3LLIA

Sulfhydryl oxidase fragment of human qsox1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
251
Chain Sequence
ADRSKIYMADLESALHYILRIEVGRFPVLEGQRLVALKKFVAVLAKYFPGRPLVQNFLHSVNEWLKRQKRNKIPYSFFKTALDDRKEGAVLAKKVNWIGCQGSEPHFRGFPCSLWVLFHFLTVQAARQNVDHSQEAAKAKEVLPAIRGYVHYFFGCRDCASHFEQMAAASMHRVGSPNAAVLWLWSSHNRVNARLAGAPSEDPQFPKVQWPPRELCSACHNERLDVPVWDVEATLNFLKAHFSPSNIILDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sulfhydryl oxidase 1
publication title QSOX contains a pseudo-dimer of functional and degenerate sulfhydryl oxidase domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 87
structure length 251
sequence length 251
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
A PF18371 FAD_SOX Flavin adenine dinucleotide (FAD)-dependent sulfhydryl oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3lliA02
1.20.120.1960 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3lliA01
3R7CA 3U2MA 3U5SA 4E0IA 1OQCA 3MBGA 3LLKA 3U2LA 4E0HA 3O55A 1JRAA 1JR8A 3W4YA 3TK0A 3GWNA 2HJ3A 3LLIA 3TD7A 4LDKA 3GWLA
chains in the Genus database with same CATH superfamily
1YA9A 3MFNA 5L0JA 5KYUB 4PJNA 4BEJA 1A0BA 4JCHA 5KYNA 2VASA 3JSZA 3S9OA 1KU2A 5A6AA 2JD3A 1LIHA 3ZQYA 1RCPA 3C63A 3M1CB 1HMDA 4C3EA 3ATPA 4XEFA 5JRAA 4XPWA 3S90A 2EPOA 1LI5A 1H6GA 1CPQA 2VH3A 2X51A 4XLNF 4BJ6C 3LLKA 2C04A 3WODF 4HEAJ 2NUTA 5JUAA 4EUKB 1MMGA 3FVYA 3ZSUA 5KYWA 4D4XA 1A7VA 1NU9C 3DZAA 2RSEB 2NSFA 3AQCA 5CIVA 2HJ3A 1MNDA 3B71A 2Q9BA 4JEAA 3TQOA 3AG1C 3ABLC 1SR2A 2Q9CA 4P6IC 4YT2A 1VB5A 1LKXA 2IXOA 4GEHA 4IAQA 3L34A 2L6HA 2HSBA 1LVKA 1I4YA 4CJGA 1T5OA 5KYYB 3EZHA 3BEHA 3VM6A 1RKEB 2HV7A 2XLEA 4O6YA 3QVZA 3W8IA 2QUPA 4LLCA 2HSQA 1H9TA 1SZIA 3KYJA 3POVA 2D5RB 2HJMA 3K1HA 4NTAA 3B0VC 3U9JA 4PJJA 1FMWA 3Q7LA 4N6HA 1A7DA 2UUIA 2XS1A 2R9RB 2R7TA 3ASNC 2G3KA 3O39A 3AOUA 4J7TA 1U89A 3DAFA 3MYIA 5A6BD 3M4BA 3GWNA 3GM2A 5DQZA 2YRFA 3G4ZA 1HE9A 1EKYA 4CS7A 5AC5A 2W4BA 4YL1A 1FNTc 4MTGA 5L0CA 2B0HA 4IB4A 4PFPA 2H7OA 1BR1A 3FAJA 4OIOF 4KNVA 3EGDA 4DVYP 1Z3IX 3SXYA 5KYXA 2F22A 2QTVA 3C8GD 1Y6DA 2XLVA 1MMNA 4BJ6A 5A6BA 2XL6A 4CSAC 2R7WA 4R32A 4UDVA 1PD0A 5E3CA 3AG4C 5TJ5E 2OOCA 4KBLA 5BQGA 4MVZA 1E83A 1D1AA 1MMAA 2HS5A 4YK5A 5D92A 1LM3B 3F47A 4WJ0A 2YEVA 3MYFA 2IXPA 1RJ9A 4KNWA 3IQTA 4G7OF 3G4XA 4CDVA 3S0XA 3WHNA 1TWAA 1M2VB 1T6UA 5A6JA 1L3PA 5KYUA 4J32B 2A1DD 2IXMA 1E84A 2Y69C 3VAYA 2XM0A 2IBFA 1HW2A 4YN0B 3EZIA 3ECSA 4JURI 1E86A 3K6BA 3LLIA 5BUOA 2R7XA 3C8GB 2XL4A 2XS8A 1OCRC 1A41A 4K7BA 2AU5A 2J45A 3Q6NA 2IOQA 3Q6MA 3U8PA 2GWWA 2ZXWC 1T6QA 1T9KA 4IWBA 2NG1A 2Y3GA 2HV6A 5A69A 2EIMC 1E85A 4A4AA 4CX9A 2R7SA 1QVXA 4DJ9A 3O55A 2YZSA 3GEEA 3WAQA 1JR8A 3DKAA 1NFNA 4MW3A 3OEOA 2HZ8A 2IYLD 3LAYA 4G0HA 1YYXA 3KKBA 3GM3A 5KYYA 4B6IA 4MQ9F 1RKEA 2P7VA 2DYRC 2M4EA 3RVYA 2W4MA 4CS9C 3HNKA 1R4TA 1EQ1A 1I5NA 3H2UA 3N0TA 4LDKA 3EGXA 3F46A 3QW0A 1YZAA 2LK4A 2GAQA 1JMWA 2NUPA 3S29A 2I15A 3SNHA 3T6GB 5E3AA 2L7AA 4E18A 3S28A 2V3CC 1NSGB 2DGJA 2YQYA 4MW8A 1T01A 1YDIA 4MVMA 1Z63A 2OG2A 4JCZA 1GM5A 3CQZA 3HNLA 2KK1A 3MBGA 4M63A 5E2QA 2Q7RA 3EGDB 4JTCB 2LQGA 3HKKA 1JRAA 1ORSC 3LUTB 5CI9A 2KJGA 3AQBA 2FAPB 1TFOB 2KSFA 5COGA 1YZCA 2LIGA 2J9WA 2DI3A 2KW3C 3TK0A 2M64A 3NYLA 4E7ZA 5BQIA 4Z9IA 5DLJA 1YJGA 3FMSA 3SP1A 3CSKA 5L0GA 3W2WA 3ZC4A 2QY9A 3TD7A 5B1AC 2YLGA 5L0DA 5EHHA 3CZ6A 1OCOC 2CW0F 4FX5A 4F4BA 2CGEA 3CEXA 3EHNA 4HE8D 2BL2A 3Q7GA 1IW7F 3DWWA 4QDLA 1M2VA 5JP7A 1ZHWA 4C3BA 1J8YF 3RW0A 4JZAA 1M2OA 1Z6AA 1BZ4A 1FMVA 4G7ZF 4PR9A 1ORYA 1VOMA 2YL3A 1OXBA 3X2QC 4PJMA 4YL3A 1D1BA 2VCAA 3TJ6A 5JVEA 1VTMP 1ZZPA 3JT1A 4A2NB 3EH2A 4DRJB 4CS9A 4K1OA 4BJ5C 5L3QA 2E87A 4HFKB 5E33A 3L8IA 2V26A 4N06A 4EBBA 1Q0MA 2I8BA 3SEOA 1NLXA 1PCXA 4J7YA 3LEVA 3AGTA 2J0XA 4Z9JA 2QE9A 3FOPA 2ZPAA 4OD5A 4BG0A 3LNRA 3NYJA 3US6A 1OW6A 2YL0A 1OCCC 2LFDA 3K1IC 2R02A 3M15A 2G3VA 2ZXOA 2OKUA 1LS1A 1Z23A 2DYSC 3B29A 4U5HA 3DXJF 4U5DE 1CPRA 3NKEA 1MMDA 1V55C 5DS6A 3FDQA 3EGXB 4YT8A 2X0CA 4IGGA 1TWGA 2FFHA 2NUPB 1ORJA 2XLDA 2XL8A 3QVYA 1D1CA 2CYDA 4U5GA 4CJOA 2H8AA 4NQFA 4DBRA 2JPUA 1DOVA 4PACA 4U9DA 3V7OA 1CGME 1BBHA 5EGYA 3UMKA 4O6NA 3SXMA 1C17M 3I5PA 3KYIA 1TKNA 1M56C 1ZHXA 3ZTZA 4QI2A 2FGYA 4E0HA 1OW7A 2HFIA 4MS2A 3TULA 4PJLA 1JPJA 3T9OA 4ANJA 2R7UA 2H7VC 2WZLA 2MWQA 1D0ZA 3H65A 3JCUQ 2EIJC 4NY3A 1VYIA 2WL8A 4KC9A 4MNDA 3A9CA 3NKDA 5T3TA 4BJ5A 1CGNA 1DOWA 2RD9A 3AJMA 4I1MA 3GEHA 4X0RA 2YWAA 3J06A 5T1DB 1S05A 5F28E 1MNEA 1OKKA 1Q0DA 1H9GA 2A6EF 2KYHA 3T4RA 3UMHA 2JX0A 3UGPA 3IQ5A 2Q9AA 2Y3BA 4EHPA 2PX0A 2EILC 3CAXA 2BE5F 2MYSA 3AGUA 4J30B 4MVUA 4XEVA 2TMVP 1SMYF 3HTKC 2WVNA 4WABA 2CNWA 4JE9A 4IAOA 2XRHA 3E70C 5COFA 2YLIA 2QNLA 2CCYA 3QMKA 5DS5A 3NG1A 1OCZC 4PK4A 4Z9HA 1S7ZA 3IQ6A 3PCVA 3RF3A 1OR2A 2P61A 1TWHA 3GANA 4K0DA 4XWJA 3UNGC 3B9QA 1FTSA 1RXQA 4CBEA 2XLOA 3DE9A 3KMIA 4XPXA 3AG3C 2O9XA 4OIRF 1WTYA 2LSEA 3JTLO 3ABKC 2WZFA 3U2LA 3ZWIA 2EPNA 1OXKA 1XZQA 4OD4A 4NC3A 1RMVA 2VC9A 4MVRA 2R7RA 1VYKA 1KTMA 5T3WA 3QZCA 2C03A 3PMRA 1E2XA 1V54C 4HFFB 5CI8A 2Q00A 3EG9A 1H7IA 2NPUA 2VB6A 1CGOA 1OR3A 1YAUO 1Z7Qc 3ZIBA 1J8MF 1HMOA 2EINC 3M79A 4CSAA 4I44A 4GQHA 1G8XA 1LI7A 1AEPA 2ZD9A 5COMA 5HV9A 3UGOA 1Q0FA 2L6FA 3B0UX 2A0UA 3RYLA 4XLPF 2PP4A 2A0BA 2R25A 3RQFA 1ZHYA 2EPMX 3NMJA 4NTBA 3RVZA 3U5SA 5DQTA 4E0IA 4JJGA 1HE1A 2WVQA 3QTHA 1O87A 4WGYA 2PX3A 2EPLX 4E7SA 2ASRA 1Q0KA 1ZHZA 4ULWA 3SXKA 3VYWA 2WVOA 1NU7D 3EFOB 3I4UA 1TFKB 1ZU4A 4KI2A 1EA8A 4OINF 4H54A 4CS8C 1B68A 1G4US 1HW1A 1O3UA 4IRUA 5HSWA 5EK0A 3DE8A 4QI0A 2LD6A 4MTOA 2P1AA 3MLGA 2YKZA 1JOGA 3H2VA 4JTDB 1N1CA 1NZEA 1ST6A 3M4CA 1HY5A 1BR2A 3LS0A 3RQGA 1ZVZA 3ZQVA 2P6VA 3S84A 2HUJA 4JTAB 2LP4A 2J46A 2YL7A 4FAPB 4OIQF 4CDAA 1WASA 4N6CA 4E17A 1YARO 2J8WA 1BR4A 2KQ9A 2OU6A 1JAFA 2XM4A 2YLDA 5L3VA 4NCQA 4RD9A 5AC4A 3IPMO 1WN0A 2YVKA 1A7EA 1R5ID 5AGFA 2PNOA 3HNJA 3E9VA 4C7OB 1XZPA 3ABMC 3HNIA 4G78A 3W2VA 3JSEO 4ER9A 2OEXA 1F1MA 3FOOA 4YWQA 2IXNA 2OQMA 1T6IA 2LFFA 3N24A 1ZYRF 3EHMA 4O79A 4BEMJ 4AK9A 2DB4A 1LS4A 3RKOF 1SYQA 3SXZA 3EPVA 3ZDLA 2WB7A 4G7HF 4GYTA 2HKVA 1APCA 1U0BB 3B0PA 4ONSA 3EG9B 2B0JA 3LESA 2H7BA 3G50A 3RQEA 4XPYA 4CS8A 1FAPB 4ZLDA 5JS5A 1NBBA 2Z15A 3KH2A 3LS1A 3HJCA 3BRJA 2HMZA 2GDCA 3K33A 4O6MA 3JZ0A 3ASOC 2ETSA 2A68F 5B3IA 3EH1A 1C03A 4AL0A 3V5YA 1BDJB 2KC3A 3LNMB 2OCCC 4I1OB 4JKVA 4ZLCA 2Y39A 3IEEA 1QQ3A 2EIKC 2ZXRA 1L7CA 1K04A 3V5XA 1PD1A 1OKKD 2OJQA 2XSEA 4IARA 1FFTC 4XTKA 2YHSA 3R7CA 2PF4E 2OEVA 3A11A 2KGOA 1GS9A 1Z5ZA 3EFOA 3O10A 3RH3A 4Q4ZF 2NSGA 4LERA 5D91A 1Y4CA 4MVQA 2GA0A 5B1BC 3S27A 5FCLA 2CNWD 1TR2A 4RDAA 4YT5A 1OQCA 5FZTA 1ZHTA 4YJWA 3RFYA 4JJFA 4U9EA 4AE4B 1UFBA 2PFDA 2IM8A 3DJUB 3GEIA 4DOZA 2AVKA 2J9BA 3T6BA 2Y3HA 1ZW2A 1LE2A 1SF8A 2J0WA 3QW1A 4EIYA 1EI7A 4ULVA 2XLMA 5IY5C 1C02A 2MHRA 4D4NA 3PHF2 4AX2A 1QSPA 2W9YA 3JRMO 3K1IA 3FHDA 1K40A 5F5FA 3K7DA 2R05A 2ICWG 3C7JA 4EBKA 2Q4FA 5A6KA 3ZVRA 3GWLA 3VF0A 4JC7A 1G4WR 2R7QA 4JEBA 3U2MA 4LLEA 1VLSA 2YL1A 4WGZA 3L8JA 2J9UA 1LPEA 1QLEC 2HMQA 3DMDA 2R7VA 2L6GA 4C7OA 1ZU5A 1WWPA 4FWVA 5L0FA 5B3SC 2XXAB 2A69F 4DRHB 3NMIA 4BJ1A 4DRIB 3GODA 4JVSA 1W2WA 1LE4A 1MQVA 4CIHA 3EJNA 2LCHA 4MVOA 3I5QA 3C8GA 3W4YA 2GFHA 3JYYA 1GQAA 1NG1A 4LDQA 4L6RA 3ZTMA 1AUEA 2OJED 3O6XA 4YT4A 1VMAA 4U5FE 1YYJA 1ZW3A 4AL1A 2QLAA 2AP3A 1YVIA 3GM1A 2AWCA 3NMKA 2G62A 2NUTB 3T6JA 4JIOA 4DXWA 3U3FA 3C18A 4C3DA 4PFOA 3NDBB 5KYWB 1M6TA 1U6HA 1O5HA 3PDMP 3NYMA 5DVWA 3U0CA 4U5CE 4N4WA 4FESA 2XLHA 2XLWA 2KNHA 3IHUA 3U3BA 2W45A 2WZGA 1V74B 2Y3DA 1AVOB 3UR3C 2R03A 1I4ZA 4H4KC 4LDRA 3VRCA 3DAGA 1WGWA 3OA1A 5JSLA 4BPMA 1G5ZA 5L0IA 4Q5SF 3UMIA 1TQGA 2UUHA 1QPUA 3FXHA 256BA 2Q3TA 3C8ZA 3SYNA 5DS4A 3TJ5A 5K0IA 4XQ1A 3OWTA 3U9MA 3N2ZB 3L1MA 4MVSA 2EPKX 4EWCA 2J7PD 2L81A 4IJJA 3EQLF 2BC5A 5L0HA 2D4UA 3JYHA 4EKWA 2VCBA 2AWYA 1WATA 2ZXPA 3C62A 3FAPB 1JPNA 3KPHA 1D0XA 4RBNA 5GPGB 3V5ZA 4CIPA 3LEOA 1FR0A 1GGQA 5F5HA 4BJTA 4AE4A 4DVZA 1UG7A 2P0NA 4YL0A 1KNYA 1XWJA 3LJBA 3DJNB 3ZG1A 4CDYA 5JT4A 4JRZA 3TOLA 5JLIA 3W8HA 1YLMA 2J7PA 1NFOA 1Q0GA 1OW8A 1FFHA 1M57C 4LACB 4MTFA 1K05A 1QZXA 3GORA 3K66A 3MX3A 4I3MA 1IZMA 2R7OA 3DI5A 4O7GA 4U5EE 5KYXB 1V4AA 2J9VA 3AG2C 3ITFA 3JRTA 4Q7CA 1RKCA 1QKRA 2VCCA 4U5BE 3HLZA 3TOMA 4DBQA 4P9TA 3U8VA 1YA7O 1TWCA 4XEKA 4JW1A 3DM5A 3DD7A 3DM9B 2CDQA 3L0IA 2A6HF 4EBJA 3WG7C 1D0YA 4W8PA 1PV3A 1VK5A 4W8KA 3X1OA 5BQHA 2XXAA 1WOLA 1RJ9B 3IQCA 3SZRA 3KL4A 4NTFA 2L9JA 4P9FA 4OIPF 2PBEA 3NRHA 3R2PA 3RIPA 1VLTA
chains in the Genus database with same CATH topology
5KYUB 4PJNA 4BEJA 4JCHA 5KYNA 2VASA 3JSZA 1KU2A 2JD3A 3M1CB 4C3EA 2X51A 4XLNF 2VH3A 4BJ6C 3LLKA 2C04A 3WODF 4HEAJ 2NUTA 1MMGA 3FVYA 3ZSUA 5KYWA 1NU9C 3DZAA 3AQCA 2HJ3A 1MNDA 2Q9BA 3AG1C 3ABLC 2Q9CA 4P6IC 4YT2A 1LKXA 2IXOA 4GEHA 3L34A 1LVKA 5KYYB 3EZHA 2HV7A 4O6YA 3W8IA 4LLCA 1SZIA 3POVA 2D5RB 3K1HA 3B0VC 4PJJA 1FMWA 3Q7LA 2R7TA 3ASNC 2G3KA 3O39A 3DAFA 3GWNA 5DQZA 4CS7A 2W4BA 4PFPA 2H7OA 1BR1A 3FAJA 4OIOF 4KNVA 3EGDA 4DVYP 1Z3IX 5KYXA 2QTVA 1MMNA 4BJ6A 4CSAC 2R7WA 1PD0A 5E3CA 3AG4C 4KBLA 1D1AA 1MMAA 5D92A 3F47A 4WJ0A 2YEVA 2IXPA 1RJ9A 4KNWA 4G7OF 3S0XA 1TWAA 1M2VB 5KYUA 4J32B 2A1DD 2IXMA 2Y69C 3VAYA 4YN0B 3EZIA 3ECSA 4JURI 3K6BA 3LLIA 5BUOA 2R7XA 2XL4A 1OCRC 4K7BA 2J45A 3Q6NA 2IOQA 3Q6MA 2ZXWC 4IWBA 2NG1A 2Y3GA 2HV6A 2EIMC 2R7SA 3O55A 2YZSA 1JR8A 3OEOA 2IYLD 3LAYA 4G0HA 5KYYA 3KKBA 4B6IA 4MQ9F 2P7VA 2DYRC 2M4EA 2W4MA 4CS9C 4LDKA 3N0TA 3EGXA 3F46A 3S29A 2NUPA 3SNHA 5E3AA 3S28A 2V3CC 2DGJA 1Z63A 2OG2A 3CQZA 3MBGA 4M63A 5E2QA 3EGDB 1JRAA 5CI9A 2KJGA 3AQBA 3TK0A 4E7ZA 2J9WA 2KW3C 3NYLA 5DLJA 3SP1A 3CSKA 3W2WA 3ZC4A 2QY9A 3TD7A 5B1AC 5EHHA 3CZ6A 1OCOC 2CW0F 4FX5A 4F4BA 2CGEA 3EHNA 4HE8D 3Q7GA 1IW7F 4QDLA 1M2VA 1ZHWA 1J8YF 4JZAA 1M2OA 1Z6AA 1FMVA 4G7ZF 3X2QC 1VOMA 4PJMA 1D1BA 3JT1A 4A2NB 3EH2A 4CS9A 4BJ5C 5L3QA 2E87A 4HFKB 5E33A 2V26A 4N06A 4EBBA 3SEOA 2I8BA 1PCXA 3LEVA 2J0XA 4OD5A 2ZPAA 4BG0A 3LNRA 3NYJA 3K1IC 1OCCC 2G3VA 2ZXOA 1LS1A 1Z23A 2DYSC 4U5HA 3DXJF 4U5DE 3NKEA 1MMDA 1V55C 5DS6A 3FDQA 3EGXB 4YT8A 1TWGA 2FFHA 2NUPB 1D1CA 4U5GA 4DBRA 3V7OA 5EGYA 3UMKA 4O6NA 3I5PA 1TKNA 1M56C 1ZHXA 4QI2A 2FGYA 4E0HA 4PJLA 1JPJA 4ANJA 2R7UA 2H7VC 2WZLA 2MWQA 1D0ZA 3H65A 3JCUQ 2EIJC 4NY3A 1VYIA 2WL8A 4KC9A 4MNDA 3NKDA 5T3TA 4BJ5A 4I1MA 4X0RA 5T1DB 1MNEA 1OKKA 3UMHA 2A6EF 3T4RA 3UGPA 2Q9AA 2Y3BA 2PX0A 2EILC 2BE5F 2MYSA 4J30B 1SMYF 3HTKC 2WVNA 2CNWA 4IAOA 2XRHA 3E70C 3QMKA 5DS5A 3NG1A 1OCZC 4PK4A 1S7ZA 4XWJA 1TWHA 3GANA 4K0DA 3UNGC 3B9QA 1FTSA 4CBEA 3KMIA 3AG3C 2O9XA 4OIRF 2LSEA 3ABKC 2WZFA 3U2LA 4OD4A 2R7RA 1VYKA 5T3WA 3QZCA 2C03A 3PMRA 1V54C 4HFFB 5CI8A 3EG9A 2VB6A 3ZIBA 1J8MF 2EINC 4CSAA 4I44A 1G8XA 3UGOA 3B0UX 3RYLA 4XLPF 2PP4A 3U5SA 5DQTA 4E0IA 1ZHYA 4JJGA 2WVQA 1O87A 4E7SA 2PX3A 1ZHZA 4ULWA 3VYWA 2WVOA 1NU7D 3EFOB 3I4UA 1ZU4A 4KI2A 4OINF 4CS8C 4IRUA 5HSWA 4QI0A 3MLGA 1N1CA 1NZEA 1ST6A 1BR2A 3LS0A 2P6VA 2J46A 4OIQF 2KQ9A 5L3VA 1BR4A 4RD9A 4C7OB 3E9VA 3ABMC 3W2VA 4YWQA 2IXNA 3N24A 1ZYRF 3EHMA 4O79A 4AK9A 3RKOF 3EPVA 2WB7A 4G7HF 4GYTA 3B0PA 3EG9B 2B0JA 3LESA 2H7BA 4CS8A 4ZLDA 2Z15A 3KH2A 3LS1A 3HJCA 3K33A 4O6MA 3ASOC 2A68F 3EH1A 2OCCC 4I1OB 4ZLCA 2Y39A 3IEEA 2EIKC 2ZXRA 1OKKD 1PD1A 2XSEA 1FFTC 3R7CA 2YHSA 4XTKA 2PF4E 2KGOA 1Z5ZA 3EFOA 3RH3A 4Q4ZF 5FCLA 4LERA 5D91A 3S27A 5B1BC 2CNWD 1TR2A 4RDAA 4YT5A 1OQCA 3RFYA 1ZHTA 4YJWA 4JJFA 4AE4B 2PFDA 3DJUB 4DOZA 3T6BA 2Y3HA 2J0WA 1SF8A 5IY5C 3PHF2 4AX2A 2W9YA 3FHDA 5F5FA 3K7DA 3ZVRA 3GWLA 3U2MA 2R7QA 4LLEA 2J9UA 3DMDA 1QLEC 4C7OA 1ZU5A 4FWVA 2XXAB 5B3SC 2A69F 4BJ1A 3GODA 4JVSA 1W2WA 4CIHA 3EJNA 3I5QA 3W4YA 2GFHA 1NG1A 3O6XA 4YT4A 1VMAA 4U5FE 3T6JA 2G62A 2NUTB 4C3DA 4PFOA 3NDBB 5KYWB 1O5HA 3NYMA 5DVWA 4U5CE 4FESA 2KNHA 2W45A 2WZGA 2Y3DA 3UR3C 4H4KC 3DAGA 1WGWA 3OA1A 4Q5SF 3UMIA 3SYNA 5DS4A 2Q3TA 3OWTA 3N2ZB 4EWCA 2J7PD 2L81A 4IJJA 3EQLF 3JYHA 2ZXPA 1JPNA 4RBNA 1D0XA 5F5HA 4BJTA 4AE4A 4DVZA 3LJBA 3DJNB 3ZG1A 3W8HA 2J7PA 1FFHA 1M57C 4LACB 1QZXA 4O7GA 3K66A 3MX3A 4I3MA 1IZMA 2R7OA 4U5EE 5KYXB 2J9VA 3AG2C 3ITFA 3JRTA 4Q7CA 4C3BA 4DBQA 4U5BE 3HLZA 1TWCA 4JW1A 3DM5A 3DD7A 3DM9B 2CDQA 3L0IA 2A6HF 3WG7C 1D0YA 1VK5A 4W8KA 3X1OA 2XXAA 4OIPF 1RJ9B 3SZRA 3KL4A 2L9JA 2R7VA 3NRHA 3RIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7C A;  3U2M A;  3U5S A;  4E0I A;  1OQC A;  3MBG A;  3LLK A;  3U2L A;  4E0H A;  3O55 A;  1JRA A;  1JR8 A;  3W4Y A;  3TK0 A;  3GWN A;  2HJ3 A;  3LLI A;  3TD7 A;  4LDK A;  3GWL A; 
#chains in the Genus database with same CATH topology
 1YA9 A;  3MFN A;  5L0J A;  5KYU B;  4PJN A;  4BEJ A;  1A0B A;  4JCH A;  5KYN A;  2VAS A;  3JSZ A;  3S9O A;  1KU2 A;  5A6A A;  2JD3 A;  1LIH A;  3ZQY A;  1RCP A;  3C63 A;  3M1C B;  1HMD A;  4C3E A;  3ATP A;  4XEF A;  5JRA A;  4XPW A;  3S90 A;  2EPO A;  1LI5 A;  1H6G A;  1CPQ A;  2VH3 A;  2X51 A;  4XLN F;  4BJ6 C;  3LLK A;  2C04 A;  3WOD F;  4HEA J;  2NUT A;  5JUA A;  4EUK B;  1MMG A;  3FVY A;  3ZSU A;  5KYW A;  4D4X A;  1A7V A;  1NU9 C;  3DZA A;  2RSE B;  2NSF A;  3AQC A;  5CIV A;  2HJ3 A;  1MND A;  3B71 A;  2Q9B A;  4JEA A;  3TQO A;  3AG1 C;  3ABL C;  1SR2 A;  2Q9C A;  4P6I C;  4YT2 A;  1VB5 A;  1LKX A;  2IXO A;  4GEH A;  4IAQ A;  3L34 A;  2L6H A;  2HSB A;  1LVK A;  1I4Y A;  4CJG A;  1T5O A;  5KYY B;  3EZH A;  3BEH A;  3VM6 A;  1RKE B;  2HV7 A;  2XLE A;  4O6Y A;  3QVZ A;  3W8I A;  2QUP A;  4LLC A;  2HSQ A;  1H9T A;  1SZI A;  3KYJ A;  3POV A;  2D5R B;  2HJM A;  3K1H A;  4NTA A;  3B0V C;  3U9J A;  4PJJ A;  1FMW A;  3Q7L A;  4N6H A;  1A7D A;  2UUI A;  2XS1 A;  2R9R B;  2R7T A;  3ASN C;  2G3K A;  3O39 A;  3AOU A;  4J7T A;  1U89 A;  3DAF A;  3MYI A;  5A6B D;  3M4B A;  3GWN A;  3GM2 A;  5DQZ A;  2YRF A;  3G4Z A;  1HE9 A;  1EKY A;  4CS7 A;  5AC5 A;  2W4B A;  4YL1 A;  1FNT c;  4MTG A;  5L0C A;  2B0H A;  4IB4 A;  4PFP A;  2H7O A;  1BR1 A;  3FAJ A;  4OIO F;  4KNV A;  3EGD A;  4DVY P;  1Z3I X;  3SXY A;  5KYX A;  2F22 A;  2QTV A;  3C8G D;  1Y6D A;  2XLV A;  1MMN A;  4BJ6 A;  5A6B A;  2XL6 A;  4CSA C;  2R7W A;  4R32 A;  4UDV A;  1PD0 A;  5E3C A;  3AG4 C;  5TJ5 E;  2OOC A;  4KBL A;  5BQG A;  4MVZ A;  1E83 A;  1D1A A;  1MMA A;  2HS5 A;  4YK5 A;  5D92 A;  1LM3 B;  3F47 A;  4WJ0 A;  2YEV A;  3MYF A;  2IXP A;  1RJ9 A;  4KNW A;  3IQT A;  4G7O F;  3G4X A;  4CDV A;  3S0X A;  3WHN A;  1TWA A;  1M2V B;  1T6U A;  5A6J A;  1L3P A;  5KYU A;  4J32 B;  2A1D D;  2IXM A;  1E84 A;  2Y69 C;  3VAY A;  2XM0 A;  2IBF A;  1HW2 A;  4YN0 B;  3EZI A;  3ECS A;  4JUR I;  1E86 A;  3K6B A;  3LLI A;  5BUO A;  2R7X A;  3C8G B;  2XL4 A;  2XS8 A;  1OCR C;  1A41 A;  4K7B A;  2AU5 A;  2J45 A;  3Q6N A;  2IOQ A;  3Q6M A;  3U8P A;  2GWW A;  2ZXW C;  1T6Q A;  1T9K A;  4IWB A;  2NG1 A;  2Y3G A;  2HV6 A;  5A69 A;  2EIM C;  1E85 A;  4A4A A;  4CX9 A;  2R7S A;  1QVX A;  4DJ9 A;  3O55 A;  2YZS A;  3GEE A;  3WAQ A;  1JR8 A;  3DKA A;  1NFN A;  4MW3 A;  3OEO A;  2HZ8 A;  2IYL D;  3LAY A;  4G0H A;  1YYX A;  3KKB A;  3GM3 A;  5KYY A;  4B6I A;  4MQ9 F;  1RKE A;  2P7V A;  2DYR C;  2M4E A;  3RVY A;  2W4M A;  4CS9 C;  3HNK A;  1R4T A;  1EQ1 A;  1I5N A;  3H2U A;  3N0T A;  4LDK A;  3EGX A;  3F46 A;  3QW0 A;  1YZA A;  2LK4 A;  2GAQ A;  1JMW A;  2NUP A;  3S29 A;  2I15 A;  3SNH A;  3T6G B;  5E3A A;  2L7A A;  4E18 A;  3S28 A;  2V3C C;  1NSG B;  2DGJ A;  2YQY A;  4MW8 A;  1T01 A;  1YDI A;  4MVM A;  1Z63 A;  2OG2 A;  4JCZ A;  1GM5 A;  3CQZ A;  3HNL A;  2KK1 A;  3MBG A;  4M63 A;  5E2Q A;  2Q7R A;  3EGD B;  4JTC B;  2LQG A;  3HKK A;  1JRA A;  1ORS C;  3LUT B;  5CI9 A;  2KJG A;  3AQB A;  2FAP B;  1TFO B;  2KSF A;  5COG A;  1YZC A;  2LIG A;  2J9W A;  2DI3 A;  2KW3 C;  3TK0 A;  2M64 A;  3NYL A;  4E7Z A;  5BQI A;  4Z9I A;  5DLJ A;  1YJG A;  3FMS A;  3SP1 A;  3CSK A;  5L0G A;  3W2W A;  3ZC4 A;  2QY9 A;  3TD7 A;  5B1A C;  2YLG A;  5L0D A;  5EHH A;  3CZ6 A;  1OCO C;  2CW0 F;  4FX5 A;  4F4B A;  2CGE A;  3CEX A;  3EHN A;  4HE8 D;  2BL2 A;  3Q7G A;  1IW7 F;  3DWW A;  4QDL A;  1M2V A;  5JP7 A;  1ZHW A;  4C3B A;  1J8Y F;  3RW0 A;  4JZA A;  1M2O A;  1Z6A A;  1BZ4 A;  1FMV A;  4G7Z F;  4PR9 A;  1ORY A;  1VOM A;  2YL3 A;  1OXB A;  3X2Q C;  4PJM A;  4YL3 A;  1D1B A;  2VCA A;  3TJ6 A;  5JVE A;  1VTM P;  1ZZP A;  3JT1 A;  4A2N B;  3EH2 A;  4DRJ B;  4CS9 A;  4K1O A;  4BJ5 C;  5L3Q A;  2E87 A;  4HFK B;  5E33 A;  3L8I A;  2V26 A;  4N06 A;  4EBB A;  1Q0M A;  2I8B A;  3SEO A;  1NLX A;  1PCX A;  4J7Y A;  3LEV A;  3AGT A;  2J0X A;  4Z9J A;  2QE9 A;  3FOP A;  2ZPA A;  4OD5 A;  4BG0 A;  3LNR A;  3NYJ A;  3US6 A;  1OW6 A;  2YL0 A;  1OCC C;  2LFD A;  3K1I C;  2R02 A;  3M15 A;  2G3V A;  2ZXO A;  2OKU A;  1LS1 A;  1Z23 A;  2DYS C;  3B29 A;  4U5H A;  3DXJ F;  4U5D E;  1CPR A;  3NKE A;  1MMD A;  1V55 C;  5DS6 A;  3FDQ A;  3EGX B;  4YT8 A;  2X0C A;  4IGG A;  1TWG A;  2FFH A;  2NUP B;  1ORJ A;  2XLD A;  2XL8 A;  3QVY A;  1D1C A;  2CYD A;  4U5G A;  4CJO A;  2H8A A;  4NQF A;  4DBR A;  2JPU A;  1DOV A;  4PAC A;  4U9D A;  3V7O A;  1CGM E;  1BBH A;  5EGY A;  3UMK A;  4O6N A;  3SXM A;  1C17 M;  3I5P A;  3KYI A;  1TKN A;  1M56 C;  1ZHX A;  3ZTZ A;  4QI2 A;  2FGY A;  4E0H A;  1OW7 A;  2HFI A;  4MS2 A;  3TUL A;  4PJL A;  1JPJ A;  3T9O A;  4ANJ A;  2R7U A;  2H7V C;  2WZL A;  2MWQ A;  1D0Z A;  3H65 A;  3JCU Q;  2EIJ C;  4NY3 A;  1VYI A;  2WL8 A;  4KC9 A;  4MND A;  3A9C A;  3NKD A;  5T3T A;  4BJ5 A;  1CGN A;  1DOW A;  2RD9 A;  3AJM A;  4I1M A;  3GEH A;  4X0R A;  2YWA A;  3J06 A;  5T1D B;  1S05 A;  5F28 E;  1MNE A;  1OKK A;  1Q0D A;  1H9G A;  2A6E F;  2KYH A;  3T4R A;  3UMH A;  2JX0 A;  3UGP A;  3IQ5 A;  2Q9A A;  2Y3B A;  4EHP A;  2PX0 A;  2EIL C;  3CAX A;  2BE5 F;  2MYS A;  3AGU A;  4J30 B;  4MVU A;  4XEV A;  2TMV P;  1SMY F;  3HTK C;  2WVN A;  4WAB A;  2CNW A;  4JE9 A;  4IAO A;  2XRH A;  3E70 C;  5COF A;  2YLI A;  2QNL A;  2CCY A;  3QMK A;  5DS5 A;  3NG1 A;  1OCZ C;  4PK4 A;  4Z9H A;  1S7Z A;  3IQ6 A;  3PCV A;  3RF3 A;  1OR2 A;  2P61 A;  1TWH A;  3GAN A;  4K0D A;  4XWJ A;  3UNG C;  3B9Q A;  1FTS A;  1RXQ A;  4CBE A;  2XLO A;  3DE9 A;  3KMI A;  4XPX A;  3AG3 C;  2O9X A;  4OIR F;  1WTY A;  2LSE A;  3JTL O;  3ABK C;  2WZF A;  3U2L A;  3ZWI A;  2EPN A;  1OXK A;  1XZQ A;  4OD4 A;  4NC3 A;  1RMV A;  2VC9 A;  4MVR A;  2R7R A;  1VYK A;  1KTM A;  5T3W A;  3QZC A;  2C03 A;  3PMR A;  1E2X A;  1V54 C;  4HFF B;  5CI8 A;  2Q00 A;  3EG9 A;  1H7I A;  2NPU A;  2VB6 A;  1CGO A;  1OR3 A;  1YAU O;  1Z7Q c;  3ZIB A;  1J8M F;  1HMO A;  2EIN C;  3M79 A;  4CSA A;  4I44 A;  4GQH A;  1G8X A;  1LI7 A;  1AEP A;  2ZD9 A;  5COM A;  5HV9 A;  3UGO A;  1Q0F A;  2L6F A;  3B0U X;  2A0U A;  3RYL A;  4XLP F;  2PP4 A;  2A0B A;  2R25 A;  3RQF A;  1ZHY A;  2EPM X;  3NMJ A;  4NTB A;  3RVZ A;  3U5S A;  5DQT A;  4E0I A;  4JJG A;  1HE1 A;  2WVQ A;  3QTH A;  1O87 A;  4WGY A;  2PX3 A;  2EPL X;  4E7S A;  2ASR A;  1Q0K A;  1ZHZ A;  4ULW A;  3SXK A;  3VYW A;  2WVO A;  1NU7 D;  3EFO B;  3I4U A;  1TFK B;  1ZU4 A;  4KI2 A;  1EA8 A;  4OIN F;  4H54 A;  4CS8 C;  1B68 A;  1G4U S;  1HW1 A;  1O3U A;  4IRU A;  5HSW A;  5EK0 A;  3DE8 A;  4QI0 A;  2LD6 A;  4MTO A;  2P1A A;  3MLG A;  2YKZ A;  1JOG A;  3H2V A;  4JTD B;  1N1C A;  1NZE A;  1ST6 A;  3M4C A;  1HY5 A;  1BR2 A;  3LS0 A;  3RQG A;  1ZVZ A;  3ZQV A;  2P6V A;  3S84 A;  2HUJ A;  4JTA B;  2LP4 A;  2J46 A;  2YL7 A;  4FAP B;  4OIQ F;  4CDA A;  1WAS A;  4N6C A;  4E17 A;  1YAR O;  2J8W A;  1BR4 A;  2KQ9 A;  2OU6 A;  1JAF A;  2XM4 A;  2YLD A;  5L3V A;  4NCQ A;  4RD9 A;  5AC4 A;  3IPM O;  1WN0 A;  2YVK A;  1A7E A;  1R5I D;  5AGF A;  2PNO A;  3HNJ A;  3E9V A;  4C7O B;  1XZP A;  3ABM C;  3HNI A;  4G78 A;  3W2V A;  3JSE O;  4ER9 A;  2OEX A;  1F1M A;  3FOO A;  4YWQ A;  2IXN A;  2OQM A;  1T6I A;  2LFF A;  3N24 A;  1ZYR F;  3EHM A;  4O79 A;  4BEM J;  4AK9 A;  2DB4 A;  1LS4 A;  3RKO F;  1SYQ A;  3SXZ A;  3EPV A;  3ZDL A;  2WB7 A;  4G7H F;  4GYT A;  2HKV A;  1APC A;  1U0B B;  3B0P A;  4ONS A;  3EG9 B;  2B0J A;  3LES A;  2H7B A;  3G50 A;  3RQE A;  4XPY A;  4CS8 A;  1FAP B;  4ZLD A;  5JS5 A;  1NBB A;  2Z15 A;  3KH2 A;  3LS1 A;  3HJC A;  3BRJ A;  2HMZ A;  2GDC A;  3K33 A;  4O6M A;  3JZ0 A;  3ASO C;  2ETS A;  2A68 F;  5B3I A;  3EH1 A;  1C03 A;  4AL0 A;  3V5Y A;  1BDJ B;  2KC3 A;  3LNM B;  2OCC C;  4I1O B;  4JKV A;  4ZLC A;  2Y39 A;  3IEE A;  1QQ3 A;  2EIK C;  2ZXR A;  1L7C A;  1K04 A;  3V5X A;  1PD1 A;  1OKK D;  2OJQ A;  2XSE A;  4IAR A;  1FFT C;  4XTK A;  2YHS A;  3R7C A;  2PF4 E;  2OEV A;  3A11 A;  2KGO A;  1GS9 A;  1Z5Z A;  3EFO A;  3O10 A;  3RH3 A;  4Q4Z F;  2NSG A;  4LER A;  5D91 A;  1Y4C A;  4MVQ A;  2GA0 A;  5B1B C;  3S27 A;  5FCL A;  2CNW D;  1TR2 A;  4RDA A;  4YT5 A;  1OQC A;  5FZT A;  1ZHT A;  4YJW A;  3RFY A;  4JJF A;  4U9E A;  4AE4 B;  1UFB A;  2PFD A;  2IM8 A;  3DJU B;  3GEI A;  4DOZ A;  2AVK A;  2J9B A;  3T6B A;  2Y3H A;  1ZW2 A;  1LE2 A;  1SF8 A;  2J0W A;  3QW1 A;  4EIY A;  1EI7 A;  4ULV A;  2XLM A;  5IY5 C;  1C02 A;  2MHR A;  4D4N A;  3PHF 2;  4AX2 A;  1QSP A;  2W9Y A;  3JRM O;  3K1I A;  3FHD A;  1K40 A;  5F5F A;  3K7D A;  2R05 A;  2ICW G;  3C7J A;  4EBK A;  2Q4F A;  5A6K A;  3ZVR A;  3GWL A;  3VF0 A;  4JC7 A;  1G4W R;  2R7Q A;  4JEB A;  3U2M A;  4LLE A;  1VLS A;  2YL1 A;  4WGZ A;  3L8J A;  2J9U A;  1LPE A;  1QLE C;  2HMQ A;  3DMD A;  2R7V A;  2L6G A;  4C7O A;  1ZU5 A;  1WWP A;  4FWV A;  5L0F A;  5B3S C;  2XXA B;  2A69 F;  4DRH B;  3NMI A;  4BJ1 A;  4DRI B;  3GOD A;  4JVS A;  1W2W A;  1LE4 A;  1MQV A;  4CIH A;  3EJN A;  2LCH A;  4MVO A;  3I5Q A;  3C8G A;  3W4Y A;  2GFH A;  3JYY A;  1GQA A;  1NG1 A;  4LDQ A;  4L6R A;  3ZTM A;  1AUE A;  2OJE D;  3O6X A;  4YT4 A;  1VMA A;  4U5F E;  1YYJ A;  1ZW3 A;  4AL1 A;  2QLA A;  2AP3 A;  1YVI A;  3GM1 A;  2AWC A;  3NMK A;  2G62 A;  2NUT B;  3T6J A;  4JIO A;  4DXW A;  3U3F A;  3C18 A;  4C3D A;  4PFO A;  3NDB B;  5KYW B;  1M6T A;  1U6H A;  1O5H A;  3PDM P;  3NYM A;  5DVW A;  3U0C A;  4U5C E;  4N4W A;  4FES A;  2XLH A;  2XLW A;  2KNH A;  3IHU A;  3U3B A;  2W45 A;  2WZG A;  1V74 B;  2Y3D A;  1AVO B;  3UR3 C;  2R03 A;  1I4Z A;  4H4K C;  4LDR A;  3VRC A;  3DAG A;  1WGW A;  3OA1 A;  5JSL A;  4BPM A;  1G5Z A;  5L0I A;  4Q5S F;  3UMI A;  1TQG A;  2UUH A;  1QPU A;  3FXH A;  256B A;  2Q3T A;  3C8Z A;  3SYN A;  5DS4 A;  3TJ5 A;  5K0I A;  4XQ1 A;  3OWT A;  3U9M A;  3N2Z B;  3L1M A;  4MVS A;  2EPK X;  4EWC A;  2J7P D;  2L81 A;  4IJJ A;  3EQL F;  2BC5 A;  5L0H A;  2D4U A;  3JYH A;  4EKW A;  2VCB A;  2AWY A;  1WAT A;  2ZXP A;  3C62 A;  3FAP B;  1JPN A;  3KPH A;  1D0X A;  4RBN A;  5GPG B;  3V5Z A;  4CIP A;  3LEO A;  1FR0 A;  1GGQ A;  5F5H A;  4BJT A;  4AE4 A;  4DVZ A;  1UG7 A;  2P0N A;  4YL0 A;  1KNY A;  1XWJ A;  3LJB A;  3DJN B;  3ZG1 A;  4CDY A;  5JT4 A;  4JRZ A;  3TOL A;  5JLI A;  3W8H A;  1YLM A;  2J7P A;  1NFO A;  1Q0G A;  1OW8 A;  1FFH A;  1M57 C;  4LAC B;  4MTF A;  1K05 A;  1QZX A;  3GOR A;  3K66 A;  3MX3 A;  4I3M A;  1IZM A;  2R7O A;  3DI5 A;  4O7G A;  4U5E E;  5KYX B;  1V4A A;  2J9V A;  3AG2 C;  3ITF A;  3JRT A;  4Q7C A;  1RKC A;  1QKR A;  2VCC A;  4U5B E;  3HLZ A;  3TOM A;  4DBQ A;  4P9T A;  3U8V A;  1YA7 O;  1TWC A;  4XEK A;  4JW1 A;  3DM5 A;  3DD7 A;  3DM9 B;  2CDQ A;  3L0I A;  2A6H F;  4EBJ A;  3WG7 C;  1D0Y A;  4W8P A;  1PV3 A;  1VK5 A;  4W8K A;  3X1O A;  5BQH A;  2XXA A;  1WOL A;  1RJ9 B;  3IQC A;  3SZR A;  3KL4 A;  4NTF A;  2L9J A;  4P9F A;  4OIP F;  2PBE A;  3NRH A;  3R2P A;  3RIP A;  1VLT A; 
#chains in the Genus database with same CATH homology
 5KYU B;  4PJN A;  4BEJ A;  4JCH A;  5KYN A;  2VAS A;  3JSZ A;  1KU2 A;  2JD3 A;  3M1C B;  4C3E A;  2X51 A;  4XLN F;  2VH3 A;  4BJ6 C;  3LLK A;  2C04 A;  3WOD F;  4HEA J;  2NUT A;  1MMG A;  3FVY A;  3ZSU A;  5KYW A;  1NU9 C;  3DZA A;  3AQC A;  2HJ3 A;  1MND A;  2Q9B A;  3AG1 C;  3ABL C;  2Q9C A;  4P6I C;  4YT2 A;  1LKX A;  2IXO A;  4GEH A;  3L34 A;  1LVK A;  5KYY B;  3EZH A;  2HV7 A;  4O6Y A;  3W8I A;  4LLC A;  1SZI A;  3POV A;  2D5R B;  3K1H A;  3B0V C;  4PJJ A;  1FMW A;  3Q7L A;  2R7T A;  3ASN C;  2G3K A;  3O39 A;  3DAF A;  3GWN A;  5DQZ A;  4CS7 A;  2W4B A;  4PFP A;  2H7O A;  1BR1 A;  3FAJ A;  4OIO F;  4KNV A;  3EGD A;  4DVY P;  1Z3I X;  5KYX A;  2QTV A;  1MMN A;  4BJ6 A;  4CSA C;  2R7W A;  1PD0 A;  5E3C A;  3AG4 C;  4KBL A;  1D1A A;  1MMA A;  5D92 A;  3F47 A;  4WJ0 A;  2YEV A;  2IXP A;  1RJ9 A;  4KNW A;  4G7O F;  3S0X A;  1TWA A;  1M2V B;  5KYU A;  4J32 B;  2A1D D;  2IXM A;  2Y69 C;  3VAY A;  4YN0 B;  3EZI A;  3ECS A;  4JUR I;  3K6B A;  3LLI A;  5BUO A;  2R7X A;  2XL4 A;  1OCR C;  4K7B A;  2J45 A;  3Q6N A;  2IOQ A;  3Q6M A;  2ZXW C;  4IWB A;  2NG1 A;  2Y3G A;  2HV6 A;  2EIM C;  2R7S A;  3O55 A;  2YZS A;  1JR8 A;  3OEO A;  2IYL D;  3LAY A;  4G0H A;  5KYY A;  3KKB A;  4B6I A;  4MQ9 F;  2P7V A;  2DYR C;  2M4E A;  2W4M A;  4CS9 C;  4LDK A;  3N0T A;  3EGX A;  3F46 A;  3S29 A;  2NUP A;  3SNH A;  5E3A A;  3S28 A;  2V3C C;  2DGJ A;  1Z63 A;  2OG2 A;  3CQZ A;  3MBG A;  4M63 A;  5E2Q A;  3EGD B;  1JRA A;  5CI9 A;  2KJG A;  3AQB A;  3TK0 A;  4E7Z A;  2J9W A;  2KW3 C;  3NYL A;  5DLJ A;  3SP1 A;  3CSK A;  3W2W A;  3ZC4 A;  2QY9 A;  3TD7 A;  5B1A C;  5EHH A;  3CZ6 A;  1OCO C;  2CW0 F;  4FX5 A;  4F4B A;  2CGE A;  3EHN A;  4HE8 D;  3Q7G A;  1IW7 F;  4QDL A;  1M2V A;  1ZHW A;  1J8Y F;  4JZA A;  1M2O A;  1Z6A A;  1FMV A;  4G7Z F;  3X2Q C;  1VOM A;  4PJM A;  1D1B A;  3JT1 A;  4A2N B;  3EH2 A;  4CS9 A;  4BJ5 C;  5L3Q A;  2E87 A;  4HFK B;  5E33 A;  2V26 A;  4N06 A;  4EBB A;  3SEO A;  2I8B A;  1PCX A;  3LEV A;  2J0X A;  4OD5 A;  2ZPA A;  4BG0 A;  3LNR A;  3NYJ A;  3K1I C;  1OCC C;  2G3V A;  2ZXO A;  1LS1 A;  1Z23 A;  2DYS C;  4U5H A;  3DXJ F;  4U5D E;  3NKE A;  1MMD A;  1V55 C;  5DS6 A;  3FDQ A;  3EGX B;  4YT8 A;  1TWG A;  2FFH A;  2NUP B;  1D1C A;  4U5G A;  4DBR A;  3V7O A;  5EGY A;  3UMK A;  4O6N A;  3I5P A;  1TKN A;  1M56 C;  1ZHX A;  4QI2 A;  2FGY A;  4E0H A;  4PJL A;  1JPJ A;  4ANJ A;  2R7U A;  2H7V C;  2WZL A;  2MWQ A;  1D0Z A;  3H65 A;  3JCU Q;  2EIJ C;  4NY3 A;  1VYI A;  2WL8 A;  4KC9 A;  4MND A;  3NKD A;  5T3T A;  4BJ5 A;  4I1M A;  4X0R A;  5T1D B;  1MNE A;  1OKK A;  3UMH A;  2A6E F;  3T4R A;  3UGP A;  2Q9A A;  2Y3B A;  2PX0 A;  2EIL C;  2BE5 F;  2MYS A;  4J30 B;  1SMY F;  3HTK C;  2WVN A;  2CNW A;  4IAO A;  2XRH A;  3E70 C;  3QMK A;  5DS5 A;  3NG1 A;  1OCZ C;  4PK4 A;  1S7Z A;  4XWJ A;  1TWH A;  3GAN A;  4K0D A;  3UNG C;  3B9Q A;  1FTS A;  4CBE A;  3KMI A;  3AG3 C;  2O9X A;  4OIR F;  2LSE A;  3ABK C;  2WZF A;  3U2L A;  4OD4 A;  2R7R A;  1VYK A;  5T3W A;  3QZC A;  2C03 A;  3PMR A;  1V54 C;  4HFF B;  5CI8 A;  3EG9 A;  2VB6 A;  3ZIB A;  1J8M F;  2EIN C;  4CSA A;  4I44 A;  1G8X A;  3UGO A;  3B0U X;  3RYL A;  4XLP F;  2PP4 A;  3U5S A;  5DQT A;  4E0I A;  1ZHY A;  4JJG A;  2WVQ A;  1O87 A;  4E7S A;  2PX3 A;  1ZHZ A;  4ULW A;  3VYW A;  2WVO A;  1NU7 D;  3EFO B;  3I4U A;  1ZU4 A;  4KI2 A;  4OIN F;  4CS8 C;  4IRU A;  5HSW A;  4QI0 A;  3MLG A;  1N1C A;  1NZE A;  1ST6 A;  1BR2 A;  3LS0 A;  2P6V A;  2J46 A;  4OIQ F;  2KQ9 A;  5L3V A;  1BR4 A;  4RD9 A;  4C7O B;  3E9V A;  3ABM C;  3W2V A;  4YWQ A;  2IXN A;  3N24 A;  1ZYR F;  3EHM A;  4O79 A;  4AK9 A;  3RKO F;  3EPV A;  2WB7 A;  4G7H F;  4GYT A;  3B0P A;  3EG9 B;  2B0J A;  3LES A;  2H7B A;  4CS8 A;  4ZLD A;  2Z15 A;  3KH2 A;  3LS1 A;  3HJC A;  3K33 A;  4O6M A;  3ASO C;  2A68 F;  3EH1 A;  2OCC C;  4I1O B;  4ZLC A;  2Y39 A;  3IEE A;  2EIK C;  2ZXR A;  1OKK D;  1PD1 A;  2XSE A;  1FFT C;  3R7C A;  2YHS A;  4XTK A;  2PF4 E;  2KGO A;  1Z5Z A;  3EFO A;  3RH3 A;  4Q4Z F;  5FCL A;  4LER A;  5D91 A;  3S27 A;  5B1B C;  2CNW D;  1TR2 A;  4RDA A;  4YT5 A;  1OQC A;  3RFY A;  1ZHT A;  4YJW A;  4JJF A;  4AE4 B;  2PFD A;  3DJU B;  4DOZ A;  3T6B A;  2Y3H A;  2J0W A;  1SF8 A;  5IY5 C;  3PHF 2;  4AX2 A;  2W9Y A;  3FHD A;  5F5F A;  3K7D A;  3ZVR A;  3GWL A;  3U2M A;  2R7Q A;  4LLE A;  2J9U A;  3DMD A;  1QLE C;  4C7O A;  1ZU5 A;  4FWV A;  2XXA B;  5B3S C;  2A69 F;  4BJ1 A;  3GOD A;  4JVS A;  1W2W A;  4CIH A;  3EJN A;  3I5Q A;  3W4Y A;  2GFH A;  1NG1 A;  3O6X A;  4YT4 A;  1VMA A;  4U5F E;  3T6J A;  2G62 A;  2NUT B;  4C3D A;  4PFO A;  3NDB B;  5KYW B;  1O5H A;  3NYM A;  5DVW A;  4U5C E;  4FES A;  2KNH A;  2W45 A;  2WZG A;  2Y3D A;  3UR3 C;  4H4K C;  3DAG A;  1WGW A;  3OA1 A;  4Q5S F;  3UMI A;  3SYN A;  5DS4 A;  2Q3T A;  3OWT A;  3N2Z B;  4EWC A;  2J7P D;  2L81 A;  4IJJ A;  3EQL F;  3JYH A;  2ZXP A;  1JPN A;  4RBN A;  1D0X A;  5F5H A;  4BJT A;  4AE4 A;  4DVZ A;  3LJB A;  3DJN B;  3ZG1 A;  3W8H A;  2J7P A;  1FFH A;  1M57 C;  4LAC B;  1QZX A;  4O7G A;  3K66 A;  3MX3 A;  4I3M A;  1IZM A;  2R7O A;  4U5E E;  5KYX B;  2J9V A;  3AG2 C;  3ITF A;  3JRT A;  4Q7C A;  4C3B A;  4DBQ A;  4U5B E;  3HLZ A;  1TWC A;  4JW1 A;  3DM5 A;  3DD7 A;  3DM9 B;  2CDQ A;  3L0I A;  2A6H F;  3WG7 C;  1D0Y A;  1VK5 A;  4W8K A;  3X1O A;  2XXA A;  4OIP F;  1RJ9 B;  3SZR A;  3KL4 A;  2L9J A;  2R7V A;  3NRH A;  3RIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...