1ZU4A

Crystal structure of ftsy from mycoplasma mycoides- space group p21212
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
309
structure length
305
Chain Sequence
b'PMEKAMLKSAFNFSKDIKKLSKKYKQADDEFFEELEDVLIQTDMGMKMVLKVSNLVRKKTKRDTSFENIKDALVESLYQAYTDNDWYRIDFKENRLNIFMLVGVNGTGKTTSLAKMANYYAELGYKVLIAAADTFRAGATQQLEEWIKTRLNNKVDLVKANKLNADPASVVFDAIKKAKEQNYDLLLIDTAGRLQNKTNLMAELEKMNKIIQQVEKSAPHEVLLVIDATTGQNGVIQAEEFSKVADVSGIILTKMDSTSKGGIGLAIKELLNIPIKMIGVGEKVDDLLAFDIDQYIVHLSSGFMQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ftsY
molecule tags Protein transport
source organism Mycoplasma mycoides
publication title Conformational variability of the GTPase domain of the signal recognition particle receptor FtsY
pubmed doi rcsb
total genus 116
structure length 305
sequence length 309
ec nomenclature
pdb deposition date 2005-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1zu4A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1zu4A02
4ZO4A 3GEEA 2B92A 3X1YA 1DVRA 1YKSA 2LKDA 3B1XA 3EZ9A 4G1UC 4DUGD 4C2UA 2CBZA 5CJ2A 3TBKA 1TL7C 1XCGB 2ZS9A 3KFVA 3TUIC 4DB4A 1G291 5SZJA 2O0JA 3Q7QA 2WTUA 4UNQA 2Z6VA 4HLDA 2QRZA 4HB4A 1TNDA 5CIWA 3CZPA 4TLEA 1RFLA 2REOA 2MMCA 2GF9A 3VX4A 1W5SA 3U4QB 2D74A 3O8RA 2PH1A 4RD2A 1WB9A 4UQOA 3FHTA 5BQ5A 3RC8A 4HUTA 2NG1A 4KHZA 3C7KA 2ZXUA 3SJBA 1Q44A 5P21A 1GFIA 5J5CA 1RVDA 4WIAA 2ZUDA 2JIZD 4TMXA 2H92A 3U6BA 2IYXA 1R0ZA 2ZI6A 2NQ2C 1SVLA 4D81A 1RW4A 4F4CA 5FOSA 2REBA 1WBDA 2AL7A 3AVOA 3U60B 1OH5A 4ACBA 1UBGA 5C1BA 3SN6A 1NIPA 3QKSB 4B3CA 3SJZA 4C0LA 1KI3A 1XZQA 5BN3A 2RGBA 1E9DA 1CRPA 3U44B 3NBXX 3ZQJA 1F5NA 2QMHA 2ODWA 1IJEA 1XEXB 3RSOA 2P6RA 3X1XA 4HLUC 4OYHA 1GKUB 3QBVA 3VAAA 1VIYA 4UKDA 2ZRKA 3W34A 2YV5A 4EDHA 3DDCA 1NLYA 4N0EA 3LVQE 2BEKA 4QJ4A 4PSAA 4TMTA 1RC8A 1CP2A 4EQ6A 4RY2A 3D7MA 5B2ZA 1G6HA 2F1JA 3B85A 3U3OA 3NBZC 4JLDA 3CW2A 2CHVA 1MKYA 2IUSA 2J3EA 1AS2A 2HDNB 3A1SA 2PMDA 3RANA 3SEAA 5FPHA 1ZU5A 3I72A 4DB2A 1OYYA 1D8TA 4RSGA 4HAZA 3OEHA 4DEYA 1E0SA 4B32A 1E32A 5EE5B 1XTSA 1OB5A 1JBKA 3H2YA 2RGNC 1NRJB 2GEUA 2VO1A 2QAGA 4FWTA 3ZS9A 3SDZA 2ZPTX 4A2WA 3THWB 5JCPA 4BFZA 3R8FA 5EP2A 4Y0VA 1YZQA 4UNNA 2J0UA 3CRW1 4KBGA 4O3MA 5IF9A 4LHYA 4EJSB 1RJ9A 5B57C 5GJCA 1N0UA 1EFHA 4B3FX 4WVFA 1WGWA 2ZRGA 4IFBA 3X1ZA 1C1YA 4MITA 5KSPA 4C0QC 4XTRA 1JJ7A 3CBQA 4ZDWA 1ZAKA 2E87A 4B3DA 1IN4A 1UJ2A 2J7PA 3GFTA 2C98A 1NY6A 1G7TA 2IYRA 3A4NA 4JLOA 2CHQA 4BECA 2DWQA 3TUZC 1JECA 1U0JA 3OEED 2G9NA 4OKSA 5LDDC 2WWGA 2OLJA 1JJVA 2ATVA 4Q47A 3RVBA 3ZVLA 3NBFA 4E22A 5FPKA 4IVQA 1CR0A 3ND8A 3LVRE 4KFTA 1X3SA 2QU8A 2KSQA 1XXHA 1MOZA 2AK2A 2WJHA 4NYJR 4RKEA 2P67A 3K0FB 2ZJZA 1WF3A 2VP6A 4WZBE 1GITA 2CEAA 1XJQA 1S1MA 4CRWB 2VP4A 1SVWA 4PO9A 2WMOB 3DVLA 1O3YA 3A4LA 1SXJB 3EC1A 1ZP6A 4RFSB 4OQXA 2HYIC 4CEHA 3LXXA 2CCJA 2AFIE 2H16A 1Z07A 3OEHD 3TRFA 4ZIRA 1U9IA 3KQUA 2B7BA 4LK2A 1Z63A 4B73A 1W1WA 1VYUA 4EIWA 1G17A 4URUR 2CLSA 2OE2A 2OT3B 1X8KA 1WMSA 4JVNA 3EIEA 3KL4A 1ZUNB 1RRGA 4AD8A 4HYYA 1ZC4A 2BBTA 3GLHE 3R8CA 1XTKA 5JWRA 1E1QA 2ZVPX 3GEHA 1ZUIA 4JBYA 1DBSA 2ZROA 2ZRJA 3C5CA 3K70C 4M4SA 1Z29A 4MUBA 1VTKA 4LHVA 3SJAA 3W9YA 3GLFA 1TU4A 4L9SA 1U81A 4DIDA 4KLZA 3TR0A 2A3RA 1E2PA 3WYGA 4OHZA 5C18A 3QSYA 4JLMA 4LBVA 2LKCA 2ZRAA 3IHWA 5EZ5A 3U7HB 1GNRA 3BB3A 1F3OA 1IXZA 2Y8EA 3U2QA 4OI2A 1W48A 3BS4A 3K0CA 2BMFA 1NN3A 2ZR7A 4G5GA 4HDCA 4QHSA 2OBLA 4NYMQ 4QHTA 4TLCA 3ADBA 2ASEA 3KKPA 5FI1B 4AYXA 5KTYA 2H8KA 4DCVA 1ZNWA 2XITA 1C4OA 2AXPA 1E98A 4XTCS 1XTIA 3EIQA 3RNLA 3A4MA 4MUAA 4NL4H 1V43A 1K8RA 2Q9CA 2W6JD 1IY0A 2WJIA 1RIFA 5CK5A 1MO6A 4BQSA 1IJFA 5HTKA 1ANKA 1SZPA 4IFEA 3WNDA 2YINC 4Z54A 4ZI3A 1XEWY 5G53C 2QSYA 3IBYA 4OQLA 5HE9A 4PZZA 5FOWA 1P5ZB 1GDDA 2IXGA 4D80A 4FI3C 5C2JB 2WKRA 3NTUA 3Q5DA 1TF7A 3UMFA 1G8YA 3GJ6A 1Q1BA 1E2LA 1JR3A 1E79A 3MWJA 2J0SA 2DY1A 1HT1E 1KI6A 3Q7PA 1Q22A 2ZU6A 4DCNA 4GRAA 4DDVA 1DAIA 3TGPA 1ZM7A 3MGCA 4D6PA 5HR5A 2NMVA 4TLBA 3W5JA 3ZDQA 4IDOA 1FW6A 2WSSA 4MDEA 1KJYA 3P32A 4W5HA 5AUNB 2J59A 3BK7A 1AA9A 2J0QA 1XPOA 3A6PC 1N6RA 1UBCA 2EQBA 3U7GA 2Q3FA 3RDPA 3WY9A 4P0TA 1FTSA 3CX8A 4AYTA 1A82A 2DPXA 4U5XA 2VEDA 2ZITA 3GLHA 1OH6A 2GCOA 1CU1A 4LJ5A 1VCMA 2PEYA 1R10A 4JL5A 1Q57A 2GEDA 4Q9JA 3SBDA 4DLUA 1W36C 4CYMA 4F4JA 4CDGA 1Q1QA 2ZUBA 2O0KA 1QHIA 1UBEA 2BBSA 4TQUS 2YKGA 3MRSA 5IHPA 2OXCA 3I5XA 3FE2A 5FOVA 4M9XA 1D9XA 4OJQA 4QBIA 1WP9A 2R62A 1AGRA 1GTVA 1CKEA 1GRQA 1XD2A 1BIFA 3ETLA 2EU8A 2W58A 1S3GA 3QKRA 3PUXA 3M4YA 3QKSA 4V0MA 3WMFA 2HF9A 3KQHA 2XZPA 4DLZA 1VG8A 4EPVA 3EZ6A 2PLRA 1HTWA 4TYPA 5FOTA 3ZIAD 1SVOA 4HB0A 3J81k 1IY1A 2AN9A 4CEJB 2VSXA 1NIJA 3NH6A 4C2TA 2A7QA 2G0NA 1P9NA 1R7RA 2J7PD 1FTNA 4NU0A 1E2NA 1U98A 1IXRC 2QM7A 3TQFA 2Z5FA 3U4QA 4D25A 1BMFD 3A1TA 2BM0A 1W4CA 1XMSA 2OESA 1M7GA 1OFUX 2FX3A 2O8EB 4FN5A 2OV2A 2Q6TA 4B75A 1T3SA 3DMNA 3UATA 2D3WA 3TAHA 3B1WA 1CIPA 5TB5A 3K09A 4R71A 1NLFA 2RAPA 2BM1A 3AP1A 2GTPA 3N5CA 1E79D 1IN8A 2J87A 4UNSA 3PUVA 4KI0A 4NBSA 2A2ZA 2BWJA 3QPWA 5L3QA 4A0GA 2OHFA 2P2LA 4BLPA 1KI2A 3JZMA 4TLAA 5FUWA 3T1VA 2NPFA 1LF0A 4S2EA 4LZZA 3G0HA 2WV9A 4CT5A 2GVZC 4PAMA 1NNEA 1LVGA 3CUEF 4OHYA 2FSIA 1F2TA 4TT3D 5GJVC 1E2DA 3W3ZB 2R6AA 5CIQA 5BYJA 5CB8A 4L16A 2NOAA 5EE1A 1PJRA 4Q4HA 3SFZA 3QVUA 4JT4A 4M0LA 2JAQA 1R2QA 2NO6A 1FX0A 5AUPB 3KKOA 1OXVA 4FINA 1II0A 4GOJA 2ODBA 3A36A 3NG1A 1TMKA 4HAUA 2BC9A 2IYQA 1DO0A 2O8FA 5D3QA 5EXTA 2IUTA 4MYUA 1J8YF 1J99A 3KFXA 2RCNA 3NVAA 3X2SA 1Z2CA 4ZCLA 2BJWA 4LBZA 3THWA 3MWYW 4V0ME 3BFKA 4Q4AA 3AUYA 1Z08A 3QG1A 2P5TB 3EG5A 1II8A 1PVOA 1UEJA 5LB2A 3CB4A 5BWMA 1HURA 4LYHA 4LJ9A 3K9GA 3D31A 4C4PA 4QRHA 5H8WA 1YZKA 4TZ0A 3PQCA 4MRVA 3K0AB 4CEHB 1H8HD 1UAAA 1XZPA 3GJ5A 3K09C 4C0SA 2CK3D 4GL2A 5DE3A 2ZRIA 2XNDA 1RRCA 3NHBA 2EVWX 2GETA 1KDOA 3T35A 2MSDB 1KMHB 4UJ5A 2BJVA 3REFA 4EAQA 1RPZA 1AQUA 1TTTA 3Q3JB 2IF2A 4FCWA 4KITB 3VKHA 5DNYB 3GLIB 2Z83A 2ZS8A 2YC2C 1W46A 3C16C 2VHJA 2EFGA 5L3RA 1EFTA 3AF1A 3FHOA 3FDIA 3CF2A 4PPGA 1I4TD 3QKRB 2VHUA 1G3RA 4IRUB 4D0GA 4QGFA 1JR3D 1GZSA 1R0YA 2ZVQX 4MGIR 5FR1A 4X8HA 2ODEA 3P4YA 2FDCA 2HXYA 2B21A 5G41A 3EZFA 2EFCB 3B82A 1E0KA 1DAMA 2J5XA 4IKEA 4MGKR 5CLLA 3SHWA 5IK2D 3OFND 3CZQA 2H7VA 4EKDA 2HJVA 1U9IC 3C5HA 1XXHE 1VG1A 4HZUB 1KO5A 4O0MA 2FZ4A 5IT5A 2DWPA 1HT2E 4TMKA 1FNMA 2BEJA 1Q3HA 5FTJA 1Z0DA 3HWSA 4DSOA 1W0KD 4AWXA 1SKYB 3QENA 2IEYA 2YWHA 1KYIA 1Z6YA 3NXSA 1NY5A 1ZNXA 4JSYA 5DI3A 2JLXA 5F98A 1R4AA 2E9SA 5J47A 1N5KA 1YR8A 4JVSB 4H9GA 4KYUA 1OB2A 2AKYA 2VF7A 2H5EA 3FTQA 5F2EA 3CR7A 821PA 1RZ3A 4II7A 4Q01A 3JVUA 4IOKA 4JLJA 5KDDA 2FA9A 1MO3A 2YOHA 2AHOA 3KKNA 4DUGA 2PJRA 2PJZA 1Q1EA 4G0NA 4W7SA 4TYYA 4KBFA 5L3SA 3BFXA 4DHEA 5LBIA 1HH4A 1S3SA 3HYRA 4PSKA 3SZRA 4N3NA 4E5UA 1QG4A 3VR1A 2ZM5A 1XJ0A 3CWZA 2KI5A 1Z28A 1D5CA 2JASA 3K9HA 3ASZA 2LWIA 4US2R 2A9KA 1DO2A 2WPDA 1J8MF 2GEVA 5FOXA 4Q03A 3OE7D 8OHMA 1OXSC 5CDFA 4A8JB 1DARA 4FIDA 3VU9A 1CJMA 1ZC3A 2ZREA 3G82C 4GPTA 2IC5A 3NH9A 3T1TA 5E4FA 4I1SA 5GJBA 4PPFA 3QXHA 1OHHA 1KI8A 2CNWD 3IIKA 4H1UA 3RLFA 4B3GA 3DMDA 2B7CA 4IVPA 2CHGA 4F92B 3OZXA 2ZYTX 1II8B 2HLDA 4Q48A 4F93B 3VR6A 3VR3A 2XZLA 4JLNA 2ZI7A 3BH0A 4TYWA 5E7IA 2CLDX 3WYAA 1NLZA 4PHHA 3ZGXA 4RCZA 4PC6A 1PLKA 4UXJA 2C04A 2PZGA 1ZUHA 3QF7A 1KMHA 1JAHA 2I4IA 1W4AA 2QN6A 5K8UA 1SHKA 1Z5ZA 1FP7A 1E4VA 2IYLD 2FFQA 3SS8A 4QKQA 2HT1A 2JJ8A 3PV0A 1IN7A 4DT1B 1Z2AA 3K0FA 4DZZA 4Q1AA 3EW9A 3QJYA 5AUQA 4D82A 3THXA 5FPSA 3QF4A 3EWSA 4AY2A 1R0XA 2VP2A 4N0DA 3DM9B 1PUIA 3FOZA 1LTQA 4B43A 1KK1A 3B8HA 2EWWA 1A5TA 4RFSA 4JL6A 1EK0A 1G16A 3BRWD 4XH9B 1A4RA 1DS6A 1NJFA 4B2LA 4Q1BA 4D4KA 2ERYA 2JLZA 1DAFA 4PPNA 5LD2B 1N6PA 4PC1A 2J46A 4YMTA 2CE7A 5JHGB 4PC2A 4FMDF 3TSZA 1F6BA 2BBOA 1BYIA 1LS6A 3QPVA 5KNBA 3RABA 2WVJA 2GKSA 1T6NA 3U6KA 1N6HA 1GVNB 3GEIA 2QBYB 5G3YA 2O8DA 4BPBA 2ZRFA 1FUUA 4V03A 3V4RA 3FB4A 1NMZA 4E09A 4B6FA 1S0UA 1I2DA 4IEIA 5G40A 1T4GA 1Q0UA 2AFHE 5B64A 1SKQA 3BXZA 4NYJQ 5GADl 521PA 5IDVA 2G88A 1LNZA 4PQFA 3FGNA 2ZETA 3CPHA 3IPXA 1KI9A 2FWRA 1IM2A 1TX4B 3K0SA 4JBWA 1OSNA 3B1ZA 3N70A 1FZQA 4HZIA 1PUJA 4DDTA 1XWIA 1WQ1R 2G1KA 4C9BA 3CRVA 3KJIA 4FCTA 1OLOA 5G3ZA 1P72A 5L3SB 2ZYVX 4HEJA 4FW9A 3HU3A 3PUZA 3RS4A 4B35A 1GM5A 1NG9A 4IDNA 1YJ5A 1XD8A 5KHOC 1KY3A 1WE2A 3C8UA 1HA3A 5FOUA 2YWFA 4B74A 2HLDD 4TL7A 3LFUA 2GBLC 3RAPR 4HAWA 4A4DA 3ZVNA 4LGMA 4KYIB 2OCBA 1D9ZA 3AKEA 4Q21A 2XXAA 3H1TA 3QI2A 3W8RA 4QGGA 4JLPA 2W6ID 4DLSA 5JSZB 5KU1A 3Q9LA 3JZAA 4A1FA 5L3QB 1GKIA 3W5IA 5JLJA 3KQKA 4YLGA 2QG6A 1HQYE 4IHQA 5FBLB 4LRWA 4I4LA 4JIMA 1VG9B 1G7SA 2ERXA 4WAUA 1OFTA 1F2TB 5D3MB 1F48A 4KXFB 4Q4LA 2G0TA 2IS2A 1KI6B 1J7KA 2R6FA 1JPNA 1FPMA 3ICEA 4I99A 1XEFA 4B48A 3E2IA 1SXJA 3UG7A 4Q9IA 1Z6XA 1D2EA 3C15C 1JQJC 2F3TA 3PITA 1GRRA 2IHYA 4ZIRB 3LAWA 1TU3A 4CVNA 4NYIQ 2V7QA 4KV9A 3WNBA 4KODA 4LJ6A 3DZ8A 1XMVA 2RB4A 3A1WA 2MMGA 5FTNA 3TQCA 4BZXA 2OSBA 3SR0A 4A0RA 2DHRA 1E9EA 1W4BA 1E0AA 3P20A 1BO6A 2X8AA 1E1RA 2IBMA 4MKFA 2BMDA 1DADA 3CH5A 1XMJA 5AJZA 1COWD 3I8SA 2RMKA 2NPIA 2XTNA 4HB3A 3ZLJA 4ARZB 5EP4A 4BFVA 5KNDA 3W90A 3Q8XB 2WWFA 2V6IA 3DOFA 4MA4A 2HV8A 2EFDB 1PZNA 4NH0A 1W0JA 2GXUA 4TLDA 1N2CE 1ZINA 2F1RA 3K0AA 2A5GA 2ZI5A 4I1VA 4TN1A 4PAQA 3FMOB 2H17A 4PTLA 2PX0A 1A7JA 3LX5A 4PANA 4PQRA 2IWRA 3VMFA 1KY2A 3NHAA 4PSVA 4AKEA 2IT1A 4G5SA 1CR1A 2JJ2A 1Z06A 5FUVA 5CYOA 3QE0A 1GNQA 2ZE6A 4DWJA 4ASUA 2N1BA 3KTAB 4DDUA 1AS3A 2QBYA 1HQCA 4XJXA 4L4UA 3Q85A 2CCKA 3CX6A 2ZSAA 1E9RA 2B8TA 4RKFA 1G8PA 1NVWQ 1DG1G 4OHVA 4KCGA 2QUZA 3S1AB 3BE4A 2BMJA 2QMUA 3N2EA 4AI6A 1S9DA 4UXIA 3KXIA 2W0MA 1UFQA 3CX7A 1O87A 1W47A 1FQKA 1OXXK 4QC2A 5EXSA 1ZCBA 1VHTA 3BJIC 3IEVA 2O8CA 1KJZA 4OHWA 4GOKA 5IK2A 1QZXA 3ZVRA 1KDTA 1P7CA 2CMKA 1MABA 1Q20A 3VFDA 5UKDA 1BMFA 1ESNA 1XCMA 2PL3A 3AVQA 3WYFA 3ECCA 2PCLA 3M6AA 3QVVA 4EFLA 2J0VA 1YZUA 4YONB 2ZRDA 5BW8A 2FE4A 2GCPA 2NO9A 4MKIA 2IUUA 2XAUA 1NVXQ 4POAA 4Q4JB 5L3VA 4LPKA 2DFKB 4L8GA 4Q1DA 4ZV4A 2GZDA 3I8XA 5HCNA 2WKPA 2OO7A 3KDSE 3O8DA 2D7DA 2WJJA 1VPLA 3FWYA 4JVMA 1SVSA 4OI1A 2JLYA 3GJ8A 1DOAA 2NO7A 2QAGB 2ZJBA 1N25A 3PJRA 4DCTA 1KNQA 3T12A 2AKAB 1VMAA 4YMWA 1NN1A 4QNMA 1C9KA 1X8LA 1KO1A 4UJ3A 1R5BA 3KUDA 3RC3A 5JBQA 2WWHA 1X1SA 1N6IA 4LBYA 1K5GA 1OPXA 4A0HA 2XJ9A 4EPXA 1AKYA 4MKHA 3EIHA 3FKSA 4NCIA 5DISB 1XEWX 2XEXA 2WBLC 4LOAA 2CVHA 4BFWA 2ZANA 5JJKA 3LNCA 1IXSB 3GLIE 3CM0A 1Z6AA 3VX3A 4OI0A 1Q21A 3T5DA 4BUJA 1BOFA 3WHKA 5H1YA 4MDFA 1NBMA 4ZKEA 1UKZA 2IS6A 3IDQA 2P6UA 3LBHA 5HCIA 2ZEJA 2FPLA 4Q4AB 1HY3A 3F3YA 4A8JA 2FFHA 1G5RA 1G8FA 2QMOA 2X77A 1N5LA 2QL6A 1Q12A 5KPJA 3A8TA 5TDHA 4CEJA 2XGJA 2CVFA 3RS7A 4ZDJA 3V00A 3T61A 3TKLA 1FP6A 2QENA 1G19A 2P0EA 1OXUA 2O5VA 2AD5A 1WCV1 1SVIA 4D2IA 2BIFA 2C77A 4JS0A 3TSWA 4A2PA 1E9SA 3AVVA 4Q5IA 2IYWA 2OG2A 3ZIAA 1JI0A 3SQXA 3BFVA 1VKJA 4XD7D 1TUEA 5DN6A 1TQ6A 3K70B 1G4UR 2ZRNA 3L43A 3W3AA 2D7CA 3LX8A 421PA 4EPRA 1IN5A 3KZ1E 4ZDKA 3CRMA 4LHZA 5AJXA 1AZSC 1YZTA 2FNAA 2ZSEA 2O8DB 2ZRMA 2V6JA 4BZPA 2AD1A 2QGZA 3ONWA 1JALA 3BH7A 2OAQ1 3B9PA 3O8CA 5J4HA 1E1RD 4TYQA 1E2HA 3AQ4A 4ITRC 2QA5A 4LX0A 2QROA 1KDRA 4Q9LA 4Z1MA 2JIZA 4P3YA 1YZLA 4P32A 3TW4A 4US1R 3ICQB 1Z0KA 3LW8A 1LV7A 4CGZA 4XSGA 4MGZR 1W2HA 2PT7A 3GJ4A 2VBCA 4HAXA 4KO8A 4KJZA 4I1UA 1E9BA 1VG0B 3U5ZB 3B78A 2WOOA 2X2FA 1BS1A 1OKKA 2A5JA 4ERNA 1DG3A 1Q3TA 3I4LA 3K1JA 4NKRA 4BZQA 5KPDA 3AF2A 4AK9A 1JR3E 1W7AA 1K5DA 3D6TB 3IO5A 5DYGA 3QY0A 4LYJA 1VHLA 4TL9A 1Z0IA 5BN5A 1S9HA 2A5YB 5TARA 4P4SB 4JLAA 4TSFD 2CLCX 2JGNA 4MGYR 1G3UA 1NMXA 3IEUA 3V4FA 3BH6A 2OCAA 4JSTA 2Q9AA 3EXAA 4Q1FA 4KU4A 4B3BA 5F3WB 5FR2A 1AK2A 4TYNA 4DRZA 4LJ8A 4KSBA 5FBRB 2G3YA 3MCAA 1QG2A 4D26A 3PCRB 4G3XA 3OIVA 2ZTSA 3KJGA 4BFUA 1UKVY 4BLQA 2V1XA 3VTKA 3NEJA 1HEIA 1XNJA 4ON9A 3UWKA 2WJGA 4PAOA 4XWAA 3THYA 5DLQC 4YMSA 4YDHB 3LD9A 1CJKC 4EJSC 5AUOB 2YZ2A 2IA5A 2D62A 4LYFA 2QPOA 2OUKA 3LDAA 4Q9KA 2D4HA 1L4UA 2VHCA 4LJ4A 5TVKA 1XCPA 1WDTA 1MV5A 3UG6A 4JLKA 2RGCA 5H70A 1OXTA 1NKTA 4HLUA 1W49A 2WWXA 4URVR 1L2TA 3VKGA 2DR3A 5EJEA 4FMCB 3BAFA 1S8FA 2BHRA 4LBWA 3MMPA 1HYQA 5DH9A 4BGDA 1GNPA 3AH8A 1XB2A 5FPTA 3BWDD 2C99A 4EFMA 3DPUA 4PPQA 5KSOA 2CJWB 1J70A 5FFMA 1DAGA 1Z6GA 4RZ3A 2W2TA 2IYUA 3PFIA 4KSCA 4C0BA 5HZKA 2F7SA 2PCJA 1FQJA 4JJKA 5E7JA 5FBWB 4AG6A 1OJLA 2FEOA 2QNRA 3SI7A 1GL6A 1U0HC 4LV8B 4A2QA 1EXMA 4E03A 4OQFA 2IYTA 1OT3A 2VP9A 4Z51A 4NPHA 1P9WA 2FJUA 5B30A 2BBWA 4Q7KA 5JHHB 4JLVA 2FN4A 3AKYA 2F1HA 4BRWA 1R5NA 1ZD8A 4O25A 4B34A 1BH2A 4MQBA 4BLOA 1VDZA 5TXGA 2J1LA 1YZGA 4IEEA 1PLJA 3KTAA 4NONA 5HKKA 3DKPA 1FFHA 1F60A 1G4AE 4CW7A 5E7MA 2PZFA 2H1LA 3EPKA 2JJ1D 4NDZA 4LUCA 1KK2A 2YWEA 5DYIA 3VKWA 2BKEA 1XPRA 2C95A 3ZS8A 2FU5C 3DHWC 3A37A 3AB3A 3S1AA 1YR6A 2GK7A 4QJ3A 4NZYA 1E9FA 2R8RA 2A5DA 1LS1A 4DSTA 4RD0A 4LCBA 4OL0A 1EESA 1OF1A 3ZH9B 3SC3A 1Z47A 3MD0A 1RRPA 2KBFA 4BEJA 2OM2A 4DJTA 1EX7A 4JJZA 2I3BA 4V0NA 3OEEA 4B6EA 3EC2A 4TL8A 2QE7D 2XTMA 2P65A 3REGA 2UVQA 3E70C 3N2IA 1U2RA 3OIWA 2NZJA 2ANBA 1A1VA 1UF9A 3RS0A 2R6CA 4DSNA 1IN6A 1GIAA 2GK6A 3SJCA 3A1VA 3OHMA 1KKMA 1M74A 1XJCA 4OI4A 2F6RA 4M1SA 2P5SA 5AK0A 4AC9A 4HDOB 4HB2A 4A92A 3HPQA 4LJYA 2GZHA 3QOFA 2ZI4A 4DIEA 4WXPA 2JDID 3W6OA 3RYTC 3BORA 4BFSA 3MUFA 2J0UB 2YWGA 2FEMA 4Z8XA 1R8SA 2AWNA 1ZD1A 4LI0A 3IUYA 4EPTA 2V7QD 3MSXA 1QDEA 4HLQB 1XTQA 2C78A 3TW8B 4A6PA 2VL7A 1M6NA 2DFTA 4M21A 2RGGA 1FX0B 2KWIA 2QPTA 4HAVA 2WPDD 2OBMA 3IPYA 1GL9B 4ZPXA 3TVDA 3C4JA 1NSFA 3FMFA 2D2FA 2WIBA 4B2PA 4M22A 4M9QA 5AJWA 1JXOA 1N3BA 3QXCA 1WXQA 4PXAA 3ZQ6A 3EX7C 2CNWA 1BKDR 1ONBA 3R9IA 4NTZA 1Q1ZA 1MO4A 4LDJA 3RWMB 5DSZA 4KLNA 1VCOA 5GVRA 3WRXC 4U02A 4J0QA 1E2KA 2MSEB 2G83A 2ZRLA 5E95A 2DCUA 4TQ9A 5GVSA 5TY0A 3AP2A 5AWFC 2YC4C 4W5WA 1IONA 1A2BA 4WBSA 3SYNA 1KDPA 4NCNA 2W2VA 1DPFA 3QKTA 1YQTA 4RZXA 2FSGA 3BGWA 3R9WA 1JR6A 1N6NA 1SULA 3IIMA 3QUSA 1DAKA 1Z0FA 2UKDA 3F8TA 4MYCA 2W6IA 3CF6R 4TQAA 4ESVA 1MRSA 2ZAMA 3QEJA 4S35A 4XVQA 4LSGA 3OAAD 1S4QA 1KZGB 2GCNA 3GFOA 1KNXA 2GRJA 2QP4A 2ZAOA 2QAGC 3HU1A 4M1KA 1KGDA 1ZIPA 1TADA 1DTSA 4Z8YA 5F9FA 2RGXA 4XOIA 2CL6X 4K8OA 4IJMA 4DKXA 1G7CA 2ANCA 3KQNA 1KTVA 4H1VA 3LXRA 5JFGA 3B5JA 4QHYA 3ADCA 2GZAA 4V02A 3SQWA 3UK6A 3HDTA 3PG5A 4YXWD 5JS7A 1XD2B 2JLWA 3U3MA 3VHXA 3B9QA 3DM5A 1OV4A 3QNUA 2ONJA 3PEWA 1LF5A 2Q3HA 4OQMA 3HP1A 1KO7A 1MH1A 3PEYA 4LC0A 2XXAB 1P2UA 4Q9HA 4P31A 1TUIA 2C8VA 2ZJYA 1V5WA 3U7FB 2GAAA 2PMKA 1TEXA 3KKQA 5EE3A 2E1RA 1NVVQ 2WSSD 4GBMA 2O8CB 2JEOA 3I73A 2VLIA 3H0KA 2GJSA 5J4YA 5JCZA 4RZUA 2VP5A 1XRJA 1Z6TA 3CF0A 3RSLA 1ESMA 1TEVA 3X1WA 1YRAA 2OFXA 4LV5B 1B23P 1GWNA 2V54A 4IVRA 1E1QD 3KJEA 4TL6A 5CM8B 5JI3E 1XPUA 2HF8A 3SE0A 1P73A 3OE7A 3TJZA 2Z4RA 4AG5A 4YQFA 3L8ZA 1P60A 5JMTA 2W83A 1II9A 4JZKA 3F0TA 3T1QA 2BV3A 4ASUD 5ELXA 1QHGA 2GF0A 4OQNA 1KK0A 1WA5A 2GXQA 4TZ6A 3OAAA 3K0EA 2ZJAA 4TTRA 1OHHD 1M7HA 1E6CA 5ANRB 3IILA 2QTVB 2XSZA 1IY2A 1HE1C 1IQPA 2GDJA 1UADA 1N5IA 4M8NE 1T9HA 2ZU0C 3EAQA 2FOLA 4TMVA 1SVKA 5EP3A 5AJYA 5FL7D 1AS0A 1QHHA 3GLGE 1CJTC 3TE6A 2HJGA 1JXMA 2ZRPA 1L8QA 4DLWA 1TPZA 2ZE5A 2A78A 2I1QA 2V55B 4DLTA 2IK8A 4AURA 4O2RA 4LYAA 2YOGA 2JLRA 4QNRA 3EPJA 1VIAA 4NCKA 5H68A 4GOXA 2PX3A 1YHNA 1US8A 4LV6A 4QGHA 3THYB 3HU2A 1WBBA 2YHSA 3FFAA 1L4YA 3QXXA 4GI7A 4L5BA 2VHQA 3A1UA 3Q72A 1H8EA 2ZSFA 1VECA 2G6BA 3L0IB 4PFSA 3KJHA 4PR0A 1X8JA 3CR8A 4QL3A 2NZ8A 2GXSA 2R65A 1IAQA 3T15A 1G3IA 3EA5A 4MKGA 4FD2A 1JQLB 2XOKA 3H86A 3CPJB 4XSHA 3EZ7A 3SYLA 4E07A 2D2EA 2VRWA 4TTPA 1U0LA 4PZYA 1RKBA 3NIBA 4A36A 1N6OA 5EXPA 2C9OA 4AYWA 1FNNA 1CF4A 3ND9A 1DE0A 2XOKD 2FZLA 3AF3A 1UEIA 1W4RA 4JYBA 4UNRA 3DKVA 1M1YE 1E94E 2FSFA 4P33A 1MT0A 3PIRA 4I1OA 2IL1A 4GMXA 2XTZA 2FH5B 3TR5A 1G3MA 3NC0C 3L0OA 2V9PA 2IYSA 1P2SA 4DBLC 4TTQA 1G64A 1KI1A 3NWJA 3UMSA 2XZOA 1OH7A 2YVUA 2DFNA 5KYKA 1R0WA 4EPWA 4Q4JA 1NN0A 2GJ8A 5HZHA 1G5TA 4CF7A 3GJ0A 4OHXA 2FFBA 1G5PA 2ODNA 3HPRA 3WP1B 5J4VA 4V0LA 3LQRA 4BLRA 2CL0X 4DEXA 1N0VC 2F1IA 3THOA 5DHFA 5JEEA 4M1YA 1Y63A 5FL7A 3CRQA 2J9RA 4OK3A 2KE5A 1TQDA 5EUMA 2QY9A 1ZU4A 2OFWA 1P2TA 2WICA 3GJ3A 4K46A 1AKEA 3CWQA 2IW3A 1M8PA 2ORVA 121PA 3LBNA 1MO5A 1KO8A 2YOFA 5SZKB 4BLSA 2F9LA 3T5GA 3TAUA 3EASA 3R9XA 2C96A 4RFVA 2UZ3A 1GRNA 2IX3A 3RRMA 4Q7JB 3EZ2A 2IYVA 2WAYA 1EX6A 1MRNA 4WA7A 2EYQA 4W9MC 1CBUA 1G7RA 2FV8A 1H8HA 5KUTA 1E2EA 2VIIA 4Q7MB 4A82A 2ZI9A 4QOSA 1SGWA 3RHFA 4A15A 4BFXA 4P4UA 4C0JA 3WBKA 221PA 3WNCA 1XTJA 2GCOB 2RGNA 4BFTA 5JSZA 2GAOA 1DEKA 1SXJC 2DBYA 3IKJA 4GFDA 2FPKA 2RGAA 5KNCA 1ZRHA 1ZIOA 1FUKA 3UXMA 3D8BA 4Q4HB 2QTHA 3LW7A 3UPUA 4B47A 3K9NA 3U61B 1ZD9A 1SHZA 1OIVA 2QZ4A 2XJ4A 4QBFA 4JMPA 3LRPA 5LPNA 2IEZA 2AWOA 2H18A 3OIUA 3QQ5A 4C0KA 2XB2A 3ADKA 3CLVA 3GJXC 4Q1EA 2B8WA 1K6MA 2ORWA 3ZVMA 1R8QA 2YNMA 3GLGB 3G5UA 2X1VA 4AIIA 3PEVA 1NF3A 1TQ2A 3AV0B 3PEUA 1GP2A 3QEOA 1T3HA 2JJ1A 4CEIA 1ZNZA 1NVVR 4DLYA 3ZD7A 3KUCA 4QBGB 4TT3A 2OCYC 3CH4B 1S96A 1JPJA 3AF0A 3CKLA 2QORA 1ZMXA 1E96A 1ZM9A 1CR4A 1AIPA 3CPEA 1G20E 2A30A 2R2AA 4D4JA 1KSHA 1ZW6A 2ORIA 3NC1C 1DAHA 4FMDB 1UM8A 4XVUA 3VNUA 4QBHA 4DDWA 5FUXA 1ZYUA 2AX4A 1QVRA 2HCBA 3GJ7A 4LWZA 2ZRCA 3IGFA 2WIAA 4LHXA 4BLTA 3MAAC 4PZLA 2GNOA 2IYZA 1RE0A 2QRNA 2VYFA 3QXSA 4MRNA 3L8YA 4RCYA 2ZE7A 1GKYA 3SFVA 721PA 2KB0A 3VR2A 4HUQA 3B60A 2G77B 1E3MA 2HCJB 5JS8A 3UMRA 3BB4A 1KK3A 3CO5A 3FFBA 2UZIR 3AGQA 3QBTA 2G1JA 1N5JA 4GMDA 5FBVB 2RGEA 2WMNB 1JAIA 1EGAA 1G6OA 1QHXA 1SXJD 1COWA 2C9CA 1KZ7B 4U7DA 1B0UA 4C0AC 3CRRA 5FTLA 3W6PA 4ZI2A 4DLVA 4L15A 2O8BA 4URZR 1E2QA 3AVUA 2GJ9A 2EWVA 3EPHA 3HYTA 1EG7A 4WW0A 2GVDC 1E9AA 3SNHA 2JLQA 2JLUA 4US0R 3TIFA 5BYKA 2Z43A 5JZVA 3GLFE 2GHIA 4BRUA 4LPSA 1XDBA 3L82B 3P4XA 1H8ED 4HZUA 1TF2A 3L2OB 4IOMA 3RS3A 1NN5A 3AEZA 1F2UA 4D4MA 4ZCMA 3CIOA 2J7KA 3AUXA 5JRJA 2QI9C 4PHTA 4AKHA 2BOVA 2AXNA 3PR1A 3P26A 4EPYA 2PBRA 4IOJA 5FI0B 2F55A 1I4DD 2CK3A 4DSUA 1E2IA 2F43B 4UXHA 4XWKA 2WAXA 3C14C 1XF9A 5DI3B 2X19A 3R7WA 1M34E 2KBEA 3DO6A 2QE7A 3IBGA 3AKDA 1CR2A 3A58B 3QKUA 4MRSA 4R98A 4URYR 4EUNA 4QJ5A 1G3QA 2B6HA 2Q3MA 3M1IA 1UDWA 4R2IA 5EQTA 3ZJYA 1DELA 1JNYA 2QSZA 2RHDA 5K8TA 1XEXA 1ZBDA 2RHMA 2VF8A 5EE0A 4RD1A 4PHGA 4Q66C 1AQYA 3FKQA 5GJWC 1EFCA 1EWQA 1OW3B 1KMQA 1U99A 2HXSA 3IQXA 1P61B 2PEZA 2ZJ2A 2FSHA 2BDTA 2DWOA 4OBEA 4MRRA 4B71A 3T06B 4AKIA 1YR9A 1H65A 1GUAA 2P6NA 1XX6A 5TMPA 3QXJA 1HUQA 4A6XA 4D4LA 5DGXA 3GD7A 4B2IA 3T1OA 1P62B 1QHNA 2OFOA 4JKYA 2FG5A 4GNKA 4YMVA 1CTQA 3I1FA 2R6DA 2WKQA 3GLIA 1P6XA 2ZR9A 4G5RA 4W5JA 4EQ6B 3AVWA 3B1YA 1OYWA 2Z4SA 3GLGA 3O8BA 2VPPA 1KI7A 5LB4A 1T91A 1ZVQA 4M9SA 4KFRA 4Q7LA 4NCJA 1CS4C 4R9UC 3Q5EA 5KSYA 2Q9BA 5FBQB 4M1MA 2RGDA 1U8YA 3V9PA 3UANA 2XNDD 2NTYC 4NMMA 5LD2C 1RRFA 4MYHA 2IWHA 2VSFA 3AP3A 2QTFA 3WMEA 3EARA 3KB2A 5CB6A 4URXR 2A5FA 1GAJA 3QF4B 1NG1A 3AF4A 3DOEA 1T5LA 4AKGA 3I32A 3BBPA 2OBNA 3TNFA 4ESHA 2X2EA 2CL7X 4EFNA 1G8GA 4BEBA 1GSIA 2Z0MA 4YMUA 3L0PA 3AVPA 4PX9A 1D2MA 3CNLA 4KAXA 2QP3A 4FWIB 1ETUA 3I61A 1OKKD 3WBJA 1LB1B 1KJWA 1NJGA 4MYTA 1EFUA 4NP6A 3UIEA 1US8B 1XU4A 5TV2A 2N42A 3QIAA 4PC7A 3ADDA 3RRZA 2Q0HA 2C03A 2RH5A 4GZMA 1KIMA 1OFIA 2ZSBA 3ZYCA 2WWIA 1VCIA 3NKVA 1X86B 1CLUA 4GSYA 3L0SA 3BOSA 3PUYA 2KJQA 2WOJA 1M7BA 4IDHA 2XX3A 3VQTA 2IS4A 1XXHB 4D0NA 4JKIA 1CXZA 4PC3A 4C30A 2FPMA 4ILEA 4O2LA 4Q18A 1EFRD 1Z22A 4YDSA 1OIWA 3K70D 4LHWA 4D0LB 5F9HA 3MFYA 3NDPA 3PENA 5M04A 2YYZA 4RVCA 3TH5A 2OXRA 2ATXA 1JEEA 2O8EA 1PLLA 1E9CA 1M2OB 4F38A 3GPLA 3H84A 2QM8A 3SOPA 4V0OA 3KB1A 1ELOA 4L9WA 1EFRA 2GJKA 5HPYB 2ECKA 1KSGA 5CDFE 2ZYUX 4XD7A 1W36D 4JT2A 3B6EA 4OK5A 1ZM2A 5KDOA 4DLXA 4GT1A 4LJ7A 5EXXA 5C4GB 2HEIA 3ZD6A 5JJIA 4GP6A 5FTKA 4M1TA 2V4ZA 2F43A 2QP9X 2D06A 3MJHA 3OESA 1HV8A 5KO2A 2CE2X 4BASA 2EW1A 4Q1CA 3I62A 4NYMR 4IXMA 3FVQA 4UNPA 2IXFA 1N6KA 3LV8A 4BE7B 5FPYA 1J2JA 3R7WB 4P4SA 1LY1A 3D3QA 2IS1A 4HAYA 3FHCB 3JVVA 1VYTA 2VHTA 2VH5R 1FMLA 4G5OA 3ZZUA 4DCSA 3I5YA 2WSMA 3PVSA 2P3SA 4ACAA 4QM7A 1E4YA 4IDPA 1SKYE 2V3CC 3KX2A 4EJSA 1Y3AA 5C46F 3I92A 1IHUA 2W0SA 3GCGA 4QM6A 2EYUA 3F5FA 4NYIR 4TSFA 5D3MA 1KAOA 5EP1A 4ZCIA 1MR3F 2QQ0A 2WJYA 4ABYA 1T0JB 5JEDA 4DXAA 4GP7A 2QT1A 1G21E 1G9XA 5EE9A 1R5OA 3AKCA 1P3JA 2BKUA 2QT0A 2J45A 4IXNA 1L7VC 5IRCD 4F7WA 3IIJA 3KXKA 4Q02A 2DB3A 2WWWA 3K9LA 2TMKA 4IDQA 3THXB 1W36B 1QHSA 5CITA 3AVXA 4PO1A 1ZJ6A 3HR8A 4LC1A 2OCPA 4HSEA 1NBMD 4XWOA 5DN6D 1SQ5A 1I2MA 1QHHB 1QF9A 4RD4A 2XSZD 5FTMA 2BCGY 4JVLA 2AR7A 2REXB 3QG5A 2N46A 5J4KA 3B13B 2FGKA 3GFPA 2ZIAA 1ZM4A 4HUQB 3AVYA 2HT6A 2OLKA 3GQBA 4Q00A 2ZJOA 3K53A 3VHLB 2BVNA 5J4LA 3IQWA 4HLCA 3W8NA 2MSCB 2QAJA 1E69A 2ZR0A 3P27A 4QGAA 1KSJA 5HE8A 3T34A 2ZYWX 4C7OB 3ZZ0A 2ZSDA 4GZLA 4OK6A 3LQQA 1TF5A 2VQSA 1CRQA 5A5GA 3ZZTA 4CEIB 1BYUA 2JA1A 3CNNA 1G1MA 4U00A 1VYVA 4ARZA 4Q19A 3TLXA 1NBME 1G18A 5CLQA 4CZ2A 3DZDA 3QPUA 1QHYA 1XBTA 4ZKDA 1NSTA 3GMTA 1T8TA 3U7EB 1SVMA 3C41J 5KOYA 1P2VA 1XP8A 4TMZA 4F4IA 2ZQ5A 4OJKA 5JECA 2JLVA 1EWRA 1WRBA 1F2UB 1KO4A 1T3LA 4ZDIA 2ZRHA 2GA8A 5FL3A 2OAP1 4JBXA 4IOLA 1CJVC 4KVAA 4BFYA 2XB4A 3B2EA 4P4TA 4NHOA 3W6NA 1YZNA 1G8HA 4WXRA 1D6JA 1IOZA 1LFDB 3OF5A 2DFLA 4KFSA 3UWOA 3FMPB 2JLSA 4G5QA 1OH8A 3SBEA 1MABB 2IXEA 1KKLA 2JATA 1AN0A 3FKSD 1E0JA 1W0JD 2QQEA 1N6LA 1E2MA 2JDIA 3LY5A 1U8ZA 1P75A 1Z0AA 1P4SA 1E2JA 1Z8FA 2GWHA 2W2XA 5A0FA 3MLEA 2O0HA 5CYPA 4FMBB 4TMWA 1CEEA 5AR1A 1XTRA 4DCUA 3HJNA 1KSFX 1SXJE 5JWOA 5JJLA 4WZ6A 1T8UA 3FYHA 3PXGA 4CIDA 5AJVB 3DL0A 1NVUQ 5EUQB 3LLMA 4DLRA 4WOPA 2V8OA 4M9ZA 2PZEA 1QVAA 4RD3A 1YVDA 3E5HA 3RS5A 2FMXA 4XVRA 1AGPA 2F3RA 3FMIA 5SZHB 3B7GA 4FMCF 2EFEB 3RS2A 3EPLA 4IW3B 1J90A 2R44A 1KAGA 1OFHA 2QMEA 3AGPA 4X8MA 4LY6A 5L8VA 1P9RA 3ASYA 3VU9B 4CT4B 3E1SA 2ZUCA 3OFNA 4M1OA 3EA0A 4M2LA 2GJAA 3RWOA 2FF7A 4A0FA 2L0XA 2NGRA 1I4LD 3K8YA 2ZE8A 3SYKA 1GOTA 2R6GA 1CULC 3CONA 3OIYA 3H4MA 2OZEA 4KFUA 4X8LA 1NI3A 1Z3IX 3WRYC 1VCNA 3U3RA 4C3ZA 3I3SR 4B3XA 1GL7A 3GP8A 1RJ9B 2VTKA 4B76A 3HR7A 1NKSA 2ZI3A 4HDQB 4MRPA 1E99A 5BXQC 4FXPA 2WWYA 2WJVA 1N0WA 2WM9B 3M0EA 621PA 2ZJ5A 3MWLA 1AM4D 1W5TA 3BB1A 3FPAA 3PUWA 1AJEA 1NP6A 4NE2A 1AZTA 4LJAA 4QXAA 2AK3A 4JLBA 4KVGA 1QRAA 4M53A 1LW7A 5C4MA 2NIPA 4PO8A 2RKOA 3MWKA 4DT1A 2C2HA 4YXWA 4MH0R 4C7OA 4JYCA 2ZRBA 4HATA 4TWZA 5JWHA 1ODFA 3RRYA 2JCSA 2NO0A 4N1AA 3U3KA 4GDFA 1RYHA 4RZ2A 1XMIA 1JB1A 2YJTD 1E2FA 2CDNA 1G41A 4B44A 2OILA 3P1JA 1D2NA 3GLFB 1FL9A 3LLUA 3NBYC 2CJWA 1XFAA 2PLFA 3LO5A 1ZNYA 5JI2E 1W44A 2NO1A 4BWYA 2GILA 1R6BX 4F91B 2F9MA 1S1CA 3IHLA 2XNSA 2I1VB 5FUYA 3LWNA 1UBFA 4HI0E 4RJLA 1YR7A 3KQLA 2SHKA 3KXLA 4R2HA 5KDLA 5JRZA 1TAGA 2GESA 2VA8A 1W0KA 1CJUC 2W6JA 5CJPA 3AM1A 1TQ4A 2O8BB 1A2KC 2OEPA 4A9AA 5HKKD 2IF0A 2WHXA 3AVTA 3K0CC 1PV4A 3U44A 5EZ6B 5DIFA 3X1DA 4R7ZA 1UKYA 4G01B 2ZS7A 3WHLA 4B33A 2ONKA 1NL3A 5KSZA 1FMJA 4PHFA 3WXMA 1RYFA 5A4JA 1YRBA 3VR4A 2JJ2D 1UDXA 4A8JC 5E3HA 3LBIA 1T0HB 1S2MA 4RD6A 3TUJC 3VNVA 2FGJA 4QFMA 3TSOA 2CCGA 1ZM3A 3NDBB 4PQYA 3LA6A 1XD9A 1KI4A 2Q21A 2C9YA 3LH5A 3DEFA 4C0HA 5SZIA 1YE8A 1IBRA 1E2GA 3KKMA 1T5IA 2WZQA 2H57A 4JL8A 1OE0A 4WZAE 3R20A 2HYDA 5B58C 1X1RA 3MG9A 3VR5A 1KOFA 4M1WA 2GXAA 4DVGA 6Q21A 1NMYA 2CXXA 5K8IA 1U90A 3TMKA 1X6VA 1OIXA 2V1UA 3TK1A 1GG2A 2R9VA 4X8OA 5DHAA 5DI9A 1JEDA 4XIGS 5FH9A 3EWAA 1UPTA 1U94A 1U8AA 3BERA 4QG7A 4DC9A 5DO9A 3IO3A 3B1VA 3SHFA 2PT5A 5K8LA 1KHTA 3CNOA 2O8FB 1HE8B 3BIFA 2C5LA 2VP0A 3GLHB 1ZCAA 2QPAA 3MJRA 4URWR 2GBLA 3O47A 4Z1MD 4K81B 5J40A 3BD9A 3SU8A 2IYYA 1DAEA 1Z0JA 2BMEA 2VSOA 3BC1A 2HUPA 1UKEA 1QBKC 1YU9A 2J41A 3RRNA 2QEQA 1W2GA 3U3JA 5CM9C 2K5UA 4Y0AA 5BN4A 4FCVA 3WP0A 2QGNA 2ZJ8A 5CK4A 1GILA 2EFHB 3NEYA 4NCHA 4V0KA 2BCJQ 2LCFA 3WMGA 4I81A 2W00A 2O52A 2DYKA 1Z83A 3TVTA 1FOEB 3UKDA 4YC7A 2IHBA 2FFAA
chains in the Genus database with same CATH superfamily
3EG9B 4E7ZA 2G9VA 3RJZA 2Q4EA 4GXTA 4ZO4A 5DWVA 4U7WA 2HK7A 3EZ9A 3PXXA 1ZKDA 4FKBA 1LM3B 2CBZA 3RKSA 1R9NA 1A95A 2I2AA 3IQZA 4G1VA 1VYKA 4QDOA 4DNOA 1RU3A 1PQPA 1YS6A 1Y9DA 4OHRA 4H6XA 1RMTA 1TZ2A 2CB9A 4H7DA 2Z6VA 4L9AA 4UNQA 4WNCA 4RTQA 4JD5A 3A9CA 4XYEA 4RTKA 3KOUA 4HB4A 1NFQA 3AFMA 3LS2A 4DCMA 3DAFA 1LFAA 4J91A 4R54A 3H4TA 1U5CA 1MAWA 3CZPA 4TLEA 1RFLA 3GGDA 1C3VA 3A32A 3TLYA 5CAEA 2CLLB 1Y89A 5AKJA 3AESB 1RCPA 5DOZA 2WK1A 3FCXA 1Z56C 3FKJA 1D3AA 3M79A 3FSEA 2EQAA 2MMCA 3P9ZA 4YAUA 3ANSA 1TTHA 3G8DA 1HFKA 1T5DX 2OV4A 1M1UA 3DDOA 5HFAA 3KWMA 3ZY3A 4DGSA 4KWTA 1XNQB 3HO1A 4K0KB 4XR9A 4BVEA 1N75A 4HFMA 2I9KA 3DR3A 2PSHA 5J5CA 5IS2A 3L1MA 2NW6A 3OP4A 1RVDA 2V6FA 3KV3O 4TKMA 4BB0A 2FRVA 4AROA 4BC0A 1CY7A 4JHXA 4R1MA 4MPPA 1YCFA 1TB4A 1R0ZA 2OD9A 4BGEA 2IPAB 4LQLA 4CLXA 5ULLA 4F11A 1S3IA 1A9SA 1TFKB 3NKLA 2XCTB 4BNJA 2SNIE 1OH5A 3ZJVA 4RNDB 4RU1A 3WFJA 1Z68A 2CT8A 5C1BA 1DJNA 4OUKX 4C0LA 3AHFA 3GFQA 2PFDA 1H1LA 1KI3A 1QFSA 4OYRA 4EY7A 5BN3A 1E9DA 4DV5B 3LNTA 1HE2A 3M6MD 1I4EB 2I03A 2ODWA 1IJEA 4LRSB 5AHWA 3X1XA 2YWJA 4HLUC 4MP6A 1ISFA 1OLXB 1VIDA 2FQYA 4CF5A 1YQWA 2AX3A 3IDZA 2OCGA 3W34A 1K0FA 1C4XA 3WFIA 5K6TA 2YV5A 4DZTA 4OQPA 4EDHA 3PQ8A 4R8RA 1NLYA 4NFYA 3HCDA 1WVMA 3RRXA 1I1HA 4RY2A 3D7MA 5B2ZA 3K1HA 3ZNPA 3WQQA 4EO9A 4AECA 4JLDA 3JD1A 2RGUA 4JA0A 2A6PA 3ZTYA 3L1JA 2J3EA 1GPJA 4QA9A 4DMFA 4PS0A 1PV3A 4K9KA 5SY6A 5FPHA 3B0UX 3AZOA 1IVSA 1VJRA 4LKOA 3ZX4A 3Q8KA 3A31A 4HAZA 2NSLA 3OEHA 1R37A 5ALMA 3SEFA 4DXDA 5HUHA 2Y9PB 1E32A 5EE5B 3UJ7A 3HYLA 2A9QA 1JBKA 3WGIA 1L5HB 2GEUA 3UAYA 4KBLA 2CF6A 1PD0A 4R0MA 3TSYA 4QDXA 4FWTA 3ZS9A 3R8FA 3THWB 1DPGA 1P0QA 4H0NA 4NJOA 4Y0VA 1XG5A 4D5EA 3BHMA 1KEVA 1YJCA 2EDCA 2J0UA 4UNNA 5DF1A 3RC1A 1HBJA 4KBGA 4YAKA 3TPFA 1N2HA 5IF9A 4LHYA 2I6GA 4MEJA 4NPAA 4EJSB 5GJCA 1GV0A 3DE9A 2KQUA 2BONA 9MHTA 4CNQA 3X1ZA 3TD2A 3JSZA 1BDMA 1GUBA 1DDGA 1H2RS 1H6BA 2EJCA 1DMRA 5FNVA 1N2ZA 4XTRA 1JJ7A 4YJ3A 2O7VA 3JPYA 1L7OA 3H2BA 1R74A 1ZAKA 4H1TA 4H7PA 1X1BA 4B3DA 3INRA 1IN4A 1SKAA 2C98A 2HJRA 4A6DA 4NENA 2E85A 1K40A 1NVDA 2CHQA 2CVPA 2DBVO 1WLYA 4GQBA 4N7MA 4Y9RA 5EWLB 3RFYA 2WJ6A 4EG7A 4OX9Y 1C1HA 3WZMA 3NBMA 4MROA 3KV1A 4RHFA 2LDXA 2VAMA 3FFTA 4TXJA 4OF4A 3SY8A 1OR8A 4JEAA 2ATVA 4Q47A 16PKA 1SF8A 2Q6KA 3HFRA 3ILSA 4BKRA 4EUEA 1CRLA 2MOKA 5DX1A 1M8GA 3ZVLA 3LFHA 2HF7A 3MSCA 3ND8A 4KOEC 2KHZA 1Z36A 1DFGA 1X3SA 1F6WA 1LBSA 4GKKB 2Z95A 1CF2O 2FKNA 3IVXA 5LOVA 1TD1A 2HF2A 2ZJZA 3FCCA 3JRNA 3LF1A 2XYRA 4GHWA 4H77A 4WZBE 1GITA 1NBWB 4L08A 2OKGA 4KQFA 3DVAB 5FWXA 1ZESA 3FPGA 3LYLA 3VOTA 2XVMA 1D0SA 5BOVA 5K7SA 2CGEA 8MHTA 1ESCA 1G6Q1 3L8MA 4HTFA 4J8PA 4CEHA 1ZP6A 2BRUA 2HYIC 2IXPA 2MSLA 3LXXA 2CCJA 1K89A 5AI0A 4FFVA 1EPUA 1RCUA 2AOTB 2PAAA 3DMTA 5DM60 1CIJA 4XQCA 4CKZA 1WDMA 3RNOA 1Q7RA 1W1WA 2Q6LA 2VTVA 4UASA 5DBIA 1SXIA 1G17A 2H1HA 4KIUA 4QPCA 1T35A 5AVKA 1ZHYA 1NZDA 1ZK0A 1YL7A 1H42A 3ENKA 5KMGB 1X38A 5BQPA 1X94A 4PONA 3ROKA 2UYGA 1IHXA 1EA7A 2HJHA 2LFDA 1QV9A 1FFWA 1FLVA 1RRGA 1XQ1A 4PLPA 4NOMA 4W63A 2CL5A 3R8CA 6PFKA 4NK4A 1UOQA 5JWRA 1UBTS 3VPAA 1CUXA 1F8GA 1DBSA 2D5BA 3H11B 2UYCA 1X7ZA 1DMSA 2VBGA 3K70C 4CDVA 2BLLA 3E4CA 2HSWA 3AWDA 3B7PA 4RJTA 3MTDA 3FOOA 1UXHA 3SJAA 1WETA 5BV8A 3GLFA 4B6OA 1DP4A 2H4WA 4HNAA 4L9SA 1U81A 3VPBA 4RF4A 3RTEA 5ALUA 1GTG1 2C7GA 4Y9UA 3LRTA 5JH7B 4INOA 3KTDA 2LKCA 1KMMA 4R01A 1QF7A 1GFWA 1SK9A 3JQGA 4P9FA 2HRZA 1Z6QA 2GFQA 2I6QA 1VI6A 2F17A 3U2QA 4U5QA 4AX8A 4WKBA 3OZAA 1CNFA 2ILTA 3ASVA 1W48A 5CCEA 5LXTA 4XGIA 2ZR7A 4HDCA 4CUJA 3JQAD 3ADBA 1C7ZA 4GZ5A 4ARCA 2B83A 1NW5A 3KKPA 1A4UA 4HEHA 2R97A 2NAPA 1P0IA 4YP5A 4IUYA 4EQZA 4CF6A 1TJ4A 4MQ4A 1C4OA 4Y2PA 3GRYA 3MRXA 5MN5A 2UUAB 2IXNA 3RK0A 4CL3A 2R7NA 3RNLA 2FCAA 1BA3A 4IV8A 5AXCA 3A6ZA 4BO4A 2WUEA 2WJIA 3CIFA 2P27A 3ESXA 4RFLA 2QUHA 2FQXA 1TCVA 3D3JA 2H85A 3LOUA 2X9LA 3NHFA 3M8KA 1IJFA 1K6XA 5CVCA 5GINE 1SA0B 3WNZA 2QYSA 5HMMA 1SZPA 3L1HA 1PBNA 2UZAA 3H2ZA 4ZI3A 1SHLA 4YAEA 5DK6A 3W2IA 4F7DA 2QRPA 2O57A 3OY7A 1CQIA 1WBJB 2CW5A 5AD1A 4D80A 2ID9A 2VYND 3FIJA 3IAFA 1IQUA 4UZFA 4YALA 2WMYA 4E5VA 2WKRA 5C2JB 1ZPDA 1RS0A 3NTUA 2GD1O 3NOXA 2QLBA 4OGWA 4W6QA 3TOVA 1ZKMA 2TYSB 1G8YA 3GJ6A 3BMQA 1Q1BA 4W8KA 1JR3A 3DLAA 3MINA 3MWJA 1AKRA 1IVYA 2XE7A 3SZ3A 3D02A 4HVAA 3Q7PA 2XXBA 3C6KA 3RH3A 5ARDA 4DCNA 3P19A 1SURA 3C7AA 3MGCA 2C0CA 2D5CA 2PL5A 1D0XA 2EIJC 3NETA 4ND2A 2QZSA 1SOWA 1W5FA 1Z75A 3HB4X 1SCKA 3OQBA 2ZCJA 1MDBA 1RWPA 1H4SA 3WLAA 1P6UA 1KJYA 1K2VN 3AOUA 1XZJA 3P32A 3EUWA 4W5HA 1HL7A 4WLEA 2E2WA 1L5FA 2AIRA 3OMLA 1AA9A 4U7GA 3A6PC 3FNQA 1TJ5A 3JATB 1LX6A 3PFCA 4YAJA 4QECA 3WY9A 2JGKA 3ZY6A 1XYGA 2O2YA 2VZEA 1FTSA 2W37A 3QHAA 3TRJA 2JH3A 2C8JA 4AYTA 4JBLA 4GZ6A 1A82A 3HXKA 3OTGA 4B6IA 3WLMA 4KPYA 2DSNA 2DMRA 2VEDA 3Q9NA 1AY0A 4I19A 4YCSA 3CVUA 3SBDA 3GAFA 3JR7A 1TD9A 1E9VA 5AMXA 3PDMP 1Q57A 4BO7A 3MCZA 3NAZA 1R0RE 2IIQA 5KYTA 2RG7A 4CYMA 4J1TA 2BLNA 1RLUA 1GPYA 5E2IA 5JCOA 2G40A 4ZYYA 4BWFB 2YUIA 4NARA 2B2CA 3CSDA 4FHEA 1EBFA 5IM4F 2BBSA 2CFSA 4TQUS 4BBAA 5ADWA 2YKGA 2CLHB 3WLHA 5TF4A 1GUYA 4FZ5A 1NF8A 1ZCFA 3S90A 2G17A 2IP2A 2IYOA 2FZEA 2YFQA 4ZC8A 1I14A 1NUQA 2R62A 1QO9A 1DQPA 1SCAA 2QGFA 1AGRA 3G68A 2ZR8A 5KYNA 5LQKA 4UTPA 1PWHA 3KSZO 3N75A 3SXKA 4CI0B 2XUFA 1XD2A 1BIFA 2BKVA 4KQ1A 1ABFA 1S3GA 3GQVA 3QKRA 2D54A 3M4YA 2B0JA 4RHTA 1QO0D 5INTA 4OJNA 3WIUA 2GASA 5TSDA 1D4ZA 1JHPA 2JB9A 4LRXA 4EPVA 2X22A 1HTWA 1YL5A 4JY7A 3Q10A 1SY7A 4HB0A 4X1KB 3J81k 2D5LA 4INZA 3A0UA 5CTJA 4CG3A 1L5LA 1K1EA 3IPAA 1MX1A 1MVNA 4QPPA 1CNMA 3RF3A 1R7RA 1LW6E 3F6RA 5ITZB 1FTNA 3E3NA 1IEVA 3EQZA 1NVTA 4BMXA 1U98A 1VXOA 4AKSA 2H48A 3JZDA 5A3QA 2J4DA 4YMIA 3HFGA 5GM1A 1LX7A 2Z5FA 1XRLA 4D25A 1G63A 3GAAA 3H1GA 3WL7A 1CZUA 1UZNA 3GP3A 1PD1A 3WICA 1B73A 4C3VA 4NJMB 4FAPB 2QLTA 4D57A 5BSFA 5HHTA 2ZJFA 1F8XA 4H2DA 5KYVA 3LYAA 5KREA 3I6ZA 1IQRA 3NEPX 4FN5A 4R5HA 1ONOA 1PNVA 2OV2A 3D0KA 4IMPA 3BDIA 4RKWA 5CTAA 6REQB 2OECA 1FW8A 3QE3A 4B75A 4JNCA 3Q7LA 4HQKA 2PG3A 3B53X 3ET5A 3UT6A 1HMDA 2AOXA 2HA5A 1DC8A 2XHZA 4GW3A 3H7IA 1EVLA 4YCBA 4R71A 3THYB 1RZRA 1E77A 3I37X 4UVEA 4EP1A 3K16A 3T5CA 2XNJA 1XRMA 3SF0A 3JZIA 2ZWAA 2J87A 4MVJE 4XX0A 3K94A 1LCIA 4FP9A 4MAMA 2BWJA 2YJNA 3QPWA 1E3LA 4A7PA 5I5GA 1H0SA 1S89A 2OHFA 2P2LA 1A72A 2QSUA 2W48A 3A1CA 3FNIA 1LF0A 2EZUA 2ZIXB 3AHCA 2H07A 3EQ9A 2B94A 3N2KA 3UWMA 4UMEA 5THXA 3LT0A 2Q07A 5GJVC 4P84A 4AMZA 1T6QA 1T29A 4K9LA 2H1WA 2IHTA 3C3AA 3HVHA 2XT9A 5IANA 1PJLA 2VB6A 1DRWA 2CKMA 2DOKA 4JENA 5I8ZA 3TEJA 2JBWA 3RIEA 5IDYA 2OV1A 1DTEA 3D59A 1A8SA 4W4TA 2C5HA 1P2BA 3OD1A 3OZTA 3SFZA 3QVUA 3ZG6A 1RKXA 2GM9A 3NU1A 5UKDA 1PDWA 1R2QA 1KYVA 2C8KA 3KKOA 4FINA 1YCDA 3W8EA 1EBUA 1ST6A 1ULTA 2ODBA 3A36A 4B6PA 3D0OA 1ZGBA 1K7SN 1SEVA 2R7QA 1SNYA 1YOBA 3HO8A 5ESDA 4AXBA 5KJCA 5LKRA 3KSBC 2Z3WA 4KXMA 3RSHA 2H1OA 2QY6A 1B6GA 2I4LA 3KL2A 4Q3BA 4MEAA 3TM5A 1WEHA 1N0HA 1QUEA 2B9EA 2Z6QA 2RCNA 5GAJA 3X2SA 1FX1A 1Z2CA 4ZCLA 1U7TA 3HL0A 3NW9A 1JSZA 4LBZA 1YZYA 1V71A 3EVGA 4OOFA 3HKBB 4OSEA 3N8NA 4Q4AA 1FVFA 5CNIA 2VKQA 1OROA 3O6VA 4D4HA 4A10A 1U0EA 4AMUA 1U7XA 2FJPA 1I2CA 2C88A 5U4XA 1UEJA 5LB2A 3SFTA 4E3ZA 4LYHA 1UJNA 1OY1A 3SHTA 3L8JA 4RY0A 4PWYA 1WKBA 5H8WA 4MW9A 2BD0A 5KJFA 1ZICA 3H65A 2AFHB 4MRVA 4TZ0A 1T9KA 1UAAA 1G38A 3FYUC 4HH3C 4DLLA 3K09C 3R1IA 4C0SA 2ZRIA 5FLYA 1PZGA 3E22B 4INAA 3N58A 3NHBA 2HXGA 1NM5C 2XBMA 3T35A 3TSAA 4BOYA 1KMHB 4BO2A 2QTZA 3GEGA 5B4VA 1Q19A 1CZRA 4FCWA 4JYZA 4Y6LA 2NU7A 3VKHA 2GLTA 4OJTA 2YC2C 1YS1X 3I6BA 1W46A 3U1TA 4HFKB 3KQSA 3FCOA 3ABIA 2A4MA 4CL0A 3FDIA 4OUDA 3AL2A 1I4TD 1EVEA 4M7OA 3CG4A 3ZY2A 2B37A 2HZBA 2WDZA 4G0HA 3BILA 1M3SA 4D0GA 4E30A 1JR3D 1GZSA 2J6HA 2W8ZA 3CMMA 3HVUA 3KAPA 4B0OA 2APJA 2ODEA 3QV2A 3LPLA 3H5WA 2HXYA 2FZWA 5DP1A 1XXLA 5G41A 5LQUA 1ACJA 2FMKA 2X4GA 1DUIA 2EFCB 5JH7A 1TYCA 2J5XA 3H9QA 2AHRA 3OFND 3OZ7A 4ZOQI 3RS9A 1OCRC 5ALXA 1PEAA 5AW5A 1NPYA 5I4CA 3TK0A 3DV0A 5ICGA 3DWWA 2FZ4A 3VV3A 3ET4A 3AF5A 4RY9A 5IT5A 1GPMA 5A1TA 4RWEA 1YXMA 3HLTA 5JVDB 1A04A 1ZNQO 4PPYA 3IT3A 1R18A 1M2JA 2PAFA 1SB8A 4AWXA 4EB6B 2IU4A 5DSTA 1Z5WA 3HJGA 1BTOA 2BHLA 1KYIA 3C3XA 4FBMA 1TAUA 1FNBA 3IBSA 3UA3A 3F7OA 3KZKA 4GO1A 3AUUA 3KLBA 2GJ4A 6ABPA 3T54A 1XEAA 2NXCA 1NY5A 1ZNXA 2YTZA 1T6XA 1UWKA 3I6YA 3JQ8B 2H5JA 3QYJA 3AY7A 3AR5A 4EF4A 3BRQA 2NWQA 3ZDEA 4MR9B 5ALHA 5ALWA 4Z7OB 4WJZA 3BRSA 4QSHA 2AKYA 2VF7A 5G4KA 4CMJA 3QH4A 3C6QA 4HNUA 5CFQA 2VAXA 3CR7A 3QMPA 4II7A 5F2EA 3DXJF 3C7CB 4R8KA 5EQDA 3ON5A 2BSAA 3AERA 4DBZA 2AHOA 3KKNA 4DUGA 2PJRA 2PJZA 4U5DE 1Q1EA 2JJYA 3N2KB 4CM9A 3P2JA 1Q0ZA 3BF7A 3ZGNA 4KBFA 5AVSA 4BP1A 1MX3A 1HSOA 1ZITA 1T25A 3BFXA 2VDUE 1HH4A 3G2QA 3HYRA 2FWIA 4HWSA 1MPXA 1P4HA 1P0FA 3EXG1 2HEGA 3RU2A 2ZM5A 1Z33A 4FHGA 2Q2VA 1KYYA 5B1AC 3H05A 4AU1A 3KQWA 3LZDA 3C63A 4HDAA 1Z28A 5G2OA 4JV5B 2V7PA 4KO1S 1CZHA 3RUAA 3HUFA 1V4NA 4GQHA 2A9KA 1DO2A 2ON6A 4DMHA 2GEVA 3OKPA 1T2CA 1ZGJA 3MB8A 4O1MA 2OGWA 2VC2B 3M1CB 4A8JB 1BH6A 1I7NA 3T52A 4FIDA 4CUZA 4UFPA 3RFVA 1LSJA 2R8XA 5CNJA 2Y93A 3EWNA 3LIIA 4GPTA 3UA4A 1NE2A 1B4DA 4E88A 3SDSA 3T1TA 4EI8A 3M4NA 5K0LA 3SYMA 4QWMA 4I1SA 5E4FA 3SLGA 5GJBA 4OXRA 5CVJA 5KWJA 2XMRA 1VGVA 3G5LA 2CNWD 4ER7A 2LIVA 4RXTA 3VI3B 1OB2A 3DMDA 3H2IA 4IVPA 3GNLA 4F92B 3LC1O 3OZXA 2I55A 1D0IA 2VBFA 2ZYTX 4Q48A 4Z9FA 2Y4OA 4R2JA 3WGYA 1Y7HA 5JC8A 2YW2A 3H5IA 2XZLA 2ZI7A 4H3VA 1JKXA 2WF8A 1E8DA 1BMQA 3GANA 1JZSA 3WYAA 1NLZA 1H1DA 2CLMB 1XKTA 4O4JB 3ZGXA 2XMGA 4PC6A 2I6FA 4ZTBA 1XRQA 3UAXA 4UXJA 4CBEA 1DTWB 4DIFA 3V6MA 3QF7A 3BD8A 2C9MA 1WSAA 4WINA 3IT1A 3FTEA 1KJ8A 4AJEA 1E4VA 3BICA 1YS9A 2J4FA 1VHWA 4YP9A 5IG2A 4ADSG 5ISMA 4HWTA 1RRVA 1Z2AA 2OWEA 2ZYHA 1Y3FE 3K0FA 1J97A 4TXNA 4X1IA 3QJYA 1BWPA 4TTSA 5AUQA 4D82A 4V1CB 1EDDA 2PWBA 5FPSA 2QSJA 4J1TC 2YASA 2J9ZB 3UK0A 3ESYA 4G0UA 3WMWA 3DM9B 3UM9A 3DR5A 2PGLA 3QFSA 2MJLA 4AJOA 1FNDA 4WERA 5JO9A 1LTQA 4AS2A 4QQNA 4U5FE 5E3AA 1ODTC 3DBOB 4I50F 4F9FA 4U9EA 5FAKA 1B3BA 1A5TA 3CURA 2C2GA 4A4AA 1L7AA 2OBXA 3BRWD 1P81A 1NJFA 1QIKA 3Q2OA 4UAGA 2GTHA 3D6FA 5ALGA 2CXTA 2E4YA 1DAFA 4PPNA 5LD2B 1S05A 5REQB 3W8DA 4RVFA 4PC1A 2J46A 3PX2A 4ND5A 5IBRA 6REQA 3CZ5A 4DNFA 5JHGB 3U49A 1A9XA 1F6BA 1N8KA 1KEPA 4KIFA 4PYQA 4EFDA 4G7ZF 3QPVA 2YRWA 1MU0A 1K8QA 2VCHA 2GKSA 1T6NA 3IUPA 3PJDA 1RLTA 3HKEA 1GVNB 2CD7A 1CVIA 2EKDA 1R15A 2ENUA 1OTXA 2NT4A 3OIGA 1FUUA 4JCOA 1IJKA 3TINA 1SU6A 3U1VA 1Z7EA 3TZLA 2CLEB 2VDNB 1S0UA 3DP7A 4IEIA 4LX8A 4DZRA 3K71B 4S3MA 4YRAA 2JVIA 3KAQA 2AFHE 5GADl 1B74A 3BXZA 1Y6DA 4I6GA 1RYYA 3UMIA 2A7XA 4NYJQ 5EKDA 3OQMA 3O83A 5EZQA 4XYMA 3D5EA 4IL5A 4FVTA 4PQFA 2E5LB 3FGNA 1NNSA 2ZETA 3SD7A 4RPKA 2B4KA 3W9UA 5LU9A 1D1QA 2D5AA 1TX4B 2FP4B 1DIOB 3CKKA 2ETSA 3VC3A 1YAUO 1H4TA 1UANA 1WQ1R 2I87A 4I55F 3MBIA 3RW9A 4BV2A 3KJIA 3QOXA 4F97A 2XS1A 5G3ZA 5L3SB 2WYWA 1A8UA 5A4KA 3HU3A 1AKMA 3PUZA 1GM5A 1EDZA 2BZGA 4IDNA 3HTKC 3B3FA 5KHOC 3LCUA 5P8WA 5FA5A 3P9XA 3E4DA 1NQXA 3KU4A 2PANA 2NV0A 5FOUA 3HNRA 4OQQA 2J5QA 4BNNA 4B74A 4QT4A 2HLDD 4MB6A 2LW7A 3IEXA 5EHZA 2XCRB 2EATA 2X6TA 3LFUA 4HTAA 3U9LA 5FFFA 1SHJA 4R2LA 1I4OA 1SBHA 4ZT7A 4LGMA 2OCBA 2XXAA 1JLHA 1V4VA 3W8RA 4DLSA 5IBQA 1QH0A 3JZAA 3Q9LA 1SU8A 2FW6A 2QVZX 3WHNA 3EAGA 1WS6A 2QD3A 4DYHA 5B3KA 3ZDFA 1U4SA 2HCRA 5COGA 1XA4A 1F4VA 1MIOA 1JUDA 1G7SA 2ERXA 3GDWA 3BMQB 4FYXA 1WLSA 1VKZA 3F98A 2JLCA 1F48A 1NJ1A 2B20A 1YA9A 3C4VA 4KXFB 4Q4LA 3UJPA 1AZLA 2R6FA 3DMGA 4C5AA 1JEYB 2MSKA 4ETMA 2VQEB 3E2IA 2GNPA 2ZYRA 5FWDA 2ASRA 5LMNB 3H9JA 1D2EA 1FRFS 2PQ0A 2R66A 2YWCA 1BAPA 1DDIA 1OASA 2GZMA 2J9UA 3WAKA 4EB0A 3U2LA 2IE0A 2WL8A 5DQTA 2I33A 1JF8A 3GOHA 4ZIRB 1G59A 2FPWA 4CVNA 2YXPX 3C98A 1QRTA 1WZEA 2YZMA 3BG5A 4IV5A 3BMOA 4ZARA 4RF5A 3UGTA 4HWPA 3WNBA 5FX2A 1E2BA 5FTNA 4RA9B 1JDBB 2Q6VA 1N5MA 4H4KC 5K3DA 2CNDA 1O2DA 1TLFA 3HG7A 4UHJA 3OQPA 9ABPA 1E0AA 2ZZNA 2BFWA 4FDVA 1X7YB 2R47A 1OAOC 2AXQA 1FQOA 1R88A 4JOSA 4MKFA 2Q2WA 3CH5A 4CL2A 3CLKA 4R3UC 2YL0A 4OFBA 1COWD 2HJ3A 2RMKA 2YVLA 3ZLJA 4RV4A 4X44A 2RONA 3FWNA 4UVHA 2WTEA 2RHWA 3LQ1A 1Q6ZA 4NECA 4RM2A 5D1NA 1NM5A 2V6IA 4G97A 4MA4A 2B8EA 4QUEA 2HV8A 3U39A 4YUWA 3GRUA 3EQ6A 2ODAA 4W9NC 4BNIA 4BO8A 3LUAA 2EW8A 2F1RA 2Q1XA 2A5GA 2X41A 4MUFA 1U7OA 4FEGA 2P6RA 2H17A 3NRJA 3OC6A 4YV7A 4E4YA 2R02A 1A7JA 2P9CA 1E7MA 4EB6A 3EWIA 4PQRA 4OCZA 1PJQA 1HO3A 2V9CA 3EYWA 3EW7A 3E8XA 1JIKA 1SMKA 1W6RA 1XT6A 4QD3A 4ZQCB 3O3NB 5CVDA 1QX4A 1Z06A 4B9EA 3GGPA 4LWQA 3TLZA 4F3KA 1I01A 2E55A 1GNQA 4PVDA 2VP3A 4ASUA 2LSEA 2C4NA 4RPGA 1J5XA 1LNQA 4A8TA 4CDRA 4DDUA 1C7FA 2ZDHA 2V7UA 1UCFA 4G1BA 1KAMA 4BNZA 4NQRA 1TOAA 4L4UA 4F45A 3HCFA 3KYCB 3CX6A 1A50B 2GRUA 2ZSAA 4NEGA 6LDHA 4JEMA 4Z3DA 4KX3A 1ZD4A 1F4LA 2FN9A 1Y7IA 3DWEX 3HYNA 3JD2A 4YQEA 3HR4A 4JJ4A 4AMBA 2ID7A 1PZXA 4B6GA 1DG1G 3NYJA 3COPA 4FFLA 2P91A 4KCGA 3AY6A 2QG9A 2DVMA 4Q4ZF 2I80A 1CUUA 1T3GA 2JI7A 1QGED 2XWBF 3IDOA 3IP3A 3GARA 1DBVO 1WZUA 3CX7A 3DZFA 3PUKA 1OXXK 1FQKA 5EIWA 5K51A 3S2IA 4BLWA 3K6KA 4ENSA 1EQ2A 4ZVPA 3ECAA 4RK1A 1KJZA 2GCEA 2OV6A 4RV5A 1F8FA 3GHHA 3I5QA 4LRTB 5F4ZA 3ZVRA 1EGHA 2J4CA 4MVWA 1KDTA 1P7CA 1YZFA 4BMDA 5LNK1 4EUKB 4JLUA 1XCMA 3C8GD 3HNKA 2PL3A 2NX2A 1GPH1 3LO8A 3WYFA 4R9RA 2PCLA 5BW8A 3LT2A 3IXLA 2NO9A 4MKIA 2XAUA 1I0LA 3UTCA 3L3BA 3OF2A 2XZTA 5HZGA 2PTHA 1F51E 2H2FA 4G5FA 3YASA 2DFKB 4ZV4A 3NTRA 2WKPA 3PPWA 4C0WA 2OO7A 3O8DA 2BP7A 3VAYA 3JSEO 2P6OA 1PR0A 2WJJA 3CU5A 4RPIA 2PIAA 1SVSA 3TOZA 1XZDA 1P7PA 2B34A 1D0YA 3ITKA 3M1LA 1DOAA 1SC3A 2BMVA 2QAGB 1LIHA 1ULAA 2QZPA 5F1YA 1LBHA 3BSSA 1AA6A 5HTOA 2GSDA 5F7JA 3H2GA 5LBUA 3T12A 3A6KA 2BGIA 1JYEA 1YRHA 4KN9S 4QNMA 3KZVA 1V25A 2Y0CA 4KNVA 2W4IA 3OURA 1PFQA 2ZTVA 3HZHA 3PRJA 4HQNA 1K5GA 1USVA 4C7VA 4CKCB 2QVLA 4OOEA 1FZTA 2X4DA 3UMCA 3Q88A 4NNJA 5FYQA 4LJLA 2X0DA 1GR1A 1KHHA 3C3WA 4X3OA 3LNCA 1C30A 3FUTA 4YCCA 1J5EB 4QU5A 2PVPA 1AKQA 5T41A 2W42A 2VJAA 1PAUA 2H65A 3NVKI 4OREX 2P3QA 1MXFA 3T9BA 4MDFA 4UCWA 1NBMA 1XZKA 2C2MA 2H3HA 3D7LA 2IS6A 4MQEA 4EZEA 3NC4A 3LBHA 5KYYB 5AKIA 1V16B 1CVLA 1JH9A 1CDZA 4KQ6A 3DJUB 1ZI8A 3BF8A 4KQMA 4QPZA 1U5AA 1G8FA 1WY7A 3BIOA 5A62A 1X1TA 2VZ8A 3AEYA 3D9QX 3A8TA 3ONFA 2XGJA 3N6VA 2AG0A 1Z6ZA 2MSWA 3E35A 3NWEA 4OXKA 3VDQA 3RIPA 1G19A 2P0EA 1WCV1 5JNLA 2JK0A 4ZQHA 3Q11A 4D2IA 3EXFB 2L6HA 3GJTA 2CSUA 4Q5IA 1GUFA 1TGVA 3AR2A 3CKMA 1P1BA 1P2GA 3G89A 3LL7A 2HBRA 4R32A 4AN1A 4COKA 1OX4A 1E1NA 2REQA 4K40A 4OGKA 5TMDA 2BL2A 3K6RA 1TQ6A 1O77A 2DH5A 4FFWA 5DJ5A 1YRQA 1MMGA 1CT9A 2ZRNA 3LX8A 5JTTA 4RQBA 3ZHOA 2R1VA 4EPRA 2J9BA 4R1TA 4Y2HA 4TVKA 2PZKA 4DMLA 5AW1A 4YN0B 3UC5A 3FPBA 2CHUA 1WMAA 3BJRA 3IJEB 5DT2A 2FNAA 4F96A 1M2VA 2ZRMA 4BZPA 2ASVA 2C2KA 2QT9A 3BMNA 3RVYA 2A9VA 2H1CA 3ED5A 3SM3A 3UV7A 3V5XA 3BH7A 1Y3CE 2OAQ1 2O3JA 4CM1A 4JHLA 4S1WA 4N3AA 4W99A 4TYQA 1OBHA 3CEPB 4LX0A 2QA5A 2VDQB 1KDRA 4RACA 1ST3A 4IJKA 3DJYA 1KJQA 1C1XA 3ICQB 2WIFA 4BNLA 5LA6A 4IQGA 4IWYA 4ALLA 1PL8A 3BAZA 2GHRA 1W2HA 1X9GA 2VT2A 1VI2A 1V9LA 3O75A 4KJZA 5B6JA 1BFUA 5I7FA 1L7BA 1JQEA 1DX6A 2Z98A 3PR3A 3OJ0A 4L0MA 5ECGC 2C94A 2DT8A 3U5ZB 2UYQA 3B78A 2WOOA 3BKXA 5HFNA 3RFTA 3WHPA 4XI9A 2X2FA 5K0JA 1Y9EA 3COJA 4XR4A 1RLIA 1W5AA 3GUCA 4FDLA 4HN9A 3PMRA 5HMLA 5IVIA 5AHOA 5M3BA 5TQ0B 3T6KA 3HCBA 4X5OA 5KPDA 1CQPA 3AF2A 5IEBA 1QOPB 2PSSA 1FYXA 3C6BA 2VH2A 3TSCA 4PYNA 4EVIA 1CUAA 3C3BA 4LYJA 2NLOA 1M56C 1SXGA 1H0RA 2H54A 5ERXA 5JCXA 3A9TA 4YUYA 4NDAA 1G8SA 4XARA 1S9HA 3GX1A 1VKRA 4P4SB 4TSFD 4ZCQA 2M4EA 2JGNA 4B8WA 5TJHA 3QV1A 1NMXA 3IEUA 3DQPA 3OZEA 1GJRA 1ODJA 1OWNA 1U2GC 2OCAA 3BH6A 3LQ2A 4JSTA 1G5HA 3EXAA 1MEOA 4KU4A 4D4NA 1I9CA 1IE3A 1AK2A 4C3EA 4DRZA 1WHTB 3NIDB 3PUIA 3C48A 4EOGA 2ADFA 3MCAA 4PF1A 1C9MA 2BUAA 4XZ3A 5TPZD 3RJMA 3BCSA 5IZ4A 5MGBA 1OYOA 2AA3A 3AG4C 4F71A 1SC1A 1KORA 1BE1A 3FNRA 1FJHA 4PGAA 3HA7A 5K3BA 1DJMA 1KS2A 4RPHA 1NXSA 1UKVY 4CCAA 4F04A 4HNGA 2XLWA 2V1XA 3VTKA 1L1EA 3HJAA 4KE8A 4ON9A 1G6KA 4U3JB 3RE1A 5KVSA 4PAOA 3THYA 5JPDA 1VXRA 4Y1RB 5FNZA 4IJWA 4EJSC 1CJKC 3CUSA 2O2JA 3A9VA 2ZAYA 4CQLA 4RDXA 1DV1A 1RACA 4JDUA 1NC1A 2XNHA 3GGOA 2FW0A 5FORA 5TVKA 3SX0A 4TZKA 1P1RA 2NUTA 1MV5A 1EX1A 4J0HA 4BMYA 2YYYA 1IM8A 4PJJA 5IABA 3KO8A 1CP3A 4WLVA 1NKTA 2J0XA 3QVLA 4HLUA 4WNAA 1T2FA 1XZ8A 2WWXA 3S27A 4URVR 2H52A 2PBZA 1XVLA 5EJEA 2NSFA 5DS6A 3FHDA 1HXHA 1OXKB 2A3NA 1IK6A 1J22A 1EGMB 2BHRA 1Q95A 1Y37A 4LBWA 2R6ZA 3AH8A 5KSOA 4KQEA 2CJWB 2HO4A 4YP1A 3OZDA 1CUFA 3D6HA 4GSLA 1Z6GA 2W2TA 1U3GA 1WIWA 2IYUA 1KYQA 4X95A 1SPXA 4C0BA 5EK0A 4F9GA 3GDOA 5HZKA 1E3EA 2Z5GA 5T3UA 1GUZA 2C61A 3HV0A 5F1KA 1GQRA 4D74A 2XDWA 3K4QA 2WQZA 4AG6A 2FEOA 3QUAA 4BNXA 3A70A 4AJHA 4BXOA 5TPWB 2OC9A 3T7CA 4GICA 2EAUA 1HDZA 4Z51A 1P9WA 1SUFA 4C6SA 4Q7KA 3TDKA 1WMFA 2RKWA 4JLVA 5D51S 4DC0A 2ST1A 3NT5A 3GT0A 2PFKA 2XODA 3WWPA 3OO0A 1CQJA 3IYLW 3ZCVA 1XZGA 1VDZA 5TXGA 2PZJA 3GRRA 4TV9B 2ORED 1YZGA 4KZPA 3T1NA 1O6FA 3VO9A 4QUGA 1G20B 5JQGF 2A68F 1MMFB 1F60A 1G4AE 1YDHA 2EZ9A 3MWEB 4QOIA 1D09A 3L02A 1N2IA 2HK9A 5E2BA 1WZIA 2XDQB 4E18A 2BFFA 2BR5A 2I2FA 2VH1A 4UQLA 4BYMA 4LUCA 3SXUB 1EK6A 2JZCA 3Q41A 2BKEA 2IGTA 4GEGA 2COUA 2XUDA 5DXFA 3VKWA 2Z57A 4RULA 3GGGA 3L7BA 1J1UA 2CEKA 2CFOA 1TLTA 3PNBA 3DLBA 1YDEA 2JI9A 2G0AA 1I6KA 1ETHA 3AEUB 1WP4A 4QJ3A 3B89A 3P4UA 1W8IA 3PJEA 4NZYA 4KUHA 5GZ6A 3HKCB 2OO5C 2A5DA 1LE2A 2HPZA 3AI2A 4BMPB 4Q4CA 5A4FS 3KS9A 1LS1A 1VJTA 4G67A 3WL6A 2QPLA 3ZGZA 4RD0A 2QRUA 1BXZA 1SB9A 3KOZA 7MHTA 1QC5A 2JBAB 4EG5A 1GV1A 3SJ7A 1LRJA 3ATPA 3IQCA 1QFMA 1RRPA 3BXEA 3QYPA 4DJTA 3VVLA 4DWVA 2GD2A 1PNOA 1EX7A 5J58A 2I3BA 3HXLA 1JZQA 3GLQA 4MHSA 3ZWCA 3C1AA 4B6EA 5GP1A 3JRTA 4GX5A 3VV2A 3G5MA 4UDVA 1TO6A 2P65A 3INGA 3REGA 2UVQA 3N2GA 1NVMB 5JDCA 1U2RA 3S28A 2XECA 3OIWA 2NZJA 4LYDA 3W4KA 1OU0A 2ECPA 1A1VA 2ICAA 3QVGB 3RS0A 6AT1A 4OLBA 4KQ2A 5L6MB 1GIAA 3GUZA 5ELMA 2GK6A 5IMSA 5JBIA 1I2BA 4M3NA 4MP8A 3FRJA 4FFOA 2F6RA 1DI0A 2P5SA 1JIJA 3CV3A 3ENVA 3AL3A 3Q6IA 3AV3A 4DR3B 4ID3A 1UDBA 1EVJA 4UM9D 4FNMA 1CF9A 2EHJA 2R7AA 2YMPA 3MCTA 3N53A 1RKCA