1ZU4A

Crystal structure of ftsy from mycoplasma mycoides- space group p21212
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
309
structure length
305
Chain Sequence
PMEKAMLKSAFNFSKDIKKLSKKYKQADDEFFEELEDVLIQTDMGMKMVLKVSNLVRKKTKRDTSFENIKDALVESLYQAYTDNDWYRIDFKENRLNIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFRAGATQQLEEWIKTRLNNKVDLVKANKLNADPASVVFDAIKKAKEQNYDLLLIDTAGRLQNKTNLMAELEKMNKIIQQVEKSAPHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDLLAFDIDQYIVHLSSGFMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational variability of the GTPase domain of the signal recognition particle receptor FtsY
pubmed doi rcsb
source organism Mycoplasma mycoides
molecule tags Protein transport
molecule keywords ftsY
total genus 116
structure length 305
sequence length 309
ec nomenclature
pdb deposition date 2005-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1zu4A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zu4A02
1KMQA 4LDJA 2GRJA 2RGNC 3HU1A 1E0SA 5KU1A 2AWOA 2OCPA 4BE7B 5H8WA 2QM7A 4QGGA 4KLNA 4RCYA 4OHXA 3TSWA 4TLEA 4P4SB 5EE5B 4M9SA 3U3OA 3A4MA 4ZDWA 1XCPA 4NYIQ 3U6KA 4ZCIA 2GF9A 3V4FA 1VYUA 5E95A 2N46A 4FD2A 2PLRA 1AQYA 4DJTA 4A8JB 5CB8A 3LBHA 4LJAA 4KBGA 1JQJC 5JSZB 2QP4A 3AM1A 1TTTA 5FOWA 3UMSA 5CK4A 3FMIA 4HDQB 1TX4B 1YRAA 4B2LA 2JEOA 5TVKA 4AKGA 5IT5A 5FL7D 2ASEA 2F1JA 4DXAA 4URWR 1N5LA 4EUNA 1M7BA 4MUBA 1BYUA 4OQMA 1SXJA 1XXHB 1SXJD 2OILA 2WJHA 4PC7A 5FOTA 2V54A 4JBYA 721PA 3CH5A 3BRWD 3SHWA 2ZSDA 4JL8A 3U7FB 3DZ8A 1EESA 1NVWQ 2GF0A 1F6BA 2J0UB 1G8YA 3SR0A 4E09A 4B3DA 1Z07A 2C78A 1SVSA 5L3VA 1XTSA 2JCSA 4Q4AA 3TAHA 3U2QA 1GM5A 1U9IA 3IILA 4OI4A 1MO4A 2HT6A 2MSEB 3FMOB 4HSEA 4GMXA 1N2CE 1CLUA 1NVUQ 1F2TA 1CULC 3JVVA 5FR2A 1DEKA 5B2ZA 5C18A 2RGCA 1GIAA 2VF8A 5L3QA 2C03A 1KDOA 1SXJB 2WJVA 2HCBA 4OHWA 4A8JC 1P2UA 3AGQA 1KJWA 4HLDA 4A0HA 3THYA 5ELXA 1SVWA 1GNPA 1UADA 3PUXA 2IYWA 5JEEA 5IRCD 2OT3B 4TYQA 3I8SA 5EXPA 3REGA 2Z4RA 2IW3A 2FJUA 2JJ2D 4Q47A 1IXZA 1QHYA 2PMDA 4J0QA 2QY9A 1AGRA 3PUYA 5H1YA 4DT1A 5AJWA 2CVHA 3PCRB 4PHHA 3QIAA 4RD6A 2XJ4A 2WSSD 1W36D 4KSBA 2A5YB 4JS0A 4BLPA 3NTUA 1NSFA 3BFKA 2FE4A 5EE1A 3LNCA 3KQHA 3K0FB 3LLUA 2N42A 3HPQA 3RRNA 1Q1EA 3C41J 1RIFA 3EC1A 3BS4A 3H0KA 2LCFA 4LC1A 4ZIRB 5P21A 2ZSEA 2BCGY 4S2EA 5DNYB 3C5CA 1X8LA 5DSZA 1RE0A 1OV4A 2A30A 3K9HA 2CCJA 2YJTD 3CM0A 2BC9A 3BJIC 2QORA 5DO9A 2FF7A 2ODBA 1Z0DA 5KSZA 3EPHA 1II0A 4LWZA 4XWKA 3AF1A 3KJEA 4AD8A 1FP7A 2I3BA 3QF4B 3B5JA 1NP6A 1XTIA 1N6RA 3MWKA 2GA8A 1P72A 1WXQA 4B3BA 4FMCF 5SZKB 1OSNA 3JZAA 1WB9A 1OFHA 2VIIA 4GI7A 5TXGA 3RABA 4AKEA 3TGPA 2GTPA 5JI2E 1VG0B 5M04A 4JT2A 2FU5C 3CW2A 3CNLA 1I4TD 2JDIA 2QTVB 2CHVA 3GLIB 4EQ6B 3K09C 1CJKC 2BBSA 5KHOC 1CEEA 4PXAA 1VMAA 2CDNA 4PPGA 2J7KA 4Z8XA 1PVOA 3QPVA 3C14C 4GMDA 4RFVA 2A5JA 3AKYA 3PG5A 2AD1A 2VPPA 4EKDA 1HT1E 3U3RA 2ZYUX 2AK3A 2XZPA 3BIFA 4HAZA 3GFPA 1NVVQ 3SFZA 2A78A 5CIQA 4M2LA 4PQYA 2RKOA 4YMVA 1MR3F 2DWOA 4G5OA 1WP9A 2AKAB 3HU2A 4D4LA 1MV5A 3L0IB 4V02A 5IDVA 1OH7A 2JAQA 5C4MA 4DKXA 4BRUA 4NMMA 4D6PA 4DHEA 2VO1A 3CBQA 1U8AA 4NHOA 3FKSD 2HT1A 3FB4A 1KHTA 4JSTA 1Q22A 2GEDA 5TB5A 3LW7A 2PZEA 5KPDA 2QPTA 2VBCA 3MGCA 1CIPA 1FNNA 4RFSB 4I81A 1W49A 1I4LD 1CJUC 2WJYA 2QROA 1TMKA 4OK5A 1UKZA 3BERA 3DMDA 5KDLA 3IBGA 1SVLA 3MAAC 1M1YE 4M1MA 4OK6A 4D4MA 3E70C 1N6NA 4M22A 4LHWA 1NVXQ 1SZPA 4NONA 2OSBA 1OFTA 2YNMA 4GRAA 3VR1A 4CT4B 4EJSB 2WTUA 2FPLA 3TW4A 4AKIA 4TL9A 4GOXA 4QNRA 4RCZA 4ESVA 4IXNA 5JJKA 1Q1ZA 2YV5A 1OT3A 1NKTA 3M6AA 2WPDA 4HLUA 4XOIA 1YZUA 2CLDX 2OEPA 5CDFE 1DAFA 1E2NA 1E94E 2P67A 1CF4A 1X1SA 4XD7D 4BUJA 2DWPA 3NEJA 4QGAA 4QRHA 3AF0A 1P2SA 1ZD9A 1Z0AA 4JBWA 3GPLA 4Q48A 4Y0AA 5A0FA 2IXEA 4DCSA 4DIDA 2UKDA 4IDHA 2QAJA 1IN7A 3A8TA 4F93B 5G3ZA 2ZR9A 4AI6A 1W0KA 1KYIA 3EPLA 4DLXA 1AS3A 4IOJA 3TVTA 3VU9B 1TF7A 2H92A 2ZJZA 3FMPB 3KJIA 3UMRA 1JB1A 4HAUA 4IXMA 1T8UA 2D7CA 4LC0A 3O47A 1C1YA 3KTAA 3HYTA 2VSXA 4R2HA 2JA1A 1ZNWA 2HCJB 4MRNA 1VYVA 3REFA 3AVXA 3ZLJA 4ZDIA 1HE8B 4JL6A 5K8IA 2QTFA 3IO5A 3HR7A 5E4FA 3W6PA 1G18A 3RYTC 2WV9A 4TQAA 3CZPA 4YDSA 4I1SA 4LBVA 3MWJA 3FHTA 1ZW6A 4WXRA 2HYDA 4ITRC 1EGAA 3A1WA 3AUYA 2G3YA 2D3WA 4PQRA 3WMGA 4ZO4A 2CE2X 3H4MA 4LJ7A 3MJRA 4NE2A 2XTMA 1SVOA 4DDTA 3F3YA 2ZI7A 1W0KD 2MSCB 4FMDF 1GUAA 1S8FA 3CUEF 3FHCB 4GP6A 3LXRA 4TSFA 4F4CA 1TEXA 1G64A 4JVLA 3AP1A 5JHGB 1RVDA 4V0MA 4WZ6A 4Q1EA 4LJ9A 5J5CA 2CE7A 1D2MA 3EWAA 2WKPA 4II7A 2ZE8A 2G0NA 4JMPA 1D6JA 1QVRA 4HI0E 3HR8A 2QE7A 2FNAA 1TL7C 3P26A 2OG2A 1T9HA 1G9XA 2GWHA 4DB4A 1G4UR 4C7OA 1J99A 2UZIR 2ZI6A 1JNYA 3GMTA 1O3YA 1ZIPA 2WPDD 4BZXA 3PUZA 4Q7LA 1FP6A 5L3SA 4JYBA 4TN1A 1KSFX 4Q9JA 3SBDA 3ASZA 2F1IA 1ZM7A 2VHJA 2XSZA 4RD2A 2WHXA 3K9GA 3Q7PA 2IL1A 5FPSA 1D8TA 3WRXC 3A1VA 4PC3A 3OHMA 2ZS7A 4KCGA 1LS6A 2O52A 3THWB 2R6AA 3TRFA 4BFXA 3GCGA 3B2EA 1BS1A 1F3OA 1G3MA 1W5SA 2EQBA 2QM8A 3KKPA 3PIRA 2OE2A 4M0LA 4XTCS 5CIWA 1ZBDA 4V03A 4RVCA 3WMFA 4MGKR 2CMKA 2QAGC 1T4GA 5FUYA 3NWJA 4KFUA 2Y8EA 3UK6A 1MO3A 3RRMA 2QPOA 2C04A 3ADKA 3K8YA 4QJ4A 4D0LB 4NDZA 5CLQA 1GG2A 3CF2A 4H1UA 4Q7MB 4HATA 1XCMA 1NN3A 2HXSA 5A5GA 1U0LA 5FPYA 1ZM3A 4B71A 2VP0A 3QNUA 1UDWA 1N5JA 2C96A 5GJWC 4TYWA 4R7ZA 4QG7A 5DN6A 3A36A 1K5GA 3VU9A 3WP0A 2CL6X 5F98A 2KE5A 4JBXA 1BYIA 1MABA 4B43A 5A4JA 2P0EA 3R8CA 4NYMR 2X19A 3TMKA 3ECCA 3V9PA 1E99A 2O8FA 3SS8A 1MO6A 4UXJA 1LW7A 4OQXA 5DYIA 3UKDA 1EX6A 4LJ8A 1JQLB 2QSYA 1P9NA 3FHOA 4D25A 5AJXA 1R5OA 2DWQA 2YWGA 4PHGA 4QHYA 2VLIA 3AV0B 2OXCA 1JECA 2X77A 4M8NE 4A6PA 2UZ3A 4DRZA 4KI0A 2ZYVX 3AF4A 4B6FA 5TDHA 4A2PA 3PR1A 2GZAA 4B76A 5DHAA 2P6RA 1VG8A 4NP6A 3ETLA 1OW3B 4NKRA 2G88A 4UJ3A 3M0EA 3PFIA 4LHYA 3BK7A 1OH8A 1KNQA 4A1FA 4LJ4A 1E0JA 3PENA 5LB2A 2QMUA 2NZJA 1E6CA 2IHYA 3DZDA 5TARA 4YC7A 1XCGB 2ZI9A 4JZKA 2HEIA 1P9RA 3RC3A 1N6PA 2QSZA 4YXWA 2AD5A 4B2IA 3P4YA 3EZ9A 1SQ5A 3OEEA 2JATA 1R8QA 2QP9X 2ZAOA 4LZZA 3NBFA 1LS1A 3RS4A 4F92B 1GZSA 3WMEA 1FMLA 1KDPA 1RC8A 5BN4A 5EXTA 3M4YA 1WBBA 1HURA 2GXQA 5J40A 3NIBA 2H57A 1UKVY 5BQ5A 3ZVMA 5CDFA 3E2IA 1R4AA 1EX7A 2ZRKA 4PAOA 2Z6VA 3K0FA 4Q4AB 3U6BA 1ZMXA 3IHWA 1A2BA 2IUUA 2CJWB 2DFLA 2GHIA 1OH6A 3B6EA 3C16C 3I32A 4ABYA 5JRJA 3GLGA 2VRWA 2HLDA 2PZFA 2XX3A 1KO5A 2QZ4A 3GLGB 4MYUA 5JCZA 4QM7A 5FUXA 4NYIR 1T3SA 4U7DA 2HV8A 2QA5A 1G20E 4QL3A 1KDTA 3B7GA 4QBGB 2J45A 1XXHA 2O0KA 1CRPA 4YXWD 4UNNA 4EPYA 2D06A 2VYFA 5GJVC 5AUPB 5L8VA 2IYXA 2W6ID 1DAMA 3EZFA 4IDPA 2ECKA 4HUTA 4HAWA 4ZI2A 1V5WA 3A6PC 2XITA 3ZD7A 2FOLA 2GKSA 1U81A 4TT3D 1Z6XA 2RAPA 3ZZUA 3THXA 2AFIE 2J0SA 1N0WA 3KXIA 2ERXA 3N2IA 1NG9A 1A5TA 4V0OA 3MCAA 5F2EA 5DISB 1LY1A 5JS7A 4XIGS 1D2EA 4AYTA 2GCOB 2LWIA 3FFAA 2GESA 4MYHA 1XZQA 2BJWA 1J70A 2D2EA 4NCJA 3TUJC 2QL6A 4JVMA 4MH0R 4DZZA 4R71A 4V0LA 1CU1A 2J87A 2H8KA 1E9DA 4M9QA 4QGFA 2QMHA 3D31A 2ZM5A 3AF2A 2Q21A 3AVVA 3K0CC 2IEYA 4JLJA 2XTNA 1TU4A 2O8FB 4MKHA 1XD9A 3QY0A 1RJ9A 3GLHA 3R9XA 5DE3A 1JR6A 1S1CA 4ZIRA 5GJBA 4KFSA 3GJ7A 5JSZA 1Z08A 3I1FA 4PO1A 1UEJA 1B0UA 1VKJA 1HEIA 5EP2A 1MOZA 4XVQA 1FW6A 5K8TA 2EFEB 1UKEA 1Z47A 5BN3A 4LYJA 4D80A 4TQ9A 3UWOA 2P6NA 4KITB 2JIZD 2PZGA 2C98A 1L2TA 1XEXA 3HJNA 2IBMA 3QBVA 3TUIC 1Z2AA 2GNOA 3OIWA 2G9NA 4EIWA 1YZQA 5DH9A 2X8AA 1A82A 1G3IA 3BB3A 1TF5A 1MT0A 2RGEA 1D9ZA 4M9ZA 1XMVA 5JFGA 2EFCB 2BV3A 1Z22A 3QBTA 1E1QA 2ZRFA 4W5JA 1HY3A 2B6HA 1HUQA 1KDRA 4PZLA 5CB6A 3LDAA 1M34E 2QGNA 4CEHB 4FIDA 3TR5A 1ZC3A 2IUSA 1KI7A 5K8UA 3LFUA 1P6XA 2C9YA 4IDNA 4Q1DA 3DOEA 1GRRA 4TYPA 1MO5A 1EWQA 4CT5A 3QENA 4LV8B 3RSLA 3T34A 1Z6AA 3DMNA 2WKRA 5FOSA 4C0QC 4N0EA 2CL7X 3O8RA 1GRNA 2RMKA 1Q44A 3PEWA 4U5XA 4DDWA 3QXSA 4ZCLA 1KTVA 1QHHB 4TLDA 1QRAA 2J0VA 5JS8A 5KDOA 1KKMA 3KUCA 5EP3A 4XTRA 3SE0A 3AEZA 3THWA 2NOAA 5FBLB 3HWSA 1XD2A 2FPMA 2ZE6A 3DDCA 4NCNA 3AKEA 4E22A 4OL0A 1RFLA 2DFNA 4AIIA 1A7JA 4HB3A 3OIVA 4ASUA 1ZCAA 1GOTA 1XX6A 1H8EA 1IN5A 3D8BA 3TR0A 2CBZA 2GXAA 1KIMA 1W2HA 2R9VA 1DAKA 1S0UA 1SKQA 3VR5A 4DLZA 3L43A 4OQLA 1FPMA 3OEHA 4OHZA 1Q12A 4LBYA 3CRRA 3TLXA 2GXUA 3VHXA 3WNBA 1XXHE 1Q20A 2A7QA 3X1WA 3GLFB 5CITA 1T5IA 3RAPR 4L15A 1JBKA 4BZQA 2IYYA 5DIFA 3G0HA 4FCVA 3W5JA 4TTPA 2BBWA 2ZRIA 4CYMA 1W0JA 3ZVRA 1G3UA 4PPFA 2YYZA 5AR1A 3LY5A 4DCUA 1ZUHA 4Z54A 2OBMA 1E2HA 2QGZA 1XTKA 2ZVPX 3KFVA 2FFBA 2JIZA 2VHUA 2XZOA 2QAGB 1JJVA 4MGYR 5IK2D 4M21A 1WBDA 3C4JA 4W5HA 4BASA 2ZUBA 5HR5A 1XEWX 5EUQB 2VP2A 1TU3A 4Q9KA 1FTNA 1XU4A 4IOMA 4YDHB 1DE0A 2J3EA 4LYHA 5E7MA 3RRYA 2ZRDA 5KOYA 5EE3A 3I5XA 4ON9A 2IYTA 4GSYA 2ZRNA 4HUQB 2F1HA 5DYGA 3NHBA 1RZ3A 1R5BA 5G53C 4KVGA 2IT1A 2QENA 4GFDA 1NLFA 4PC2A 1OXXK 5EP4A 4CEJB 2FZLA 2PLFA 4BFUA 2V7QD 2P65A 4PAMA 3OZXA 4GBMA 521PA 1G21E 4Q1FA 3SQWA 2QT1A 3K0AB 1AKYA 4C3ZA 2XAUA 2OHFA 3DKPA 2YC4C 4D81A 1FNMA 3U60B 2QG6A 4MDFA 3ADBA 2ZI5A 4KFTA 1ODFA 4MGIR 1L4UA 1QHNA 5FI1B 3GLFE 2FZ4A 1A2KC 3CKLA 3IUYA 1MKYA 1X6VA 1QF9A 5FPHA 1YZTA 5E3HA 4D4JA 3A4LA 2XNDA 4TTRA 2X1VA 4XWOA 3IEUA 2XXAA 5EXSA 3ND9A 1W4AA 1ZUIA 4FMCB 1IY0A 4A0FA 4HLCA 4IHQA 2GEVA 4TLAA 3VR3A 3D3QA 4EQ6A 4X8HA 3N2EA 3GLIA 1G19A 2V8OA 3NBXX 5K8LA 1IOZA 5HTKA 1KSJA 1SXJE 2XZLA 1WCV1 2IXGA 3BE4A 4U00A 2KWIA 5FOVA 4MYTA 3EPKA 2EWWA 3RS3A 1G5PA 2ZRCA 1JPNA 1NMXA 5SZIA 2P3SA 4K8OA 1EG7A 3FOZA 1L7VC 5LD2C 1IN8A 4LRWA 2OLKA 2PJZA 3CX6A 4F7WA 1E2QA 3LWNA 3EPJA 3AVWA 2V55B 3CPJB 4IEEA 1ZRHA 4LSGA 4K46A 2GVDC 3KQNA 1T5LA 1NMZA 1JEEA 1VHTA 2JJ2A 1E0AA 3K9NA 4P4UA 2ZUDA 4UQOA 4KXFB 1JPJA 4GP7A 1Z63A 1J8MF 4PQFA 3CRMA 2FH5B 5G41A 1Z6GA 1AN0A 1OHHD 2Z5FA 4A2QA 3U4QA 2NQ2C 1E32A 1E69A 4BQSA 2IS6A 3FWYA 2CHQA 2C2HA 2GJSA 3KKQA 4JLDA 4Q4HA 4A9AA 2QU8A 3W90A 4P0TA 2QAGA 4PC1A 4I4LA 1IY2A 2JJ8A 4BFVA 3ICQB 1EFTA 3OIUA 2IC5A 2XJ9A 2ATVA 2REOA 3AVPA 2OO7A 2IYQA 3ZVLA 2VA8A 1DG3A 4Q9LA 1WE2A 2Z43A 1R6BX 2BM1A 2ERYA 3A1SA 3T1QA 5B30A 5FTMA 3I61A 1NBMA 1ZVQA 4RSGA 5DI3B 3X1ZA 4FN5A 4DDUA 4TMZA 3ZDQA 2QP3A 4C0AC 2O5VA 4AYWA 4OQFA 1UPTA 3CWZA 4LYAA 1W5TA 4M1YA 2WOJA 4UNSA 5EP1A 2J0UA 2DHRA 3KQLA 1G5RA 1G8GA 1X3SA 4C0JA 2ORVA 4DLYA 4URXR 1WA5A 1UDXA 2PX0A 3T06B 2BJVA 1P9WA 2B8TA 2QMOA 4QBHA 1FMJA 2FEMA 4TZ6A 2WIBA 4EFMA 3DL0A 3NKVA 1OF1A 3SJBA 1KI8A 1W1WA 2F43A 3EIHA 5JCPA 1KOFA 4OQNA 1CR1A 5EJEA 3CX7A 1FFHA 2ZQ5A 3TNFA 1ZYUA 1N3BA 4AG6A 4G01B 1LFDB 1GNQA 2YOHA 4QXAA 5IF9A 2GAAA 1GVNB 1R0XA 3TW8B 2ZXUA 2Z4SA 2NG1A 5BXQC 1F60A 5EZ6B 3T1TA 3EIEA 3SJCA 5FH9A 3K70B 2JLVA 2ZS8A 4ZDKA 4MKGA 5UKDA 3HP1A 4PTLA 4D82A 4HLUC 1E2JA 3GP8A 1H8HA 4DB2A 3MD0A 1YR9A 4MRPA 1U99A 4DIEA 5EZ5A 4A0RA 1IONA 1PV4A 3B1ZA 4O25A 1KI3A 2A2ZA 2G1KA 2OZEA 1VCIA 2CLSA 1GKIA 3EA0A 4NBSA 3U3MA 1IQPA 2ANCA 3NBZC 1CP2A 4IKEA 2QUZA 4E07A 1UBFA 3CF0A 2WSSA 1AZSC 4LK2A 3ZVNA 2CCGA 1KKLA 1H65A 1QG4A 3ZH9B 1KK3A 3CZQA 4L8GA 2ZIAA 2VQSA 3L0PA 4PO9A 4RKFA 3B9PA 4HDCA 3X1XA 2RGAA 4C0HA 2C95A 1KO4A 2KB0A 1E9BA 3GFOA 1KAGA 1KZGB 3M1IA 4MKFA 4CEIB 4A4DA 3EAQA 4DSNA 2YC2C 1QDEA 1OIXA 4Y0VA 4E5UA 2OCAA 3NXSA 3P32A 3R7WA 3F0TA 1RW4A 3D6TB 1FUKA 2ORWA 1R5NA 2V6JA 4IRUB 4JJKA 2FFHA 5L3RA 1NN5A 4CGZA 2D4HA 3IEVA 3AH8A 1MH1A 5HE9A 2ZITA 2PL3A 2JLWA 1KI4A 3OIYA 3PUVA 1GTVA 1DELA 4LY6A 5EE9A 3T1OA 2GJ9A 2HDNB 4OI1A 4PAQA 2N1BA 1E2MA 1ZP6A 3B1VA 2PT5A 3LRPA 5L3QB 1XMIA 2DFKB 4JLKA 1BMFD 4GOJA 1R8SA 3ZS8A 2EYUA 4DLVA 1NRJB 2J7PA 4OJQA 4TSFD 2E9SA 4PX9A 4A0GA 1P7CA 1VIYA 3TSOA 3IDQA 4B74A 4Z1MD 4TWZA 4JLNA 4BLTA 1OXTA 2ZYTX 1AZTA 3LVRE 1N6HA 3QXJA 3I73A 3ADDA 1OH5A 4M1OA 3CRVA 1G6HA 2XOKD 1ZUNB 2HJVA 3VKWA 1E9CA 1KAOA 2W6JA 3UWKA 1LTQA 3RDPA 2H5EA 1ZCBA 3OE7D 2JLXA 3O8CA 1U90A 1IY1A 3FE2A 3ND8A 2IUTA 4Q19A 3U4QB 2Z0MA 5DI3A 2FSIA 1Y3AA 5BW8A 2D62A 4UNPA 2W2VA 3CF6R 4B75A 1N6KA 2ZJ2A 4FCTA 3DOFA 4KVAA 1VPLA 4HUQA 3CONA 2CLCX 3SHFA 4IVQA 2I4IA 2XB4A 1QHXA 3OAAA 2G6BA 3NG1A 3B78A 4QHTA 5JLJA 3HDTA 4IDQA 1ZM9A 5GJCA 3VNUA 1BKDR 2NIPA 2OBLA 3NDBB 1RRPA 1XEFA 4ASUD 4OHYA 3L0OA 1U98A 4Q5IA 3VR6A 2YWEA 1SVMA 4XD7A 1VG1A 2WAYA 2QEQA 2GILA 4X8LA 1N0UA 3GJ5A 1WDTA 2WJJA 3LBNA 3G5UA 2Q3MA 2ZJ5A 1NSTA 1U9IC 3H2YA 3OESA 4TMWA 2FX3A 4CDGA 4NZYA 3K09A 3F8TA 3T35A 2BKEA 2WVJA 2XGJA 2D74A 2ZPTX 4PFSA 5KSYA 5AUNB 1EFRA 4A82A 2AN9A 4IDOA 3AKCA 3FGNA 2WKQA 1FL9A 3BGWA 3DM9B 3A37A 2HUPA 5GADl 2BEKA 5G40A 1ZINA 2DB3A 3PQCA 4EPRA 1Q1BA 2V6IA 2CXXA 4DLTA 3ZD6A 4NL4H 3ZZ0A 4QFMA 2BVNA 2GJKA 4XSHA 3AVTA 1JXOA 2OESA 3BFVA 1DAIA 3NBYC 4KLZA 4YMWA 4JJZA 3TSZA 4WBSA 1R2QA 1Z06A 1Q3HA 2H16A 3IHLA 4TYNA 1RYFA 1YE8A 2CEAA 5SZJA 1CBUA 2ZJYA 1WMSA 1IN6A 2V4ZA 3IIKA 2W2XA 1DARA 5J4HA 1AM4D 2EVWX 2QRNA 2XXAB 5JZVA 4QBIA 2NTYC 4XWAA 3RVBA 2PJRA 2FN4A 1E2EA 2QT0A 2OAQ1 1R7RA 3QPWA 4CF7A 5JBQA 5KTYA 2VP9A 1KK0A 3OE7A 2QBYA 4JLVA 1US8B 3FKQA 1P75A 1KO8A 4D0NA 3OFND 1OFIA 3QEJA 1NG1A 4NH0A 3EZ7A 2FFAA 4JLOA 4TTQA 4ACAA 2WWXA 5FL7A 2YWFA 4URZR 4XSGA 3RRZA 2C99A 2JLYA 2TMKA 3Q9LA 3QJYA 4UXHA 2GBLC 5KYKA 1XMSA 1CJVC 3O8DA 4BEJA 4HB2A 3A4NA 2ODNA 4I1VA 2OFWA 2WBLC 4P4TA 4ESHA 4URVR 4QOSA 5F9FA 4LUCA 3QKRB 4O2RA 5J47A 2VHTA 5J4LA 2FSHA 3KKMA 3UPUA 2XTZA 2L0XA 3AGPA 3BC1A 3TQFA 2ZI3A 3BOSA 2IYSA 1XNJA 2O0HA 2R6CA 1GWNA 3QXHA 3OF5A 2P5SA 3TVDA 3LV8A 4P32A 3QKSA 1XPOA 2WICA 5JEDA 4RKEA 1FZQA 2ZTSA 4DVGA 4C7OB 4B3CA 5FBVB 1YZGA 3B1WA 3KFXA 3OEHD 5AJYA 1E9SA 2EWVA 1AS2A 3L82B 1GSIA 1N6LA 3GLHB 5C2JB 3B1YA 3U3KA 1RRGA 1VHLA 4URUR 1NIJA 4ARZB 4DLRA 4KV9A 1JEDA 5FBWB 2IF2A 1R0YA 3I62A 1KJYA 821PA 1JAIA 4R9UC 1IHUA 3IPXA 1ZIOA 1EFRD 2CK3D 1G16A 4DEXA 4LV6A 4XJXA 2F9MA 4YQFA 5FTLA 4UNQA 1SVIA 4CEHA 1XBTA 2FFQA 3K0AA 5CYPA 1XPUA 1ETUA 3EZ2A 3FTQA 2NPFA 1KO1A 2YWHA 1GITA 4JLAA 1DBSA 1YHNA 3GJ0A 4DCNA 2PCLA 4O0MA 4EPVA 2J46A 1AIPA 2BMEA 3UANA 1JXMA 6Q21A 1F2UA 4G5RA 3THOA 3WYFA 1COWA 2ZRJA 5KNDA 1TAGA 3B13B 3WP1B 2RHDA 2ZU6A 5JWOA 2XB2A 1ZD1A 2RH5A 4RZ2A 1NJGA 2GDJA 3KKNA 4MRVA 2RHMA 2AX4A 1TQ4A 3EXAA 3GEIA 3R7WB 4A92A 3PXGA 1IM2A 4B35A 1H8HD 3EASA 3KJHA 4QJ3A 3EG5A 3SN6A 1OE0A 2BOVA 1GL7A 3BBPA 4LYFA 2O8BA 2C77A 4OHVA 3SNHA 3D7MA 1DO2A 5AUQA 2REBA 3KUDA 4X8MA 4WZAE 2EFGA 4NCIA 1E79D 5J4VA 4MGZR 4IVPA 3ICEA 1IXSB 2AL7A 2FPKA 5JRZA 1OJLA 1FUUA 1XFAA 1YR8A 4P31A 4US2R 3GLGE 2O8EA 1VIAA 3O8BA 2YVUA 4FINA 4B2PA 1S1MA 1US8A 1YJ5A 1AJEA 3BWDD 3VKGA 2MSDB 3CH4B 1S4QA 1I4DD 2AKYA 4L9SA 4BLQA 4Z8YA 2ZSBA 1CR4A 2WSMA 1N25A 3K0EA 1OIVA 2E87A 2AXPA 3LAWA 3GEHA 3SEAA 4NPHA 1F2TB 3QKTA 4G0NA 3X2SA 1P4SA 4PSVA 1W0JD 5JHHB 1VCOA 4TMVA 1E2PA 1QHGA 4JLMA 4LGMA 2B7BA 2HF8A 1XTRA 3WRYC 1HYQA 1K8RA 4B34A 2GBLA 5H68A 2ZE5A 2KJQA 4B33A 1VTKA 3DPUA 4TYYA 4TZ0A 4C4PA 4G5QA 2MMCA 1ZNYA 4Q18A 1IBRA 3LX5A 1C4OA 1XTQA 3VFDA 2WWFA 2R65A 2PMKA 2GAOA 3I5YA 1BO6A 2WWWA 2GCOA 5LBIA 2PH1A 1H8ED 3AKDA 3ZYCA 4HAYA 4PR0A 1PZNA 4RJLA 4IFEA 3B82A 4DC9A 4PSAA 1XRJA 4JVNA 2CVFA 3P4XA 2FDCA 4FMDB 4P4SA 2O0JA 1OFUX 4NTZA 4EAQA 4Z51A 1OHHA 3CIOA 1KI1A 2UVQA 4QJ5A 3TKLA 1XJCA 2FSFA 3NH6A 1KY2A 4EPWA 3B8HA 3IO3A 4F91B 1OKKA 4RY2A 1Y63A 2R8RA 3FDIA 4BLSA 1P60A 4BLRA 5HE8A 2ZAMA 1M7HA 1NKSA 2Q3HA 3WBKA 2RB4A 3GQBA 2RCNA 2VP5A 1ESNA 2NO9A 1Z6YA 3WHLA 1N5IA 1ZU4A 1P5ZB 3RANA 1S3SA 2VP4A 1YKSA 3W9YA 2W2TA 4RD3A 1OKKD 4ACBA 2V9PA 3FYHA 4JVSB 1E1QD 3S1AA 4YMTA 3X1DA 2KI5A 2P6UA 2BDTA 2KBEA 5D3QA 1SXJC 1AQUA 1U0JA 4GPTA 4CIDA 1CKEA 4HB0A 2VHCA 2G0TA 4FCWA 2QE7D 2HF9A 3Q3JB 3JVUA 2BCJQ 1NN0A 1A1VA 2R6GA 2CNWA 2FV8A 2XNDD 1YZNA 4TLBA 4WAUA 3U7GA 4ZKEA 3T1VA 1M6NA 3B85A 3QXCA 3CRW1 3T15A 4OYHA 2ZRAA 3B60A 2BBTA 4X8OA 4EPTA 5JJLA 1TUIA 3C15C 3CNNA 221PA 1E3MA 1LVGA 2C9CA 3TQCA 2WJIA 2XEXA 4Q00A 1VCMA 2W0MA 2J41A 1RJ9B 5FOUA 1AS0A 2BIFA 3CWQA 2R6DA 1ZNXA 1D9XA 3KXKA 2NO7A 2X2EA 2H18A 5FOXA 1N5KA 1PJRA 4KFRA 5EXXA 2OAP1 1E4VA 4DCTA 4EFLA 2BWJA 2ZRLA 4Q01A 1E1RA 1R0WA 3NC1C 1KSHA 2F1RA 3ZJYA 4DSUA 3U44B 2IS1A 1IAQA 1Z8FA 3U44A 3JZMA 2A3RA 2VHQA 3LBIA 3VR4A 1G6OA 3QF4A 3QKSB 2P2LA 1CRQA 1ESMA 3GLHE 2K5UA 2HYIC 1AA9A 1BMFA 5HZKA 1KI9A 4OK3A 3WYAA 2DBYA 5LB4A 3CNOA 1E9RA 1J2JA 3AP2A 1E79A 1PUJA 4I1UA 3SC3A 3UMFA 5JECA 3VR2A 1M2OB 1II9A 2DCUA 2GJAA 1Z5ZA 5DN6D 2JLRA 1IXRC 4M1KA 5FUVA 3WXMA 4KAXA 1VCNA 4C0BA 2EFHB 3SI7A 1KI6A 4HDOB 1NJFA 3BB1A 2OUKA 1W7AA 2BMDA 1S3GA 4LX0A 3U7EB 2O8DB 4IOLA 4FI3C 1TPZA 4HZIA 4DBLC 1UKYA 4AK9A 4NCHA 1SHZA 5KPJA 1KSGA 3Q8XB 3TIFA 1G291 4C0SA 1P61B 1E0KA 3AP3A 5CLLA 5GVSA 1G7TA 4MQBA 1S96A 4K81B 2WMOB 4N1AA 1F2UB 1NY6A 2YKGA 1JJ7A 2J5XA 2AFHE 2PT7A 4M1WA 2WWYA 4GDFA 2LKDA 3VMFA 4ZI3A 4V0KA 2Q9AA 3AVYA 1LNZA 1LF5A 5HCIA 1UM8A 4N3NA 2V1UA 2FSGA 1M7GA 4KODA 2ZRMA 5D3MA 2GCNA 2REXB 5CM8B 4RZXA 4BPBA 2DPXA 4V0ME 4JKYA 4Q21A 5TMPA 1DG1G 1DTSA 4C9BA 1NLYA 1FQJA 1ANKA 4ZPXA 2VF7A 2EW1A 3RSOA 3GJXC 2IYRA 5F9HA 1KK2A 2Q6TA 3LA6A 1CS4C 4Q1CA 1Z6TA 4CW7A 4I99A 5JMTA 2ZJ8A 3NHAA 1BIFA 2VL7A 4PZYA 2B8WA 4HZUA 2ZVQX 4NYMQ 3C5HA 1GDDA 4LJ6A 2O8EB 1I2DA 4PHFA 1WQ1R 1NF3A 3TH5A 4LBWA 1EWRA 1KGDA 2P5TB 1W46A 2MMGA 3PEVA 3FVQA 4QNMA 2FWRA 2ZRBA 3NEYA 4WVFA 1CTQA 2R44A 2AR7A 2GZHA 3MJHA 1TQ6A 2G77B 1T3HA 2RGGA 3BAFA 3PITA 1KNXA 1NLZA 4L16A 2ZREA 2D2FA 1C9KA 4XVRA 1NNEA 1TNDA 3GD7A 3LQRA 3RWMB 2G1JA 3BXZA 1G5TA 1S9DA 2W83A 1T6NA 3R9IA 2JLUA 2J0QA 3IIMA 2V3CC 1E1RD 3QEOA 2B21A 5IHPA 5HZHA 4WZBE 3VX3A 2V7QA 3KTAB 2EFDB 3PJRA 4IOKA 4FXPA 2G83A 4ILEA 2ODWA 1GNRA 4Q9IA 1G41A 3UXMA 1DAEA 1X8JA 1HQYE 4MRRA 1EXMA 1XMJA 5AJZA 1NBMD 2WM9B 1Q0UA 1N6OA 4US0R 4Q7KA 2JDID 4B47A 4KYIB 4FMBB 2IXFA 1HTWA 5J4KA 3K70C 2BMFA 4JIMA 4QC2A 2RGNA 2CNWD 1BH2A 1XEWY 3ASYA 3C7KA 2F9LA 1S2MA 4AC9A 3LQQA 2W00A 2OBNA 2ZE7A 1UF9A 3A1UA 4AWXA 4ARZA 3ZS9A 3LVQE 621PA 4OI2A 1COWD 3SJZA 1JR3D 1OXUA 4LHZA 4U02A 4D4KA 2IS2A 5B64A 2PEYA 1F5NA 3BORA 1FTSA 3W3AA 2F55A 1U0HC 5FTJA 1QZXA 3P27A 5FL3A 3W34A 3HU3A 1M74A 3CPEA 1FQKA 4Q03A 4DSOA 2W6IA 1HQCA 1IJEA 3NC0C 4L9WA 4RZUA 2RGXA 2ZU0C 3RS7A 2H1LA 1GAJA 4DLUA 1Z0KA 121PA 1M8PA 2QN6A 2GXSA 3IQXA 2X2FA 4EJSC 2AK2A 2WMNB 2IS4A 3WNCA 3RC8A 1KI2A 2Q9CA 1OXSC 3RS0A 2F43B 2JGNA 2IF0A 2OV2A 1ZM2A 3AB3A 4CEJA 3Q5DA 4UKDA 3UG7A 1OLOA 1VECA 3GJ3A 3QOFA 5TV2A 3UATA 1FX0B 1NIPA 1G8FA 2IWHA 3KDSE 5FUWA 1E2LA 2ZEJA 2ZR0A 1UEIA 1QG2A 4KSCA 4HB4A 3MLEA 2ZYWX 2NO1A 3DEFA 2W0SA 4PZZA 5C1BA 1FOEB 2A9KA 3MUFA 1IN4A 4MYCA 4M1SA 2WAXA 1U8YA 3QKRA 1G7CA 5DLQC 2QBYB 3FKSA 2WOOA 5B58C 4DLSA 4B32A 4JL5A 3K9LA 3ZQ6A 4W7SA 4Q4LA 3WNDA 3R8FA 3LW8A 1DVRA 2FEOA 1VG9B 1G3QA 2GK6A 2ZSAA 4IEIA 3AUXA 1GFIA 2JASA 4G5SA 4HYYA 2O8BB 2F3RA 2BBOA 3CX8A 3G82C 4KJZA 2FMXA 3NDPA 1WGWA 1W36B 1D5CA 3CR7A 4QM6A 2AWNA 2QNRA 2W58A 3IKJA 5FPKA 2ZANA 3QQ5A 1S9HA 3GJ8A 4TMTA 2QI9C 1EK0A 3QG5A 4JSYA 2EYQA 5IK2A 1GILA 1L8QA 1BOFA 2Q0HA 5E7JA 3SJAA 5JJIA 2HJGA 2OM2A 2OFOA 5HKKD 2ZS9A 1XD2B 2H17A 1I2MA 2A5GA 3MWYW 3I8XA 2NGRA 3V4RA 5DGXA 3W5IA 3QXXA 3L8ZA 3QE0A 1Z0JA 4BFTA 1G17A 4TL6A 4O3MA 1V43A 4KO8A 1OB2A 1VDZA 3K1JA 1EFUA 3PEYA 1DAHA 1UJ2A 2LKCA 2PEZA 1E2GA 3RS2A 5C4GB 2NPIA 1G8HA 1YR6A 1UFQA 2YZ2A 3GLIE 4WOPA 5KNCA 1YZLA 1YVDA 3N5CA 3VQTA 2C9OA 4NYJQ 3AQ4A 2DY1A 4D26A 3MFYA 3NVAA 3T5DA 3UIEA 3UG6A 4XVUA 4NYJR 2ZRGA 4HAVA 1EFHA 4YMUA 1PLLA 4ERNA 4OBEA 3ONWA 1MRNA 2R6FA 4PSKA 1LB1B 2C5LA 4IJMA 5B57C 1CR2A 3PUWA 1Z0FA 4LPKA 4KHZA 4B73A 2J1LA 4WXPA 5HPYB 1NL3A 1XEXB 1SKYE 2JJ1A 2OCYC 4MUAA 5BYJA 5KO2A 3L8YA 2ZJOA 1RPZA 2BHRA 2ZRPA 4QHSA 1R10A 1P3JA 1ZU5A 1KMHA 1X8KA 3VNVA 1L4YA 4ZCMA 3Q85A 5LDDC 5JWRA 1GKYA 2ZJAA 3TAUA 1OYWA 3PVSA 4PPNA 1UBEA 1Z28A 1TQDA 2ORIA 4KYUA 3I92A 2OCBA 1GL9B 3TUZC 1XJ0A 1T0JB 3OAAD 3WHKA 3ADCA 4IFBA 1XP8A 1X1RA 2ATXA 2ZETA 1II8B 1HV8A 3AVQA 3AVUA 5F3WB 4L5BA 1NMYA 3SOPA 2IYLD 4BRWA 4IW3B 1GRQA 3S1AB 3BH0A 3TK1A 1YU9A 4FWTA 4AYXA 1ZAKA 2DFTA 1F48A 5GVRA 5CYOA 1P2TA 4POAA 1NBME 2JLQA 5LPNA 2YHSA 3CPHA 1KZ7B 4H1VA 4GZLA 4AURA 5FTKA 1KMHB 4BLOA 1XTJA 3QVUA 1OYYA 4CVNA 3V00A 3T5GA 4DT1B 3P1JA 5AUOB 4MDEA 1YZKA 2VEDA 3SDZA 1MRSA 5BWMA 4UXIA 1Q3TA 2DR3A 2WJGA 4JKIA 1DADA 3ZQJA 2VSFA 4LCBA 4DWJA 4PPQA 5H70A 1E98A 4EPXA 1WF3A 3J81k 4Q7JB 4JLPA 1W44A 1T91A 2NO0A 3LXXA 4LJ5A 2R62A 3LH5A 1E2IA 4WW0A 3W8NA 5HKKA 3GFTA 3ZZTA 2IX3A 1XDBA 4O2LA 5J4YA 3EX7C 4CZ2A 3THYB 1HE1C 3EWSA 2E1RA 1JR3E 2YINC 5CJ2A 3BD9A 1XB2A 4QKQA 2ANBA 4URYR 3BFXA 3KQUA 2KSQA 4L4UA 4TMXA 4HLQB 3VX4A 5D3MB 4XH9B 421PA 5KUTA 1PUIA 3BH6A 3IBYA 2VSOA 2NZ8A 4RD1A 4DSTA 1W4RA 2F7SA 3DO6A 4OJKA 4EFNA 3W6NA 3K0CA 3VHLB 3QSYA 4NCKA 4OKSA 3KXLA 4HAXA 1Z2CA 4G3XA 3K70D 5C46F 1G3RA 1W47A 1G4AE 3U7HB 1DS6A 2BKUA 1ZJ6A 4R2IA 4C2UA 3X1YA 4M4SA 4B6EA 5FI0B 4BGDA 2CJWA 3TE6A 1KI6B 3FFBA 4GZMA 4BFWA 2GEUA 4HEJA 3KJGA 1HA3A 1Q21A 4YLGA 2O8CA 4PC6A 3CB4A 4W5WA 3QI2A 3ZGXA 1NY5A 1MABB 3CR8A 3MWLA 3RS5A 4PANA 4QGHA 1JI0A 1E9EA 4LOAA 3BB4A 3F5FA 4JT4A 3WYGA 2Z83A 1Z83A 4PO8A 2ZUCA 4GOKA 2IEZA 2HXYA 1E9FA 2F6RA 3DM5A 3QVVA 3SYKA 3N70A 4Q02A 4PHTA 5KSPA 3GLFA 4P33A 3SZRA 3I4LA 1A4RA 5TY0A 4GL2A 4Q1BA 3L2OB 1T0HB 3WY9A 1RRFA 5BYKA 1U8ZA 1AKEA 1O87A 1XJQA 1GKUB 4H9GA 4JYCA 1TF2A 3VAAA 5KSOA 3PV0A 3SYNA 1P73A 1Z29A 3CRQA 5CK5A 4M1TA 2ZR7A 4A15A 4BECA 1YRBA 2ONJA 3QUSA 1P62B 4DCVA 1KO7A 4YONB 2DYKA 1N6IA 3MRSA 2OXRA 1GP2A 1UBGA 4YMSA 8OHMA 3W3ZB 2XNSA 3P20A 2RGDA 4S35A 4A8JA 3GJ6A 3SFVA 4M9XA 3MMPA 1TUEA 4Q66C 2ODEA 3EARA 2ZROA 3IQWA 2A5DA 2ONKA 3K53A 1HT2E 3CLVA 4C0LA 4DUGA 1OIWA 2PBRA 2FG5A 4Q9HA 2F3TA 1U2RA 2VTKA 4LBZA 4Q4HB 1KY3A 5FBQB 4FWIB 2J59A 1TQ2A 1QHSA 3KB2A 4NU0A 1YQTA 2ZRHA 2C8VA 3H86A 3I3SR 2IWRA 5KDDA 4KBFA 4TMKA 3NH9A 1SGWA 2WWGA 1W2GA 4Z1MA 4B48A 2FGJA 1W36C 3QG1A 3R20A 1CXZA 4I1OA 5AJVB 2AXNA 4W9MC 2A5FA 4A2WA 2QRZA 4F4JA 2GCPA 1XD8A 2GVZC 1ZD8A 2IYZA 5DI9A 3I72A 3GJ4A 2V1XA 3U5ZB 4DUGD 2GZDA 4M53A 4Q4JA 1KK1A 5G3YA 4BFSA 2FGKA 1TEVA 5DHFA 3H1TA 1QVAA 3IPYA 4AKHA 1JALA 4TT3A 1OB5A 2JLSA 1II8A 4C30A 1UAAA 5FTNA 2BEJA 3DKVA 2OFXA 3VKHA 3W8RA 1SVKA 1T8TA 5AK0A 2B92A 1E2FA 1KJZA 4MA4A 4MKIA 1U94A 3EC2A 4C2TA 2GK7A 1PLJA 3RWOA 4A36A 1J7KA 1JAHA 3RHFA 5FBRB 2CL0X 3C8UA 3EIQA 2YOFA 4GT1A 3RLFA 3A1TA 1G1MA 3HYRA 3RNLA 2D7DA 1ZM4A 5FFMA 1CJTC 3AF3A 1GL6A 1RRCA 2WIAA 4LI0A 2KBFA 1LF0A 4AY2A 2JJ1D 3ZIAA 2IYUA 1X86B 5L3SB 2AHOA 1W48A 2CK3A 4RZ3A 2J9RA 5EE0A 4P3YA 1XWIA 2VH5R 4WA7A 4D2IA 2QMEA 2SHKA 2FA9A 2NMVA 3FPAA 4LPSA 3QF7A 1AGPA 3B9QA 4RD0A 3MSXA 3ZIAD 2CHGA 2I1QA 3IIJA 2JLZA 1W4CA 4UNRA 5JWHA 3THXB 1WRBA 4UJ5A 1B23P 3W6OA 2PX3A 1CR0A 2QQ0A 3HPRA 3QKUA 1DO0A 1K5DA 1OXVA 3L0SA 1ELOA 4V0NA 1XPRA 1PLKA 3Q5EA 1Q57A 4BFYA 1E2KA 1VYTA 2IK8A 2YOGA 3U3JA 3OEED 3QPUA 5KNBA 3LO5A 3U61B 4Q1AA 4R98A 5FPTA 1SHKA 1K6MA 1E9AA 3KQKA 2NO6A 3TBKA 1Q1QA 4RFSA 2GJ8A 2WWIA 2OLJA 1OPXA 3E5HA 3DVLA 1IJFA 3EA5A 3BH7A 2ZSFA 1QHHA 3Q7QA 4B44A 4G5GA 5ANRB 2BMJA 2GETA 1QHIA 1T3LA 4BWYA 1G7SA 1E4YA 1NI3A 3H84A 3LD9A 4TL8A 1W4BA 3E1SA 3KB1A 5LD2B 1E2DA 2I1VB 2R2AA 2W6JD 4Q4JB 4US1R 5EQTA 3DHWC 2CCKA 1YR7A 1QBKC 3SU8A 5FR1A 3SQXA 1J90A 1DPFA 4A6XA 3LX8A 5BN5A 1DAGA 1Z0IA 2XOKA 2IYVA 1RYHA 4B3XA 1UBCA 2O8DA 3OFNA 5EUMA 4EDHA 1FX0A 1E96A 5CM9C 4OI0A 1N0VC 5E7IA 1DOAA 3TJZA 4DDVA 3EW9A 4KU4A 4TLCA 2Q9BA 1P2VA 2Q3FA 1EFCA 2RGBA 5SZHB 1RKBA 1SULA 3T12A 4G1UC 1G8PA 2VP6A 3WBJA 4BFZA 4EJSA 1ZNZA 3CO5A 4ZKDA 4MITA 2QQEA 2J7PD 5HCNA 4TL7A 5AWFC 3SYLA 2WZQA 3K0SA 3GEEA 3IGFA 4GNKA 4LV5B 3AVOA 4BEBA 4DEYA 3PEUA 4ZDJA 3A58B 4DLWA 4LHVA 3KZ1E 4LHXA 2QTHA 4ZV4A 2BM0A 4B3GA 1HH4A 4RD4A 1Z3IX 4AG5A 3KX2A 3B1XA 1D2NA 4BZPA 1CJMA 2EU8A 1ONBA 1NN1A 1G7RA 4N0DA 3VTKA 3R9WA 2WWHA 4HZUB 4LJYA 1TADA 1XZPA 2IHBA 2H7VA 2ZI4A 4FW9A 3LLMA 4F38A 4F4IA 3MG9A 4C0KA 4CRWB 4QBFA 4TQUS 3T61A 2O8CB 3EZ6A 4JLBA 4B3FX 2HLDD 2XSZD 2QPAA 1R0ZA 2ZJBA 4E03A 1SKYB 5CJPA 1NVVR 1AK2A 1ZC4A 4D0GA 4MRSA 3KL4A 4CEIA 3KKOA 3FMFA 1XF9A 3SBEA 5JI3E 1LV7A 2IA5A 2PCJA 1J8YF 3Q72A 4IVRA 2B7CA 4WIAA 1JR3A
chains in the Genus database with same CATH superfamily
1Y8QA 1T8RA 4LDJA 3MERA 3LBAA 3SEZA 3GM2A 1YI0A 1QX3A 5FUMA 1TYZA 1E0SA 1C9MA 2GT1A 3HA2A 1YGYA 4MTGA 4LGVA 4PBRA 1NI4A 3SXJA 4BE7B 2XTAA 3I9MA 2BMVA 3ZI7A 3I34X 1C02A 2HTFA 2QM7A 4IXWA 4QGGA 4CETA 3H5IA 3NHPA 5ICGA 3O0TA 4RCYA 3TSWA 2H7CA 2JH3A 3C3KA 1YRWA 2Q5IA 4P4SB 3A4MA 4TLEA 4ZDWA 1XCPA 2FJ0A 3IODA 3EXEB 3RJ5A 2Q7OE 3DW3X 5K6TA 3U6KA 4G1MB 2ZVJA 1D2CA 3MX3A 5I9MA 1RC1A 3O39A 2CMGA 4CLEA 4EW1A 2ZB2A 4PX2A 2O2JA 3ZE0B 3DE5X 1SC9A 3GH3A 3IIIA 3KWJA 3QE4A 4A8JB 1SY7A 5CB8A 5FEUA 2W4IA 5JATA 3AM1A 3D43A 1YQWA 1QO0D 3Q0TA 2X8LA 5DVZA 1M6YA 3G7UA 1WR8A 1NR5A 2DQYA 3FMIA 3FUWA 1YRAA 4HDQB 4EB6A 1C3OA 1HOTA 1RPJA 1SYQA 2JEOA 2WF8A 2PKEA 4ZAWA 3VSDA 5A5VA 5IT5A 1PS0A 3L4EA 4WX2B 1XMPA 1Y0BA 3PF9A 3CUYA 1EVYA 4H6WA 4DCPA 3PIIA 3RT1A 1T01A 4AO8A 1BYUA 2QN2A 1EWTA 1S7CA 1T2CA 4OQMA 3PGJA 1XXHB 2NUAA 2OILA 3P5SA 1TT5A 1XZJA 5L7WA 3K5WA 2B99A 3SHWA 5TQVA 4RIFA 1NQVA 3VV3A 3I4FA 1NVWQ 3ADPA 4RH3A 4KWHA 1F6BA 2J48A 2VQ3A 4KR3A 1G8YA 1ATZA 1UH5A 1HW2A 2I7CA 3DULA 2JCGA 3QVTA 3SR0A 2FPIB 3FVYA 2O7VA 5L3VA 1H2AS 4X45A 2FRDA 1P0QA 3N2ZB 4B4WA 3PDJA 5LQCA 2RBEA 1MUUA 1H6DA 2R751 4ESHA 4EHKA 4IARA 2Q3JA 3E23A 3ENQA 1ZJ5A 3OLZA 3M82A 4HSEA 3O2JA 4YQEA 3UGTA 3NDRA 5FR2A 2IXOA 3KBOA 2H7YA 3RS8A 1GIAA 2JJMA 3KLMX 4ZJZA 3EDYA 5L3QA 5GINE 1PGOA 5CW2A 1A88A 3EFEA 1A96A 3VJKA 4HLDA 3THYA 1FSGA 2QL5A 2NYAA 4RCVA 1GAEO 3C70A 4MB6A 5ELXA 1YULA 4JJGA 4PNZA 3Q2KA 2FUG1 1FMCA 2WT8A 3GUVA 2IYWA 2QW1A 3NHSA 3PUXA 5IJZA 2OT3B 2DQSA 2DPMA 5IRCD 3NVKI 2VRNA 2XLEA 3I8SA 4PTYA 1QKIA 2W6PA 4WN3A 3CYFA 3C24A 2Y6UA 2O1XA 3HEAA 1O54A 1WSWA 3PRKE 1IXZA 1CGOA 2PMDA 3D5TA 3Q15C 4OSOA 4YB8A 4NV3A 3V7UA 3VVBA 1EP2B 1T3ZA 1XZEA 4B87A 4CWAA 4LOJA 3OM8A 5H1YA 3WLQA 1YONA 5ALEA 1E89A 4GRIA 4PHHA 4WZZA 2XOEA 5F4ZA 4MARA 3DMRA 1Z2OX 3NHUA 2BGIA 3ONFA 2KX7A 3QIAA 4RD6A 3C3PA 1NVEA 4NG4A 2WSSD 3VO1A 5GM1A 5AD1A 3KQTA 2JKVA 4H3KB 5I8ZA 1MAWA 2X0EA 3VSCA 3A28A 4OTZA 3JAWA 1GUZA 4L8WB 3UHOA 5JNWA 4CS9C 3OQBA 1KVUA 5BWBA 3NTUA 1NSFA 3I2GA 4EY7A 3O7WA 1VYKA 2FE4A 2G5CA 5HQ3B 2QWXA 1KMCA 3EBOA 3L6RA 5C5EA 1ISHA 3K0FB 2KK1A 5BUSA 1TK2A 1NQAO 3A3OA 3FRJA 3OLVA 2SKEA 3RRNA 1OX5A 2D0OB 1RIFA 4LC1A 3BS4A 3RRXA 2I5PO 5K5EA 3OJXA 3REOA 5KQMA 3PL5A 1JS1X 1ZHZA 2BCGY 2D59A 3Q3EA 4JCCA 1H23A 1DTWA 1T4CB 1U4NA 1G42A 2ILVA 3K9HA 1L4LA 2CCJA 3CM0A 2W2PA 2BC9A 4CG2A 5JVDF 2QORA 2VAVA 4RF3A 4MDHA 1Z0DA 2C2XA 3PR3A 4EMSA 1RPAA 1SOVA 1QYRA 3N59A 1D2HA 3BWVA 3R8XA 4BJ5C 4ZAFA 4AD8A 2I3BA 3DAYA 4FYXA 4EENA 3TTXA 3KH2A 1Y1PA 1UZUA 1PKEA 2W70A 3B3JA 1VE9A 4MHSA 3SR4A 2VBGA 3GL9A 1WSAA 1GEGA 3H5LA 1F7UA 1OFHA 2OYSA 2VIIA 3FPCA 5TXGA 5ALXA 4HVCA 3SIPA 2C8LA 4IS3A 1O3UA 1W1IA 1ZWLA 4PX5A 2J8WA 4P35A 3DOCA 5JI2E 1AK1A 4MHTA 4JT2A 1PD0A 2WC1A 2X0FA 2M9MA 1I4TD 4G9EA 4WT7A 2JDIA 1GZHB 4AULA 2I8AA 1PV1A 2CHVA 3FUUA 1P2DA 2D7JA 4CGYA 4EQ6B 3K09C 2BGTA 3GLIB 1G59A 2UXBB 5KHOC 3ILYA 5CIYA 4PPGA 1GPKA 3DHEA 1C50A 3DDWA 4K6HA 1U8FO 4MVCA 1ZXLA 2H1IA 3NHMA 1V54C 1DC4A 3QPVA 4UHKA 3WGJA 5CI8A 3PSHA 1SMYF 2A5JA 3OZFA 2OORC 3AKYA 1TKRA 1OU4A 2SCUB 2AD1A 3GHYA 3PG5A 1VE5A 5DNDA 3U3RA 3ZLVA 4OHMA 2AK3A 3BDIA 4LJSA 2X0KA 2P9QA 1P81A 2PO5A 3DAPA 3GFPA 4MKXA 2XA9A 5DW0A 1X7DA 2A78A 3BGVA 3N0VA 2P1RA 4M2LA 1MR3F 2DWOA 3REQB 3TTWA 3WLHA 4R8SA 4D9NA 2X8JA 1WP9A 4DV6B 1C7ZA 3N7TA 2CYCA 5A05A 4H1HA 4YV2A 4LA4A 1NFNA 3FAJA 1Q83A 1WQ4A 2FPGB 3IOYA 1VHJA 5EZYA 5BNTA 2FYTA 4JK3A 2O06A 1U8AA 2Q3CA 3FYSA 1DC3A 1Z5UA 4F45A 3FB4A 1KHTA 2I1WA 4KWTA 4KIGA 3UNXA 4U5DE 3LW7A 3RU3A 5KPDA 3ZXIA 1VOMA 1WUHS 2DKOA 2VBCA 3TRKA 1GUBA 1CIPA 1GNTA 1YC5A 3FDZB 2VOJA 3DE2X 2XF2A 4I81A 1C1XA 1I4LD 4MS3B 4XWTA 1N2CA 4U5FE 2R1VA 2WJYA 1TMKA 3N86A 4OK5A 3TLBA 2G36A 3MJEA 4M8SA 3RVMA 4IICA 3EXHC 4BE9A 3RJ9A 2DETA 4JLSA 1IHOA 2DLCX 3W8FA 3ZWYA 3UMBA 5FXMA 4G1CA 4OK6A 4G86A 5KOHA 1N6NA 3R7CA 3HVIA 1NVXQ 4ZQEA 5A4FS 3UN1A 4NONA 1AQJA 3N2KA 1RZRA 1FZTA 2ZXFA 1E0DA 2BHSA 5KIAA 3VR1A 4F9GA 4JVOA 1VMEA 3B1FA 2KNHA 3FCEA 4EJSB 2P9TA 4AKIA 4ESVA 4QNRA 3UXYA 2VJDA 4GZ3A 4IXNA 3TSCA 5JJKA 1JG3A 3H3XA 5CVJA 1U65A 4F06A 3T38A 2CLDX 1V2GA 3V42A 3ZGVA 3DFFA 1DAFA 7REQB 1E2NA 1K88A 3ZBQA 4I66A 3PL1A 1U6KA 1QGOA 2C0PA 2HV9A 4NBKA 1C8BA 1YZYA 1A3CA 3NEJA 3OC0A 4LLCA 1SELA 2IH5A 4A7PA 1CB7A 1P2SA 5AGFA 1P7YA 1ZD9A 2QG4A 3RSZA 3G89A 2WF7A 4FI3F 2WB2A 1NI5A 1BJKA 2LK4A 2RSLA 1DJOA 3D8UA 4DDMA 3EODA 4DMMA 2OZKA 1IBMB 3KSDO 3GPLA 3CVYA 2IX3A 1Z88A 2IXEA 3MS2A 4DIDA 3JQPA 1FFYA 1K0FA 1TA4A 5INTA 2QAJA 1UC8A 3A8TA 4JGGA 4FZRA 4AI6A 2QJRA 3LT5A 3GFGA 3EPLA 1TWHA 4DLXA 3G6WA 1AS3A 3VU9B 5CDUA 1YZCA 3HSYA 6LDHA 1QP7A 2H92A 3SG0A 1JR4A 1M0TA 1JB1A 1WG8A 4UVHA 3UMRA 5HM6A 1T8UA 1HNNA 2D7CA 2NYVA 1V2HE 1JG6A 3I1IA 4LC0A 1JYEA 1QAOA 1V47A 3HB4X 3STUA 3VZBA 6REQB 4MQ6A 3ZGNA 4ZVKA 4ZT6A 4MI6A 3VNSA 2YEVA 2J07A 1OW6A 3TEJA 1W29A 2IY7A 1J9ZA 2PLWA 4GGPA 1SUWA 4DE5A 3CLUD 3QFHA 3BRWA 4ZDIA 4J0DA 5K8IA 4DQUA 1ZHTA 1NJ2A 5DLJA 1V55C 4DBRA 4I2NA 3OKFA 4DN6A 1GCGA 2XGGA 3L6EA 1WDLA 3CZPA 4G84A 5BV1A 3H18A 4FZ3A 4LBVA 1LW6E 1T5SA 3T1NA 2GWWA 1QWOA 4WXRA 4F9TA 4ITRC 1EGAA 4RPKA 3AUYA 5CM2Z 2BL4A 2R7VA 2AFHA 3WMGA 2J9FA 4ZO4A 4CDAA 3UA4A 2VCEA 3NYLA 1SVOA 2OGTA 1IPFA 4I44A 2YMMA 4DDTA 4ZYVA 5C7OO 4AXXA 2G5GX 2XIJA 1UXGA 1P0CA 4GP6A 3BTVA 1I94B 1TEXA 3H1BA 3V1MA 3WL4A 1Z35A 2ET6A 5JHGB 4RV9A 2JFWA 1V7QA 4M0EA 1SD5A 3CN7A 1REQB 4EG0A 3OHSX 4MVSA 1ODSA 4I1OB 4ZU3A 4EELA 5BURA 3EY9A 2CE7A 4M89A 2WKPA 3UMGA 1YU6A 2ZE8A 1ENYA 3VU0A 2OUIA 1OY1A 3QBJA 4O4JF 1FNSA 2DE0X 4MVJF 4HI0E 3KHUA 3I0MA 1KBZA 3HR8A 2QE7A 5JS5A 5JP7A 5ESXA 2YDYA 4Y30A 1L6RA 1T9HA 4ZVTA 1RM4A 4R81A 1Y1RA 2PH3A 4H3HB 4AURA 3FYDA 1ZIPA 5CNJA 4CM3A 4Q7LA 4RA6B 4D5GA 5L3SA 4JYBA 3IXQA 4Q9JA 3Q7TA 3SBDA 5ILOA 1NDHA 3DB1A 2JW5A 1FK8A 1AQNA 1WXIA 2VHJA 3VTZA 1B16A 3AUTA 3K9GA 1CE8A 2DQ4A 4R2JA 1DAOA 3VUFA 3MJTA 1U31A 4EMBA 3A1VA 3PHGA 4PC3A 2ZIZA 3OHMA 1LS6A 1N3YA 2H0QA 4FWVA 2CZCA 2GFQA 3LWZA 3THWB 3TRFA 2O3UA 1R64A 2ODTX 1W5SA 2YJZA 2AH5A 3KKPA 1ZX1A 2XRMA 3IJRA 4M0LA 3Q0EA 4MWCA 4LLEA 1TJ4A 3IUJA 5CIWA 4EYOA 1EHYA 4GSLA 4NU8X 4G67A 5EQDA 2BKXA 3WC4A 5AFSA 4RVCA 3ORSA 2OEXA 2CMKA 2AJLI 4A2CA 2J30A 3R0ZA 1SXGA 4RV4A 3UJ3X 4C89A 3NWJA 4UUBA 5F5NA 4M88A 3GJZA 4R1UA 2Z3WA 3BWCA 3SS9X 3DFMA 2HOQA 4D96A 3J80A 3GT4A 5TMEA 4JP1A 4D0LB 5H3LA 2I8BA 1K92A 2ECPA 5CLQA 2ZIUB 3QLEA 1KWKA 2P0AA 3PLNA 1K3UB 3EC7A 1I9GA 5ERYA 5ALLA 4CM8B 3ESDA 1XCMA 1NN3A 1PTJA 3WKCA 2HXSA 1GTMA 5BSMA 4ARBA 1OXBA 1S05A 3C7JA 2YL1A 1WZEA 2QMQA 2CXQA 4P5PA 5GJWC 5DN6A 1K5GA 2AZ4A 3VU9A 3WP0A 2V7GA 4UMVA 5D5HA 1F7VA 3P2IA 4JODA 2A33A 3T0IA 5DT2A 2YTZA 1FFXA 3CW8X 3GR6A 2OCGA 1MABA 3JU3A 2FWPA 1E92A 3I5PA 3KOMA 2D00A 3BG5A 4FBMA 3S2EA 3TMKA 1X7ZA 3X2FA 4YEDA 3BDVA 2XB8A 1D03A 4DY4A 3EGXA 4XJVA 5E0KB 1C2TA 3O38A 3F49S 4OQXA 1EX6A 2P9HA 3C8HA 1TIKA 1P9NA 2QSYA 3FHOA 3T3MB 1R5OA 3UA3A 3ENVA 2YWGA 4CIVA 4N3GA 3RGGA 3FBTA 1D4OA 4YCDA 2VLIA 2OXCA 4MUIA 5IBCA 1KVTA 2QM0A 2X77A 1JPVA 4NFHA 5E2AA 4ZAVA 3TZHA 4CF3A 3UMMA 1SUBA 2UZ3A 1TM1E 3L41A 3ZQ4A 3PFKA 5CCXA 1P4HA 3OPYA 1ZJZA 4B76A 4O6NA 1O8CA 1LJLA 3AM4A 3ZU4A 1U11A 3QYFA 1V16B 2HWXA 1OW3B 3I45A 3AG3C 1BR4A 3OKPA 4NKRA 4AB1A 3KOUA 3GZ4A 4UJ3A 3M0EA 3GP3A 4I6EA 2L2QA 2OYCA 4LHYA 2PX8A 3BK7A 4QA9A 5JO9A 4BNZA 4R8RA 2YVKA 1MGOA 1ZL2A 4LJ4A 5EHGA 1LFAA 3RD5A 2R1TB 1RM3A 2OD9A 5LB2A 2FK7A 2QMUA 2Z8YM 3E9RA 3GP5A 3Q8WA 1E6CA 2IHYA 2QS9A 3DZDA 5COMA 4IG9A 2EF0A 3HBAA 5HMMA 3K71B 1XCGB 2BC5A 3Q3IA 4JZKA 3NETA 1NNLA 2E49A 1RWKA 3AERA 1N7HA 1D3AA 3D7LA 4Y2GA 2MR5A 4J2OA 3EZ9A 1M0EA 3OEEA 2DTDA 4O2BA 5IXSA 3MTBA 2QP9X 1XMQB 3DE9A 1OREA 2WF9A 5TQ0B 5LP6F 4MGEA 1FLAA 1GZSA 4YQYA 3WMEA 2X3UA 3ANYB 2XRFA 4CMIA 4R6WA 4NTBA 3T6BA 1CHDA 4QEZA 4EUSA 5EEGA 3M4YA 1SRRA 1XZGA 4QAQA 3NIBA 1Y6ZA 2H57A 2LCHA 1UKVY 2Q2NA 2YV3A 2NPUA 3IR6A 2UVPA 2CJYA 2GMWA 4GZ5A 2ZRKA 3KVNA 5CDFA 4ECAA 1X42A 3R7SA 5HDBB 1N4DA 4HWSA 1TK9A 2JA2A 2CEKA 3IHWA 2VDVE 3IP5A 3WE7A 1J0AA 3R24A 2CJWB 2GHIA 3D3KA 4F1WA 1CDZA 3WQSB 1D0SA 2FN7A 2Z9BA 3FNHA 3IB6A 3DNPA 4ABYA 4KIUA 2G06A 2HLDA 2XX3A 4RKYA 2QZ4A 3OQIA 3TLAA 4BX0A 4GSKA 3MIZA 4EY8A 3G2KA 1T3SA 2Y1EA 3VA7A 5F7XA 1I9CA 4F72A 4YFYA 4EGCB 1G20E 2IHKA 3DT9A 4ZQIA 2OBXA 2JL1A 2J45A 2LR0A 4M7OA 2IRWA 4QXOA 1T1SA 5FI5A 3QOWA 2HHHB 4EPYA 3ESXA 4ENPA 4UREA 3Q12A 3PXXA 4MQ4A 3H65A 3A6PC 1FVOA 5F51A 1BOOA 4WADA 3ZD7A 3KWMA 4EARA 3CT6A 2GKSA 4O02B 1PNOA 1RMYA 3EMBA 1Y89A 3H8JA 4FOSA 2HUJA 4IXTA 3ZDCA 3FUXA 1DXYA 2PKYX 1G8SA 2DUJA 3OEYA 4O4HA 1N57A 3M6MD 5D6OA 2XUKA 3E82A 4XCVA 1D2EA 4AYTA 4FVTA 3GJTA 1E20A 2BAGA 4DZZA 1ZSNA 1TWCA 2VJLA 1YAHA 4JVMA 5TX7A 4DNQA 3WLLA 1LBEA 1MC8A 1XZLA 3LXUX 2D3TA 2HSEA 3SYRA 2WE8A 3D31A 4LXQA 1T3TA 3L8IA 2Y9MB 1SUDA 1K9SA 2H4ZA 4RMJA 2GPBA 4X1KA 4AFNA 2OK7A 4BNDB 4CFZA 3KZMA 1FS4A 2ZUUA 4DJ9A 4OIQF 4MKHA 2CGEA 1HFWA 3V32A 1XD9A 4CIXA 1KFCB 3L7JA 3QY0A 3DXFA 1RJ9A 1H0RA 2D0PB 4JBLA 3RYFB 4B81A 3WK5A 4NEHB 4HOYA 3EEFA 4H4KC 4NR0A 5GJBA 2X4DA 1T0BA 5I45A 4QXMA 2YNMC 1K4MA 1QSGA 4HWPA 2R7TA 3I52A 4MQFB 3DBHB 1E6LA 3PQEA 4XYBA 1H3NA 1HEIA 4OV6B 4YHBA 4PCUA 4XVQA 5KZMB 4JNCA 3BXPA 3G59A 3IBTA 4DVZA 3FGOA 1X7GA 1UKEA 5C1IA 2FOIA 4C03A 3LECA 3O03A 1DQYA 4AJ9A 1JSCA 2L18A 1U0NA 5B1DA 3UWOA 3ELWA 3T7DA 4MLZA 2MINA 3IQGX 3NXKA 2PZGA 2Y93A 3SJ7A 2C98A 1IM5A 5G0WA 1L2TA 3A2KA 3GNQA 4UOQA 1KC1A 1XEXA 1MJGA 5HJ5A 2PJDA 3TUIC 1AV6A 4RTQA 4HP8A 1Z25A 3U2LA 2ISSD 3EVEA 4AJOA 3HJGA 4EIWA 2PZBA 1C8VB 3FDJA 2OBBA 1QSPA 3P9YA 2J9FB 4J6EA 2XLHA 3F8SA 3BB3A 3H1EA 3GAFA 4BMCA 5HGXA 5C8XA 3HB9A 1MT0A 4F2WA 2CVPA 1GXSB 1FVHA 1U8XX 2DTXA 3GUYA 4V0SA 1SMKA 6PFKA 4M9ZA 1XMVA 1PJ8A 5JFGA 3BD7A 5MN4A 1XKXA 3HWRA 1E1QA 5CVVA 1YUBA 1HY3A 3PC7A 3RARA 2AHRA 2B6HA 3NAMA 3W2IA 1FJXA 1XVAA 5HILA 1ZC3A 4NBVA 2IUSA 3CKKA 3TR5A 3LFUA 4CM4B 2C9YA 1X1TA 4WFIA 5K8UA 3DOEA 5ECWA 5F4BA 2IDZA 2ZJ6A 2BSXA 4DHWA 1IOVA 1CJCA 4B9EA 4LEIA 3T34A 5H9WA 3L7AA 1Z6AA 3DPSA 2J5QA 2WKRA 2AMYA 5CDHA 4OYLA 4DLNA 3M6WA 2RI0A 5LU9A 1Q44A 1DFHA 2PUFA 4YUWA 1BR2A 3QXSA 4IQ4A 2QXTA 4MWSA 4KB5A 5JS8A 1Q50A 3IIEA 3NCTA 1U6IA 2DSNA 3A4VA 2Z3ZA 3L7MA 1XCJA 3HDVA 4UBOA 1M67A 2GTIA 4QUAA 3ZVKA 5FBLB 2VHEA 4ROTA 3T9DA 1I1HA 4FE7A 2F4VB 4NCNA 3T7RA 4EBFA 1HPLA 3HDJA 1RACA 4Z0NA 4AIIA 1U89A 3OIVA 2PKWA 1N2GA 4ASUA 1ZCAA 2FTKE 2H2WA 1IN5A 3COWA 3D8BA 4RM2A 3TQSA 2CBZA 3COYA 4N01A 2R9VA 1DAKA 1S0UA 4DRJB 4OSEA 4OHZA 1X2EA 2X0DA 2WUEA 5IYZB 2PRJA 1AVOB 1Q12A 1YR1A 5C32A 2O6LA 3CRRA 4LBYA 3TLXA 3X1WA 3GLFB 1CIVA 3PGVA 2A7QA 1KU0A 4H7EA 3UCXA 2UZ0A 2WD7A 4R2WA 5HEKA 3RAPR 4YIKA 4AMUA 2RI6A 1CJSA 4U2KA 1GPAA 4WZBA 3TZCA 4BMVA 3VZCA 4U7FA 3DLHA 5AVQA 1G3UA 4MUMA 4DCUA 3LY5A 5F1YA 1ZUHA 4F4FA 1AF7A 2AG1A 3HBJA 1XTKA 4I55B 4Y9TA 5TPWA 3BBLA 4AJEA 4OMDA 4BYMA 4L51A 4DIMA 1RI1A 2XZOA 2WG0A 2P62A 1MZVA 2Z2XA 4PWYA 4ZU6X 5A1JA 3MCWA 5ED4A 3TL3A 4MGYR 4OIMA 1U4OA 4D9CA 1CS0B 3NONA 1MGPA 3C4JA 1H4TA 4XEVA 5EUQB 2H2HA 2XIQA 1C1XB 1DE0A 2GN8A 4LYHA 4MS3A 5E7MA 5AM2A 2IKQA 1ICIA 2O3QA 1KPHA 5EE3A 4HN4B 2DTEA 1EH5A 2WJ6A 3D1LA 2FGYA 4MYRA 2IYTA 3ZGOA 3GYGA 5CDSA 2W6MA 3RCBA 1TFKB 2F1HA 3RC7A 1UK8A 5IVHA 2UXDB 4BQPA 5G53C 5T3UA 1BGXT 1EFVB 1CUZA 3DE1X 4B0OA 4XX0B 5EP4A 4B4UA 2PLFA 4KXMA 1DUIA 3ZQYA 1KZYC 1N2HA 2V7QD 4GBMA 4OXXA 521PA 3T6GB 3MPOA 4E5VA 1LTKA 4D92A 1MX5A 3HE3A 4C3ZA 1JEAA 1OAOA 2FR8A 3DKPA 4FB5A 4CS8A 4L8VA 2WTXA 3K3PA 3OSZA 1ZI6A 3U60B 1XNRB 3NM4A 2BEWA 4UDVA 2HQ1A 3H5VA 1L4UA 3LI2A 2WLSA 4DYVA 1X13A 4EL0A 1M72A 3CKLA 1A8QA 1MKYA 2VH1A 3EVZA 3D4BA 3MAGA 5JDCA 4B17A 1V8OA 1U0TA 1EBFA 2DULA 3A4LA 3GF4A 3VPBA 4TTRA 1JSRA 1F1BA 3ND9A 1W4AA 3UY4A 5AW9A 4FMCB 3WGMA 1QUEA 1JFFA 4BC0A 2GEVA 2IPAB 4BO4A 2I8CA 3D0RA 1L7OA 3R6TA 3GMDA 4PLWA 3NBMA 1Y9DA 1I13A 3TULA 1QG6A 3GLIA 1IHXA 2VTBB 5C0OE 5ADHA 4BNUA 5K3AA 4TN5A 4E5NA 3UVEA 1SXJE 1UDBA 1A0BA 2WTEA 1LBSA 1CNEA 1SD2A 2G67A 4QEKA 3HUTA 3QEMB 4QQNA 4U00A 3D6MA 5FOVA 1UP6A 4RIHA 1JIIA 4IQGA 5J2UF 3I04M 4MYTA 3K2BA 3VKUA 3WKAA 3EPKA 1VMIA 5ICCA 5KJCA 1NMXA 2WF6A 4AN0A 1L7VC 2IYEA 4TMYA 1IN8A 2B8NA 4LRWA 2GNAA 4IJWA 2R7XA 3PUJA 2KGOA 4NZZA 4PLCA 4XGNA 3G85A 1GN9A 4CR7A 1PVOA 4RTMA 4LSGA 5JJ5A 1QONA 1PT6A 3NQ41 1VC2A 4OBWA 3DWWA 4RPCA 3V8QA 1HW1A 1NMZA 2O2DA 4ARUA 2JJ2A 2YQ4A 1MP0A 2JBAB 3K9NA 1DTWB 4P4UA 1L3PA 2ZUDA 4AW9A 2XF8A 3HNPA 2YL2A 4X1OA 1JPJA 3ESZA 4PQFA 1LVHA 2YFQA 1OT5A 2Z5FA 1CY4A 1E5VA 1E32A 1E69A 3WSWA 3FWYA 1YS6A 4IL5A 3ZD8A 1QF7A 2HV6A 2XBLA 3M6VA 2H00A 4D3FA 4GC9A 1R0RE 2NVUA 2QAGA 4PC1A 3PDUA 1DEHA 3BFJA 4CJGA 3D4OA 2ATVA 2REOA 3JQBC 4YP5A 1SPXA 1K9VF 3BL6A 3KIPA 5FV7A 5LQSA 4CUKA 1ZD5A 1XE3A 5H7XA 3ZVLA 2IYQA 2WIJA 4EFDA 5I7UA 3LJKA 1GGKA 1N0HA 2ZBVA 2Q46A 2VA8A 1A8HA 3A4YA 3LRTA 4HS4A 1NFOA 1WE2A 4N4AA 4O4IF 4Q9LA 3B0UX 2DPHA 4BNLA 5DTRA 3D59A 4CMCA 3H9CA 2VQFB 5HDQA 2ZB4A 4LNUB 2WUGA 3DS8A 2HDOA 4JSRA 3WGTA 2XLVA 4G8CA 4J43A 4MCHA 1FUYB 1WXDA 3CUUA 4X84A 5DI3B 3ITNA 2RHGB 4TMZA 3WNQA 2QP3A 3X1ZA 3SR3A 3K73O 4DDUA 1F4VA 4ZOLA 4QD3A 3NP7A 1QE0A 3CWZA 3H75A 4M1YA 4RWZA 1MJNA 4UVEA 1O94A 1J20A 2J0UA 1G5RA 1HMPA 1ZGBA 2C2YA 2Z6UA 4J7TA 4MR9B 3T7KA 1TZJA 3Q7IA 4MWGA 2PX0A 1WA5A 4NV1A 1I01A 4E0HA 4MVJE 3EEIA 4MO9A 1LC0A 4QBHA 1QTQA 4Y2TA 3UFXB 3G17A 1ECJA 3KM0A 3HMKA 3S27A 2WIBA 4NJMB 4EFMA 1PFQA 3DL0A 5BY2A 4TZ6A 1OF1A 1XYYA 3T5CA 5JYBA 1LPEA 1KI8A 1W1WA 1L4BA 1KOFA 3IP8A 1A76A 1CR1A 5EJEA 1P18A 2X5OA 1FFHA 3OUZA 3Q6IA 1YDMA 3OLQA 4KQFA 7ABPA 3ABMC 4RMGA 3STWA 1LFDB 1F8YA 3OFJA 4IXDA 5CRIA 3TPCA 4CKBA 3TW8B 1EEXB 3HUFA 3IR7A 3G8YA 4IQ0A 3KALA 3HO6A 4HQ6A 1RPNA 2QLBA 2YFHA 2ZS8A 4NTFA 4G0VA 3WK9A 5UKDA 3HP1A 3OIFA 5JUAA 3QHPA 4YBRA 5JH7B 2UYOA 4KNWA 1E2JA 1BMTA 3GP8A 1NLXA 4L4RA 4MRPA 5U4XA 3F7OA 3GHHA 4ISBA 4KQ6A 4OIRF 1KTMA 5EZ5A 4A0RA 4CS7A 1X1CA 4DIEA 4BQFA 2EHDA 3A9UA 3B1ZA 2UYQA 2LP4Y 2G1KA 1K7SN 5KYWA 2WU0A 3CSUA 3EA0A 4M37A 4QPDA 3U3MA 2ANCA 5REQB 1X87A 3GCWA 3SICE 4E07A 4DR3B 2UUCB 1KRXA 2ZYSA 1V6CA 2WSSA 1I6WA 4CKWB 1PG0A 2Z2JA 2ZTMA 4X95A 2HR1A 1KKLA 3F6SA 1LVKA 1J5EB 1QAQA 1K75A 3CZQA 3TRDA 3NNSA 3KT6A 4OOFA 5FZTA 2ISCA 1RRMA 2VQSA 3DJYA 3BGSA 3JQ6A 5J58A 2EILC 4RSRA 1T2NA 4G0HA 3CLTC 3AR5A 2C95A 1YB5A 1GCIA 4LDNA 3X1XA 4C0HA 2KB0A 5IUJC 2GSDA 2ZUFA 3EK2A 1KWGA 1CZHA 1RD4A 5E33A 1HZJA 2WZCA 2ZBUA 3M1IA 3N28A 4MGHA 4X6LA 5E4JA 5B1HA 5JAQA 4BRSA 4DEVA 3EAQA 4YR7A 5IH7A 2YC2C 2I78A 3LGAA 1SXQA 1S01A 5EOVA 4OP1A 4EJFA 3OQ1A 3I9V6 1DLIA 3K30A 2PZMA 3D6TB 2V0NA 2V6JA 2HQBA 4IRUB 1ECGA 4WY8A 4NX2A 1NN5A 2V03A 3G0BA 4CGZA 2BTQA 2R7MA 2J9WA 2QY6A 5FAXA 1PZHA 1OOEA 2YJ5A 5EWJB 4F8YA 2OKCA 3S40A 4UU1A 1V35A 2WG1A 3PUVA 1QQBA 2V6GA 1SJ9A 5J43A 1USKA 1NVTA 4DR4B 4PAQA 2N1BA 1ZP6A 2HRZA 1UAYA 1XMIA 3PGKA 5KNCD 4FEEA 3IMCA 4TSKA 4ULWA 5EJ9A 1T43A 4M1ZA 4GOJA 2G5PA 2NXEA 4DLVA 3GG2A 5L0FA 3GJSA 3UGOA 4TSFD 3C1AA 2E9SA 3IXLA 1OCZC 2O7RA 3C85A 1YMVA 3K1AA 3DOHA 3TRJA 4A0GA 4QOEA 4GECA 3OIDA 3GEDA 3TSOA 4UHEA 3ZHBA 4L2IB 4XQ1A 4BX9A 3VDXA 3V5YA 1WSBA 5DB4A 1YZ3A 4CQMA 2YY5A 1E63A 1YJQA 2ZD9A 5KKCA 1LLQA 2C29D 4R5HA 1AZTA 1UQRA 3CXUA 3GT3A 3HMQA 5FQNA 1FDRA 2WQ7A 3AQBA 4U8HA 3PHIA 1Y3CE 3U40A 3ADDA 3GX1A 2Y1XA 1XN1A 4RVSA 3CRVA 2TMYA 2VAPA 2XOKD 5BQXA 2KS6A 1RXEA 2VXOA 4N5HX 1IZYA 1QVZA 2HJVA 1TEHA 5CX1A 2BM9A 5M2QA 2CD7A 2W6JA 1YR3A 3RDPA 4OUDA 4DV0B 4DMUB 5CFRA 3KKLA 3PFNA 2E37A 1U90A 1BG6A 1DBPA 4MVJA 4QLBA 5A5EA 3ND8A 4L6AA 1RAGA 1ZW3A 4PBTA 2O9XA 1UKAA 2BN4A 4S1OA 1MF7A 2NU7A 3G79A 4BCCA 3R5FA 3U4QB 1XL1A 4E2YA 2DY0A 2FSIA 3GRKA 4L4YA 5ERXA 4IUDS 2DPGA 1QV7A 5FWYB 2PUHA 4PYIA 5BW8A 2D62A 2CXUA 2OXFA 1QKJA 4KYVA 4V2UA 2H2IA 3VH3A 1N6KA 4KXYA 1X77A 3TINA 4ER6A 5AXDA 4NXMB 2J31A 4TXMA 1Z4JA 2BCEA 4HUQA 5AI4A 13PKA 1EVKA 2WAAA 4MNDA 3C3JA 4AX4A 4DV5B 1M8FA 2I4IA 2XB4A 4B40A 4KNYA 2X4IA 3NG1A 4EHDA 1VBMA 2UVDA 3ABZA 2YFYA 4D41A 1OR8A 4G81A 4V3BA 1BKDR 1NW9B 2NIPA 1XI2A 1YJ8A 2OBLA 2ZDGA 3GRYA 7YASA 4JB8A 3NDBB 5JPCA 1DB3A 5JYDA 1QP8A 1ZI9A 3L0OA 5DEOA 3VR6A 2QTTA 4ENUA 3WGKA 4XD7A 3ZN2A 2QEQA 2GILA 4AM8A 3W4JA 5C8ZA 1C3VA 1YMQA 4FQ5A 1YBFA 2JGJA 5HKBA 3G23A 2AQHA 1NSTA 3DHNA 3N53A 4TMWA 2TSYB 1KJ8A 3EFBA 2EJCA 2B5OA 3EGEA 4CDGA 3GPBA 4PACA 4NZYA 4HPJB 4D9MA 2C3OA 4WVLA 1W6RA 3CS3A 1HY5A 3T35A 3VRHA 4FE4A 2XGJA 4RE5A 1AKQA 2EKQA 2RJOA 4QOIA 1KEUA 2G3KA 3IOBA 4PFSA 3IV6A 4C14A 5JCXA 5K8JB 1EFRA 2DJ5A 3RG8A 2J32A 4FX2A 5JALA 4IDOA 3C6QA 3AKCA 2IYNA 5GQSA 5PNTA 4A6EA 2QR5A 2FCAA 3ET5A 3TCKA 3A37A 3DL2A 2VUIB 2ACEA 2BEKA 3PT9A 3W4YA 3B89A 1Q1BA 4R2KA 1UM9B 4DLTA 4EPRA 4RIGA 3ZD6A 2DUNA 3HWWA 3DV0A 1DOWA 1EZZA 4GR5A 4QFMA 5LBUA 2AV6A 3ZC4A 4R1NA 1G2QA 4BN5A 3TOMA 4CKZA 3BFVA 3RVPA 3VR2D 3AJDA 3NBYC 4UTPA 1U2EA 4YMWA 4JJZA 1B42A 1CEYA 4UQPA 1R2QA 1P77A 1RHJA 1Z06A 1Q3HA 4WBSA 1EFLA 3DWIA 4QYIA 2CEAA 5EXDA 4BMXA 1CBUA 2CUNA 1SCQA 1V3QE 3OE1A 2R7WA 1IN6A 4WGFA 2V4ZA 4YCBA 3M6XA 5K0LA 1DARA 3RSGA 2QRNA 2EVWX 3KZKA 2XXAB 2XUQA 4PGHA 4QBIA 5JZVA 3S1SA 4ARCA 3L4BC 4ZZ0A 2QT0A 4CF7A 4B6JA 1SIWA 3BM5A 4MRMA 4D98A 4Q4CA 4G0ZA 4P8RA 3FPGA 1R1DA 1IJKA 2P2YA 3KU1A 2P2SA 3FKQA 4XDHA 2JCYA 4UVDA 1QLHA 3NO4A 1TZMA 1G1AA 4HVTA 2NU8B 2WTNA 4NQRA 1XZIA 4QYXA 4TTQA 1CDDA 4EFKA 1KQGA 4KJXA 2BTEA 2Y1DA 4RTRA 3ZGZA 2CYAA 3A9CA 4OXIA 3DE7X 2GAJA 2YWFA 1C30A 3W0LB 4C43A 1LPOA 2JLYA 2A8YA 2I1LA 3Q9LA 4TV9B 3SMVA 4DTCA 4UXHA 1WD5A 4E5PA 3R6WA 4JR1A 2JD2A 3D4NA 4JB0A 4JUDX 3BMQB 3DT8A 2OFWA 3BAZA 2N47A 1U3FA 4HNAB 2NSHA 4UUOA 3O90A 5IAKA 3QKRB 5LA6F 5HQTA 3OLYA 1OA1A 2XR1A 3KKMA 3Q9NA 1K8XB 1YHYA 3WRXA 4AY3A 3HDGA 5J4LA 5KVSA 2L0XA 4CKCA 4BXOA 1OWMA 1BROA 3AGPA 1M1XB 1ZH6A 1CW2B 2O0HA 3NC4A 2JHPA 3Q7RA 1GWNA 3QXHA 4JC5A 4WNIA 4ZRNA 4GWKA 3AJ9A 3LV8A 4P32A 2HX1A 4H16A 1NDQA 2WICA 3F96A 5JEDA 3OZEA 1A5ZA 1DHTA 1Z75A 2ZK7A 4M6WB 4DQKA 1D2AA 1X1BA 1N5RA 1FZQA 1VYIA 1JQDA 4R01A 4E17A 5CH3A 4B3CA 4DVGA 5ARBA 3KK0A 3P7MA 5AM5A 1O57A 1C0IA 4HDNA 2P41A 2ZWIA 3O3OB 1AS2A 1JQEA 1N6LA 1T15A 2R11A 2AP3A 2IUFA 3QWIA 4PRZA 1PT9A 2E18A 1RRGA 4KR9A 4JC4A