3LLIA

Sulfhydryl oxidase fragment of human qsox1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
251
Chain Sequence
ADRSKIYMADLESALHYILRIEVGRFPVLEGQRLVALKKFVAVLAKYFPGRPLVQNFLHSVNEWLKRQKRNKIPYSFFKTALDDRKEGAVLAKKVNWIGCQGSEPHFRGFPCSLWVLFHFLTVQAARQNVDHSQEAAKAKEVLPAIRGYVHYFFGCRDCASHFEQMAAASMHRVGSPNAAVLWLWSSHNRVNARLAGAPSEDPQFPKVQWPPRELCSACHNERLDVPVWDVEATLNFLKAHFSPSNIILDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Sulfhydryl oxidase 1
publication title QSOX contains a pseudo-dimer of functional and degenerate sulfhydryl oxidase domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 251
sequence length 251
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
A PF18371 FAD_SOX Flavin adenine dinucleotide (FAD)-dependent sulfhydryl oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3lliA02
1.20.120.1960 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3lliA01
3U2MA 3LLIA 1OQCA 4E0IA 3GWNA 3O55A 4LDKA 3LLKA 3R7CA 3U2LA 4E0HA 3TK0A 2HJ3A 3TD7A 1JRAA 3GWLA 1JR8A 3W4YA 3MBGA 3U5SA
chains in the Genus database with same CATH superfamily
2P7VA 5DQZA 3F47A 1LVKA 4ULWA 3RF3A 4UDVA 1OQCA 2XL4A 4PACA 4AX2A 1EKYA 2YL3A 4HFKB 3UMHA 2Y3HA 2YZSA 4E7SA 1KNYA 4GEHA 3C8GB 1PV3A 3DZAA 3UMKA 3RIPA 3JSEO 1Y4CA 3OWTA 3F46A 2IOQA 1BR4A 2IYLD 4XEKA 4JRZA 3S90A 1H9TA 2QUPA 3EFOA 5L3QA 1WN0A 2B0HA 2Z15A 3EQLF 3B0UX 1QKRA 2LK4A 3QW0A 1QLEC 2OKUA 2XLDA 3JRMO 2G3VA 4K0DA 5JUAA 4BEMJ 4KC9A 3W8HA 1M2VA 1E2XA 3T9OA 2RSEB 2R9RB 4JTCB 4MVOA 3AJMA 4JC7A 3H2UA 3AG3C 2XXAA 2OU6A 1OR2A 3HLZA 4YL0A 2GA0A 2J9WA 2HKVA 1Z23A 4ZLCA 2D5RB 2J46A 1SYQA 5JS5A 1HY5A 1A7DA 3QZCA 3N0TA 4MVMA 3NG1A 4H54A 3C8GD 3GANA 3G50A 5L0FA 1GGQA 5F5FA 5EK0A 3SZRA 2LFFA 1R4TA 4GYTA 1LE2A 2OOCA 2YL7A 2IM8A 4IWBA 3FMSA 1OXKA 4XWJA 4J7TA 2P1AA 4RBNA 4F4BA 3IEEA 3NYLA 4E17A 2CNWA 3AG4C 2EIKC 3ATPA 3EG9A 3FDQA 1OCRC 1G5ZA 3IQCA 3LEVA 3VYWA 1SR2A 3TQOA 5BQIA 2HV6A 1A0BA 4NQFA 4EBKA 1M57C 3JYYA 2YEVA 4IB4A 1JPJA 1VK5A 1G4US 2OEXA 2ZPAA 3LLIA 3B0PA 1L7CA 1CGNA 1BBHA 1NFNA 2ZXWC 2L6HA 1IZMA 3DE8A 3W8IA 1XZQA 4BJ5C 3I5PA 5CI8A 1L3PA 1LS4A 4IJJA 3R7CA 2A68F 4JJFA 3RYLA 4EBBA 1E83A 4G7OF 3SP1A 1AUEA 3RQEA 3U3FA 4YJWA 1OW8A 3C8ZA 3GODA 3HNIA 2FFHA 2F22A 2Y3DA 2LSEA 3S27A 5DLJA 1YJGA 1J8YF 4YT4A 1ZW2A 1VLSA 2VCBA 2LP4A 2Y69C 4YL3A 4C7OA 3U8VA 3W4YA 2W9YA 1MMAA 4CDVA 2R7RA 4K1OA 1T6IA 3U5SA 3KKBA 3QVZA 1OCZC 4CS8C 2D4UA 3DI5A 1NSGB 3Q6MA 4J30B 3FAJA 4XEVA 5E33A 5A69A 1ZHYA 2OCCC 3Q7GA 2HMQA 2LCHA 4JTDB 2DYRC 1NLXA 4Q4ZF 1LS1A 2J9BA 1QVXA 2DB4A 1Y6DA 2HJMA 1AEPA 2NUPB 2L7AA 1A7VA 4FAPB 3G4XA 4P9TA 2UUIA 2J9UA 2PX3A 2EIJC 2YVKA 4YT8A 2CYDA 1ORJA 5DQTA 3MLGA 4U5GA 1EA8A 1T6QA 3EG9B 4K7BA 4MS2A 4KBLA 4CX9A 2GFHA 4PJJA 5L0GA 3NMKA 3POVA 3H2VA 1ZHZA 4D4XA 2A0BA 4N6CA 2L9JA 4LDRA 4W8KA 2VASA 2XM0A 5KYNA 2A69F 4ER9A 1ZHXA 4IAQA 1JAFA 2XLWA 4O6YA 3VRCA 2RD9A 2R7VA 3EGDA 2G3KA 2LIGA 2OJED 3K7DA 4XPWA 1TWGA 3KL4A 3LJBA 3IQTA 2J7PA 1I4YA 3U2LA 2KSFA 3HTKC 5DS5A 1TWCA 3IQ6A 1CPQA 3DXJF 3EGXB 1VYKA 3L34A 3A9CA 5B3IA 4P6IC 1MMDA 2JX0A 4NY3A 2YRFA 5COFA 3UGOA 1G4WR 1ORYA 3S28A 1HMDA 3ZSUA 2Q9AA 4C7OB 1LIHA 3VAYA 4DXWA 1YA7O 1YAUO 3MBGA 3RFYA 2AVKA 5AGFA 3PCVA 4YK5A 2G62A 4XPYA 3O6XA 1TWHA 4HEAJ 3RVZA 3NMJA 4JCZA 2P6VA 2EPNA 3DAFA 1V4AA 4MTOA 2QY9A 3SYNA 3LS1A 2NG1A 1LM3B 3TOMA 4JE9A 2C03A 2HFIA 1GQAA 3UR3C 3IPMO 3K33A 5KYXA 3B9QA 4WJ0A 1Z5ZA 1TFKB 5A6BD 1YZCA 1C17M 3GEIA 5F5HA 3VF0A 2KW3C 1SMYF 4IARA 4OINF 1V55C 2ICWG 2IXMA 2NUTA 2Q9BA 2XLEA 4CS8A 1C02A 1VTMP 2P0NA 256BA 4J32B 3CEXA 3L8IA 3B71A 4JW1A 1BR1A 3DE9A 4XEFA 4EWCA 2OEVA 2AP3A 2PF4E 2BL2A 2PFDA 3SXZA 2H7OA 4EBJA 1OR3A 1FFHA 1YYJA 2HMZA 3JT1A 4U5BE 4WABA 4E18A 5BQHA 1APCA 1YZAA 4KNWA 3M4BA 4JKVA 1Q0MA 4RD9A 2PNOA 4JURI 4XQ1A 3E9VA 4U5DE 3HJCA 4JEBA 5BQGA 3KMIA 4XLNF 3AOUA 3JTLO 5AC5A 2WB7A 1I5NA 2GWWA 3EGDB 2DYSC 1D1AA 2NSGA 4CIHA 1SZIA 3ABKC 2M64A 4ONSA 4U5EE 2R7XA 4EUKB 1NZEA 1ZHTA 3SNHA 1FMWA 3GM1A 3TK0A 3C18A 2R7WA 1CPRA 3I5QA 5HV9A 3RQFA 2L6FA 3DAGA 2FAPB 1H6GA 1BDJB 1RJ9A 2YLIA 3J06A 2HSBA 3G4ZA 2EIMC 1I4ZA 2NSFA 1LI7A 4A4AA 3V7OA 3GEEA 5CI9A 3MYFA 3WAQA 3K66A 2NPUA 4NTBA 4MVZA 1U0BB 1FTSA 3N2ZB 1S05A 1Z63A 2WZFA 2XRHA 1WWPA 1MNEA 3JCUQ 5KYWA 1FFTC 4CDAA 2QNLA 5KYUA 3VM6A 4R32A 4AL1A 1H9GA 1VMAA 2KK1A 2Q3TA 3DJNB 2A1DD 5DS4A 3K1HA 3RQGA 3EHNA 3JSZA 4YWQA 5KYXB 2JD3A 1ZU4A 2EPOA 4BJ6C 5A6BA 4QI2A 4CS7A 4PJLA 1TFOB 1D0XA 2XLMA 3K1IA 1RKEA 5EGYA 2NUTB 3SXKA 2QTVA 2R02A 2J7PD 3EFOB 3CQZA 4XLPF 2R25A 3L8JA 4D4NA 2XS1A 3S0XA 3RW0A 1YA9A 3ZTZA 1N1CA 1MQVA 2V26A 4HFFB 1WATA 4O7GA 2AWYA 3TD7A 3ASOC 2R7QA 3JRTA 4U5CE 1WOLA 4M63A 1JMWA 1M2VB 1V54C 4OD5A 5B3SC 5L0JA 3NDBB 1HE9A 4N06A 2J9VA 2XXAB 4XTKA 3A11A 4MVRA 1G8XA 2IXNA 2IXOA 2WZLA 2EPKX 2YLDA 2MYSA 4DRIB 3C62A 4OIRF 1T9KA 2MHRA 1EQ1A 3FAPB 3QMKA 3EPVA 3NYMA 3ZIBA 2YL0A 4GQHA 3PDMP 1HW2A 4OIPF 1KU2A 2L6GA 3GM3A 1PD1A 1OKKD 1DOWA 2XS8A 3MYIA 3V5XA 4IAOA 4XPXA 1WGWA 2CCYA 3O10A 3LS0A 5DVWA 4ANJA 2YHSA 5T3TA 4BPMA 1K05A 2VH3A 1ZZPA 1J8MF 1R5ID 3EZIA 1D1BA 3DJUB 2HJ3A 3AQCA 2VCAA 3MX3A 1RJ9B 3MFNA 3W2VA 1LPEA 2PX0A 3EH1A 1UG7A 5CIVA 2FGYA 3KPHA 4LDQA 2R7TA 3ZVRA 5L0IA 2B0JA 2LFDA 4DBRA 1YVIA 3T6GB 1ZU5A 4CJOA 5L3VA 2XM4A 5KYWB 4E0IA 1YLMA 2R03A 1VB5A 2KGOA 3GORA 4PFPA 5A6KA 5A6JA 2XL6A 4U9DA 3ZDLA 2WVOA 4KNVA 3HNJA 3IHUA 4CS9C 3V5YA 3FOOA 3FVYA 5E2QA 1F1MA 3US6A 4B6IA 1BZ4A 2OG2A 1O87A 4C3DA 3ABLC 1RKEB 3NKDA 1YDIA 4MNDA 3U9MA 1O5HA 1NU7D 2HUJA 5L0HA 4Z9IA 3HKKA 3HNLA 4JZAA 3S9OA 2C04A 4BJ1A 3L0IA 3L1MA 1T01A 2IBFA 3CSKA 4AE4A 2I8BA 1ZW3A 3TOLA 1NU9C 2Q7RA 4AL0A 3UMIA 4BJ6A 2GAQA 3LEOA 4MVSA 4EHPA 5A6AA 1FNTc 2H7BA 1M56C 3KYJA 3NKEA 3T4RA 1A7EA 3AG2C 3UNGC 4I1MA 3E70C 3K1IC 4JVSA 2KYHA 2HS5A 2W4BA 2ZXRA 3AGUA 4L6RA 4WGYA 1QQ3A 2A0UA 2GDCA 4PFOA 4I3MA 2KC3A 4G0HA 4YT5A 3ZTMA 1E85A 2DI3A 3NRHA 2KNHA 3LNMB 4O6NA 3KH2A 4W8PA 3S29A 2AWCA 2J8WA 4LDKA 4MW8A 5B1AC 2JPUA 5B1BC 1OKKA 2YKZA 3FHDA 3ZQVA 3ITFA 4G7ZF 2TMVP 3I4UA 5HSWA 1MMGA 1SF8A 4E0HA 4JCHA 4JEAA 4LACB 5EHHA 4G7HF 1Q0GA 1FAPB 1XZPA 4FX5A 2OJQA 4NTFA 2BE5F 3ZG1A 5JLIA 5JRAA 2R05A 1Q0KA 2Q9CA 2XLOA 1YARO 1E86A 2ASRA 4CJGA 4YT2A 2R7OA 2WVNA 1LE4A 3M79A 3FOPA 3KYIA 1HMOA 4BG0A 5D92A 3V5ZA 3U2MA 1QZXA 4OD4A 2X0CA 2Q4FA 3Q7LA 3WG7C 3U0CA 4I44A 1WTYA 2BC5A 1ZHWA 4MQ9F 2J0XA 1FR0A 3OEOA 3ABMC 4MTFA 1GS9A 1M2OA 2IXPA 1QPUA 3S84A 4OIQF 1O3UA 4LLCA 3LLKA 2KQ9A 2KJGA 5FZTA 1ZVZA 2P61A 2Y39A 4Q5SF 3OA1A 4FESA 4DRJB 4PK4A 1Z6AA 1S7ZA 2XLVA 4BJTA 2W4MA 3UGPA 4ZLDA 3N24A 4LERA 1U6HA 4PJMA 4DBQA 3GEHA 2VB6A 3FXHA 3M15A 3TJ6A 4AE4B 5L0DA 4U5FE 1E84A 4J7YA 1OW7A 5DS6A 1MMNA 1Q0FA 3LESA 4CS9A 4Z9HA 5JT4A 4DRHB 1KTMA 4O6MA 4FWVA 3BRJA 2M4EA 3AGTA 3U9JA 3M1CB 2ETSA 3QTHA 2Y3BA 3T6BA 2QLAA 1XWJA 4QDLA 4DVZA 4CSAC 1YYXA 3DD7A 5E3CA 2CDQA 3CAXA 4N6HA 1RMVA 1CGME 3GM2A 5F28E 2NUPA 3QVYA 2OQMA 3NMIA 3R2PA 3EJNA 1Z3IX 4NTAA 3TULA 3DMDA 4P9FA 2E87A 2YWAA 2Q00A 1TWAA 2I15A 3TJ5A 2PP4A 3ECSA 1D0ZA 5E3AA 1M6TA 4JTAB 1TKNA 2X51A 2XLHA 1H7IA 3B29A 3GWLA 4QI0A 2HV7A 1D1CA 2LQGA 2PBEA 2UUHA 3LUTB 3EH2A 4MVUA 3PMRA 1K04A 1D0YA 1OCOC 1FMVA 1OCCC 2R7UA 4IRUA 4ULVA 1TQGA 4C3EA 5L0CA 5T1DB 2EPMX 4YL1A 1LI5A 1VOMA 3Q6NA 3HNKA 4RDAA 1BR2A 3ZC4A 1MNDA 1ST6A 2CW0F 3RKOF 4JIOA 1NG1A 4NCQA 1EI7A 3T6JA 4KI2A 3PHF2 1W2WA 1JPNA 2L81A 2ZXOA 2AU5A 3DM5A 2LD6A 3EGXA 4IGGA 1GM5A 4N4WA 4DVYP 5IY5C 2H7VC 2XSEA 3RVYA 5JP7A 2YL1A 5T3WA 1T5OA 3DM9B 3SEOA 4PJNA 4PR9A 2VC9A 1PCXA 4BEJA 1VLTA 2HSQA 3QW1A 1RXQA 2MWQA 2DGJA 3ZQYA 5KYYA 1RKCA 2J0WA 3O55A 4LLEA 4C3BA 4DOZA 4EKWA 3JYHA 4CBEA 3AQBA 1PD0A 1U89A 3X2QC 3GWNA 5KYUB 4U9EA 1IW7F 1WASA 3WODF 2O9XA 3CZ6A 3DWWA 2VCCA 1AVOB 3C8GA 1LKXA 1HE1A 2J45A 3DKAA 1T6UA 4Q7CA 2Y3GA 1VYIA 4CIPA 4HE8D 1ORSC 2CGEA 3O39A 2A6EF 3WHNA 3EZHA 4CSAA 3RH3A 1JOGA 5K0IA 2XL8A 1C03A 3C7JA 1NBBA 1Q0DA 1JRAA 2V3CC 2W45A 5GPGB 1JR8A 3M4CA 4MW3A 5BUOA 3K6BA 1UFBA 4Z9JA 1TR2A 3EHMA 3ASNC 1OW6A 1OXBA 1CGOA 5JSLA 3NYJA 1A41A 5TJ5E 5FCLA 2WZGA 3C63A 3SXYA 1RCPA 3AG1C 4CDYA 3B0VC 4E7ZA 2QE9A 3SXMA 4U5HA 1ZYRF 5AC4A 1NFOA 4JJGA 3X1OA 3U8PA 4EIYA 4NC3A 2WL8A 2H8AA 2HZ8A 5COMA 5JVEA 2R7SA 3BEHA 3LNRA 4MTGA 5D91A 4I1OB 3JZ0A 4X0RA 4OIOF 2EINC 4H4KC 4DJ9A 4O79A 3ZWIA 5COGA 1B68A 1DOVA 4WGZA 3H65A 1K40A 2YLGA 4A2NB 2ZXPA 3LAYA 3IQ5A 4YN0B 2CNWD 2ZD9A 2WVQA 3U3BA 2YQYA 3W2WA 2EILC 1QSPA 1HW1A 4BJ5A 2A6HF 4G78A 2EPLX 5KYYB 1Z7Qc 4MVQA 1V74B 4AK9A
chains in the Genus database with same CATH topology
2P7VA 5DQZA 3F47A 1LVKA 4ULWA 1OQCA 2XL4A 4AX2A 4HFKB 3UMHA 2Y3HA 2YZSA 4E7SA 4GEHA 3UMKA 3DZAA 3RIPA 3OWTA 3F46A 2IOQA 1BR4A 2IYLD 3EFOA 5L3QA 3EQLF 2Z15A 3B0UX 1QLEC 4K0DA 2G3VA 4KC9A 3W8HA 1M2VA 2XXAA 3AG3C 3HLZA 2J9WA 1Z23A 4ZLCA 2D5RB 2J46A 3QZCA 3N0TA 3NG1A 3GANA 3SZRA 4GYTA 4IWBA 4XWJA 4RBNA 4F4BA 3IEEA 3NYLA 2CNWA 3AG4C 2EIKC 3EG9A 3FDQA 1OCRC 3LEVA 3VYWA 2HV6A 1M57C 2YEVA 1JPJA 1VK5A 2ZPAA 3LLIA 3B0PA 2ZXWC 1IZMA 3W8IA 4BJ5C 3I5PA 5CI8A 4IJJA 3R7CA 2A68F 4JJFA 3RYLA 4EBBA 4G7OF 3SP1A 4YJWA 3GODA 2FFHA 2Y3DA 2LSEA 3S27A 5DLJA 1J8YF 4YT4A 2Y69C 4C7OA 3W4YA 2W9YA 1MMAA 2R7RA 3U5SA 3KKBA 1OCZC 4CS8C 5E33A 3Q6MA 4J30B 3FAJA 1ZHYA 2OCCC 3Q7GA 2DYRC 4Q4ZF 1LS1A 2NUPB 2J9UA 2PX3A 2EIJC 4YT8A 5DQTA 3MLGA 4U5GA 4K7BA 3EG9B 4KBLA 2GFHA 4PJJA 3POVA 1ZHZA 4W8KA 2L9JA 2VASA 5KYNA 2A69F 1ZHXA 4O6YA 2R7VA 3EGDA 2G3KA 3K7DA 1TWGA 3KL4A 3LJBA 2J7PA 3U2LA 3HTKC 5DS5A 1TWCA 3DXJF 3EGXB 1VYKA 3L34A 4P6IC 1MMDA 4NY3A 3UGOA 3S28A 3ZSUA 2Q9AA 4C7OB 3VAYA 3MBGA 3RFYA 2G62A 3O6XA 1TWHA 4HEAJ 2P6VA 3DAFA 2QY9A 3SYNA 3LS1A 2NG1A 2C03A 3UR3C 3K33A 5KYXA 3B9QA 4WJ0A 1Z5ZA 5F5HA 2KW3C 1SMYF 4OINF 1V55C 2IXMA 2NUTA 4CS8A 2Q9BA 4J32B 4JW1A 1BR1A 4EWCA 2PF4E 2PFDA 2H7OA 1FFHA 3JT1A 4U5BE 4KNWA 4RD9A 4JURI 3E9VA 4U5DE 3HJCA 3KMIA 4XLNF 2WB7A 3EGDB 2DYSC 1D1AA 1SZIA 3ABKC 4U5EE 2R7XA 1NZEA 1ZHTA 3SNHA 1FMWA 3TK0A 2R7WA 3I5QA 3DAGA 1RJ9A 2EIMC 3V7OA 5CI9A 3K66A 1FTSA 3N2ZB 2WZFA 2XRHA 3JCUQ 1MNEA 5KYWA 1FFTC 5KYUA 1VMAA 2Q3TA 3DJNB 5DS4A 2A1DD 3K1HA 3EHNA 3JSZA 4YWQA 5KYXB 2JD3A 1ZU4A 4QI2A 4BJ6C 4CS7A 4PJLA 1D0XA 5EGYA 2NUTB 2QTVA 3EFOB 2J7PD 3CQZA 4XLPF 3S0XA 1N1CA 2V26A 4HFFB 3TD7A 4O7GA 3ASOC 2R7QA 3JRTA 4U5CE 4M63A 1M2VB 1V54C 5B3SC 4OD5A 3NDBB 4N06A 2J9VA 2XXAB 4XTKA 1G8XA 2IXNA 2IXOA 2WZLA 2MYSA 4OIRF 3QMKA 3EPVA 3NYMA 3ZIBA 4OIPF 1KU2A 1PD1A 1OKKD 4IAOA 1WGWA 5DVWA 4ANJA 3LS0A 2YHSA 5T3TA 2VH3A 1J8MF 3EZIA 1D1BA 3DJUB 2HJ3A 3AQCA 3MX3A 1RJ9B 3W2VA 2PX0A 3EH1A 2FGYA 2R7TA 3ZVRA 2B0JA 4DBRA 1ZU5A 5L3VA 5KYWB 4E0IA 2KGOA 4PFPA 2WVOA 4KNVA 4CS9C 4B6IA 3FVYA 5E2QA 2OG2A 4C3DA 1O87A 3ABLC 3NKDA 4MNDA 1O5HA 1NU7D 4JZAA 2C04A 4BJ1A 3L0IA 4AE4A 3CSKA 2I8BA 1NU9C 3UMIA 4BJ6A 2H7BA 1M56C 3NKEA 3T4RA 3AG2C 3UNGC 4I1MA 3E70C 3K1IC 4JVSA 2W4BA 2ZXRA 5F5FA 1Z63A 4PFOA 4YT5A 4I3MA 4G0HA 3NRHA 2KNHA 4O6NA 3KH2A 3S29A 4LDKA 5B1AC 5B1BC 1OKKA 3FHDA 4G7ZF 3ITFA 3I4UA 5HSWA 1MMGA 1SF8A 4E0HA 4JCHA 4LACB 5EHHA 4G7HF 4FX5A 2BE5F 3ZG1A 2Q9CA 4YT2A 2R7OA 2WVNA 4BG0A 5D92A 3U2MA 1QZXA 4OD4A 3WG7C 3Q7LA 4I44A 4MQ9F 1ZHWA 2J0XA 3OEOA 3ABMC 1M2OA 2IXPA 4OIQF 4LLCA 3LLKA 2KQ9A 2KJGA 2Y39A 4Q5SF 3OA1A 4FESA 4PK4A 1Z6AA 1S7ZA 4BJTA 2W4MA 3UGPA 4ZLDA 3N24A 4LERA 4PJMA 4DBQA 2VB6A 4AE4B 4U5FE 5DS6A 1MMNA 3LESA 4CS9A 4O6MA 4FWVA 2M4EA 4CIHA 3M1CB 3T6BA 2Y3BA 4QDLA 4DVZA 4CSAC 3DD7A 5E3CA 2CDQA 2NUPA 3EJNA 1Z3IX 3DMDA 2E87A 1TWAA 2PP4A 3ECSA 1D0ZA 5E3AA 1TKNA 2X51A 3GWLA 4QI0A 2HV7A 1D1CA 3EH2A 3PMRA 1D0YA 1OCOC 1FMVA 1OCCC 2R7UA 4IRUA 4C3EA 5T1DB 1VOMA 3Q6NA 4RDAA 1BR2A 3ZC4A 1MNDA 1ST6A 2CW0F 3RKOF 1NG1A 3T6JA 4KI2A 3PHF2 1W2WA 1JPNA 2L81A 2ZXOA 3DM5A 3EGXA 4DVYP 5IY5C 2H7VC 2XSEA 5T3WA 3DM9B 3SEOA 4PJNA 1PCXA 4BEJA 5KYYA 2MWQA 2DGJA 2J0WA 3O55A 4LLEA 4C3BA 4DOZA 3JYHA 4CBEA 3AQBA 1PD0A 3X2QC 3GWNA 5KYUB 1IW7F 3WODF 2O9XA 3CZ6A 1LKXA 2J45A 4Q7CA 2Y3GA 1VYIA 4HE8D 2CGEA 3O39A 2A6EF 3EZHA 4CSAA 3RH3A 1JRAA 2V3CC 2W45A 1JR8A 5BUOA 3K6BA 1TR2A 3EHMA 3ASNC 3NYJA 5FCLA 2WZGA 3AG1C 3B0VC 4E7ZA 4U5HA 1ZYRF 4JJGA 3X1OA 2WL8A 2R7SA 3LNRA 5D91A 4I1OB 4X0RA 4OIOF 2EINC 4H4KC 4O79A 4A2NB 3H65A 2ZXPA 3LAYA 4YN0B 2CNWD 2WVQA 3W2WA 2EILC 4BJ5A 2A6HF 5KYYB 4AK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U2M A;  3LLI A;  1OQC A;  4E0I A;  3GWN A;  3O55 A;  4LDK A;  3LLK A;  3R7C A;  3U2L A;  4E0H A;  3TK0 A;  2HJ3 A;  3TD7 A;  1JRA A;  3GWL A;  1JR8 A;  3W4Y A;  3MBG A;  3U5S A; 
#chains in the Genus database with same CATH topology
 2P7V A;  5DQZ A;  3F47 A;  1LVK A;  4ULW A;  3RF3 A;  4UDV A;  1OQC A;  2XL4 A;  4PAC A;  4AX2 A;  1EKY A;  2YL3 A;  4HFK B;  3UMH A;  2Y3H A;  2YZS A;  4E7S A;  1KNY A;  4GEH A;  3C8G B;  1PV3 A;  3DZA A;  3UMK A;  3RIP A;  3JSE O;  1Y4C A;  3OWT A;  3F46 A;  2IOQ A;  1BR4 A;  2IYL D;  4XEK A;  4JRZ A;  3S90 A;  1H9T A;  2QUP A;  3EFO A;  5L3Q A;  1WN0 A;  2B0H A;  2Z15 A;  3EQL F;  3B0U X;  1QKR A;  2LK4 A;  3QW0 A;  1QLE C;  2OKU A;  2XLD A;  3JRM O;  2G3V A;  4K0D A;  5JUA A;  4BEM J;  4KC9 A;  3W8H A;  1M2V A;  1E2X A;  3T9O A;  2RSE B;  2R9R B;  4JTC B;  4MVO A;  3AJM A;  4JC7 A;  3H2U A;  3AG3 C;  2XXA A;  2OU6 A;  1OR2 A;  3HLZ A;  4YL0 A;  2GA0 A;  2J9W A;  2HKV A;  1Z23 A;  4ZLC A;  2D5R B;  2J46 A;  1SYQ A;  5JS5 A;  1HY5 A;  1A7D A;  3QZC A;  3N0T A;  4MVM A;  3NG1 A;  4H54 A;  3C8G D;  3GAN A;  3G50 A;  5L0F A;  1GGQ A;  5F5F A;  5EK0 A;  3SZR A;  2LFF A;  1R4T A;  4GYT A;  1LE2 A;  2OOC A;  2YL7 A;  2IM8 A;  4IWB A;  3FMS A;  1OXK A;  4XWJ A;  4J7T A;  2P1A A;  4RBN A;  4F4B A;  3IEE A;  3NYL A;  4E17 A;  2CNW A;  3AG4 C;  2EIK C;  3ATP A;  3EG9 A;  3FDQ A;  1OCR C;  1G5Z A;  3IQC A;  3LEV A;  3VYW A;  1SR2 A;  3TQO A;  5BQI A;  2HV6 A;  1A0B A;  4NQF A;  4EBK A;  1M57 C;  3JYY A;  2YEV A;  4IB4 A;  1JPJ A;  1VK5 A;  1G4U S;  2OEX A;  2ZPA A;  3LLI A;  3B0P A;  1L7C A;  1CGN A;  1BBH A;  1NFN A;  2ZXW C;  2L6H A;  1IZM A;  3DE8 A;  3W8I A;  1XZQ A;  4BJ5 C;  3I5P A;  5CI8 A;  1L3P A;  1LS4 A;  4IJJ A;  3R7C A;  2A68 F;  4JJF A;  3RYL A;  4EBB A;  1E83 A;  4G7O F;  3SP1 A;  1AUE A;  3RQE A;  3U3F A;  4YJW A;  1OW8 A;  3C8Z A;  3GOD A;  3HNI A;  2FFH A;  2F22 A;  2Y3D A;  2LSE A;  3S27 A;  5DLJ A;  1YJG A;  1J8Y F;  4YT4 A;  1ZW2 A;  1VLS A;  2VCB A;  2LP4 A;  2Y69 C;  4YL3 A;  4C7O A;  3U8V A;  3W4Y A;  2W9Y A;  1MMA A;  4CDV A;  2R7R A;  4K1O A;  1T6I A;  3U5S A;  3KKB A;  3QVZ A;  1OCZ C;  4CS8 C;  2D4U A;  3DI5 A;  1NSG B;  3Q6M A;  4J30 B;  3FAJ A;  4XEV A;  5E33 A;  5A69 A;  1ZHY A;  2OCC C;  3Q7G A;  2HMQ A;  2LCH A;  4JTD B;  2DYR C;  1NLX A;  4Q4Z F;  1LS1 A;  2J9B A;  1QVX A;  2DB4 A;  1Y6D A;  2HJM A;  1AEP A;  2NUP B;  2L7A A;  1A7V A;  4FAP B;  3G4X A;  4P9T A;  2UUI A;  2J9U A;  2PX3 A;  2EIJ C;  2YVK A;  4YT8 A;  2CYD A;  1ORJ A;  5DQT A;  3MLG A;  4U5G A;  1EA8 A;  1T6Q A;  3EG9 B;  4K7B A;  4MS2 A;  4KBL A;  4CX9 A;  2GFH A;  4PJJ A;  5L0G A;  3NMK A;  3POV A;  3H2V A;  1ZHZ A;  4D4X A;  2A0B A;  4N6C A;  2L9J A;  4LDR A;  4W8K A;  2VAS A;  2XM0 A;  5KYN A;  2A69 F;  4ER9 A;  1ZHX A;  4IAQ A;  1JAF A;  2XLW A;  4O6Y A;  3VRC A;  2RD9 A;  2R7V A;  3EGD A;  2G3K A;  2LIG A;  2OJE D;  3K7D A;  4XPW A;  1TWG A;  3KL4 A;  3LJB A;  3IQT A;  2J7P A;  1I4Y A;  3U2L A;  2KSF A;  3HTK C;  5DS5 A;  1TWC A;  3IQ6 A;  1CPQ A;  3DXJ F;  3EGX B;  1VYK A;  3L34 A;  3A9C A;  5B3I A;  4P6I C;  1MMD A;  2JX0 A;  4NY3 A;  2YRF A;  5COF A;  3UGO A;  1G4W R;  1ORY A;  3S28 A;  1HMD A;  3ZSU A;  2Q9A A;  4C7O B;  1LIH A;  3VAY A;  4DXW A;  1YA7 O;  1YAU O;  3MBG A;  3RFY A;  2AVK A;  5AGF A;  3PCV A;  4YK5 A;  2G62 A;  4XPY A;  3O6X A;  1TWH A;  4HEA J;  3RVZ A;  3NMJ A;  4JCZ A;  2P6V A;  2EPN A;  3DAF A;  1V4A A;  4MTO A;  2QY9 A;  3SYN A;  3LS1 A;  2NG1 A;  1LM3 B;  3TOM A;  4JE9 A;  2C03 A;  2HFI A;  1GQA A;  3UR3 C;  3IPM O;  3K33 A;  5KYX A;  3B9Q A;  4WJ0 A;  1Z5Z A;  1TFK B;  5A6B D;  1YZC A;  1C17 M;  3GEI A;  5F5H A;  3VF0 A;  2KW3 C;  1SMY F;  4IAR A;  4OIN F;  1V55 C;  2ICW G;  2IXM A;  2NUT A;  2Q9B A;  2XLE A;  4CS8 A;  1C02 A;  1VTM P;  2P0N A;  256B A;  4J32 B;  3CEX A;  3L8I A;  3B71 A;  4JW1 A;  1BR1 A;  3DE9 A;  4XEF A;  4EWC A;  2OEV A;  2AP3 A;  2PF4 E;  2BL2 A;  2PFD A;  3SXZ A;  2H7O A;  4EBJ A;  1OR3 A;  1FFH A;  1YYJ A;  2HMZ A;  3JT1 A;  4U5B E;  4WAB A;  4E18 A;  5BQH A;  1APC A;  1YZA A;  4KNW A;  3M4B A;  4JKV A;  1Q0M A;  4RD9 A;  2PNO A;  4JUR I;  4XQ1 A;  3E9V A;  4U5D E;  3HJC A;  4JEB A;  5BQG A;  3KMI A;  4XLN F;  3AOU A;  3JTL O;  5AC5 A;  2WB7 A;  1I5N A;  2GWW A;  3EGD B;  2DYS C;  1D1A A;  2NSG A;  4CIH A;  1SZI A;  3ABK C;  2M64 A;  4ONS A;  4U5E E;  2R7X A;  4EUK B;  1NZE A;  1ZHT A;  3SNH A;  1FMW A;  3GM1 A;  3TK0 A;  3C18 A;  2R7W A;  1CPR A;  3I5Q A;  5HV9 A;  3RQF A;  2L6F A;  3DAG A;  2FAP B;  1H6G A;  1BDJ B;  1RJ9 A;  2YLI A;  3J06 A;  2HSB A;  3G4Z A;  2EIM C;  1I4Z A;  2NSF A;  1LI7 A;  4A4A A;  3V7O A;  3GEE A;  5CI9 A;  3MYF A;  3WAQ A;  3K66 A;  2NPU A;  4NTB A;  4MVZ A;  1U0B B;  1FTS A;  3N2Z B;  1S05 A;  1Z63 A;  2WZF A;  2XRH A;  1WWP A;  1MNE A;  3JCU Q;  5KYW A;  1FFT C;  4CDA A;  2QNL A;  5KYU A;  3VM6 A;  4R32 A;  4AL1 A;  1H9G A;  1VMA A;  2KK1 A;  2Q3T A;  3DJN B;  2A1D D;  5DS4 A;  3K1H A;  3RQG A;  3EHN A;  3JSZ A;  4YWQ A;  5KYX B;  2JD3 A;  1ZU4 A;  2EPO A;  4BJ6 C;  5A6B A;  4QI2 A;  4CS7 A;  4PJL A;  1TFO B;  1D0X A;  2XLM A;  3K1I A;  1RKE A;  5EGY A;  2NUT B;  3SXK A;  2QTV A;  2R02 A;  2J7P D;  3EFO B;  3CQZ A;  4XLP F;  2R25 A;  3L8J A;  4D4N A;  2XS1 A;  3S0X A;  3RW0 A;  1YA9 A;  3ZTZ A;  1N1C A;  1MQV A;  2V26 A;  4HFF B;  1WAT A;  4O7G A;  2AWY A;  3TD7 A;  3ASO C;  2R7Q A;  3JRT A;  4U5C E;  1WOL A;  4M63 A;  1JMW A;  1M2V B;  1V54 C;  4OD5 A;  5B3S C;  5L0J A;  3NDB B;  1HE9 A;  4N06 A;  2J9V A;  2XXA B;  4XTK A;  3A11 A;  4MVR A;  1G8X A;  2IXN A;  2IXO A;  2WZL A;  2EPK X;  2YLD A;  2MYS A;  4DRI B;  3C62 A;  4OIR F;  1T9K A;  2MHR A;  1EQ1 A;  3FAP B;  3QMK A;  3EPV A;  3NYM A;  3ZIB A;  2YL0 A;  4GQH A;  3PDM P;  1HW2 A;  4OIP F;  1KU2 A;  2L6G A;  3GM3 A;  1PD1 A;  1OKK D;  1DOW A;  2XS8 A;  3MYI A;  3V5X A;  4IAO A;  4XPX A;  1WGW A;  2CCY A;  3O10 A;  3LS0 A;  5DVW A;  4ANJ A;  2YHS A;  5T3T A;  4BPM A;  1K05 A;  2VH3 A;  1ZZP A;  1J8M F;  1R5I D;  3EZI A;  1D1B A;  3DJU B;  2HJ3 A;  3AQC A;  2VCA A;  3MX3 A;  1RJ9 B;  3MFN A;  3W2V A;  1LPE A;  2PX0 A;  3EH1 A;  1UG7 A;  5CIV A;  2FGY A;  3KPH A;  4LDQ A;  2R7T A;  3ZVR A;  5L0I A;  2B0J A;  2LFD A;  4DBR A;  1YVI A;  3T6G B;  1ZU5 A;  4CJO A;  5L3V A;  2XM4 A;  5KYW B;  4E0I A;  1YLM A;  2R03 A;  1VB5 A;  2KGO A;  3GOR A;  4PFP A;  5A6K A;  5A6J A;  2XL6 A;  4U9D A;  3ZDL A;  2WVO A;  4KNV A;  3HNJ A;  3IHU A;  4CS9 C;  3V5Y A;  3FOO A;  3FVY A;  5E2Q A;  1F1M A;  3US6 A;  4B6I A;  1BZ4 A;  2OG2 A;  1O87 A;  4C3D A;  3ABL C;  1RKE B;  3NKD A;  1YDI A;  4MND A;  3U9M A;  1O5H A;  1NU7 D;  2HUJ A;  5L0H A;  4Z9I A;  3HKK A;  3HNL A;  4JZA A;  3S9O A;  2C04 A;  4BJ1 A;  3L0I A;  3L1M A;  1T01 A;  2IBF A;  3CSK A;  4AE4 A;  2I8B A;  1ZW3 A;  3TOL A;  1NU9 C;  2Q7R A;  4AL0 A;  3UMI A;  4BJ6 A;  2GAQ A;  3LEO A;  4MVS A;  4EHP A;  5A6A A;  1FNT c;  2H7B A;  1M56 C;  3KYJ A;  3NKE A;  3T4R A;  1A7E A;  3AG2 C;  3UNG C;  4I1M A;  3E70 C;  3K1I C;  4JVS A;  2KYH A;  2HS5 A;  2W4B A;  2ZXR A;  3AGU A;  4L6R A;  4WGY A;  1QQ3 A;  2A0U A;  2GDC A;  4PFO A;  4I3M A;  2KC3 A;  4G0H A;  4YT5 A;  3ZTM A;  1E85 A;  2DI3 A;  3NRH A;  2KNH A;  3LNM B;  4O6N A;  3KH2 A;  4W8P A;  3S29 A;  2AWC A;  2J8W A;  4LDK A;  4MW8 A;  5B1A C;  2JPU A;  5B1B C;  1OKK A;  2YKZ A;  3FHD A;  3ZQV A;  3ITF A;  4G7Z F;  2TMV P;  3I4U A;  5HSW A;  1MMG A;  1SF8 A;  4E0H A;  4JCH A;  4JEA A;  4LAC B;  5EHH A;  4G7H F;  1Q0G A;  1FAP B;  1XZP A;  4FX5 A;  2OJQ A;  4NTF A;  2BE5 F;  3ZG1 A;  5JLI A;  5JRA A;  2R05 A;  1Q0K A;  2Q9C A;  2XLO A;  1YAR O;  1E86 A;  2ASR A;  4CJG A;  4YT2 A;  2R7O A;  2WVN A;  1LE4 A;  3M79 A;  3FOP A;  3KYI A;  1HMO A;  4BG0 A;  5D92 A;  3V5Z A;  3U2M A;  1QZX A;  4OD4 A;  2X0C A;  2Q4F A;  3Q7L A;  3WG7 C;  3U0C A;  4I44 A;  1WTY A;  2BC5 A;  1ZHW A;  4MQ9 F;  2J0X A;  1FR0 A;  3OEO A;  3ABM C;  4MTF A;  1GS9 A;  1M2O A;  2IXP A;  1QPU A;  3S84 A;  4OIQ F;  1O3U A;  4LLC A;  3LLK A;  2KQ9 A;  2KJG A;  5FZT A;  1ZVZ A;  2P61 A;  2Y39 A;  4Q5S F;  3OA1 A;  4FES A;  4DRJ B;  4PK4 A;  1Z6A A;  1S7Z A;  2XLV A;  4BJT A;  2W4M A;  3UGP A;  4ZLD A;  3N24 A;  4LER A;  1U6H A;  4PJM A;  4DBQ A;  3GEH A;  2VB6 A;  3FXH A;  3M15 A;  3TJ6 A;  4AE4 B;  5L0D A;  4U5F E;  1E84 A;  4J7Y A;  1OW7 A;  5DS6 A;  1MMN A;  1Q0F A;  3LES A;  4CS9 A;  4Z9H A;  5JT4 A;  4DRH B;  1KTM A;  4O6M A;  4FWV A;  3BRJ A;  2M4E A;  3AGT A;  3U9J A;  3M1C B;  2ETS A;  3QTH A;  2Y3B A;  3T6B A;  2QLA A;  1XWJ A;  4QDL A;  4DVZ A;  4CSA C;  1YYX A;  3DD7 A;  5E3C A;  2CDQ A;  3CAX A;  4N6H A;  1RMV A;  1CGM E;  3GM2 A;  5F28 E;  2NUP A;  3QVY A;  2OQM A;  3NMI A;  3R2P A;  3EJN A;  1Z3I X;  4NTA A;  3TUL A;  3DMD A;  4P9F A;  2E87 A;  2YWA A;  2Q00 A;  1TWA A;  2I15 A;  3TJ5 A;  2PP4 A;  3ECS A;  1D0Z A;  5E3A A;  1M6T A;  4JTA B;  1TKN A;  2X51 A;  2XLH A;  1H7I A;  3B29 A;  3GWL A;  4QI0 A;  2HV7 A;  1D1C A;  2LQG A;  2PBE A;  2UUH A;  3LUT B;  3EH2 A;  4MVU A;  3PMR A;  1K04 A;  1D0Y A;  1OCO C;  1FMV A;  1OCC C;  2R7U A;  4IRU A;  4ULV A;  1TQG A;  4C3E A;  5L0C A;  5T1D B;  2EPM X;  4YL1 A;  1LI5 A;  1VOM A;  3Q6N A;  3HNK A;  4RDA A;  1BR2 A;  3ZC4 A;  1MND A;  1ST6 A;  2CW0 F;  3RKO F;  4JIO A;  1NG1 A;  4NCQ A;  1EI7 A;  3T6J A;  4KI2 A;  3PHF 2;  1W2W A;  1JPN A;  2L81 A;  2ZXO A;  2AU5 A;  3DM5 A;  2LD6 A;  3EGX A;  4IGG A;  1GM5 A;  4N4W A;  4DVY P;  5IY5 C;  2H7V C;  2XSE A;  3RVY A;  5JP7 A;  2YL1 A;  5T3W A;  1T5O A;  3DM9 B;  3SEO A;  4PJN A;  4PR9 A;  2VC9 A;  1PCX A;  4BEJ A;  1VLT A;  2HSQ A;  3QW1 A;  1RXQ A;  2MWQ A;  2DGJ A;  3ZQY A;  5KYY A;  1RKC A;  2J0W A;  3O55 A;  4LLE A;  4C3B A;  4DOZ A;  4EKW A;  3JYH A;  4CBE A;  3AQB A;  1PD0 A;  1U89 A;  3X2Q C;  3GWN A;  5KYU B;  4U9E A;  1IW7 F;  1WAS A;  3WOD F;  2O9X A;  3CZ6 A;  3DWW A;  2VCC A;  1AVO B;  3C8G A;  1LKX A;  1HE1 A;  2J45 A;  3DKA A;  1T6U A;  4Q7C A;  2Y3G A;  1VYI A;  4CIP A;  4HE8 D;  1ORS C;  2CGE A;  3O39 A;  2A6E F;  3WHN A;  3EZH A;  4CSA A;  3RH3 A;  1JOG A;  5K0I A;  2XL8 A;  1C03 A;  3C7J A;  1NBB A;  1Q0D A;  1JRA A;  2V3C C;  2W45 A;  5GPG B;  1JR8 A;  3M4C A;  4MW3 A;  5BUO A;  3K6B A;  1UFB A;  4Z9J A;  1TR2 A;  3EHM A;  3ASN C;  1OW6 A;  1OXB A;  1CGO A;  5JSL A;  3NYJ A;  1A41 A;  5TJ5 E;  5FCL A;  2WZG A;  3C63 A;  3SXY A;  1RCP A;  3AG1 C;  4CDY A;  3B0V C;  4E7Z A;  2QE9 A;  3SXM A;  4U5H A;  1ZYR F;  5AC4 A;  1NFO A;  4JJG A;  3X1O A;  3U8P A;  4EIY A;  4NC3 A;  2WL8 A;  2H8A A;  2HZ8 A;  5COM A;  5JVE A;  2R7S A;  3BEH A;  3LNR A;  4MTG A;  5D91 A;  4I1O B;  3JZ0 A;  4X0R A;  4OIO F;  2EIN C;  4H4K C;  4DJ9 A;  4O79 A;  3ZWI A;  5COG A;  1B68 A;  1DOV A;  4WGZ A;  3H65 A;  1K40 A;  2YLG A;  4A2N B;  2ZXP A;  3LAY A;  3IQ5 A;  4YN0 B;  2CNW D;  2ZD9 A;  2WVQ A;  3U3B A;  2YQY A;  3W2W A;  2EIL C;  1QSP A;  1HW1 A;  4BJ5 A;  2A6H F;  4G78 A;  2EPL X;  5KYY B;  1Z7Q c;  4MVQ A;  1V74 B;  4AK9 A; 
#chains in the Genus database with same CATH homology
 2P7V A;  5DQZ A;  3F47 A;  1LVK A;  4ULW A;  1OQC A;  2XL4 A;  4AX2 A;  4HFK B;  3UMH A;  2Y3H A;  2YZS A;  4E7S A;  4GEH A;  3UMK A;  3DZA A;  3RIP A;  3OWT A;  3F46 A;  2IOQ A;  1BR4 A;  2IYL D;  3EFO A;  5L3Q A;  3EQL F;  2Z15 A;  3B0U X;  1QLE C;  4K0D A;  2G3V A;  4KC9 A;  3W8H A;  1M2V A;  2XXA A;  3AG3 C;  3HLZ A;  2J9W A;  1Z23 A;  4ZLC A;  2D5R B;  2J46 A;  3QZC A;  3N0T A;  3NG1 A;  3GAN A;  3SZR A;  4GYT A;  4IWB A;  4XWJ A;  4RBN A;  4F4B A;  3IEE A;  3NYL A;  2CNW A;  3AG4 C;  2EIK C;  3EG9 A;  3FDQ A;  1OCR C;  3LEV A;  3VYW A;  2HV6 A;  1M57 C;  2YEV A;  1JPJ A;  1VK5 A;  2ZPA A;  3LLI A;  3B0P A;  2ZXW C;  1IZM A;  3W8I A;  4BJ5 C;  3I5P A;  5CI8 A;  4IJJ A;  3R7C A;  2A68 F;  4JJF A;  3RYL A;  4EBB A;  4G7O F;  3SP1 A;  4YJW A;  3GOD A;  2FFH A;  2Y3D A;  2LSE A;  3S27 A;  5DLJ A;  1J8Y F;  4YT4 A;  2Y69 C;  4C7O A;  3W4Y A;  2W9Y A;  1MMA A;  2R7R A;  3U5S A;  3KKB A;  1OCZ C;  4CS8 C;  5E33 A;  3Q6M A;  4J30 B;  3FAJ A;  1ZHY A;  2OCC C;  3Q7G A;  2DYR C;  4Q4Z F;  1LS1 A;  2NUP B;  2J9U A;  2PX3 A;  2EIJ C;  4YT8 A;  5DQT A;  3MLG A;  4U5G A;  4K7B A;  3EG9 B;  4KBL A;  2GFH A;  4PJJ A;  3POV A;  1ZHZ A;  4W8K A;  2L9J A;  2VAS A;  5KYN A;  2A69 F;  1ZHX A;  4O6Y A;  2R7V A;  3EGD A;  2G3K A;  3K7D A;  1TWG A;  3KL4 A;  3LJB A;  2J7P A;  3U2L A;  3HTK C;  5DS5 A;  1TWC A;  3DXJ F;  3EGX B;  1VYK A;  3L34 A;  4P6I C;  1MMD A;  4NY3 A;  3UGO A;  3S28 A;  3ZSU A;  2Q9A A;  4C7O B;  3VAY A;  3MBG A;  3RFY A;  2G62 A;  3O6X A;  1TWH A;  4HEA J;  2P6V A;  3DAF A;  2QY9 A;  3SYN A;  3LS1 A;  2NG1 A;  2C03 A;  3UR3 C;  3K33 A;  5KYX A;  3B9Q A;  4WJ0 A;  1Z5Z A;  5F5H A;  2KW3 C;  1SMY F;  4OIN F;  1V55 C;  2IXM A;  2NUT A;  4CS8 A;  2Q9B A;  4J32 B;  4JW1 A;  1BR1 A;  4EWC A;  2PF4 E;  2PFD A;  2H7O A;  1FFH A;  3JT1 A;  4U5B E;  4KNW A;  4RD9 A;  4JUR I;  3E9V A;  4U5D E;  3HJC A;  3KMI A;  4XLN F;  2WB7 A;  3EGD B;  2DYS C;  1D1A A;  1SZI A;  3ABK C;  4U5E E;  2R7X A;  1NZE A;  1ZHT A;  3SNH A;  1FMW A;  3TK0 A;  2R7W A;  3I5Q A;  3DAG A;  1RJ9 A;  2EIM C;  3V7O A;  5CI9 A;  3K66 A;  1FTS A;  3N2Z B;  2WZF A;  2XRH A;  3JCU Q;  1MNE A;  5KYW A;  1FFT C;  5KYU A;  1VMA A;  2Q3T A;  3DJN B;  5DS4 A;  2A1D D;  3K1H A;  3EHN A;  3JSZ A;  4YWQ A;  5KYX B;  2JD3 A;  1ZU4 A;  4QI2 A;  4BJ6 C;  4CS7 A;  4PJL A;  1D0X A;  5EGY A;  2NUT B;  2QTV A;  3EFO B;  2J7P D;  3CQZ A;  4XLP F;  3S0X A;  1N1C A;  2V26 A;  4HFF B;  3TD7 A;  4O7G A;  3ASO C;  2R7Q A;  3JRT A;  4U5C E;  4M63 A;  1M2V B;  1V54 C;  5B3S C;  4OD5 A;  3NDB B;  4N06 A;  2J9V A;  2XXA B;  4XTK A;  1G8X A;  2IXN A;  2IXO A;  2WZL A;  2MYS A;  4OIR F;  3QMK A;  3EPV A;  3NYM A;  3ZIB A;  4OIP F;  1KU2 A;  1PD1 A;  1OKK D;  4IAO A;  1WGW A;  5DVW A;  4ANJ A;  3LS0 A;  2YHS A;  5T3T A;  2VH3 A;  1J8M F;  3EZI A;  1D1B A;  3DJU B;  2HJ3 A;  3AQC A;  3MX3 A;  1RJ9 B;  3W2V A;  2PX0 A;  3EH1 A;  2FGY A;  2R7T A;  3ZVR A;  2B0J A;  4DBR A;  1ZU5 A;  5L3V A;  5KYW B;  4E0I A;  2KGO A;  4PFP A;  2WVO A;  4KNV A;  4CS9 C;  4B6I A;  3FVY A;  5E2Q A;  2OG2 A;  4C3D A;  1O87 A;  3ABL C;  3NKD A;  4MND A;  1O5H A;  1NU7 D;  4JZA A;  2C04 A;  4BJ1 A;  3L0I A;  4AE4 A;  3CSK A;  2I8B A;  1NU9 C;  3UMI A;  4BJ6 A;  2H7B A;  1M56 C;  3NKE A;  3T4R A;  3AG2 C;  3UNG C;  4I1M A;  3E70 C;  3K1I C;  4JVS A;  2W4B A;  2ZXR A;  5F5F A;  1Z63 A;  4PFO A;  4YT5 A;  4I3M A;  4G0H A;  3NRH A;  2KNH A;  4O6N A;  3KH2 A;  3S29 A;  4LDK A;  5B1A C;  5B1B C;  1OKK A;  3FHD A;  4G7Z F;  3ITF A;  3I4U A;  5HSW A;  1MMG A;  1SF8 A;  4E0H A;  4JCH A;  4LAC B;  5EHH A;  4G7H F;  4FX5 A;  2BE5 F;  3ZG1 A;  2Q9C A;  4YT2 A;  2R7O A;  2WVN A;  4BG0 A;  5D92 A;  3U2M A;  1QZX A;  4OD4 A;  3WG7 C;  3Q7L A;  4I44 A;  4MQ9 F;  1ZHW A;  2J0X A;  3OEO A;  3ABM C;  1M2O A;  2IXP A;  4OIQ F;  4LLC A;  3LLK A;  2KQ9 A;  2KJG A;  2Y39 A;  4Q5S F;  3OA1 A;  4FES A;  4PK4 A;  1Z6A A;  1S7Z A;  4BJT A;  2W4M A;  3UGP A;  4ZLD A;  3N24 A;  4LER A;  4PJM A;  4DBQ A;  2VB6 A;  4AE4 B;  4U5F E;  5DS6 A;  1MMN A;  3LES A;  4CS9 A;  4O6M A;  4FWV A;  2M4E A;  4CIH A;  3M1C B;  3T6B A;  2Y3B A;  4QDL A;  4DVZ A;  4CSA C;  3DD7 A;  5E3C A;  2CDQ A;  2NUP A;  3EJN A;  1Z3I X;  3DMD A;  2E87 A;  1TWA A;  2PP4 A;  3ECS A;  1D0Z A;  5E3A A;  1TKN A;  2X51 A;  3GWL A;  4QI0 A;  2HV7 A;  1D1C A;  3EH2 A;  3PMR A;  1D0Y A;  1OCO C;  1FMV A;  1OCC C;  2R7U A;  4IRU A;  4C3E A;  5T1D B;  1VOM A;  3Q6N A;  4RDA A;  1BR2 A;  3ZC4 A;  1MND A;  1ST6 A;  2CW0 F;  3RKO F;  1NG1 A;  3T6J A;  4KI2 A;  3PHF 2;  1W2W A;  1JPN A;  2L81 A;  2ZXO A;  3DM5 A;  3EGX A;  4DVY P;  5IY5 C;  2H7V C;  2XSE A;  5T3W A;  3DM9 B;  3SEO A;  4PJN A;  1PCX A;  4BEJ A;  5KYY A;  2MWQ A;  2DGJ A;  2J0W A;  3O55 A;  4LLE A;  4C3B A;  4DOZ A;  3JYH A;  4CBE A;  3AQB A;  1PD0 A;  3X2Q C;  3GWN A;  5KYU B;  1IW7 F;  3WOD F;  2O9X A;  3CZ6 A;  1LKX A;  2J45 A;  4Q7C A;  2Y3G A;  1VYI A;  4HE8 D;  2CGE A;  3O39 A;  2A6E F;  3EZH A;  4CSA A;  3RH3 A;  1JRA A;  2V3C C;  2W45 A;  1JR8 A;  5BUO A;  3K6B A;  1TR2 A;  3EHM A;  3ASN C;  3NYJ A;  5FCL A;  2WZG A;  3AG1 C;  3B0V C;  4E7Z A;  4U5H A;  1ZYR F;  4JJG A;  3X1O A;  2WL8 A;  2R7S A;  3LNR A;  5D91 A;  4I1O B;  4X0R A;  4OIO F;  2EIN C;  4H4K C;  4O79 A;  4A2N B;  3H65 A;  2ZXP A;  3LAY A;  4YN0 B;  2CNW D;  2WVQ A;  3W2W A;  2EIL C;  4BJ5 A;  2A6H F;  5KYY B;  4AK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...