1ZU4A

Crystal structure of ftsy from mycoplasma mycoides- space group p21212
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
309
structure length
305
Chain Sequence
PMEKAMLKSAFNFSKDIKKLSKKYKQADDEFFEELEDVLIQTDMGMKMVLKVSNLVRKKTKRDTSFENIKDALVESLYQAYTDNDWYRIDFKENRLNIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFRAGATQQLEEWIKTRLNNKVDLVKANKLNADPASVVFDAIKKAKEQNYDLLLIDTAGRLQNKTNLMAELEKMNKIIQQVEKSAPHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDLLAFDIDQYIVHLSSGFMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ftsY
publication title Conformational variability of the GTPase domain of the signal recognition particle receptor FtsY
pubmed doi rcsb
source organism Mycoplasma mycoides
molecule tags Protein transport
total genus 116
structure length 305
sequence length 309
ec nomenclature
pdb deposition date 2005-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1zu4A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zu4A02
1VYVA 4A0FA 2J9RA 221PA 1Q1EA 2YZ2A 2V1UA 2ATXA 3KJIA 1KK2A 5GJWC 3ZIAA 1HTWA 3BIFA 1E79A 4ZDKA 4NPHA 3I61A 2CLCX 2GETA 3EXAA 1W5SA 2IK8A 3GJ7A 2V7QA 1Q3TA 4LBZA 3GD7A 5JHGB 1L2TA 3W5IA 1E9AA 1OXTA 3NDBB 1NBMD 1G41A 4KSCA 2JDID 5CYOA 4M1MA 5EE5B 2QMOA 2I1VB 4KITB 3U6BA 2OEPA 4L5BA 1S9HA 4DDUA 2GILA 3TRFA 4PPQA 4CT4B 3S1AB 4MITA 4IKEA 1W5TA 5A4JA 3WXMA 1XJ0A 4KXFB 1T9HA 5J4LA 1YVDA 1GAJA 4RKFA 2H8KA 3Q5EA 4M1TA 1DPFA 3JVUA 3K1JA 1II0A 3GJ0A 3LVQE 3FMIA 1SVIA 3ZYCA 2BBWA 1ZD8A 5JEEA 5L8VA 3AF4A 3X1XA 2OAQ1 1R2QA 1IXZA 4M9ZA 3SOPA 1KDTA 3I4LA 3H84A 1UJ2A 3D6TB 3IPYA 2J59A 5FBRB 3D31A 1SULA 2XJ4A 2VP6A 3FKQA 3OEED 2ODEA 2DWPA 2QMUA 2R8RA 5D3QA 1NY6A 2PEZA 4DVGA 5TMPA 1SKYB 1ZNYA 3OESA 5IF9A 1NBMA 4FIDA 4EQ6B 2VRWA 3IGFA 2WOJA 2QSZA 2JDIA 3AUXA 1G3QA 4O0MA 5EUQB 2CVHA 3UPUA 2JLYA 821PA 4YC7A 2IA5A 1RRGA 3IILA 2IYSA 4ZDWA 3PEYA 2UKDA 3OE7D 3CF0A 1OB2A 4TLCA 1E4YA 3H4MA 3VR4A 1W44A 1KOFA 2IYUA 2ZYWX 3QENA 1NLFA 3LQRA 1YRAA 1SXJD 3GFTA 3AKEA 3IEVA 2X19A 1G1MA 1XMSA 4JJKA 2QEQA 3LWNA 4JS0A 4MKFA 4RZUA 5GJBA 3CRMA 4M9QA 3QY0A 4LOAA 4E09A 2AXNA 3OEEA 1L4UA 2WHXA 1G6OA 1VECA 4PO9A 3GLIA 4OKSA 4HLCA 2HDNB 1EWRA 1E2GA 2BCJQ 3OAAD 1FMJA 3K9LA 4Q19A 3RC3A 3BXZA 4IDPA 1CJUC 2IT1A 1J2JA 2VP2A 2NO9A 1UADA 2QAGB 1D2EA 4B75A 2IF0A 1HE8B 3VR2A 4MRRA 3MSXA 4PC6A 3SHWA 5JCPA 4DLZA 3GLGA 2VBCA 4DSUA 1KI6A 1XU4A 3KQKA 4V0NA 1UKEA 1TADA 2BEKA 2IEZA 4JVLA 3TAUA 4AKGA 3DM5A 1KI7A 4MDEA 2HT1A 3QG5A 1SXJA 3VX3A 3LQQA 3T1OA 4A8JA 4DLVA 3L0OA 1U9IA 2HYIC 3BH0A 1SVKA 1P4SA 3FMOB 5FOSA 2F3RA 1YR9A 1TL7C 5DHFA 5F2EA 1E9CA 1FTNA 4H1VA 5IDVA 5F98A 5DGXA 4Q9HA 1D2NA 3A6PC 2AD5A 2ODNA 3U3KA 4DLSA 1M7HA 2ERYA 1FMLA 1YZQA 2OFXA 3OAAA 1A7JA 5G3YA 4BWYA 2EWWA 1OXSC 1LNZA 4F4IA 5TDHA 1II8A 1E9FA 2ZRFA 3KKPA 5BYKA 3UMFA 1Z0KA 3QSYA 2ZSBA 1DAHA 4JLOA 1KZ7B 3R8FA 3SJBA 2QGZA 4I4LA 2EYQA 1L8QA 2ODWA 1T8TA 4AYTA 4CW7A 1I4TD 1F48A 5FUXA 2JJ1D 1RJ9A 2BDTA 1G291 4D4MA 1FW6A 1DAGA 2PX3A 2QPOA 1AQYA 3B85A 1R0WA 1OYWA 1H8ED 5CK4A 2J7PD 1IQPA 4FXPA 5TV2A 3FYHA 2ZRKA 2Q9CA 1P5ZB 2FWRA 2CJWA 2ZAMA 3BORA 2G9NA 4ZV4A 2QP9X 3K0AA 3T1VA 3LA6A 3UG6A 4ARZB 1OXVA 5L3QB 3Q72A 1O3YA 1E2IA 4JVNA 2HCJB 3REFA 3QBVA 1FP7A 5EXPA 4A15A 1U2RA 3SFZA 3P4YA 2IYWA 1E1QD 4LZZA 1E2LA 1G17A 1TMKA 1T0JB 1TQ4A 2ECKA 2GRJA 2P5TB 3LBIA 3MRSA 2JJ1A 3Q85A 4GP7A 2G6BA 5EE3A 3ZZUA 3B1XA 1Z6XA 1IXSB 3BRWD 3BC1A 5IRCD 2WIAA 4A0RA 1VYUA 2P65A 1H8EA 4G5QA 3AVPA 1N3BA 1W4CA 2J7PA 4HAWA 3TE6A 4G1UC 3DEFA 1KSJA 1ZNWA 4MYHA 4QFMA 1UF9A 3N2IA 2YHSA 4MGIR 4DSNA 4IVPA 1Z5ZA 4K8OA 4M9XA 3VR3A 1CJKC 2XAUA 4L9WA 1COWD 2NTYC 3AEZA 4BFVA 1WB9A 2ZI3A 3WBKA 1HUQA 4HLDA 3WRXC 3WMFA 1DARA 2H1LA 5LDDC 2GCNA 4D0NA 2CE7A 3KUCA 4EFMA 5LBIA 2GWHA 1JALA 1AIPA 3CM0A 2E87A 2ZS8A 1WBBA 1GG2A 2J7KA 4BECA 5AJVB 2AX4A 1RC8A 2NO6A 1W48A 4RD0A 5EZ5A 1WXQA 5KSZA 1TQDA 2GJ8A 4PPFA 1T8UA 3LDAA 5IHPA 5BN5A 4ABYA 3ECCA 4WVFA 3P26A 4M1YA 1R4AA 5C4MA 3AVYA 1KY3A 3LNCA 3U2QA 2GXAA 1OIWA 2DPXA 4GT1A 3K0FA 4PC7A 3CNOA 4PC3A 2YWEA 5G41A 2J5XA 3V9PA 3ZLJA 4B43A 1RRCA 3KQNA 3FHOA 4Y0VA 1VCMA 1NMZA 1G9XA 2O52A 1K5DA 2YOFA 1COWA 2FPKA 3AP3A 1CR0A 2ASEA 1W4BA 4LHVA 2D06A 4YONB 2GZHA 1NL3A 4DIDA 2QE7A 1EFUA 1AA9A 3U3MA 5FTKA 4EPXA 4WAUA 5CK5A 4DT1A 2F1IA 1Q1BA 1RFLA 2VP5A 3MWKA 3GLHB 4JKYA 2R6FA 4EDHA 4URXR 1IM2A 2QROA 4LJ9A 5JJIA 1EX7A 1AGPA 2KB0A 2N46A 4U02A 4XIGS 4YMVA 2AR7A 3SFVA 2ZM5A 2OM2A 4PHFA 1Q22A 1E4VA 1RKBA 1VTKA 1X8JA 1E98A 1XZQA 3U7FB 5KNDA 3EWAA 1AJEA 3TUIC 4XWAA 4ERNA 3AVTA 1QHHB 3U7GA 2YNMA 2MMCA 4ZI3A 3I5YA 1E0KA 3OIYA 5CM8B 2FEMA 5KYKA 2A5GA 1TNDA 3IO3A 1JEDA 3LD9A 2O8FB 5B58C 3V00A 1P2TA 1KGDA 1KJWA 4JJZA 1VYTA 2XSZD 1TPZA 5SZIA 5K8UA 3LAWA 1G7RA 2JGNA 2XITA 4RFSB 4HZUA 3IIKA 1ZJ6A 2WKRA 1OF1A 4O2RA 3FKSD 1XTQA 4KV9A 1KSHA 2MSDB 4HDQB 2IBMA 1OYYA 1XRJA 2JASA 4AI6A 1VIAA 2OBLA 4Q7JB 2CBZA 4M22A 3IIMA 3QPUA 2DFTA 1Z47A 4A0GA 2QTHA 1XMJA 3W90A 2BEJA 2ZTSA 3QVVA 3EZFA 1E0SA 2VLIA 4LPKA 3EC2A 4Q9KA 4H1UA 5EQTA 2CHVA 4LPSA 1KKMA 1ZAKA 4D26A 2QP3A 1KI4A 1RYHA 3QNUA 3TAHA 3HDTA 1XTIA 2FU5C 2OLKA 2DFLA 2VHCA 3A1WA 1DG3A 1ZM3A 3HU3A 3KKQA 3QF7A 4HAUA 1XCPA 1U99A 3B1ZA 4V0MA 3T12A 3GLFB 2DFKB 2DB3A 4Y0AA 2Y8EA 5HZHA 4AYXA 1KAGA 2RGDA 3FMPB 2WSSD 3MCAA 4DLTA 2BCGY 1W47A 2XSZA 3KXIA 4G0NA 4ASUD 1JQJC 3KJEA 2OE2A 4OI4A 5B30A 2GEDA 5DHAA 1NKSA 4QJ4A 4ITRC 3VKGA 3THWB 2C98A 1M7GA 4PHHA 4P4TA 4RKEA 2RCNA 2QAJA 2RH5A 3VTKA 1N6KA 3EG5A 5C46F 3PJRA 3OZXA 3NC0C 3EWSA 5LPNA 1UAAA 1G5PA 4HDCA 4AURA 2QTFA 3V4FA 3BK7A 1VMAA 3IQXA 2ZU0C 1ZMXA 2WWFA 3AVUA 2G83A 1Z2AA 2BHRA 3MMPA 4QXAA 4X8OA 4OQXA 4G3XA 3EIEA 4Q4AB 4C2UA 1EESA 3HPRA 4MDFA 3UIEA 4WXRA 5TY0A 3NEJA 3T5DA 3KFXA 1KK3A 4ZCIA 5C2JB 1KK1A 2F1HA 1MH1A 1YE8A 4D0GA 3G0HA 3VX4A 1JJ7A 1NIJA 2JAQA 3THXB 2Q9BA 1Z29A 1P9NA 3GJ6A 3WBJA 2WSSA 3V4RA 4XWOA 4CGZA 1CF4A 4ASUA 3X2SA 3HJNA 1QG4A 5JSZA 1Z22A 4II7A 4QNMA 4Q01A 4HZIA 4B47A 1WGWA 5DN6D 1II9A 1YU9A 4LJYA 4TMVA 5JCZA 4CEJB 4JYBA 3K09A 3SC3A 4B3BA 4Q4HB 4ZO4A 4OHZA 4KLNA 4US1R 2KBEA 1HE1C 5HTKA 1ZINA 1G8FA 2HF9A 3C5CA 3IIJA 2WVJA 2HXSA 2ZXUA 2ZS9A 3CLVA 4NE2A 3M1IA 2R62A 1XJQA 1U0LA 2BBOA 1UEJA 4EJSA 2D2EA 2QENA 3VU9B 2V4ZA 2GF0A 1OXXK 1XWIA 5BN3A 1J90A 3SU8A 3A1VA 3AP2A 2WJHA 2KWIA 3K9GA 4I1OA 4IOJA 1AK2A 5DLQC 3B1VA 2IHBA 4HLUA 2P6RA 2WAYA 3M4YA 2G0TA 3X1ZA 4NCJA 2F43A 4A0HA 1E2QA 2CVFA 1N6PA 4BZQA 5KDOA 4YMTA 4M1OA 4MKIA 5DN6A 3NBFA 1XJCA 1IHUA 3RANA 1DO2A 4BFSA 4BGDA 1NNEA 2XNSA 2XB2A 3I62A 3ICEA 3OFND 1SXJC 4A8JC 2XX3A 3WYAA 3ND9A 4LK2A 1EFCA 2REBA 5FTNA 1AQUA 4QC2A 4BRUA 3QJYA 3U3JA 3I5XA 1IONA 4DCNA 4JSYA 2ZI5A 4GP6A 4EPWA 2C5LA 4XSGA 5EP4A 3GLGE 3ZQ6A 4NYJQ 3Q5DA 4XH9B 4N1AA 2QT1A 2FFAA 1NP6A 3QIAA 4M9SA 1Q1QA 6Q21A 1M7BA 1XPOA 2X77A 1HURA 1DS6A 2VF7A 2ZRJA 1SHKA 2H17A 3QKRA 4AIIA 1Q3HA 1NIPA 2ZRBA 3KQLA 3W8RA 4EIWA 1Z0AA 1IN7A 4DDVA 3BERA 3BFVA 4B6FA 3SYKA 4XD7D 4D4JA 3MFYA 3OFNA 3I8XA 4AG6A 2QSYA 2WWGA 2CEAA 1XPUA 1XNJA 4GZMA 4JMPA 4D81A 1Z0JA 3TR5A 2PMDA 1S4QA 1CULC 1XEFA 4G5RA 1XTJA 4PX9A 4LCBA 5FI0B 1GRNA 4UJ5A 4JBYA 1KSGA 4DLYA 4P3YA 3KX2A 4OJQA 1NVVR 4UJ3A 1OIVA 1OFUX 5HE8A 3B13B 2LCFA 2RGEA 3KTAA 4RY2A 1B23P 3FB4A 3BAFA 3QF4A 4LX0A 4GMDA 2ZI4A 2UZIR 4XD7A 3QI2A 2WICA 1E9RA 1MRNA 3GJ5A 4DDWA 4LYFA 4ZIRA 2IW3A 2VHJA 4X8MA 1MT0A 2AKYA 2CDNA 2ZJ2A 4JLVA 1Q12A 4QBHA 2HLDD 4JL6A 3I8SA 1ZD9A 2EFCB 4HATA 1N6IA 3ZS9A 2VSOA 4F93B 1S3GA 4XVQA 4GSYA 2XTMA 3QXHA 1LY1A 2ONJA 3PVSA 1IY1A 1PJRA 3L0PA 2GJAA 4BFUA 5DI9A 2I1QA 3L8ZA 2GVDC 3HP1A 3ZJYA 4TYYA 4HUTA 2JIZD 2CXXA 1G7CA 4FCWA 5CITA 4LSGA 1NVVQ 3PFIA 3CKLA 4CEIB 3DMDA 2ZVQX 3E2IA 3AVOA 3NG1A 2R6DA 4Q21A 3EZ6A 3BOSA 1NRJB 4I1VA 4MKHA 2A5YB 2VYFA 1E69A 4OQMA 5FPHA 3WNDA 3FPAA 1R8SA 1VDZA 3GLIB 4TZ0A 3O8CA 1Q21A 4EPTA 2VP0A 2EFGA 4Q9JA 1F2TA 2V6JA 1N6NA 1EK0A 2LKCA 4F91B 4PPNA 4GL2A 2JLXA 4JLNA 3U3OA 1XTKA 4ZPXA 1RW4A 1KI6B 4DHEA 1FPMA 1RIFA 2NG1A 4JL5A 1A82A 2QPAA 3D7MA 2FGKA 4Q1AA 4BLTA 3NVAA 3PEVA 2NIPA 1Y63A 1SXJB 2JIZA 4DXAA 1E94E 4LC1A 4B76A 1NVUQ 4YMUA 4BFZA 3ETLA 4PZLA 3SEAA 1ZUHA 4PR0A 2FNAA 4OK5A 5BXQC 5TVKA 4FWTA 3CIOA 1MABA 2GF9A 2CHGA 5CYPA 3KZ1E 3AV0B 5DSZA 1PUJA 4RJLA 4KYUA 5HPYB 1P2UA 1NY5A 4Q47A 1W36D 1EG7A 5F3WB 1VPLA 2X2EA 3RS4A 2G1KA 2GESA 1ZUIA 3T15A 3GFOA 3A1UA 3EAQA 2C9OA 2HJVA 2VF8A 2CE2X 3A37A 4BASA 4B3DA 1XF9A 2FX3A 1ZNXA 4YDHB 2GAOA 5M04A 1XXHB 2B7BA 3CNNA 3NEYA 2O8EA 5FOVA 2B8TA 4MRSA 4YXWD 4N3NA 4P31A 2FSGA 3ASZA 1ZD1A 2Q3FA 1KK0A 1G5TA 5J40A 4B2LA 1DELA 4BFWA 2CJWB 3K0AB 4DWJA 4IDQA 4G01B 3QPWA 1FZQA 4G5SA 4M1WA 1R10A 2RKOA 4BEBA 3B78A 2ZETA 3PENA 3E1SA 3SDZA 4FN5A 2SHKA 3U60B 2XOKD 3E5HA 1LFDB 3NWJA 4DB4A 1F2UA 3AQ4A 2QN6A 2ONKA 2J3EA 4GPTA 1LTQA 3ZQJA 5J4HA 1NG1A 2V1XA 3FVQA 1XX6A 3T35A 1T0HB 1TTTA 2ORIA 3SYLA 3K70C 4RSGA 3AVQA 3QXSA 3PIRA 3BB3A 4HEJA 1NMYA 3GEIA 4NMMA 4Z8XA 4YXWA 3R7WB 2ZQ5A 1OIXA 5FTMA 1IJFA 1ZIOA 3VNUA 2B6HA 2XJ9A 4W9MC 4P32A 5EXTA 2XXAA 3B1YA 3MAAC 2PCJA 3TW4A 4LHYA 4RD3A 1A2BA 1UKYA 2RGBA 3CF6R 2FSHA 3UWKA 3VR1A 3ICQB 4V0ME 1MO6A 1PLLA 4HDOB 3PUVA 3IHWA 3W8NA 4KAXA 5AR1A 4Q03A 5JJLA 3EIHA 1XPRA 4PZZA 5CB6A 3RC8A 4GRAA 2RMKA 1JR3E 1NSFA 3B1WA 3GCGA 2XOKA 2R6GA 4CVNA 3PUXA 4FMCF 4LBYA 1QRAA 2F9MA 2J0VA 4B3CA 1VG8A 3A4MA 3PCRB 2J45A 3VAAA 5FFMA 1E2NA 3ADBA 4AWXA 1XTSA 5C1BA 5AUNB 1LB1B 5EXXA 1G3IA 4DIEA 4LBVA 2FE4A 2FH5B 2NMVA 1E9EA 4KVGA 3CPHA 1J8MF 1S9DA 4HUQA 3K0FB 3FHCB 1NG9A 1S8FA 1YJ5A 3MJRA 1F6BA 4Z1MD 3EPKA 2V8OA 1M2OB 2ZRCA 4WZAE 5E95A 1R5OA 3N2EA 2XEXA 2HF8A 3K09C 4UNRA 2PL3A 2XGJA 1NLYA 1GNRA 2P2LA 3B9PA 4LHZA 3OE7A 5LD2C 1AS2A 2FFBA 4HAXA 3TVDA 1KI9A 4P4SA 3B2EA 1JAIA 5JWHA 1AS3A 1QHYA 4TL7A 2IF2A 3R9WA 1N5JA 4EJSC 4DT1B 4TQ9A 3NBZC 1U0JA 2O8CA 5EP1A 2JATA 1U8ZA 2W6ID 3IO5A 5JEDA 2QRNA 3KJGA 4JKIA 4E5UA 2FFHA 2EFEB 4L16A 3VR5A 4FMBB 4TN1A 3EPJA 2GDJA 1KTVA 4HLUC 1J8YF 2FN4A 2FF7A 1C1YA 1RYFA 2VIIA 4MYTA 1R5NA 4IFEA 1IN5A 4BUJA 1ZW6A 3SE0A 1GIAA 4H9GA 3WMGA 3ONWA 1P62B 1GVNB 2FPMA 4WIAA 1UFQA 1OXUA 2CCKA 1U90A 5G40A 4TMWA 4OHVA 3TNFA 4OHYA 2GBLA 1DBSA 2CCGA 5J4KA 1T91A 4GNKA 4PFSA 1GFIA 4TL6A 2WWYA 1PV4A 1FX0B 5CDFE 2HEIA 2O5VA 3CNLA 1FUUA 1HQCA 1T3LA 1DOAA 2QI9C 4TYWA 2X8AA 1KMQA 2J0SA 4C0AC 5DO9A 2OT3B 4NZYA 2OCBA 4PQFA 2F1JA 2QUZA 1J99A 5TARA 4HZUB 2R44A 3EZ2A 2OSBA 2Q3HA 2KBFA 4PZYA 1BYUA 2BKUA 2DY1A 3QXCA 4BEJA 2REOA 1E0JA 1MRSA 3GJ4A 1E3MA 1ETUA 5FL3A 1H8HD 4A6XA 1N5IA 2ZSEA 4C7OB 1XP8A 2REXB 1P2VA 2V6IA 5JWOA 1ZM7A 5DE3A 4ACBA 3PEWA 2YKGA 1G7SA 2YC2C 3LO5A 1AZTA 4QGAA 3CRQA 2PT7A 4OQLA 5L3SB 3A4NA 2A5DA 3ZVMA 3A4LA 1LS1A 2GJSA 3AF2A 1YR6A 4R98A 1K6MA 2CL0X 2VHTA 4WXPA 1TF5A 1G18A 3K70B 4DLXA 1C9KA 1SKQA 2WM9B 4IEIA 2WIBA 3A1TA 4OHWA 2YWFA 2IX3A 3L0IB 1KO7A 3WMEA 2BBTA 3CPEA 4CEHA 1W2HA 2WJYA 3MJHA 1N0VC 2CL6X 3T5GA 4DDTA 2BC9A 3K0SA 2H16A 4XSHA 1XMVA 3QEOA 1TF2A 4DUGD 2LKDA 3MWLA 3DHWC 1H8HA 2CHQA 4IOMA 2QP4A 4JLPA 3W6OA 2R9VA 2QM7A 1Z6TA 4K46A 3DM9B 1IJEA 1WDTA 2ZIAA 4URUR 2IYTA 4Q7LA 2JLRA 1MR3F 2JLVA 3H86A 2ZRDA 4LJ6A 1QHNA 3ZS8A 2QORA 1Q20A 2PJZA 4MA4A 1E1QA 1D6JA 3U3RA 1S0UA 4DEYA 4EQ6A 1GL9B 2RGNA 3TQFA 3U44A 2ORVA 2QQEA 4ACAA 4QHYA 4NYIR 2CNWD 4PAOA 3L0SA 2XZLA 3KQUA 1OH7A 2A78A 3MWYW 4POAA 1G20E 1I2MA 1WA5A 4W5JA 4AC9A 1E2FA 4DSTA 2GNOA 2ZYTX 5JSZB 3GLFE 1FFHA 4O3MA 4LUCA 5SZHB 1DAIA 5E7JA 3T34A 1SHZA 2KJQA 4KJZA 1F3OA 1ESNA 1GSIA 1QBKC 3TMKA 2GXSA 4O2LA 5TB5A 2ZR9A 2VP4A 2G77B 3CONA 5FUWA 1DADA 2ZI9A 2IXGA 4HAZA 2FZLA 5LD2B 3NKVA 1M74A 2IYXA 1ZM4A 2G88A 4C2TA 3TVTA 2D3WA 1CJVC 1D5CA 3KXKA 1CR4A 3VQTA 2QBYA 2IXEA 3U4QA 3FHTA 1VKJA 3Q9LA 1KI2A 3RSOA 1OFIA 4G5GA 1LS6A 4BFTA 1FOEB 4JYCA 3FFAA 4MGKR 3IBGA 1BOFA 1ZNZA 4PC1A 1OH8A 2CNWA 2B7CA 1WE2A 2DWOA 1NJFA 4MGYR 2CL7X 4HLQB 1WBDA 4Q00A 4Q1DA 2YV5A 4NYIQ 2F43B 5G53C 2OO7A 2YOGA 5L3RA 5FBVB 1KDPA 3NHAA 1N25A 1AKEA 4CYMA 1IXRC 3K0CA 1G5RA 4LHXA 2I4IA 1UEIA 1UM8A 1LVGA 2IUSA 3ADDA 4TWZA 1KJZA 4PSAA 4JSTA 1TAGA 2W2XA 4F38A 3FWYA 1IOZA 3DO6A 1N6HA 2GK7A 4B73A 1IN6A 3CW2A 1CRQA 2ZSDA 3WNCA 1KZGB 1TU3A 3LXXA 4PQYA 5KUTA 4QGHA 4UQOA 1Z0DA 4IXNA 3OIUA 4LJ7A 1CR1A 1JR3D 1E9DA 3GPLA 3THYB 3TR0A 1EGAA 2ZI6A 2BWJA 1KDOA 3CX8A 3CX7A 3QKRB 2PZEA 5E4FA 1JXMA 1D2MA 5DI3B 1OPXA 2V9PA 2NZJA 4TQAA 3LW8A 5JLJA 3KB1A 2J0UA 4IJMA 3RWMB 5HE9A 1OLOA 4DBLC 4PAMA 1Z0IA 3WNBA 2QA5A 5FUVA 2AD1A 1OKKD 2C9YA 3NH6A 1YZLA 4LY6A 4UNSA 4ESHA 4PSKA 621PA 1KI1A 121PA 4JLAA 5ANRB 2FG5A 2GJ9A 1KMHB 4NYMQ 3IUYA 3C8UA 3MUFA 3NXSA 4KSBA 3EPLA 2AN9A 1MO4A 3G5UA 4LHWA 2IYQA 2GXUA 5G3ZA 5L3QA 1TF7A 1JPNA 5AUQA 2QGNA 5H68A 1ODFA 2ZS7A 3TK1A 3FKSA 1JR3A 4A6PA 1HQYE 5CM9C 1WQ1R 4V03A 3GJ3A 4MRVA 1IN4A 1P73A 3WHLA 3NHBA 4FINA 4M4SA 2IYVA 1E1RD 3LV8A 4FMCB 1P7CA 3DMNA 5ELXA 3L82B 3CH5A 1BO6A 2QPTA 3KTAB 4TLEA 2YOHA 2GKSA 3RWOA 2ZE5A 1BMFD 3GQBA 4S35A 3QF4B 1P9RA 5HZKA 1P75A 1OH6A 1YR8A 1SVMA 4TMKA 2WZQA 1OKKA 1SVLA 3CRVA 3DPUA 3K9HA 4ZIRB 1Z2CA 2DHRA 1BKDR 3P32A 4MYUA 4GOKA 4NTZA 3RS2A 4DKXA 5KOYA 2CLDX 5DNYB 1W0JD 4KFUA 4DJTA 4CRWB 2W6JD 1KDRA 2YINC 1G16A 4OL0A 2O8BA 3X1DA 1KY2A 1QG2A 5FI1B 4M21A 1SZPA 4C0HA 2H92A 3RS7A 3AF1A 1SQ5A 3KXLA 3PITA 4ZCMA 1TEXA 1XCGB 1JI0A 1OFHA 4JIMA 4M8NE 4TT3D 4ZDJA 2C8VA 1TQ6A 4N0DA 2WOOA 2BVNA 3F5FA 1NF3A 4QNRA 3ZH9B 2O8DB 2P6NA 4LV6A 4NONA 4QKQA 2EFHB 3O47A 4EPVA 2PX0A 1S1MA 2N42A 1FQKA 4A1FA 5F9HA 5EE9A 1HT1E 2UZ3A 3D3QA 3MD0A 1E1RA 3OIWA 4Q4JA 3SBDA 1ZC3A 1SVSA 4KYIB 1ANKA 2EU8A 5HKKD 3QXJA 2JJ2D 2ZYVX 1GNPA 3DKPA 2OCPA 4OK6A 4KBGA 1BMFA 1DAEA 4IOLA 4R2IA 1DAMA 4XOIA 1NLZA 2RHMA 3KKNA 4NYJR 1ZCAA 4TL9A 3Q8XB 3KQHA 2ZPTX 2RB4A 1L7VC 3NC1C 1TU4A 4PPGA 4UNPA 3U61B 1W0JA 4IVRA 1NN0A 3WHKA 4PO1A 4C30A 2W6JA 1VCOA 2BMEA 5HR5A 5EZ6B 3AKDA 1ZIPA 1US8B 3HYTA 2ZSFA 1SGWA 1M6NA 4TSFD 2YWHA 5CDFA 3PG5A 3OIVA 4RFVA 5HCNA 4Q1EA 2NOAA 4AD8A 3I32A 5SZKB 4M2LA 1I4LD 1PZNA 4O25A 4Q7MB 2FEOA 1GL7A 1T3SA 1NSTA 2ZSAA 4M1SA 2JLSA 3WP1B 2FA9A 1OT3A 3LH5A 5DYIA 1KI3A 4LJ4A 2FSIA 5KHOC 1U8AA 4KODA 4US0R 3K0EA 2RGGA 4KVAA 3PXGA 3GLHA 1JAHA 1P6XA 1U9IC 2A2ZA 1A4RA 4F7WA 4LJ8A 3NH9A 4NKRA 1T6NA 2PLFA 1Z63A 2ZI7A 3EC1A 3UATA 2YC4C 1V5WA 1YZGA 3HU1A 2JLWA 1CEEA 4GOXA 1YHNA 2ZR7A 4WZBE 4FCVA 1QHXA 2IYRA 1OE0A 4OHXA 4I81A 4PC2A 2IYYA 1G4UR 4BLSA 1E2PA 3AVXA 3CZQA 3L43A 4JLDA 2JLQA 4D80A 1WMSA 1MKYA 1XEWY 4R7ZA 1QHHA 4N0EA 4C4PA 1WCV1 4TSFA 2GBLC 1S3SA 2ANCA 4YMWA 3VFDA 2OHFA 3DOEA 3SQXA 3IHLA 4DLUA 3MWJA 1GWNA 2ZEJA 4A2WA 1SVOA 4B3GA 4CDGA 3HR8A 1LW7A 2ZUBA 4MRNA 5FPKA 1OH5A 4RFSA 2AHOA 3I73A 4GMXA 3L8YA 2F1RA 4PO8A 1XDBA 2BJWA 2BM1A 3NBYC 1R8QA 3R9IA 1KIMA 1NI3A 3B8HA 3CBQA 2F9LA 4AY2A 3CF2A 3B7GA 2WBLC 3BH7A 4ZDIA 3U7HB 2QY9A 2VHQA 4BRWA 4AKEA 2GEVA 2EWVA 2WJJA 4M0LA 1D8TA 4GBMA 2ZYUX 2NPFA 4QBFA 3SJZA 3REGA 3M6AA 2LWIA 5AK0A 3RDPA 1G3MA 4DSOA 1CR2A 3GLFA 1F60A 1VHLA 3MGCA 4XVRA 2ZU6A 3ZVNA 1G8YA 1HT2E 2TMKA 4K81B 2BOVA 5L3VA 3NIBA 4WOPA 4BZXA 1R5BA 1T5IA 3FDIA 2OV2A 4MYCA 4UKDA 3TH5A 3THWA 2XXAB 4UNNA 1N6OA 1QVAA 2BV3A 2Z4RA 4Q7KA 1BIFA 5EXSA 3LLMA 3GEEA 4LV5B 2QTVB 3THOA 4CIDA 4MGZR 3RRNA 5AJYA 2CMKA 2GAAA 3C4JA 3DKVA 3QPVA 2GHIA 1HV8A 1YR7A 3EA0A 3A58B 3Q7QA 4IDNA 4TLDA 1ZP6A 1GRRA 4Q4AA 2WJIA 1FNNA 4HB3A 3RS0A 1XTRA 3HR7A 5J4VA 1XBTA 3EZ7A 2QNRA 4J0QA 4LGMA 4Q5IA 2BBSA 4OQNA 5KDLA 2J1LA 4IW3B 2DYKA 2WWWA 3QKUA 1GKYA 1E9SA 2ZITA 4FD2A 4Q1BA 3O8BA 3EARA 4LWZA 4NBSA 3AB3A 2ORWA 1ONBA 3SBEA 2WMOB 4TZ6A 5BWMA 2NPIA 4TTPA 2HLDA 2OFOA 2VO1A 3PEUA 4JLJA 4KO8A 1SKYE 4CEJA 1AN0A 2OLJA 2GJKA 2R6AA 2RGAA 3GLGB 4MKGA 3P27A 2XTNA 4P4SB 5A0FA 4I1SA 2H5EA 1E96A 4A92A 1G3RA 4E03A 1T3HA 1GM5A 1UKZA 4A8JB 3EIQA 1ZVQA 3VU9A 4PHTA 2ODBA 5CLLA 4MH0R 1P9WA 4YDSA 5BN4A 1S2MA 3FFBA 4BE7B 3AGPA 2C77A 3U7EB 1TUEA 2V55B 2BMFA 3WYGA 2B8WA 3ZGXA 1VCIA 4FMDF 2Q0HA 2QZ4A 2BMJA 2X1VA 4DCTA 5L3SA 4LDJA 1NVXQ 3M0EA 1DTSA 3N70A 5GVSA 5JJKA 4P33A 3LX8A 5A5GA 1UBEA 2IEYA 4TQUS 3WRYC 1CKEA 3ZIAD 4OQFA 3AM1A 2IS2A 4Q66C 3EW9A 1II8B 3W6NA 4WW0A 2E9SA 4QJ5A 5JZVA 4QM7A 1JPJA 2V7QD 2FZ4A 3SI7A 1KHTA 4BFYA 3B9QA 3E70C 4JT4A 1A2KC 4HSEA 2ZREA 2GCOA 3IEUA 4W5HA 4A82A 1N5LA 1RJ9B 1N2CE 3FMFA 2FDCA 1PVOA 4ZI2A 1CTQA 1Z0FA 2RGCA 5E7MA 2FPLA 1TX4B 1N0UA 3KL4A 1XEXA 4DB2A 4OJKA 1EFRD 1YZTA 3I72A 5J5CA 5JWRA 2HUPA 5C4GB 3CUEF 4B44A 4C0JA 4JBXA 3RRZA 1GKUB 4PANA 4RZXA 1RRPA 3OF5A 2ZJBA 4TTQA 1VG1A 3RRYA 4UXIA 5J47A 4MRPA 4RZ3A 2EVWX 3QOFA 1E2KA 1WF3A 1U0HC 4D6PA 3P4XA 1QHIA 2P6UA 2R65A 2A5FA 3JZAA 3PUYA 1WRBA 1GNQA 3H0KA 3TJZA 4JZKA 1ZUNB 2ZJOA 521PA 3RAPR 5JHHB 4Q1CA 2QT0A 2W2VA 2OG2A 3T1QA 4NCIA 2GCPA 4JLKA 4EFNA 5FTJA 4LYJA 1E9BA 3W9YA 1Z28A 3KB2A 2ZE7A 4YLGA 1NVWQ 1EX6A 2J46A 1EFRA 4AG5A 4CEHB 5GJVC 4ON9A 3DOFA 3SHFA 2MMGA 1E2JA 1R6BX 2CLSA 2OBNA 4C9BA 5BQ5A 3JZMA 4HB0A 1GZSA 4BQSA 5DYGA 5AUOB 2D4HA 3UMSA 3U6KA 5D3MA 1P60A 3KUDA 4RD1A 4TYPA 2PT5A 4ZCLA 3TUZC 3LLUA 3OHMA 3VMFA 5KPJA 1UKVY 4AKIA 1UPTA 3NDPA 3U44B 1GRQA 1FTSA 2OCAA 2PBRA 1BYIA 1CLUA 3AH8A 2QG6A 3NTUA 1M8PA 3LY5A 2AKAB 2HYDA 1XD8A 2KI5A 3GFPA 4EPYA 2C04A 1CJMA 1I2DA 3VKWA 3ASYA 1ZRHA 3C16C 1U98A 1Z8FA 3UG7A 4GDFA 2WV9A 3A36A 4DLRA 4PQRA 2OXCA 3QG1A 3AP1A 4EUNA 1IY2A 3OEHD 5HCIA 3SS8A 4D4LA 1JBKA 5FPYA 4RD6A 1N6LA 2PCLA 1KO8A 4JLMA 5GVRA 1X6VA 4CEIA 3GJ8A 2IC5A 3H2YA 1X3SA 1ZU4A 5IT5A 1MV5A 2QBYB 1XD2A 4IDOA 5K8LA 3U4QB 3ADKA 2IXFA 4FCTA 5FOXA 4E07A 4BPBA 3RS3A 5EJEA 4KFTA 5KSPA 1CRPA 2NO1A 1RZ3A 2GXQA 4D4KA 4Q18A 5FR2A 3EPHA 2BIFA 5KO2A 2IL1A 2ZJAA 3PQCA 4DEXA 4B3FX 1BS1A 2JEOA 1K5GA 5CB8A 1ZBDA 1QZXA 1MO5A 2Z0MA 2YYZA 5FH9A 2AWOA 1UBCA 5FOTA 3VKHA 1E32A 2OUKA 3UANA 1X8LA 2W83A 2IYLD 2X2FA 1QHGA 2QQ0A 2B92A 5JRJA 4NP6A 2XZPA 4Z1MA 4CF7A 1XD9A 5EP2A 3TGPA 3QEJA 2ZRNA 3OEHA 2WWHA 1DEKA 1GP2A 1RRFA 4QBGB 1VG0B 4QHTA 4RD2A 4U5XA 5P21A 3ADCA 2W58A 4D0LB 5GADl 3IPXA 1YKSA 3TKLA 4X8LA 4C0KA 3RS5A 2DBYA 3QKSA 1OHHD 1B0UA 1AKYA 4UXHA 3BWDD 1BH2A 1GUAA 3HWSA 2W6IA 4RD4A 1QVRA 4URWR 2GTPA 3P1JA 1G8GA 3RRMA 3GJXC 2JA1A 3GLHE 1E6CA 4IFBA 2KSQA 2GZAA 1X1RA 4QRHA 4F4CA 4A2QA 1X1SA 5DH9A 2FSFA 5CJ2A 4QL3A 3W3ZB 2Z5FA 4S2EA 2J0UB 4Z51A 1XXHA 2W0SA 2ZR0A 2VSXA 4QHSA 1H65A 5EE0A 4HB2A 4Q4LA 1Z06A 3DZ8A 5UKDA 1AM4D 4TLAA 3QKSB 2VH5R 5FR1A 2WSMA 1LF0A 4BZPA 1E2HA 1DO0A 2NQ2C 5CIWA 2WWIA 4URYR 5KSOA 1E2MA 2N1BA 4ILEA 1OHHA 2PMKA 4KI0A 3S1AA 3TSOA 1W7AA 2RAPA 2P67A 1R0YA 2H18A 3C5HA 3Q3JB 3U5ZB 4OYHA 4C0SA 4BLRA 1P72A 1CJTC 1KO4A 2A5JA 2C99A 4ZKEA 3UMRA 5KDDA 1P61B 1PLKA 3FE2A 3TIFA 3H1TA 3A1SA 3SR0A 4EFLA 1PUIA 5C18A 1HH4A 5AJWA 3BFKA 3QVUA 4D25A 3B82A 4LJ5A 1Q0UA 4W5WA 2QMHA 2VEDA 5LB4A 3EX7C 4A9AA 2ZRMA 3J81k 1XB2A 2G1JA 2GEUA 1KJYA 3KFVA 3R7WA 8OHMA 4TMXA 2C78A 2AK3A 4P4UA 2WJGA 5JI3E 2C03A 2O8BB 1GTVA 1YQTA 4E22A 3ND8A 5F9FA 1NJGA 3KKMA 3T61A 2CCJA 1ZCBA 4YMSA 3BD9A 2ZVPX 2J87A 2Z83A 4MQBA 4QG7A 4Q9IA 1TQ2A 4LYHA 4QBIA 2VPPA 2QE7D 4IEEA 2QM8A 1OB5A 4GZLA 1VHTA 1S1CA 4Q4JB 1W4RA 3I1FA 4DUGA 1XZPA 5FPSA 3LBHA 4B33A 1XMIA 4FMDB 2MSEB 4XJXA 5FOUA 5BW8A 4B71A 4P0TA 4C0LA 1G19A 4EJSB 5KU1A 2PH1A 1G8HA 1JECA 1J7KA 4G5OA 4QGGA 5KPDA 1NKTA 3HYRA 5J4YA 4TLBA 4FW9A 1N5KA 2HT6A 2QAGA 3ZZ0A 3T1TA 2R2AA 4TYNA 4WA7A 5CLQA 3DVLA 2C95A 1L4YA 1V43A 2W2TA 3IDQA 4IDHA 1GILA 1Y3AA 1S96A 3QKTA 4KCGA 5FBWB 1UBGA 5AUPB 1NN5A 4QJ3A 3LX5A 4B3XA 4FWIB 2I3BA 3C41J 3W34A 4NYMR 2ZRGA 4KU4A 1E0AA 2BMDA 3CB4A 3BB1A 4QGFA 4B32A 2AL7A 721PA 3DDCA 2EFDB 4F92B 1W0KD 2GZDA 3KDSE 1ZM9A 2F6RA 1FL9A 4C3ZA 4L9SA 2OAP1 4C0BA 4JT2A 3BS4A 3KJHA 1D9ZA 421PA 1CU1A 5FOWA 4Z54A 1Z6YA 1Z6AA 2AXPA 1W1WA 4L15A 2JLZA 4NU0A 2QRZA 3MG9A 2VHUA 4KLZA 2J0QA 2WJVA 1LF5A 5B2ZA 2FOLA 3ZVRA 1KO1A 1KO5A 2ZJ8A 4PHGA 2Q6TA 4A4DA 5H1YA 4L4UA 3SJAA 1FX0A 4IOKA 4NCHA 1W2GA 3B5JA 1CXZA 1NN3A 1FUKA 3K70D 2XZOA 2GA8A 5K8IA 4LV8B 3TSZA 1UBFA 2HV8A 2D62A 2JLUA 2YJTD 4GFDA 4Z8YA 4DCSA 1W0KA 4GOJA 5JS8A 3RHFA 1IAQA 3K8YA 3L2OB 3RSLA 2C96A 2GK6A 2D7CA 3PR1A 3CX6A 5KNBA 2HJGA 3QQ5A 4ARZA 4WBSA 2O0JA 4NDZA 3R9XA 4C7OA 1YZNA 4B2IA 3K53A 4WZ6A 4MUAA 4X8HA 5KTYA 2ZAOA 1W36C 1JQLB 1RVDA 1U8YA 3VHXA 1M1YE 3WYFA 1GL6A 4KFRA 4OI2A 1DE0A 2Q3MA 1DVRA 1U81A 3BH6A 2W00A 1P2SA 4KHZA 4F4JA 4LBWA 3O8DA 4AKHA 3PUZA 1HY3A 4TL8A 3AVWA 5JFGA 2NO0A 4RVCA 2PZFA 2P3SA 4PXAA 4HB4A 5DISB 2ZRIA 1T5LA 4LRWA 4KFSA 1TUIA 3RLFA 2AWNA 2PZGA 5CJPA 4D82A 4OI1A 4LI0A 2RHDA 3ZVLA 2V54A 1VG9B 4XWKA 3PV0A 4LC0A 5FBLB 4U00A 2WPDD 4M1KA 1R0XA 4B74A 5JMTA 2WTUA 1QDEA 2P0EA 5EE1A 4HAVA 3CPJB 3HPQA 1LV7A 4JL8A 2KE5A 1P3JA 2ZRAA 1DAFA 4EKDA 3CRW1 2AK2A 4L8GA 5H70A 4UNQA 1E99A 4EPRA 3FOZA 1OSNA 1HA3A 1HYQA 1Q44A 4BLOA 3EZ9A 2R6CA 4Q9LA 2VA8A 1JEEA 1D9XA 2F3TA 2FJUA 4NL4H 2G3YA 2O0HA 2L0XA 3MLEA 3DZDA 5B64A 3BB4A 1ZYUA 2BJVA 2F55A 1G4AE 4LYAA 1G7TA 1Z6GA 1KI8A 4M53A 4US2R 2YWGA 1JR6A 3SYNA 3JVVA 1ZC4A 2EW1A 2WAXA 1F2TB 3VR6A 2DCUA 2Z6VA 3AVVA 4DZZA 2NGRA 5FUYA 1NBME 3SJCA 2ZUCA 2G0NA 2WPDA 2BKEA 4XVUA 3AKYA 4IHQA 5K8TA 4TT3A 2WKPA 4TMZA 3BGWA 4D2IA 4PSVA 1EFTA 2HCBA 2ZRPA 4JVMA 1KYIA 2Z43A 3SZRA 2XB4A 3IBYA 5JBQA 1A1VA 3W3AA 2O0KA 3LBNA 1VIYA 1ZM2A 1MO3A 3AKCA 4JVSB 4BLQA 4C0QC 5HKKA 4DCUA 4OBEA 1K8RA 2JJ2A 1Q57A 1KNQA 3PUWA 1QF9A 1X8KA 1G64A 3FGNA 2OCYC 4QOSA 4A36A 1MABB 3BE4A 5AWFC 2NO7A 3KKOA 4DRZA 1KAOA 3N5CA 3Q7PA 2FFQA 1FP6A 1G21E 1Z07A 4UXJA 4YQFA 3GLIE 4XTCS 3BFXA 1ELOA 3ZD7A 1AS0A 2F7SA 2ZJYA 2VTKA 2EYUA 4AYWA 1XCMA 1R0ZA 2ZRLA 3LRPA 1MOZA 3UK6A 2VQSA 2FGJA 2WMNB 2GCOB 2ERXA 3CR7A 5AJZA 2J41A 2RGXA 3CWZA 4CZ2A 2O8FA 3RVBA 3D8BA 2YVUA 2VL7A 1KKLA 4TMTA 1A5TA 3AGQA 3RNLA 3SN6A 1ZU5A 1IBRA 2O8EB 2IWHA 5KSYA 2QMEA 1XEXB 1W49A 1I4DD 4V0KA 1EWQA 1O87A 1SXJE 3LW7A 3AF3A 2ZRHA 2ZROA 3THYA 2OFWA 1RE0A 3F0TA 3WY9A 3ZD6A 2QU8A 3I3SR 4U7DA 1E2DA 3LXRA 1C4OA 4Q02A 3C7KA 2OESA 3UXMA 1JNYA 4RCZA 5DI3A 4LJAA 4NH0A 2OZEA 4FI3C 2PEYA 5EP3A 4ESVA 1G8PA 4JBWA 4A2PA 3NBXX 5SZJA 4W7SA 3DL0A 2OXRA 5FTLA 1IY0A 2DWQA 1W46A 4B2PA 4B34A 1Z3IX 1W36B 1CS4C 4R2HA 3GMTA 3LVRE 5E7IA 2E1RA 4TYQA 3T06B 1R7RA 1F2UB 2Z4SA 2ZJ5A 3W5JA 1KMHA 2D74A 4DCVA 2V3CC 2FV8A 2P5SA 3QXXA 4DC9A 3WP0A 1JB1A 1HEIA 2WWXA 1ESMA 2C9CA 3A8TA 4IRUB 3C14C 5H8WA 1XXHE 3UWOA 2IHYA 1XFAA 4R71A 5JECA 1OV4A 1GDDA 2ZJZA 2JJ8A 2IS4A 2HXYA 2C2HA 3VHLB 2GVZC 3TQCA 4JLBA 4CT5A 1OJLA 4I99A 3R8CA 4IVQA 2ZE8A 3VNVA 1JXOA 3IQWA 5E3HA 3CO5A 5D3MB 4QM6A 1GITA 1TEVA 3AF0A 5DIFA 1UDWA 1J70A 2WKQA 2IS6A 2DFNA 4BFXA 1NMXA 2ZUDA 3I92A 1GKIA 2IS1A 2CK3D 3LFUA 5JS7A 1YRBA 1DAKA 4DLWA 2AFIE 3QBTA 3G82C 1N0WA 4PAQA 4V0LA 1OFTA 4URVR 3QE0A 2RGNC 1U94A 1AZSC 4AK9A 2A3RA 2A9KA 3B60A 3THXA 4B6EA 1G6HA 1VCNA 2ANBA 1SVWA 4TTRA 3P20A 2XNDD 4HYYA 1CP2A 5IK2D 2FMXA 2IUUA 3CRRA 5BYJA 5TXGA 4EAQA 1AGRA 5FL7D 4OI0A 2PLRA 3R20A 1QHSA 2H7VA 2IUTA 2OBMA 3CZPA 1Z83A 3F8TA 4HUQB 3QUSA 2O8DA 1IN8A 1T4GA 1DG1G 1YZKA 1KSFX 4V0OA 3EA5A 1UDXA 3TSWA 3ZZTA 4Q4HA 2K5UA 4Q1FA 3TLXA 2MSCB 3X1WA 1M34E 5LB2A 4NCKA 1PLJA 2VP9A 1N6RA 5KNCA 4R9UC 2D2FA 5FBQB 3B6EA 2UVQA 3TBKA 1RPZA 3GP8A 4OK3A 1XD2B 2NZ8A 2A30A 2H57A 2PJRA 1JJVA 2CK3A 2IWRA 2Q9AA 5JRZA 2O8CB 1E2EA 1Q1ZA 1WP9A 3RABA 1OW3B 2B21A 2IYZA 1EXMA 4Q48A 4RZ2A 3RYTC 4B48A 4MUBA 1US8A 2EQBA 3CWQA 2XNDA 3AUYA 3ZDQA 2QAGC 4IXMA 5GJCA 2BM0A 5B57C 3X1YA 5IK2A 4ZKDA 4URZR 4RCYA 5FL7A 1F5NA 1CBUA 3UKDA 1W4AA 4V02A 1E79D 3SQWA 2ATVA 1XEWX 2AFHE 2DR3A 1YZUA 1EFHA 1Z08A 3TW8B 2D7DA 3K0CC 1X86B 1FQJA 1NN1A 4I1UA 3IKJA 3K9NA 2A7QA 2OILA 4GI7A 5EUMA 3O8RA 3W6PA 3BBPA 5CIQA 5AJXA 4BLPA 3HU2A 3SNHA 2QL6A 4XTRA 3CH4B 1CIPA 1G3UA 3GEHA 2Q21A 3EASA 3C15C 4NHOA 1GOTA 2W0MA 4PTLA 4KBFA 3CR8A 3TUJC 2ZANA 1KNXA 2ZE6A 3BJIC 2JCSA 2XTZA 3F3YA 1FNMA 4HI0E 4B35A 5JI2E 5FPTA 4HAYA 3FTQA 2VSFA 4NCNA
chains in the Genus database with same CATH superfamily
3VO8A 4ALJA 4CIHA 1DWQA 3ZIAA 3I61A 1YQDA 2P6MA 5I9IA 1I5EA 3KVVA 1YDFA 2A1TS 1BD3A 4B6GA 1MJGM 1B0ZA 4MICA 1JHZA 5I7RA 3T5PA 2QU7A 3LT1A 3K1JA 3V7NA 1FY2A 4MI1A 2BBWA 2MOKA 5L8VA 3N2GA 1X0VA 1UJ2A 3BCRA 2FPOA 1NY6A 3AR9A 4N6NA 5TMPA 2IGTA 2K2QB 3BXEA 1SCNE 3QYJA 1YQWA 1GZ5A 3FTCA 2X19A 4RULA 4JJKA 4J8PA 3QY0A 3OEEA 3O84A 2WF6A 1UZNA 1FFTC 3D8NA 6REQB 1P2BA 4IXTA 2HDNB 4MWTA 2WWRA 4IDPA 3MPUA 4IPTA 4WBXC 3NOVA 3UH0A 4DIFA 5AKYA 1JVNA 3HY6A 2QUKA 1J49A 4G1CA 3TL3A 4X94A 4M8LA 4X24A 1K5PA 5DHFA 5IDVA 2MU1A 1XVUA 1GLNA 2FX5A 3HNPA 3KVNA 2EWWA 4N0QA 5TDHA 4MZDA 1HFEL 2ZRFA 3G49A 4R9RA 4GDMA 4YB8A 4M36A 3WKBA 5CW1A 3GLRA 4Q16A 3ZV6A 6PFKA 1G291 3KELA 4GBJA 2PX3A 5F7JA 2O7VA 1Y7PA 4DWWA 2Q62A 4PYMA 4AULA 3FYHA 2TRSB 4FILA 2G9UA 1QFZA 3BWMA 3GPCA 2WQZA 2C2KA 3ZBUA 3BE6A 4MHTA 4RYDA 2HA3A 2Q7RA 3Q85A 3BRWD 2WIAA 3D3KA 2V7VA 1H8EA 5JANA 4CUJA 1UWLA 4MYHA 2CV0A 2YN4A 4M0DA 4DSNA 5LSAA 1RPNA 1C3LA 3JTMA 3LF2A 1SUAA 3F2VA 3CM0A 3VKFA 3FNGA 3LAYA 1JFFA 5AJVB 5CRIA 4IXDA 3Q3EA 2J67A 1BX0A 4M1YA 1IIRA 1R4AA 5C4MA 5ALIA 3LNCA 4JJ8A 1CVIA 5T3YA 1LPPA 3UO8B 3AP3A 2P0YA 2HDOA 2OCKA 4WAUA 1R3DA 1U28A 1KQOA 3F4BA 3ODGA 3VC1A 6YASA 5IM4F 1VTKA 3DAGA 2Z6UA 3ZHQA 3BSWA 4XR9A 1HQDA 4BO1A 1NBBA 3I5YA 1V6AA 3KS9A 2A5GA 3EG9A 1B68A 4EBFA 4OF4A 2DPHA 1YV9A 1Q0ZA 2ZIXB 3KJNA 5IWAB 4TKUB 5LUBA 2QTHA 3W90A 5TPZD 3QVVA 4DABA 3EC2A 4Y2TA 4OQPA 1KKMA 1ZAKA 4BY9E 2DLDA 1GU1A 3R5HA 4UPDA 2H3HA 2MSKA 1UBKS 4L4SA 3D4IA 1EZZA 4ITRC 3Q9NA 2Q0XA 2ONYA 4P4TA 3EDMA 2AUTA 4QU8A 5LPNA 3E9EA 1VMAA 3MMPA 3U4AA 3HPRA 5IT9A 1HO3A 4ZANA 1KK3A 2F1HA 1Y4ZA 2IITA 2QRGA 2HCRA 2Q4FA 1XQ1A 3V6MA 4G24A 1Z4JA 1LK5A 2F22A 2JBHA 4R0VA 5KAPA 2V03A 4I1RA 1U0LA 3R5TA 1UEJA 1SURA 2PWZA 4MINA 1T6ZA 5DMXA 1ATIA 4JY7A 5C34B 3AW9A 3ML1A 1IYZA 1UBOS 1OFUA 3OFND 2NVWA 3ITEA 1TCCA 2AZTA 1AQUA 5LP6B 1IONA 1GRVA 4DCGA 2XUJA 4JDUA 1FTGA 2PJUA 4N1AA 4A6EA 3JQDA 1T13A 1AKUA 1HR0B 3V8EA 3A06A 2X77A 2IYEA 3GRUA 5A5FA 2NO4A 3CLHA 4L0CA 5EJ9A 1E1CB 4KO4S 2F3QA 3H1EA 5I9TA 3BERA 4UW9A 3RQEA 2XWPA 2F4VB 2VT6A 3L41A 1Q14A 4GKAA 1OXBA 2HC9A 4J7TA 2BTQB 3U5TA 4LCBA 3RIPA 3CZRA 4PCAA 5FO1A 3EXEB 3KX2A 3TB4A 4TV8B 3LGXA 2VB6A 3HO8A 2YFYA 1ESCA 2UZIR 3T9DA 1USUA 3MAJA 3OZAA 1DAOA 4CMAA 5AT1A 4YK5A 3F67A 1JF8A 2YQ5A 3TG8A 1LQ2A 5EMMA 5A3QA 1S2OA 4YRNA 4E5KA 3PCTA 1QK4A 4GSYA 5F51A 2ONJA 4IDAA 1A4XA 1IY1A 3CRNA 4PW0A 4TV9A 3L8CA 4NI5A 4I1VA 5IT0A 1DTEA 1PYGA 2PKXA 2BW0A 3VI4B 2RB5A 4ALLA 2WUWE 2QR5A 3PE4A 3PFCA 1P1CA 1L5HB 3U2MA 1KXZA 2LKCA 4JLNA 2HSDA 1N1CA 2LNDA 3L1KA 5JC1A 3U7IA 1RIFA 1ZI6A 5IU6A 3D7MA 4TZTA 1DJQA 3WKEA 3PEVA 1ICIA 1QE3A 2AOVA 4JROA 1R5JA 2A84A 3TW0A 4Q47A 4JSRA 4O4IA 4MVJD 4Q3KA 4W8KA 2RAFA 4IJKA 1XXHB 3CNNA 1BG6A 3ZOZA 4JTCB 5FOVA 3IB3A 1HT0A 2XH8A 3DVRX 3TQOA 2NSHA 3TTXA 4IDQA 1OLXB 4U9IS 1DQYA 4HQ0A 2D5IA 5ES4B 4A03A 4BNYA 4PWYA 4GPTA 3IT3A 5HFJA 1XX6A 2CXRA 2J8ZA 5LZ9A 4H4CA 3LKVA 2VNSA 2B6HA 2A9RA 3B1YA 2IBFA 2CEKA 3MOSA 4EHPA 3UVEA 4KAXA 4C14A 2D1QA 3DWWA 4F3NA 3E5MA 3L92A 2RMKA 3PMRA 4B7XA 3S5JA 2QVBA 2VK8A 4Y2HA 2J9FA 2J45A 4PICA 2H9AA 5FFMA 4NJMB 1FFEA 3HCRA 2FE4A 1CVLA 4AQDA 4FOLA 3FHCB 4KGVA 3U81A 5LD2C 5CA1B 2P2GA 2VYNA 2P41A 3O4GA 2H4ZA 2ZBVA 3UMYA 2P2CA 4Y1EA 4TL7A 4X6UA 1AQIA 1C30A 4G97A 2VIIA 4YHHB 2QMZA 4KW7A 3SE0A 4CF4A 2C31A 3CS3A 5C7LO 2ZWMA 2CCKA 3C3PA 2CLFB 2PFGA 4G0XA 2VUHB 2V7EA 1DBSA 1GDTA 3P2JA 5EQDA 2JFOA 5F64A 3CNLA 2O5VA 3JQAA 1FUUA 1PS8A 3O73A 2W22A 1Z17A 4HZUB 2QRKA 2FXVA 2OSBA 3E61A 3PLNA 4TWAA 4PZYA 4XLZA 4ZOQI 3C3DA 2REOA 2CFIA 3NYQA 4HNAA 4E15A 1V7QA 3R76A 4CQMB 2BEWA 4ACBA 4IVNA 3CRQA 2PT7A 4OUKX 1IEQA 1M1ZA 3CPSA 1E1KA 3ZVMA 4YV0A 2I4OA 1L8OA 4OJTA 3HDHA 3GUZA 1J2RA 3L0IB 4LHEA 2G72A 2JI6A 1DXHA 3AU8A 2QP4A 2MSWA 4JLPA 4URUR 1VE7A 4G37A 1QHNA 5IF3A 4FFSA 3F5MA 3EHDA 4PJNA 4QHYA 5JCOA 2CNWD 2YVLA 3DJNB 2JARA 3MWYW 4EG0A 4GMKA 2XS1A 1KOLA 4K03A 5TGZA 5K0JA 4DMKA 5KVAA 1OZGA 3NKVA 4LRYA 2G88A 3MJVA 2APJA 3OD5A 2QBYA 3Q9LA 4QU0A 1RYNA 3SKYA 2VNKA 1HG1A 2NWQA 3IBGA 4PC1A 2IJGX 4Q1DA 1L4GA 3P5BA 4CMCA 5B3JC 2Q99A 4MDHA 1RKVA 4FE3A 1GXSB 3HC7A 1IXRC 4LHXA 1CZHA 3HA5A 3D7RA 3RODA 3NO4A 1Y5LA 4OHUA 4QGHA 1WUJS 1LRLA 4CUZA 1EGAA 5A05A 1YB4A 3RTEA 1SHLA 4WSOA 4CL0A 2EJCA 4FB5A 1NX6A 1TRKA 1SQ0A 4TQAA 3L6CA 4GPAA 3PXXA 4QDKA 1N2SA 2QVZX 4MW4A 1RACA 2LQGA 1ZVKA 1WVGA 1MC1A 2Y2UA 4DRIB 4Z4IA 1JPNA 2A67A 5CM9C 2C7GA 3WHLA 3ZJTA 3NHBA 1Y8AA 1E1RD 4QQKA 1UDCA 3WK7A 1KR5A 1HZJA 3V97A 1QYIA 4KJXA 4GRIA 3X1DA 1PJZA 1WZEA 5KVCA 1XCGB 4E4RA 2O2CA 2C8VA 2WOOA 4MWEA 1OWNA 3E2MA 3O7WA 1YVUA 2N42A 3MD0A 4Y6RA 1SVSA 3MPOA 1GNPA 1CJBA 2FRDC 1DAMA 1NXTA 5ESRA 4PU0A 1N9GB 3NC1C 2R7QA 5ALWA 3I37X 1PSZA 4I55F 5FV7A 3UH1A 3FNFA 4BO2A 1I0LA 3SDSA 3W2VA 2DM6A 2WU3A 3L0CA 4U2DA 1RMYA 2HHAA 2B82A 1PVDA 4AO7A 3IKMB 2FR0A 2RGGA 4H3KB 2A2ZA 1A4RA 4EHNA 1T6NA 1V5WA 3CN7A 3A3OA 2B98A 3OY7A 3R5FA 2C4HA 2RGYA 3MT7A 4D80A 5D84A 1W35A 3U3ZA 5BR7A 4DLUA 3MWJA 3CUVA 2EZ4A 2NUAB 1SVOA 4QX6A 4P84A 2YZGA 3AIMA 4WV3A 5BQHA 1TMGE 3CBQA 1FSSA 4OMFG 4ZDIA 4BMPB 1SC9A 2GEVA 4QAQA 4GBMA 1PJ8A 1WWKA 1LSUA 3SJZA 4WPGA 1HW2A 4HXGA 1SU8A 1Y6QA 4GLOA 3PGMA 4IZ6A 2QN1A 2V7UA 5KZMB 5DTRA 2ZYGA 3LLMA 4WFIA 1SOMA 3FYUC 1XF1A 1OGYA 3Q7QA 3ZLTA 3EA0A 3H2KA 1WB5A 3BSSA 3ETJA 3L6OO 1QCCA 5HM6A 1P0IA 3SBEA 5JNTA 4NEGA 2W2PA 1KXJA 4ND4A 4E0IA 5CFPA 5TE9A 5FNVF 4Z4HA 4ID3A 4HX9A 4DAEA 3QLUC 1TVCA 1E96A 1ZK0A 2GEFA 4A8JB 3FFBA 4CCYA 2C4TA 4B5LA 1HF3A 5CA0F 1KEEB 5DRYA 1EZ1A 2VPXA 3QYFA 4QU5A 2V5AA 5FWAA 3PX3A 5F5XA 1DRJA 2QL7A 4O2AB 3ZHXA 2A1DD 1C14A 4YUZA 2B4RO 5J2TF 4HYQA 4FJ2A 5JH7B 4EY4A 2HUPA 3JQBA 4B8YA 4MR7A 1Z34A 1GGJA 1LBHA 5HX7A 4RZ3A 2I6SA 3WLPA 3HBAA 2FMTA 1SOUA 2QT0A 3QVYA 5L53A 4NCIA 4JUFA 2HZ7A 1C3OA 3L7MA 3S2UA 4ARCA 2ZWOA 1WZCA 4H60A 1X7XB 2CLSA 1TJ4A 3TYXA 1FMFA 2HA0A 1CQXA 1J2UA 2INGX 3MRXA 5AW7A 2GF2A 3E23A 4RVGA 3NTUA 1N8TA 3M6UA 3SEOA 4F3CA 3VKWA 4OL9A 4QLOA 5GMOA 2R48A 4BV9A 3V32A 3DBVO 5DN9A 2PCLA 2Y99A 4CI0B 3DUFB 3JS5A 5THKA 2XIJA 1H4SA 3HXKA 5BSMA 4FZ5A 4H16A 1H6AA 5CB8A 3UANA 1QHGA 3UK0A 1XVLA 2P7VA 4OD5A 4Q4DA 3KCQA 1LS4A 1GNSA 3LHDA 3P0EA 2NT3A 1XP5A 1TKAA 4D4NA 4UEKA 3EGIA 1G8GA 4LOJA 4DARA 3R3VA 2CFTA 1T1EA 1ABFA 2GZAA 1DCKA 3BYZA 4N6OA 3RJMA 4QHSA 4IMPA 3HSYA 3ZQKA 4HFJA 3UGTA 3I53A 5BNTA 3VI3B 4O3FA 1W25A 1IK4A 1K06A 1X87A 3LUHA 3U5ZB 3RAGA 4JC7A 5AOBA 1P61B 3AY6A 4HGZA 3SR0A 2RG1A 1BU5A 1YBHA 3J81k 1XB2A 3QNWA 3PPIA 4YL1A 1WD7A 3AZOA 3KO8A 1X92A 2PHZA 5E33A 5T3TA 5DM2A 1CQZA 8ABPA 5A2GA 1GZHB 2QM8A 3QU9A 4PLPA 4CS8A 4P4GA 3A6FA 1M6EX 4TOIA 4KAJA 3JAWA 3ESZA 4GGPA 1L5ZA 3Q7RA 2NU6A 5A9SB 4I1OB 1E9VA 1L4YA 1LH0A 1NW9B 5B7QA 3C41J 1EJ6A 1BS2A 2SBTA 2B4KA 2VDRB 4W9NC 4C4XA 4WMLA 4J0FA 4WEQA 3LM8A 2CKMA 1CU1A 3K32A 1VHWA 3KT3A 3GEDA 1Z0ZA 5B2ZA 5H1YA 1PV3A 4XXHA 2Y1LA 3S90A 1M75A 1C81A 1IAQA 3KOYA 1XVAA 2JCVA 4QDJA 1YDMA 3MQ4A 2POQX 1A98A 4J7AA 4JNKA 2VBGA 2CXOA 2D8MA 4FI3F 5JFGA 3VBCA 1GVHA 4BMSA 4MNDA 2ZRIA 5G4KA 8GPBA 3VO1A 1D1BA 1IHOA 4F4HA 3K92A 2Y1EA 1XA3A 5ENDA 3PV0A 4AY4A 3BULA 4B74A 1HDGO 2VDJA 4HAVA 3PQ6A 3L0YA 1P3JA 1YBFA 1DAFA 1Q83A 3EGXB 1HA3A 3EZ9A 2J09A 3UA3A 3FIUA 4B5KA 3OO0A 3O8LA 5D91A 1EFDN 4QDXA 2DWCA 2XKAA 4N5LA 5J1TB 4AN4A 1RKXA 2IEBA 1QQBA 5IBPA 2DYSC 4MWDA 5JO0A 2L6GA 4JVMA 2XE4A 4YP0A 1ULSA 1IHPA 2YVAA 3OLCX 4QVGA 2ZLBA 3WZMA 5BW5A 3WSWA 3R6WA 4KQWA 1DWOA 2V7GA 3EQZA 2EYUA 1H4QA 4KRYA 2GCOB 1F8UA 1GHTA 1I7LA 3OJLA 3CWZA 4IMJB 1ZRMA 3HHEA 2EV9A 1TC2A 1W76A 2CD7A 3HMQA 5IAGA 3WB9A 5CX4A 2VJAA 5K8CA 1JNYA 2Z2ZA 1IY0A 1CS4C 1VKOA 3RHSA 2EEZA 4YAGA 4XJVA 1JDSA 2A0XA 3SHTA 4EYKA 1R0BA 2V4UA 2V3CC 2FV8A 4TN5A 3WP0A 1GUYA 3LSTA 1R12A 4QDTA 3UKJA 1XAGA 2GVZC 2GPJA 2GUGA 3OQ6A 1OI7A 3MXTA 5E3IA 3ROFA 5E3HA 4QM6A 1GITA 4A73A 4YRLA 2AFIE 5EFOA 4PAQA 2BFBB 3W7VA 4Z9FA 2M98A 4OI0A 2IUTA 4R05A 4WESB 1YJ8A 4IFTA 3W8FA 4NZOA 3EWNA 3BRQA 4Q1FA 2MSCB 3O9VA 3OWOA 5DYNA 1L5YA 3IDFA 1Z8HA 5CLHA 4E17A 4BN5A 2QTCA 2XBMA 2Z8YA 4DMFA 1ZJJA 4ZKDA 1GPKA 5D87A 1PL6A 3V8NA 3TR6A 1NN1A 4G0YA 1PKEA 3DAPA 2BEVA 3QVSA 2GPYA 2FEKA 4KNVA 5E1MA 3C15C 3WK8A 3WJ1A 4KBFA 3TUJC 4YUAA 4RZIA 3QZCA 4PNEA 2G70A 1TMYA 1GT6A 2GVNA 4GD3Q 4ZMSA 2V1UA 2ATXA 3O3OB 1PWXA 4LC9A 1AKRA 2R7VA 3F8SA 1OXTA 2UZ4A 2JDID 1S9HA 5D5QA 3DMTA 3WAQA 5CVTA 2NNLD 4M55A 4QYIB 1DBPA 4Q3LA 3LK7A 1V2HE 4Y2JA 3AXSA 3DG9A 4P1ZA 4J6EA 4J76A 2BR3A 4LF7B 3D31A 1KFJB 1N2GA 2XJ4A 5ARBA 3FKQA 3EUEA 4CF3A 2VRWA 5DYTA 2JGIA 1H6BA 1LBEA 2QTVA 1DBQA 4ZDWA 3PEYA 4RACA 3VO2A 1ZCZA 1OB2A 4JD5A 1E4YA 1K08A 4P3NA 1UBLS 3TX6A 3AKEA 3DJFA 1HE1A 3FA2A 5CT5A 1XMSA 3BAZA 4LOAA 1U3TA 3UJ3X 1ILEA 1E7QA 2AFRA 3FNBA 4GYKA 2F48A 4F1WA 1UADA 4NMXB 1KH2A 4QFCA 5CFRA 4HY3A 5AI4A 4X45A 5A3SA 4U5BE 5IJ9A 5HIJA 2W8BB 1U9IA 3WL8A 1SVKA 3NCTA 4G84A 1K6IA 3X44A 3A6PC 4DREA 3FWNA 4J90A 2AJLI 3FUCA 1QOZA 1XNHA 4CL3A 4JLOA 1FTYA 4HQNA 1RXQA 3KWLA 2Y92A 3SAJA 1FW6A 1TJ5A 1DAGA 2TSYB 2IZ7A 4JWTA 4J6FA 3L06A 3KLMX 3UOWA 2Q9CA 2AV6A 5A5EA 4WABA 4F5YA 1XA0A 4C5AA 1E1DA 4RVHA 4RBNA 1T6YA 2QVCA 1H2AS 1G17A 2HF7A 2GD6A 4IGIA 1XTPA 2EL9A 3JD1A 5IRCD 4HCJA 1VYUA 1JVSA 2PH7A 1OWMA 5DYWA 3ZNOA 4MLCA 4RDAA 2ZTMA 1Y4SA 4OB6A 1ND5A 3TLJA 4EFMA 4PXYA 2ZWVA 4EBBA 1WBBA 2A88A 2R7NA 2GDZA 4B7AA 3ZE1B 5DK6A 4GT1A 1TGVA 3K0FA 3NHKA 2NUPB 1IWBB 1R8XA 1W4BA 3O4FA 2EQAA 4C4ZA 2VP5A 4NJOA 3D0KA 3DZCA 4MKXA 1TJ3A 1N32B 4P3OA 2EBHX 4FQ7A 3CCCA 1J33A 2CXSA 3OIYA 4H0FA 3QFSA 4YROA 3V00A 1NU8A 2HM7A 1SKUA 2E6KA 4EENA 4LDNA 2IXTA 2FAXA 1AHNA 1E58A 4KV9A 1XNQB 4E94A 3OQVA 5JVDF 4DA8A 3C98A 2EXXA 4NOMA 2FK7A 4LPKA 1T1RA 4YY3B 2VXBA 3QNUA 3HDTA 3HRKA 4E5SA 4M54A 1G66A 2R8XA 1GA4A 2MJLA 1KAGA 3MCAA 2R1VA 3KJEA 4OI4A 1ADBA 4Z86A 4B4WA 4WCFC 4ZI7F 2RH5A 2EJWA 3ZCUA 4Z0HO 4J16A 2NLOA 3EJ6A 2AWYA 4TWJA 3HBLA 1Q92A 2NADA 1IZ7A 3BTUA 2I3ZA 3TD7A 2F9FA 2B36A 5C2JB 4W6QA 4MVJE 1UC8A 3HJNA 1PZXA 4P38A 1PT5A 2Y1CA 4YDRA 5LN1A 2AN3A 4KLNA 5LUAA 3BWXA 2WVJA 4D3FA 4MQEA 1MOPA 2QENA 2EPOA 1OTHA 5HIAA 2Y9MB 3STTA 1AK2A 2IHBA 2YIVX 4UVIA 4YMTA 1KWKA 3KZVA 2ATIA 4BFSA 1S7ZA 5JS1A 5HUHA 1GT91 1DHTA 1U5AA 5I3ZA 3ORYA 2Y6VA 1Z2EA 4MRAA 1T2FA 4A8PA 2VJMB 5I7SA 4XLPF 2OGWA 1R0LA 1K04A 4DIBA 1QVZA 3ITKA 1YYXA 4G4IA 3ZCRA 6Q21A 3WHNA 1RI4A 3E3AA 3A70A 3N7UA 5ALMA 1DS6A 3TDNA 3UJAA 5FWDA 4I6JA 4KXLA 1P7VA 3RLIA 4UC0A 2CEAA 1C9JA 1TI7A 1DQNA 3H0CA 1S4QA 1ZW3A 5AKZA 5DX0A 4L4ZA 3K9FC 3KTDA 1F1MA 2G9VA 1OVGA 2PL1A 4PRZA 2PGAA 2WZDA 3WLAA 1XSEA 4B0PA 2IW3A 2ZJ2A 2EW2A 3W5VA 5FA5A 3JW8A 3WO0A 1TD9A 3R44A 3OQIA 2R4QA 3CBGA 2OKCA 3O8QA 3PVSA 3ZU3A 3C1TA 4MR8B 2BGTA 2GH1A 3WGOA 5CITA 1CPRA 2CXXA 4FCWA 4QPCA 5LQRA 1W9HA 4ARVA 4MKHA 4XGNA 1VDMA 1E2BA 5KB3A 3I45A 1KZ4A 1Z62A 3IXMA 2WV7A 3D3JA 4UFNA 1ITZA 2WM3A 5EOVA 2R25B 2NG1A 1ZMBA 3TMAA 3IH5A 3A6HA 1SXJB 2QYHA 1Z7GA 5ADUS 1V39A 3P0JA 2GF9A 4JEAA 2PKCA 4ER6A 5KVQA 1EDZA 2WB7A 4RJLA 4EHDA 3EFOA 4YASA 5F3WB 2JH9A 3RS4A 4GOLD 2GYYA 2FPGA 4OAPA 4Y67A 4B3DA 3HUDA 2FX3A 2GAOA 1VLLA 3GMDA 2JG3A 6ABPA 3HBFA 4HH1A 3PFGA 3ZSUA 3TCXB 4YQZA 4BFWA 1BA2A 2QIPA 3ZHZA 4LN1A 3S84A 2JK1A 4G5SA 4CJGA 1L1FA 5FUBA 2VHVA 3N7AA 3FLBA 2ZETA 1I1HA 3I01A 1GPUA 1I2BA 4I8XA 1K9VF 5J4HA 3GFFA 3H05A 5F1YA 3ZI4A 2FKAA 2PKQO 3SYLA 4RHCA 4PSUA 3JATA 3QOYA 2UYHA 1T8SA 3R3WA 4RA6A 5CLJA 1UK8A 1PT7A 1KC1A 4JU8A 2D0IA 4U63A 3FCCA 3G88A 4MPTA 4O8CA 4QBTA 1NC1A 3E0XA 3I2GA 1YRWA 4AWXA 3AY0A 3P52A 3REQB 1UT5A 1KWGA 4R1QA 4KI2A 4BPRA 3ANXA 2XEXA 3AFGA 2E3JA 3O5AA 2WB2A 2ZT8A 4KO1S 4MJ3A 2EBFX 3NP7A 1U0JA 1BHSA 5JT4A 2JATA 3RK4A 4MGHA 3WJAA 4E5UA 2AQKA 1FYWA 2E49A 2VNAA 4UQLA 2FJPA 1PQPA 1H2EA 1RKEA 4AS3A 5A1TA 3KAPA 1C4XA 4KQFA 2GOYA 4OHYA 3DFIA 5G0SA 5JW6A 3AEXA 1TKNA 4EB3A 1DOAA 4AX4A 3LY7A 4OINF 1K7FB 1DQSA 2XCIA 1P9OA 3DEHA 4K9NA 3ZHOA 3MLAA 5ELLA 2Q3HA 2KBFA 3RBXA 3B9RA 4P3PA 2XDQB 3D6NB 1M6WA 1FYXA 2J6IA 5JD4A 3FYDA 3PEWA 4AF7A 1F8GA 3A7DA 1A0OA 1AKVA 4BQNA 4HNSA 3NT2A 1FZTA 4X65B 1PK9A 3LUAA 1KYWA 4CIWA 1YMQA 3TFOA 2BBTA 1SF8A 2BC9A 4JK3A 2QJFA 3ZVKA 3QEOA 1GGMA 4IBOA 3W6OA 5CFLA 1DBRA 3WNQA 3UV7A 1MR3F 4FLFA 1B6GA 4LG1A 2YBEA 1S0UA 3RWBA 4GOND 3GHHA 3TQFA 2IBTA 4PG7A 1OROA 3TRJA 3RSFA 4BOYA 3QKWA 1Q7TA 4HAZA 2EZTA 3PDCA 1PNQA 2P1AA 2C2GA 5FXMA 4CCWA 2YIDA 1OFIA 2K2WA 3COWA 1PEDA 2A0WA 3GNTA 3GA7A 3AY3A 1FBTA 1SJ9A 1KY4A 2Z56A 3MTJA 1N25A 1UM8A 2VJNA 2WPNA 4WN9A 4JA0A 3JWGA 1XTTA 1KH1A 3CW2A 3PGKA 2QRUA 3ORQA 1SBCA 1C0LA 2CDRA 3CX8A 4MRMB 1I4WA 4MPRA 1A7DA 1PFVA 4OU5A 3LW8A 2SKCA 3G9QA 1T5SA 1SC3A 2A14A 2J0UA 3K7DA 4KGDA 1Z0IA 3I8OA 4PSKA 4KHPB 1KMHB 5C37A 2X40A 3MUFA 3PICA 2IYQA 2GXUA 1ZOSA 4WINA 1RYEA 1Z4LA 3A2KA 4E5VA 4R1UA 4NZZA 4FINA 4NATA 1H9TA 3WIEA 2B5WA 1YR8A 3I6MA 5ERXA 1SVLA 1Z2CA 1NYQA 5B3KA 1KDRA 3VC7A 2O8BA 1PR9A 5C8VA 5FI1B 2H92A 3RS7A 4QWWA 1JU9A 4XQCA 2BVNA 3F5FA 3LCUA 3Q2OA 2P6NA 2NU8A 4BX2A 4A1FA 4F2PA 3SBDA 1Y1QA 2EU8A 3CURA 1C2TA 4KBGA 1TTQB 2H8AA 4E1BA 2HJRA 1L7VC 1PTJA 3GBSA 4C30A 2PRKA 1EUYA 4TSFD 3PG5A 2HSJA 3A4YA 2IIQA 5K5EA 4G8BA 3WLSA 5KHOC 1KI3A 5LM3A 2RK4A 4EUHA 3K0EA 4BVJA 3OZCA 3H3XA 1USWA 3ANNA 5KOJA 4FLEA 3K0BA 3RAFC 3W9SA 3DEIA 1U7WA 3GDHA 3M83A 3VFDA 4JGGA 3WTBA 3KALA 4NRDA 4PGHA 2JGEA 2A0YA 4OU4A 3OIDA 4I1PA 1ULTA 3HR8A 5BO5A 3KSMA 5CGQB 1S8AA 2BJWA 3ZWMA 1TYZA 4NPAA 3BSFA 1MW8X 4NV1A 2GPTA 5EIXA 5JD5A 4BRWA 4OGKA 1HE3A 3NNNA 3RDPA 1K9SA 4ZA2A 1A8IA 2PSDA 4TTVA 1D2CA 1QVAA 5CVEA 2AMFA 4HDKB 2IIPA 5G41A 2GAAA 2QJTA 3FDXA 2IY8A 3CV3A 4WKCA 3EVZA 3HDJA 4RTRA 3HWRA 2JJQA 3KQYA 1HDIA 4GR9A 2QRMA 1E9SA 4H1HA 1C9NA 2ORWA 5EQJB 3ZZMA 3W1EA 3N6VA 1KDVA 1DHRA 2H0AA 2XKJE 4NBNA 3L6EA 1ML4A 3NHJA 2ARKA 3HJGA 4EARA 4MX8A 4BEWA 1G3RA 2FRXA 4YDSA 3I9JA 1Y7IA 2JHCA 2B8WA 3ZGXA 4D92A 2QLFA 5EJGA 4ANFA 3WLNA 4Z0TA 1R6VA 4TQUS 1CKEA 3DMFA 3OT5A 4GSKA 1H0KA 4Q9DA 3V6LA 4PPYA 3U1BA 1J22A 4HSEA 1IHDA 1KMMA 4YUXA 5TF4A 5C0OE 4N18A 2PNJA 4AUNA 2YL0A 4XPXA 3CT4A 4CDNA 4LMPA 5ERYA 1BJKA 4KIFA 1SC4A 5U4QA 1U7PA 1L1RA 4WZZA 4G1MB 4DV7B 3RHTA 3W9YA 1H85A 3S4YA 4IRUA 3FIJA 4KPFC 3DE0X 3G1WA 2R5NA 4AG5A 5B1DA 1KQPA 1R6BX 3IDOA 2PANA 2BTOA 3I0MA 2JRCA 4D3YA 4F9EA 3VMFA 5KPJA 3CWCA 2X23A 3AY7A 3I28A 4Y7CA 1QFYA 5CB4B 1W1UA 3KKKA 3VJRA 1GUBA 3RVRA 4EUNA 2GD0A 1JBKA 2DKNA 1X3SA 1MV5A 2C3OA 2GSDA 5HGJA 3RS3A 1DKOA 5EJEA 3FHJA 3HGTA 5F2KA 5K3SA 1V8BA 2BIFA 2D0PB 1O6FA 1EGVB 3G5AA 2GM3A 3ANLA 2B37A 5FH9A 4G89A 3KPYA 2P9ZA 5BWOA 1ADFA 1X9GA 3GWGA 3UV6A 4Z1MA 4YLYA 1PHRA 5AM2A 4YCJA 4H0CA 4C7VA 2YWDA 3OZUA 4U7JA 2O1WA 1J8QA 3RS5A 3R74A 3HWSA 1TVMA 1TVEA 3TXXA 5JVEA 3EVNA 4F4CA 3WRVA 4LFBB 4YRZA 1NI4B 3IP6A 4K87A 1ONSA 3DKKA 4IUBS 2KM1A 5I4KA 5B7PA 4CS9C 5CIWA 3TLEA 1S8OA 4KI0A 2VZLA 2X4IA 1WU8A 2AH5A 4K7JA 4E13A 2RJOA 1AUXA 1KVSA 2XUPA 5C18A 1WEHA 1L5MA 4A9AA 3R7WA 3ZWIA 4TMXA 4P4UA 1QFJA 3QSGA 1M1XB 5IMSA 3HTKC 2BUAA 1JJAA 4NZPA 2EIHA 2Z83A 1ZK1A 1MTOA 4IEEA 4AVYA 1DQRA 2XUFA 3HP4A 3ECSA 3GV0A 3OE5A 5KPDA 2QUBA 1LRJA 3RBZA 3X1MA 3EXIB 1Y3AA 4DJEC 1S96A 1PO7A 4KCGA 1GKLA 2B34A 3ZGLA 3LX5A 4RENA 2YWBA 1CGME 2JGJA 4QGFA 1ZM9A 2JRLA 5JJCA 1BDJB 4HBZA 2A9PA 1E18A 1H2XA 4IIUA 3QW0A 2I15A 1UBTS 5IASA 2QRZA 5L3ZA 5DT2A 2J0QA 3GNLA 2XI4A 1I30A 4WUVA 3K6SB 5ITVA 1ZOPA 5B4UA 4DCSA 3RVDA 2C96A 3GN2A 2QTMA 2XLBA 2DRIA 3IIEA 4X8HA 1P45A 2QB5A 3W4YA 2AEJA 5BW4A 5KNDH 2Y9PB 1U81A 4AKHA 2WU0A 1ISPA 3CAXA 4JCZA 2PZFA 1B43A 4AY5A 4G2NA 1XVVA 1T43A 1NFQA 4JOSA 1R0XA 4P5EA 4WNIA 1D04A 4FBMA 1RLIA 3JY6A 2CHEA 3G2NA 4MVZA 2FJUA 4DMUB 2YWGA 3ORRA 2O3QA 1CZUA 5H82A 4I6GA 3BJRA 1PEAA 1V2GA 4EYEA 4JBNA 4BKMA 3OTQA 4AXXA 3IBYA 1D6SA 1VIYA 4BLQA 2G5CA 1Y9ZA 3COPA 2Q5JA 4P08A 1Q57A 3FG9A 3JAMA 1E5LA 2C4WA 2NO7A 5CTAA 1ACLA 3N5CA 2R7TA 2GYVA 4AICA 1G21E 2HB6A 4UXJA 4CIBA 2I2DA 1A69A 4EJ2A 1ELOA 4IIJF 5TGTA 1PVVA 3QTTA 2DPLA 3GN1A 3LRPA 3WAGA 3M4BA 2OXIA 2J41A 2XZDA 3D8BA 5LZ8A 3HO6A 3VDXA 3VAYA 4ZVTA 3N0TA 4BUCA 1XEXB 2XRYA 1YI1A 1EWQA 2ZIXA 3F0TA 1E2DA 1LJLA 4KWEA 4BYGA 2J6CA 1C9DB 4V38A 4F9TA 4TKUA 2PEYA 3G5MA 5DTEA 1SUPA 5GGYA 4W7SA 2FDXA 2YJ5A 4MVJP 2D8AA 1UM9B 4D9HA 3KAKA 4R5HA 1EFKA 4HZGA 3RW9A 1HEIA 1VCHA 5E3AA 3KC2A 1TXGA 2C9CA 3A8TA 1PX0A 2NPOA 4GYJA 2W6QA 3VHLB 4J30B 1GV1A 4COOA 4L9AA 4UD2A 4Z4CA 4AKTA 2WKQA 2ZYHA 3R7DA 3ROEA 1NYLA 4ZEOA 2PUFA 1OFTA 3G5TA 1M6YA 1AKMA 1BWPA 4B8ZA 1AGRA 2B69A 5BWCA 3F8TA 2AWCA 1T4GA 3FY4A 2H08A 2PX5A 5T5QA 5KNCA 4TROA 4MV6A 4OK3A 1XD2B 2NZ8A 1TYBE 2H57A 5D85A 2IYZA 5K01A 3ES9A 1BDMA 5ALOA 3SFTA 4URZR 2JZNA 1QJ4A 2EKQA 1WSAA 2CFCA 4BNLA 3ZE2B 4PTLA 3NZEA 3DWIA 1EIWA 3PXCX 5EVCA 4KXXA 1LA2A 3P71T 2M6KA 2ZT5A 3P2OA 1E1CA 2GPSA 2IK8A 1PGJA 4LBZA 5JHGB 2L2QA 4RVUA 1P0MA 4KSCA 2IEGA 4LXQA 2BTQA 3VRHA 1W5TA 1XJ0A 3B53X 2RHRA 1RP7A 3TLCA 1V5GA 4XQGA 1LSSA 3EXEA 1QIIA 1PV2A 1YQXA 5K0CA 3ZGYA 1ZWLA 2PQMA 4D4IA 4X9XA 5FRDA 3ND6A 2EX0A 5REQB 1XGKA 4DVGA 5BSFA 4OOFA 3INYA 1YFKA 1ZKMA 3B1JA 1D0YA 2UVDA 3V1KA 1Q0SA 3L4SO 2IYOA 2OB1A 1KKUA 2IYUA 4YJDA 3LQRA 2M32A 4UTRA 1QO0D 2IVFA 3IEVA 3TMYA 4EABA 3PRYA 4DLBA 4HLCA 2BCJQ 1FMJA 1L1QA 3BTOA 3IUSA 2DJIA 2PLWA 5JCPA 3MSXA 4AX8A 2H7XA 4NQRA 2PO7A 1OX5A 3IPRA 3G02A 3RIGA 3E7PA 3WFZA 3QG5A 2H11A 3VX3A 1E5TA 2B1JA 4EG6A 4RSHA 3UB2A 2JL1A 1TL7C 3SYMA 5DTMA 4ZTZB 1RI1A 4OJYA 3HCDA 3KKPA 1KZ7B 3SJBA 2E4XA 4AYTA 4CW7A 3ICWA 2H1FA 3C5EA 2P3QA 2M6LA 2C8JA 1IQPA 3DE7X 1YZ3A 5DX8A 4FN4A 3GM1A 1MORA 3FOWA 5DVWA 4D8WA 1CX9B 5COQA 1OLXA 3VR5H 3OLWA 3REFA 1QM5A 3AJRA 5EXPA 4L3OA 1G38A 4M9CA 1S8NA 1SG9A 2QMYA 4M7WA 3CEAA 2YLGA 3AOEC 5JQGB 1H5QA 2Q5CA 4P3KA 1A9XA 1QTIA 1GSAA 1ULBA 4AL1A 1SUBA 4BFVA 1K97A 1DARA 2JK0A 4FYPA 3OZEA 4XUDA 3RGGA 4GWKA 2GWHA 2EIKC 3PQ2A 1U1IA 2ZS8A 5YASA 1W94A 2IH4A 2I4TA 4DA9A 2AX4A 2JGDA 3T9EA 1CDOA 4KQJA 1WVMA 3R2PA 3ECCA 3NMKA 1E3WB 1OIWA 1A76A 3WMRA 5KTPA 5FADA 3FHOA 5TT1A 4TXJA 2C82A 4U8HA 3M1AA 1CR0A 4IHJF 2DJ5A 3PVZA 2UUHA 4GBED 3KYJB 4NS4A 4GEKA 5CK5A 2F1IA 1RFLA 3EF1A 5EAIA 3VOTA 2CLOB 2VG8A 2D6FA 1DIGA 1X8JA 5EMKA 1ZD3A 4MUFA 2I03A 3TXAA