1ZU4A

Crystal structure of ftsy from mycoplasma mycoides- space group p21212
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
309
structure length
305
Chain Sequence
PMEKAMLKSAFNFSKDIKKLSKKYKQADDEFFEELEDVLIQTDMGMKMVLKVSNLVRKKTKRDTSFENIKDALVESLYQAYTDNDWYRIDFKENRLNIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFRAGATQQLEEWIKTRLNNKVDLVKANKLNADPASVVFDAIKKAKEQNYDLLLIDTAGRLQNKTNLMAELEKMNKIIQQVEKSAPHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDLLAFDIDQYIVHLSSGFMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords ftsY
publication title Conformational variability of the GTPase domain of the signal recognition particle receptor FtsY
pubmed doi rcsb
source organism Mycoplasma mycoides
total genus 116
structure length 305
sequence length 309
ec nomenclature
pdb deposition date 2005-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1zu4A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zu4A02
3FKSA 3HWSA 4LBZA 4C9BA 1NY5A 2QTFA 1NVUQ 3TVTA 4NU0A 1GZSA 1VG0B 3QKSB 1NLZA 1T5LA 3AVTA 1XDBA 1W47A 2BMFA 2DWOA 2NO1A 4HB0A 4ON9A 4V03A 1WF3A 4KSBA 1G9XA 1U99A 4JZKA 1N3BA 2FEOA 2ZVPX 1U9IA 2F9LA 4XD7A 3F5FA 3QF4B 2P65A 2I1VB 4A2WA 1KY3A 1W0KA 4MUBA 4RCYA 2GRJA 5JFGA 5F9HA 1VG9B 3QVVA 3IDQA 2QENA 4I1OA 3SR0A 4TL8A 1MABB 2ZRNA 2EQBA 3ZIAD 5B64A 1NVVR 3NKVA 5JI3E 1W1WA 3FTQA 1RPZA 2ZU0C 4NL4H 4C30A 2CLSA 3VHXA 1CJTC 5E7JA 2FNAA 2QA5A 4Q47A 3TRFA 4PAOA 2C99A 2WIAA 1HY3A 2X19A 5FOWA 1K8RA 2HT6A 2P5TB 3WRYC 1TNDA 2ZSAA 3RABA 1E9BA 1J90A 1I4TD 1W4CA 4Q02A 4W7SA 2A5FA 2JIZA 1N25A 3A36A 2FX3A 3GCGA 2VYFA 2ORWA 5B57C 2DFTA 4TMWA 4ZCIA 3IQWA 1JEEA 3L0PA 4M1MA 4KYUA 2OFXA 1Q1ZA 2WPDA 3IIKA 3U3KA 2FU5C 4MRPA 1XCMA 2ZS9A 4F91B 3X1YA 1KDTA 2MSCB 5AWFC 1Z6TA 2DR3A 1DAKA 1F48A 3GQBA 2A9KA 4HAYA 1QHHA 1DO2A 1EX6A 1PLLA 1SXJE 2F43B 5FTKA 5GADl 2BCGY 2H92A 2YWHA 4JLPA 1Z83A 4DLZA 3IHLA 4OJKA 2JDID 5AUPB 1G7RA 1RYHA 3DKPA 5FPSA 4E03A 1TX4B 2GDJA 5BYKA 1Q44A 1KK3A 1E0AA 5HKKD 1GP2A 1C9KA 3PUZA 4TYQA 1V43A 1VCIA 3LQRA 4Q7KA 3Q5DA 3UWOA 1HURA 5J5CA 2DWPA 3JZMA 3OE7D 3AP1A 1T3SA 4QOSA 1R0YA 4NPHA 3PXGA 4KHZA 3CB4A 2V6IA 4FXPA 2UKDA 2Y8EA 2W6IA 1KNXA 1E79A 3Q7PA 2FFAA 4PZLA 4HLQB 2JLQA 2HF8A 2BVNA 3SE0A 1MRNA 4JMPA 1RVDA 1YZNA 4IW3B 4LJYA 3Q3JB 1T91A 4TSFA 4GSYA 1P9RA 4NKRA 1OKKA 5FOSA 4MQBA 4PSKA 1A2KC 3HYTA 1KI1A 3KB2A 3AF0A 1E9EA 4X8LA 2W58A 3N5CA 3B1YA 1AJEA 3B9PA 4LI0A 4LV8B 5AJZA 1VTKA 3U6BA 2H5EA 3SQWA 1OXTA 2QP4A 3NTUA 3KKPA 2G0NA 4PHHA 2XNDD 4NTZA 2ZSBA 3I92A 5IDVA 5JRZA 2A78A 2GVDC 2W2XA 4PFSA 5KDOA 1ZM3A 1AKEA 1GUAA 1C4OA 4LJ9A 3U5ZB 4TLEA 2WWXA 3GJ0A 121PA 1VG1A 1XD9A 1XWIA 2RGCA 3DHWC 4Q1BA 3LVQE 4MDFA 4GL2A 4FI3C 1Q22A 1NRJB 1GIAA 3WBJA 4G5RA 1ONBA 3TUJC 2OT3B 4IDPA 4AYTA 1A1VA 4ABYA 2BMDA 2ZAOA 1ZJ6A 1ZM4A 4YXWD 2GJ9A 3AVQA 3T61A 1OF1A 5B30A 4CEJB 2YWEA 4PPFA 5EP3A 1E98A 2NPFA 4Z51A 4LJ7A 3A1VA 4MGIR 4DLRA 3T1QA 3H2YA 2FG5A 1ELOA 2ODBA 3Q9LA 5TDHA 5FTLA 2G6BA 2D2FA 1XTKA 2C9CA 521PA 4M9XA 3RS2A 1MO3A 3B5JA 1T3LA 3VU9A 4YMUA 4LJ8A 1XZQA 1QHIA 4TL9A 3I5XA 5JEDA 2A5JA 1P6XA 3RS5A 2B8WA 4B3BA 1KMHB 3SNHA 5AR1A 1G6HA 5EXXA 3ZLJA 4TWZA 3WNCA 3RSLA 5FL3A 4A9AA 3TR5A 1VIYA 3QPWA 3KL4A 5FR1A 4B3XA 3BB4A 4II7A 4NE2A 5IK2A 2HYIC 4ASUD 3WMGA 4UNQA 4NCHA 2IHYA 4WOPA 2OE2A 4ZPXA 3VHLB 3MJHA 1ZIPA 3B8HA 3ZQJA 1XMSA 1TQDA 2QNRA 4CZ2A 1FZQA 2WJVA 4M1WA 1E2PA 2RH5A 3DZDA 1O87A 2KE5A 1N6NA 1WDTA 2F9MA 4RKEA 4D0LB 4YLGA 5C46F 4JVMA 2IUUA 3WHLA 1N6RA 1E1QD 1OFIA 1BO6A 1TU3A 1NKTA 2A3RA 2YVUA 1ZUIA 2QL6A 2FEMA 3TVDA 1SVIA 2IYUA 2CVFA 2VQSA 1QF9A 2JLUA 2J1LA 1XMJA 2H7VA 1YQTA 1DELA 5E3HA 5JS8A 1LFDB 4F93B 1CS4C 5JCZA 4QBGB 3EIHA 3SC3A 2P67A 1X8KA 4EUNA 1U0JA 3BFXA 4HSEA 3AUYA 1OXUA 4Q21A 1RW4A 2XSZD 4DUGA 2Q9BA 1G3IA 2F3RA 2P6RA 3L2OB 2Q3FA 2OSBA 4PSVA 1CBUA 3M0EA 5TVKA 2ZJAA 1GNPA 3KZ1E 3GLGB 5TXGA 1US8A 3U7FB 4M4SA 4PAMA 3U7EB 3U7HB 3QJYA 4NONA 2IYWA 3A4NA 1R0WA 1ZCBA 1E2HA 1FTNA 2ZJBA 3U60B 4A2QA 1NN3A 5ANRB 1H8EA 4P4TA 2HEIA 2FF7A 3WMFA 4P32A 4JLMA 4A0RA 5DHFA 4DEYA 1HV8A 5KDDA 2R9VA 2KJQA 1FUKA 1TF5A 4FCVA 3GJXC 4PC6A 4DLUA 2WTUA 3T15A 1F2UA 3QXHA 721PA 1LNZA 3LA6A 5AJWA 4S2EA 3TSWA 2AL7A 1TAGA 4QJ5A 1KZGB 2EW1A 2H57A 4Z8XA 3SBEA 3ZJYA 4BE7B 4ESHA 3FFAA 4WXPA 1KOFA 1ZP6A 2AFIE 4HDOB 4ARZB 2QE7D 3BORA 1IAQA 1ZD1A 1AKYA 2ZRPA 3EZ6A 2JLRA 2OHFA 1BKDR 1M7HA 4C0KA 1ZNWA 1MH1A 4RD0A 4IXNA 4JBXA 2J0SA 1R5BA 4UXJA 1LTQA 2AD5A 3AKEA 2QSYA 1HE1C 4TZ0A 1XD2A 2FSFA 5G3YA 4HAZA 2GEUA 2AFHE 2OO7A 1LW7A 2CVHA 3TR0A 3I73A 1S9HA 3CZQA 3T5DA 5HCNA 2V55B 3AKCA 4WAUA 1U81A 1ZC4A 2VEDA 1RZ3A 1BMFD 1KKMA 4B2PA 5KTYA 2RGXA 2WJYA 1C1YA 3GLFA 3DEFA 4DSNA 4H9GA 5AK0A 4W9MC 4OI1A 1XP8A 4WZAE 3AF3A 1TQ6A 2H1LA 5D3QA 1E1RA 2KSQA 4BRUA 1II8B 3B85A 4BQSA 2ATVA 1AK2A 1J99A 2R6DA 2OESA 4JVSB 2ZE6A 3LBHA 3AB3A 5FPYA 1R2QA 3RS7A 1FOEB 3CPHA 2ZRLA 3JVVA 1SVSA 3PUYA 4PZZA 1UKZA 4TYYA 1TPZA 1NMYA 2YKGA 1ZU4A 1FUUA 2HLDD 1E2MA 2ZETA 3LX5A 4BZPA 2XAUA 4Q4AB 4I4LA 2CNWA 3QF4A 3K0CC 2KWIA 2L0XA 4QM6A 4LUCA 3NHBA 1T0HB 3HDTA 2QQEA 2Q21A 2F1RA 4PHTA 5CIQA 1GITA 4DDTA 3BB3A 3D7MA 4RJLA 4WVFA 2CK3A 2GNOA 3CX7A 1DS6A 3FKSD 5E7MA 1CJUC 4EDHA 3AVWA 1MABA 1EFCA 2OLKA 3VR4A 3KJEA 1UADA 5JWRA 1JR3A 2UZ3A 4C0AC 3FFBA 5EP2A 4IEEA 4YMWA 2FWRA 2AK2A 3V00A 1G5PA 4OHXA 5TMPA 1UBCA 1GKIA 2VRWA 3C15C 3LV8A 5DHAA 4N1AA 4EPRA 2OG2A 2ZRIA 2XZOA 3AVXA 1HQCA 1XPOA 5LB2A 1FNMA 5DI3B 1VCMA 3AP2A 3OEHA 3PUVA 4QL3A 2RMKA 3DOEA 1RRGA 4XD7D 5GJVC 3P27A 1U9IC 1CKEA 1W0KD 3AV0B 4PZYA 1U8ZA 2QPTA 2PLRA 2C04A 3GFOA 4JLAA 3AVPA 3ZVMA 1Z29A 5F98A 2ZRCA 1QZXA 2HV8A 4BASA 2QAGB 3T1VA 3KQNA 1OH6A 3EIEA 2V7QA 1QVRA 5EXSA 1N2CE 1E2FA 4I1UA 2OAP1 1Z0AA 4NYIR 2O5VA 1X8JA 1CR1A 1SHKA 2RHMA 3IIMA 4HDQB 4ZKDA 1E0SA 2GTPA 1ANKA 4X8OA 1DAMA 3CH4B 2WWHA 4M9SA 3BH0A 3TAUA 4PO1A 3THOA 1SKYB 2W2TA 3B78A 4NYJQ 5EUQB 2XITA 4GZMA 1VHTA 3VKHA 4WXRA 5J4HA 2AXPA 2WKRA 2VP2A 2GK6A 2VHJA 3PUXA 3RLFA 8OHMA 2DCUA 3VNUA 2JIZD 3UMRA 1GNRA 3H0KA 4PR0A 1FP6A 5CDFE 2XZLA 4P0TA 3SOPA 1XPUA 2VLIA 5AUQA 4OQXA 3EAQA 4MA4A 3WNDA 2FA9A 1TUIA 2ZI4A 4FIDA 2H16A 2WPDD 1X1SA 2CL7X 2GJAA 4DLXA 1KY2A 2ZR9A 4JJKA 3UMSA 2H17A 1G5RA 3VTKA 2O8EB 1AIPA 2IT1A 3A4LA 1G4UR 1J70A 3QSYA 2PH1A 4QHTA 3SFVA 4JLNA 1NVXQ 3PEUA 4PQRA 1U94A 3KKQA 5CIWA 2AK3A 5KO2A 4KFRA 2BV3A 5EXTA 2J0VA 3QF7A 1N6LA 3ZZTA 4MRSA 4F4JA 3K9GA 5J47A 1GNQA 1XRJA 3NEYA 4M1KA 4G3XA 4KLNA 1IOZA 1KSGA 1FP7A 4DHEA 1ZMXA 1DBSA 2GHIA 4Q18A 3M6AA 1XB2A 3L43A 4A8JC 4I1VA 3GLIA 2ZROA 1Z6GA 2W6ID 3CRMA 4JBYA 5HCIA 3RRYA 1E79D 1AS0A 1I2DA 4KVGA 5DISB 3K0EA 1YR9A 1F2TA 4NP6A 3UANA 5FBQB 1Z63A 4Q1DA 4TSFD 1YZTA 2CL6X 1RKBA 1DARA 4X8MA 1OKKD 4US0R 3ADDA 2GKSA 2J5XA 4CEJA 4HZIA 1TL7C 4D82A 5E4FA 3HYRA 2KBEA 4GOXA 4BFVA 3LFUA 3VQTA 3QEOA 2PCJA 4POAA 2DPXA 2J3EA 1HT2E 1GWNA 2GA8A 1MOZA 3DL0A 4G5SA 3HR8A 1JALA 2XZPA 1UM8A 2R44A 4AURA 4TQAA 3UXMA 1OLOA 3EZFA 2BCJQ 2D4HA 4MKFA 1KKLA 1GDDA 3UG6A 1FL9A 2XOKA 3MWYW 2P6NA 3NC0C 2ZTSA 4A6XA 4JKIA 4QBFA 3QI2A 2WVJA 4URWR 3CNNA 3VFDA 2ZUCA 2DFLA 2OEPA 4S35A 3NHAA 1S9DA 1VIAA 3EZ2A 4R2IA 4DDWA 3R9XA 2PX0A 1IN4A 2ZE5A 2Q6TA 1DAEA 4ITRC 5BQ5A 3W6PA 4QGAA 2REXB 1F60A 5TB5A 2ZS8A 3BE4A 4IOLA 3VR5A 4C2UA 1Q1BA 5DYIA 1U2RA 1OW3B 1QHSA 2QTHA 3A1UA 1LV7A 4LZZA 4CF7A 1CR2A 5EXPA 4PAQA 1OXSC 1IONA 4OKSA 4BLOA 3BC1A 3R8FA 1SVLA 4MGYR 3FMFA 2D2EA 1PJRA 1G64A 1CU1A 1SXJB 4R2HA 3OEEA 2QZ4A 3SYKA 2D7DA 1W2HA 3L82B 3QVUA 4GPTA 2R6GA 2ZSEA 1VYTA 4D81A 2BMJA 1EK0A 4TTRA 5IK2D 4TN1A 1D2MA 4RZUA 4RCZA 5G53C 3KKMA 2JA1A 1SGWA 5C4GB 3SHWA 5FTJA 2CLCX 1ZNYA 1US8B 4MRNA 3EXAA 1W36B 3CO5A 1GRRA 4MKIA 2QMEA 4EKDA 2Z6VA 1FMJA 3ETLA 1BH2A 2FH5B 4DT1B 1EXMA 2AKAB 3GLGA 3AH8A 3BH6A 1GL7A 5BN5A 2OBMA 2D62A 2VF7A 1RRPA 1R0ZA 1VKJA 4IDHA 3DDCA 3MGCA 3RRZA 5JEEA 3K09A 3W8RA 1DPFA 4FINA 3TMKA 2C95A 1EFRA 5DN6A 2XGJA 2QN6A 3V4RA 3Q72A 3RRMA 3HJNA 1EGAA 4P4SA 5P21A 4CYMA 1DAFA 1W2GA 3NC1C 3D31A 3D8BA 3DMNA 4OHWA 1XJCA 3SFZA 4R71A 1JBKA 4LHWA 2YHSA 4FW9A 2G0TA 1XXHE 1U8YA 3T35A 3U44A 2WAXA 1W44A 1T8UA 4K8OA 4BLSA 1AN0A 3TQCA 1EFUA 2CHVA 4MRVA 3QBTA 3IEVA 3LAWA 1G16A 1LF0A 1VCOA 2BBTA 2GAOA 4ARZA 1Z2AA 1CRPA 1QG2A 5K8TA 4U5XA 5FOUA 2P5SA 4D80A 2X8AA 1H8ED 2ZREA 1S3GA 5FPKA 2MMCA 4UNRA 1Z0KA 2QUZA 3QY0A 4NYIQ 4HLUA 2IYLD 3SJCA 4IEIA 3P26A 4TZ6A 2BJWA 2A5GA 3VR6A 2EFEB 5DSZA 3E1SA 3PIRA 2O0HA 1R8QA 2EFCB 3GJ4A 3E5HA 3H1TA 5CB8A 4Q9JA 2FSIA 3PV0A 1TF2A 4AKGA 4ZO4A 3W3AA 3O47A 3EASA 3MWLA 2BMEA 2CJWB 2RAPA 3HP1A 3QXXA 4EFMA 1N5KA 4HYYA 2IHBA 4ZI3A 3LW7A 1JPJA 1GOTA 3ZVLA 5EE9A 1RJ9B 1Z22A 4ZV4A 3VKGA 2AWNA 1Q1QA 1TQ2A 4A36A 1W0JA 1II8A 2Z5FA 2HF9A 2W0SA 3K0SA 2YYZA 2ZRBA 3QPUA 2CCGA 4ZIRB 3EC1A 4M1OA 3FDIA 3E70C 5D3MB 2BM1A 4W5HA 2NPIA 2GCOB 2J45A 2PBRA 1NL3A 1I4LD 4JVLA 1OJLA 1P9NA 1L7VC 3GFTA 4I99A 1IXZA 4HATA 2BBOA 2QM7A 2WBLC 3TUZC 3ICQB 4E22A 3EPJA 4PQYA 1SVKA 1DG3A 1ESNA 4Q4AA 1KK2A 2VP6A 5FUXA 4JIMA 4B3DA 1CULC 2FZ4A 2QSZA 5FBRB 2V3CC 1N6OA 1E1RD 2ZUDA 4M22A 2FOLA 4DIDA 2GCNA 3KXLA 1GKUB 1NJGA 3ASYA 4DVGA 4KYIB 1G291 4V0ME 1DAGA 1TUEA 3B6EA 3LLUA 4O2RA 2IYZA 3AM1A 4JT2A 4Z1MA 5JHHB 1WRBA 2BDTA 1E9CA 2IL1A 2Q3HA 3NXSA 4QG7A 2VIIA 4L5BA 4EJSB 2PMDA 3FWYA 3I3SR 4RD3A 3GJ5A 4WZ6A 2PMKA 4O0MA 3W5JA 4DCUA 1MT0A 3EG5A 3ONWA 4OL0A 4G01B 1IN5A 2R2AA 2OCPA 4G5GA 4Q7JB 1K5GA 5DI3A 1MRSA 3LWNA 5KOYA 4WA7A 4HUTA 4DB4A 4A82A 1TEXA 2CNWD 1XTRA 3PITA 3DM5A 4Q1FA 3RYTC 4URZR 3W6NA 4C0HA 2O8FB 4AWXA 2BIFA 2EFGA 2GVZC 2HUPA 3CX8A 5EE3A 2IS6A 3KUDA 1G8YA 4RD4A 1ZM7A 2BM0A 2WAYA 2FFBA 4FMDB 4NBSA 1VMAA 1XBTA 2CK3D 4NCNA 3H4MA 4BZQA 2QAGA 2XB4A 5J4KA 1KO7A 1X86B 5FFMA 4JVNA 5EE0A 4ZDJA 2O0JA 2G77B 3LW8A 3EA5A 3MWKA 1JR3D 1R5OA 1AA9A 1FTSA 5CJ2A 2WWYA 2ONJA 4OQNA 4R9UC 2JJ8A 4K46A 1KI2A 2EWVA 5FBWB 5EUMA 5A4JA 4EPTA 2OAQ1 4DLVA 4B76A 3NG1A 1L4UA 1NG1A 1NG9A 4DWJA 1DTSA 4JBWA 3OEHD 3KQHA 4G5QA 2IEYA 2W6JA 2PJZA 4D4JA 1S3SA 5GJWC 3VX4A 2FSHA 3FE2A 4Q48A 3OHMA 3LRPA 2ATXA 4UXHA 2CCKA 2IYTA 1UBEA 1FX0B 3AVOA 5FI1B 2C2HA 2ZRMA 2OXCA 2C03A 1EFHA 3CBQA 4HEJA 1HYQA 2V7QD 3X1WA 1P3JA 2A5DA 4C0BA 3SYLA 2PLFA 2O8EA 4I1SA 5GVSA 1IJFA 2IC5A 3EW9A 1VYUA 2YINC 3FHCB 1D5CA 4XVQA 2IK8A 2ZVQX 4LHYA 1M7BA 1OHHA 3L0OA 4KFSA 3BRWD 2WOOA 2N46A 2FV8A 2EFHB 2NZJA 1ZNZA 2WWIA 2Q0HA 4Q01A 4M0LA 4C3ZA 5L3SB 2WM9B 2GZHA 3IKJA 1KI4A 1PLJA 3QIAA 1JR6A 3BFVA 1UFQA 1IHUA 3QKTA 3GLIB 1XEWY 3J81k 3RHFA 4HLCA 5LD2B 2ASEA 3AF4A 3NH9A 2CBZA 2QMOA 1WXQA 2XEXA 1P60A 4HB2A 3THWB 1F2TB 4FWIB 1IY2A 4V0LA 4KI0A 2B92A 4KVAA 2LKCA 5DYGA 3SEAA 1AS2A 1J8MF 4G5OA 3RANA 4A0FA 3T06B 2IXGA 4CRWB 3PG5A 1OIVA 2OCBA 2VP9A 3IO3A 2C96A 3BJIC 4BPBA 4QXAA 1KK0A 1OFHA 1Z3IX 3R9WA 2NO7A 2J59A 1COWA 1DAIA 4JLVA 5B58C 4IDQA 1IN6A 2IEZA 4RY2A 3VR1A 4XTRA 2XB2A 1Q12A 5EZ6B 2IF2A 2XJ4A 4IFEA 4EPWA 1LVGA 1E32A 3ND9A 3T5GA 2FPLA 5K8LA 2CEAA 1OE0A 4LGMA 4CIDA 1IN8A 4EQ6A 4UXIA 3EA0A 2J87A 4NYJR 2HCJB 5FL7A 1IXRC 3Q5EA 1SZPA 4CEHA 1XTQA 2FSGA 1UBGA 2EWWA 2I4IA 1CP2A 5K8IA 1Z6XA 3LXXA 4MYCA 5H70A 2GXAA 5GJCA 1U8AA 1BYUA 1SVWA 4EPVA 4BLRA 3X1XA 4NCJA 2B7CA 1DO0A 4FCWA 4PTLA 3BWDD 1E6CA 1D9XA 1P2SA 4TMKA 4EFNA 3NBYC 5EE5B 1Q20A 1UPTA 5EE1A 3SI7A 3GJ7A 3FVQA 1Z06A 4LHXA 5FR2A 3L0SA 1NN0A 1XZPA 2VP0A 2RGNA 2W83A 4UNPA 1ZBDA 5AJXA 4B74A 1IY0A 1J7KA 1TTTA 4UNNA 3CX6A 3QPVA 3A1SA 1MO4A 5M04A 1E2DA 1SXJA 3C7KA 2ZRJA 4PHFA 2XOKD 4CVNA 3EWSA 1Q57A 1G3MA 3VAAA 2QEQA 1E2KA 2PZFA 3BFKA 2YC2C 5FUYA 1LS6A 3ZDQA 1XU4A 1GVNB 2JLWA 4BFXA 1T8TA 1ZUNB 3HU2A 3F0TA 2GCPA 4AG6A 4D0GA 5H8WA 1ZVQA 4L8GA 3OF5A 1E69A 2IS1A 1W5SA 5KNBA 1HEIA 1W4BA 5JBQA 2JLSA 3M4YA 3A1TA 4M53A 1N5LA 4DT1A 2X2EA 3I4LA 4TT3A 1ZD9A 3CW2A 4DLYA 2K5UA 3AEZA 2ZE8A 3A37A 1IY1A 4Q19A 2IWRA 1W4RA 4GZLA 2JASA 4P4SB 1ZRHA 3HU1A 3B1ZA 4Q9LA 2J41A 3B1VA 5AJYA 2QORA 3ZQ6A 3OEED 2F1IA 3ZH9B 1DEKA 5IF9A 2QI9C 2YOFA 4JJZA 4TTPA 5C18A 5CITA 4LYJA 1F5NA 4D25A 4LC0A 3E2IA 3KXIA 3CH5A 3U44B 3TJZA 4JYCA 2JLXA 3TW8B 3RSOA 2A5YB 1NBMD 4URYR 3FPAA 2DHRA 3DZ8A 3P1JA 4QM7A 1EWRA 1E2QA 3B7GA 1G8PA 3CF2A 2EYUA 4D4LA 1OT3A 4F4CA 1EX7A 5CB6A 3O8BA 4BUJA 4ZKEA 1JXOA 2WWGA 4MITA 3K09C 1EFRD 5DN6D 2WMNB 4TLBA 2ZR0A 2GAAA 3ZD7A 2YNMA 4XTCS 1P62B 4CGZA 3DO6A 3CRRA 4DDUA 4TYNA 2ANCA 2B7BA 3GEHA 1QBKC 3C41J 4BEJA 2ZJ2A 1KK1A 1JI0A 1NIPA 2C5LA 3GLHE 5HR5A 5F2EA 2N42A 1P75A 1UKEA 3LLMA 4GNKA 1CF4A 3DKVA 2CJWA 1W4AA 4GOJA 3WMEA 2ZEJA 3FOZA 3ADKA 4OK5A 4URVR 3FYHA 3THXB 2HCBA 1RFLA 2HDNB 1RJ9A 5JCPA 1E94E 1KO5A 3CWQA 3ASZA 1LS1A 1FPMA 2A2ZA 4DXAA 4WIAA 3CPEA 1X1RA 1Z08A 4PC1A 2J7KA 4GRAA 1H8HA 3KKNA 4ZIRA 1YRBA 2JEOA 2WZQA 2C77A 3UG7A 2I3BA 1GILA 1OYWA 4P31A 2Q3MA 3TQFA 1GAJA 3NBZC 5D3MA 3VR3A 4HLUC 2GCOA 2JJ1A 3LDAA 1QG4A 2O0KA 3OIUA 1N5JA 1PZNA 2JAQA 4QNRA 2RGAA 3UIEA 4DBLC 3U3OA 3U6KA 1P9WA 1AZSC 4IOMA 1CR4A 1T3HA 4WZBE 2DFNA 4Q1AA 2MSEB 4DCVA 2HJGA 3T1TA 1EWQA 3MD0A 4V02A 2P2LA 4B3GA 1NI3A 4GDFA 3R9IA 3FHOA 4IHQA 2JJ2A 4D0NA 1W0JD 1G7SA 2ECKA 3CRW1 4GMXA 1BOFA 2BOVA 2BKUA 1S96A 1OFUX 1CJKC 5AUNB 4IFBA 1A82A 4B6EA 2WMOB 4QHYA 3BIFA 2ZI6A 2QY9A 4W5WA 4EJSA 5KPDA 4Z8YA 2NGRA 2GBLA 2OFWA 5KPJA 1RRFA 4LJ5A 4WBSA 2VL7A 2QM8A 4YQFA 3QKUA 1T9HA 2ZJOA 1GL6A 4J0QA 3A58B 5L8VA 1ZINA 4M9QA 1JAHA 3W9YA 2JLZA 1KO1A 2O8FA 1T0JB 1YZKA 2JDIA 3NIBA 4LYFA 4ZCMA 5JSZA 1XPRA 3ZVRA 1UJ2A 3AVYA 2GETA 3M1IA 1GRNA 5EP1A 4XJXA 1GM5A 1FNNA 5DIFA 4Q4JB 2E1RA 4D2IA 1UF9A 3TW4A 1Z0IA 2J7PA 2C9OA 4C0LA 2FZLA 2ZPTX 3K9NA 3PVSA 1BYIA 5CM9C 5CYOA 4Z1MD 1M6NA 1JAIA 2BEKA 4TYWA 1XXHB 4JLDA 3NEJA 3B60A 2OILA 1A4RA 2CE7A 2OUKA 2GZAA 4OQMA 2OFOA 3T12A 1GG2A 3CZPA 3EWAA 5CJPA 3K1JA 4IOKA 4OHYA 1LB1B 4EFLA 3U4QB 1H65A 4LBWA 1XJQA 1ZAKA 2ZRAA 2ZS7A 2G88A 3HPRA 5ELXA 1NSFA 1I2MA 5SZKB 3WP0A 4WW0A 4EPYA 1FX0A 3HU3A 5HZKA 1NBME 1Z0FA 1IN7A 2QAGC 1X3SA 3QXCA 3LO5A 4IRUB 4YMTA 5L3RA 5GVRA 2RKOA 1RIFA 1R8SA 2X1VA 2W00A 2VO1A 4C0JA 5KYKA 3LX8A 2GJKA 2IYSA 3K70B 4RD6A 2R6FA 3KDSE 2VSFA 1DADA 2ZYUX 3SJZA 4U00A 2F1JA 621PA 2BJVA 3B82A 4R98A 1LY1A 5IRCD 5L3SA 3GJ8A 3DM9B 4IVQA 1YZQA 2ZRGA 2B6HA 4MGZR 3LXRA 4NHOA 4YMVA 1HH4A 1NVWQ 2QMHA 3MMPA 3QG1A 2N1BA 5DI9A 5JJLA 1GL9B 3CUEF 1M34E 1WB9A 1Z47A 5IHPA 5LDDC 3IEUA 2J0UB 3THWA 2ZI9A 3W34A 1ZU5A 2XXAB 3IGFA 4UJ3A 1UAAA 2Z4RA 2IXFA 2QROA 3L8YA 3C16C 3N2IA 2PT7A 5J4LA 3EZ9A 4DIEA 4I81A 1JECA 5K8UA 3BXZA 1TEVA 5A0FA 4LOAA 4W5JA 3CWZA 1OHHD 3IHWA 1KI8A 4TMXA 1N6IA 1S1MA 3CONA 3EZ7A 1X6VA 3K8YA 4AKHA 1A7JA 2IYQA 1JNYA 1KNQA 4JT4A 3THYB 4ASUA 1YZGA 2V54A 4XVUA 3EX7C 1KJZA 1OH7A 4QGGA 3I8SA 5KSYA 1KDPA 2IBMA 4EQ6B 2RGBA 4NDZA 4BFUA 1D2EA 3AKDA 2C8VA 1EFTA 1UDWA 2ZSFA 3R20A 3KJHA 4JL6A 4Z54A 1E1QA 2F7SA 2G83A 4CEHB 2BBSA 1QHYA 4XSGA 3AGPA 4LHVA 3RWOA 1R4AA 3REGA 4DLWA 3VR2A 4B34A 3ADCA 1NN5A 5UKDA 3KX2A 2JGNA 3QKRB 3I61A 5KNCA 3Q8XB 1COWD 2EYQA 4AKEA 2D7CA 4P33A 3GPLA 5SZJA 4RFSB 3ECCA 1KSHA 4TQ9A 1YVDA 3REFA 3MSXA 2OBNA 3SHFA 5FTNA 5C4MA 2ZYVX 2VSXA 1TMKA 4C0SA 2JLYA 4RZ2A 4OK3A 4OQLA 2JATA 1E99A 3TH5A 4Q7LA 3OFNA 1Z07A 4RFVA 5HZHA 1N6KA 5BW8A 1ZC3A 4KJZA 2LKDA 3GJ3A 4ILEA 5FPTA 4TLDA 3ZGXA 3L8ZA 4QKQA 2VHCA 4KITB 4QJ3A 5FL7D 2CMKA 1G18A 5SZIA 3ZD6A 2F55A 1NY6A 1P5ZB 4JSTA 4LV6A 3FHTA 3QG5A 3WHKA 3KQUA 1U98A 2YOGA 4P4UA 2IX3A 1ZM9A 1NNEA 4HUQB 1IBRA 1ZCAA 3CNOA 1W49A 5CDFA 2AHOA 3SN6A 1CEEA 2WWFA 4RKFA 1Z0JA 4JLKA 4HZUA 2DWQA 3U61B 1E9FA 2HXYA 4B2IA 2QRNA 2I1QA 2F6RA 2DB3A 3EPLA 2RGNC 4PX9A 3U3MA 2P6UA 1M7GA 4B6FA 3JZAA 1KSJA 4HAUA 2MSDB 1F3OA 3QXJA 2G1KA 1OB2A 4JLOA 3AF1A 1NKSA 2ZRDA 1KTVA 1SXJD 2O52A 3RS3A 5F3WB 3TKLA 1Z6YA 1SXJC 1FMLA 1JXMA 2GF0A 4JS0A 2GF9A 2NTYC 5C1BA 4BFWA 4DUGD 2NMVA 2VSOA 1NP6A 2WOJA 1GTVA 3SS8A 5C2JB 4KU4A 2WIBA 1XNJA 2QBYB 1QRAA 3AGQA 4MKHA 4TYPA 3PEVA 4BZXA 1O3YA 1W36D 4HB3A 3BD9A 4C7OB 1W36C 4Q03A 3K9LA 3B2EA 3N70A 5A5GA 3F8TA 1N6HA 4TT3D 2HYDA 4IJMA 3P20A 2DYKA 5BXQC 4Q9IA 2FGJA 3PEYA 4N0EA 3ZS9A 4DC9A 4Q9KA 2GZDA 1GKYA 2QRZA 1XTJA 2ZJ5A 4NZYA 1XJ0A 1SULA 3IPYA 3OIWA 3D6TB 1GSIA 5L3VA 1FQKA 2AX4A 5EQTA 1X8LA 4LX0A 1JB1A 5EZ5A 1YR6A 4U7DA 4B32A 2GEDA 3BB1A 5FBLB 4GP6A 4Y0AA 1E3MA 4H1VA 4BRWA 2ORVA 2J46A 4KBGA 4AI6A 2D06A 2DY1A 1D6JA 4AY2A 2O8DB 2Q9CA 3DMDA 5JZVA 2RGEA 5LPNA 1KAOA 2PEYA 5L3QA 3KB1A 1KO8A 5E95A 1WCV1 1FQJA 2ZM5A 4LJ6A 2UVQA 4DCTA 4FWTA 1IJEA 1R6BX 3K0CA 3QQ5A 3THXA 3CRQA 1CR0A 2ZI5A 1OH5A 2IUSA 1PUJA 2H8KA 4G0NA 3W5IA 3BS4A 1N0WA 1YJ5A 2WSSA 2VP5A 5DE3A 2NG1A 2V1UA 4MKGA 1E9SA 1XCPA 4MUAA 4HAVA 4PO8A 3BOSA 1SQ5A 3PENA 1ZM2A 3MFYA 3KFVA 2PCLA 3X2SA 3A8TA 1S2MA 5EJEA 4LJ4A 3IBGA 3WBKA 1NF3A 4LWZA 5DLQC 1E2LA 2IA5A 1WQ1R 1W7AA 4C2TA 5JWOA 3O8CA 2P3SA 3OIYA 1UKVY 1AM4D 4BWYA 2OCAA 1RRCA 2PJRA 1AS3A 1H8HD 3LY5A 3RVBA 1HE8B 2CLDX 1E2GA 1KDRA 1E2JA 3IIJA 5LBIA 2GK7A 4B73A 1G20E 1UEJA 5IT5A 4BECA 4A4DA 2JJ1D 2IYYA 3CLVA 2X2FA 1IQPA 1OV4A 2FFQA 4RD2A 2PEZA 2DBYA 2RGDA 1KI6A 1ESMA 4UJ5A 2ONKA 5JSZB 1AGPA 2GXUA 2ZRKA 2WJGA 1OPXA 1VECA 5HPYB 5KDLA 2RCNA 2G3YA 4ACBA 3PEWA 4Q4HA 2OM2A 2IS4A 2OZEA 4A2PA 3OAAA 2ZANA 2H18A 5G40A 4MRRA 2JJ2D 4PO9A 3A4MA 1MO5A 4Q4JA 1A2BA 2ZJZA 1T4GA 2MMGA 4KODA 1ZD8A 1G19A 2QT1A 5JLJA 5DH9A 4RSGA 1XXHA 2W0MA 2HT1A 3QBVA 3GJ6A 1KIMA 3GEIA 4QFMA 3IUYA 4RZXA 1XMIA 4EJSC 1Q21A 2QPAA 1Q3TA 2GBLC 4BFTA 2WKPA 1OB5A 3SYNA 4B71A 1E9AA 3U4QA 2IF0A 1VCNA 3T34A 2FGKA 2ZRHA 4QRHA 4AC9A 4HB4A 4FD2A 4Q5IA 3KXKA 2IYXA 1L2TA 2QU8A 3MJRA 5KUTA 4LY6A 4GT1A 3A1WA 1KSFX 1N5IA 5DNYB 3QUSA 5FTMA 2A7QA 4ESVA 2EU8A 2J7PD 3QEJA 4US2R 1QHNA 4A8JA 2NO6A 1XTSA 1DVRA 4ACAA 3GLHB 1M74A 2V8OA 3IILA 4TL7A 2V9PA 2BHRA 2O8CB 4LHZA 3AKYA 1BS1A 5JJKA 3TE6A 1VHLA 1ZYUA 4B35A 4L4UA 4NH0A 3CR7A 3S1AA 2O8BA 2V6JA 3P4XA 3B1XA 4OYHA 4V0KA 4OBEA 1SVMA 4BFSA 3F3YA 4D4MA 3ZVNA 1KO4A 1G8HA 1CXZA 1W5TA 2FPMA 2J0UA 3R7WB 4KBFA 2XXAA 1G6OA 2JCSA 4TQUS 1OXVA 1KZ7B 1G8FA 5EP4A 3TGPA 4HLDA 3BH7A 3U3RA 4PC3A 3K0FB 1M8PA 1ZUHA 2WJHA 5H1YA 2NO0A 1YHNA 1OIWA 1YRAA 4O2LA 4PHGA 3R8CA 3RRNA 5CLQA 3EARA 3UPUA 3FKQA 4PSAA 2GXQA 2LWIA 4ERNA 4UKDA 1XEWX 2FJUA 4K81B 1CTQA 3VMFA 1NLYA 4GBMA 4B2LA 4CDGA 3THYA 1P7CA 2VTKA 1P2VA 1YZLA 2IYRA 4QC2A 1G7TA 2VBCA 1K6MA 3EIQA 5DO9A 4DLSA 3TSOA 3RWMB 4OI0A 2HXSA 1CRQA 1SHZA 1G17A 2UZIR 3OZXA 4Y0VA 2Q9AA 5LD2C 4V0MA 3PFIA 4DEXA 3CPJB 3KJIA 5AJVB 3GLFE 3V4FA 3GEEA 1D9ZA 3CNLA 4H1UA 3SBDA 1VPLA 2NQ2C 4ZDWA 3PCRB 5JS7A 1J2JA 1XX6A 3BK7A 3MUFA 2XJ9A 4PPNA 1MO6A 3QKRA 3NH6A 2ZQ5A 2OV2A 1OSNA 4DCNA 1N0VC 2ZE7A 1G4AE 4LPKA 4CEIA 4RFSA 3WNBA 4LSGA 1E96A 1AQUA 1OFTA 2IW3A 2VPPA 4O25A 4B3FX 2WJJA 3AUXA 4JLBA 2QMUA 3QNUA 4FCTA 2AN9A 2CXXA 2WWWA 4JL5A 1JQLB 5TARA 4KCGA 4XWOA 2V4ZA 3TLXA 1D2NA 4XWAA 1NN1A 4LJAA 2B8TA 1KI9A 3K9HA 1I4DD 4TLAA 5FOVA 3RC8A 3Q7QA 1P4SA 4GI7A 2NZ8A 3LQQA 5FUWA 2CDNA 3L0IB 4DKXA 1WBBA 1Q1EA 4B48A 4LPSA 3PJRA 2QG6A 4LK2A 1PUIA 1Y63A 3UMFA 4KSCA 4E5UA 3KJGA 3IQXA 4RZ3A 1Z28A 4HZUB 4IOJA 1XEXB 4PQFA 2G9NA 1JR3E 2VH5R 4QBIA 4QJ4A 3Q85A 4A92A 3SJAA 5CK4A 1HTWA 2CL0X 2ZUBA 4HUQA 4MGKR 5AUOB 3JVUA 2BEJA 3WYGA 1XTIA 4XVRA 3TBKA 3WRXC 4BEBA 1ZNXA 5CLLA 3LD9A 3IPXA 5JHGB 1Q0UA 3G82C 1NLFA 1MR3F 5CK5A 3G0HA 4YDSA 4OQFA 1KI7A 2OCYC 1UBFA 3OFND 3KTAB 4JSYA 1QHGA 2WKQA 4M9ZA 3NBXX 4QHSA 2REOA 1S1CA 2PX3A 3EC2A 2CE2X 3I32A 4LYAA 4Q66C 2R8RA 2F1HA 2IUTA 3C5HA 5JWHA 4NYMR 3G5UA 4IVRA 2XNSA 3UWKA 3C4JA 1NVVQ 3B9QA 3H86A 1A5TA 1TQ4A 3LVRE 2YC4C 1WBDA 2QBYA 3K0AB 3NBFA 1G1MA 2NIPA 1P2TA 4DRZA 5CYPA 1NMZA 4C7OA 2G1JA 2RHDA 1T5IA 3AP3A 3IO5A 5KSPA 4R7ZA 2C78A 4AG5A 4M1TA 4EAQA 3KQKA 3TSZA 5GJBA 4ZDKA 3MLEA 2JLVA 2ZRFA 4URUR 4F4IA 3A6PC 2XTNA 4UQOA 1K5DA 1HT1E 4OHVA 4UNSA 3CF0A 2VP4A 4Q1EA 1YR7A 4DB2A 1KYIA 4MYTA 2QGZA 4C0QC 3LBNA 1KDOA 2ZYWX 3FB4A 3IBYA 6Q21A 4BLTA 1YU9A 4JYBA 3UK6A 2A30A 1OXXK 3TK1A 1G3QA 1NIJA 5BWMA 4O3MA 1FW6A 2J9RA 2QAJA 2QP9X 4B3CA 3DVLA 3GD7A 1G3RA 3P4YA 4BGDA 1F6BA 5L3QB 4MDEA 2VHTA 1AZTA 2Z43A 3CRVA 1WMSA 2GEVA 3AF2A 2O8DA 2VHQA 3RNLA 3LNCA 2WHXA 1HA3A 1GRQA 4FMDF 2TMKA 4KLZA 4FMCB 1EG7A 3I62A 4YMSA 2ZIAA 5FOTA 3ZIAA 3CIOA 1E2NA 1MV5A 1G7CA 1KJYA 2OLJA 4KFTA 4DZZA 5FI0B 4FMBB 3U7GA 3UKDA 1U0HC 5KNDA 1S8FA 4PPQA 3GLIE 3QXSA 3NWJA 3CF6R 1KAGA 2Z83A 2E87A 4Q00A 2VF8A 421PA 3W90A 3WYAA 3KQLA 1GFIA 1HUQA 3LBIA 3QENA 3QKSA 4L15A 3BGWA 4TLCA 1II0A 2VHUA 3UATA 2P0EA 5KSZA 3NDBB 5BN3A 3WYFA 3WP1B 3TAHA 3H84A 3B1WA 4LC1A 2R62A 1RC8A 5B2ZA 1V5WA 1WP9A 4KV9A 3CR8A 5J4YA 1E9RA 5DGXA 3U3JA 2FDCA 3SQXA 2ZYTX 1PV4A 4M8NE 4AYXA 2RGGA 3DOFA 4F38A 4E07A 2D3WA 2FN4A 2ORIA 2RB4A 5FH9A 4AKIA 4LV5B 4XH9B 3VX3A 2ODWA 1Z6AA 2WSSD 4TTQA 2FMXA 2ZITA 2YZ2A 5G41A 1KI6B 3D3QA 4HI0E 2WV9A 2YJTD 1W48A 3C8UA 3W8NA 2ODNA 4F7WA 4Q4HB 4AK9A 3ZYCA 3GP8A 1N6PA 2F3TA 2GESA 3QOFA 2ZXUA 1PLKA 3HR7A 4PPGA 4GP7A 4N0DA 1S0UA 1OH8A 5BN4A 3W3ZB 1M2OB 5HKKA 1UDXA 3I1FA 1VYVA 2YWGA 3OIVA 2ZI3A 3ND8A 2OXRA 1L8QA 5KU1A 2QT0A 4A1FA 5E7IA 1SKQA 3OE7A 1E4YA 2ZI7A 5J40A 4GOKA 4D6PA 2XX3A 2FE4A 1VDZA 4PC7A 1XF9A 2R6AA 3MAAC 5HTKA 5KSOA 4Q1CA 1QHHB 3RS4A 4FN5A 4B75A 2NOAA 1QDEA 4PXAA 1XFAA 4M1SA 1P72A 4NCKA 3FMOB 4YONB 2KBFA 3C5CA 1ODFA 3X1DA 2F43A 4EIWA 2R65A 4HDCA 4E09A 2PZGA 4L16A 4LRWA 4ZDIA 2XNDA 1VG8A 2KI5A 3NVAA 3AVVA 3VKWA 3OAAD 4C4PA 3WXMA 1R0XA 2ZJ8A 4IDOA 4A8JB 1Z5ZA 3W6OA 5TY0A 4LDJA 1WA5A 3GLGE 1ZW6A 5JRJA 1RE0A 4EPXA 3ZZUA 1P61B 1R7RA 4CW7A 4NCIA 2BWJA 4DLTA 2ODEA 2AD1A 4YDHB 4AYWA 4JL8A 1B0UA 2PT5A 4KFUA 2Z0MA 4YXWA 3B13B 3GLHA 2V1XA 2W6JD 4B44A 3S1AB 3N2EA 2O8BB 4PANA 1E2EA 5F9FA 1N0UA 2O8CA 1LF5A 4KO8A 1TU4A 1KI3A 3KUCA 1E0KA 2ZSDA 3OESA 1JJVA 1QVAA 4RD1A 4XIGS 1B23P 3X1ZA 4DCSA 5HE8A 5FBVB 1R5NA 4N3NA 4M2LA 2CHQA 2GXSA 4IKEA 3R7WA 3VNVA 1OYYA 4LBVA 4MYHA 4TMZA 2GWHA 3PQCA 3MG9A 2PL3A 3K0FA 2XTZA 2J0QA 2D74A 4OHZA 3SU8A 1P2UA 4NYMQ 3LH5A 3K70D 5JJIA 3WY9A 1UEIA 3RS0A 3K70C 2W2VA 2AKYA 4IDNA 1PVOA 3T1OA 4CT4B 4L9WA 5SZHB 4DDVA 4QBHA 2C98A 1KHTA 2AR7A 4X8HA 1E4VA 2R6CA 3KKOA 1TF7A 1YR8A 2AWOA 2AXNA 2BC9A 4TL6A 5JECA 1W46A 5BYJA 4HAXA 1R10A 3VU9B 4B33A 3NDPA 4DJTA 2CCJA 4IXMA 2Z4SA 3I5YA 3DPUA 4QGHA 3K53A 821PA 1TADA 2EVWX 4M1YA 1WE2A 2EFDB 4GFDA 1IXSB 4TMVA 4AIIA 4D26A 3P32A 2IXEA 4B47A 2FPKA 2ERYA 2X77A 2ERXA 3CKLA 4TMTA 4CT5A 4CEIB 1KGDA 3MRSA 1KMHA 4IVPA 2YOHA 4B43A 4A6PA 3ZS8A 2XSZA 3RC3A 1M1YE 1MKYA 3O8RA 3RAPR 1CJMA 1NSTA 1XD8A 5G3ZA 2PZEA 2E9SA 2HJVA 4JLJA 5CM8B 2C9YA 1BIFA 1HQYE 2DFKB 4XSHA 2QP3A 4G1UC 4QGFA 3KFXA 3I8XA 5KHOC 3GFPA 1JEDA 4V0NA 1JJ7A 4BFYA 3TNFA 4ZCLA 1D8TA 2YWFA 4HAWA 1J8YF 4MYUA 1G5TA 3PR1A 4KXFB 1UKYA 3PUWA 4OJQA 4BLQA 3I72A 1XEXA 5FUVA 5JI2E 1P73A 5J4VA 3BAFA 4QNMA 3ADBA 1YE8A 1S4QA 3BERA 2ZAMA 3QE0A 4DSTA 1CJVC 4XWKA 2B21A 3ZZ0A 2WICA 1NJFA 3HPQA 1G3UA 4NMMA 1DE0A 1E2IA 2QQ0A 1NBMA 4RVCA 3TIFA 2YV5A 1WGWA 1G41A 3KTAA 4JKYA 2QE7A 4BLPA 3TUIC 4PC2A 1DOAA 1KMQA 4A15A 4US1R 4FMCF 3FMPB 3C14C 4P3YA 3BBPA 2WSMA 1FFHA 1CIPA 2NO9A 1RYFA 1DG1G 4ZI2A 4D4KA 4DSOA 1U0LA 2FFHA 2ANBA 2WJIA 3AVUA 1JQJC 1QHXA 3MCAA 4GMDA 2LCFA 4Q4LA 2ZU6A 1F2UB 5FPHA 3EPKA 2GJ8A 1AGRA 3K0AA 3V9PA 2CHGA 5TV2A 1BMFA 4Q7MB 1U90A 1SKYE 2BKEA 1AQYA 3RDPA 1YKSA 1NMXA 2QPOA 4KAXA 1T6NA 2XTMA 3AQ4A 2REBA 2OBLA 3EPHA 4XOIA 3SJBA 3CM0A 1G8GA 1YZUA 4A0HA 1KJWA 1XEFA 4LYHA 2IS2A 1DAHA 4LCBA 5H68A 3SZRA 4OI2A 4U02A 1XMVA 1OIXA 1XD2B 1Z8FA 1E0JA 1Z0DA 2KB0A 2QGNA 3FGNA 4L9SA 4A0GA 4URXR 1CLUA 1ZIOA 3MWJA 1Q3HA 221PA 1II9A 4OI4A 2ZR7A 1ETUA 2BBWA 1JPNA 1Z2CA 2SHKA 3FMIA 3U2QA 2VA8A 4BFZA 5JMTA 4MH0R 4DSUA 2HLDA 4OK6A 4LBYA 3GLFB 1Y3AA 1XCGB 3SDZA 1G21E 3ICEA 3GMTA 2QTVB 2IYVA 4M21A 4YC7A 4AD8A 5FOXA 1L4YA 1SVOA 4V0OA 1E9DA 2ZJYA 4Q9HA 4F92B 2GILA 5HE9A 3O8DA 2IWHA 5LB4A 2GJSA 1EESA 1IM2A
chains in the Genus database with same CATH superfamily
1OBHA 1DOZA 2FVXA 3FH0A 2FJ0A 2W98A 1W52X 4CLHA 5KYUA 2ZUTA 4IARA 2IPOA 1YWGO 3STUA 1U9IA 1YD7A 1I3LA 1YB2A 3FWZA 3QVVA 4WKOA 4KJXA 3AQIA 3KZXA 2RJ3A 3OX4A 4WLVA 3BWCA 3REOA 3NAMA 1Z3CA 4GF5A 3C3YA 4OIRF 5KNDD 1B1AA 5E7JA 1HY3A 5EUBA 1K8RA 3SC6A 2ZSAA 4I9UA 2UYQA 4EKIA 3A36A 1YRQA 4ZAYA 1KMCA 1VXOA 2OFXA 4LDAA 1NUPA 4MRPA 2QJFA 1M1UA 3X1YA 1ZN7A 2B8JA 2A9KA 1MB9A 2HL6A 4G5YA 2PUTA 2R68A 4EVSA 3A1DA 2LVBA 2QX4A 3GGCA 2DUWA 2VA9A 5CU7A 1VCIA 1Q0GA 1FDRA 1NJ6A 2MYUA 3AHJA 3ZU4A 3SE0A 3S2GA 3MFNA 4LJYA 3L6OO 5CLFA 2JARA 1RI4A 4MICA 1TJ5A 3IXMA 1VTKA 1G6KA 3WYDA 1OXTA 1WDWB 3KKPA 2EJVA 2V65A 4XSVA 4AQDA 4EMBA 4DCPA 4FKBA 1ZOLA 2ZOSA 1NONA 1Q22A 2EJUA 1B4DA 1KYVA 2B0HA 1Z36A 3GT0A 3G59A 4LJ7A 2H9AA 2W48A 1W1IA 1IPHA 5EHIA 3NWBA 1IC6A 4JB8A 2D5BA 4TWZA 5CLHA 4M9RA 1O2DA 3HLTA 4O3FA 2ZKIA 4NMLA 2CYAA 1N6NA 5CJJA 2IUUA 4KDFA 1E1QD 1ZRSA 2JFXA 4N7BA 1L5NA 5H5JA 3RTAA 2XUPA 3M1LA 3C3XA 3TECE 3SC3A 1HE9A 2XSZD 1R37A 4H7PA 1DHRA 3QJYA 2A1TS 4YY3B 4RVHA 1H8EA 3W9BA 4U2EA 4A0RA 4B83A 1LNZA 5DNDA 4BQIA 1TB4A 4K0KB 2H57A 2YMLA 1IN1A 1XJWA 2NU7B 4P6VF 2RGRA 2G70A 3TJRA 3MYIA 5IVDA 4G0ZA 1LTQA 2GEUA 3VU1A 5AQ1A 4M3NA 5JOQA 4MQLA 4FB4A 2PUHA 2XT0A 5I7OA 1M83A 3AFHA 1G5ZA 2GPYA 4W5OA 3BWEA 3IAHA 1II8B 2J0EA 3IJPA 4KQHA 2V74B 3PQDA 2GN9A 2CXRA 3G0GA 2WA1A 1K63A 3CPHA 4Y6RA 4FYKA 1QIMA 4PBSA 3VC7A 3W6UA 4W8HA 3ESCA 1XVUA 4UHJA 3NHBA 1N2XA 2Q21A 3EE6A 1UJNA 4BQFA 5J5AA 3CX7A 1H2YA 4EDHA 1UADA 3MTJA 4C0AC 2I7DA 3ZI4A 4G2NA 3SY8A 1KYXA 3ZU5A 1AZLA 1RP7A 1HQCA 5DI3B 3KOOA 3OOEA 1SQFA 3ZDBA 2PLRA 4DR1B 4L50A 2IRWA 3POVA 2JJYA 3PX7A 2GBFA 2GDCA 4AZWA 4K0RA 4ZZ2A 3LUKA 4X8OA 2WWHA 1WPRA 5EUQB 4AUNA 3MB5A 2WKRA 4HBZA 1D5WA 2JIZD 5BP7A 3WWOA 3PRKE 4QDJA 1JEOA 2X13A 1XV5A 4FWBA 2C0CA 4LZJA 4MA4A 1TUIA 1U0SY 2H16A 4DG5A 3SZGA 4JJKA 2P9GA 4NMXB 1UANA 3A4LA 1T3TA 3NR2A 2XE4A 3AM4A 4IH1A 4KMOA 4Z9BA 2HA6A 3AB7A 1PSDA 1GSOA 5L95A 1NFRA 3QF7A 2BC5A 3NAGA 1ND5A 4LCJA 1Q92A 3JQDA 4G7OF 2GLXA 3V4PB 3I04M 3VPFA 4BAUA 3RRYA 1W75A 1MCZA 3C8GA 3IBCA 2Q2WA 3VO2A 1HMOA 3LC7O 3OF3A 3DUFA 3I01M 3FF1A 2W6OA 4GOXA 3V4OA 3TGWA 3TTUA 1OGJA 1UM8A 2J8WA 2F67A 4H7IA 1OLOA 3EZFA 2BGWA 1KMIY 3EJ6A 4CS8C 4S35A 2QZZA 1D2RA 3W6PA 2WDPA 5HZGA 1I10A 3UAWA 2QVXX 1U2RA 1QHSA 1KARA 4ED9A 4MPRA 2O59A 3LS2A 2AJ8A 3OX3A 1GPMA 4JROA 5IZCA 2BM8A 1W2WA 5FFNA 5IK2D 1XZGA 2ESRA 3H9CA 4Y2TA 5A9TA 3HTXA 1WQ3A 1FMJA 3H9BA 1GL7A 3EH2A 2E6KA 1R0ZA 3FWNA 4IDHA 5AHKA 3W8RA 3MTAA 1P7VA 2Q62A 1EFRA 2XGJA 1D2HA 5A4FS 1QPGA 1NBOA 4MW1A 3OX2A 3A6ZA 1E8MA 1TU0A 3SFZA 3UGJA 1QIGA 1U6JA 4QPCA 4QGSA 2OYSA 9LDTA 5JAUA 1Z4PX 3QBTA 4QQKA 3LPLA 4ARZA 3PHLA 5IN4A 5FPKA 5H3LA 1T2UA 3QY0A 2XRFA 5A5VA 1ICIA 1IXKA 1XRNA 3N0TA 1BE0A 1U7HA 3N0XA 1RM5A 1ZGZA 5A02A 4JMLA 1N5KA 1RADA 4R69A 3LW7A 1GOTA 4BNFA 9GPBA 2Z5FA 2R3SA 3K0SA 5E8RA 3QPUA 4S04A 4R7TA 4RTRA 4G67A 2R7SA 5D3MB 2YVLA 4XWJA 3NDRA 2R05A 4JVLA 1NL3A 4ZVOA 1ENZA 3TUZC 1Z5OA 1SVKA 4G0XA 4B3DA 2QSZA 4FGLA 3LEVA 3Q1LA 4BFLA 1T6XA 2V3CC 1NW4A 4XX0A 3ETCA 1Y6QA 4V0ME 3H4VA 3SDSA 4YH1A 4G01B 2R2AA 2Z6AA 2EKLA 2RHLA 4RO0A 4AMBA 1QRUA 1MQSA 2Y1OA 4AWXA 3ZUPA 2A9JA 2FFBA 5J4KA 1P8AA 5KTSA 3MWKA 4FYXA 3IHTA 1RAEA 3ER6A 1ISHA 5FBWB 4B7ZA 1QWOA 5LDGA 1XHEA 3NG1A 1NG9A 2VC2B 3H9EO 3HSYA 3L8FA 2O6LA 2IEYA 2W8BB 5C3UA 3AILA 2CCKA 4UPDA 1E6KA 2C03A 1XDUA 3CBQA 4Y98A 2PLFA 1F38A 4OHOA 4TV8B 4R1OA 2FV8A 4X24A 3TNJA 2WM9B 1JR6A 4MW5A 2TYSB 1A7EA 4R05A 1J56A 2IYPA 3RHFA 3D3JA 3HBAA 1MORA 3AG2C 4OQ4A 4IMJB 3W2TA 2GS9A 1RXVA 3DEIA 2J5KA 7AT1A 4U6QA 2NO5A 3KHKA 5COFA 2MT9A 3T9FA 3MRXA 4RK1A 3FJOA 4KC0A 2J31A 2FPLA 3MINA 1YK1A 1NUTA 4HNVA 3RV4A 3CF4A 3NU1A 3JPWA 2GRUA 3A9WA 2P30A 4ANFA 4BLRA 1MENA 1D9XA 2C58A 1XTPA 3SI7A 1BCSB 5JLAA 2AOTA 3VVMA 5B1DA 3OSUA 4ZT7A 2SCUA 1OW7A 2AEJA 3U8PA 1V6AA 4K6HA 1TA9A 3W4YA 4HFMA 2EP5A 3DZJA 4JHXA 2JLWA 1X70A 5GM2A 4D0GA 1E69A 4A8HA 1PFUA 4M60A 4AX2A 3I4LA 1NXXA 4H60A 1W4RA 4RPLA 3HG7A 3GUVA 5LNK6 4TTPA 5BMVB 3E2IA 4OGKA 3KXIA 3IDOA 3RSOA 4QM7A 1M2HA 2AJCA 1RM4A 1A2QA 5CGZA 2BR4A 5JSLA 3F47A 4E6EA 3WGZA 4CGZA 2FR1A 4H15A 2HK6A 1T4CB 3G2IA 1QP0A 5HR5A 5F2EA 4BMVA 2X8JB 5EXDA 4B4UA 4DXAA 3W1EA 4PC1A 4PFQA 3FLAA 1EYZA 3E48A 3H4IA 4WINA 3H6GA 2R7WA 2G82A 2AVNA 3SXPA 3WQBA 3WHPA 2JGKA 3RF6A 1HW2A 3NO4A 3MMXA 1GQRA 1U6KA 1I6KA 4D46A 2ECKA 3O84A 1BOFA 2O2JA 1LLDA 4GECA 2VBGA 1A82A 3KALA 3IBTA 4WXYB 3RF3A 4H0CA 2VTDA 5KPJA 2AMFA 2DTXA 1FDSA 2CJPA 4BTEA 4QD3A 1BDHA 1WSBA 5GP1A 4RVDA 1UJ2A 4JELA 3AVYA 3NFRA 1NU9C 1QRTA 5MHTA 1I2AA 2J7PA 4UHEA 1RLTA 4N8EA 2O2IA 5AM4A 3QVWA 1RAFA 1NQTA 1C1DB 2R25A 4A8TA 1JAYA 4DIBA 3R5FA 4ZI5A 4BKPA 1A9YA 2AFIA 3T12A 3K1JA 4OHYA 1IOLA 2FDRA 2O2GA 5DCYA 3R7AA 4FJ0A 4LRSB 3U4HA 3KAJA 2P35A 1FX0A 4F7DA 1PT9A 3LO5A 2RKOA 3RRJA 4MUMA 4DDKA 2IYSA 4OHFA 3TG2A 5L3SA 1I1QB 4MGZR 3T9BA 1MLDA 1DRWA 1ZU5A 3GLUA 4LCEA 2VNHA 2QUHA 4K9KA 4Z0PA 4CCAA 3NOXA 3BXZA 4KVFA 3M6VA 1KI8A 3L7CA 1A7JA 3UZUA 1MVLA 2O9XA 3TZEA 4BB9A 5BMOA 2RHBA 3HQ4O 4BFUA 1A7AA 3BTOA 3AGPA 5IN5A 3REQB 1AMOA 3GI1A 3ESAA 4KQJA 2Y99A 2XVYA 5KNCA 3DVSX 1F2VA 4BJ5C 1KSHA 3BFPA 1RKUA 3WTCA 4QBKA 2Z58A 1QP4A 2IP1A 4IAOA 6NULA 1JR8A 2MINB 4CG0A 3QG5A 1KS2A 3N87A 1KBQA 1S3IA 3G2LA 1TJYA 3NATA 3UHFA 4MP6A 1V7QA 1KTVA 2QUAA 2PKRA 4I4NA 1VE6A 3ZK9A 4LK3A 5HDQA 5HUHA 3EBLA 2YWDA 3BD9A 3CN7A 2Q1SA 2OTCA 4Z7OB 3PCVA 1DEXA 1E8NA 3ROMA 3D7LA 2W2PA 4R40A 3I30X 3B3FA 4Q12A 2B37A 1QRRA 1JE0A 4FZVA 1VJRA 4I19A 5EZ5A 3ZDFA 1X14A 3JS5A 1I6MA 3JQAD 5JZVA 3L4EA 1BVRA 3VYSB 3WL6A 3QQ5A 3THXA 1L9KA 2PR7A 1JWAB 1WWKA 2IUSA 2H8KA 4ZP1A 2NG1A 1E9SA 4WLOA 2FWIA 3PENA 5HMLA 5TS3A 3MTQA 4Y9UA 1RYNA 5JWOA 1FQOA 2D0DA 2OQRA 5FLKA 5BOVA 5KYNA 1OYVA 3D6AA 2YMQA 2R47A 4LAFA 5SY6A 1IK4A 3DA8A 5IT5A 5JV5A 3QZCA 5I6DA 5BSRA 4LYYA 4NAUA 5HUQA 1TVKB 3DMGA 5BN4B 1VECA 5HPYB 3RFVA 3OAAA 2G36A 2G28A 2XCQA 3ZDLA 1ZH4A 3D6NB 5FJIA 1E1DA 3UGKA 3WHIA 4UVHA 5DH9A 2W0MA 5DWVA 5H3CA 2GH1A 4DMCA 3OLWA 3WWYA 2A88A 5KVQA 3RSSA 2VCHA 4NFHA 5DGHA 1YBHA 4KAFA 3MN1A 3LOPA 3ZJ4A 1DVRA 3U7RA 3ITKA 2W6NA 1BS1A 4KX5A 5L9AA 4B35A 2AVDA 2ODTX 4DVYP 2VTEA 4IJUA 1SVMA 3H5NA 3R7WB 4CTMA 3P52A 3G9ZA 4Y6QA 4MVJF 3KD3A 2QRJA 5C37A 1KJQA 2FJUA 4OH7A 4MVOA 4GBMA 4MVJP 3MOGA 1I4OA 3H04A 5K6RA 2X5JO 2ZZNA 4H1UA 1JQKA 2Y3HA 3WR5A 1J2JA 1XX6A 4PPNA 3DVQX 2ONZA 2VHZA 4DCNA 1OSNA 2C0QA 3MRVA 4J0FA 1OZHA 1W30A 3N76A 4HDAA 3O1JC 2Y3DA 2ECOA 2PGDA 3C43A 1SOWA 3Q7GA 3TZKA 1QFJA 4MR9B 4P7KA 4HZUB 2EP8A 2ZUBA 1TO6A 4LY9A 3TBKA 5A04A 4GXNA 2E5WA 3U2MA 4YK5A 3DI5A 3IVAA 3GM1A 4QHSA 2H08A 2QX7A 1OI7A 4LYAA 4K28A 1QX4A 5IKEA 4RH0A 4BYGA 4NC9A 1AF4A 2MDTA 4NOLA 1P2TA 4DRZA 1DNPA 1EP3B 2POCA 3TRDA 3VDNB 3PE6A 2FRDC 2J07A 3ZHYA 4KNYA 5D86A 2J85A 1MOPA 4DMUB 4NAVA 2V9ZA 2BZ0A 1YR2A 4A7PA 4O6YA 3UK6A 2J09A 1G3QA 3R7FA 5BWMA 3D6MA 4MDEA 3S99A 2VHQA 3L6DA 4DMFA 3I62A 4LXQA 3H5WA 5BT9A 1M54A 2J9YB 1OFVA 3PHIA 5DM60 5KNDA 4MDYA 4PLHA 1YL5A 1D1QA 1FDTA 5AKYA 4MAFA 4QJBA 4DHEA 3H84A 3CR8A 4F6RA 1UMKA 2ZYTX 4F38A 4Z2AA 5D01A 2HJ3A 3KCQA 3OFSA 4MP8A 4TTQA 2FMXA 4EHDA 5FO1A 1BHSA 3DV2A 3LUFA 1TK2A 3HR7A 1OH8A 1HG1A 1QO0D 4BTVA 2Z2IA 1B8NA 4BX0A 3OPXA 1AKMA 4E7OA 2W37A 4BDSA 5K1ZA 2HSJA 4KMSA 3AHDA 1XFAA 4BJ6C 4YRGA 1VGVA 1P72A 1C81A 3FHLA 2YYYA 1V1MB 1NWCA 4JCZA 10MHA 3TQTA 5AI6A 5DM1A 2ADOA 4BPRA 1GZ7A 1LTHR 4H18A 5BPFA 4IDOA 3DMHA 5E2QA 4XIJA 1H1LB 2C5FA 3SEOA 5E38A 3J80A 1B68A 1JH8A 4I1RA 2GWRA 5CVUA 1L5VA 2O5RA 2I3GA 3IEKA 2Q28A 4BBJA 5LLSA 4DGSA 2B6NA 5HM8A 1LBEA 4FFRA 1C1XA 4ZAWA 2QTZA 4CHGA 1N3LA 2WVAA 3QE9Y 1QBGA 2JJMA 4L9WA 3VAZA 4KUGA 2C98A 1T0PA 2RFLA 2XHZA 1W85A 2R6CA 4TL6A 2Z4SA 4I1YA 4YP1A 1TADA 3TCKA 2W70A 4CBVA 1X39A 1SVUA 5BNZA 2ERYA 4RWZA 2IDKA 1AV7A 3WWEA 4CLOB 2HH9A 2XSZA 1CJMA 2HJVA 5CHEA 2C9YA 5T3TA 1VHQA 1JSXA 2NVUA 2PT9A 1GPKA 1JEDA 4F8JA 4IIHA 3OT4A 2OHGA 2ZW9A 2QL7A 3CZ6A 3KCNA 3P9XA 4CBEA 3ISJA 2X76A 3ZZ0A 1YMUA 2WD7B 4GI2A 3TIFA 4B3MB 4RJIA 4G4JA 4ZO6A 3D3WB 1KEZA 4EMUA 1KMQA 3CW9A 4FBMA 1Y7LA 1EK6A 5H4HA 4CSAC 2AG1A 4ZI2A 5K0ZA 4J1NA 3EPKA 2GJ8A 5EJAA 4K8RB 4Z3DA 2C4WA 4MW2A 1QC5A 4PRZA 3AQ4A 3ZHBA 3PFWO 3RODA 3DBHA 1RYEA 3R4CA 1G8GA 3LXMA 1YJGA 1JJFA 2DT8A 3TS1A 3ZXXA 1XMVA 1Z8FA 2V3WA 2D3TA 3OA1A 2QTVB 2IYVA 4HNUA 4Q9HA 2GILA 3O8DA 4K5QA 4LBZA 1FJXA 3BQMB 4M55A 3A9VA 3W2GA 2HMVA 3JAWB 4AJLA 2QXYA 2D4UA 1A8SA 5JFGA 1T9AA 2F4NA 5B55A 1Y1PA 3JQFC 1IEQA 2EQBA 3HCPA 1ZGJA 2EPOA 1W1WA 4IGKA 3KTFA 1T1IA 4ZHQF 4Q47A 4PAOA 4X65B 2P5TB 1TNDA 4GC5A 1Q50A 2JIZA 5HUJA 3ZTTA 2OO5C 1MW9X 1F48A 4YRCA 3WLSA 1NT2A 2BCGY 4DNQA 5ED4A 3K1IC 1JX6A 4E03A 4D98A 3R5HA 4NESA 4KGDA 1GP2A 2H51A 1R0YA 3ED5A 4L8VA 3CB4A 3COSA 3WGJA 2JAXA 1H05A 1VI6A 2QUPA 4ZVPA 4AJKA 1E9EA 2PXCA 2G0NA 1PYOA 2A78A 3CR3C 3VZSA 2V7UA 1O6GA 4R2MA 1IMOA 1CQJA 1LRLA 4PPFA 3A1VA 4HO1X 4CF4A 3T1QA 4UTRA 3PMRA 2ZR8A 4XQ9A 1TXGA 3H7AA 521PA 4LJ8A 4EUKB 4PAGA 5AH0A 1LE2A 3VPSA 1URPA 2PMCA 5EXXA 1XRLA 2JI9A 2HI0A 3TR5A 3GH3A 3JV7A 5IK2A 3A0UA 2MWMA 4UW9A 3MJHA 1ZIPA 5FLEX 1E2PA 5JPIA 4BC1A 1HL3A 4L9AA 3LMKA 3K1ZA 4MLZA 5BSTA 3VSAA 4LXYA 1IVNA 1LFDB 4Q3LA 4I66A 4KE6A 4HSEA 3AJDA 4NFLA 1FFGA 1ONOA 4DKJA 1W9HA 1ISSA 1UBOS 2DG2A 1XZFA 2X5KO 4U7FA 1BDJB 3GWNA 4AMVA 3U60B 1NN3A 5IABA 5DHFA 1TE2A 3MCVA 2HA4A 3O91A 3JWHA 3SQMA 1IAQA 4DMMA 1LE4A 3FAJA 5DN9A 2GZRA 1M2VA 4NBTA 5G3YA 5CCDA 4HG2A 3PIDA 4EBBA 1ZC4A 3DBOB 2VEDA 3AU8A 2DWUA 3DCNA 1DSSG 3L06A 1WJGA 4B80A 4E4RA 2XDQA 1FRFS 4YCAA 3DZFA 1Z13A 1U0GA 2A94A 4RHUA 1UPAA 2ZE6A 4OHKA 3AB3A 1JEYA 1ST3A 4I4IA 5IJXA 4OM8A 2B1RA 3CKKA 2JBAB 3FDFA 1YONA 3W4KA 1Z2NX 2PAFA 1MJ5A 3KJEA 5JWRA 1QOZA 4ZREA 1BROA 2GZ2A 3AYZB 1BH6A 4O8CA 1RBMA 1NYLA 2RMKA 1SZCA 5LNK1 4M8IA 1C17M 2Q8PA 4AQYB 4Z9XA 3UHOA 1V54C 2UZ4A 3BZWA 3K1TA 3PRJA 3I09A 1JMWA 1YL6A 2J6CA 3BH0A 3THOA 4RHFA 2VQFB 2XITA 2IHUA 5ALWA 4KIGA 2OCLA 5DF1A 4PZDA 3MGKA 2Y1DA 3PE3A 4C4SA 4L07A 4L3OA 4H4CA 1X94A 3CNBA 5D87A 1RC0A 1X1CA 4C0XA 3QGMA 2DPLA 2IT1A 1XLTC 3A9UA 5TX7A 2DERA 3EQ8A 5EXTA 1Z4NA 2UYHA 4DLAA 1WOLA 1M75A 2ZROA 4IY1A 4H7FA 3FSJX 3J7TA 1J4AA 2NU9A 3MIZA 1Z63A 1DARA 4F2GA 1GXSA 4BFVA 5FFFA 1U7WA 3QEOA 2IP4A 3SQNA 3ND6A 5CCEA 3IC5A 1TZKA 4IP0A 3HBMA 3LU1A 4XJTA 2ZWAA 4RDCA 1AUQA 2ZTSA 4JI1B 3MELA 3DF9A 3VAYA 3AG5A 4OXKA 1CUHA 3NHAA 1VIAA 2X5NA 2QTHA 2H4XA 2D2EA 5EZYA 4CM4A 3FF4A 1HOXA 1DTEA 1XZCA 3PGLA 4TTRA 5HZMA 1D2MA 1XKTA 3WYNA 1PW5A 1UKBA 3QFSA 4BRZA 5JARA 5K8CA 2O07A 1RRPA 1VKJA 4BY9E 1Z0SA 4D9HA 4OYRA 5KX5A 3KQTA 3RRMA 3LHIA 4XJVA 5P21A 3T5BA 3EDRA 1CUDA 3F7TA 1A7KA 4O6MA 5CPFA 1W19A 4FW9A 3RBXA 2G0TA 3INGA 4ER9A 3FM9A 1AN0A 4DQDA 3DTVD 1U0FA 4WKBA 3IEVA 2A0WA 2H52A 4JEBA 1M67A 3P9ZA 4C6RA 3STTA 3U1VA 1RI1A 2W11A 4ZAGA 4EA6A 4FONA 4EATA 5IYZF 1RRKA 3GJZA 2FSIA 5KAPA 1YJ8A 2G6TA 3FA2A 4BIIA 3VJKA 4ZI3A 2WYUA 1RJ9B 1KRHA 3SFTA 4DOMA 4JIGA 3MNFA 3ZU2A 3D1JA 2YYZA 4ZGBA 1L4HA 5JLIA 1OJLA 5JD4A 4C6SA 3D8NA 1BU8A 2H1SA 4GOLD 2PU7A 3SF0A 2HO4A 3PUJA 1VL0A 3U5SA 3HEBA 4WQMA 2C9DA 4YRBA 1EEXB 3AHHA 1T5BA 4RD3A 4P83A 1SF8A 4O0MA 5REQB 2XCRB 4RVGA 1IN5A 4Q7JB 4D6XA 1A9SA 1V1JA 5HQTA 5EE3A 2GVZC 3RIYA 4NCNA 4ARVA 2QAGA 1RQNA 4ZDJA 5INTA 4C06A 2WWYA 3G8DA 2F00A 4HGNA 5A4JA 3EMKA 5I5GA 3AJAA 2Q6OA 4FGUA 2UXDB 1N2GA 3WK4A 2JIRA 3LUAA 3Q11A 1UR5A 4LXUA 1FYWA 4UXHA 4JBHA 3HA2A 3ESQA 1PFGA 1L5HB 1P3JA 4QQNA 1R8JA 4QG3A 2WT4A 4XVQA 4M87A 3DDSA 1TYZA 5JZSA 1MHTA 4E46A 1JFFA 2NUAB 3NRCA 4RVFA 2KX7A 4FP9A 4NF2A 1VI2A 1WXQA 4BN5A 5ALUA 5BNFA 1MPXA 4QT0A 3QW2A 4J9VA 4MWDA 1B1CA 1B14A 4B45A 1CNEA 2ACEA 3SHVA 1CUFA 3HZZA 5BQIA 1D2AA 1KK0A 3ELBA 3M83A 3LSTA 4LVOA 3CJQA 5LR6A 1E32A 4YTEA 3I04A 2GO7A 2X7JA 1D2CA 1SZPA 1XMXA 1UBGA 2J4CA 1B15A 1KFKB 1AKQA 4ZYXA 4JQYA 1M2EA 3KR0A 3HNJA 5JNSA 3I01A 2PG3A 3HO6A 1WIWA 1ZXBA 1MO4A 5JASA 1E2KA 3UTCA 1AV6A 4IDCA 2QMQA 3K15A 1CQIB 2WUFA 4LSMA 4J0GA 4TTSA 1RYBA 2IS1A 2O57A 4OAPA 5F51A 4TRNA 4DLYA 5DIZA 4JI6B 1KAMA 2OG1A 3HACA 2GN2A 3OQ6A 3B1ZA 3B1VA 1N9GA 4O4HA 5A6JA 5F35A 1RBYA 1UAGA 4H0FA 4JJZA 4LYJA 4C3VA 1BE6A 4F2HA 3JQ9C 2OJED 2HFKA 3JQAA 3T5CA 4F4CA 1EX7A 4LNHA 1JHOA 2JFNA 4RK7A 4BUJA 1CW2B 2IZ1A 3DMYA 1JXOA 2YL1A 4TLBA 4ZTUB 1PEDA 3RAJA 2JCXA 1VLJA 4IM7A 3EXFA 2IIQA 3JX9A 4CT0A 3WJAA 1CHDA 1C3EA 3BA1A 4GOJA 1JQDA 4FQ7A 3CWQA 4WIAA 1O4VA 5D7NA 3BX1A 4GRAA 4C3OB 1G8XA 1GAJA 3NGMA 2ZJ4A 2IXAA 4DBLC 4X1IB 3FZYA 1IBSA 1MIHA 3ISVA 4WCVA 1P2FA 4AKTA 4MW4A 3FHOA 4D0NA 2PVCA 5LP6F 4MTGA 1U3VA 1S96A 1OFUX 1GZHB 1I33A 4IGIA 3BIFA 3KB6A 5K0GA 2QM8A 4N5DA 2TMDA 3W9YA 2XDYA 1KO1A 1NNI1 3IB3A 5A6BD 3IOEA 3NJ4A 2W6QA 4C7MA 3K9NA 5JO9A 3TJMA 4Q4CA 2ATCA 4LY0A 1G8KA 2OOSA 3F3KA 3O4VA 1PK9A 5GPBA 2H5JA 2FPSA 2HWWA 1PX0A 5AHWA 2OENG 3UEOA 1JBEA 2W00A 1KZ4A 5FNVF 4F3RA 5CFLA 4K9PA 3T4EA 2ZRGA 1FP2A 4YMVA 4C78A 3I6BA 5DI9A 3C1TA 1A8HA 5ALJA 3BXFA 2A0UA 5HMMA 3EZ9A 4PBRA 3FNFA 1SRRA 3ABQB 4F11A 2REQB 1QE5A 2IQIA 1J2YA 1K7EB 2PZKA 1OXBA 4DV7B 2FLVA 3FUTA 4QATA 4OFZA 3E1GA 5KSYA 2G07A 1TLFA 4OREX 2BZSA 1FMVA 4FKZA 3GAMA 3KJHA 3HP7A 3KR9A 3R3XA 3OY7A 3Q8XB 2D7CA 3WRXA 1YVEI 4RZHA 2BEVB 3H17A 4YV2A 2ZB3A 2R8OA 4FHDA 1N2CA 1KOJA 4GKVA 3E1KA 4CLDA 4QKQA 1CUGA 3WAGA 2FMUA 2IX3A 1QIKA 4R54A 2F90A 3LESA 3OWXA 1M1NA 3OJXA 1G2QA 3VTFA 2P27A 3OMLA 1X1QA 3VVBA 2P6UA 3VYRB 3QXJA 5F5LA 1OAKA 2I4MA 2O52A 1T1GA 3ZWBA 4KN5A 4IO0A 1UBNA 2X7XA 1L5FA 1ZGBA 2QBYB 1QRAA 3AGQA 1W36D 2NLOA 3MSCA 4QWMA 5GONA 3ER9A 5ALZA 3KYJB 4RF4A 1VYHA 1SEPA 3MOSA 2O9JA 1FQKA 4LX0A 1K9VF 1JB1A 2Z09A 4OXYA 3AL2A 4ARUA 4JENA 5H81A 1DDIA 2Q4DA 5LPNA 2AN4A 3MXOA 1FQJA 2JFYA 4FWTA 4YRKA 4GDMA 2OD2A 4K9RA 1OH5A 1GU0A 3OQOA 2EJCA 3FUXA 2VP5A 2V1UA 4MKGA 5B3LA 1QZUA 2ATIA 3IIEA 4L5AA 2R7AA 2WJ3A 1QO0A 3FIUA 4TVOA 3JZDA 3EQ7A 2OCAA 2J67A 2C3MA 2GPAA 5K05A 5EJMA 3TEJA 1L8XA 1AS3A 1H8HD 4QLAA 3HR4A 3RW0A 3EIUA 4DUZB 4XZ3A 2JJ1D 2FN9A 1O9GA 4K2AA 3INTA 2JRLA 4NJEB 4J7CA 1QYCA 1SB9A 3CUTA 3IH5A 2VOJA 3LYLA 3C18A 1EEHA 2NUTA 2D1TA 5ED0A 4ZMRA 3GFFA 1FFSA 4YPFA 1UPUA 3EUAA 1FMWA 4AC9A 1WPXA 5E8JA 3RYHA 3W5BA 5HF8A 3GFBA 5A3SA 3LRTA 4US2R 4LF6B 4GEKA 2O8CB 3L4BC 1KQFA 4CMIA 1GPAA 2X1MA 4OGFA 3JASB 1IPEA 3F3SA 2PMFA 1QLHA 4PYMA 3IOMA 4ZQIA 2WM2A 4ERNA 1P91A 5K0LA 2WJ4A 4YHBA 3WJ1A 4EG8A 3FPSA 3G49A 1IULA 4G26A 4B2LA 2BFAA 2FN3A 4WFJA 5JS7A 2BFBA 4LZAA 3OE1A 1IBLB 3NH6A 3EK2A 3TLBA 4U0KA 5BUOA 3N8KA 3EGXB 4IJJA 4JLBA 1JFRA 3X3HA 2B4KA 3I5QA 1QP8A 1I4DD 1MX5A 2O2DA 3BEHA 3QE3A 5CIYA 5DYWA 4BS9A 1MNDA 1JR2A 2W42A 4FPXA 1PJ2A 1K2VN 1Y63A 4KSCA 3F1KA 4IR7A 5AW5A 3RGGA 1ZNXA 3RKSA 4L0QA 3CEAA 3K0HA 4M9ZA 4QUIA 4YT4A 2QRGA 2R8RA 1XP5A 2QTWB 3W0LB 3OBIA 5LM3A 5K0JA 2ZJ6A 3PXEA 5A5DA 1TQ4A 6YASA 5DBHX 3R8XA 2EQAA 2PMWB 4EVIA 3UGQA 4R7ZA 1QKKA 4TXLA 4R0MA 3MCUA 3GLRA 4W8PA 5IBQA 5KYYA 4Y2HA 3BZBA 3HCDA 1Q17A 2KC3A 1BBHA 3SSNA 3QNWA 4NZOA 1DQNA 1FLDA 1G55A 4YUAA 3TNYA 1OX4B 5J1TB 2WVNA 1BCRA 3OD5A 2EGUA 1LRKA 1J0AA 4DZZA 3EVNA 1QH1A 2HK7A 5J2UA 3WYAA 1GFIA 3NDBB 4PTZA 1KZ1A 4UEJA 4WXMA 1O94D 1X1EA 3GWZA 1U3GA 2YZ2A 1L7QA 3D3QA 4HF7A 4WRRA 3ECSA 3O8LA 3RYCA 2Q1YA 4J90A 4HLNA 4BO5A 3VUFA 4GP7A 1UDXA 5DDIP 2OXRA 1L8QA 4OUDA 1O6CA 3MA0A 3HNKA 1SCBA 4RMGA 3PHGA 4UMDA 1TM5E 4JITA 3BFJA 4YJ3A 4CU5A 4HTFB 3NI2A 3EGVA 3FPGA 4PM4A 1P7PA 4K9MA 1FFCA 2F43A 3W2HA 1PDWA 4J32B 2PZGA 3C39A 1IIBA 3BRWA 4LRWA 4RGVA 4ZDIA 2KI5A 3NVAA 1PFVA 3VPGA 4C4PA 2HHJA 1Z5ZA 1NX9A 2PWZA 5LXTB 2P2SA 4WV3A 3ZPXA 4B79A 2Z0MA 4UD6A 3V5ZA 4EGQA 3NYLA 3VPHA 2G5CA 1RKQA 5HE8A 1CUUA 1P0IA 3QWIA 2XUGA 5CNJA 3AFOA 4TS3A 3O1HB 3T3MB 2HV7A 4I5FA 1NYTA 3HXMA 3QMWA 1IL0A 1JZSA 2XBLA 3IP8A 2Y1EA 2AR7A 4CLRB 1V2HE 3GEDA 4CJGA 4FK8A 4MJ3A 4P3XA 2EFDB 1IXSB 4B3RB 2Q3BA 2XLCA 3HJBA 1PG5A 1B6TA 5FOQA 4ZV9A 2VFAA 1X7XA 1TT7A 5LQMA 1H5QA 4O2AF 1HQYE 4XSHA 1KEUA 4LVNA 5AW7A 1U7PA 3EXIB 3KFXA 3VISA 1B2RA 1NWHA 4ZU1X 3WK6A 3TNFA 3DJNB 1RCTE 4V1CA 1G5TA 2GNAA 1XEXA 5TLSA 3BAFA 4JI4B 4FESA 3HFRA 5HQJA 4YRAA 4JKYA 3ORYA 3AEUB 1GR0A 1YLMA 2IZZA 3A31A 3ABZA 2ZBFA 1DKOA 1N5DA 2ZU6A 2GPBA 2W2OA 2VYVD 3AHIA 5DT9A 3MT9A 5JNRA 4WDRA 2VDOB 2XMQA 3HNOA 2BFDA 3B7PA 3SMQA 3OZSA 5TQVA 5HIAA 2BHNA 4EKNB 1EXNA 4TT8A 4N49A 3W6ZA 3I4UA 2C7BA 3PUIA 3OM9A 2RHRA 3F97A 5ALFA 1JPNA 4DSUA 4NMHA 1RQ7A 3S29A 1USGA 1E9DA 1M2WA 1G2OA 4S1NA 2FJPA 2HQ1A 4G78A 3WLMA 1UFBA 5EHXA 3X2EA 2BRUA 2ZTMA 3T5PA 2PL9A 1U99A 2XCTB 5AVJA 2O50A 3VKUA 3F5FA 4KH1A 1YDMA 2XYGA 4UFPA 1CY7A 4I1OA 3S40A 1BVYF 4Y2PA 2V0NA 2CNNA 1CJTC 1YDWA 1NATA 2HT6A 3NZEA 2NT4A 5T7BA 1QUEA 4ZZ0A 1VBNA 4BKOA 3IAAA 1Z56C 2HMSA 4Y2RA 4BVFA 2B30A 3I53A 2MSCB 3GR6A 1DAKA 4ANJA 3KFLA 2Y4NA 2VJOA 2A1UA 1TX4B 3EXEA 1FSFA 5JH7F 5ITZA 1B76A 4P7JA 2Q4FA 1A8IA 3GUYA 3B0VC 2WR8A 2UKDA 3I05A 2XLVA 2TMVP 5FLYA 4CLXA 5EI5A 2HF8A 5AVOA 5AESA 3KYDA 2R7UA 4GSYA 5T8KC 3FLMA 3HYTA 1JDJA 1KI1A 1ORIA 3C5WP 4LI0A 4MI6A 3NTUA 4LJSA 2XNDD 2AEFA 1SQSA 5KJ6A 4ALJA 2XIQA 1WHSB 4AO7A 3URMA 1U4SA 1UZMA 1DBRA 4B7XA 3H3FA 4G5RA 3UXEA 1JLLB 3FZEA 1OF1A 4KLAA 4BNKA 3E4DA 4MGIR 4UAGA 3HUTA 1C7FA 2FG5A 4H6VA 5L7YA 3HI4A 1T2DA 4NBRA 1H94A 2G6BA 1QU3A 3RAFC 3RS2A 3SQOA 2GFHA 2A5JA 3CS3A 4BO6A 3WNCA 3ESDA 3RSLA 4FZJA 2E1PA 1F8YA 1RYZA 4MV8A 4U5QA 4RKQA 5H9VA 2HFJA 1CZOA 4JT9A 3RARA 2ZT7A 2PNFA 1YQTA 2Q4TA 3VHQA 5AVYA 2JFOA 4XEUA 3WKEA 1KE2A 2OKCA 1N5OX 3TQIA 2F3RA 2A9RA 4D74A 1SC9A 1RWKA 1Y6DA 2PBZA 4E2FA 1HI9A 2FF7A 1CETA 3P2EA 4D0SA 1CEQA 3T6BA 4Q37A 4YN0B 1D2GA 4XVCA 3T15A 5AJWA 4ZRMA 4MHTA 2Q07A 4Y1RA 4CU2A 1FFXB 2BFMA 2XWQA 3D1LA 1ZHXA 4YP7A 3VZPA 2GR9A 1XD2A 4QUJA 3TR0A 4OG2A 3EYAA 3UJ3X 1KDYA 4GBJA 1DZ3A 1Z75A 1C1YA 4U9EA 3DEFA 3LYHA 3G2NA 3RRFA 3AF3A 5L0HA 4BRUA 1B8OA 5M3BA 5EIHA 4J03A 1GT6A 1HLGA 1MMDA 3PUYA 1G38A 4QLBA 3ILVA 3W78A 1X7WA 1ECBA 4G4IA 1T0HB 4S05A 4G86A 2HOQA 4Q15A 4EENA 4BIMA 2GPSA 4H35A 1OWPA 2YN4A 4TOIA 4RIGA 1GKIA 3VV2A 5KU7A 5EIWA 2XZOA 1FNMA 1RRGA 4JCOA 3P71T 2DBVO 1W0KD 3AV0B 3SVZA 3V4ZA 2IHVA 4F04A 4XA8A 3ZTYA 2YXPX 2AF4C 3HA7A 3EIEA 1QVRA 2Q6IA 1EJBA 1U2TA 4MLCA