3LLIA

Sulfhydryl oxidase fragment of human qsox1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
251
Chain Sequence
ADRSKIYMADLESALHYILRIEVGRFPVLEGQRLVALKKFVAVLAKYFPGRPLVQNFLHSVNEWLKRQKRNKIPYSFFKTALDDRKEGAVLAKKVNWIGCQGSEPHFRGFPCSLWVLFHFLTVQAARQNVDHSQEAAKAKEVLPAIRGYVHYFFGCRDCASHFEQMAAASMHRVGSPNAAVLWLWSSHNRVNARLAGAPSEDPQFPKVQWPPRELCSACHNERLDVPVWDVEATLNFLKAHFSPSNIILDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sulfhydryl oxidase 1
publication title QSOX contains a pseudo-dimer of functional and degenerate sulfhydryl oxidase domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 87
structure length 251
sequence length 251
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
A PF18371 FAD_SOX Flavin adenine dinucleotide (FAD)-dependent sulfhydryl oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3lliA02
1.20.120.1960 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3lliA01
4E0HA 1JRAA 3GWNA 4LDKA 3W4YA 3U2MA 3TD7A 3MBGA 3TK0A 3LLIA 2HJ3A 1OQCA 3U2LA 3U5SA 3LLKA 3GWLA 1JR8A 4E0IA 3O55A 3R7CA
chains in the Genus database with same CATH superfamily
1YA7O 3B0UX 3IPMO 4JTDB 5KYXB 1JAFA 2IBFA 3RF3A 2XLOA 4MTGA 1ORSC 2PFDA 2XSEA 3W4YA 3ZWIA 3HJCA 4CS7A 1ZHWA 1QQ3A 3E9VA 2O9XA 2OEXA 2LD6A 1FR0A 1QSPA 4GQHA 2LCHA 2XXAA 1IZMA 2A6EF 2P1AA 5L3QA 1T5OA 1YLMA 2KNHA 3JYYA 2QY9A 2XRHA 4I44A 3SP1A 4BJTA 4NTFA 1H7IA 3PMRA 4EBBA 1WATA 1VYIA 3C7JA 3FMSA 1HY5A 2XM0A 3G4XA 1RCPA 3NYMA 4N6CA 4PJJA 1YAUO 1APCA 4IRUA 3JSZA 1RKEA 3VM6A 2YKZA 1OCZC 1SF8A 2AWCA 1LIHA 1LE2A 2W4BA 3GODA 3JCUQ 4IARA 4N06A 2R7WA 3FVYA 4H54A 3U0CA 3Q6NA 3US6A 3IHUA 4K0DA 1Q0KA 1YYJA 3RW0A 3RQEA 2XLEA 2HFIA 3WAQA 4JJGA 3ZQYA 3JSEO 1BBHA 1FFHA 2R05A 3LESA 1DOWA 4O7GA 2FFHA 1MMGA 1ZHTA 5L3VA 2KK1A 4E7SA 2XLMA 3JYHA 3M1CB 3NKDA 4J32B 2ZXRA 3U9JA 2R7XA 2B0HA 1C03A 1OQCA 2EIKC 2YRFA 3HNLA 1D0YA 3J06A 2XLWA 2P7VA 3DWWA 2LSEA 2AWYA 2Y3BA 1SMYF 1VLTA 3TOLA 3UGPA 3B29A 1LM3B 4JEAA 4ER9A 3IQ6A 3GORA 2MWQA 3LJBA 5DVWA 3V5ZA 2YL0A 1NG1A 1OW7A 3HNKA 3OEOA 4Q7CA 3M15A 2KC3A 2Q3TA 1YA9A 1IW7F 3C63A 3O10A 2GFHA 4DRHB 4C7OB 2MYSA 3X1OA 2R02A 4N4WA 2LIGA 3U8PA 3WHNA 3KYJA 1G8XA 2R9RB 1CGNA 4YJWA 5CIVA 2ZXWC 2CNWA 1D0XA 3SXMA 4XPWA 2ZD9A 2A0BA 3DZAA 5JVEA 4PACA 3RIPA 2PNOA 2GAQA 1AVOB 2VCAA 3NG1A 1WOLA 2PX0A 3HKKA 3I5QA 4DVYP 5JRAA 2Z15A 3E70C 3LUTB 5JT4A 2HKVA 3FOPA 4FWVA 1A7EA 2HS5A 3ITFA 3V7OA 4BJ6A 1Z5ZA 2QLAA 3JT1A 1SZIA 4FESA 5T3WA 1HE9A 3W8IA 1QPUA 2A6HF 3C8GD 4IAQA 5KYUA 4EIYA 4BPMA 3DE8A 4U5EE 4A2NB 3AG4C 3MFNA 4JC7A 4WABA 3R7CA 4XLPF 1GGQA 2HSQA 2VCBA 3C8ZA 5GPGB 1U89A 3N24A 2GA0A 2HMQA 1E2XA 1OR3A 1V55C 1Y6DA 2OEVA 2YL7A 4JURI 4U5FE 4DOZA 1MMAA 5KYWA 3FXHA 2C03A 4XTKA 3QW1A 4K1OA 3ABKC 3B71A 4C3EA 2KYHA 1UG7A 4YL0A 3HLZA 4AX2A 1BZ4A 2L6FA 4E18A 1G4US 1SYQA 2EPOA 4CS8A 1OCOC 3BEHA 1K05A 3G50A 3LLIA 4XWJA 4G7ZF 2WZGA 1YARO 4CS9C 1A41A 5A6BA 4JTCB 4WJ0A 1QLEC 2HUJA 1ZHZA 5A69A 1L3PA 3TJ5A 2J9VA 2A68F 3A11A 2RD9A 2CCYA 4CJOA 3K1IC 2PBEA 4XEFA 3O39A 2J7PA 4X0RA 1JPJA 2R7UA 3DE9A 3DM9B 4PR9A 2L6GA 1A7DA 2Q9BA 3F47A 2A1DD 3NMIA 4P9FA 4BJ1A 1PV3A 1E83A 1T9KA 2QUPA 1OCCC 2HJMA 2YLIA 2JPUA 2WL8A 4JTAB 2W9YA 1WASA 2GWWA 3L0IA 3BRJA 3S90A 4MVOA 3EJNA 1EQ1A 2Q4FA 3HTKC 4K7BA 3VRCA 3ABLC 3S0XA 5HV9A 4XPYA 4E17A 2EPMX 4CDAA 4YT8A 1L7CA 3KMIA 3UGOA 2J9BA 1G5ZA 1M2VA 4RDAA 1XZPA 1QZXA 3DI5A 2A0UA 5L0CA 2J0XA 3JRTA 3K6BA 2R03A 4Q4ZF 3NKEA 1TFOB 3F46A 4JJFA 2R7RA 4KI2A 3JTLO 2OQMA 3IQTA 3NMJA 4I1OB 2H8AA 3EZIA 1BDJB 2Q9AA 1Q0FA 2ZPAA 2OJED 3NYLA 4MVMA 4C3DA 1NLXA 3EG9A 2IXNA 1HW2A 1VYKA 2PP4A 3M4CA 4J7TA 5HSWA 4XEKA 2NG1A 1N1CA 3O55A 3R2PA 2TMVP 2YLDA 4U5GA 2KJGA 2M4EA 5B3SC 5L0IA 4OIQF 1CPQA 1H6GA 1JRAA 4O79A 5CI8A 3EFOB 2EPNA 4BJ5C 4LDKA 1E84A 3TD7A 1KTMA 3GEHA 1KU2A 3DJNB 1LVKA 3AQBA 1LE4A 4O6YA 3SEOA 3EHNA 1GM5A 3H65A 1EKYA 1XWJA 2LFDA 5COMA 4JCZA 3ZSUA 1YYXA 3H2UA 4MNDA 5AC5A 1T6UA 2OCCC 2VC9A 5L0DA 5DS5A 2CYDA 3U9MA 4XQ1A 5JLIA 3AG3C 1OR2A 2CNWD 5BQHA 3G4ZA 3K33A 3VF0A 3CQZA 4E0IA 3S9OA 1OW8A 1RJ9A 3DJUB 1I4ZA 4WGYA 2JX0A 4OD4A 3DKAA 3MYFA 4O6NA 3EZHA 1MMDA 4MQ9F 3W2VA 2XL4A 5E2QA 3V5XA 1OKKD 4BEMJ 2EINC 3DAFA 4BEJA 1Z23A 2D5RB 2L6HA 2WZLA 4GYTA 4FAPB 3GANA 3T6JA 4HEAJ 1LPEA 3C18A 1TQGA 3EH2A 4EBJA 4ZLDA 5D91A 4CSAC 2OU6A 1EA8A 5JSLA 1BR1A 2EPKX 4YT5A 2V3CC 4MS2A 1YVIA 2MHRA 2OKUA 3EH1A 5EHHA 2PX3A 4MVZA 4QI0A 3Q7LA 3U3FA 1Q0DA 2HMZA 3K66A 5KYNA 1Z63A 2QTVA 2LP4A 1ZHYA 3ABMC 2E87A 2XLVA 4IJJA 4NTBA 1MQVA 3L1MA 5F28E 1E86A 4U9DA 1TWAA 4JKVA 5KYYB 1C02A 1O87A 2LQGA 1U6HA 3RH3A 4Z9JA 5KYXA 3SXYA 4DRIB 5L0FA 2J9WA 4JEBA 1U0BB 1UFBA 2QE9A 1YZAA 4IAOA 4JCHA 2Q7RA 3PDMP 4Z9IA 1LI5A 3RVYA 4P6IC 2OJQA 2YL1A 5CI9A 3M4BA 1ORYA 2P0NA 5AGFA 4CBEA 3VYWA 2HSBA 4OIRF 3AGUA 4LLCA 3N0TA 1HMOA 2J9UA 2KW3C 3TULA 2Y3DA 1AUEA 1TKNA 2R25A 3LNRA 3LEVA 1RXQA 3L8IA 2WZFA 4KNVA 5DQZA 3S84A 3ATPA 4WGZA 4GEHA 3M79A 4E7ZA 4NQFA 2C04A 4G0HA 2IXMA 5BQIA 1ST6A 5L0HA 2ASRA 1OW6A 3V5YA 1G4WR 1D1CA 3EGXB 3ZTMA 3U2MA 3UMHA 3DD7A 3U8VA 3C8GB 1B68A 4KNWA 3GEEA 3U3BA 5E33A 1OCRC 4BG0A 3JZ0A 2OOCA 4NTAA 4HFKB 5AC4A 5DS4A 3U5SA 3AQCA 3EHMA 3K7DA 3NDBB 4JIOA 2PF4E 2YL3A 1KNYA 2NUTB 4OINF 1NBBA 5FZTA 3B9QA 4EWCA 3S28A 1Z3IX 1WTYA 4J30B 4HE8D 3C62A 1SR2A 4AL0A 3S27A 3T6BA 2CW0F 2DYRC 3QW0A 3IQCA 2DYSC 2XLDA 1A0BA 4DBQA 3L8JA 3ZG1A 3H2VA 2XL6A 2EILC 3ZDLA 3ASNC 3W8HA 1PD0A 2BC5A 5KYYA 5JS5A 1NFOA 4C7OA 1QVXA 2F22A 4KC9A 4PJLA 3SXKA 3O6XA 2ZXPA 2YVKA 2KSFA 4OIOF 2XS8A 1S05A 2KGOA 2YEVA 3ZVRA 4A4AA 1H9TA 2XXAB 2J0WA 2WB7A 2IXOA 2H7BA 1K04A 3PCVA 4LDQA 2ETSA 4YT2A 4OD5A 3DMDA 1M2OA 3DAGA 3LLKA 3OWTA 4L6RA 3TQOA 2A69F 1Q0MA 3T4RA 3QZCA 2AU5A 3AJMA 1DOVA 3GWLA 1LI7A 1RKEB 2IOQA 4RD9A 1VMAA 4G7HF 1O5HA 2XM4A 5B1BC 1PCXA 4DRJB 5A6KA 4FX5A 5TJ5E 3AG2C 5B3IA 3N2ZB 3MLGA 2FGYA 3UNGC 5L0JA 4E0HA 1H9GA 3GM1A 3KPHA 1YZCA 4NCQA 5JP7A 4NY3A 3FOOA 3LAYA 2R7QA 2G3KA 4IGGA 1YDIA 4LDRA 4PJMA 4DBRA 1FFTC 2QNLA 3EGXA 4U5DE 4MVSA 4ULVA 1M6TA 4NC3A 4U5HA 3QVYA 4YL3A 3UMKA 1V4AA 5BUOA 4J7YA 3U2LA 3DXJF 2IYLD 1TFKB 1VLSA 3JRMO 3VAYA 4QI2A 2HV6A 1K40A 4JZAA 2NSGA 4ZLCA 3LEOA 1ZVZA 3GM2A 1JR8A 3HNJA 4MW3A 4ULWA 2H7OA 4D4XA 3EPVA 5DQTA 2J8WA 4MVQA 1ZZPA 1NSGB 1VTMP 1LKXA 1FTSA 4O6MA 1ZU4A 4CS9A 5F5FA 2ICWG 1QKRA 3AG1C 1O3UA 1OXKA 5E3AA 3RQFA 2I8BA 3X2QC 1M57C 2YLGA 2KQ9A 3GWNA 3KYIA 5A6JA 4PFPA 2NUPB 2R7OA 3AGTA 3K1IA 3K1HA 2I15A 4BJ6C 1MNEA 4XEVA 4XPXA 5COGA 3LS1A 3ZIBA 1ORJA 2D4UA 4G78A 2R7SA 4EHPA 2YWAA 3FDQA 2NSFA 2HJ3A 4ANJA 1VK5A 4Z9HA 2YZSA 4OIPF 3IQ5A 3OA1A 1R4TA 3I5PA 2X51A 5T3TA 2CGEA 4F4BA 1MNDA 5L0GA 5KYUB 3DM5A 4MVUA 3MX3A 1XZQA 1V74B 3LNMB 4MTOA 4MVRA 3T9OA 4JRZA 3B0PA 3Q7GA 2DGJA 4CS8C 1TWCA 2XS1A 5BQGA 5A6BD 1NU7D 5KYWB 2DI3A 3SYNA 3QTHA 5T1DB 1TWGA 1PD1A 2J7PD 3NMKA 1ZHXA 2EIJC 3KL4A 3LS0A 3MBGA 1JOGA 3EFOA 1AEPA 3QMKA 4HFFB 4P9TA 3FAJA 2G62A 4DXWA 3A9CA 4EBKA 5F5HA 4C3BA 1FMVA 4UDVA 5D92A 4JVSA 1RKCA 2Y39A 4U5CE 3B0VC 1FMWA 1I4YA 2Y3HA 3S29A 4QDLA 4RBNA 4LLEA 1FAPB 4D4NA 4YWQA 1OXBA 1TR2A 1HW1A 1VB5A 1Z6AA 1EI7A 2V26A 3ASOC 1JMWA 3FHDA 4PFOA 4XLNF 2Y3GA 4LERA 4N6HA 3UR3C 1T01A 3CAXA 3RQGA 4BJ5A 5IY5C 5JUAA 2NPUA 4LACB 2Q00A 2L7AA 1TWHA 3SNHA 1CGME 2FAPB 3SZRA 1I5NA 4MTFA 3NYJA 3SXZA 4U9EA 1JPNA 4CIPA 1C17M 1T6IA 2VB6A 4DJ9A 2P61A 3CEXA 3EQLF 1M56C 1M2VB 1J8YF 2XL8A 4YL1A 3RKOF 3NRHA 3ZTZA 3L34A 4CJGA 2NUPA 4AE4B 3IEEA 2ZXOA 1MMNA 3WG7C 3KH2A 4I3MA 2W4MA 5E3CA 1E85A 4YT4A 2CDQA 2Q9CA 3EGDB 1GS9A 1YJGA 4JW1A 1HE1A 3EG9B 2WVNA 1OKKA 4CX9A 5B1AC 1D1AA 3CSKA 3PHF2 4M63A 2M64A 2X0CA 4CSAA 2JD3A 2OG2A 3HNIA 3AOUA 2R7TA 3I4UA 1ZW3A 4U5BE 3TOMA 2XLHA 4KBLA 1LS4A 2DB4A 2IXPA 2LFFA 4IB4A 4W8KA 1RMVA 2WVOA 4EUKB 1NZEA 2UUIA 1S7ZA 2P6VA 4Q5SF 256BA 3Q6MA 1Z7Qc 3RFYA 5COFA 1WWPA 1Y4CA 2BE5F 4R32A 2G3VA 1BR4A 2VH3A 2W45A 1WN0A 2YQYA 3RVZA 2RSEB 4CIHA 4W8PA 2L81A 1J8MF 4JE9A 3ZC4A 1CGOA 2HZ8A 2J45A 4AK9A 1HMDA 4IWBA 1CPRA 1LS1A 4G7OF 2BL2A 3W2WA 1A7VA 2J46A 1RJ9B 1W2WA 2AP3A 4CDVA 1D1BA 3CZ6A 3POVA 3TJ6A 3WODF 1ZU5A 3FAPB 5EK0A 3T6GB 2GDCA 5DLJA 4EKWA 4AL1A 2L9JA 2AVKA 1D0ZA 1BR2A 2VCCA 3MYIA 5K0IA 4MW8A 2YHSA 2EPLX 4PK4A 5A6AA 1NFNA 3QVZA 2IM8A 4PJNA 1F1MA 4I1MA 4AE4A 4YN0B 5DS6A 1Q0GA 2LK4A 3KKBA 2Y69C 4H4KC 3RYLA 1VOMA 1R5ID 3C8GA 3GEIA 1ZYRF 3TK0A 2VASA 5FCLA 3EGDA 2EIMC 5EGYA 1T6QA 3GM3A 1FNTc 1V54C 4CDYA 2UUHA 1ZW2A 1WGWA 4DVZA 2HV7A 1GQAA 2WVQA 3ZQVA 3ECSA 1NU9C 2NUTA 3UMIA 2R7VA 4B6IA 2B0JA 4ONSA 4YK5A 2H7VC
chains in the Genus database with same CATH topology
3B0UX 5KYXB 3W4YA 2PFDA 2XSEA 3HJCA 4CS7A 1ZHWA 3E9VA 2O9XA 2XXAA 1IZMA 2A6EF 5L3QA 2KNHA 4I44A 2QY9A 2XRHA 3SP1A 4BJTA 3PMRA 1VYIA 3NYMA 4PJJA 4IRUA 3JSZA 1OCZC 1SF8A 2W4BA 3JCUQ 4N06A 3GODA 2R7WA 3FVYA 3Q6NA 4K0DA 4JJGA 1FFHA 3LESA 4O7GA 2FFHA 1MMGA 1ZHTA 5L3VA 4E7SA 3JYHA 3M1CB 3NKDA 4J32B 2ZXRA 2R7XA 1OQCA 2EIKC 1D0YA 2P7VA 2LSEA 2Y3BA 1SMYF 3UGPA 3LJBA 2MWQA 5DVWA 4Q7CA 1NG1A 3OEOA 2Q3TA 1IW7F 2GFHA 4C7OB 2MYSA 3X1OA 1G8XA 4YJWA 2ZXWC 2CNWA 1D0XA 3DZAA 3RIPA 3NG1A 2PX0A 3I5QA 4DVYP 3S0XA 2Z15A 3E70C 3V7OA 4FWVA 3ITFA 4BJ6A 1Z5ZA 3JT1A 4FESA 1SZIA 5T3WA 3W8IA 2A6HF 5KYUA 4U5EE 4A2NB 3R7CA 3AG4C 4XLPF 3N24A 1V55C 4DOZA 4JURI 4U5FE 1MMAA 5KYWA 2C03A 4XTKA 3ABKC 4C3EA 3HLZA 4AX2A 4CS8A 1OCOC 3LLIA 4XWJA 4G7ZF 2WZGA 4CS9C 4WJ0A 1QLEC 1ZHZA 2J9VA 2A68F 3K1IC 3O39A 2J7PA 4X0RA 1JPJA 2R7UA 3DM9B 2Q9BA 3F47A 2A1DD 4BJ1A 1OCCC 2WL8A 2W9YA 3L0IA 3EJNA 3HTKC 4K7BA 3ABLC 3UGOA 4YT8A 3KMIA 1M2VA 4RDAA 1QZXA 2J0XA 3JRTA 3K6BA 4Q4ZF 3NKEA 3F46A 2R7RA 4JJFA 4KI2A 4I1OB 3EZIA 2Q9AA 2ZPAA 3NYLA 4C3DA 3EG9A 2IXNA 1VYKA 2PP4A 2NG1A 3O55A 1N1CA 4U5GA 2KJGA 2M4EA 5B3SC 4OIQF 1JRAA 4O79A 5CI8A 3EFOB 4BJ5C 4LDKA 3TD7A 1KU2A 3DJNB 1LVKA 3AQBA 4O6YA 3SEOA 3EHNA 3H65A 3ZSUA 4MNDA 2OCCC 5DS5A 3AG3C 2CNWD 3K33A 3CQZA 4E0IA 1RJ9A 3DJUB 4OD4A 4O6NA 3EZHA 1MMDA 4MQ9F 3W2VA 2XL4A 5E2QA 1OKKD 2EINC 3DAFA 4BEJA 1Z23A 2D5RB 2WZLA 4GYTA 3GANA 3T6JA 4HEAJ 3EH2A 4ZLDA 5D91A 4CSAC 1BR1A 4YT5A 2V3CC 3EH1A 5EHHA 2PX3A 4QI0A 3Q7LA 3K66A 5KYNA 1Z63A 2QTVA 1ZHYA 3ABMC 2E87A 4IJJA 1TWAA 5KYYB 1O87A 3RH3A 5KYXA 2J9WA 4IAOA 4JCHA 4P6IC 5CI9A 4CBEA 3VYWA 4OIRF 4LLCA 3N0TA 2J9UA 2KW3C 2Y3DA 3LNRA 1TKNA 3LEVA 2WZFA 4KNVA 5DQZA 4GEHA 4E7ZA 2C04A 4G0HA 2IXMA 1ST6A 1D1CA 3EGXB 3U2MA 3UMHA 3DD7A 4KNWA 5E33A 1OCRC 4BG0A 5DS4A 4HFKB 3U5SA 3AQCA 3EHMA 3K7DA 3NDBB 2PF4E 2NUTB 4OINF 3B9QA 4EWCA 3S28A 1Z3IX 4J30B 4HE8D 3S27A 3T6BA 2CW0F 2DYRC 2DYSC 4DBQA 3ZG1A 2EILC 3ASNC 3W8HA 1PD0A 4C7OA 5KYYA 4PJLA 4KC9A 4OIOF 3O6XA 2ZXPA 2KGOA 2YEVA 3ZVRA 2XXAB 2J0WA 2WB7A 2IXOA 2H7BA 4YT2A 4OD5A 3DMDA 1M2OA 3LLKA 3DAGA 3OWTA 2A69F 3T4RA 3QZCA 3GWLA 2IOQA 4RD9A 1VMAA 4G7HF 1O5HA 5B1BC 1PCXA 4FX5A 3AG2C 3N2ZB 3MLGA 2FGYA 3UNGC 4E0HA 4NY3A 3LAYA 2R7QA 2G3KA 4DBRA 4PJMA 1FFTC 3EGXA 4U5DE 4U5HA 3UMKA 5BUOA 3U2LA 3DXJF 2IYLD 3VAYA 4QI2A 2HV6A 4JZAA 4ZLCA 1JR8A 4ULWA 2H7OA 3EPVA 1LKXA 1FTSA 4O6MA 1ZU4A 4CS9A 5F5FA 3AG1C 5E3AA 3X2QC 2I8BA 1M57C 3GWNA 2KQ9A 4PFPA 2NUPB 2R7OA 3K1HA 4BJ6C 1MNEA 3ZIBA 3LS1A 2R7SA 3FDQA 2HJ3A 4ANJA 1VK5A 2YZSA 4OIPF 3OA1A 3I5PA 2X51A 5T3TA 2CGEA 4F4BA 1MNDA 5KYUB 3DM5A 3MX3A 3B0PA 3Q7GA 2DGJA 4CS8C 1TWCA 5KYWB 1NU7D 3SYNA 5T1DB 1TWGA 1PD1A 2J7PD 1ZHXA 2EIJC 3KL4A 3LS0A 3MBGA 3EFOA 3QMKA 4HFFB 5HSWA 3FAJA 2G62A 5F5HA 4C3BA 1FMVA 3B0VC 5D92A 4JVSA 2Y39A 4U5CE 1FMWA 2Y3HA 3S29A 4QDLA 4RBNA 4LLEA 4YWQA 1TR2A 3ASOC 1Z6AA 2V26A 4EBBA 4XLNF 3FHDA 5DQTA 4PFOA 3UR3C 2Y3GA 4LERA 4BJ5A 5IY5C 4LACB 1TWHA 3SNHA 3SZRA 3NYJA 1JPNA 2VB6A 3EQLF 1M56C 1M2VB 1J8YF 3RKOF 3NRHA 3L34A 2NUPA 4AE4B 3IEEA 2ZXOA 1MMNA 3WG7C 3KH2A 4I3MA 2W4MA 5E3CA 4YT4A 2CDQA 2Q9CA 3EGDB 4JW1A 3EG9B 2WVNA 1OKKA 5B1AC 1D1AA 3CSKA 3PHF2 4M63A 4CSAA 2JD3A 2OG2A 2R7TA 3I4UA 4U5BE 4KBLA 2IXPA 4W8KA 2WVOA 1NZEA 1S7ZA 2P6VA 4Q5SF 3Q6MA 3RFYA 2BE5F 2G3VA 1BR4A 2VH3A 2W45A 4CIHA 2L81A 1J8MF 3ZC4A 2J45A 4AK9A 4IWBA 1LS1A 4G7OF 3W2WA 2J46A 1RJ9B 1W2WA 1D1BA 3CZ6A 3POVA 3WODF 1ZU5A 5DLJA 2L9JA 1D0ZA 1BR2A 2YHSA 4PK4A 4PJNA 4I1MA 4AE4A 5DS6A 4YN0B 3KKBA 2Y69C 4H4KC 3TK0A 1VOMA 3RYLA 1ZYRF 2VASA 5FCLA 3EGDA 2EIMC 5EGYA 1V54C 1WGWA 4DVZA 2HV7A 2WVQA 3ECSA 1NU9C 2NUTA 3UMIA 2R7VA 4B6IA 2B0JA 2H7VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E0H A;  1JRA A;  3GWN A;  4LDK A;  3W4Y A;  3U2M A;  3TD7 A;  3MBG A;  3TK0 A;  3LLI A;  2HJ3 A;  1OQC A;  3U2L A;  3U5S A;  3LLK A;  3GWL A;  1JR8 A;  4E0I A;  3O55 A;  3R7C A; 
#chains in the Genus database with same CATH topology
 1YA7 O;  3B0U X;  3IPM O;  4JTD B;  5KYX B;  1JAF A;  2IBF A;  3RF3 A;  2XLO A;  4MTG A;  1ORS C;  2PFD A;  2XSE A;  3W4Y A;  3ZWI A;  3HJC A;  4CS7 A;  1ZHW A;  1QQ3 A;  3E9V A;  2O9X A;  2OEX A;  2LD6 A;  1FR0 A;  1QSP A;  4GQH A;  2LCH A;  2XXA A;  1IZM A;  2A6E F;  2P1A A;  5L3Q A;  1T5O A;  1YLM A;  2KNH A;  3JYY A;  2QY9 A;  2XRH A;  4I44 A;  3SP1 A;  4BJT A;  4NTF A;  1H7I A;  3PMR A;  4EBB A;  1WAT A;  1VYI A;  3C7J A;  3FMS A;  1HY5 A;  2XM0 A;  3G4X A;  1RCP A;  3NYM A;  4N6C A;  4PJJ A;  1YAU O;  1APC A;  4IRU A;  3JSZ A;  1RKE A;  3VM6 A;  2YKZ A;  1OCZ C;  1SF8 A;  2AWC A;  1LIH A;  1LE2 A;  2W4B A;  3GOD A;  3JCU Q;  4IAR A;  4N06 A;  2R7W A;  3FVY A;  4H54 A;  3U0C A;  3Q6N A;  3US6 A;  3IHU A;  4K0D A;  1Q0K A;  1YYJ A;  3RW0 A;  3RQE A;  2XLE A;  2HFI A;  3WAQ A;  4JJG A;  3ZQY A;  3JSE O;  1BBH A;  1FFH A;  2R05 A;  3LES A;  1DOW A;  4O7G A;  2FFH A;  1MMG A;  1ZHT A;  5L3V A;  2KK1 A;  4E7S A;  2XLM A;  3JYH A;  3M1C B;  3NKD A;  4J32 B;  2ZXR A;  3U9J A;  2R7X A;  2B0H A;  1C03 A;  1OQC A;  2EIK C;  2YRF A;  3HNL A;  1D0Y A;  3J06 A;  2XLW A;  2P7V A;  3DWW A;  2LSE A;  2AWY A;  2Y3B A;  1SMY F;  1VLT A;  3TOL A;  3UGP A;  3B29 A;  1LM3 B;  4JEA A;  4ER9 A;  3IQ6 A;  3GOR A;  2MWQ A;  3LJB A;  5DVW A;  3V5Z A;  2YL0 A;  1NG1 A;  1OW7 A;  3HNK A;  3OEO A;  4Q7C A;  3M15 A;  2KC3 A;  2Q3T A;  1YA9 A;  1IW7 F;  3C63 A;  3O10 A;  2GFH A;  4DRH B;  4C7O B;  2MYS A;  3X1O A;  2R02 A;  4N4W A;  2LIG A;  3U8P A;  3WHN A;  3KYJ A;  1G8X A;  2R9R B;  1CGN A;  4YJW A;  5CIV A;  2ZXW C;  2CNW A;  1D0X A;  3SXM A;  4XPW A;  2ZD9 A;  2A0B A;  3DZA A;  5JVE A;  4PAC A;  3RIP A;  2PNO A;  2GAQ A;  1AVO B;  2VCA A;  3NG1 A;  1WOL A;  2PX0 A;  3HKK A;  3I5Q A;  4DVY P;  5JRA A;  2Z15 A;  3E70 C;  3LUT B;  5JT4 A;  2HKV A;  3FOP A;  4FWV A;  1A7E A;  2HS5 A;  3ITF A;  3V7O A;  4BJ6 A;  1Z5Z A;  2QLA A;  3JT1 A;  1SZI A;  4FES A;  5T3W A;  1HE9 A;  3W8I A;  1QPU A;  2A6H F;  3C8G D;  4IAQ A;  5KYU A;  4EIY A;  4BPM A;  3DE8 A;  4U5E E;  4A2N B;  3AG4 C;  3MFN A;  4JC7 A;  4WAB A;  3R7C A;  4XLP F;  1GGQ A;  2HSQ A;  2VCB A;  3C8Z A;  5GPG B;  1U89 A;  3N24 A;  2GA0 A;  2HMQ A;  1E2X A;  1OR3 A;  1V55 C;  1Y6D A;  2OEV A;  2YL7 A;  4JUR I;  4U5F E;  4DOZ A;  1MMA A;  5KYW A;  3FXH A;  2C03 A;  4XTK A;  3QW1 A;  4K1O A;  3ABK C;  3B71 A;  4C3E A;  2KYH A;  1UG7 A;  4YL0 A;  3HLZ A;  4AX2 A;  1BZ4 A;  2L6F A;  4E18 A;  1G4U S;  1SYQ A;  2EPO A;  4CS8 A;  1OCO C;  3BEH A;  1K05 A;  3G50 A;  3LLI A;  4XWJ A;  4G7Z F;  2WZG A;  1YAR O;  4CS9 C;  1A41 A;  5A6B A;  4JTC B;  4WJ0 A;  1QLE C;  2HUJ A;  1ZHZ A;  5A69 A;  1L3P A;  3TJ5 A;  2J9V A;  2A68 F;  3A11 A;  2RD9 A;  2CCY A;  4CJO A;  3K1I C;  2PBE A;  4XEF A;  3O39 A;  2J7P A;  4X0R A;  1JPJ A;  2R7U A;  3DE9 A;  3DM9 B;  4PR9 A;  2L6G A;  1A7D A;  2Q9B A;  3F47 A;  2A1D D;  3NMI A;  4P9F A;  4BJ1 A;  1PV3 A;  1E83 A;  1T9K A;  2QUP A;  1OCC C;  2HJM A;  2YLI A;  2JPU A;  2WL8 A;  4JTA B;  2W9Y A;  1WAS A;  2GWW A;  3L0I A;  3BRJ A;  3S90 A;  4MVO A;  3EJN A;  1EQ1 A;  2Q4F A;  3HTK C;  4K7B A;  3VRC A;  3ABL C;  3S0X A;  5HV9 A;  4XPY A;  4E17 A;  2EPM X;  4CDA A;  4YT8 A;  1L7C A;  3KMI A;  3UGO A;  2J9B A;  1G5Z A;  1M2V A;  4RDA A;  1XZP A;  1QZX A;  3DI5 A;  2A0U A;  5L0C A;  2J0X A;  3JRT A;  3K6B A;  2R03 A;  4Q4Z F;  3NKE A;  1TFO B;  3F46 A;  4JJF A;  2R7R A;  4KI2 A;  3JTL O;  2OQM A;  3IQT A;  3NMJ A;  4I1O B;  2H8A A;  3EZI A;  1BDJ B;  2Q9A A;  1Q0F A;  2ZPA A;  2OJE D;  3NYL A;  4MVM A;  4C3D A;  1NLX A;  3EG9 A;  2IXN A;  1HW2 A;  1VYK A;  2PP4 A;  3M4C A;  4J7T A;  5HSW A;  4XEK A;  2NG1 A;  1N1C A;  3O55 A;  3R2P A;  2TMV P;  2YLD A;  4U5G A;  2KJG A;  2M4E A;  5B3S C;  5L0I A;  4OIQ F;  1CPQ A;  1H6G A;  1JRA A;  4O79 A;  5CI8 A;  3EFO B;  2EPN A;  4BJ5 C;  4LDK A;  1E84 A;  3TD7 A;  1KTM A;  3GEH A;  1KU2 A;  3DJN B;  1LVK A;  3AQB A;  1LE4 A;  4O6Y A;  3SEO A;  3EHN A;  1GM5 A;  3H65 A;  1EKY A;  1XWJ A;  2LFD A;  5COM A;  4JCZ A;  3ZSU A;  1YYX A;  3H2U A;  4MND A;  5AC5 A;  1T6U A;  2OCC C;  2VC9 A;  5L0D A;  5DS5 A;  2CYD A;  3U9M A;  4XQ1 A;  5JLI A;  3AG3 C;  1OR2 A;  2CNW D;  5BQH A;  3G4Z A;  3K33 A;  3VF0 A;  3CQZ A;  4E0I A;  3S9O A;  1OW8 A;  1RJ9 A;  3DJU B;  1I4Z A;  4WGY A;  2JX0 A;  4OD4 A;  3DKA A;  3MYF A;  4O6N A;  3EZH A;  1MMD A;  4MQ9 F;  3W2V A;  2XL4 A;  5E2Q A;  3V5X A;  1OKK D;  4BEM J;  2EIN C;  3DAF A;  4BEJ A;  1Z23 A;  2D5R B;  2L6H A;  2WZL A;  4GYT A;  4FAP B;  3GAN A;  3T6J A;  4HEA J;  1LPE A;  3C18 A;  1TQG A;  3EH2 A;  4EBJ A;  4ZLD A;  5D91 A;  4CSA C;  2OU6 A;  1EA8 A;  5JSL A;  1BR1 A;  2EPK X;  4YT5 A;  2V3C C;  4MS2 A;  1YVI A;  2MHR A;  2OKU A;  3EH1 A;  5EHH A;  2PX3 A;  4MVZ A;  4QI0 A;  3Q7L A;  3U3F A;  1Q0D A;  2HMZ A;  3K66 A;  5KYN A;  1Z63 A;  2QTV A;  2LP4 A;  1ZHY A;  3ABM C;  2E87 A;  2XLV A;  4IJJ A;  4NTB A;  1MQV A;  3L1M A;  5F28 E;  1E86 A;  4U9D A;  1TWA A;  4JKV A;  5KYY B;  1C02 A;  1O87 A;  2LQG A;  1U6H A;  3RH3 A;  4Z9J A;  5KYX A;  3SXY A;  4DRI B;  5L0F A;  2J9W A;  4JEB A;  1U0B B;  1UFB A;  2QE9 A;  1YZA A;  4IAO A;  4JCH A;  2Q7R A;  3PDM P;  4Z9I A;  1LI5 A;  3RVY A;  4P6I C;  2OJQ A;  2YL1 A;  5CI9 A;  3M4B A;  1ORY A;  2P0N A;  5AGF A;  4CBE A;  3VYW A;  2HSB A;  4OIR F;  3AGU A;  4LLC A;  3N0T A;  1HMO A;  2J9U A;  2KW3 C;  3TUL A;  2Y3D A;  1AUE A;  1TKN A;  2R25 A;  3LNR A;  3LEV A;  1RXQ A;  3L8I A;  2WZF A;  4KNV A;  5DQZ A;  3S84 A;  3ATP A;  4WGZ A;  4GEH A;  3M79 A;  4E7Z A;  4NQF A;  2C04 A;  4G0H A;  2IXM A;  5BQI A;  1ST6 A;  5L0H A;  2ASR A;  1OW6 A;  3V5Y A;  1G4W R;  1D1C A;  3EGX B;  3ZTM A;  3U2M A;  3UMH A;  3DD7 A;  3U8V A;  3C8G B;  1B68 A;  4KNW A;  3GEE A;  3U3B A;  5E33 A;  1OCR C;  4BG0 A;  3JZ0 A;  2OOC A;  4NTA A;  4HFK B;  5AC4 A;  5DS4 A;  3U5S A;  3AQC A;  3EHM A;  3K7D A;  3NDB B;  4JIO A;  2PF4 E;  2YL3 A;  1KNY A;  2NUT B;  4OIN F;  1NBB A;  5FZT A;  3B9Q A;  4EWC A;  3S28 A;  1Z3I X;  1WTY A;  4J30 B;  4HE8 D;  3C62 A;  1SR2 A;  4AL0 A;  3S27 A;  3T6B A;  2CW0 F;  2DYR C;  3QW0 A;  3IQC A;  2DYS C;  2XLD A;  1A0B A;  4DBQ A;  3L8J A;  3ZG1 A;  3H2V A;  2XL6 A;  2EIL C;  3ZDL A;  3ASN C;  3W8H A;  1PD0 A;  2BC5 A;  5KYY A;  5JS5 A;  1NFO A;  4C7O A;  1QVX A;  2F22 A;  4KC9 A;  4PJL A;  3SXK A;  3O6X A;  2ZXP A;  2YVK A;  2KSF A;  4OIO F;  2XS8 A;  1S05 A;  2KGO A;  2YEV A;  3ZVR A;  4A4A A;  1H9T A;  2XXA B;  2J0W A;  2WB7 A;  2IXO A;  2H7B A;  1K04 A;  3PCV A;  4LDQ A;  2ETS A;  4YT2 A;  4OD5 A;  3DMD A;  1M2O A;  3DAG A;  3LLK A;  3OWT A;  4L6R A;  3TQO A;  2A69 F;  1Q0M A;  3T4R A;  3QZC A;  2AU5 A;  3AJM A;  1DOV A;  3GWL A;  1LI7 A;  1RKE B;  2IOQ A;  4RD9 A;  1VMA A;  4G7H F;  1O5H A;  2XM4 A;  5B1B C;  1PCX A;  4DRJ B;  5A6K A;  4FX5 A;  5TJ5 E;  3AG2 C;  5B3I A;  3N2Z B;  3MLG A;  2FGY A;  3UNG C;  5L0J A;  4E0H A;  1H9G A;  3GM1 A;  3KPH A;  1YZC A;  4NCQ A;  5JP7 A;  4NY3 A;  3FOO A;  3LAY A;  2R7Q A;  2G3K A;  4IGG A;  1YDI A;  4LDR A;  4PJM A;  4DBR A;  1FFT C;  2QNL A;  3EGX A;  4U5D E;  4MVS A;  4ULV A;  1M6T A;  4NC3 A;  4U5H A;  3QVY A;  4YL3 A;  3UMK A;  1V4A A;  5BUO A;  4J7Y A;  3U2L A;  3DXJ F;  2IYL D;  1TFK B;  1VLS A;  3JRM O;  3VAY A;  4QI2 A;  2HV6 A;  1K40 A;  4JZA A;  2NSG A;  4ZLC A;  3LEO A;  1ZVZ A;  3GM2 A;  1JR8 A;  3HNJ A;  4MW3 A;  4ULW A;  2H7O A;  4D4X A;  3EPV A;  5DQT A;  2J8W A;  4MVQ A;  1ZZP A;  1NSG B;  1VTM P;  1LKX A;  1FTS A;  4O6M A;  1ZU4 A;  4CS9 A;  5F5F A;  2ICW G;  1QKR A;  3AG1 C;  1O3U A;  1OXK A;  5E3A A;  3RQF A;  2I8B A;  3X2Q C;  1M57 C;  2YLG A;  2KQ9 A;  3GWN A;  3KYI A;  5A6J A;  4PFP A;  2NUP B;  2R7O A;  3AGT A;  3K1I A;  3K1H A;  2I15 A;  4BJ6 C;  1MNE A;  4XEV A;  4XPX A;  5COG A;  3LS1 A;  3ZIB A;  1ORJ A;  2D4U A;  4G78 A;  2R7S A;  4EHP A;  2YWA A;  3FDQ A;  2NSF A;  2HJ3 A;  4ANJ A;  1VK5 A;  4Z9H A;  2YZS A;  4OIP F;  3IQ5 A;  3OA1 A;  1R4T A;  3I5P A;  2X51 A;  5T3T A;  2CGE A;  4F4B A;  1MND A;  5L0G A;  5KYU B;  3DM5 A;  4MVU A;  3MX3 A;  1XZQ A;  1V74 B;  3LNM B;  4MTO A;  4MVR A;  3T9O A;  4JRZ A;  3B0P A;  3Q7G A;  2DGJ A;  4CS8 C;  1TWC A;  2XS1 A;  5BQG A;  5A6B D;  1NU7 D;  5KYW B;  2DI3 A;  3SYN A;  3QTH A;  5T1D B;  1TWG A;  1PD1 A;  2J7P D;  3NMK A;  1ZHX A;  2EIJ C;  3KL4 A;  3LS0 A;  3MBG A;  1JOG A;  3EFO A;  1AEP A;  3QMK A;  4HFF B;  4P9T A;  3FAJ A;  2G62 A;  4DXW A;  3A9C A;  4EBK A;  5F5H A;  4C3B A;  1FMV A;  4UDV A;  5D92 A;  4JVS A;  1RKC A;  2Y39 A;  4U5C E;  3B0V C;  1FMW A;  1I4Y A;  2Y3H A;  3S29 A;  4QDL A;  4RBN A;  4LLE A;  1FAP B;  4D4N A;  4YWQ A;  1OXB A;  1TR2 A;  1HW1 A;  1VB5 A;  1Z6A A;  1EI7 A;  2V26 A;  3ASO C;  1JMW A;  3FHD A;  4PFO A;  4XLN F;  2Y3G A;  4LER A;  4N6H A;  3UR3 C;  1T01 A;  3CAX A;  3RQG A;  4BJ5 A;  5IY5 C;  5JUA A;  2NPU A;  4LAC B;  2Q00 A;  2L7A A;  1TWH A;  3SNH A;  1CGM E;  2FAP B;  3SZR A;  1I5N A;  4MTF A;  3NYJ A;  3SXZ A;  4U9E A;  1JPN A;  4CIP A;  1C17 M;  1T6I A;  2VB6 A;  4DJ9 A;  2P61 A;  3CEX A;  3EQL F;  1M56 C;  1M2V B;  1J8Y F;  2XL8 A;  4YL1 A;  3RKO F;  3NRH A;  3ZTZ A;  3L34 A;  4CJG A;  2NUP A;  4AE4 B;  3IEE A;  2ZXO A;  1MMN A;  3WG7 C;  3KH2 A;  4I3M A;  2W4M A;  5E3C A;  1E85 A;  4YT4 A;  2CDQ A;  2Q9C A;  3EGD B;  1GS9 A;  1YJG A;  4JW1 A;  1HE1 A;  3EG9 B;  2WVN A;  1OKK A;  4CX9 A;  5B1A C;  1D1A A;  3CSK A;  3PHF 2;  4M63 A;  2M64 A;  2X0C A;  4CSA A;  2JD3 A;  2OG2 A;  3HNI A;  3AOU A;  2R7T A;  3I4U A;  1ZW3 A;  4U5B E;  3TOM A;  2XLH A;  4KBL A;  1LS4 A;  2DB4 A;  2IXP A;  2LFF A;  4IB4 A;  4W8K A;  1RMV A;  2WVO A;  4EUK B;  1NZE A;  2UUI A;  1S7Z A;  2P6V A;  4Q5S F;  256B A;  3Q6M A;  1Z7Q c;  3RFY A;  5COF A;  1WWP A;  1Y4C A;  2BE5 F;  4R32 A;  2G3V A;  1BR4 A;  2VH3 A;  2W45 A;  1WN0 A;  2YQY A;  3RVZ A;  2RSE B;  4CIH A;  4W8P A;  2L81 A;  1J8M F;  4JE9 A;  3ZC4 A;  1CGO A;  2HZ8 A;  2J45 A;  4AK9 A;  1HMD A;  4IWB A;  1CPR A;  1LS1 A;  4G7O F;  2BL2 A;  3W2W A;  1A7V A;  2J46 A;  1RJ9 B;  1W2W A;  2AP3 A;  4CDV A;  1D1B A;  3CZ6 A;  3POV A;  3TJ6 A;  3WOD F;  1ZU5 A;  3FAP B;  5EK0 A;  3T6G B;  2GDC A;  5DLJ A;  4EKW A;  4AL1 A;  2L9J A;  2AVK A;  1D0Z A;  1BR2 A;  2VCC A;  3MYI A;  5K0I A;  4MW8 A;  2YHS A;  2EPL X;  4PK4 A;  5A6A A;  1NFN A;  3QVZ A;  2IM8 A;  4PJN A;  1F1M A;  4I1M A;  4AE4 A;  4YN0 B;  5DS6 A;  1Q0G A;  2LK4 A;  3KKB A;  2Y69 C;  4H4K C;  3RYL A;  1VOM A;  1R5I D;  3C8G A;  3GEI A;  1ZYR F;  3TK0 A;  2VAS A;  5FCL A;  3EGD A;  2EIM C;  5EGY A;  1T6Q A;  3GM3 A;  1FNT c;  1V54 C;  4CDY A;  2UUH A;  1ZW2 A;  1WGW A;  4DVZ A;  2HV7 A;  1GQA A;  2WVQ A;  3ZQV A;  3ECS A;  1NU9 C;  2NUT A;  3UMI A;  2R7V A;  4B6I A;  2B0J A;  4ONS A;  4YK5 A;  2H7V C; 
#chains in the Genus database with same CATH homology
 3B0U X;  5KYX B;  3W4Y A;  2PFD A;  2XSE A;  3HJC A;  4CS7 A;  1ZHW A;  3E9V A;  2O9X A;  2XXA A;  1IZM A;  2A6E F;  5L3Q A;  2KNH A;  4I44 A;  2QY9 A;  2XRH A;  3SP1 A;  4BJT A;  3PMR A;  1VYI A;  3NYM A;  4PJJ A;  4IRU A;  3JSZ A;  1OCZ C;  1SF8 A;  2W4B A;  3JCU Q;  4N06 A;  3GOD A;  2R7W A;  3FVY A;  3Q6N A;  4K0D A;  4JJG A;  1FFH A;  3LES A;  4O7G A;  2FFH A;  1MMG A;  1ZHT A;  5L3V A;  4E7S A;  3JYH A;  3M1C B;  3NKD A;  4J32 B;  2ZXR A;  2R7X A;  1OQC A;  2EIK C;  1D0Y A;  2P7V A;  2LSE A;  2Y3B A;  1SMY F;  3UGP A;  3LJB A;  2MWQ A;  5DVW A;  4Q7C A;  1NG1 A;  3OEO A;  2Q3T A;  1IW7 F;  2GFH A;  4C7O B;  2MYS A;  3X1O A;  1G8X A;  4YJW A;  2ZXW C;  2CNW A;  1D0X A;  3DZA A;  3RIP A;  3NG1 A;  2PX0 A;  3I5Q A;  4DVY P;  3S0X A;  2Z15 A;  3E70 C;  3V7O A;  4FWV A;  3ITF A;  4BJ6 A;  1Z5Z A;  3JT1 A;  4FES A;  1SZI A;  5T3W A;  3W8I A;  2A6H F;  5KYU A;  4U5E E;  4A2N B;  3R7C A;  3AG4 C;  4XLP F;  3N24 A;  1V55 C;  4DOZ A;  4JUR I;  4U5F E;  1MMA A;  5KYW A;  2C03 A;  4XTK A;  3ABK C;  4C3E A;  3HLZ A;  4AX2 A;  4CS8 A;  1OCO C;  3LLI A;  4XWJ A;  4G7Z F;  2WZG A;  4CS9 C;  4WJ0 A;  1QLE C;  1ZHZ A;  2J9V A;  2A68 F;  3K1I C;  3O39 A;  2J7P A;  4X0R A;  1JPJ A;  2R7U A;  3DM9 B;  2Q9B A;  3F47 A;  2A1D D;  4BJ1 A;  1OCC C;  2WL8 A;  2W9Y A;  3L0I A;  3EJN A;  3HTK C;  4K7B A;  3ABL C;  3UGO A;  4YT8 A;  3KMI A;  1M2V A;  4RDA A;  1QZX A;  2J0X A;  3JRT A;  3K6B A;  4Q4Z F;  3NKE A;  3F46 A;  2R7R A;  4JJF A;  4KI2 A;  4I1O B;  3EZI A;  2Q9A A;  2ZPA A;  3NYL A;  4C3D A;  3EG9 A;  2IXN A;  1VYK A;  2PP4 A;  2NG1 A;  3O55 A;  1N1C A;  4U5G A;  2KJG A;  2M4E A;  5B3S C;  4OIQ F;  1JRA A;  4O79 A;  5CI8 A;  3EFO B;  4BJ5 C;  4LDK A;  3TD7 A;  1KU2 A;  3DJN B;  1LVK A;  3AQB A;  4O6Y A;  3SEO A;  3EHN A;  3H65 A;  3ZSU A;  4MND A;  2OCC C;  5DS5 A;  3AG3 C;  2CNW D;  3K33 A;  3CQZ A;  4E0I A;  1RJ9 A;  3DJU B;  4OD4 A;  4O6N A;  3EZH A;  1MMD A;  4MQ9 F;  3W2V A;  2XL4 A;  5E2Q A;  1OKK D;  2EIN C;  3DAF A;  4BEJ A;  1Z23 A;  2D5R B;  2WZL A;  4GYT A;  3GAN A;  3T6J A;  4HEA J;  3EH2 A;  4ZLD A;  5D91 A;  4CSA C;  1BR1 A;  4YT5 A;  2V3C C;  3EH1 A;  5EHH A;  2PX3 A;  4QI0 A;  3Q7L A;  3K66 A;  5KYN A;  1Z63 A;  2QTV A;  1ZHY A;  3ABM C;  2E87 A;  4IJJ A;  1TWA A;  5KYY B;  1O87 A;  3RH3 A;  5KYX A;  2J9W A;  4IAO A;  4JCH A;  4P6I C;  5CI9 A;  4CBE A;  3VYW A;  4OIR F;  4LLC A;  3N0T A;  2J9U A;  2KW3 C;  2Y3D A;  3LNR A;  1TKN A;  3LEV A;  2WZF A;  4KNV A;  5DQZ A;  4GEH A;  4E7Z A;  2C04 A;  4G0H A;  2IXM A;  1ST6 A;  1D1C A;  3EGX B;  3U2M A;  3UMH A;  3DD7 A;  4KNW A;  5E33 A;  1OCR C;  4BG0 A;  5DS4 A;  4HFK B;  3U5S A;  3AQC A;  3EHM A;  3K7D A;  3NDB B;  2PF4 E;  2NUT B;  4OIN F;  3B9Q A;  4EWC A;  3S28 A;  1Z3I X;  4J30 B;  4HE8 D;  3S27 A;  3T6B A;  2CW0 F;  2DYR C;  2DYS C;  4DBQ A;  3ZG1 A;  2EIL C;  3ASN C;  3W8H A;  1PD0 A;  4C7O A;  5KYY A;  4PJL A;  4KC9 A;  4OIO F;  3O6X A;  2ZXP A;  2KGO A;  2YEV A;  3ZVR A;  2XXA B;  2J0W A;  2WB7 A;  2IXO A;  2H7B A;  4YT2 A;  4OD5 A;  3DMD A;  1M2O A;  3LLK A;  3DAG A;  3OWT A;  2A69 F;  3T4R A;  3QZC A;  3GWL A;  2IOQ A;  4RD9 A;  1VMA A;  4G7H F;  1O5H A;  5B1B C;  1PCX A;  4FX5 A;  3AG2 C;  3N2Z B;  3MLG A;  2FGY A;  3UNG C;  4E0H A;  4NY3 A;  3LAY A;  2R7Q A;  2G3K A;  4DBR A;  4PJM A;  1FFT C;  3EGX A;  4U5D E;  4U5H A;  3UMK A;  5BUO A;  3U2L A;  3DXJ F;  2IYL D;  3VAY A;  4QI2 A;  2HV6 A;  4JZA A;  4ZLC A;  1JR8 A;  4ULW A;  2H7O A;  3EPV A;  1LKX A;  1FTS A;  4O6M A;  1ZU4 A;  4CS9 A;  5F5F A;  3AG1 C;  5E3A A;  3X2Q C;  2I8B A;  1M57 C;  3GWN A;  2KQ9 A;  4PFP A;  2NUP B;  2R7O A;  3K1H A;  4BJ6 C;  1MNE A;  3ZIB A;  3LS1 A;  2R7S A;  3FDQ A;  2HJ3 A;  4ANJ A;  1VK5 A;  2YZS A;  4OIP F;  3OA1 A;  3I5P A;  2X51 A;  5T3T A;  2CGE A;  4F4B A;  1MND A;  5KYU B;  3DM5 A;  3MX3 A;  3B0P A;  3Q7G A;  2DGJ A;  4CS8 C;  1TWC A;  5KYW B;  1NU7 D;  3SYN A;  5T1D B;  1TWG A;  1PD1 A;  2J7P D;  1ZHX A;  2EIJ C;  3KL4 A;  3LS0 A;  3MBG A;  3EFO A;  3QMK A;  4HFF B;  5HSW A;  3FAJ A;  2G62 A;  5F5H A;  4C3B A;  1FMV A;  3B0V C;  5D92 A;  4JVS A;  2Y39 A;  4U5C E;  1FMW A;  2Y3H A;  3S29 A;  4QDL A;  4RBN A;  4LLE A;  4YWQ A;  1TR2 A;  3ASO C;  1Z6A A;  2V26 A;  4EBB A;  4XLN F;  3FHD A;  5DQT A;  4PFO A;  3UR3 C;  2Y3G A;  4LER A;  4BJ5 A;  5IY5 C;  4LAC B;  1TWH A;  3SNH A;  3SZR A;  3NYJ A;  1JPN A;  2VB6 A;  3EQL F;  1M56 C;  1M2V B;  1J8Y F;  3RKO F;  3NRH A;  3L34 A;  2NUP A;  4AE4 B;  3IEE A;  2ZXO A;  1MMN A;  3WG7 C;  3KH2 A;  4I3M A;  2W4M A;  5E3C A;  4YT4 A;  2CDQ A;  2Q9C A;  3EGD B;  4JW1 A;  3EG9 B;  2WVN A;  1OKK A;  5B1A C;  1D1A A;  3CSK A;  3PHF 2;  4M63 A;  4CSA A;  2JD3 A;  2OG2 A;  2R7T A;  3I4U A;  4U5B E;  4KBL A;  2IXP A;  4W8K A;  2WVO A;  1NZE A;  1S7Z A;  2P6V A;  4Q5S F;  3Q6M A;  3RFY A;  2BE5 F;  2G3V A;  1BR4 A;  2VH3 A;  2W45 A;  4CIH A;  2L81 A;  1J8M F;  3ZC4 A;  2J45 A;  4AK9 A;  4IWB A;  1LS1 A;  4G7O F;  3W2W A;  2J46 A;  1RJ9 B;  1W2W A;  1D1B A;  3CZ6 A;  3POV A;  3WOD F;  1ZU5 A;  5DLJ A;  2L9J A;  1D0Z A;  1BR2 A;  2YHS A;  4PK4 A;  4PJN A;  4I1M A;  4AE4 A;  5DS6 A;  4YN0 B;  3KKB A;  2Y69 C;  4H4K C;  3TK0 A;  1VOM A;  3RYL A;  1ZYR F;  2VAS A;  5FCL A;  3EGD A;  2EIM C;  5EGY A;  1V54 C;  1WGW A;  4DVZ A;  2HV7 A;  2WVQ A;  3ECS A;  1NU9 C;  2NUT A;  3UMI A;  2R7V A;  4B6I A;  2B0J A;  2H7V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...