3LLIA

Sulfhydryl oxidase fragment of human qsox1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
251
structure length
251
Chain Sequence
ADRSKIYMADLESALHYILRIEVGRFPVLEGQRLVALKKFVAVLAKYFPGRPLVQNFLHSVNEWLKRQKRNKIPYSFFKTALDDRKEGAVLAKKVNWIGCQGSEPHFRGFPCSLWVLFHFLTVQAARQNVDHSQEAAKAKEVLPAIRGYVHYFFGCRDCASHFEQMAAASMHRVGSPNAAVLWLWSSHNRVNARLAGAPSEDPQFPKVQWPPRELCSACHNERLDVPVWDVEATLNFLKAHFSPSNIILDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title QSOX contains a pseudo-dimer of functional and degenerate sulfhydryl oxidase domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Sulfhydryl oxidase 1
total genus 87
structure length 251
sequence length 251
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2010-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
A PF18371 FAD_SOX Flavin adenine dinucleotide (FAD)-dependent sulfhydryl oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3lliA02
1.20.120.1960 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3lliA01
3LLKA 1OQCA 3R7CA 3LLIA 1JRAA 3GWLA 2HJ3A 3O55A 4E0HA 3TD7A 3TK0A 3W4YA 4E0IA 3MBGA 3U2LA 4LDKA 1JR8A 3GWNA 3U2MA 3U5SA
chains in the Genus database with same CATH superfamily
2H8AA 3LLIA 1O3UA 2VCAA 2R7QA 3C62A 4CS9C 1IZMA 4JCZA 3SYNA 4DBQA 5L3QA 4YJWA 1MNDA 1GGQA 2X0CA 4ONSA 2J9WA 2WZFA 4E17A 1OXBA 3TOLA 2XLDA 4F4BA 4U5DE 1MQVA 4AL1A 4D4NA 4DRIB 2XLOA 1UFBA 3JRTA 2IOQA 5AGFA 2IYLD 1GQAA 3UGPA 1PD0A 2FFHA 3HNKA 5A6JA 2XS8A 2R9RB 3AGTA 3HNIA 1W2WA 1J8MF 3T6GB 4MVUA 4M63A 2RSEB 1YYXA 4EHPA 2V3CC 1EQ1A 2PNOA 3R7CA 3O10A 2LCHA 2QE9A 2B0HA 5JUAA 4NC3A 4CBEA 3C8ZA 4G78A 1VYIA 3KL4A 5GPGB 2ETSA 3EG9A 3QW0A 2J9VA 2H7OA 3DJUB 2FGYA 3MFNA 3AQCA 3UMHA 1AUEA 2HFIA 3NMKA 3UNGC 5L0FA 2R7RA 3IQ5A 1N1CA 4YT4A 4FX5A 3W8HA 5DLJA 3AG3C 1E84A 2EIJC 3KPHA 1ORYA 3U2LA 3VF0A 2OU6A 2WVNA 3I4UA 4LDKA 4AE4B 4YT2A 1Z63A 4XEFA 3S29A 4EBJA 3EJNA 1O87A 2LSEA 3K1IC 4LACB 4RDAA 5EHHA 1CGME 4Z9JA 3ABLC 4LLCA 1T5OA 5T1DB 5KYUA 3RH3A 3U2MA 5JRAA 1HE1A 1QSPA 3CZ6A 3FMSA 2Q9BA 3H2VA 1YDIA 3EG9B 3PCVA 2HSQA 5KYUB 1HW2A 2L81A 4XEKA 1H9TA 3L8IA 3GWNA 3A11A 1OCOC 3U5SA 5A6KA 3ZIBA 4NTFA 3Q6MA 2YZSA 3UMIA 5L0IA 3T6JA 3E70C 5JT4A 1HW1A 4JIOA 1NFOA 3UGOA 3IQTA 3ZQYA 1G4US 3M4BA 1G8XA 5L3VA 3DXJF 2XM0A 2QNLA 4J32B 5L0GA 3TJ5A 2NUPA 4C7OB 1SF8A 2HMQA 2J7PA 4E7SA 3EZHA 2WZLA 3QTHA 5T3TA 4PJLA 1B68A 3JCUQ 3ZG1A 1YJGA 2XLEA 2WVOA 2YWAA 4LDQA 1ZYRF 3ASNC 3NYMA 1MNEA 2VH3A 2Q9CA 1NLXA 1QKRA 1EA8A 1NSGB 4YL3A 2XXAA 2LD6A 3O6XA 4BJ5C 3EPVA 4WGZA 2AVKA 1Z7Qc 5B3IA 4IB4A 1H7IA 4JW1A 3LS1A 3N24A 3BEHA 4CSAA 1TQGA 1E2XA 3IQ6A 4FESA 4O7GA 3LEOA 3JZ0A 2JX0A 1NU7D 2Y3HA 2PBEA 1EI7A 1S7ZA 2O9XA 3QW1A 3EGDA 1YZCA 3NRHA 3MLGA 2HV7A 2Y3DA 1F1MA 3Q7GA 3ATPA 4MTGA 2G3VA 5COGA 3DI5A 2QLAA 3H65A 4DVZA 4U9EA 3EH2A 3EQLF 3EZIA 3LESA 4O6MA 3MBGA 5KYYA 1T9KA 1NU9C 2P6VA 1U89A 1MMDA 3LLKA 1GS9A 3NMIA 2XXAB 1OCZC 4PR9A 4ULVA 1Y6DA 4FWVA 3S0XA 4CIHA 4ER9A 1S05A 2ICWG 5DQZA 3RQEA 1R4TA 2GAQA 2Z15A 1TWHA 2QY9A 4BEJA 2R7WA 2HZ8A 2TMVP 3KYJA 3K1IA 4MTOA 2KGOA 2JPUA 3FAJA 3C63A 3NYJA 2KC3A 3JTLO 2V26A 3OEOA 2LFFA 5DVWA 1Q0KA 3EHNA 2KNHA 3IHUA 4PJJA 1T01A 1WOLA 4YN0B 3S27A 1O5HA 2EINC 4BJ5A 4MQ9F 4I3MA 2YLGA 1CPRA 2VASA 4K1OA 3HTKC 3A9CA 4IAOA 2FAPB 1BR4A 2R05A 5D91A 5E2QA 3UR3C 2Y3GA 1MMNA 3FXHA 3S28A 4IRUA 1I4ZA 3HKKA 2R7VA 4EIYA 3DJNB 2C04A 4LLEA 3RVZA 3GWLA 2YL1A 1Y4CA 4K0DA 4AX2A 2ZXRA 3M79A 4CS9A 2NUPB 2R7UA 1PCXA 4EKWA 3RYLA 2HJ3A 4HEAJ 3QVZA 2I8BA 2KQ9A 3DWWA 3EH1A 3ZTMA 4W8PA 2JD3A 3C7JA 4QDLA 4XEVA 4ZLDA 1VB5A 3G4XA 2GDCA 2Q4FA 2YVKA 4MVMA 5KYXB 2VCCA 5BUOA 5F5FA 1RKCA 2MYSA 3FVYA 3K33A 3U0CA 2IXOA 2R25A 3DAGA 4JC7A 4Q7CA 1VK5A 3RKOF 2CGEA 1ZU4A 3ZC4A 2OG2A 1NZEA 2EPKX 2H7VC 2NG1A 1BR1A 4ULWA 5D92A 2W4BA 5CIVA 4J7YA 5T3WA 3JSZA 3JYYA 4G7HF 1XWJA 1M2VA 1AVOB 1HY5A 3ZDLA 5E3AA 3U8VA 1ORJA 2KJGA 4GQHA 3K7DA 1YA7O 3V7OA 3PDMP 1I5NA 2Y69C 4CDAA 4BEMJ 2EPNA 4YT8A 2J8WA 1I4YA 1NFNA 4NCQA 3B0UX 2IBFA 2YKZA 4QI0A 2MHRA 1VLTA 3EFOB 5KYWB 1TFKB 4QI2A 5A6AA 1OW7A 5KYWA 4KNVA 2Y39A 1LE2A 1XZPA 2UUHA 256BA 2E87A 2J0XA 1E86A 1WASA 3Q7LA 2VB6A 2A68F 4I1OB 5DQTA 4Q4ZF 3F46A 1JPNA 3IPMO 3L1MA 1MMAA 1SZIA 1YA9A 4UDVA 1A7DA 5L0CA 2I15A 5DS4A 1EKYA 1TFOB 5L0HA 1M56C 1BDJB 1YAUO 4JTAB 2AP3A 4BPMA 3LEVA 2H7BA 2YLDA 1V74B 3T6BA 4MVSA 1LE4A 3US6A 3GM2A 3M1CB 5EK0A 4DVYP 1C03A 3U9JA 1K40A 1K04A 1VMAA 3R2PA 3FAPB 2CCYA 4HFKB 1JRAA 4P6IC 1D0XA 5A6BD 2EPMX 4OIOF 3GEEA 3F47A 1NG1A 2G3KA 4JE9A 3RFYA 5DS6A 2J9BA 2A6HF 1OR3A 3O39A 4AE4A 5B1BC 1H9GA 2OJQA 2ZPAA 4PJNA 4MVOA 2EPLX 2PFDA 3PHF2 5EGYA 3AG2C 2P1AA 3ABKC 1TR2A 1Q0FA 4MVRA 4BJ6C 4HE8D 4JEBA 4GEHA 4KNWA 4OD4A 2J46A 1J8YF 4PFOA 3O55A 4YT5A 1ZHZA 5JP7A 3U3FA 4NY3A 4EWCA 4J7TA 5F28E 3K1HA 3CSKA 3DE9A 3AGUA 3VM6A 1VOMA 4PK4A 1QLEC 2VCBA 1C17M 1FFHA 1T6QA 2CYDA 3GEHA 3ITFA 3W2VA 4H54A 2Q7RA 2HSBA 1D1CA 2A1DD 2F22A 3I5PA 5BQIA 1Z23A 3C18A 4CJOA 4YL0A 2HS5A 2VC9A 4U9DA 2PX3A 2J9UA 1RJ9B 2UUIA 3ABMC 1BR2A 3LNRA 1ORSC 2DI3A 2XLMA 3KYIA 2M4EA 4L6RA 4IGGA 4BG0A 2XRHA 2XSEA 3I5QA 1FMWA 1TKNA 4OINF 4OIPF 3OWTA 2X51A 2OEXA 1FTSA 1LPEA 4DOZA 1NBBA 4KBLA 5CI9A 5E33A 2A0BA 1A0BA 3AG4C 2XL8A 1RKEA 3TQOA 3W2WA 3X1OA 4A2NB 4C3BA 4DJ9A 4Z9HA 5JSLA 3K66A 3DAFA 3SXYA 3VYWA 1FAPB 2DYSC 2NSFA 1ZW3A 1VYKA 3L0IA 1Q0GA 3N0TA 3RW0A 1UG7A 3C8GA 2R7SA 3SP1A 4B6IA 3DM5A 2YRFA 3GODA 2DGJA 2R7OA 5A69A 1WATA 2P61A 2OKUA 3GORA 4C3DA 1YLMA 4PFPA 1E85A 2EIMC 1G5ZA 2D4UA 4JJGA 3X2QC 4YK5A 2LK4A 3GEIA 4GYTA 3Q6NA 4R32A 1RMVA 3W8IA 3K6BA 1Q0DA 4JZAA 4DXWA 5B1AC 5KYXA 4IAQA 1Q0MA 1QVXA 2BE5F 1OQCA 5TJ5E 3J06A 2C03A 4RBNA 3H2UA 3GANA 3NG1A 1AEPA 1FMVA 2KW3C 3ZVRA 2WZGA 3CEXA 2CNWA 3HLZA 2L6GA 1SR2A 2KSFA 4XTKA 3TD7A 4CDYA 1LIHA 2W4MA 2J7PD 2W9YA 2YL3A 3VAYA 2OCCC 1L3PA 2IXMA 3L34A 3MYFA 4MVQA 4O6NA 3V5XA 3MYIA 3NKEA 3NDBB 3JRMO 4U5GA 3SZRA 3M4CA 1XZQA 3CQZA 2M64A 3LUTB 2EIKC 1ZHYA 2XLVA 3B9QA 1FFTC 4C3EA 3S84A 1OKKA 4BJTA 1OW6A 4CX9A 4G7OF 2MWQA 3C8GB 2ZXWC 1FNTc 1RCPA 4NQFA 4NTAA 4WJ0A 1V54C 1ST6A 1SYQA 2Q00A 3GM3A 2D5RB 1U0BB 2WVQA 2A6EF 5BQHA 4O79A 1LS1A 5HSWA 3AJMA 3LNMB 2XM4A 2ASRA 1OW8A 1JOGA 2DB4A 2IXPA 2L6HA 4LDRA 3NMJA 3S9OA 2IM8A 3FOPA 2YHSA 2LQGA 4CS8C 2IXNA 4DRJB 5K0IA 5KYNA 2A0UA 3EHMA 1ZHTA 4MW8A 1QZXA 3ECSA 1M2OA 3OA1A 3TULA 1KTMA 3PMRA 3KMIA 2AWCA 4G0HA 3HNLA 4N4WA 1JMWA 2W45A 1WTYA 2NUTB 4CS8A 2BC5A 1H6GA 1OKKD 4U5FE 3DKAA 3G4ZA 4JTCB 5COMA 2P0NA 3WODF 3M15A 1Z3IX 1VTMP 2A69F 1LI5A 1M2VB 1LS4A 3IQCA 1KNYA 3RVYA 2Q9AA 4CJGA 4DBRA 2L6FA 3BRJA 4I44A 1WN0A 1L7CA 1JPJA 3JYHA 4WABA 4X0RA 4N06A 1M6TA 4IWBA 4CIPA 3T4RA 1E83A 4MNDA 1D0ZA 5FZTA 3LAYA 4XLNF 3QMKA 4OIRF 3QVYA 4KC9A 2XLHA 4W8KA 4XPWA 1TWGA 4U5HA 2KK1A 2Y3BA 2B0JA 5JS5A 3S90A 3WG7C 2GFHA 4EUKB 1BBHA 3AOUA 2OQMA 1ZU5A 4JTDB 3JT1A 1A41A 2YL0A 3EFOA 1CPQA 4MW3A 3AQBA 3EGDB 4PACA 1QQ3A 1DOWA 3WAQA 1V55C 3SXKA 5E3CA 4CS7A 2J0WA 3RIPA 4NTBA 2CNWD 3B0PA 5A6BA 1TWCA 2DYRC 1V4AA 3C8GD 1KU2A 2XLWA 2NUTA 3HNJA 4U5EE 4HFFB 3DMDA 4MTFA 4PJMA 3U8PA 4XLPF 1T6UA 4OIQF 4IJJA 2LP4A 2PX0A 3KH2A 4YL1A 2NPUA 1FR0A 1G4WR 1HMDA 3KKBA 2NSGA 4JRZA 1LI7A 2HV6A 4MVZA 3SNHA 5B3SC 4BJ1A 5JVEA 1OCCC 1ZHXA 1ZZPA 4O6YA 4OD5A 3TJ6A 1APCA 2WL8A 4H4KC 3U9MA 4DRHB 4E0IA 2WB7A 4EBBA 4XQ1A 5L0JA 3POVA 2HJMA 2RD9A 5HV9A 1YYJA 1BZ4A 5DS5A 3RQFA 2AU5A 1JAFA 1YARO 5L0DA 3NYLA 3E9VA 1C02A 3ZSUA 2XL6A 2OOCA 3B71A 4RD9A 2EPOA 3DD7A 2ZXPA 1LVKA 3LJBA 5IY5C 1YZAA 5AC4A 1M57C 2P7VA 1TWAA 2YL7A 3FDQA 1A7VA 2QUPA 4BJ6A 5FCLA 5JLIA 2PF4E 2YEVA 3HJCA 4N6CA 3LS0A 3NKDA 1RJ9A 5BQGA 4AK9A 1D0YA 3DE8A 3V5ZA 2PP4A 3ASOC 4MS2A 1T6IA 2ZD9A 3B29A 1OCRC 4U5CE 1A7EA 1PD1A 3V5YA 1D1AA 1DOVA 2QTVA 3ZQVA 3G50A 3T9OA 3UMKA 4P9FA 4WGYA 3SXZA 4YWQA 3TK0A 1LKXA 4LERA 1JR8A 2L9JA 1ZVZA 2LFDA 2OJED 1Z6AA 2G62A 3RQGA 4JVSA 1R5ID 4Z9IA 4CDVA 4EBKA 1CGNA 2EILC 5F5HA 1HMOA 1OR2A 1VLSA 2XS1A 3B0VC 4AL0A 4C7OA 3DZAA 4XPXA 1SMYF 2ZXOA 2HKVA 3SXMA 4JURI 1HE9A 3GM1A 4IARA 4E18A 2Q3TA 3JSEO 1OXKA 4JJFA 1MMGA 2GWWA 1WGWA 1GM5A 1ZW2A 3L8JA 1QPUA 1IW7F 4J30B 4JKVA 4D4XA 2KYHA 4A4AA 1RKEB 2AWYA 3MX3A 2R7TA 1LM3B 2R7XA 1WWPA 2HUJA 3SEOA 3TOMA 2J45A 1CGOA 3QZCA 2YLIA 2LIGA 4CSAC 2CW0F 2L7AA 3RF3A 4XWJA 4G7ZF 5AC5A 1YVIA 2GA0A 2R02A 2BL2A 1D1BA 1U6HA 3AG1C 4K7BA 4P9TA 3W4YA 4E7ZA 3EGXB 4Q5SF 5COFA 3VRCA 1ZHWA 1K05A 1Z5ZA 2YQYA 3DM9B 3EGXA 4FAPB 3FHDA 5CI8A 3ZWIA 5KYYB 3ZTZA 2OEVA 3IEEA 4U5BE 2XL4A 4N6HA 2HMZA 3N2ZB 3FOOA 1RXQA 3U3BA 4E0HA 4I1MA 2CDQA 4JCHA 4XPYA 3CAXA 3WHNA 2R03A 4ZLCA 4KI2A 4ANJA 1PV3A 4JEAA
chains in the Genus database with same CATH topology
3LLIA 3FDQA 4CS9C 2R7QA 4DBQA 1IZMA 3SYNA 5L3QA 4YJWA 1MNDA 2J9WA 2WZFA 4F4BA 4U5DE 3JRTA 2IOQA 2IYLD 3UGPA 1PD0A 2FFHA 1W2WA 1J8MF 4M63A 2V3CC 3R7CA 4CBEA 1VYIA 3KL4A 3EG9A 2J9VA 2H7OA 3DJUB 2FGYA 3AQCA 3UMHA 2R7RA 3UNGC 1N1CA 4YT4A 4FX5A 3W8HA 5DLJA 3AG3C 2EIJC 3U2LA 4LDKA 2WVNA 3I4UA 4AE4B 1Z63A 3S29A 3EJNA 1O87A 2LSEA 3K1IC 4LACB 4RDAA 5EHHA 3ABLC 4LLCA 5T1DB 5KYUA 3U2MA 3RH3A 3CZ6A 2Q9BA 3EG9B 5KYUB 2L81A 3GWNA 1OCOC 3U5SA 3ZIBA 3Q6MA 2YZSA 3UMIA 3T6JA 3E70C 3UGOA 5L3VA 1G8XA 3DXJF 4J32B 2NUPA 4C7OB 1SF8A 2J7PA 4E7SA 3EZHA 2WZLA 5T3TA 4PJLA 3JCUQ 3ZG1A 2WVOA 1ZYRF 3ASNC 3NYMA 1MNEA 2VH3A 2Q9CA 2XXAA 3O6XA 4BJ5C 3EPVA 4CSAA 4JW1A 3LS1A 3N24A 4FESA 4O7GA 1NU7D 2Y3HA 1S7ZA 2O9XA 3EGDA 3NRHA 3MLGA 2HV7A 2Y3DA 3Q7GA 2G3VA 3H65A 4DVZA 3EH2A 3EQLF 3EZIA 3LESA 4O6MA 3MBGA 5KYYA 1NU9C 2P6VA 1MMDA 3LLKA 2XXAB 1OCZC 4FWVA 3S0XA 4CIHA 5DQZA 2R7WA 2Z15A 1TWHA 2QY9A 4BEJA 2KGOA 3FAJA 3NYJA 3OEOA 5DVWA 2V26A 3EHNA 2KNHA 4PJJA 4YN0B 3S27A 1O5HA 2EINC 4BJ5A 4MQ9F 4I3MA 2VASA 3HTKC 4IAOA 1BR4A 5D91A 5E2QA 3UR3C 2Y3GA 1MMNA 2R7VA 3S28A 4IRUA 3DJNB 2C04A 4LLEA 3GWLA 4K0DA 4AX2A 2ZXRA 4CS9A 2NUPB 2R7UA 1PCXA 3RYLA 2HJ3A 4HEAJ 2I8BA 2KQ9A 3EH1A 4ZLDA 2JD3A 5KYXB 5F5FA 5BUOA 2MYSA 3FVYA 3K33A 2IXOA 3DAGA 4Q7CA 1VK5A 3RKOF 2CGEA 1ZU4A 3ZC4A 2OG2A 1NZEA 2H7VC 2NG1A 4ULWA 1BR1A 5D92A 2W4BA 5T3WA 3JSZA 4G7HF 1M2VA 5E3AA 2KJGA 3K7DA 3V7OA 2Y69C 4YT8A 3B0UX 4QI0A 3EFOB 5KYWB 4QI2A 5KYWA 4KNVA 2Y39A 2E87A 2J0XA 3Q7LA 2VB6A 2A68F 4I1OB 5DQTA 4Q4ZF 3F46A 1JPNA 1MMAA 1SZIA 5DS4A 1M56C 3LEVA 2H7BA 3T6BA 3M1CB 4DVYP 1VMAA 4HFKB 1JRAA 4P6IC 1D0XA 4OIOF 3F47A 1NG1A 2G3KA 3RFYA 5DS6A 3O39A 2A6HF 4AE4A 5B1BC 2ZPAA 4PJNA 2PFDA 3PHF2 5EGYA 3AG2C 3ABKC 1TR2A 4BJ6C 4HE8D 4OD4A 4GEHA 4KNWA 2J46A 1J8YF 4PFOA 3O55A 4YT5A 1ZHZA 4EWCA 4NY3A 3K1HA 3CSKA 1VOMA 4PK4A 1QLEC 1FFHA 3ITFA 3W2VA 1D1CA 2A1DD 3I5PA 1Z23A 2PX3A 2J9UA 1RJ9B 3LNRA 3ABMC 1BR2A 4WJ0A 4BG0A 2M4EA 2XRHA 2XSEA 3I5QA 1FMWA 1TKNA 4OINF 4OIPF 3OWTA 2X51A 1FTSA 4DOZA 4KBLA 5CI9A 5E33A 3AG4C 3W2WA 4C3BA 3X1OA 4A2NB 3K66A 3DAFA 3VYWA 2DYSC 3L0IA 1VYKA 3N0TA 2R7SA 3SP1A 4B6IA 3DM5A 3GODA 2DGJA 2R7OA 4C3DA 4PFPA 2EIMC 4JJGA 3X2QC 4GYTA 3Q6NA 3W8IA 3K6BA 4JZAA 5KYXA 5B1AC 2BE5F 1OQCA 2C03A 4RBNA 3NG1A 3GANA 1FMVA 2KW3C 3ZVRA 2WZGA 2CNWA 3HLZA 3TD7A 4XTKA 2W4MA 2W9YA 2J7PD 3VAYA 2OCCC 2IXMA 3L34A 3NDBB 4O6NA 3NKEA 4U5GA 3SZRA 3CQZA 2EIKC 1ZHYA 3B9QA 1FFTC 4C3EA 1OKKA 4BJTA 4G7OF 2MWQA 2ZXWC 1V54C 1ST6A 2D5RB 2WVQA 2A6EF 4O79A 1LS1A 5HSWA 2IXPA 2YHSA 4CS8C 2IXNA 5KYNA 3EHMA 1ZHTA 1QZXA 3ECSA 1M2OA 3OA1A 3PMRA 3KMIA 4G0HA 2W45A 2NUTB 4CS8A 1OKKD 4U5FE 3WODF 1Z3IX 2A69F 1M2VB 4DBRA 2Q9AA 4I44A 3JYHA 1JPJA 4X0RA 4N06A 4IWBA 3T4RA 4MNDA 1D0ZA 3LAYA 4XLNF 3QMKA 4OIRF 4KC9A 4W8KA 1TWGA 4U5HA 2Y3BA 2B0JA 3WG7C 2GFHA 1ZU5A 3JT1A 3EFOA 3AQBA 3EGDB 1V55C 5E3CA 4CS7A 2J0WA 3RIPA 2CNWD 3B0PA 1TWCA 2DYRC 1KU2A 2NUTA 4U5EE 4HFFB 3DMDA 4PJMA 4XLPF 4OIQF 4IJJA 2PX0A 3KH2A 3KKBA 2HV6A 3SNHA 5B3SC 4BJ1A 1OCCC 1ZHXA 4O6YA 4OD5A 4YT2A 2WL8A 4H4KC 4E0IA 2WB7A 4EBBA 3POVA 5DS5A 3NYLA 3E9VA 3ZSUA 4RD9A 3DD7A 2ZXPA 1LVKA 3LJBA 5IY5C 1M57C 2P7VA 1TWAA 5FCLA 4BJ6A 2PF4E 2YEVA 3HJCA 3LS0A 3NKDA 1RJ9A 4AK9A 1D0YA 2PP4A 3ASOC 1OCRC 4U5CE 1PD1A 1D1AA 2QTVA 3UMKA 4YWQA 3TK0A 1LKXA 4LERA 1JR8A 2L9JA 1Z6AA 2G62A 4JVSA 2EILC 5F5HA 3B0VC 4C7OA 3DZAA 1SMYF 2ZXOA 4JURI 2Q3TA 4JJFA 1MMGA 1WGWA 1IW7F 4J30B 2R7TA 3MX3A 2R7XA 3SEOA 2J45A 3QZCA 4CSAC 2CW0F 4XWJA 4G7ZF 1D1BA 3AG1C 4Q5SF 3W4YA 4K7BA 4E7ZA 3EGXB 1ZHWA 1Z5ZA 3EGXA 3DM9B 3FHDA 5CI8A 5KYYB 3IEEA 4U5BE 2XL4A 3N2ZB 4E0HA 4I1MA 2CDQA 4JCHA 4ZLCA 4KI2A 4ANJA 4QDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LLK A;  1OQC A;  3R7C A;  3LLI A;  1JRA A;  3GWL A;  2HJ3 A;  3O55 A;  4E0H A;  3TD7 A;  3TK0 A;  3W4Y A;  4E0I A;  3MBG A;  3U2L A;  4LDK A;  1JR8 A;  3GWN A;  3U2M A;  3U5S A; 
#chains in the Genus database with same CATH topology
 2H8A A;  3LLI A;  1O3U A;  2VCA A;  2R7Q A;  3C62 A;  4CS9 C;  1IZM A;  4JCZ A;  3SYN A;  4DBQ A;  5L3Q A;  4YJW A;  1MND A;  1GGQ A;  2X0C A;  4ONS A;  2J9W A;  2WZF A;  4E17 A;  1OXB A;  3TOL A;  2XLD A;  4F4B A;  4U5D E;  1MQV A;  4AL1 A;  4D4N A;  4DRI B;  2XLO A;  1UFB A;  3JRT A;  2IOQ A;  5AGF A;  2IYL D;  1GQA A;  3UGP A;  1PD0 A;  2FFH A;  3HNK A;  5A6J A;  2XS8 A;  2R9R B;  3AGT A;  3HNI A;  1W2W A;  1J8M F;  3T6G B;  4MVU A;  4M63 A;  2RSE B;  1YYX A;  4EHP A;  2V3C C;  1EQ1 A;  2PNO A;  3R7C A;  3O10 A;  2LCH A;  2QE9 A;  2B0H A;  5JUA A;  4NC3 A;  4CBE A;  3C8Z A;  4G78 A;  1VYI A;  3KL4 A;  5GPG B;  2ETS A;  3EG9 A;  3QW0 A;  2J9V A;  2H7O A;  3DJU B;  2FGY A;  3MFN A;  3AQC A;  3UMH A;  1AUE A;  2HFI A;  3NMK A;  3UNG C;  5L0F A;  2R7R A;  3IQ5 A;  1N1C A;  4YT4 A;  4FX5 A;  3W8H A;  5DLJ A;  3AG3 C;  1E84 A;  2EIJ C;  3KPH A;  1ORY A;  3U2L A;  3VF0 A;  2OU6 A;  2WVN A;  3I4U A;  4LDK A;  4AE4 B;  4YT2 A;  1Z63 A;  4XEF A;  3S29 A;  4EBJ A;  3EJN A;  1O87 A;  2LSE A;  3K1I C;  4LAC B;  4RDA A;  5EHH A;  1CGM E;  4Z9J A;  3ABL C;  4LLC A;  1T5O A;  5T1D B;  5KYU A;  3RH3 A;  3U2M A;  5JRA A;  1HE1 A;  1QSP A;  3CZ6 A;  3FMS A;  2Q9B A;  3H2V A;  1YDI A;  3EG9 B;  3PCV A;  2HSQ A;  5KYU B;  1HW2 A;  2L81 A;  4XEK A;  1H9T A;  3L8I A;  3GWN A;  3A11 A;  1OCO C;  3U5S A;  5A6K A;  3ZIB A;  4NTF A;  3Q6M A;  2YZS A;  3UMI A;  5L0I A;  3T6J A;  3E70 C;  5JT4 A;  1HW1 A;  4JIO A;  1NFO A;  3UGO A;  3IQT A;  3ZQY A;  1G4U S;  3M4B A;  1G8X A;  5L3V A;  3DXJ F;  2XM0 A;  2QNL A;  4J32 B;  5L0G A;  3TJ5 A;  2NUP A;  4C7O B;  1SF8 A;  2HMQ A;  2J7P A;  4E7S A;  3EZH A;  2WZL A;  3QTH A;  5T3T A;  4PJL A;  1B68 A;  3JCU Q;  3ZG1 A;  1YJG A;  2XLE A;  2WVO A;  2YWA A;  4LDQ A;  1ZYR F;  3ASN C;  3NYM A;  1MNE A;  2VH3 A;  2Q9C A;  1NLX A;  1QKR A;  1EA8 A;  1NSG B;  4YL3 A;  2XXA A;  2LD6 A;  3O6X A;  4BJ5 C;  3EPV A;  4WGZ A;  2AVK A;  1Z7Q c;  5B3I A;  4IB4 A;  1H7I A;  4JW1 A;  3LS1 A;  3N24 A;  3BEH A;  4CSA A;  1TQG A;  1E2X A;  3IQ6 A;  4FES A;  4O7G A;  3LEO A;  3JZ0 A;  2JX0 A;  1NU7 D;  2Y3H A;  2PBE A;  1EI7 A;  1S7Z A;  2O9X A;  3QW1 A;  3EGD A;  1YZC A;  3NRH A;  3MLG A;  2HV7 A;  2Y3D A;  1F1M A;  3Q7G A;  3ATP A;  4MTG A;  2G3V A;  5COG A;  3DI5 A;  2QLA A;  3H65 A;  4DVZ A;  4U9E A;  3EH2 A;  3EQL F;  3EZI A;  3LES A;  4O6M A;  3MBG A;  5KYY A;  1T9K A;  1NU9 C;  2P6V A;  1U89 A;  1MMD A;  3LLK A;  1GS9 A;  3NMI A;  2XXA B;  1OCZ C;  4PR9 A;  4ULV A;  1Y6D A;  4FWV A;  3S0X A;  4CIH A;  4ER9 A;  1S05 A;  2ICW G;  5DQZ A;  3RQE A;  1R4T A;  2GAQ A;  2Z15 A;  1TWH A;  2QY9 A;  4BEJ A;  2R7W A;  2HZ8 A;  2TMV P;  3KYJ A;  3K1I A;  4MTO A;  2KGO A;  2JPU A;  3FAJ A;  3C63 A;  3NYJ A;  2KC3 A;  3JTL O;  2V26 A;  3OEO A;  2LFF A;  5DVW A;  1Q0K A;  3EHN A;  2KNH A;  3IHU A;  4PJJ A;  1T01 A;  1WOL A;  4YN0 B;  3S27 A;  1O5H A;  2EIN C;  4BJ5 A;  4MQ9 F;  4I3M A;  2YLG A;  1CPR A;  2VAS A;  4K1O A;  3HTK C;  3A9C A;  4IAO A;  2FAP B;  1BR4 A;  2R05 A;  5D91 A;  5E2Q A;  3UR3 C;  2Y3G A;  1MMN A;  3FXH A;  3S28 A;  4IRU A;  1I4Z A;  3HKK A;  2R7V A;  4EIY A;  3DJN B;  2C04 A;  4LLE A;  3RVZ A;  3GWL A;  2YL1 A;  1Y4C A;  4K0D A;  4AX2 A;  2ZXR A;  3M79 A;  4CS9 A;  2NUP B;  2R7U A;  1PCX A;  4EKW A;  3RYL A;  2HJ3 A;  4HEA J;  3QVZ A;  2I8B A;  2KQ9 A;  3DWW A;  3EH1 A;  3ZTM A;  4W8P A;  2JD3 A;  3C7J A;  4QDL A;  4XEV A;  4ZLD A;  1VB5 A;  3G4X A;  2GDC A;  2Q4F A;  2YVK A;  4MVM A;  5KYX B;  2VCC A;  5BUO A;  5F5F A;  1RKC A;  2MYS A;  3FVY A;  3K33 A;  3U0C A;  2IXO A;  2R25 A;  3DAG A;  4JC7 A;  4Q7C A;  1VK5 A;  3RKO F;  2CGE A;  1ZU4 A;  3ZC4 A;  2OG2 A;  1NZE A;  2EPK X;  2H7V C;  2NG1 A;  1BR1 A;  4ULW A;  5D92 A;  2W4B A;  5CIV A;  4J7Y A;  5T3W A;  3JSZ A;  3JYY A;  4G7H F;  1XWJ A;  1M2V A;  1AVO B;  1HY5 A;  3ZDL A;  5E3A A;  3U8V A;  1ORJ A;  2KJG A;  4GQH A;  3K7D A;  1YA7 O;  3V7O A;  3PDM P;  1I5N A;  2Y69 C;  4CDA A;  4BEM J;  2EPN A;  4YT8 A;  2J8W A;  1I4Y A;  1NFN A;  4NCQ A;  3B0U X;  2IBF A;  2YKZ A;  4QI0 A;  2MHR A;  1VLT A;  3EFO B;  5KYW B;  1TFK B;  4QI2 A;  5A6A A;  1OW7 A;  5KYW A;  4KNV A;  2Y39 A;  1LE2 A;  1XZP A;  2UUH A;  256B A;  2E87 A;  2J0X A;  1E86 A;  1WAS A;  3Q7L A;  2VB6 A;  2A68 F;  4I1O B;  5DQT A;  4Q4Z F;  3F46 A;  1JPN A;  3IPM O;  3L1M A;  1MMA A;  1SZI A;  1YA9 A;  4UDV A;  1A7D A;  5L0C A;  2I15 A;  5DS4 A;  1EKY A;  1TFO B;  5L0H A;  1M56 C;  1BDJ B;  1YAU O;  4JTA B;  2AP3 A;  4BPM A;  3LEV A;  2H7B A;  2YLD A;  1V74 B;  3T6B A;  4MVS A;  1LE4 A;  3US6 A;  3GM2 A;  3M1C B;  5EK0 A;  4DVY P;  1C03 A;  3U9J A;  1K40 A;  1K04 A;  1VMA A;  3R2P A;  3FAP B;  2CCY A;  4HFK B;  1JRA A;  4P6I C;  1D0X A;  5A6B D;  2EPM X;  4OIO F;  3GEE A;  3F47 A;  1NG1 A;  2G3K A;  4JE9 A;  3RFY A;  5DS6 A;  2J9B A;  2A6H F;  1OR3 A;  3O39 A;  4AE4 A;  5B1B C;  1H9G A;  2OJQ A;  2ZPA A;  4PJN A;  4MVO A;  2EPL X;  2PFD A;  3PHF 2;  5EGY A;  3AG2 C;  2P1A A;  3ABK C;  1TR2 A;  1Q0F A;  4MVR A;  4BJ6 C;  4HE8 D;  4JEB A;  4GEH A;  4KNW A;  4OD4 A;  2J46 A;  1J8Y F;  4PFO A;  3O55 A;  4YT5 A;  1ZHZ A;  5JP7 A;  3U3F A;  4NY3 A;  4EWC A;  4J7T A;  5F28 E;  3K1H A;  3CSK A;  3DE9 A;  3AGU A;  3VM6 A;  1VOM A;  4PK4 A;  1QLE C;  2VCB A;  1C17 M;  1FFH A;  1T6Q A;  2CYD A;  3GEH A;  3ITF A;  3W2V A;  4H54 A;  2Q7R A;  2HSB A;  1D1C A;  2A1D D;  2F22 A;  3I5P A;  5BQI A;  1Z23 A;  3C18 A;  4CJO A;  4YL0 A;  2HS5 A;  2VC9 A;  4U9D A;  2PX3 A;  2J9U A;  1RJ9 B;  2UUI A;  3ABM C;  1BR2 A;  3LNR A;  1ORS C;  2DI3 A;  2XLM A;  3KYI A;  2M4E A;  4L6R A;  4IGG A;  4BG0 A;  2XRH A;  2XSE A;  3I5Q A;  1FMW A;  1TKN A;  4OIN F;  4OIP F;  3OWT A;  2X51 A;  2OEX A;  1FTS A;  1LPE A;  4DOZ A;  1NBB A;  4KBL A;  5CI9 A;  5E33 A;  2A0B A;  1A0B A;  3AG4 C;  2XL8 A;  1RKE A;  3TQO A;  3W2W A;  3X1O A;  4A2N B;  4C3B A;  4DJ9 A;  4Z9H A;  5JSL A;  3K66 A;  3DAF A;  3SXY A;  3VYW A;  1FAP B;  2DYS C;  2NSF A;  1ZW3 A;  1VYK A;  3L0I A;  1Q0G A;  3N0T A;  3RW0 A;  1UG7 A;  3C8G A;  2R7S A;  3SP1 A;  4B6I A;  3DM5 A;  2YRF A;  3GOD A;  2DGJ A;  2R7O A;  5A69 A;  1WAT A;  2P61 A;  2OKU A;  3GOR A;  4C3D A;  1YLM A;  4PFP A;  1E85 A;  2EIM C;  1G5Z A;  2D4U A;  4JJG A;  3X2Q C;  4YK5 A;  2LK4 A;  3GEI A;  4GYT A;  3Q6N A;  4R32 A;  1RMV A;  3W8I A;  3K6B A;  1Q0D A;  4JZA A;  4DXW A;  5B1A C;  5KYX A;  4IAQ A;  1Q0M A;  1QVX A;  2BE5 F;  1OQC A;  5TJ5 E;  3J06 A;  2C03 A;  4RBN A;  3H2U A;  3GAN A;  3NG1 A;  1AEP A;  1FMV A;  2KW3 C;  3ZVR A;  2WZG A;  3CEX A;  2CNW A;  3HLZ A;  2L6G A;  1SR2 A;  2KSF A;  4XTK A;  3TD7 A;  4CDY A;  1LIH A;  2W4M A;  2J7P D;  2W9Y A;  2YL3 A;  3VAY A;  2OCC C;  1L3P A;  2IXM A;  3L34 A;  3MYF A;  4MVQ A;  4O6N A;  3V5X A;  3MYI A;  3NKE A;  3NDB B;  3JRM O;  4U5G A;  3SZR A;  3M4C A;  1XZQ A;  3CQZ A;  2M64 A;  3LUT B;  2EIK C;  1ZHY A;  2XLV A;  3B9Q A;  1FFT C;  4C3E A;  3S84 A;  1OKK A;  4BJT A;  1OW6 A;  4CX9 A;  4G7O F;  2MWQ A;  3C8G B;  2ZXW C;  1FNT c;  1RCP A;  4NQF A;  4NTA A;  4WJ0 A;  1V54 C;  1ST6 A;  1SYQ A;  2Q00 A;  3GM3 A;  2D5R B;  1U0B B;  2WVQ A;  2A6E F;  5BQH A;  4O79 A;  1LS1 A;  5HSW A;  3AJM A;  3LNM B;  2XM4 A;  2ASR A;  1OW8 A;  1JOG A;  2DB4 A;  2IXP A;  2L6H A;  4LDR A;  3NMJ A;  3S9O A;  2IM8 A;  3FOP A;  2YHS A;  2LQG A;  4CS8 C;  2IXN A;  4DRJ B;  5K0I A;  5KYN A;  2A0U A;  3EHM A;  1ZHT A;  4MW8 A;  1QZX A;  3ECS A;  1M2O A;  3OA1 A;  3TUL A;  1KTM A;  3PMR A;  3KMI A;  2AWC A;  4G0H A;  3HNL A;  4N4W A;  1JMW A;  2W45 A;  1WTY A;  2NUT B;  4CS8 A;  2BC5 A;  1H6G A;  1OKK D;  4U5F E;  3DKA A;  3G4Z A;  4JTC B;  5COM A;  2P0N A;  3WOD F;  3M15 A;  1Z3I X;  1VTM P;  2A69 F;  1LI5 A;  1M2V B;  1LS4 A;  3IQC A;  1KNY A;  3RVY A;  2Q9A A;  4CJG A;  4DBR A;  2L6F A;  3BRJ A;  4I44 A;  1WN0 A;  1L7C A;  1JPJ A;  3JYH A;  4WAB A;  4X0R A;  4N06 A;  1M6T A;  4IWB A;  4CIP A;  3T4R A;  1E83 A;  4MND A;  1D0Z A;  5FZT A;  3LAY A;  4XLN F;  3QMK A;  4OIR F;  3QVY A;  4KC9 A;  2XLH A;  4W8K A;  4XPW A;  1TWG A;  4U5H A;  2KK1 A;  2Y3B A;  2B0J A;  5JS5 A;  3S90 A;  3WG7 C;  2GFH A;  4EUK B;  1BBH A;  3AOU A;  2OQM A;  1ZU5 A;  4JTD B;  3JT1 A;  1A41 A;  2YL0 A;  3EFO A;  1CPQ A;  4MW3 A;  3AQB A;  3EGD B;  4PAC A;  1QQ3 A;  1DOW A;  3WAQ A;  1V55 C;  3SXK A;  5E3C A;  4CS7 A;  2J0W A;  3RIP A;  4NTB A;  2CNW D;  3B0P A;  5A6B A;  1TWC A;  2DYR C;  1V4A A;  3C8G D;  1KU2 A;  2XLW A;  2NUT A;  3HNJ A;  4U5E E;  4HFF B;  3DMD A;  4MTF A;  4PJM A;  3U8P A;  4XLP F;  1T6U A;  4OIQ F;  4IJJ A;  2LP4 A;  2PX0 A;  3KH2 A;  4YL1 A;  2NPU A;  1FR0 A;  1G4W R;  1HMD A;  3KKB A;  2NSG A;  4JRZ A;  1LI7 A;  2HV6 A;  4MVZ A;  3SNH A;  5B3S C;  4BJ1 A;  5JVE A;  1OCC C;  1ZHX A;  1ZZP A;  4O6Y A;  4OD5 A;  3TJ6 A;  1APC A;  2WL8 A;  4H4K C;  3U9M A;  4DRH B;  4E0I A;  2WB7 A;  4EBB A;  4XQ1 A;  5L0J A;  3POV A;  2HJM A;  2RD9 A;  5HV9 A;  1YYJ A;  1BZ4 A;  5DS5 A;  3RQF A;  2AU5 A;  1JAF A;  1YAR O;  5L0D A;  3NYL A;  3E9V A;  1C02 A;  3ZSU A;  2XL6 A;  2OOC A;  3B71 A;  4RD9 A;  2EPO A;  3DD7 A;  2ZXP A;  1LVK A;  3LJB A;  5IY5 C;  1YZA A;  5AC4 A;  1M57 C;  2P7V A;  1TWA A;  2YL7 A;  3FDQ A;  1A7V A;  2QUP A;  4BJ6 A;  5FCL A;  5JLI A;  2PF4 E;  2YEV A;  3HJC A;  4N6C A;  3LS0 A;  3NKD A;  1RJ9 A;  5BQG A;  4AK9 A;  1D0Y A;  3DE8 A;  3V5Z A;  2PP4 A;  3ASO C;  4MS2 A;  1T6I A;  2ZD9 A;  3B29 A;  1OCR C;  4U5C E;  1A7E A;  1PD1 A;  3V5Y A;  1D1A A;  1DOV A;  2QTV A;  3ZQV A;  3G50 A;  3T9O A;  3UMK A;  4P9F A;  4WGY A;  3SXZ A;  4YWQ A;  3TK0 A;  1LKX A;  4LER A;  1JR8 A;  2L9J A;  1ZVZ A;  2LFD A;  2OJE D;  1Z6A A;  2G62 A;  3RQG A;  4JVS A;  1R5I D;  4Z9I A;  4CDV A;  4EBK A;  1CGN A;  2EIL C;  5F5H A;  1HMO A;  1OR2 A;  1VLS A;  2XS1 A;  3B0V C;  4AL0 A;  4C7O A;  3DZA A;  4XPX A;  1SMY F;  2ZXO A;  2HKV A;  3SXM A;  4JUR I;  1HE9 A;  3GM1 A;  4IAR A;  4E18 A;  2Q3T A;  3JSE O;  1OXK A;  4JJF A;  1MMG A;  2GWW A;  1WGW A;  1GM5 A;  1ZW2 A;  3L8J A;  1QPU A;  1IW7 F;  4J30 B;  4JKV A;  4D4X A;  2KYH A;  4A4A A;  1RKE B;  2AWY A;  3MX3 A;  2R7T A;  1LM3 B;  2R7X A;  1WWP A;  2HUJ A;  3SEO A;  3TOM A;  2J45 A;  1CGO A;  3QZC A;  2YLI A;  2LIG A;  4CSA C;  2CW0 F;  2L7A A;  3RF3 A;  4XWJ A;  4G7Z F;  5AC5 A;  1YVI A;  2GA0 A;  2R02 A;  2BL2 A;  1D1B A;  1U6H A;  3AG1 C;  4K7B A;  4P9T A;  3W4Y A;  4E7Z A;  3EGX B;  4Q5S F;  5COF A;  3VRC A;  1ZHW A;  1K05 A;  1Z5Z A;  2YQY A;  3DM9 B;  3EGX A;  4FAP B;  3FHD A;  5CI8 A;  3ZWI A;  5KYY B;  3ZTZ A;  2OEV A;  3IEE A;  4U5B E;  2XL4 A;  4N6H A;  2HMZ A;  3N2Z B;  3FOO A;  1RXQ A;  3U3B A;  4E0H A;  4I1M A;  2CDQ A;  4JCH A;  4XPY A;  3CAX A;  3WHN A;  2R03 A;  4ZLC A;  4KI2 A;  4ANJ A;  1PV3 A;  4JEA A; 
#chains in the Genus database with same CATH homology
 3LLI A;  3FDQ A;  4CS9 C;  2R7Q A;  4DBQ A;  1IZM A;  3SYN A;  5L3Q A;  4YJW A;  1MND A;  2J9W A;  2WZF A;  4F4B A;  4U5D E;  3JRT A;  2IOQ A;  2IYL D;  3UGP A;  1PD0 A;  2FFH A;  1W2W A;  1J8M F;  4M63 A;  2V3C C;  3R7C A;  4CBE A;  1VYI A;  3KL4 A;  3EG9 A;  2J9V A;  2H7O A;  3DJU B;  2FGY A;  3AQC A;  3UMH A;  2R7R A;  3UNG C;  1N1C A;  4YT4 A;  4FX5 A;  3W8H A;  5DLJ A;  3AG3 C;  2EIJ C;  3U2L A;  4LDK A;  2WVN A;  3I4U A;  4AE4 B;  1Z63 A;  3S29 A;  3EJN A;  1O87 A;  2LSE A;  3K1I C;  4LAC B;  4RDA A;  5EHH A;  3ABL C;  4LLC A;  5T1D B;  5KYU A;  3U2M A;  3RH3 A;  3CZ6 A;  2Q9B A;  3EG9 B;  5KYU B;  2L81 A;  3GWN A;  1OCO C;  3U5S A;  3ZIB A;  3Q6M A;  2YZS A;  3UMI A;  3T6J A;  3E70 C;  3UGO A;  5L3V A;  1G8X A;  3DXJ F;  4J32 B;  2NUP A;  4C7O B;  1SF8 A;  2J7P A;  4E7S A;  3EZH A;  2WZL A;  5T3T A;  4PJL A;  3JCU Q;  3ZG1 A;  2WVO A;  1ZYR F;  3ASN C;  3NYM A;  1MNE A;  2VH3 A;  2Q9C A;  2XXA A;  3O6X A;  4BJ5 C;  3EPV A;  4CSA A;  4JW1 A;  3LS1 A;  3N24 A;  4FES A;  4O7G A;  1NU7 D;  2Y3H A;  1S7Z A;  2O9X A;  3EGD A;  3NRH A;  3MLG A;  2HV7 A;  2Y3D A;  3Q7G A;  2G3V A;  3H65 A;  4DVZ A;  3EH2 A;  3EQL F;  3EZI A;  3LES A;  4O6M A;  3MBG A;  5KYY A;  1NU9 C;  2P6V A;  1MMD A;  3LLK A;  2XXA B;  1OCZ C;  4FWV A;  3S0X A;  4CIH A;  5DQZ A;  2R7W A;  2Z15 A;  1TWH A;  2QY9 A;  4BEJ A;  2KGO A;  3FAJ A;  3NYJ A;  3OEO A;  5DVW A;  2V26 A;  3EHN A;  2KNH A;  4PJJ A;  4YN0 B;  3S27 A;  1O5H A;  2EIN C;  4BJ5 A;  4MQ9 F;  4I3M A;  2VAS A;  3HTK C;  4IAO A;  1BR4 A;  5D91 A;  5E2Q A;  3UR3 C;  2Y3G A;  1MMN A;  2R7V A;  3S28 A;  4IRU A;  3DJN B;  2C04 A;  4LLE A;  3GWL A;  4K0D A;  4AX2 A;  2ZXR A;  4CS9 A;  2NUP B;  2R7U A;  1PCX A;  3RYL A;  2HJ3 A;  4HEA J;  2I8B A;  2KQ9 A;  3EH1 A;  4ZLD A;  2JD3 A;  5KYX B;  5F5F A;  5BUO A;  2MYS A;  3FVY A;  3K33 A;  2IXO A;  3DAG A;  4Q7C A;  1VK5 A;  3RKO F;  2CGE A;  1ZU4 A;  3ZC4 A;  2OG2 A;  1NZE A;  2H7V C;  2NG1 A;  4ULW A;  1BR1 A;  5D92 A;  2W4B A;  5T3W A;  3JSZ A;  4G7H F;  1M2V A;  5E3A A;  2KJG A;  3K7D A;  3V7O A;  2Y69 C;  4YT8 A;  3B0U X;  4QI0 A;  3EFO B;  5KYW B;  4QI2 A;  5KYW A;  4KNV A;  2Y39 A;  2E87 A;  2J0X A;  3Q7L A;  2VB6 A;  2A68 F;  4I1O B;  5DQT A;  4Q4Z F;  3F46 A;  1JPN A;  1MMA A;  1SZI A;  5DS4 A;  1M56 C;  3LEV A;  2H7B A;  3T6B A;  3M1C B;  4DVY P;  1VMA A;  4HFK B;  1JRA A;  4P6I C;  1D0X A;  4OIO F;  3F47 A;  1NG1 A;  2G3K A;  3RFY A;  5DS6 A;  3O39 A;  2A6H F;  4AE4 A;  5B1B C;  2ZPA A;  4PJN A;  2PFD A;  3PHF 2;  5EGY A;  3AG2 C;  3ABK C;  1TR2 A;  4BJ6 C;  4HE8 D;  4OD4 A;  4GEH A;  4KNW A;  2J46 A;  1J8Y F;  4PFO A;  3O55 A;  4YT5 A;  1ZHZ A;  4EWC A;  4NY3 A;  3K1H A;  3CSK A;  1VOM A;  4PK4 A;  1QLE C;  1FFH A;  3ITF A;  3W2V A;  1D1C A;  2A1D D;  3I5P A;  1Z23 A;  2PX3 A;  2J9U A;  1RJ9 B;  3LNR A;  3ABM C;  1BR2 A;  4WJ0 A;  4BG0 A;  2M4E A;  2XRH A;  2XSE A;  3I5Q A;  1FMW A;  1TKN A;  4OIN F;  4OIP F;  3OWT A;  2X51 A;  1FTS A;  4DOZ A;  4KBL A;  5CI9 A;  5E33 A;  3AG4 C;  3W2W A;  4C3B A;  3X1O A;  4A2N B;  3K66 A;  3DAF A;  3VYW A;  2DYS C;  3L0I A;  1VYK A;  3N0T A;  2R7S A;  3SP1 A;  4B6I A;  3DM5 A;  3GOD A;  2DGJ A;  2R7O A;  4C3D A;  4PFP A;  2EIM C;  4JJG A;  3X2Q C;  4GYT A;  3Q6N A;  3W8I A;  3K6B A;  4JZA A;  5KYX A;  5B1A C;  2BE5 F;  1OQC A;  2C03 A;  4RBN A;  3NG1 A;  3GAN A;  1FMV A;  2KW3 C;  3ZVR A;  2WZG A;  2CNW A;  3HLZ A;  3TD7 A;  4XTK A;  2W4M A;  2W9Y A;  2J7P D;  3VAY A;  2OCC C;  2IXM A;  3L34 A;  3NDB B;  4O6N A;  3NKE A;  4U5G A;  3SZR A;  3CQZ A;  2EIK C;  1ZHY A;  3B9Q A;  1FFT C;  4C3E A;  1OKK A;  4BJT A;  4G7O F;  2MWQ A;  2ZXW C;  1V54 C;  1ST6 A;  2D5R B;  2WVQ A;  2A6E F;  4O79 A;  1LS1 A;  5HSW A;  2IXP A;  2YHS A;  4CS8 C;  2IXN A;  5KYN A;  3EHM A;  1ZHT A;  1QZX A;  3ECS A;  1M2O A;  3OA1 A;  3PMR A;  3KMI A;  4G0H A;  2W45 A;  2NUT B;  4CS8 A;  1OKK D;  4U5F E;  3WOD F;  1Z3I X;  2A69 F;  1M2V B;  4DBR A;  2Q9A A;  4I44 A;  3JYH A;  1JPJ A;  4X0R A;  4N06 A;  4IWB A;  3T4R A;  4MND A;  1D0Z A;  3LAY A;  4XLN F;  3QMK A;  4OIR F;  4KC9 A;  4W8K A;  1TWG A;  4U5H A;  2Y3B A;  2B0J A;  3WG7 C;  2GFH A;  1ZU5 A;  3JT1 A;  3EFO A;  3AQB A;  3EGD B;  1V55 C;  5E3C A;  4CS7 A;  2J0W A;  3RIP A;  2CNW D;  3B0P A;  1TWC A;  2DYR C;  1KU2 A;  2NUT A;  4U5E E;  4HFF B;  3DMD A;  4PJM A;  4XLP F;  4OIQ F;  4IJJ A;  2PX0 A;  3KH2 A;  3KKB A;  2HV6 A;  3SNH A;  5B3S C;  4BJ1 A;  1OCC C;  1ZHX A;  4O6Y A;  4OD5 A;  4YT2 A;  2WL8 A;  4H4K C;  4E0I A;  2WB7 A;  4EBB A;  3POV A;  5DS5 A;  3NYL A;  3E9V A;  3ZSU A;  4RD9 A;  3DD7 A;  2ZXP A;  1LVK A;  3LJB A;  5IY5 C;  1M57 C;  2P7V A;  1TWA A;  5FCL A;  4BJ6 A;  2PF4 E;  2YEV A;  3HJC A;  3LS0 A;  3NKD A;  1RJ9 A;  4AK9 A;  1D0Y A;  2PP4 A;  3ASO C;  1OCR C;  4U5C E;  1PD1 A;  1D1A A;  2QTV A;  3UMK A;  4YWQ A;  3TK0 A;  1LKX A;  4LER A;  1JR8 A;  2L9J A;  1Z6A A;  2G62 A;  4JVS A;  2EIL C;  5F5H A;  3B0V C;  4C7O A;  3DZA A;  1SMY F;  2ZXO A;  4JUR I;  2Q3T A;  4JJF A;  1MMG A;  1WGW A;  1IW7 F;  4J30 B;  2R7T A;  3MX3 A;  2R7X A;  3SEO A;  2J45 A;  3QZC A;  4CSA C;  2CW0 F;  4XWJ A;  4G7Z F;  1D1B A;  3AG1 C;  4Q5S F;  3W4Y A;  4K7B A;  4E7Z A;  3EGX B;  1ZHW A;  1Z5Z A;  3EGX A;  3DM9 B;  3FHD A;  5CI8 A;  5KYY B;  3IEE A;  4U5B E;  2XL4 A;  3N2Z B;  4E0H A;  4I1M A;  2CDQ A;  4JCH A;  4ZLC A;  4KI2 A;  4ANJ A;  4QDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...