3LESA 4BJ5A 1YVIA 4OIPF 1Z3IX 4M63A 3IQ6A 3JRMO 1OCOC 5CI8A 3AQCA 3SYNA 5EHHA 2L6FA 2LP4A 5JT4A 1HY5A 4ULWA 4EBBA 2NPUA 4JTAB 1D1BA 1Z23A 3ZVRA 2BL2A 1OW7A 2LD6A 4NTBA 5A6JA 4O79A 1EQ1A 3EQLF 3ZTZA 3W8HA 3ZG1A 1H7IA 3U5SA 4CS8A 4EBKA 1FFHA 4KBLA 1E84A 2CNWA 1HW1A 2ICWG 2VH3A 3C63A 4JRZA 4EKWA 5A6AA 4EUKB 2EPNA 5KYYB 1VLSA 1MNDA 1DOVA 3VYWA 3K1HA 1WN0A 1LE4A 4KI2A 1OXKA 2G62A 2ETSA 5D92A 3EGXA 2EPOA 5K0IA 1LKXA 4DJ9A
chains in the Genus database with same CATH topology
4N6HA 3ZWIA 1QQ3A 1MQVA 3QVYA 5JSLA 3U8PA 4WGYA 2J9BA 3VRCA 3TOLA 1CPRA 1S05A 4CDYA 4CDAA 3ZQYA 2XLEA 1CPQA 2XM4A 4ULVA 3ZQVA 4L6RA 3HNJA 2XLVA 4D4XA 5JUAA 2YKZA 4N4WA 3HNKA 2YL3A 1E83A 1YYXA 2YLDA 3ZTMA 1E86A 1LM3B 5AGFA 5B3IA 256BA 2XLHA 2J8WA 4CJOA 1E85A 3DE8A 3HNLA 4WGZA 4IARA 4CIPA 4U9DA 2XL6A 4JEAA 1GQAA 4CDVA 1YZCA 3IQ5A 4CX9A 3C62A 3HNIA 3L1MA 5JLIA 1EKYA 4CJGA 1YZAA 3M79A 2XL8A 3FOPA 3NMIA 5JRAA 2YLGA 3TOMA 1BBHA 3QVZA 3M4BA 2XLOA 1A7VA 2BC5A 3M4CA 3FOOA 5JVEA 1NBBA 1QPUA 4D4NA 4ER9A 4JEBA 2XLWA 1JAFA 5JP7A 4NC3A 2QLAA 4IB4A 4EIYA 2XLMA 3NMKA 5JS5A 3IQ6A 5JT4A 2YL0A 3QW0A 1RCPA 2XM0A 2XLDA 3M15A 1CGNA 3ZTZA 4IAQA 1APCA 1CGOA 1E84A 3C63A 4JE9A 3NMJA 1YYJA 2YL7A 2CCYA 4JKVA 2YL1A 2YLIA 4U9EA 1M6TA 3QW1A 3DE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6H A;  3ZWI A;  1QQ3 A;  1MQV A;  3QVY A;  5JSL A;  3U8P A;  4WGY A;  2J9B A;  3VRC A;  3TOL A;  1CPR A;  1S05 A;  4CDY A;  4CDA A;  3ZQY A;  2XLE A;  1CPQ A;  2XM4 A;  4ULV A;  3ZQV A;  4L6R A;  3HNJ A;  2XLV A;  4D4X A;  5JUA A;  2YKZ A;  4N4W A;  3HNK A;  2YL3 A;  1E83 A;  1YYX A;  2YLD A;  3ZTM A;  1E86 A;  1LM3 B;  5AGF A;  5B3I A;  256B A;  2XLH A;  2J8W A;  4CJO A;  1E85 A;  3DE8 A;  3HNL A;  4WGZ A;  4IAR A;  4CIP A;  4U9D A;  2XL6 A;  4JEA A;  1GQA A;  4CDV A;  1YZC A;  3IQ5 A;  4CX9 A;  3C62 A;  3HNI A;  3L1M A;  5JLI A;  1EKY A;  4CJG A;  1YZA A;  3M79 A;  2XL8 A;  3FOP A;  3NMI A;  5JRA A;  2YLG A;  3TOM A;  1BBH A;  3QVZ A;  3M4B A;  2XLO A;  1A7V A;  2BC5 A;  3M4C A;  3FOO A;  5JVE A;  1NBB A;  1QPU A;  4D4N A;  4ER9 A;  4JEB A;  2XLW A;  1JAF A;  5JP7 A;  4NC3 A;  2QLA A;  4IB4 A;  4EIY A;  2XLM A;  3NMK A;  5JS5 A;  3IQ6 A;  5JT4 A;  2YL0 A;  3QW0 A;  1RCP A;  2XM0 A;  2XLD A;  3M15 A;  1CGN A;  3ZTZ A;  4IAQ A;  1APC A;  1CGO A;  1E84 A;  3C63 A;  4JE9 A;  3NMJ A;  1YYJ A;  2YL7 A;  2CCY A;  4JKV A;  2YL1 A;  2YLI A;  4U9E A;  1M6T A;  3QW1 A;  3DE9 A; 
#chains in the Genus database with same CATH topology
 3LLI A;  4XEV A;  1RKC A;  4HE8 D;  2WZF A;  2Q9B A;  2PFD A;  4P6I C;  2J7P D;  2O9X A;  3ZWI A;  1QQ3 A;  2JD3 A;  3CEX A;  4OIR F;  3S84 A;  5KYX B;  3U8P A;  1Y6D A;  2WVQ A;  5AC4 A;  2HSQ A;  3EH2 A;  4AE4 A;  4NTA A;  1Z7Q c;  2JPU A;  2A0B A;  3X2Q C;  2IXP A;  2VCB A;  3EG9 B;  2G3K A;  1YJG A;  3I5Q A;  3TJ5 A;  1FNT c;  4CDY A;  1D1C A;  4CDA A;  3ZQY A;  3B9Q A;  5FCL A;  1QZX A;  2VAS A;  3N2Z B;  2XM4 A;  2B0H A;  1H9T A;  5IY5 C;  3O6X A;  5A6B D;  3ZQV A;  2VC9 A;  2L7A A;  4BJ5 C;  1WTY A;  1F1M A;  1VLT A;  3V5Z A;  4XWJ A;  4N4W A;  3AQB A;  2YL3 A;  5KYU B;  3J06 A;  3UMH A;  1YYX A;  3TD7 A;  3RW0 A;  1ZW3 A;  4K0D A;  1E86 A;  2AU5 A;  2NSF A;  1U6H A;  4W8P A;  4LLE A;  4Q5S F;  3SXK A;  1MMD A;  2EPM X;  3K1I C;  4I1M A;  1BR2 A;  256B A;  1NFO A;  2HFI A;  2OQM A;  2XLH A;  2Y3H A;  4C7O B;  3NYL A;  4CS8 C;  4JTD B;  2A6E F;  4BJ6 A;  2P7V A;  3NYJ A;  4PAC A;  3AG4 C;  2PX3 A;  4JVS A;  3EZH A;  5DS4 A;  4MW3 A;  4IAR A;  4KC9 A;  1NSG B;  1OR2 A;  3GEE A;  4U9D A;  1W2W A;  3ABK C;  4EHP A;  2AVK A;  3KMI A;  4JJF A;  4MVZ A;  4WJ0 A;  4DVY P;  2KK1 A;  4MQ9 F;  3SXM A;  3LS0 A;  5E3C A;  1JRA A;  4CX9 A;  3C62 A;  3C8G B;  2AP3 A;  2WL8 A;  2ZXO A;  4FWV A;  3U3F A;  2XL8 A;  3RKO F;  2R7Q A;  4PJM A;  2HV6 A;  2YLG A;  3IHU A;  3F46 A;  3AOU A;  3UR3 C;  3L0I A;  4BJT A;  3FVY A;  2R7V A;  1VB5 A;  2IXM A;  5AC5 A;  3E70 C;  2DYR C;  1FR0 A;  2A69 F;  4BG0 A;  4YWQ A;  5L0D A;  3I4U A;  4AX2 A;  3NRH A;  3HTK C;  3K7D A;  1IZM A;  2YZS A;  3FOO A;  4FES A;  3VF0 A;  2HS5 A;  1JPJ A;  3DWW A;  3DZA A;  3FAJ A;  1K40 A;  2XLW A;  3HLZ A;  2X51 A;  2QE9 A;  3N0T A;  3NYM A;  4IJJ A;  5JP7 A;  3U3B A;  3U9J A;  2X0C A;  2XS1 A;  3KL4 A;  1ZVZ A;  3F47 A;  3SNH A;  1C17 M;  4NQF A;  2W45 A;  1OKK A;  1BZ4 A;  3HJC A;  3Q6M A;  3S27 A;  2FGY A;  2IXN A;  1KNY A;  3KYJ A;  3OWT A;  3S28 A;  2KJG A;  4B6I A;  3X1O A;  1JOG A;  4YT5 A;  5FZT A;  4A4A A;  4LAC B;  2J0X A;  2MYS A;  1PV3 A;  4MTO A;  4XPX A;  4WAB A;  5JS5 A;  2HJM A;  2YQY A;  1N1C A;  4JJG A;  4JCZ A;  4XQ1 A;  1TWA A;  2GAQ A;  1G4W R;  3QZC A;  2KNH A;  4U5D E;  3RVY A;  3TUL A;  2H7O A;  4N6C A;  1S7Z A;  4GEH A;  3UGP A;  2EPK X;  2CNW D;  4IAQ A;  1BDJ B;  1I4Y A;  2Y69 C;  5BQG A;  1M2V B;  2YHS A;  1ZU5 A;  2HMQ A;  1ZHZ A;  1C02 A;  3RF3 A;  2OCC C;  1KTM A;  1ZHW A;  1CGO A;  3LEO A;  1TR2 A;  1RXQ A;  1O5H A;  4H54 A;  3RQF A;  3U2L A;  3WAQ A;  2M64 A;  2NUP B;  5L0J A;  5KYW B;  1RJ9 A;  2GA0 A;  1MMA A;  3CQZ A;  1ZZP A;  2CCY A;  4G7H F;  4JKV A;  4G0H A;  3SZR A;  1YA9 A;  1U89 A;  2L6H A;  2JX0 A;  3MYF A;  3O55 A;  4IRU A;  4O7G A;  1BR4 A;  3QW1 A;  3DE9 A;  2OU6 A;  1TWH A;  3KH2 A;  3KKB A;  4LDK A;  4PJL A;  4DOZ A;  3QVY A;  3AGU A;  1V4A A;  2QUP A;  1GS9 A;  4W8K A;  3US6 A;  3Q6N A;  5A69 A;  1AUE A;  1NU9 C;  2R9R B;  4WGY A;  4XPY A;  2J9B A;  3QTH A;  3VRC A;  3RQG A;  1OQC A;  5L0F A;  4C3D A;  4XPW A;  3LNR A;  5DLJ A;  4CSA A;  3T9O A;  2J9V A;  5L0H A;  4DRI B;  3VAY A;  3UGO A;  1JR8 A;  1CPQ A;  3GWN A;  4E7S A;  5EGY A;  1T01 A;  2LIG A;  2XS8 A;  3EFO B;  4J30 B;  3GM3 A;  1L3P A;  5E3A A;  1M2O A;  2A0U A;  2YEV A;  1SR2 A;  2R7O A;  1C03 A;  3C8Z A;  3JSE O;  4D4X A;  2R7S A;  2KSF A;  2QY9 A;  4MVU A;  1TFO B;  2W4B A;  4MVO A;  3TQO A;  3DM9 B;  1H6G A;  1LI7 A;  4J7T A;  1E2X A;  5HSW A;  2XXA A;  5L3V A;  2EIM C;  2XRH A;  3AG3 C;  3FMS A;  3EHM A;  1R5I D;  2BE5 F;  3O39 A;  3EGD B;  3T6J A;  1J8Y F;  2P0N A;  3R7C A;  3TK0 A;  2J8W A;  2IXO A;  4XLN F;  3T6B A;  3C7J A;  3LJB A;  4JW1 A;  2WVN A;  2HMZ A;  1OW6 A;  4NCQ A;  4PR9 A;  1T5O A;  2DYS C;  3DE8 A;  3HNL A;  4GYT A;  4QDL A;  2Z15 A;  4YL1 A;  4DBQ A;  2ZD9 A;  2AWC A;  4A2N B;  4CIH A;  1NU7 D;  1M57 C;  3Q7G A;  1A41 A;  1ST6 A;  2GWW A;  2R05 A;  1A7E A;  2LCH A;  4JEA A;  4MVQ A;  3W8I A;  3L8J A;  4R32 A;  3G4Z A;  3U2M A;  3ZSU A;  3SEO A;  2YVK A;  2WZG A;  3IQC A;  3IQ5 A;  2KGO A;  5E2Q A;  3RIP A;  3MLG A;  3S29 A;  3T6G B;  1L7C A;  2A68 F;  3ASO C;  3RFY A;  1VTM P;  1VMA A;  3HNI A;  5JLI A;  3FAP B;  4G7Z F;  1YZA A;  3M79 A;  3JTL O;  4OIQ F;  1EI7 A;  2I8B A;  1OCC C;  2J0W A;  5BQI A;  4BPM A;  5JRA A;  1Q0D A;  1HMO A;  2CGE A;  3WOD F;  3RYL A;  2CDQ A;  3DD7 A;  2VB6 A;  4G78 A;  3QVZ A;  3W2W A;  2XL4 A;  3EH1 A;  5B1B C;  4YN0 B;  3WG7 C;  3R2P A;  5COG A;  1A0B A;  2L9J A;  3HKK A;  3M4C A;  4MTG A;  4CS7 A;  4JC7 A;  1NBB A;  1QPU A;  3W4Y A;  2J9W A;  2LQG A;  1D0Z A;  3S90 A;  1TWG A;  1OKK D;  4N06 A;  4EBJ A;  4NC3 A;  1HE9 A;  4OIN F;  1ZHX A;  2NG1 A;  1OCR C;  2R7X A;  4HEA J;  5F28 E;  4EIY A;  1HW2 A;  4MVM A;  5T3W A;  3BRJ A;  2E87 A;  1T6I A;  2QTV A;  3K66 A;  3NMK A;  3LLK A;  4U5G A;  1SZI A;  4KNV A;  2IM8 A;  2NUT A;  4CS9 A;  3GEI A;  4O6M A;  1RCP A;  4QI0 A;  3GM1 A;  1CGN A;  2LFD A;  3M15 A;  3V5X A;  3AG1 C;  3V7O A;  1APC A;  2A6H F;  2C03 A;  4I1O B;  1YLM A;  3AGT A;  3H65 A;  5EK0 A;  3U8V A;  4AK9 A;  3ABM C;  4LER A;  4JE9 A;  1V55 C;  3NMJ A;  2HSB A;  3DAF A;  1YA7 O;  2YL7 A;  2OKU A;  3DXJ F;  2YL1 A;  2ZXW C;  3U9M A;  2YLI A;  3DM5 A;  3ECS A;  1FTS A;  4MVS A;  4HFK B;  4MS2 A;  2C04 A;  5KYN A;  4DRH B;  2ASR A;  3NMI A;  3QW0 A;  2XLD A;  2Q7R A;  3VM6 A;  3DMD A;  2UUH A;  3EZI A;  1YAR O;  3PDM P;  2M4E A;  1FMV A;  4U5B E;  2Q3T A;  3SP1 A;  1RKE B;  2A1D D;  4PFP A;  5JSL A;  3IEE A;  1NLX A;  3OEO A;  1YDI A;  1D0Y A;  1TFK B;  2GFH A;  3JYY A;  3B0P A;  3TOL A;  3NDB B;  4OD5 A;  5L0I A;  1R4T A;  3SXY A;  4AL0 A;  4Z9H A;  4BJ6 C;  3C8G A;  4C3E A;  2Q9A A;  5B1A C;  1CPR A;  1LPE A;  2DI3 A;  1A7D A;  4Z9I A;  2EIL C;  2XLE A;  3EJN A;  3A11 A;  4IGG A;  2EPL X;  3G50 A;  4XLP F;  2MHR A;  4ULV A;  4CBE A;  3UMI A;  3CAX A;  1Q0F A;  1V54 C;  3HNJ A;  2RSE B;  3H2V A;  2VCC A;  2D4U A;  5HV9 A;  2F22 A;  5JUA A;  2YKZ A;  4K1O A;  1T6Q A;  1MMG A;  3HNK A;  4I44 A;  3NKE A;  4DVZ A;  5L3Q A;  1OCZ C;  2YLD A;  3ZTM A;  4CS9 C;  3GOD A;  2UUI A;  1MNE A;  1TKN A;  1DOW A;  1SF8 A;  3PCV A;  5BUO A;  5B3I A;  4YT8 A;  1G4U S;  4Q7C A;  3G4X A;  3EGX B;  3H2U A;  1V74 B;  4MW8 A;  2KC3 A;  2ZXP A;  2XXA B;  5KYX A;  4ONS A;  3W2V A;  4WGZ A;  3B71 A;  4U5C E;  3U0C A;  2XL6 A;  3DKA A;  3KPH A;  1XZQ A;  4JIO A;  1SYQ A;  3ATP A;  1GQA A;  1WAS A;  4XTK A;  1M56 C;  3DJN B;  4XEK A;  2CW0 F;  2J9U A;  4AE4 B;  3S0X A;  2LK4 A;  1M2V A;  5F5F A;  1MMN A;  2ZXR A;  3L1M A;  4JTC B;  2R25 A;  5T3T A;  1EKY A;  1KU2 A;  4CJG A;  3FDQ A;  2NUP A;  5DQZ A;  5KYW A;  2P61 A;  3BEH A;  4O6Y A;  4OIO F;  4BEM J;  4DXW A;  3K1I A;  1TQG A;  4P9T A;  1UFB A;  3TOM A;  1ORY A;  2J45 A;  2YRF A;  4K7B A;  1NFN A;  3M4B A;  4LDR A;  5DS5 A;  1NZE A;  2V26 A;  1K05 A;  2MWQ A;  1A7V A;  2BC5 A;  3JSZ A;  3L8I A;  3DI5 A;  5B3S C;  5JVE A;  4E17 A;  2PNO A;  4D4N A;  2CYD A;  4JEB A;  1Y4C A;  2P1A A;  1VYK A;  1SMY F;  3S9O A;  3AG2 C;  1G8X A;  1U0B B;  2FFH A;  3POV A;  1LE2 A;  4ZLD A;  4YL3 A;  1LS1 A;  4IB4 A;  3L34 A;  5D91 A;  3GWL A;  3AJM A;  4BEJ A;  4G7O F;  4MVR A;  1Q0M A;  2HZ8 A;  3LS1 A;  2L81 A;  3ZIB A;  3V5Y A;  2Q4F A;  3JYH A;  3CSK A;  3PHF 2;  3NG1 A;  3GAN A;  2YL0 A;  1QLE C;  1WGW A;  2GDC A;  1JPN A;  1QVX A;  3NKD A;  4PK4 A;  4UDV A;  2R02 A;  2XM0 A;  4JZA A;  2DGJ A;  3MBG A;  2Q00 A;  3M1C B;  5KYY A;  1T6U A;  2D5R B;  3EFO A;  4E7Z A;  4MTF A;  5GPG B;  5DVW A;  2H8A A;  1LI5 A;  3JCU Q;  1EA8 A;  1QKR A;  4E0H A;  4RBN A;  1Z6A A;  1RMV A;  1GGQ A;  1UG7 A;  2NUT B;  3FXH A;  1FAP B;  3K33 A;  4CSA C;  1YYJ A;  3CZ6 A;  4LDQ A;  4O6N A;  1YAU O;  2TMV P;  2EIK C;  3DAG A;  4J32 B;  5T1D B;  1PD1 A;  3ZC4 A;  2Y3B A;  3EGD A;  3EPV A;  3B0V C;  2HUJ A;  4JUR I;  3LAY A;  2NSG A;  1T9K A;  3GM2 A;  4U9E A;  1M6T A;  4PJN A;  1B68 A;  1G5Z A;  1VOM A;  4BJ1 A;  2R7U A;  1ZU4 A;  3EG9 A;  4YK5 A;  4N6H A;  4ZLC A;  2R7R A;  2Y3G A;  4IWB A;  4NY3 A;  1MQV A;  5E33 A;  1K04 A;  1FMW A;  1H9G A;  3C18 A;  1Q0G A;  1Z63 A;  4YT4 A;  3MYI A;  3B0U X;  3KYI A;  2J46 A;  2J7P A;  1HMD A;  2Y39 A;  3JRT A;  1OR3 A;  1FFT C;  2OJQ A;  3C8G D;  3IQT A;  1VYI A;  3ASN C;  2OEV A;  2Y3D A;  3O10 A;  1O87 A;  1LVK A;  3ABL C;  4DBR A;  3LUT B;  4LLC A;  2WVO A;  2PP4 A;  4U5F E;  3LNM B;  1S05 A;  3LEV A;  1IW7 F;  2AWY A;  5KYU A;  2OJE D;  4EWC A;  1OW8 A;  2QNL A;  2R7W A;  3ITF A;  2OEX A;  4YJW A;  2P6V A;  3QMK A;  1D0X A;  2EIJ C;  2PX0 A;  4E18 A;  2W9Y A;  4L6R A;  1JMW A;  1WWP A;  2XLV A;  2ZPA A;  3DJU B;  4AL1 A;  4C7O A;  3E9V A;  3MX3 A;  1HE1 A;  2R03 A;  3JZ0 A;  1NG1 A;  2FAP B;  5COM A;  4KNW A;  4YT2 A;  5A6B A;  1E83 A;  2OG2 A;  4NTF A;  2L6G A;  1RJ9 B;  3I5P A;  1I5N A;  2HV7 A;  3RVZ A;  1LM3 B;  5AGF A;  1XWJ A;  1ZHY A;  1TWC A;  3A9C A;  4GQH A;  4X0R A;  5BQH A;  4Z9J A;  5TJ5 E;  4Q4Z F;  1ZW2 A;  3GEH A;  2XSE A;  1AVO B;  2R7T A;  1D1A A;  2KQ9 A;  1WOL A;  4FAP B;  4P9F A;  3OA1 A;  2W4M A;  4CJO A;  5DQT A;  2IBF A;  1E85 A;  2WB7 A;  1ZYR F;  1Z5Z A;  3JT1 A;  2Q9C A;  1O3U A;  1WAT A;  4YL0 A;  4C3B A;  4CIP A;  1LS4 A;  3T4R A;  4DRJ B;  3UNG C;  5COF A;  5CIV A;  3TJ6 A;  4HFF B;  1AEP A;  2I15 A;  4RD9 A;  1XZP A;  3K6B A;  1J8M F;  3RH3 A;  5A6K A;  2YWA A;  3UMK A;  4CDV A;  1YZC A;  3FHD A;  2PF4 E;  3PMR A;  3GOR A;  3MFN A;  2PBE A;  1I4Z A;  2H7B A;  2HKV A;  4U5H A;  3FOP A;  5F5H A;  4OD4 A;  1BR1 A;  1PCX A;  4RDA A;  2B0J A;  4IAO A;  4U5E E;  1CGM E;  3B29 A;  1BBH A;  5CI9 A;  2LSE A;  3EHN A;  1PD0 A;  5DS6 A;  5L0G A;  4J7Y A;  2XLO A;  3WHN A;  2KW3 C;  3N24 A;  4E0I A;  2VCA A;  2IOQ A;  1ORJ A;  2HJ3 A;  3Q7L A;  2EIN C;  4MND A;  4F4B A;  2LFF A;  2RD9 A;  2H7V C;  3IPM O;  4JCH A;  1VK5 A;  2IYL D;  2V3C C;  4ER9 A;  5L0C A;  2G3V A;  1QSP A;  1JAF A;  2OOC A;  4XEF A;  4FX5 A;  4H4K C;  4PJJ A;  2KYH A;  3ZDL A;  1LIH A;  4PFO A;  1RKE A;  4QI2 A;  2QLA A;  2DB4 A;  1OXB A;  1GM5 A;  2WZL A;  3SXZ A;  4I3M A;  1ORS C;  3RQE A;  4ANJ A;  1ZHT A;  1Q0K A;  2XLM A;  3LES A;  4BJ5 A;  1YVI A;  4OIP F;  1Z3I X;  4M63 A;  3IQ6 A;  3JRM O;  1OCO C;  5CI8 A;  3AQC A;  3SYN A;  5EHH A;  2L6F A;  2LP4 A;  5JT4 A;  1HY5 A;  4ULW A;  4EBB A;  2NPU A;  4JTA B;  1D1B A;  1Z23 A;  3ZVR A;  2BL2 A;  1OW7 A;  2LD6 A;  4NTB A;  5A6J A;  4O79 A;  1EQ1 A;  3EQL F;  3ZTZ A;  3W8H A;  3ZG1 A;  1H7I A;  3U5S A;  4CS8 A;  4EBK A;  1FFH A;  4KBL A;  1E84 A;  2CNW A;  1HW1 A;  2ICW G;  2VH3 A;  3C63 A;  4JRZ A;  4EKW A;  5A6A A;  4EUK B;  2EPN A;  5KYY B;  1VLS A;  1MND A;  1DOV A;  3VYW A;  3K1H A;  1WN0 A;  1LE4 A;  4KI2 A;  1OXK A;  2G62 A;  2ETS A;  5D92 A;  3EGX A;  2EPO A;  5K0I A;  1LKX A;  4DJ9 A; 
#chains in the Genus database with same CATH homology
 4N6H A;  3ZWI A;  1QQ3 A;  1MQV A;  3QVY A;  5JSL A;  3U8P A;  4WGY A;  2J9B A;  3VRC A;  3TOL A;  1CPR A;  1S05 A;  4CDY A;  4CDA A;  3ZQY A;  2XLE A;  1CPQ A;  2XM4 A;  4ULV A;  3ZQV A;  4L6R A;  3HNJ A;  2XLV A;  4D4X A;  5JUA A;  2YKZ A;  4N4W A;  3HNK A;  2YL3 A;  1E83 A;  1YYX A;  2YLD A;  3ZTM A;  1E86 A;  1LM3 B;  5AGF A;  5B3I A;  256B A;  2XLH A;  2J8W A;  4CJO A;  1E85 A;  3DE8 A;  3HNL A;  4WGZ A;  4IAR A;  4CIP A;  4U9D A;  2XL6 A;  4JEA A;  1GQA A;  4CDV A;  1YZC A;  3IQ5 A;  4CX9 A;  3C62 A;  3HNI A;  3L1M A;  5JLI A;  1EKY A;  4CJG A;  1YZA A;  3M79 A;  2XL8 A;  3FOP A;  3NMI A;  5JRA A;  2YLG A;  3TOM A;  1BBH A;  3QVZ A;  3M4B A;  2XLO A;  1A7V A;  2BC5 A;  3M4C A;  3FOO A;  5JVE A;  1NBB A;  1QPU A;  4D4N A;  4ER9 A;  4JEB A;  2XLW A;  1JAF A;  5JP7 A;  4NC3 A;  2QLA A;  4IB4 A;  4EIY A;  2XLM A;  3NMK A;  5JS5 A;  3IQ6 A;  5JT4 A;  2YL0 A;  3QW0 A;  1RCP A;  2XM0 A;  2XLD A;  3M15 A;  1CGN A;  3ZTZ A;  4IAQ A;  1APC A;  1CGO A;  1E84 A;  3C63 A;  4JE9 A;  3NMJ A;  1YYJ A;  2YL7 A;  2CCY A;  4JKV A;  2YL1 A;  2YLI A;  4U9E A;  1M6T A;  3QW1 A;  3DE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...