2PF4E

Crystal structure of the full-length simian virus 40 small t antigen complexed with the protein phosphatase 2a aalpha subunit
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
172
structure length
163
Chain Sequence
MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWASSLNPGVDAIYCKQWPECVKKMSTNCICLLCLLRMKHENRKLYRKDPLVWVDCYCFDCFRMWFGLDLCEGTLLLWCDIIGQTTYRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of PP2A inhibition by small t antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase regulator/viral protein
molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
total genus 40
structure length 163
sequence length 172
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02380 Papo_T_antigen T-antigen specific domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2pf4E01
1.20.120.1860 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2pf4E02
2EJ7A 1BQZA 2PF4E 3AG7A 2M6YA 1WJZA 2L6LA 2CTWA 2GUZA 3BVOA 2N04A 2CUGA 1FAFA 1NZ6A 2YS8A 1IURA 3UO3A 4J7ZA 4RWUA 2QWRB 4J80A 2QWPB 2QWOB 2QWNB 2LO1A 2GUZB 2DN9A 3UO2A 2QSAA 4IT5A 2CTRA 1XBLA 2QWQB 2CTQA 2KQXA 1FPOA 2LGWA 1GH6A 1HDJA 2N05A 2CTPA 2OCHA 2DMXA 1N4CA 2Y4UA 3APOA 2YUAA 1BQ0A 3APQA 2Y4TA 3UCSC
chains in the Genus database with same CATH superfamily
4JRZA 3CQZA 1W2WA 4C3DA 2J46A 3HKEB 2E74B 3T4RA 4DR2O 1TR2A 1FFTB 1ZTEA 3UNGC 4CBEA 2IH3C 3AK2A 2H7BA 2AWYA 2NN4A 2HJFC 3E35A 2Q6AA 1BSMA 2X0LA 5EZYB 3RVYA 4J11A 5B1OA 3PDMP 4UV8A 5FPOA 4I3MA 1OV9A 4JEAA 3FB6C 2JIZG 5EYPA 3ZC4A 3OTFA 1EA8A 5FCLA 3UGOA 2FB5A 4UUJC 4DV0O 4EWCA 2A0LA 2XUMA 1JOYA 1GN2A 4P9OA 3LJBA 5KYUA 4YXWG 2H8PC 4NTYA 3ZEDA 1K40A 3EGXA 3CPWU 1C17M 2HZ8A 3QVYA 4GX2A 1SMYF 1EQ1A 1D5NA 2N04A 4MTFA 2VASA 4ER9A 3J7AU 1RFYA 3RW0A 3S9OA 1XNQO 1FMWA 4CS2A 4NYKA 4LERA 5FLXN 1QSPA 4I1MA 1PNMA 4ULVA 1JOGA 3RYHA 1OKKA 1HNWO 1AILA 4JTAB 3FHDA 5IYZB 2EIKB 4PDMA 2KGOA 4ONSA 1XHZA 4LF8B 1KECA 3OGIB 3AG4B 4O4JA 3J06A 1HNZO 3OTOO 1PM9A 2P67A 4DR1O 2OQMA 5CA0B 5DVWA 2QKSA 4JI7O 1ORJA 3JD4A 4DV1B 4P9FA 2D4UA 2ZDIA 2XAQA 5LP6B 1S05A 2UUBO 1ZL8B 1R6KA 1EN5A 2XLWA 3KMIA 1ZUQA 2XOKG 2Q9BA 2ARHA 2UUHA 5CA3A 4O2AB 3FB7C 2QKCA 3K0DA 1FS0G 4LLCA 3GWKC 3W8HA 4PV1B 5LA6B 4K7BA 5L0HA 1A32A 4FWVA 2NUTB 1PP9H 5KYYB 1NH2D 3SJQC 2RCVA 1OW6A 1XHXA 3IAYA 2Y39A 1SETA 4RWUA 1M56B 4XPYA 3TULA 4BJ6A 4DUZB 3HKKA 4BEJA 3C63A 2WLHA 5L0DA 4XEFA 3O10A 5K1PA 3HKDA 3DMDA 2OCHA 3ABMB 4DR1B 1AVOB 5LOVB 3TXQA 2YC0A 3JCUZ 4LFBO 3PN1A 4NQFA 1K5QA 3KCYA 3SPGA 3U2LA 5BUOA 1KB9F 1B68A 2XAHA 5L0JA 1RJ9A 3CX5F 4AILC 4HNAB 3QTCA 1J5EB 2OT5A 1Z5VA 3AG1C 2XRHA 2A79B 3IHUA 1RM1C 3HR0A 1K7DA 1N36B 3QW1A 4Q4ZF 2KG7A 4TV8B 1M90W 1IURA 1FMVA 1DTOA 2QA4V 4J42A 4X88A 1AR5A 1MSWD 2R7OA 4E7ZA 4O2BB 3STLC 4HFKB 3KKYA 4U9DA 5JVDA 4WBNB 1F1MA 2IXNA 2YWAA 5DLJA 4ZHQA 1NU9C 1TQGA 4O4HB 3CB2A 5F5FA 2HVKC 4X1YA 1WA8A 3EXAA 3RIPA 5KA5A 2QNLA 3AG2C 4CS9C 2EZOA 2ZQMA 4FLVA 1ZYRF 4U5BE 3ZS8C 4Q5SF 1TWGA 3FAVA 3AG3B 2KSFA 1VQPV 4O4IB 3CC4V 2XHBA 2WVNA 2DYRB 5E2QA 3UM7A 4GCZA 1IX9A 1HNXB 4X62B 1XNRB 1KU2A 1PNKA 1YYXA 2KK1A 3DI5A 2OG2A 2DI3A 3QNEA 1FR0A 4GT1A 3OE7G 1B06A 4GLXA 3K1IC 1H38A 4WABA 3IC9A 3H65A 5KLVH 5EGYA 4GKKO 5EIBC 4MW3A 4LF5B 2Z15A 4GKJB 3S28A 4NR1A 2DW4A 2KKWA 2EIMB 3ZN0A 2UXBO 4J7ZA 5B1BB 4U7NA 4B6IA 1UJWB 3CZ6A 3A8TA 4F6EA 1Q86W 4UB6Z 2VRZA 3X2QC 1CPQA 3D3QA 2Q67A 2QTSA 4X1IA 1RCPA 3F46A 3S84A 4BEMJ 4EKWA 2AW9A 5B3IA 2Q5ZA 5IYBO 3U0ZA 1MMMA 4CDYA 3BY6A 4CX9A 4CSAC 3C8ZA 2UXDO 3FAPB 3K58A 1L0NH 2KW3C 3QTHA 3CCMV 3T6JA 1NTMH 1RSOA 4DW0A 5KYUB 1FJGB 2A6EF 2KB1A 4YT5A 3TQOA 3UO2A 4FFBB 1D1AA 1TUBB 4JIOA 4G7HF 3WU2Z 1O87A 4RAIA 1M1KW 5KYXA 3OT7A 3IQ5A 4BIUA 2MWQA 4OX9O 2IBFA 2JD3A 4Q6GA 1WGWA 2FFHA 4PFPA 5T3WA 1Q90D 2E75B 3ZDLA 4GX1A 4RBNA 2J7PA 1OJHA 1T5OA 2CGOA 5FNVB 1SZXA 5HFMA 3OEOA 4YT8A 4DV7B 4Z9IA 1KC8W 1SESA 2AGAA 1AR1B 2EILB 2Q4FA 5F2VO 3U9JA 4FESA 1YSCA 1NU1H 4DYLA 5KYWB 4QPKA 3W7XA 2F4VB 2A7WA 1K33A 4CS9A 1XL6A 4O7GA 3PHF2 2W6JG 1WASA 1QQCA 5KAFZ 4CDVA 1JPNA 3LSSA 1VTMP 1GN3A 4LR3A 2KC3A 5DQTA 4GYTA 2YS8A 3N2ZB 1BL8A 3M7MX 2BOBC 3I4UA 1ORQC 2YXYA 2LQTA 1AI6A 1NLXA 1CXZB 3AEIA 2KQXA 1VF5B 3NKDA 2PX3A 4LWSB 4IHJB 4G7OF 4XWJA 1VF6A 1E86A 3VBBA 4E0HA 1YITV 2BTQA 3ZG1A 2OWOA 1J95A 4U5GA 4I50A 1N33O 4B08A 1Q82W 3MHHC 3WFVA 2ICWG 4KXRA 1SC5B 2CTWA 2GAQA 2YHSA 3LEVA 4DV4B 1IBLO 3GM1A 1E1QG 3L9DA 2G38A 3HKCA 3WODF 1BE3H 1G6UA 1LIHA 5K1XA 2WPDG 1VF6C 4JE9A 1URFA 4X9QA 1ZW2A 1JRAA 2B0HA 2XL4A 4TV8A 2ZXRA 4UDVA 4FFBA 5B66Z 2ZR2A 2V3CC 3VQXA 1XQ8A 1YZAA 3ZRWB 3U10A 2RN9A 1WLEA 4I0XB 2QM8A 4MTOA 3S3XA 3O6XA 1XREA 1J5EO 2QWOB 2HFIA 2QDOA 2Y69B 1QVGU 1N0JA 2NG1A 1DF5A 1YDXA 4LFBB 1QR8A 1HWYA 4X20A 3ETEA 1U96A 5L0FA 1M2OA 3U9MA 3CWBH 2P5OA 3FAJA 4DW1A 1YIJV 1VQMV 2ZKOA 4FLWA 5LXTA 4DUZO 1SF8A 2DQ0A 1N32B 2P90A 2B1GA 4Q7CA 2Q9AA 1JJ2U 2F23A 2YIBA 5ITZA 3D36C 5LMNB 1D2DA 2HHHO 2YDEA 1LE2A 3TOMA 1BMFG 5CI9A 1I4YA 1SQXH 1R3LC 1V55C 3LNRA 3E2EA 4LDRA 3L70H 5JVEA 1DK1A 2KJGA 2QEXV 1GN4A 2H7VC 2KNHA 4FZ1A 1FXVA 1NT2B 4IAOA 2QWQB 2CTQA 3DM5A 1E85A 2R03A 1M2VB 3MAQA 2XLHA 4JGSA 5L3DA 1MG1A 4D7TA 2HMQA 2DGJA 4JI1O 1BGYH 2BCCH 2QGNA 1MMNA 4CSAA 2YL0A 4WFGA 4LBEC 4B3MO 4JYAB 1BQZA 1JAFA 4YJ2B 4YJWA 4FZ0A 3OM3B 1KNYA 4KC9A 3EPVA 1H9GA 3SXZA 1H2LA 3TK0A 1D1CA 2CGNA 5C8YA 2KQ9A 1N1CA 1TFOB 2CTPA 5CA1A 4G7ZF 3VQVA 5KHJA 1CPRA 2EPKX 1L0LH 4GEHA 5KYNA 4JYCA 2R7SA 1DGSA 3SPHA 1SQPH 2DWDC 1XNQB 3H1HH 3H1KH 4KUMA 4WFBV 3B40A 3O39A 1AJQA 2W45A 4GYCB 1QBZA 1SKVA 4JW1A 4F4LA 2QWNB 5A6KA 4MVSA 1Q0DA 4XBFA 4WFFA 4TUYA 2NSGA 3L8IA 4YHHO 3RQGA 2VCCA 3LAYA 4DR5B 3P3PA 4IL6Z 3WG7B 3CRAA 3RYHB 4OIRF 3SPCA 4LF9O 1OCOC 2YIAA 1ENVA 4BIOA 3WB2A 4YJ3A 3RYIB 1S72V 3SR2C 3WG7C 2WLIB 4DR2B 3GM3A 4JZAA 1ZVZA 3POVA 4FLYA 1N32O 4YT4A 3C3TA 2IBZH 3FDQA 4J7TA 1LE4A 3QF7A 2AP3A 5IJ9A 5IWAO 3K9AA 3SYOA 4X64O 3SYAA 4QE9A 3ZX6A 3ZTMA 4KI2A 5BMVA 2CCYA 4K35A 4X66O 3CMAV 1RJ9B 1VLSA 4JI5B 3FD9A 3CCRV 3S90A 2XTAA 2HG5C 2EZPA 1WP7A 4NXNO 3KH2A 5JSLA 3C7JA 5A2QN 4E2LA 3EHMA 3V5XA 1NR7A 4PDRA 5LGUA 4JF3A 4W4LA 1JJOA 1PD1A 4EHPA 1IBMB 2XNDG 4DUYO 2A06H 4LNUA 3S29A 5B1AB 3EFOA 3IGAC 5KMGA 4ZHQB 3K79A 2P7TC 4EB6B 2AU5A 4BJ5A 4TV9B 5GW7A 5JWPA 1VQ5V 3JARA 5COGA 4PFOA 2NNUA 4BJ6C 1NVPB 2Q4PA 4CC6A 1DOVA 4DV4O 1NI8A 1OR3A 4FFKA 1IBMO 2WA4A 3ABLC 3RWRD 4YL0A 1K9MW 5BZBA 1OCZC 2ODMA 1LPEA 3RF3A 2W6IG 4DV3B 3DAFA 1GS9A 2ITDC 4MVRA 2LW7A 2VWJA 2B1IA 3KG2A 3IJ4A 3J81N 2NUPA 5EC1C 4OIQF 3ASOC 3C8GD 5JVDB 3PMRA 1TKNA 2QTVA 2XL8A 3JAMN 1AI4A 4X1YB 1UPGA 1W2BU 1S0VA 2LK4A 4HEAJ 1LI5A 5KA6A 3K3WA 4JI0O 2JEXA 3R66A 5EBMC 4I55B 2P6JA 1AROP 1R3IC 2D5RB 1AR4A 4HE8D 1K92A 1QLEB 3CRMA 3I55V 2ZXWC 2CH7B 4D6TH 2YLGA 4N4WA 2M4EA 3SYPA 3EHNA 3KPHA 5EK0A 4CC5A 3APOA 3BABA 4E0IA 4AX2A 3LS0A 3FX7A 3EGDA 2JS3A 1M57B 1Z5WA 3RQEA 3ZMUA 2ILMA 2R7RA 3ZQVA 3SEOA 3TETA 2WZGA 3U8VA 1APCA 4JI6B 4IARA 4YHHB 4MTGA 1XUQA 5BMVB 1F4MA 4TQDA 5DN6G 3SPJA 3AOUA 3OEHG 3GM2A 4P30A 4BW5A 2N05A 1Q0GA 2Y3DA 4G2KA 2AZ0A 4PJ0Z 2UUAB 4Z9JA 2YUAA 4FM1A 4LACB 3B9QA 4DRIB 2G3VA 1OZ0A 3N2KB 2W9YA 3OWTA 1FJGO 1NVPD 4NKGB 1VQ8V 3F7YC 1NH2B 1QPUA 4ASUG 4PJLA 3CC7V 3E22B 1VQKV 1H2GA 2OEXA 1I5NA 3GANA 4LDQA 1CEZA 2XLVA 4O79A 3JARB 5FL7G 4JAUA 4K0DA 1WB7A 4OPHA 3WHNA 1UG7A 2GWWA 1TGOA 1ZU5A 2ZINA 2CE4A 5DS4A 3PJSK 1GM5A 4OIOF 3DGEA 2GSMB 3UGPA 5B1NA 3OMIB 4B3RO 4L8JA 4FM2A 5L3BA 2B0JA 1N34B 3FKSG 1M6TA 4JVSA 2A1DD 2XXAA 3NG1A 1OCCB 1PL4A 1IXBA 1XEQA 3D36A 5IY5C 3AG1B 4JI0B 1SZIA 1H8HG 1BS3A 4QIWF 5BQHA 4F6RA 3JRTA 4JZGA 4KHPB 1OKKD 1BR1A 1H8EG 3L1MA 3MYIA 4YN0B 2ZD9A 3C8GB 1ROPA 2ZIMA 4ZIBA 1I4ZA 1T01A 2WB7A 3SXMA 4FM0A 4K8XA 1TWHA 1Y6DA 2YL3A 5IE9A 5TISZ 4JV5B 4G78A 1HNXO 2ZE5A 3TCUA 4U9EA 4QI0A 3CJHA 4KBLA 2PF4E 2CW0F 4HAMA 3LDDA 2LW1A 3QVNA 4UXNA 1XWJA 1NQTA 1TA8A 1G5ZA 2W4BA 4UCUA 5D91A 3ZWIA 3T4DA 3E70C 1M4UA 4F4BA 2PYJA 1AVMA 4DBQA 3U3BA 4FLXA 3WAQA 1N4CA 3HKBB 1PD0A 2BSKB 1RKEB 3MX3A 3I56V 3CRRA 3FOOA 1B04A 4PHZA 1RPOA 2BTQB 4KL1A 2YXLA 4UCTA 5IT9N 3M4CA 2O57A 2Y0PA 2IXOA 2QM4A 1WN7A 3BVOA 4MVQA 2D3OW 4P9TA 5L3QA 1N36O 4AQYO 4EB6A 4MQ9F 2P4VA 3KZIZ 3P3NA 1Q81W 3BFRA 4NB5A 1NZEA 3U5SA 2OCCC 1KP2A 3AK3A 3JSLA 3VAYA 3HKCB 1F7YA 2LQGA 4AE4A 4MVMA 1XBLA 3BAAA 5IJ0A 2WVOA 4NTAA 4JI8O 1KP3A 3JYCA 1HDJA 1CGNA 4X1KA 4OGQB 2JPUA 5L0CA 4IB4A 4M63A 1JMKC 3X1OA 2HJMA 4CIHA 3SDLA 4O6MA 1K5SA 1PD3A 1AUEA 1E83A 2R02A 3LDCA 1O3UA 3C18A 3OEEG 5CIVA 5CA0A 1LUWA 2P61A 4X0RA 1SRYA 4PA9A 3RGBA 5B1BC 4QGPA 3E8FA 2WLLA 1Y66A 1SA0B 5IYCO 3CE2A 4A5UB 1KTMA 2ZE7A 5KHHA 2IOQA 1LKXA 3B0PA 2WSSG 4LDKA 2DJVA 3W7UA 5CB4B 3B09A 1K4DC 1HW2A 2F4VO 3LSQA 5JQGA 1N34O 1OCOB 2E76B 3JD0A 4DV2O 3G6BA 2VWKA 4IAQA 4OD4A 4NVPA 2L6LA 3UMIA 2R72A 4JI7B 1EN6A 2Q0OC 2CYDA 2V4DA 5L3CA 3ZIBA 3EGDB 4MS2A 1W59A 2R05A 4LF8O 4PR9A 4JPRA 5LOVA 1T6UA 4DV5O 5CI8A 1Z6AA 4ULWA 2VCBA 3E8BA 1P84F 3VOUA 3MLGA 1VARA 4RD9A 3JALA 5AC5A 1Y74A 2BC5A 4HZ3A 3APQA 4TQFA 1XZQA 3VYWA 1E84A 4DRJB 2CNWA 2V1DA 4UV9A 3GEEA 1Y76B 2IXMA 4O6NA 2KG7B 3OAAG 4DO2A 5CMUA 1GM7A 1BHAA 3STZC 3C90A 4NTBA 3R65A 2OU6A 1GTOA 4U7OA 4UVAA 4YL1A 2R70A 3CCUV 3UR3C 2R9IA 3MD0A 4P6IC 4IIJA 4LF4O 4BJ1A 2PGGA 4JI1B 4CH6A 3SYNA 1VF7A 2Q7EA 1SR2A 2W4MA 2UXDB 1T9KA 1YVWA 2LD6A 4HFFB 2QM7A 4R50A 1PV0A 4R8CA 2PI5A 4DK0A 1TAEA 2FYUH 3HTKC 1B3QA 4J9YB 5K0IA 2NR5A 5LMNO 1BZ4A 2YI8A 2JGUA 3K6BA 4BW9A 1QCEA 1UFBA 1L8DA 3K08A 2M64A 3W7WA 3E9VA 5IYDO 5DQZA 4DRXA 2WLLB 4CS3A 1R3JC 4MVOA 2CDQA 3DXRA 4LF5O 3DXJF 5H2FZ 1IVSA 1WA8B 1XILA 4KNWA 3CEXA 1Q6IA 3S0XA 3QW0A 2BE3A 4Z1MG 2M7WA 3T2MA 1Q8IA 2YLDA 2JS5A 2ZIOA 2O9XA 4NCQA 1XOUA 4FIPC 3UT5B 4QDLA 1YZCA 3CC2V 3N2GA 4J80A 3ZQYA 4ZI7A 1MMGA 4DV6B 1SZTA 2Q7HA 1AJPA 1G4WR 4O4LA 2J9BA 1B6QA 1FPOA 1H2NA 4ICGA 3CRCA 3HNKA 3M15A 2AVKA 2TMVP 4NTXA 3CSKA 2D2CB 2VQEB 3ZHUA 5T3TA 2Q73A 4GQHA 2CDYA 2IXPA 2Y3HA 2VQEO 2YKZA 4CH4A 1K3EA 1J8YF 3H2VA 2HFEC 3RYFB 1NFNA 3K5OA 1MA1A 1Z5ZA 3BPZA 1LVKA 4U3FH 3JD3A 2EPOA 4NXNB 4XDJA 2FGYA 2XLDA 3LLKA 3W4YA 1GM9A 2Q68A 4J7KA 4HBNA 5B3SB 4XEKA 4AL0A 4JC7A 1L1FA 3US6A 4CDAA 4PJJA 5IJ0B 4X1KB 2W0FC 3M79A 1PV3A 4R6ZA 4CBCA 3W2WA 3TJTA 2K1EA 2ADPA 3K57A 1A7DA 1PNLA 1RSOB 4JEBA 3AK1A 3CCJV 4CS4A 1D0XA 2JRIA 3U3FA 1WNSA 3JSNA 1Y4CA 2PP4A 2HS5A 3JAKB 3TXSA 5GONA 1T6IA 2Q9LA 3Q7GA 1RXQA 3G4ZA 1SA0A 3NDBB 4LF9B 4LF6O 4U5EE 4CH5A 1S5LZ 3G71V 4X65O 1OCRB 1LUVA 1Q43A 4DR5O 4BAYA 2YVKA 5IY5B 1Q0KA 2IJHA 3ZRXA 1I94O 3UKMA 4U5HA 1Y4MA 3ABLB 2V26A 3T6GB 2Q7GA 4I5SA 4DV1O 4RQEA 2XLOA 3K59A 2XSEA 1KQSU 1H7IA 3NRHA 5H6QA 3CYOA 1YHQV 3QO8A 2R7QA 2Q7RA 3P32A 2DE0X 4FJCC 2L9JA 4ZOLA 3W2VA 3H1JH 3DAGA 2JK5C 2XAFA 3QZCA 3GWOA 2UUIA 5GTHZ 3MYFA 1QHTA 2HLDG 5A6AA 1VQLV 1Y74B 2GHYA 3SZRA 3VQWA 3RVZA 5B3SC 1SQBH 4GX0A 3HKEA 4JTCB 4OIPF 3G6EV 3B4SA 4R32A 4LWSA 5J2UB 3EGXB 4QI2A 2ETNA 1HMDA 2XM4A 2EIMC 2WLKA 3CCVV 4JYAO 5J2TB 4I50B 1PL0A 3I5DA 2RNBA 1F51A 4ZLCA 5JRAA 2XXAB 2L6GA 2F22A 2ZM6B 5BQIA 4WFAV 4U5FE 4FLZA 4CS7A 2YLIA 5E79Z 4GKKB 3ABKC 1RKCA 5JS5A 1D0YA 2L6HA 3H1LH 1VQNV 2XS1A 2YSUB 1E79G 2MYSA 2XASA 1R6NA 1XMQO 3ASNC 3BCCH 2GA0A 2HHHB 2X6AA 4LCUC 4IWBA 4L6RA 4X62O 1XNRO 3K1HA 2HKOA 1SYQA 2JJ2G 2ZR3A 3JASB 2UU9O 1R6TA 3BEHA 1Q7YW 5LP6A 3FXHA 4EBJA 3T4ZA 2GDCA 2OOCA 1EZJA 1M9NA 3JYHA 3D3IA 4Z1VA 4FX5A 3MBGA 4JI8B 2UUCB 3WB0A 2YQYA 5HFLA 3JCZA 3W7SA 1GGQA 3K9SA 2DB4A 2VH3A 3AG4C 2QLAA 3IEEA 2R7TA 4UVBA 1BHBA 1OR2A 2XAGA 4J30B 2Y48A 4H33A 1MZFA 3VRCA 3OMAB 5ITZB 4C7OA 2ATKC 5LYJB 2BSKA 4BG0A 3CCSV 4ZI7B 1AI7A 4DUYB 2P1AA 3R7CA 4YT2A 4O4LB 3AG7A 1OXKA 1YJNV 1WJZA 1L3PA 1JFFA 1P7GA 1WOLA 2JEUA 2XM0A 1VQOV 2OJQA 1GQAA 1HR0B 3K03A 4KFMA 1HY5A 3UO3A 3AGUA 5E33A 1YDIA 2Y3BA 4U3JB 2Q9CA 3ZMTA 4MNDA 2QE9A 1Q3EA 4UCVA 2UUCO 1OW8A 2UXXA 2R7UA 2BOCC 1WPBA 3RYFA 1M2VA 3K0GA 4XPXA 3E86A 5JJEB 3OFNG 1VOMA 4PELA 4I4TA 4C3EA 2UU9B 4YY3O 1Q6HA 1N33B 4N6HA 5GTIZ 3CCEV 2DQ3A 5C8YB 4JV5O 5DM6V 2P0NA 1EBOA 1H2SB 4DR7B 3BRCA 4WBNA 5LHHA 1FKAO 3HPLC 3UQ8A 4TUYB 1BCCH 3O55A 4OPAA 1FXKB 4FAPB 1T6QA 1TWAA 3V5ZA 2FTKA 3C62A 3HJCA 1IW7F 2WVQA 4XPWA 3A0HZ 3G50A 4LF7B 1MSDA 4FLTA 2IH1C 5H5NA 4N06A 1QLNA 4DV7O 4XDLA 1EM1A 3QO5A 2R7WA 3TOLA 4E7SA 1HMOA 1H2MA 1AJNA 2R7XA 3KCXA 5E3AA 2DN9A 1WPXA 4PI2A 5F28E 3FAVB 1IZMA 2PFDA 4Q20A 1HNWB 3L0IA 4YJ3B 3JALB 3BA9A 3H9VA 4OX9B 3ABKB 2AHYA 3OR7C 2HVJC 4EFEA 3SNHA 5LP6C 1EZVH 2J7PD 4JI4O 4JJGA 5D5QA 2UUAO 4J32B 3KYIA 3GODA 4I7ZB 2QKAA 3N27A 2YL1A 1FYJA 4LFCB 1KYOF 4BR6A 4B3MB 2OIGA 2RDCA 4IIJB 1NBMG 2QR4A 4XTKA 1FNTc 2B9ZA 3CMEV 3EHBB 3JAWA 3ZMVA 2WA3A 2AWCA 2JVDA 3EH2A 3NMJA 4JI6O 3UMHA 2HR3A 3CP1A 1V9PA 3THOA 1HE1A 3HNIA 4JI3B 4AL1A 4B3TB 4X65B 1Q5OA 4UCRA 2YIBD 2XT9A 1KBHA 1NTKH 3LESA 3JSZA 1YXBA 1EFRG 2J0WA 3NXSA 2QJ1A 2X6CA 3ZRVA 3CHXA 2LP4A 1JA8A 1I08A 1VQ9V 1G4US 3OD4A 3M1CB 2ZNJA 2HV6A 1YEWA 3C3SA 4RUEA 2DWEC 5DECA 2PTMA 3E83A 5LHGA 4TV9A 2L81A 3ITFA 2X0CA 1LM3B 4H44B 4PJMA 2MK3A 3RYLA 1ZX3A 2WLMA 1KUQA 3RT3C 3B8NA 1TFKB 1U97A 4LH6A 4IGGA 4NTFA 1TUBA 1KMIZ 2B5UA 4K8ZA 4PDLA 2ZPAA 1P49A 3F5WC 5KYXB 3H1IH 1NBBA 4JCZA 3FOPA 3NMIA 3HLZA 3VF0A 4J7JA 2BTOA 3JASA 1Z23A 3K5LA 1NKDA 4BIZA 4DK1A 1O9HA 2QSAA 3J80N 4B3SO 3RYCA 1LNQA 3JZ0A 4BJTA 3Q6MA 4JI3O 1QVXA 2MHRA 1ZLZA 1YCIA 4Z2WA 3OGCC 1BR2A 3AJMA 3T1HO 3AG3C 3JCUQ 2G62A 3BRJA 3ETQA 2FMLA 4JASA 2E87A 1SQGA 2RJZA 2WL8A 1N0NA 4OXSA 2DYRC 1VMAA 4JAAA 2PNOA 4H4KC 2F66C 1ZHYA 4WGZA 4DRHB 4Z9HA 2XAJA 4IYIA 1JMWA 3CCLV 4J10A 3OR6C 4JCHA 3SXYA 4IHJA 2OCCB 4I55A 1LR1A 3UT5A 3ZSUA 2GTAA 4I9WA 1T5EA 2LP7A 2A3QA 3LUTB 4WF9V 5KAIZ 1YJWV 3EJNA 3DTUB 3ETGA 4QJFB 1G8MA 1ZHWA 5EYPB 3U2MA 2UXCB 1W0JG 2OTJV 4JI5O 4DOZA 5EHHA 2ITCC 4JTDB 1JPXA 4X66B 2XLEA 2EJ7A 4WGYA 4G28B 5DS5A 1XZPA 1VEWA 4PA6A 2WZLA 3X2QB 2J9UA 4WJ0A 4GZRB 3HNLA 4UCSA 1K34A 1Z63A 1V74B 1JCHA 2J8WA 1EKYA 1E2XA 1NU7D 4P9PA 1THZA 3K5NA 3Q6NA 3N2KA 1GN6A 1GKFA 1VLTA 1RMVA 4LF7O 4UFZA 5KHKA 3E8GA 4DR3B 1FTSA 1NSGB 3U0CA 3N0TA 1VYIA 1SERA 2WWWA 4TT3G 3LEOA 3FFQA 2A9HA 5EC2C 3OMNB 1QZXA 4JURI 2Z3YA 1YYJA 1QU7A 1GO3F 2E5LO 2H3OA 2A68F 1RP3B 4PD4F 3U8PA 3DSQA 3E8HA 5D5PA 5LHIA 1DLBA 4G27B 1WAZA 2UUBB 4EBBA 4G0HA 2EPNA 3KKBA 2VCAA 5COMA 5LXTB 1IDSA 3H01A 1LS1A 4RUFA 1IZ3A 2F93B 1FFXA 1HNZB 4O2AA 1A7VA 4JYBA 1M5IA 3VM6A 3RYCB 5LA6A 2LFSA 2QTOA 2YL7A 4EFBA 2P06A 5KUKA 2FKXA 1HR0O 1MZEA 1MOFA 4CZZA 4DV5B 2KSDA 1NTZH 1LS4A 3HB3B 2ZE8A 3EVKA 3O65A 1ORYA 2HSBA 4C3BA 3LLIA 2NUTA 3DJUB 4E18A 4I9QA 2CNWD 3TD7A 1QQ3A 4DV2B 1X59A 1QVFU 1YJGA 4CS8C 2HMZA 4JI2O 3JAWB 4PJNA 2A0UA 2NSFA 1G8XA 2UXBB 1R3KC 2LSEA 2CUGA 2WAMA 5JH7A 2YI9A 3JRMO 5KYYA 3HKBA 2Y0IA 2X6BA 3ZJZA 1C02A 1RKEA 1YAUO 3FYEB 3FMSA 2LO1A 5C93A 3GWLA 4YK5A 1EN4A 4ANJA 4PA7A 3VQYA 4HNAA 3E89A 1M57C 4MSWC 3ZHQA 5H6RA 1FD9A 3KYJA 2DMXA 3M4BA 1XMQB 5AC4A 1R1BA 3FB8C 2GV9A 1C03A 3V5YA 1H6GA 1AB3A 1VYKA 5BR8O 3ML0A 3KL4A 1TVKA 2PUSA 2YEVB 4FK5C 4WFHA 4AE4B 3RFYA 4DJ9A 2XS8A 4O6YA 3IC7A 2EILC 2A69F 3K66A 2IJJA 3EZHA 3ICXA 2GBOA 2ZM6O 1W0KG 1U0BB 4EUKB 5BXZA 3K5MA 1OW7A 4JI2B 2RSEB 4DR4B 2ZE6A 4PI0A 1Y67A 3A11A 3IQ6A 4UVCA 4AQYB 1JVMA 2OTLV 4J41A 3JD1A 3B0UX 2EIKC 5LYJA 2ZNIA 3JATB 4A2NB 3RYIA 4IRUA 2QY9A 4XQ1A 4NXMO 3ZTZA 2R9AA 4IYHA 4JAVA 5A6BA 3F5TA 2Y69C 1BR4A 1FFXB 3K7DA 2A0BA 2EPMX 1RM1B 1R4TA 3TJ5A 1H9TA 1JQ0A 5F5HA 2PBEA 5JQGB 1DF4A 3DM9B 2HV7A 5J9PC 5A6JA 5LMUO 4BWAA 1I0HA 5A9GA 1ZZPA 2OEVA 3ABUA 1S3JA 2GDSA 1US6A 4U5CE 4H37A 1P4RA 5TJ5E 2H7OA 2EULA 1NFOA 4XLNF 3EG9A 3FB5C 1WWPA 4N21A 2M6YA 2L35A 3LNNA 5IJ9B 4EBKA 2GUZA 2PZSA 1I94B 3S27A 1VQ4V 2E5LB 5JLIA 2YXHA 1WTYA 1D5AA 4PA4A 4LNUB 2VB6A 2DYSC 2YICA 1YZBA 2ZDIC 3LNMB 1ORSC 2LFDA 1JX9A 4MT8A 4LF6B 2V7QG 3NR7A 5D92A 5L0IA 2H94A 3P30A 5AG2A 1K4CC 4U3JA 5T1DB 2RQ6A 2EJRA 3ABMC 4K0KB 4UB8Z 3T1YO 1OXBA 1ZWIC 1I5XA 4X1IB 5KX5B 4E17A 2EX3A 2GTSA 2Z5UA 1WATA 2JDIG 2IYLD 3A0RA 2WZFA 4B3RB 1K04A 1MNGA 4K0KO 1NS1A 1RPRA 1K73W 2R25A 1KD1W 2MW2B 2QWRB 2F1MA 3FVYA 1K05A 1V54C 3Q4HB 2EPLX 4JYYA 2CTRA 4LH7A 1JR8A 3ZMZA 3RBZA 1UFIA 1VK5A 3ZMSA 3DZAA 1V55B 1YARO 1G4YB 2UXNA 4U5DE 4BPMA 4CH3A 2Y4TA 1KKCA 3G80A 5BY1A 1WN0A 3HNJA 5KYWA 3ZN1A 4RO2A 1SQQH 5JCOC 2X51A 3L74H 2HJ3A 4RQFA 2X7RB 5COFA 3D8CA 1GAXA 1AEPA 2C03A 2YRFA 3AG2B 4D4NA 3GB7C 1CGME 3N2GB 2ZXWB 4CJGA 3S3WA 2CH7A 4CIPA 1YA7O 3MFNA 2P22C 3A0BZ 4HYOA 2ZT9B 3CD6V 2N74A 4DV0B 1GMGA 4DBRA 3BA8A 1VQ6V 1VB5A 3ASNB 3B77A 2Y4UA 2AZ2A 2DYSB 2G3KA 3AGTA 2KYHA 1N8RW 4L87A 4LLEA 2J45A 4PDVA 4DV6O 1D0ZA 1SQFA 3ZHSA 2LCHA 4RDAA 1NR1A 4C7UA 3ZIAG 3CRQA 4DR4O 1BT8A 3T9OA 4EIYA 1GRJA 3UMKA 2GUZB 3OW2U 1YF2A 3PCVA 3ZRSA 3QMKA 3DD7A 1AI5A 3QO7A 1FFHA 2YZSA 1G1XB 3CSXA 4GKJO 3CXCU 3F47A 4W4KA 2IJKA 3MHSC 3G4SV 2J0XA 1ZW3A 1LI7A 1PKXA 2R9RB 4J9ZB 1O5HA 2ADQB 3EFFK 3OUSA 1CGOA 5BQGA 4JJFA 1KU9A 4NY3A 5E3CA 1XDCA 1MMAA 4DV3O 1PCXA 2QUPA 3JAKA 4D4XA 1TVKB 3B29A 5EZYA 1A41A 4JZ2A 3TK1A 1GK9A 2NLJC 5IYZA 4H13B 4TOIA 4B3TO 4YL3A 1FXHA 1YVIA 3IPMO 4K1OA 3B2EE 4QNHB 4LF4B 4F6RB 1QKRA 1ST6A 4LFCO 4I1OB 2HKVA 4X20B 2J9VA 1SF9A 1GM8A 3JATA 1ZL8A 3ZRWA 1XI1A 1R73A 1Z2GA 4TSFG 4DR6B 1HW1A 1U89A 4JI4B 3N24A 3K1IA 3V7OA 3U11A 4XLPF 1XL4A 2VQFB 1YLMA 1VIBA 2L7AA 3CJHB 3RKOF 1U6HA 2LIGA 5GONB 3IFXA 1ZHXA 2Q0AA 3BHPA 2NPUA 3CXHF 1YI2V 2L6FA 2P6VA 4X89A 3C8GA 2FAPB 4YIOA 5KHIA 4XDKA 3H2UA 3O9OA 2F95B 4D7SA 5IWAB 1S76D 3GEIA 5A69A 2IU0A 3EH1A 1HE9A 3FYIB 2W0XA 3ZHVA 2AXTZ 2I8BA 3EG9B 1CP9A 1FXKC 4DVZA 4IT5A 1MNEA 3L75H 1S5HC 3A2FA 2LFFA 2VS0A 5CA1B 4ZOLB 1Q0FA 2ETSA 2ZXOA 3ZVRA 2JX0A 4PA3A 1NG1A 4AK9A 3EZIA 2EBOA 4ZLDA 5B5EZ 1VMGA 4DR7O 2PI4A 4YJ2A 4PACA 1ZAUA 1H2KA 5CN0A 3CCQV 2XLMA 3DC6A 5J2TA 3RQFA 4WFEA 4K3AA 4YY3B 1DOWA 2Y3GA 2E3CA 3HKDB 1YTFB 1OCRC 2WLNA 4O4HA 5J2UA 1F4NA 1TUEB 1K97A 3GVMA 5LGNA 3OTOB 3ATPA 5GPGB 5LMUB 5KUMA 1Y6XA 3Q4HA 3NMKA 4ZKIA 1QLEC 1AP6A 1MNDA 3ZCCA 4UCOA 2GFHA 1A0BA 2HEPA 3K04A 3M8AA 2WLIA 5E1AC 3T6BA 4PK4A 3SPIA 1I7FA 3ABTA 3TGUH 2VQFO 1BZKA 4YWQA 2IW5A 1BBHA 4O2BA 4NXMB 3R2PA 2P4KA 1IBKB 4C7OB 1O9GA 5HSWA 1ZU4A 2PX0A 1SQVH 3SXKA 3QG5A 4DVYP 5L3VA 4IJJA 1EI7A 2EINB 1R5ID 1JPJA 4W8PA 4CJOA 3OA1A 5A6BD 5FZTA 4H0LB 3IQCA 5CB4A 5JH7B 3QVZA 4I44A 3W8IA 3SJBC 4BJ5C 4O4IA 4LP8A 5L3EA 4LFAB 1L7CA 3ZHRA 1VQ7V 1YJ9V 4N23A 1Y76A 2LGWA 1GH6A 2ASRA 2OJED 4YIPA 3EFOB 2A6HF 4I4TB 4WCEV 2K9PA 5B1AC 4DXWA 1BDJB 2PY5A 2C2AA 5KHGA 1WP8A 1YA9A 4H54A 2OIEA 4LFAO 3SYCA 4JKVA 2YEVA 2AHZA 3RN4A 4KHPO 3ECSA 3NYMA 1JFFB 1FFTC 4KP4A 5KMGB 2IJIA 3EQLF 1ZSPA 3K33A 1V4AA 3I5QA 1FXKA 1F23A 5L0GA 2LGQA 1CPYA 1MQVA 2XL6A 4P2ZA 1S5JA 5CBHA 4W8KA 3IQTA 2OKUA 3GEHA 4QPJA 4CS8A 1M93A 5JUAA 4B7KA 2FL4A 2Z0AA 3K06A 3B8MA 2JJ1G 1IBKO 5DS6A 5H9CA 3LSUA 1FAPB 4OINF 2LJ2A 2CK3G 1HP8A 4DRXB 3RH3A 3RFRA 2WLJA 2YIDA 3L72H 5LL6Y 3DXRB 4X8AA 5LGTA 2EINC 3I5PA 1OHHG 1S7ZA 2Q69A 256BA 4MW8A 3JT1A 3LDEA 1IBLB 3B0VC 1Q6UA 1BQ0A 2NUPB 4AI8A 5FPRA 3ZHTA 5HV9A 4TWKA 1IXMA 5LBQA 4KNVA 4ABMA 1Z3IX 3JYYA 3GORA 3AQCA 3SJCC 4NTWA 3MDSA 4MTXA 3DWWA 2Q8VA 1MMDA 4MVUA 5L3FA 2JGDA 5FNVA 1YTFD 1SS3A 3OUFA 3CS5A 1XMOB 3NYJA 4GX5A 5CBFA 2ZCEA 4DR3O 4J7YA 3L34A 1COWG 2C04A 2HSQA 1JR9A 5EIBD 4NC3A 3A9CA 3SGIA 3T1YB 1NJIW 3M99B 3LS1A 5JJNB 4E4EA 3DKAA 1A7EA 4EEQA 1XMOO 5JJJB 1E1RG 1AP5A 4FMTA 2ZXPA 1ZHTA 2PYLA 5CBGA 4N6CA 3ETDA 2HUJA 4GUNA 3ZBHA 2BE5F 5JT4A 2UXCO 4FVMA 3E22A 4FLUA 1I5YA 1D1BA 2H8AA 2HP8A 2QE7G 2CAZC 2Q00A 3G4XA 3L8JA 4B7EA 3GWNA 4R7CA 5KX5A 4DR6O 3T1CA 5AGFA 4FPPA 2J9WA 1OCCC 3W7TA 5JP7A 4A4AA 2DOSA 2F43G 1PPJH 3DC5A 3F7VC 2EIJB 2IU3A 3JD2A 2OYQA 3SJAC 2HJDA 3DJNB 5L3GA 3JTLO 3CAXA 3G67A 3T1HB 3CEIA 3WB1A 1K8AW 3SP1A 3TJ6A 2P7VA 2VC9A 3DE9A 5DEDA 1ZHZA 4O4JB 1Z7Qc 3AQBA 3ASOB 3L73H 3B71A 2EIJC 1M56C 4LC1A 5EBLC 4B3SB 2R7VA 1WB8A 3L71H 2RD9A 4OD5A 2BL2A 1MABG 4QE7A 1FAFA 4I0XA 3JSEO 1NZ6A 1VP7A 4ZBMA 1X4TA 4MVZA 3Q7LA 2QWPB 5JCOA 1V54B 2IM8A 1J8MF 2LFRA 3SYQA 1HW7A 1QNMA 1OQCA 1Q0MA 1OCZB 1QR9A 2I15A 2IM9A 4X64B 5IDJA 2RMKB 4XEVA 1KKDA 1P7BA 1S77D 4AHCA 3DE8A 5EBWC 2JGDB 2Q3TA 5BR8B 3NYLA 1TWCA 2CGEA 3UCSC 3NKEA
chains in the Genus database with same CATH topology
3QZCA 3CQZA 1W2WA 2M6YA 1RJ9B 2J46A 4C3DA 3T4RA 2GUZA 3S27A 1TR2A 3KH2A 2VB6A 3UNGC 2DYSC 4CBEA 3SZRA 2H7BA 3EHMA 5B3SC 1PD1A 5D92A 4OIPF 4I3MA 3S29A 5T1DB 3EFOA 3ZC4A 3EGXB 3ABMC 4QI2A 3UGOA 5FCLA 2EIMC 4EWCA 4BJ5A 3LJBA 5KYUA 2IYLD 2WZFA 4ZLCA 2XXAB 3EGXA 1SMYF 4PFOA 4BJ6C 2N04A 2VASA 4U5FE 4CS7A 2QWRB 3FVYA 1FMWA 1V54C 3ABLC 4LERA 3ABKC 1OCZC 4I1MA 1D0YA 2CTRA 3DAFA 1OKKA 2MYSA 1VK5A 3ASNC 2NUPA 3DZAA 4OIQF 3FHDA 4IWBA 3ASOC 3K1HA 4U5DE 2Y4TA 3PMRA 5KYWA 2KGOA 2X51A 1TKNA 2QTVA 2C03A 4HEAJ 3JYHA 4FX5A 5DVWA 2VH3A 2D5RB 3AG4C 3KMIA 3IEEA 4HE8D 2R7TA 2Q9BA 2ZXWC 4J30B 2M4EA 4DBRA 3EHNA 4C7OA 2Y4UA 4LLCA 3APOA 4BG0A 3W8HA 2G3KA 4AX2A 3LS0A 3EGDA 4YT2A 4LLEA 4K7BA 2J45A 3AG7A 4FWVA 1D0ZA 2NUTB 1WJZA 5KYYB 3SEOA 2R7RA 2WZGA 4RDAA 2Y39A 3UO3A 5E33A 4RWUA 2Y3BA 4BJ6A 2Q9CA 3UMKA 2GUZB 4MNDA 4BEJA 2R7UA 2N05A 2OCHA 1M2VA 3DD7A 3DMDA 2Y3DA 3QMKA 1FFHA 2YZSA 3F47A 2YUAA 1VOMA 4LACB 3B9QA 4C3EA 2G3VA 2J0XA 5BUOA 2W9YA 3OWTA 1RJ9A 1O5HA 3AG1C 2XRHA 4Q4ZF 1IURA 4JJFA 4PJLA 1FMVA 4NY3A 5E3CA 1MMAA 1PCXA 3GANA 2R7OA 4O79A 4E7ZA 4HFKB 4K0DA 1TWAA 3HJCA 1IW7F 1ZU5A 2IXNA 5DS4A 2WVQA 4OIOF 5DLJA 1NU9C 3UGPA 2B0JA 5F5FA 4JVSA 3RIPA 2A1DD 2XXAA 3AG2C 1ST6A 4CS9C 4I1OB 3NG1A 4N06A 5IY5C 2J9VA 1SZIA 1ZYRF 4U5BE 4Q5SF 1TWGA 3N24A 3JRTA 2R7WA 1OKKD 4E7SA 3V7OA 1BR1A 2R7XA 2WVNA 4XLPF 5E3AA 2DN9A 4YN0B 5E2QA 3RKOF 1KU2A 2WB7A 1IZMA 1TWHA 1ZHXA 2PFDA 2OG2A 3L0IA 3K1IC 3SNHA 2P6VA 4QI0A 3H65A 2J7PD 4KBLA 2PF4E 4JJGA 2CW0F 5EGYA 2Z15A 4J32B 3S28A 3GODA 4KI2A 3EH1A 4J7ZA 4B6IA 2I8BA 2W4BA 3CZ6A 3EG9B 5D91A 3E70C 4DVZA 4XTKA 4F4BA 4IT5A 3EH2A 1MNEA 3X2QC 3UMHA 3F46A 4DBQA 1N4CA 1PD0A 3MX3A 3LESA 3JSZA 2J0WA 2ZXOA 3ZVRA 4CSAC 1NG1A 2IXOA 4AK9A 3EZIA 3BVOA 4ZLDA 5L3QA 2KW3C 3T6JA 3M1CB 4MQ9F 2HV6A 5KYUB 1NZEA 3VAYA 2OCCC 2A6EF 2L81A 4YT5A 4AE4A 3UO2A 2Y3GA 1XBLA 3ITFA 2WVOA 1D1AA 1HDJA 1OCRC 4PJMA 4M63A 3X1OA 3RYLA 4CIHA 4G7HF 4O6MA 1O87A 5KYXA 2MWQA 1QLEC 2JD3A 4X0RA 1WGWA 2FFHA 1MNDA 4PFPA 5T3WA 2ZPAA 2GFHA 5KYXB 5B1BC 3T6BA 3HLZA 4PK4A 4RBNA 2J7PA 1Z23A 4YWQA 2QSAA 4C7OB 2IOQA 4BJTA 3OEOA 4YT8A 1LKXA 3B0PA 3Q6MA 5HSWA 1ZU4A 2PX0A 4DVYP 5L3VA 3JCUQ 1BR2A 4IJJA 3AG3C 4FESA 2G62A 5KYWB 4CS9A 1JPJA 2WL8A 2E87A 3OA1A 4H4KC 4O7GA 1VMAA 2DYRC 3PHF2 4OD4A 1ZHYA 2L6LA 3UMIA 1JPNA 5DQTA 4JCHA 4GYTA 2YS8A 3N2ZB 4I44A 3ZIBA 3W8IA 3EGDB 3I4UA 3ZSUA 4BJ5C 3EJNA 5CI8A 2KQXA 1Z6AA 2LGWA 1GH6A 2PX3A 3NKDA 4ULWA 1ZHWA 3EFOB 2A6HF 4G7OF 4XWJA 3MLGA 5B1AC 4RD9A 4DOZA 5EHHA 3ZG1A 3APQA 3VYWA 4U5GA 2CNWA 4O6NA 2EJ7A 2IXMA 2YEVA 5DS5A 3ECSA 3NYMA 2CTWA 2WZLA 2J9UA 1FFTC 2YHSA 3LEVA 4WJ0A 3EQLF 3K33A 1Z63A 3WODF 3I5QA 3UR3C 1NU7D 4P6IC 3Q6NA 4BJ1A 4W8KA 3SYNA 4CS8A 1FTSA 3W2VA 2XL4A 2W4MA 2ZXRA 1VYIA 3N0TA 4HFFB 4JURI 1QZXA 5DS6A 2V3CC 3HTKC 4OINF 2A68F 3O6XA 3RH3A 2QWOB 3K6BA 2EINC 3I5PA 4G0HA 4EBBA 3KKBA 1S7ZA 2NG1A 3E9VA 3JT1A 1LS1A 5DQZA 3B0VC 1M2OA 2CDQA 3DXJF 1BQ0A 2NUPB 3FAJA 4KNWA 3S0XA 1SF8A 4Q7CA 2Q9AA 2O9XA 1Z3IX 4KNVA 3AQCA 4QDLA 5CI9A 1V55C 3LNRA 4J80A 1MMDA 1MMGA 2KJGA 2H7VC 2KNHA 4C3BA 3LLIA 2NUTA 3DJUB 4IAOA 2QWQB 2CTQA 1FPOA 3DM5A 3NYJA 2CNWD 1M2VB 3TD7A 3L34A 3CSKA 2C04A 2DGJA 5T3TA 4CS8C 1MMNA 2IXPA 4CSAA 2Y3HA 1BQZA 4PJNA 4YJWA 1G8XA 1J8YF 3LS1A 2LSEA 2CUGA 5KYYA 4KC9A 3EPVA 1D1CA 1Z5ZA 2LO1A 1LVKA 4ANJA 2ZXPA 2KQ9A 1M57C 1ZHTA 1N1CA 2CTPA 2BE5F 2FGYA 4G7ZF 3LLKA 2DMXA 1D1BA 4GEHA 5KYNA 1VYKA 4PJJA 2R7SA 3KL4A 4AE4B 3RFYA 4O6YA 3O39A 2EILC 1OCCC 2A69F 2J9WA 3W2WA 3K66A 3EZHA 2W45A 4JW1A 2QWNB 1D0XA 3DJNB 2PP4A 3SP1A 2P7VA 3LAYA 1ZHZA 3Q7GA 3B0UX 3AQBA 2EIKC 2EIJC 4OIRF 4A2NB 1M56C 4IRUA 2QY9A 3NDBB 2R7VA 4U5EE 1OCOC 4OD5A 2Y69C 1BR4A 3K7DA 1FAFA 1NZ6A 3WG7C 4JZAA 4U5HA 3Q7LA 2QWPB 3POVA 1J8MF 2V26A 5F5HA 4YT4A 3FDQA 3DM9B 2XSEA 2HV7A 3NRHA 2R7QA 4U5CE 2H7OA 2Q3TA 3NYLA 2L9JA 4XLNF 1TWCA 2CGEA 3EG9A 3DAGA 3UCSC 3NKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJ7 A;  1BQZ A;  2PF4 E;  3AG7 A;  2M6Y A;  1WJZ A;  2L6L A;  2CTW A;  2GUZ A;  3BVO A;  2N04 A;  2CUG A;  1FAF A;  1NZ6 A;  2YS8 A;  1IUR A;  3UO3 A;  4J7Z A;  4RWU A;  2QWR B;  4J80 A;  2QWP B;  2QWO B;  2QWN B;  2LO1 A;  2GUZ B;  2DN9 A;  3UO2 A;  2QSA A;  4IT5 A;  2CTR A;  1XBL A;  2QWQ B;  2CTQ A;  2KQX A;  1FPO A;  2LGW A;  1GH6 A;  1HDJ A;  2N05 A;  2CTP A;  2OCH A;  2DMX A;  1N4C A;  2Y4U A;  3APO A;  2YUA A;  1BQ0 A;  3APQ A;  2Y4T A;  3UCS C; 
#chains in the Genus database with same CATH topology
 4JRZ A;  3CQZ A;  1W2W A;  4C3D A;  2J46 A;  3HKE B;  2E74 B;  3T4R A;  4DR2 O;  1TR2 A;  1FFT B;  1ZTE A;  3UNG C;  4CBE A;  2IH3 C;  3AK2 A;  2H7B A;  2AWY A;  2NN4 A;  2HJF C;  3E35 A;  2Q6A A;  1BSM A;  2X0L A;  5EZY B;  3RVY A;  4J11 A;  5B1O A;  3PDM P;  4UV8 A;  5FPO A;  4I3M A;  1OV9 A;  4JEA A;  3FB6 C;  2JIZ G;  5EYP A;  3ZC4 A;  3OTF A;  1EA8 A;  5FCL A;  3UGO A;  2FB5 A;  4UUJ C;  4DV0 O;  4EWC A;  2A0L A;  2XUM A;  1JOY A;  1GN2 A;  4P9O A;  3LJB A;  5KYU A;  4YXW G;  2H8P C;  4NTY A;  3ZED A;  1K40 A;  3EGX A;  3CPW U;  1C17 M;  2HZ8 A;  3QVY A;  4GX2 A;  1SMY F;  1EQ1 A;  1D5N A;  2N04 A;  4MTF A;  2VAS A;  4ER9 A;  3J7A U;  1RFY A;  3RW0 A;  3S9O A;  1XNQ O;  1FMW A;  4CS2 A;  4NYK A;  4LER A;  5FLX N;  1QSP A;  4I1M A;  1PNM A;  4ULV A;  1JOG A;  3RYH A;  1OKK A;  1HNW O;  1AIL A;  4JTA B;  3FHD A;  5IYZ B;  2EIK B;  4PDM A;  2KGO A;  4ONS A;  1XHZ A;  4LF8 B;  1KEC A;  3OGI B;  3AG4 B;  4O4J A;  3J06 A;  1HNZ O;  3OTO O;  1PM9 A;  2P67 A;  4DR1 O;  2OQM A;  5CA0 B;  5DVW A;  2QKS A;  4JI7 O;  1ORJ A;  3JD4 A;  4DV1 B;  4P9F A;  2D4U A;  2ZDI A;  2XAQ A;  5LP6 B;  1S05 A;  2UUB O;  1ZL8 B;  1R6K A;  1EN5 A;  2XLW A;  3KMI A;  1ZUQ A;  2XOK G;  2Q9B A;  2ARH A;  2UUH A;  5CA3 A;  4O2A B;  3FB7 C;  2QKC A;  3K0D A;  1FS0 G;  4LLC A;  3GWK C;  3W8H A;  4PV1 B;  5LA6 B;  4K7B A;  5L0H A;  1A32 A;  4FWV A;  2NUT B;  1PP9 H;  5KYY B;  1NH2 D;  3SJQ C;  2RCV A;  1OW6 A;  1XHX A;  3IAY A;  2Y39 A;  1SET A;  4RWU A;  1M56 B;  4XPY A;  3TUL A;  4BJ6 A;  4DUZ B;  3HKK A;  4BEJ A;  3C63 A;  2WLH A;  5L0D A;  4XEF A;  3O10 A;  5K1P A;  3HKD A;  3DMD A;  2OCH A;  3ABM B;  4DR1 B;  1AVO B;  5LOV B;  3TXQ A;  2YC0 A;  3JCU Z;  4LFB O;  3PN1 A;  4NQF A;  1K5Q A;  3KCY A;  3SPG A;  3U2L A;  5BUO A;  1KB9 F;  1B68 A;  2XAH A;  5L0J A;  1RJ9 A;  3CX5 F;  4AIL C;  4HNA B;  3QTC A;  1J5E B;  2OT5 A;  1Z5V A;  3AG1 C;  2XRH A;  2A79 B;  3IHU A;  1RM1 C;  3HR0 A;  1K7D A;  1N36 B;  3QW1 A;  4Q4Z F;  2KG7 A;  4TV8 B;  1M90 W;  1IUR A;  1FMV A;  1DTO A;  2QA4 V;  4J42 A;  4X88 A;  1AR5 A;  1MSW D;  2R7O A;  4E7Z A;  4O2B B;  3STL C;  4HFK B;  3KKY A;  4U9D A;  5JVD A;  4WBN B;  1F1M A;  2IXN A;  2YWA A;  5DLJ A;  4ZHQ A;  1NU9 C;  1TQG A;  4O4H B;  3CB2 A;  5F5F A;  2HVK C;  4X1Y A;  1WA8 A;  3EXA A;  3RIP A;  5KA5 A;  2QNL A;  3AG2 C;  4CS9 C;  2EZO A;  2ZQM A;  4FLV A;  1ZYR F;  4U5B E;  3ZS8 C;  4Q5S F;  1TWG A;  3FAV A;  3AG3 B;  2KSF A;  1VQP V;  4O4I B;  3CC4 V;  2XHB A;  2WVN A;  2DYR B;  5E2Q A;  3UM7 A;  4GCZ A;  1IX9 A;  1HNX B;  4X62 B;  1XNR B;  1KU2 A;  1PNK A;  1YYX A;  2KK1 A;  3DI5 A;  2OG2 A;  2DI3 A;  3QNE A;  1FR0 A;  4GT1 A;  3OE7 G;  1B06 A;  4GLX A;  3K1I C;  1H38 A;  4WAB A;  3IC9 A;  3H65 A;  5KLV H;  5EGY A;  4GKK O;  5EIB C;  4MW3 A;  4LF5 B;  2Z15 A;  4GKJ B;  3S28 A;  4NR1 A;  2DW4 A;  2KKW A;  2EIM B;  3ZN0 A;  2UXB O;  4J7Z A;  5B1B B;  4U7N A;  4B6I A;  1UJW B;  3CZ6 A;  3A8T A;  4F6E A;  1Q86 W;  4UB6 Z;  2VRZ A;  3X2Q C;  1CPQ A;  3D3Q A;  2Q67 A;  2QTS A;  4X1I A;  1RCP A;  3F46 A;  3S84 A;  4BEM J;  4EKW A;  2AW9 A;  5B3I A;  2Q5Z A;  5IYB O;  3U0Z A;  1MMM A;  4CDY A;  3BY6 A;  4CX9 A;  4CSA C;  3C8Z A;  2UXD O;  3FAP B;  3K58 A;  1L0N H;  2KW3 C;  3QTH A;  3CCM V;  3T6J A;  1NTM H;  1RSO A;  4DW0 A;  5KYU B;  1FJG B;  2A6E F;  2KB1 A;  4YT5 A;  3TQO A;  3UO2 A;  4FFB B;  1D1A A;  1TUB B;  4JIO A;  4G7H F;  3WU2 Z;  1O87 A;  4RAI A;  1M1K W;  5KYX A;  3OT7 A;  3IQ5 A;  4BIU A;  2MWQ A;  4OX9 O;  2IBF A;  2JD3 A;  4Q6G A;  1WGW A;  2FFH A;  4PFP A;  5T3W A;  1Q90 D;  2E75 B;  3ZDL A;  4GX1 A;  4RBN A;  2J7P A;  1OJH A;  1T5O A;  2CGO A;  5FNV B;  1SZX A;  5HFM A;  3OEO A;  4YT8 A;  4DV7 B;  4Z9I A;  1KC8 W;  1SES A;  2AGA A;  1AR1 B;  2EIL B;  2Q4F A;  5F2V O;  3U9J A;  4FES A;  1YSC A;  1NU1 H;  4DYL A;  5KYW B;  4QPK A;  3W7X A;  2F4V B;  2A7W A;  1K33 A;  4CS9 A;  1XL6 A;  4O7G A;  3PHF 2;  2W6J G;  1WAS A;  1QQC A;  5KAF Z;  4CDV A;  1JPN A;  3LSS A;  1VTM P;  1GN3 A;  4LR3 A;  2KC3 A;  5DQT A;  4GYT A;  2YS8 A;  3N2Z B;  1BL8 A;  3M7M X;  2BOB C;  3I4U A;  1ORQ C;  2YXY A;  2LQT A;  1AI6 A;  1NLX A;  1CXZ B;  3AEI A;  2KQX A;  1VF5 B;  3NKD A;  2PX3 A;  4LWS B;  4IHJ B;  4G7O F;  4XWJ A;  1VF6 A;  1E86 A;  3VBB A;  4E0H A;  1YIT V;  2BTQ A;  3ZG1 A;  2OWO A;  1J95 A;  4U5G A;  4I50 A;  1N33 O;  4B08 A;  1Q82 W;  3MHH C;  3WFV A;  2ICW G;  4KXR A;  1SC5 B;  2CTW A;  2GAQ A;  2YHS A;  3LEV A;  4DV4 B;  1IBL O;  3GM1 A;  1E1Q G;  3L9D A;  2G38 A;  3HKC A;  3WOD F;  1BE3 H;  1G6U A;  1LIH A;  5K1X A;  2WPD G;  1VF6 C;  4JE9 A;  1URF A;  4X9Q A;  1ZW2 A;  1JRA A;  2B0H A;  2XL4 A;  4TV8 A;  2ZXR A;  4UDV A;  4FFB A;  5B66 Z;  2ZR2 A;  2V3C C;  3VQX A;  1XQ8 A;  1YZA A;  3ZRW B;  3U10 A;  2RN9 A;  1WLE A;  4I0X B;  2QM8 A;  4MTO A;  3S3X A;  3O6X A;  1XRE A;  1J5E O;  2QWO B;  2HFI A;  2QDO A;  2Y69 B;  1QVG U;  1N0J A;  2NG1 A;  1DF5 A;  1YDX A;  4LFB B;  1QR8 A;  1HWY A;  4X20 A;  3ETE A;  1U96 A;  5L0F A;  1M2O A;  3U9M A;  3CWB H;  2P5O A;  3FAJ A;  4DW1 A;  1YIJ V;  1VQM V;  2ZKO A;  4FLW A;  5LXT A;  4DUZ O;  1SF8 A;  2DQ0 A;  1N32 B;  2P90 A;  2B1G A;  4Q7C A;  2Q9A A;  1JJ2 U;  2F23 A;  2YIB A;  5ITZ A;  3D36 C;  5LMN B;  1D2D A;  2HHH O;  2YDE A;  1LE2 A;  3TOM A;  1BMF G;  5CI9 A;  1I4Y A;  1SQX H;  1R3L C;  1V55 C;  3LNR A;  3E2E A;  4LDR A;  3L70 H;  5JVE A;  1DK1 A;  2KJG A;  2QEX V;  1GN4 A;  2H7V C;  2KNH A;  4FZ1 A;  1FXV A;  1NT2 B;  4IAO A;  2QWQ B;  2CTQ A;  3DM5 A;  1E85 A;  2R03 A;  1M2V B;  3MAQ A;  2XLH A;  4JGS A;  5L3D A;  1MG1 A;  4D7T A;  2HMQ A;  2DGJ A;  4JI1 O;  1BGY H;  2BCC H;  2QGN A;  1MMN A;  4CSA A;  2YL0 A;  4WFG A;  4LBE C;  4B3M O;  4JYA B;  1BQZ A;  1JAF A;  4YJ2 B;  4YJW A;  4FZ0 A;  3OM3 B;  1KNY A;  4KC9 A;  3EPV A;  1H9G A;  3SXZ A;  1H2L A;  3TK0 A;  1D1C A;  2CGN A;  5C8Y A;  2KQ9 A;  1N1C A;  1TFO B;  2CTP A;  5CA1 A;  4G7Z F;  3VQV A;  5KHJ A;  1CPR A;  2EPK X;  1L0L H;  4GEH A;  5KYN A;  4JYC A;  2R7S A;  1DGS A;  3SPH A;  1SQP H;  2DWD C;  1XNQ B;  3H1H H;  3H1K H;  4KUM A;  4WFB V;  3B40 A;  3O39 A;  1AJQ A;  2W45 A;  4GYC B;  1QBZ A;  1SKV A;  4JW1 A;  4F4L A;  2QWN B;  5A6K A;  4MVS A;  1Q0D A;  4XBF A;  4WFF A;  4TUY A;  2NSG A;  3L8I A;  4YHH O;  3RQG A;  2VCC A;  3LAY A;  4DR5 B;  3P3P A;  4IL6 Z;  3WG7 B;  3CRA A;  3RYH B;  4OIR F;  3SPC A;  4LF9 O;  1OCO C;  2YIA A;  1ENV A;  4BIO A;  3WB2 A;  4YJ3 A;  3RYI B;  1S72 V;  3SR2 C;  3WG7 C;  2WLI B;  4DR2 B;  3GM3 A;  4JZA A;  1ZVZ A;  3POV A;  4FLY A;  1N32 O;  4YT4 A;  3C3T A;  2IBZ H;  3FDQ A;  4J7T A;  1LE4 A;  3QF7 A;  2AP3 A;  5IJ9 A;  5IWA O;  3K9A A;  3SYO A;  4X64 O;  3SYA A;  4QE9 A;  3ZX6 A;  3ZTM A;  4KI2 A;  5BMV A;  2CCY A;  4K35 A;  4X66 O;  3CMA V;  1RJ9 B;  1VLS A;  4JI5 B;  3FD9 A;  3CCR V;  3S90 A;  2XTA A;  2HG5 C;  2EZP A;  1WP7 A;  4NXN O;  3KH2 A;  5JSL A;  3C7J A;  5A2Q N;  4E2L A;  3EHM A;  3V5X A;  1NR7 A;  4PDR A;  5LGU A;  4JF3 A;  4W4L A;  1JJO A;  1PD1 A;  4EHP A;  1IBM B;  2XND G;  4DUY O;  2A06 H;  4LNU A;  3S29 A;  5B1A B;  3EFO A;  3IGA C;  5KMG A;  4ZHQ B;  3K79 A;  2P7T C;  4EB6 B;  2AU5 A;  4BJ5 A;  4TV9 B;  5GW7 A;  5JWP A;  1VQ5 V;  3JAR A;  5COG A;  4PFO A;  2NNU A;  4BJ6 C;  1NVP B;  2Q4P A;  4CC6 A;  1DOV A;  4DV4 O;  1NI8 A;  1OR3 A;  4FFK A;  1IBM O;  2WA4 A;  3ABL C;  3RWR D;  4YL0 A;  1K9M W;  5BZB A;  1OCZ C;  2ODM A;  1LPE A;  3RF3 A;  2W6I G;  4DV3 B;  3DAF A;  1GS9 A;  2ITD C;  4MVR A;  2LW7 A;  2VWJ A;  2B1I A;  3KG2 A;  3IJ4 A;  3J81 N;  2NUP A;  5EC1 C;  4OIQ F;  3ASO C;  3C8G D;  5JVD B;  3PMR A;  1TKN A;  2QTV A;  2XL8 A;  3JAM N;  1AI4 A;  4X1Y B;  1UPG A;  1W2B U;  1S0V A;  2LK4 A;  4HEA J;  1LI5 A;  5KA6 A;  3K3W A;  4JI0 O;  2JEX A;  3R66 A;  5EBM C;  4I55 B;  2P6J A;  1ARO P;  1R3I C;  2D5R B;  1AR4 A;  4HE8 D;  1K92 A;  1QLE B;  3CRM A;  3I55 V;  2ZXW C;  2CH7 B;  4D6T H;  2YLG A;  4N4W A;  2M4E A;  3SYP A;  3EHN A;  3KPH A;  5EK0 A;  4CC5 A;  3APO A;  3BAB A;  4E0I A;  4AX2 A;  3LS0 A;  3FX7 A;  3EGD A;  2JS3 A;  1M57 B;  1Z5W A;  3RQE A;  3ZMU A;  2ILM A;  2R7R A;  3ZQV A;  3SEO A;  3TET A;  2WZG A;  3U8V A;  1APC A;  4JI6 B;  4IAR A;  4YHH B;  4MTG A;  1XUQ A;  5BMV B;  1F4M A;  4TQD A;  5DN6 G;  3SPJ A;  3AOU A;  3OEH G;  3GM2 A;  4P30 A;  4BW5 A;  2N05 A;  1Q0G A;  2Y3D A;  4G2K A;  2AZ0 A;  4PJ0 Z;  2UUA B;  4Z9J A;  2YUA A;  4FM1 A;  4LAC B;  3B9Q A;  4DRI B;  2G3V A;  1OZ0 A;  3N2K B;  2W9Y A;  3OWT A;  1FJG O;  1NVP D;  4NKG B;  1VQ8 V;  3F7Y C;  1NH2 B;  1QPU A;  4ASU G;  4PJL A;  3CC7 V;  3E22 B;  1VQK V;  1H2G A;  2OEX A;  1I5N A;  3GAN A;  4LDQ A;  1CEZ A;  2XLV A;  4O79 A;  3JAR B;  5FL7 G;  4JAU A;  4K0D A;  1WB7 A;  4OPH A;  3WHN A;  1UG7 A;  2GWW A;  1TGO A;  1ZU5 A;  2ZIN A;  2CE4 A;  5DS4 A;  3PJS K;  1GM5 A;  4OIO F;  3DGE A;  2GSM B;  3UGP A;  5B1N A;  3OMI B;  4B3R O;  4L8J A;  4FM2 A;  5L3B A;  2B0J A;  1N34 B;  3FKS G;  1M6T A;  4JVS A;  2A1D D;  2XXA A;  3NG1 A;  1OCC B;  1PL4 A;  1IXB A;  1XEQ A;  3D36 A;  5IY5 C;  3AG1 B;  4JI0 B;  1SZI A;  1H8H G;  1BS3 A;  4QIW F;  5BQH A;  4F6R A;  3JRT A;  4JZG A;  4KHP B;  1OKK D;  1BR1 A;  1H8E G;  3L1M A;  3MYI A;  4YN0 B;  2ZD9 A;  3C8G B;  1ROP A;  2ZIM A;  4ZIB A;  1I4Z A;  1T01 A;  2WB7 A;  3SXM A;  4FM0 A;  4K8X A;  1TWH A;  1Y6D A;  2YL3 A;  5IE9 A;  5TIS Z;  4JV5 B;  4G78 A;  1HNX O;  2ZE5 A;  3TCU A;  4U9E A;  4QI0 A;  3CJH A;  4KBL A;  2PF4 E;  2CW0 F;  4HAM A;  3LDD A;  2LW1 A;  3QVN A;  4UXN A;  1XWJ A;  1NQT A;  1TA8 A;  1G5Z A;  2W4B A;  4UCU A;  5D91 A;  3ZWI A;  3T4D A;  3E70 C;  1M4U A;  4F4B A;  2PYJ A;  1AVM A;  4DBQ A;  3U3B A;  4FLX A;  3WAQ A;  1N4C A;  3HKB B;  1PD0 A;  2BSK B;  1RKE B;  3MX3 A;  3I56 V;  3CRR A;  3FOO A;  1B04 A;  4PHZ A;  1RPO A;  2BTQ B;  4KL1 A;  2YXL A;  4UCT A;  5IT9 N;  3M4C A;  2O57 A;  2Y0P A;  2IXO A;  2QM4 A;  1WN7 A;  3BVO A;  4MVQ A;  2D3O W;  4P9T A;  5L3Q A;  1N36 O;  4AQY O;  4EB6 A;  4MQ9 F;  2P4V A;  3KZI Z;  3P3N A;  1Q81 W;  3BFR A;  4NB5 A;  1NZE A;  3U5S A;  2OCC C;  1KP2 A;  3AK3 A;  3JSL A;  3VAY A;  3HKC B;  1F7Y A;  2LQG A;  4AE4 A;  4MVM A;  1XBL A;  3BAA A;  5IJ0 A;  2WVO A;  4NTA A;  4JI8 O;  1KP3 A;  3JYC A;  1HDJ A;  1CGN A;  4X1K A;  4OGQ B;  2JPU A;  5L0C A;  4IB4 A;  4M63 A;  1JMK C;  3X1O A;  2HJM A;  4CIH A;  3SDL A;  4O6M A;  1K5S A;  1PD3 A;  1AUE A;  1E83 A;  2R02 A;  3LDC A;  1O3U A;  3C18 A;  3OEE G;  5CIV A;  5CA0 A;  1LUW A;  2P61 A;  4X0R A;  1SRY A;  4PA9 A;  3RGB A;  5B1B C;  4QGP A;  3E8F A;  2WLL A;  1Y66 A;  1SA0 B;  5IYC O;  3CE2 A;  4A5U B;  1KTM A;  2ZE7 A;  5KHH A;  2IOQ A;  1LKX A;  3B0P A;  2WSS G;  4LDK A;  2DJV A;  3W7U A;  5CB4 B;  3B09 A;  1K4D C;  1HW2 A;  2F4V O;  3LSQ A;  5JQG A;  1N34 O;  1OCO B;  2E76 B;  3JD0 A;  4DV2 O;  3G6B A;  2VWK A;  4IAQ A;  4OD4 A;  4NVP A;  2L6L A;  3UMI A;  2R72 A;  4JI7 B;  1EN6 A;  2Q0O C;  2CYD A;  2V4D A;  5L3C A;  3ZIB A;  3EGD B;  4MS2 A;  1W59 A;  2R05 A;  4LF8 O;  4PR9 A;  4JPR A;  5LOV A;  1T6U A;  4DV5 O;  5CI8 A;  1Z6A A;  4ULW A;  2VCB A;  3E8B A;  1P84 F;  3VOU A;  3MLG A;  1VAR A;  4RD9 A;  3JAL A;  5AC5 A;  1Y74 A;  2BC5 A;  4HZ3 A;  3APQ A;  4TQF A;  1XZQ A;  3VYW A;  1E84 A;  4DRJ B;  2CNW A;  2V1D A;  4UV9 A;  3GEE A;  1Y76 B;  2IXM A;  4O6N A;  2KG7 B;  3OAA G;  4DO2 A;  5CMU A;  1GM7 A;  1BHA A;  3STZ C;  3C90 A;  4NTB A;  3R65 A;  2OU6 A;  1GTO A;  4U7O A;  4UVA A;  4YL1 A;  2R70 A;  3CCU V;  3UR3 C;  2R9I A;  3MD0 A;  4P6I C;  4IIJ A;  4LF4 O;  4BJ1 A;  2PGG A;  4JI1 B;  4CH6 A;  3SYN A;  1VF7 A;  2Q7E A;  1SR2 A;  2W4M A;  2UXD B;  1T9K A;  1YVW A;  2LD6 A;  4HFF B;  2QM7 A;  4R50 A;  1PV0 A;  4R8C A;  2PI5 A;  4DK0 A;  1TAE A;  2FYU H;  3HTK C;  1B3Q A;  4J9Y B;  5K0I A;  2NR5 A;  5LMN O;  1BZ4 A;  2YI8 A;  2JGU A;  3K6B A;  4BW9 A;  1QCE A;  1UFB A;  1L8D A;  3K08 A;  2M64 A;  3W7W A;  3E9V A;  5IYD O;  5DQZ A;  4DRX A;  2WLL B;  4CS3 A;  1R3J C;  4MVO A;  2CDQ A;  3DXR A;  4LF5 O;  3DXJ F;  5H2F Z;  1IVS A;  1WA8 B;  1XIL A;  4KNW A;  3CEX A;  1Q6I A;  3S0X A;  3QW0 A;  2BE3 A;  4Z1M G;  2M7W A;  3T2M A;  1Q8I A;  2YLD A;  2JS5 A;  2ZIO A;  2O9X A;  4NCQ A;  1XOU A;  4FIP C;  3UT5 B;  4QDL A;  1YZC A;  3CC2 V;  3N2G A;  4J80 A;  3ZQY A;  4ZI7 A;  1MMG A;  4DV6 B;  1SZT A;  2Q7H A;  1AJP A;  1G4W R;  4O4L A;  2J9B A;  1B6Q A;  1FPO A;  1H2N A;  4ICG A;  3CRC A;  3HNK A;  3M15 A;  2AVK A;  2TMV P;  4NTX A;  3CSK A;  2D2C B;  2VQE B;  3ZHU A;  5T3T A;  2Q73 A;  4GQH A;  2CDY A;  2IXP A;  2Y3H A;  2VQE O;  2YKZ A;  4CH4 A;  1K3E A;  1J8Y F;  3H2V A;  2HFE C;  3RYF B;  1NFN A;  3K5O A;  1MA1 A;  1Z5Z A;  3BPZ A;  1LVK A;  4U3F H;  3JD3 A;  2EPO A;  4NXN B;  4XDJ A;  2FGY A;  2XLD A;  3LLK A;  3W4Y A;  1GM9 A;  2Q68 A;  4J7K A;  4HBN A;  5B3S B;  4XEK A;  4AL0 A;  4JC7 A;  1L1F A;  3US6 A;  4CDA A;  4PJJ A;  5IJ0 B;  4X1K B;  2W0F C;  3M79 A;  1PV3 A;  4R6Z A;  4CBC A;  3W2W A;  3TJT A;  2K1E A;  2ADP A;  3K57 A;  1A7D A;  1PNL A;  1RSO B;  4JEB A;  3AK1 A;  3CCJ V;  4CS4 A;  1D0X A;  2JRI A;  3U3F A;  1WNS A;  3JSN A;  1Y4C A;  2PP4 A;  2HS5 A;  3JAK B;  3TXS A;  5GON A;  1T6I A;  2Q9L A;  3Q7G A;  1RXQ A;  3G4Z A;  1SA0 A;  3NDB B;  4LF9 B;  4LF6 O;  4U5E E;  4CH5 A;  1S5L Z;  3G71 V;  4X65 O;  1OCR B;  1LUV A;  1Q43 A;  4DR5 O;  4BAY A;  2YVK A;  5IY5 B;  1Q0K A;  2IJH A;  3ZRX A;  1I94 O;  3UKM A;  4U5H A;  1Y4M A;  3ABL B;  2V26 A;  3T6G B;  2Q7G A;  4I5S A;  4DV1 O;  4RQE A;  2XLO A;  3K59 A;  2XSE A;  1KQS U;  1H7I A;  3NRH A;  5H6Q A;  3CYO A;  1YHQ V;  3QO8 A;  2R7Q A;  2Q7R A;  3P32 A;  2DE0 X;  4FJC C;  2L9J A;  4ZOL A;  3W2V A;  3H1J H;  3DAG A;  2JK5 C;  2XAF A;  3QZC A;  3GWO A;  2UUI A;  5GTH Z;  3MYF A;  1QHT A;  2HLD G;  5A6A A;  1VQL V;  1Y74 B;  2GHY A;  3SZR A;  3VQW A;  3RVZ A;  5B3S C;  1SQB H;  4GX0 A;  3HKE A;  4JTC B;  4OIP F;  3G6E V;  3B4S A;  4R32 A;  4LWS A;  5J2U B;  3EGX B;  4QI2 A;  2ETN A;  1HMD A;  2XM4 A;  2EIM C;  2WLK A;  3CCV V;  4JYA O;  5J2T B;  4I50 B;  1PL0 A;  3I5D A;  2RNB A;  1F51 A;  4ZLC A;  5JRA A;  2XXA B;  2L6G A;  2F22 A;  2ZM6 B;  5BQI A;  4WFA V;  4U5F E;  4FLZ A;  4CS7 A;  2YLI A;  5E79 Z;  4GKK B;  3ABK C;  1RKC A;  5JS5 A;  1D0Y A;  2L6H A;  3H1L H;  1VQN V;  2XS1 A;  2YSU B;  1E79 G;  2MYS A;  2XAS A;  1R6N A;  1XMQ O;  3ASN C;  3BCC H;  2GA0 A;  2HHH B;  2X6A A;  4LCU C;  4IWB A;  4L6R A;  4X62 O;  1XNR O;  3K1H A;  2HKO A;  1SYQ A;  2JJ2 G;  2ZR3 A;  3JAS B;  2UU9 O;  1R6T A;  3BEH A;  1Q7Y W;  5LP6 A;  3FXH A;  4EBJ A;  3T4Z A;  2GDC A;  2OOC A;  1EZJ A;  1M9N A;  3JYH A;  3D3I A;  4Z1V A;  4FX5 A;  3MBG A;  4JI8 B;  2UUC B;  3WB0 A;  2YQY A;  5HFL A;  3JCZ A;  3W7S A;  1GGQ A;  3K9S A;  2DB4 A;  2VH3 A;  3AG4 C;  2QLA A;  3IEE A;  2R7T A;  4UVB A;  1BHB A;  1OR2 A;  2XAG A;  4J30 B;  2Y48 A;  4H33 A;  1MZF A;  3VRC A;  3OMA B;  5ITZ B;  4C7O A;  2ATK C;  5LYJ B;  2BSK A;  4BG0 A;  3CCS V;  4ZI7 B;  1AI7 A;  4DUY B;  2P1A A;  3R7C A;  4YT2 A;  4O4L B;  3AG7 A;  1OXK A;  1YJN V;  1WJZ A;  1L3P A;  1JFF A;  1P7G A;  1WOL A;  2JEU A;  2XM0 A;  1VQO V;  2OJQ A;  1GQA A;  1HR0 B;  3K03 A;  4KFM A;  1HY5 A;  3UO3 A;  3AGU A;  5E33 A;  1YDI A;  2Y3B A;  4U3J B;  2Q9C A;  3ZMT A;  4MND A;  2QE9 A;  1Q3E A;  4UCV A;  2UUC O;  1OW8 A;  2UXX A;  2R7U A;  2BOC C;  1WPB A;  3RYF A;  1M2V A;  3K0G A;  4XPX A;  3E86 A;  5JJE B;  3OFN G;  1VOM A;  4PEL A;  4I4T A;  4C3E A;  2UU9 B;  4YY3 O;  1Q6H A;  1N33 B;  4N6H A;  5GTI Z;  3CCE V;  2DQ3 A;  5C8Y B;  4JV5 O;  5DM6 V;  2P0N A;  1EBO A;  1H2S B;  4DR7 B;  3BRC A;  4WBN A;  5LHH A;  1FKA O;  3HPL C;  3UQ8 A;  4TUY B;  1BCC H;  3O55 A;  4OPA A;  1FXK B;  4FAP B;  1T6Q A;  1TWA A;  3V5Z A;  2FTK A;  3C62 A;  3HJC A;  1IW7 F;  2WVQ A;  4XPW A;  3A0H Z;  3G50 A;  4LF7 B;  1MSD A;  4FLT A;  2IH1 C;  5H5N A;  4N06 A;  1QLN A;  4DV7 O;  4XDL A;  1EM1 A;  3QO5 A;  2R7W A;  3TOL A;  4E7S A;  1HMO A;  1H2M A;  1AJN A;  2R7X A;  3KCX A;  5E3A A;  2DN9 A;  1WPX A;  4PI2 A;  5F28 E;  3FAV B;  1IZM A;  2PFD A;  4Q20 A;  1HNW B;  3L0I A;  4YJ3 B;  3JAL B;  3BA9 A;  3H9V A;  4OX9 B;  3ABK B;  2AHY A;  3OR7 C;  2HVJ C;  4EFE A;  3SNH A;  5LP6 C;  1EZV H;  2J7P D;  4JI4 O;  4JJG A;  5D5Q A;  2UUA O;  4J32 B;  3KYI A;  3GOD A;  4I7Z B;  2QKA A;  3N27 A;  2YL1 A;  1FYJ A;  4LFC B;  1KYO F;  4BR6 A;  4B3M B;  2OIG A;  2RDC A;  4IIJ B;  1NBM G;  2QR4 A;  4XTK A;  1FNT c;  2B9Z A;  3CME V;  3EHB B;  3JAW A;  3ZMV A;  2WA3 A;  2AWC A;  2JVD A;  3EH2 A;  3NMJ A;  4JI6 O;  3UMH A;  2HR3 A;  3CP1 A;  1V9P A;  3THO A;  1HE1 A;  3HNI A;  4JI3 B;  4AL1 A;  4B3T B;  4X65 B;  1Q5O A;  4UCR A;  2YIB D;  2XT9 A;  1KBH A;  1NTK H;  3LES A;  3JSZ A;  1YXB A;  1EFR G;  2J0W A;  3NXS A;  2QJ1 A;  2X6C A;  3ZRV A;  3CHX A;  2LP4 A;  1JA8 A;  1I08 A;  1VQ9 V;  1G4U S;  3OD4 A;  3M1C B;  2ZNJ A;  2HV6 A;  1YEW A;  3C3S A;  4RUE A;  2DWE C;  5DEC A;  2PTM A;  3E83 A;  5LHG A;  4TV9 A;  2L81 A;  3ITF A;  2X0C A;  1LM3 B;  4H44 B;  4PJM A;  2MK3 A;  3RYL A;  1ZX3 A;  2WLM A;  1KUQ A;  3RT3 C;  3B8N A;  1TFK B;  1U97 A;  4LH6 A;  4IGG A;  4NTF A;  1TUB A;  1KMI Z;  2B5U A;  4K8Z A;  4PDL A;  2ZPA A;  1P49 A;  3F5W C;  5KYX B;  3H1I H;  1NBB A;  4JCZ A;  3FOP A;  3NMI A;  3HLZ A;  3VF0 A;  4J7J A;  2BTO A;  3JAS A;  1Z23 A;  3K5L A;  1NKD A;  4BIZ A;  4DK1 A;  1O9H A;  2QSA A;  3J80 N;  4B3S O;  3RYC A;  1LNQ A;  3JZ0 A;  4BJT A;  3Q6M A;  4JI3 O;  1QVX A;  2MHR A;  1ZLZ A;  1YCI A;  4Z2W A;  3OGC C;  1BR2 A;  3AJM A;  3T1H O;  3AG3 C;  3JCU Q;  2G62 A;  3BRJ A;  3ETQ A;  2FML A;  4JAS A;  2E87 A;  1SQG A;  2RJZ A;  2WL8 A;  1N0N A;  4OXS A;  2DYR C;  1VMA A;  4JAA A;  2PNO A;  4H4K C;  2F66 C;  1ZHY A;  4WGZ A;  4DRH B;  4Z9H A;  2XAJ A;  4IYI A;  1JMW A;  3CCL V;  4J10 A;  3OR6 C;  4JCH A;  3SXY A;  4IHJ A;  2OCC B;  4I55 A;  1LR1 A;  3UT5 A;  3ZSU A;  2GTA A;  4I9W A;  1T5E A;  2LP7 A;  2A3Q A;  3LUT B;  4WF9 V;  5KAI Z;  1YJW V;  3EJN A;  3DTU B;  3ETG A;  4QJF B;  1G8M A;  1ZHW A;  5EYP B;  3U2M A;  2UXC B;  1W0J G;  2OTJ V;  4JI5 O;  4DOZ A;  5EHH A;  2ITC C;  4JTD B;  1JPX A;  4X66 B;  2XLE A;  2EJ7 A;  4WGY A;  4G28 B;  5DS5 A;  1XZP A;  1VEW A;  4PA6 A;  2WZL A;  3X2Q B;  2J9U A;  4WJ0 A;  4GZR B;  3HNL A;  4UCS A;  1K34 A;  1Z63 A;  1V74 B;  1JCH A;  2J8W A;  1EKY A;  1E2X A;  1NU7 D;  4P9P A;  1THZ A;  3K5N A;  3Q6N A;  3N2K A;  1GN6 A;  1GKF A;  1VLT A;  1RMV A;  4LF7 O;  4UFZ A;  5KHK A;  3E8G A;  4DR3 B;  1FTS A;  1NSG B;  3U0C A;  3N0T A;  1VYI A;  1SER A;  2WWW A;  4TT3 G;  3LEO A;  3FFQ A;  2A9H A;  5EC2 C;  3OMN B;  1QZX A;  4JUR I;  2Z3Y A;  1YYJ A;  1QU7 A;  1GO3 F;  2E5L O;  2H3O A;  2A68 F;  1RP3 B;  4PD4 F;  3U8P A;  3DSQ A;  3E8H A;  5D5P A;  5LHI A;  1DLB A;  4G27 B;  1WAZ A;  2UUB B;  4EBB A;  4G0H A;  2EPN A;  3KKB A;  2VCA A;  5COM A;  5LXT B;  1IDS A;  3H01 A;  1LS1 A;  4RUF A;  1IZ3 A;  2F93 B;  1FFX A;  1HNZ B;  4O2A A;  1A7V A;  4JYB A;  1M5I A;  3VM6 A;  3RYC B;  5LA6 A;  2LFS A;  2QTO A;  2YL7 A;  4EFB A;  2P06 A;  5KUK A;  2FKX A;  1HR0 O;  1MZE A;  1MOF A;  4CZZ A;  4DV5 B;  2KSD A;  1NTZ H;  1LS4 A;  3HB3 B;  2ZE8 A;  3EVK A;  3O65 A;  1ORY A;  2HSB A;  4C3B A;  3LLI A;  2NUT A;  3DJU B;  4E18 A;  4I9Q A;  2CNW D;  3TD7 A;  1QQ3 A;  4DV2 B;  1X59 A;  1QVF U;  1YJG A;  4CS8 C;  2HMZ A;  4JI2 O;  3JAW B;  4PJN A;  2A0U A;  2NSF A;  1G8X A;  2UXB B;  1R3K C;  2LSE A;  2CUG A;  2WAM A;  5JH7 A;  2YI9 A;  3JRM O;  5KYY A;  3HKB A;  2Y0I A;  2X6B A;  3ZJZ A;  1C02 A;  1RKE A;  1YAU O;  3FYE B;  3FMS A;  2LO1 A;  5C93 A;  3GWL A;  4YK5 A;  1EN4 A;  4ANJ A;  4PA7 A;  3VQY A;  4HNA A;  3E89 A;  1M57 C;  4MSW C;  3ZHQ A;  5H6R A;  1FD9 A;  3KYJ A;  2DMX A;  3M4B A;  1XMQ B;  5AC4 A;  1R1B A;  3FB8 C;  2GV9 A;  1C03 A;  3V5Y A;  1H6G A;  1AB3 A;  1VYK A;  5BR8 O;  3ML0 A;  3KL4 A;  1TVK A;  2PUS A;  2YEV B;  4FK5 C;  4WFH A;  4AE4 B;  3RFY A;  4DJ9 A;  2XS8 A;  4O6Y A;  3IC7 A;  2EIL C;  2A69 F;  3K66 A;  2IJJ A;  3EZH A;  3ICX A;  2GBO A;  2ZM6 O;  1W0K G;  1U0B B;  4EUK B;  5BXZ A;  3K5M A;  1OW7 A;  4JI2 B;  2RSE B;  4DR4 B;  2ZE6 A;  4PI0 A;  1Y67 A;  3A11 A;  3IQ6 A;  4UVC A;  4AQY B;  1JVM A;  2OTL V;  4J41 A;  3JD1 A;  3B0U X;  2EIK C;  5LYJ A;  2ZNI A;  3JAT B;  4A2N B;  3RYI A;  4IRU A;  2QY9 A;  4XQ1 A;  4NXM O;  3ZTZ A;  2R9A A;  4IYH A;  4JAV A;  5A6B A;  3F5T A;  2Y69 C;  1BR4 A;  1FFX B;  3K7D A;  2A0B A;  2EPM X;  1RM1 B;  1R4T A;  3TJ5 A;  1H9T A;  1JQ0 A;  5F5H A;  2PBE A;  5JQG B;  1DF4 A;  3DM9 B;  2HV7 A;  5J9P C;  5A6J A;  5LMU O;  4BWA A;  1I0H A;  5A9G A;  1ZZP A;  2OEV A;  3ABU A;  1S3J A;  2GDS A;  1US6 A;  4U5C E;  4H37 A;  1P4R A;  5TJ5 E;  2H7O A;  2EUL A;  1NFO A;  4XLN F;  3EG9 A;  3FB5 C;  1WWP A;  4N21 A;  2M6Y A;  2L35 A;  3LNN A;  5IJ9 B;  4EBK A;  2GUZ A;  2PZS A;  1I94 B;  3S27 A;  1VQ4 V;  2E5L B;  5JLI A;  2YXH A;  1WTY A;  1D5A A;  4PA4 A;  4LNU B;  2VB6 A;  2DYS C;  2YIC A;  1YZB A;  2ZDI C;  3LNM B;  1ORS C;  2LFD A;  1JX9 A;  4MT8 A;  4LF6 B;  2V7Q G;  3NR7 A;  5D92 A;  5L0I A;  2H94 A;  3P30 A;  5AG2 A;  1K4C C;  4U3J A;  5T1D B;  2RQ6 A;  2EJR A;  3ABM C;  4K0K B;  4UB8 Z;  3T1Y O;  1OXB A;  1ZWI C;  1I5X A;  4X1I B;  5KX5 B;  4E17 A;  2EX3 A;  2GTS A;  2Z5U A;  1WAT A;  2JDI G;  2IYL D;  3A0R A;  2WZF A;  4B3R B;  1K04 A;  1MNG A;  4K0K O;  1NS1 A;  1RPR A;  1K73 W;  2R25 A;  1KD1 W;  2MW2 B;  2QWR B;  2F1M A;  3FVY A;  1K05 A;  1V54 C;  3Q4H B;  2EPL X;  4JYY A;  2CTR A;  4LH7 A;  1JR8 A;  3ZMZ A;  3RBZ A;  1UFI A;  1VK5 A;  3ZMS A;  3DZA A;  1V55 B;  1YAR O;  1G4Y B;  2UXN A;  4U5D E;  4BPM A;  4CH3 A;  2Y4T A;  1KKC A;  3G80 A;  5BY1 A;  1WN0 A;  3HNJ A;  5KYW A;  3ZN1 A;  4RO2 A;  1SQQ H;  5JCO C;  2X51 A;  3L74 H;  2HJ3 A;  4RQF A;  2X7R B;  5COF A;  3D8C A;  1GAX A;  1AEP A;  2C03 A;  2YRF A;  3AG2 B;  4D4N A;  3GB7 C;  1CGM E;  3N2G B;  2ZXW B;  4CJG A;  3S3W A;  2CH7 A;  4CIP A;  1YA7 O;  3MFN A;  2P22 C;  3A0B Z;  4HYO A;  2ZT9 B;  3CD6 V;  2N74 A;  4DV0 B;  1GMG A;  4DBR A;  3BA8 A;  1VQ6 V;  1VB5 A;  3ASN B;  3B77 A;  2Y4U A;  2AZ2 A;  2DYS B;  2G3K A;  3AGT A;  2KYH A;  1N8R W;  4L87 A;  4LLE A;  2J45 A;  4PDV A;  4DV6 O;  1D0Z A;  1SQF A;  3ZHS A;  2LCH A;  4RDA A;  1NR1 A;  4C7U A;  3ZIA G;  3CRQ A;  4DR4 O;  1BT8 A;  3T9O A;  4EIY A;  1GRJ A;  3UMK A;  2GUZ B;  3OW2 U;  1YF2 A;  3PCV A;  3ZRS A;  3QMK A;  3DD7 A;  1AI5 A;  3QO7 A;  1FFH A;  2YZS A;  1G1X B;  3CSX A;  4GKJ O;  3CXC U;  3F47 A;  4W4K A;  2IJK A;  3MHS C;  3G4S V;  2J0X A;  1ZW3 A;  1LI7 A;  1PKX A;  2R9R B;  4J9Z B;  1O5H A;  2ADQ B;  3EFF K;  3OUS A;  1CGO A;  5BQG A;  4JJF A;  1KU9 A;  4NY3 A;  5E3C A;  1XDC A;  1MMA A;  4DV3 O;  1PCX A;  2QUP A;  3JAK A;  4D4X A;  1TVK B;  3B29 A;  5EZY A;  1A41 A;  4JZ2 A;  3TK1 A;  1GK9 A;  2NLJ C;  5IYZ A;  4H13 B;  4TOI A;  4B3T O;  4YL3 A;  1FXH A;  1YVI A;  3IPM O;  4K1O A;  3B2E E;  4QNH B;  4LF4 B;  4F6R B;  1QKR A;  1ST6 A;  4LFC O;  4I1O B;  2HKV A;  4X20 B;  2J9V A;  1SF9 A;  1GM8 A;  3JAT A;  1ZL8 A;  3ZRW A;  1XI1 A;  1R73 A;  1Z2G A;  4TSF G;  4DR6 B;  1HW1 A;  1U89 A;  4JI4 B;  3N24 A;  3K1I A;  3V7O A;  3U11 A;  4XLP F;  1XL4 A;  2VQF B;  1YLM A;  1VIB A;  2L7A A;  3CJH B;  3RKO F;  1U6H A;  2LIG A;  5GON B;  3IFX A;  1ZHX A;  2Q0A A;  3BHP A;  2NPU A;  3CXH F;  1YI2 V;  2L6F A;  2P6V A;  4X89 A;  3C8G A;  2FAP B;  4YIO A;  5KHI A;  4XDK A;  3H2U A;  3O9O A;  2F95 B;  4D7S A;  5IWA B;  1S76 D;  3GEI A;  5A69 A;  2IU0 A;  3EH1 A;  1HE9 A;  3FYI B;  2W0X A;  3ZHV A;  2AXT Z;  2I8B A;  3EG9 B;  1CP9 A;  1FXK C;  4DVZ A;  4IT5 A;  1MNE A;  3L75 H;  1S5H C;  3A2F A;  2LFF A;  2VS0 A;  5CA1 B;  4ZOL B;  1Q0F A;  2ETS A;  2ZXO A;  3ZVR A;  2JX0 A;  4PA3 A;  1NG1 A;  4AK9 A;  3EZI A;  2EBO A;  4ZLD A;  5B5E Z;  1VMG A;  4DR7 O;  2PI4 A;  4YJ2 A;  4PAC A;  1ZAU A;  1H2K A;  5CN0 A;  3CCQ V;  2XLM A;  3DC6 A;  5J2T A;  3RQF A;  4WFE A;  4K3A A;  4YY3 B;  1DOW A;  2Y3G A;  2E3C A;  3HKD B;  1YTF B;  1OCR C;  2WLN A;  4O4H A;  5J2U A;  1F4N A;  1TUE B;  1K97 A;  3GVM A;  5LGN A;  3OTO B;  3ATP A;  5GPG B;  5LMU B;  5KUM A;  1Y6X A;  3Q4H A;  3NMK A;  4ZKI A;  1QLE C;  1AP6 A;  1MND A;  3ZCC A;  4UCO A;  2GFH A;  1A0B A;  2HEP A;  3K04 A;  3M8A A;  2WLI A;  5E1A C;  3T6B A;  4PK4 A;  3SPI A;  1I7F A;  3ABT A;  3TGU H;  2VQF O;  1BZK A;  4YWQ A;  2IW5 A;  1BBH A;  4O2B A;  4NXM B;  3R2P A;  2P4K A;  1IBK B;  4C7O B;  1O9G A;  5HSW A;  1ZU4 A;  2PX0 A;  1SQV H;  3SXK A;  3QG5 A;  4DVY P;  5L3V A;  4IJJ A;  1EI7 A;  2EIN B;  1R5I D;  1JPJ A;  4W8P A;  4CJO A;  3OA1 A;  5A6B D;  5FZT A;  4H0L B;  3IQC A;  5CB4 A;  5JH7 B;  3QVZ A;  4I44 A;  3W8I A;  3SJB C;  4BJ5 C;  4O4I A;  4LP8 A;  5L3E A;  4LFA B;  1L7C A;  3ZHR A;  1VQ7 V;  1YJ9 V;  4N23 A;  1Y76 A;  2LGW A;  1GH6 A;  2ASR A;  2OJE D;  4YIP A;  3EFO B;  2A6H F;  4I4T B;  4WCE V;  2K9P A;  5B1A C;  4DXW A;  1BDJ B;  2PY5 A;  2C2A A;  5KHG A;  1WP8 A;  1YA9 A;  4H54 A;  2OIE A;  4LFA O;  3SYC A;  4JKV A;  2YEV A;  2AHZ A;  3RN4 A;  4KHP O;  3ECS A;  3NYM A;  1JFF B;  1FFT C;  4KP4 A;  5KMG B;  2IJI A;  3EQL F;  1ZSP A;  3K33 A;  1V4A A;  3I5Q A;  1FXK A;  1F23 A;  5L0G A;  2LGQ A;  1CPY A;  1MQV A;  2XL6 A;  4P2Z A;  1S5J A;  5CBH A;  4W8K A;  3IQT A;  2OKU A;  3GEH A;  4QPJ A;  4CS8 A;  1M93 A;  5JUA A;  4B7K A;  2FL4 A;  2Z0A A;  3K06 A;  3B8M A;  2JJ1 G;  1IBK O;  5DS6 A;  5H9C A;  3LSU A;  1FAP B;  4OIN F;  2LJ2 A;  2CK3 G;  1HP8 A;  4DRX B;  3RH3 A;  3RFR A;  2WLJ A;  2YID A;  3L72 H;  5LL6 Y;  3DXR B;  4X8A A;  5LGT A;  2EIN C;  3I5P A;  1OHH G;  1S7Z A;  2Q69 A;  256B A;  4MW8 A;  3JT1 A;  3LDE A;  1IBL B;  3B0V C;  1Q6U A;  1BQ0 A;  2NUP B;  4AI8 A;  5FPR A;  3ZHT A;  5HV9 A;  4TWK A;  1IXM A;  5LBQ A;  4KNV A;  4ABM A;  1Z3I X;  3JYY A;  3GOR A;  3AQC A;  3SJC C;  4NTW A;  3MDS A;  4MTX A;  3DWW A;  2Q8V A;  1MMD A;  4MVU A;  5L3F A;  2JGD A;  5FNV A;  1YTF D;  1SS3 A;  3OUF A;  3CS5 A;  1XMO B;  3NYJ A;  4GX5 A;  5CBF A;  2ZCE A;  4DR3 O;  4J7Y A;  3L34 A;  1COW G;  2C04 A;  2HSQ A;  1JR9 A;  5EIB D;  4NC3 A;  3A9C A;  3SGI A;  3T1Y B;  1NJI W;  3M99 B;  3LS1 A;  5JJN B;  4E4E A;  3DKA A;  1A7E A;  4EEQ A;  1XMO O;  5JJJ B;  1E1R G;  1AP5 A;  4FMT A;  2ZXP A;  1ZHT A;  2PYL A;  5CBG A;  4N6C A;  3ETD A;  2HUJ A;  4GUN A;  3ZBH A;  2BE5 F;  5JT4 A;  2UXC O;  4FVM A;  3E22 A;  4FLU A;  1I5Y A;  1D1B A;  2H8A A;  2HP8 A;  2QE7 G;  2CAZ C;  2Q00 A;  3G4X A;  3L8J A;  4B7E A;  3GWN A;  4R7C A;  5KX5 A;  4DR6 O;  3T1C A;  5AGF A;  4FPP A;  2J9W A;  1OCC C;  3W7T A;  5JP7 A;  4A4A A;  2DOS A;  2F43 G;  1PPJ H;  3DC5 A;  3F7V C;  2EIJ B;  2IU3 A;  3JD2 A;  2OYQ A;  3SJA C;  2HJD A;  3DJN B;  5L3G A;  3JTL O;  3CAX A;  3G67 A;  3T1H B;  3CEI A;  3WB1 A;  1K8A W;  3SP1 A;  3TJ6 A;  2P7V A;  2VC9 A;  3DE9 A;  5DED A;  1ZHZ A;  4O4J B;  1Z7Q c;  3AQB A;  3ASO B;  3L73 H;  3B71 A;  2EIJ C;  1M56 C;  4LC1 A;  5EBL C;  4B3S B;  2R7V A;  1WB8 A;  3L71 H;  2RD9 A;  4OD5 A;  2BL2 A;  1MAB G;  4QE7 A;  1FAF A;  4I0X A;  3JSE O;  1NZ6 A;  1VP7 A;  4ZBM A;  1X4T A;  4MVZ A;  3Q7L A;  2QWP B;  5JCO A;  1V54 B;  2IM8 A;  1J8M F;  2LFR A;  3SYQ A;  1HW7 A;  1QNM A;  1OQC A;  1Q0M A;  1OCZ B;  1QR9 A;  2I15 A;  2IM9 A;  4X64 B;  5IDJ A;  2RMK B;  4XEV A;  1KKD A;  1P7B A;  1S77 D;  4AHC A;  3DE8 A;  5EBW C;  2JGD B;  2Q3T A;  5BR8 B;  3NYL A;  1TWC A;  2CGE A;  3UCS C;  3NKE A; 
#chains in the Genus database with same CATH homology
 3QZC A;  3CQZ A;  1W2W A;  2M6Y A;  1RJ9 B;  2J46 A;  4C3D A;  3T4R A;  2GUZ A;  3S27 A;  1TR2 A;  3KH2 A;  2VB6 A;  3UNG C;  2DYS C;  4CBE A;  3SZR A;  2H7B A;  3EHM A;  5B3S C;  1PD1 A;  5D92 A;  4OIP F;  4I3M A;  3S29 A;  5T1D B;  3EFO A;  3ZC4 A;  3EGX B;  3ABM C;  4QI2 A;  3UGO A;  5FCL A;  2EIM C;  4EWC A;  4BJ5 A;  3LJB A;  5KYU A;  2IYL D;  2WZF A;  4ZLC A;  2XXA B;  3EGX A;  1SMY F;  4PFO A;  4BJ6 C;  2N04 A;  2VAS A;  4U5F E;  4CS7 A;  2QWR B;  3FVY A;  1FMW A;  1V54 C;  3ABL C;  4LER A;  3ABK C;  1OCZ C;  4I1M A;  1D0Y A;  2CTR A;  3DAF A;  1OKK A;  2MYS A;  1VK5 A;  3ASN C;  2NUP A;  3DZA A;  4OIQ F;  3FHD A;  4IWB A;  3ASO C;  3K1H A;  4U5D E;  2Y4T A;  3PMR A;  5KYW A;  2KGO A;  2X51 A;  1TKN A;  2QTV A;  2C03 A;  4HEA J;  3JYH A;  4FX5 A;  5DVW A;  2VH3 A;  2D5R B;  3AG4 C;  3KMI A;  3IEE A;  4HE8 D;  2R7T A;  2Q9B A;  2ZXW C;  4J30 B;  2M4E A;  4DBR A;  3EHN A;  4C7O A;  2Y4U A;  4LLC A;  3APO A;  4BG0 A;  3W8H A;  2G3K A;  4AX2 A;  3LS0 A;  3EGD A;  4YT2 A;  4LLE A;  4K7B A;  2J45 A;  3AG7 A;  4FWV A;  1D0Z A;  2NUT B;  1WJZ A;  5KYY B;  3SEO A;  2R7R A;  2WZG A;  4RDA A;  2Y39 A;  3UO3 A;  5E33 A;  4RWU A;  2Y3B A;  4BJ6 A;  2Q9C A;  3UMK A;  2GUZ B;  4MND A;  4BEJ A;  2R7U A;  2N05 A;  2OCH A;  1M2V A;  3DD7 A;  3DMD A;  2Y3D A;  3QMK A;  1FFH A;  2YZS A;  3F47 A;  2YUA A;  1VOM A;  4LAC B;  3B9Q A;  4C3E A;  2G3V A;  2J0X A;  5BUO A;  2W9Y A;  3OWT A;  1RJ9 A;  1O5H A;  3AG1 C;  2XRH A;  4Q4Z F;  1IUR A;  4JJF A;  4PJL A;  1FMV A;  4NY3 A;  5E3C A;  1MMA A;  1PCX A;  3GAN A;  2R7O A;  4O79 A;  4E7Z A;  4HFK B;  4K0D A;  1TWA A;  3HJC A;  1IW7 F;  1ZU5 A;  2IXN A;  5DS4 A;  2WVQ A;  4OIO F;  5DLJ A;  1NU9 C;  3UGP A;  2B0J A;  5F5F A;  4JVS A;  3RIP A;  2A1D D;  2XXA A;  3AG2 C;  1ST6 A;  4CS9 C;  4I1O B;  3NG1 A;  4N06 A;  5IY5 C;  2J9V A;  1SZI A;  1ZYR F;  4U5B E;  4Q5S F;  1TWG A;  3N24 A;  3JRT A;  2R7W A;  1OKK D;  4E7S A;  3V7O A;  1BR1 A;  2R7X A;  2WVN A;  4XLP F;  5E3A A;  2DN9 A;  4YN0 B;  5E2Q A;  3RKO F;  1KU2 A;  2WB7 A;  1IZM A;  1TWH A;  1ZHX A;  2PFD A;  2OG2 A;  3L0I A;  3K1I C;  3SNH A;  2P6V A;  4QI0 A;  3H65 A;  2J7P D;  4KBL A;  2PF4 E;  4JJG A;  2CW0 F;  5EGY A;  2Z15 A;  4J32 B;  3S28 A;  3GOD A;  4KI2 A;  3EH1 A;  4J7Z A;  4B6I A;  2I8B A;  2W4B A;  3CZ6 A;  3EG9 B;  5D91 A;  3E70 C;  4DVZ A;  4XTK A;  4F4B A;  4IT5 A;  3EH2 A;  1MNE A;  3X2Q C;  3UMH A;  3F46 A;  4DBQ A;  1N4C A;  1PD0 A;  3MX3 A;  3LES A;  3JSZ A;  2J0W A;  2ZXO A;  3ZVR A;  4CSA C;  1NG1 A;  2IXO A;  4AK9 A;  3EZI A;  3BVO A;  4ZLD A;  5L3Q A;  2KW3 C;  3T6J A;  3M1C B;  4MQ9 F;  2HV6 A;  5KYU B;  1NZE A;  3VAY A;  2OCC C;  2A6E F;  2L81 A;  4YT5 A;  4AE4 A;  3UO2 A;  2Y3G A;  1XBL A;  3ITF A;  2WVO A;  1D1A A;  1HDJ A;  1OCR C;  4PJM A;  4M63 A;  3X1O A;  3RYL A;  4CIH A;  4G7H F;  4O6M A;  1O87 A;  5KYX A;  2MWQ A;  1QLE C;  2JD3 A;  4X0R A;  1WGW A;  2FFH A;  1MND A;  4PFP A;  5T3W A;  2ZPA A;  2GFH A;  5KYX B;  5B1B C;  3T6B A;  3HLZ A;  4PK4 A;  4RBN A;  2J7P A;  1Z23 A;  4YWQ A;  2QSA A;  4C7O B;  2IOQ A;  4BJT A;  3OEO A;  4YT8 A;  1LKX A;  3B0P A;  3Q6M A;  5HSW A;  1ZU4 A;  2PX0 A;  4DVY P;  5L3V A;  3JCU Q;  1BR2 A;  4IJJ A;  3AG3 C;  4FES A;  2G62 A;  5KYW B;  4CS9 A;  1JPJ A;  2WL8 A;  2E87 A;  3OA1 A;  4H4K C;  4O7G A;  1VMA A;  2DYR C;  3PHF 2;  4OD4 A;  1ZHY A;  2L6L A;  3UMI A;  1JPN A;  5DQT A;  4JCH A;  4GYT A;  2YS8 A;  3N2Z B;  4I44 A;  3ZIB A;  3W8I A;  3EGD B;  3I4U A;  3ZSU A;  4BJ5 C;  3EJN A;  5CI8 A;  2KQX A;  1Z6A A;  2LGW A;  1GH6 A;  2PX3 A;  3NKD A;  4ULW A;  1ZHW A;  3EFO B;  2A6H F;  4G7O F;  4XWJ A;  3MLG A;  5B1A C;  4RD9 A;  4DOZ A;  5EHH A;  3ZG1 A;  3APQ A;  3VYW A;  4U5G A;  2CNW A;  4O6N A;  2EJ7 A;  2IXM A;  2YEV A;  5DS5 A;  3ECS A;  3NYM A;  2CTW A;  2WZL A;  2J9U A;  1FFT C;  2YHS A;  3LEV A;  4WJ0 A;  3EQL F;  3K33 A;  1Z63 A;  3WOD F;  3I5Q A;  3UR3 C;  1NU7 D;  4P6I C;  3Q6N A;  4BJ1 A;  4W8K A;  3SYN A;  4CS8 A;  1FTS A;  3W2V A;  2XL4 A;  2W4M A;  2ZXR A;  1VYI A;  3N0T A;  4HFF B;  4JUR I;  1QZX A;  5DS6 A;  2V3C C;  3HTK C;  4OIN F;  2A68 F;  3O6X A;  3RH3 A;  2QWO B;  3K6B A;  2EIN C;  3I5P A;  4G0H A;  4EBB A;  3KKB A;  1S7Z A;  2NG1 A;  3E9V A;  3JT1 A;  1LS1 A;  5DQZ A;  3B0V C;  1M2O A;  2CDQ A;  3DXJ F;  1BQ0 A;  2NUP B;  3FAJ A;  4KNW A;  3S0X A;  1SF8 A;  4Q7C A;  2Q9A A;  2O9X A;  1Z3I X;  4KNV A;  3AQC A;  4QDL A;  5CI9 A;  1V55 C;  3LNR A;  4J80 A;  1MMD A;  1MMG A;  2KJG A;  2H7V C;  2KNH A;  4C3B A;  3LLI A;  2NUT A;  3DJU B;  4IAO A;  2QWQ B;  2CTQ A;  1FPO A;  3DM5 A;  3NYJ A;  2CNW D;  1M2V B;  3TD7 A;  3L34 A;  3CSK A;  2C04 A;  2DGJ A;  5T3T A;  4CS8 C;  1MMN A;  2IXP A;  4CSA A;  2Y3H A;  1BQZ A;  4PJN A;  4YJW A;  1G8X A;  1J8Y F;  3LS1 A;  2LSE A;  2CUG A;  5KYY A;  4KC9 A;  3EPV A;  1D1C A;  1Z5Z A;  2LO1 A;  1LVK A;  4ANJ A;  2ZXP A;  2KQ9 A;  1M57 C;  1ZHT A;  1N1C A;  2CTP A;  2BE5 F;  2FGY A;  4G7Z F;  3LLK A;  2DMX A;  1D1B A;  4GEH A;  5KYN A;  1VYK A;  4PJJ A;  2R7S A;  3KL4 A;  4AE4 B;  3RFY A;  4O6Y A;  3O39 A;  2EIL C;  1OCC C;  2A69 F;  2J9W A;  3W2W A;  3K66 A;  3EZH A;  2W45 A;  4JW1 A;  2QWN B;  1D0X A;  3DJN B;  2PP4 A;  3SP1 A;  2P7V A;  3LAY A;  1ZHZ A;  3Q7G A;  3B0U X;  3AQB A;  2EIK C;  2EIJ C;  4OIR F;  4A2N B;  1M56 C;  4IRU A;  2QY9 A;  3NDB B;  2R7V A;  4U5E E;  1OCO C;  4OD5 A;  2Y69 C;  1BR4 A;  3K7D A;  1FAF A;  1NZ6 A;  3WG7 C;  4JZA A;  4U5H A;  3Q7L A;  2QWP B;  3POV A;  1J8M F;  2V26 A;  5F5H A;  4YT4 A;  3FDQ A;  3DM9 B;  2XSE A;  2HV7 A;  3NRH A;  2R7Q A;  4U5C E;  2H7O A;  2Q3T A;  3NYL A;  2L9J A;  4XLN F;  1TWC A;  2CGE A;  3EG9 A;  3DAG A;  3UCS C;  3NKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...