2PF4E

Crystal structure of the full-length simian virus 40 small t antigen complexed with the protein phosphatase 2a aalpha subunit
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
172
structure length
163
Chain Sequence
MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWASSLNPGVDAIYCKQWPECVKKMSTNCICLLCLLRMKHENRKLYRKDPLVWVDCYCFDCFRMWFGLDLCEGTLLLWCDIIGQTTYRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of PP2A inhibition by small t antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase regulator/viral protein
molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
total genus 40
structure length 163
sequence length 172
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02380 Papo_T_antigen T-antigen specific domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2pf4E01
1.20.120.1860 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2pf4E02
2QWRB 1WJZA 2N04A 2M6YA 2CTPA 2CUGA 2PF4E 2CTQA 3UO2A 2GUZB 2Y4UA 2QWOB 2DMXA 2QWQB 2CTRA 1FPOA 2LGWA 1NZ6A 2GUZA 2Y4TA 1BQ0A 1GH6A 2OCHA 2CTWA 2DN9A 1IURA 1XBLA 2N05A 2QWNB 2L6LA 3UO3A 1FAFA 3APOA 2YUAA 1BQZA 4J7ZA 4RWUA 2LO1A 1HDJA 3APQA 2EJ7A 4J80A 3AG7A 3BVOA 2QWPB 2YS8A 1N4CA 4IT5A 2QSAA 3UCSC 2KQXA
chains in the Genus database with same CATH superfamily
4X1YA 4PJNA 3B4SA 3IPMO 1HNWO 1Q3EA 4CS9A 4DJ9A 3RBZA 1HNZB 2EIKB 2Y4UA 2D3OW 2NLJC 1ZU4A 3MX3A 5TISZ 2P1AA 3BRCA 4CS3A 1S5HC 4FPPA 5JS5A 2HP8A 3JD3A 1HR0B 4AI8A 4DUYO 5B1BC 1ORSC 3AG1B 2OCCB 4TUYB 2DWEC 1C02A 1R1BA 3APQA 4WFFA 4K3AA 1ORJA 3JD0A 3L75H 2UXCB 4GKJO 2DYSC 5IE9A 1WGWA 2FMLA 3OGIB 2YL0A 1K34A 4DV3B 3AG3C 3NYJA 3QW0A 1M2OA 3CQZA 3L0IA 3K0DA 1FTSA 2YLDA 1YARO 3N2KA 1BQ0A 3LSSA 4E2LA 2LP4A 3CCVV 2D2CB 1AJNA 5JLIA 2A0LA 1C17M 3HKCA 1VQOV 4I0XB 3I4UA 3OMIB 4X9QA 4NB5A 5GTIZ 3TK0A 1VQ8V 4RO2A 2OJED 4IJJA 1P7BA 4FIPC 3EHNA 1FJGO 5BUOA 3HKDA 1US6A 2D4UA 2ZIOA 4U7OA 3GORA 4GYTA 2KGOA 4EFBA 1H38A 1BS3A 2HKOA 2GHYA 3FAVA 3JRMO 1NR1A 2OYQA 3S90A 5KUMA 2HVKC 3LDDA 2ZE8A 2HHHB 1LI5A 4LF5O 3LAYA 4O7GA 3QTCA 4AX2A 3T1YB 2KJGA 2ILMA 2ZPAA 4UCTA 1QU7A 4P9OA 5JCOA 1NLXA 1YITV 3CE2A 2Q6AA 4Q4ZF 3DXRB 3WAQA 4CDYA 5EBWC 1VQ4V 1QR8A 4DR1B 1YJGA 3L70H 4E18A 3CD6V 3JYYA 4LDKA 2Q7EA 5EBMC 1J95A 2WVQA 2EINB 5CMUA 2ETSA 4WJ0A 3C3SA 2V4DA 5DVWA 4O4IB 1AB3A 2JDIG 4HE8D 2WLNA 3JYCA 2Q3TA 4JCHA 4KP4A 2KQ9A 4FZ0A 1O9GA 1MSWD 3S29A 2A0UA 2AHZA 4DV7B 2ZNIA 5EGYA 4LWSA 1JAFA 5K1PA 3W7XA 4DV5O 1U0BB 4W4KA 1MMDA 4N4WA 2L7AA 2YXYA 2HS5A 3MYIA 4JI8B 4EWCA 2LJ2A 5KMGB 1LM3B 2CTQA 4NC3A 2HEPA 1GN6A 1LPEA 2J9UA 1OCRB 2OIEA 2FYUH 2XTAA 4Q5SF 4JI6B 4LF5B 4I4TB 4O6NA 1FXKA 3SZRA 4PI0A 1BZKA 4IAQA 2P0NA 3O10A 4J7ZA 3VBBA 1I5NA 1HDJA 3S9OA 1TQGA 3LSUA 1EBOA 4DR3O 5FCLA 1A0BA 5J2UB 3DC6A 1HWYA 3K3WA 5AC5A 5A6BA 5A6JA 2NUPB 2W4MA 2AWCA 1A7DA 1R73A 4BIUA 4O4JA 1S3JA 4ER9A 4YIOA 2V7QG 1GM8A 2ZDIC 4KFMA 5D5QA 3G71V 1M56C 2L6HA 2G3VA 3PMRA 1NZ6A 3OGCC 3ABKC 1X4TA 3CXHF 4ZI7B 3W8IA 3DGEA 1DF5A 4O4HB 3EZHA 1M4UA 1G8MA 2YUAA 1J8YF 2O9XA 4PELA 2A9HA 3Q6MA 3W8HA 4ICGA 3UGOA 3W4YA 3N2ZB 1DOWA 1OCCB 4TV8A 2ZD9A 4LF4O 4I55B 4JYBA 3JRTA 4E7ZA 3TJ5A 4P9TA 3P32A 4MW3A 4JJFA 1H9TA 1NS1A 3JATB 4NXNB 1YIJV 1RJ9B 4X65B 4XEKA 2DYRB 3N2GB 1U96A 2YIBD 3P3NA 4DV2B 1EZVH 2Q69A 4IB4A 4BIZA 3IFXA 1CP9A 4B3TB 1GGQA 3G67A 3KKBA 2AXTZ 2UUAB 1KU2A 2CCYA 2EIMB 2XXAB 2NNUA 5AGFA 3IEEA 2QTVA 4X8AA 4DR6O 1H8HG 3QVYA 3GM3A 1EZJA 3CMAV 3FOPA 4KHPB 2Q0AA 1EN4A 1I08A 4ZIBA 3LNRA 5BQGA 2HKVA 1FFXB 2LIGA 1VB5A 1NSGB 1A7VA 1SKVA 5JJNB 5LYJB 1IDSA 1Q43A 1VARA 3JAKB 1N33B 4CSAC 1O9HA 4YJWA 4I55A 5L0DA 2J9BA 1AP6A 3O65A 4ZI7A 2UXDO 1FAFA 3ZHVA 3K03A 4WBNA 2CH7B 4EIYA 4LERA 3F5WC 5IJ0B 4IAOA 4KL1A 4MQ9F 5KMGA 4ONSA 5L0GA 5B1BB 3KZIZ 2JGUA 5CB4A 4O4JB 4HYOA 1M56B 5EBLC 3RKOF 2QWRB 3OUFA 3KPHA 4TQDA 3V5ZA 1XHZA 4XLNF 3FFQA 4LF9O 4CC5A 1NH2D 5JVEA 1H8EG 3CCJV 1G1XB 1Z5WA 1KKDA 2PNOA 1PPJH 1V55C 2GWWA 1VF7A 4H33A 4R6ZA 4DV1B 5JRAA 2QKCA 2QM7A 2QLAA 4K0KB 4HNAA 1MSDA 4GX5A 1PKXA 3ZSUA 2CK3G 3OMAB 3THOA 3DKAA 1VMAA 5LA6A 1NZEA 2YICA 2B5UA 2D5RB 3CHXA 2N04A 5AG2A 1SQXH 2CTPA 2Q67A 1JOYA 2QWOB 2X0LA 5J9PC 2HVJC 4GKJB 2YWAA 4ZLCA 4X1IB 1M2VB 1RJ9A 2XAHA 3ML0A 5B5EZ 1ZHZA 1R3JC 2E75B 3J7AU 2JVDA 2UXBB 2WZFA 2HSBA 3HKBA 3DAFA 2ZNJA 2ARHA 2A69F 2VS0A 4TV8B 3CCRV 3KL4A 3X2QC 4CS4A 2VQEO 2EINC 1T6UA 3BA8A 4JI1O 3HKDB 4FLWA 2XLWA 1NT2B 1SMYF 2GDSA 3HPLC 1F4NA 5DM6V 3G6EV 2BCCH 1G8XA 3K7DA 2LD6A 3F5TA 5L0CA 4HAMA 3GWKC 1VQNV 3M4CA 4BJ6A 1W0KG 2XLDA 2DN9A 2P4KA 2YKZA 3R65A 2BSKB 2F4VO 2B0JA 3NYLA 3I55V 3BFRA 2JEUA 2OEVA 2F43G 2DB4A 1BZ4A 1PD1A 3RH3A 1QLEB 1Y66A 2Q00A 4OD4A 3U3FA 1WATA 1BT8A 1ORYA 1IBKB 3JCUQ 5IYDO 4U5GA 3J80N 2XLHA 2WLKA 4LNUB 5K0IA 1E85A 4X62O 2RSEB 4WFHA 5DS4A 3ZEDA 1SR2A 3ZN1A 1ZX3A 4CH5A 4KUMA 1VQ5V 3O55A 4GCZA 2XLVA 5KX5A 3TJ6A 4YL1A 1K4DC 4PR9A 2OT5A 4J42A 4TQFA 3VM6A 1XUQA 3N24A 2CDQA 5LP6C 3KG2A 1FXKC 5B3SC 2VQFO 3B0UX 4IWBA 4Z9JA 1HP8A 3OM3B 2XLMA 1VMGA 2XL8A 4N6CA 3AG3B 1K97A 2AZ2A 1AI4A 3HNLA 2R25A 4FM1A 1S5LZ 1PNLA 1TUEB 3T6BA 3L8IA 2ZM6B 4DV5B 3ZQYA 3HLZA 1H6GA 2Q5ZA 2ATKC 2YRFA 3GEHA 4D7SA 3B77A 3LESA 3JSEO 1M93A 4GX1A 2F4VB 4G0HA 3NG1A 3HKBB 2NG1A 4UV9A 1BGYH 1UFIA 4FLYA 3FYEB 3U3BA 4G2KA 4JYAO 5KHIA 1Y74B 3OW2U 2J0XA 3NKEA 1LS4A 2YZSA 1N36O 2K1EA 2GA0A 2LW1A 2QM8A 5HFMA 1L7CA 4QIWF 4DW1A 1G6UA 2QA4V 3RIPA 1F1MA 1AR5A 3E8FA 3PJSK 4CH3A 3WG7B 5JT4A 2LQGA 3MHHC 4DUZO 1GAXA 2JD3A 3B29A 3VQWA 2N05A 3KH2A 1L0LH 1QPUA 3W7WA 4BIOA 2IU3A 3R2PA 3IAYA 1KD1W 1ZLZA 4LF8O 3SYNA 2E5LO 4OPAA 3K5NA 3M99B 1D5NA 3LDCA 2DWDC 5BXZA 4JI2B 3B0PA 4DV7O 4B3RB 2YLIA 4YJ2B 1NVPB 1ZW3A 4BG0A 1JCHA 3CPWU 2WB7A 1VQKV 4K0DA 1I0HA 1UFBA 2YXHA 4QPJA 1PL0A 2YXLA 4TV9B 2VWJA 5E2QA 1IBMB 3HKKA 2UUIA 3RYLA 3GWNA 2Z15A 1H2NA 1K5QA 4GUNA 2P06A 5HSWA 4CSAA 1L0NH 1ZW2A 4X65O 2ADPA 2F23A 3A8TA 1IXBA 3E8GA 3IC9A 3QVNA 1GM7A 2XSEA 2KQXA 4JYCA 2XM4A 2GSMB 2JJ2G 5GPGB 2BOCC 3K0GA 4LDRA 2ZR3A 1D1CA 5CB4B 4ZKIA 5JVDB 3US6A 3C3TA 3CCSV 4CX9A 3FX7A 5IWAO 1BR1A 2KNHA 2HJMA 4FX5A 2YVKA 4JI5B 4O6MA 2QM4A 1VYIA 1GM5A 3EXAA 3GB7C 4DV3O 3N27A 3EZIA 5LOVB 4F4LA 2R7UA 1NU9C 4LLEA 3HNKA 4IT5A 4A4AA 1Q0MA 4LF7B 1CEZA 3DD7A 5H5NA 4IHJB 3AK3A 3D8CA 1IBMO 4MVRA 2Y69C 4B08A 3EJNA 4C7OA 2XS8A 1CXZB 4DRXA 4IRUA 5KYUA 2IXOA 3ETQA 4E4EA 3SYAA 1S7ZA 4X89A 2R05A 4EUKB 5E3CA 1Q6IA 4GYCB 3B71A 1GKFA 1QVXA 5LP6A 2RJZA 2RN9A 4JYYA 1XQ8A 4EEQA 4XPYA 4KHPO 1BHBA 2HHHO 3B2EE 4GT1A 4I9QA 4OXSA 4FMTA 1JMWA 1D0ZA 1N33O 4FM0A 5KAFZ 1G4YB 3LDEA 3TOLA 2VRZA 1EFRG 1KP3A 5IYBO 4O2BB 2AP3A 1OKKD 2GTAA 2CGNA 2QUPA 2UXBO 3Q7LA 4DO2A 3GODA 4AE4A 3VRCA 2HJ3A 2BOBC 4YN0B 2M6YA 2IU0A 2B9ZA 2R70A 2PI5A 1YZAA 4NTAA 3QO8A 1WN0A 2Q9LA 2CTRA 3GVMA 1YDIA 2WZGA 1K5SA 1AP5A 4AILC 2PUSA 5TJ5E 2UUHA 1HNXO 1APCA 4CJGA 3T2MA 5DS6A 4RWUA 2OWOA 4YJ3B 4LDQA 4H37A 4JI8O 2C03A 3S0XA 2DQ0A 2ZE7A 5EIBC 5DQZA 1PD0A 3TGUH 4MTFA 3HKCB 5IY5B 1ZYRF 4PI2A 3E8BA 1B06A 1V54B 3V5XA 2W6JG 4LNUA 5DECA 3DWWA 1K7DA 3V7OA 4FFBB 2LFDA 4JEAA 2LCHA 2Q7HA 2BE3A 5JWPA 1NTMH 5C8YB 4YT2A 4O2AA 2A0BA 4ZOLB 1OXKA 3SXZA 3CYOA 3TXQA 4I44A 3P30A 1BQZA 1SZXA 1XNQO 1D1BA 1YF2A 4DV4O 4RQEA 2BTOA 2YIDA 5L3EA 2IM8A 3AQCA 4JPRA 4IYHA 3FB8C 4PDMA 5FPOA 2IW5A 5A6BD 4XLPF 1N34O 1Y4MA 4XEFA 1ZU5A 4JKVA 5E79Z 3SJAC 3AJMA 4YL3A 4BW9A 4D7TA 1FAPB 2L6GA 2J46A 3SPCA 2LK4A 3IQCA 3BEHA 2ZXWB 4CBCA 3EGXA 2UUCO 3JD2A 3EPVA 2P6JA 1HMDA 4J30B 1H2SB 1BE3H 4JRZA 2FFHA 3H1KH 3J06A 4JZGA 3AOUA 3GANA 2WLIB 2L6FA 3NMIA 4G27B 3ZQVA 4DV2O 5CA1A 3D3QA 1Z5VA 5E33A 1V54C 5IY5C 3EHMA 1T5OA 4W8KA 2HMZA 3EG9A 2BE5F 3STZC 4YWQA 5EYPB 2BL2A 1DOVA 3L73H 1Y67A 3VQVA 3E86A 4WCEV 2Z0AA 5L3CA 2A7WA 2DGJA 4QJFB 3NDBB 2J7PA 4YL0A 5CIVA 2O57A 3CEXA 3DM5A 4N06A 2ZXPA 3CSKA 4X0RA 2KG7B 3JT1A 3D3IA 3CX5F 2Q8VA 2XL4A 4CIPA 1U97A 1PP9H 3ATPA 3H1HH 5BR8B 2WLHA 2MYSA 3UMHA 3S84A 4LFCO 1LUVA 3K33A 256BA 2CTWA 2XRHA 1U6HA 1NJIW 1QHTA 3C7JA 4ASUG 3L71H 4U5FE 2LFSA 3T4RA 2J7PD 4JTAB 1QSPA 2PTMA 1LVKA 3LS0A 3DJUB 2GDCA 4GX0A 3OA1A 4YXWG 4XPWA 5IDJA 2W0XA 1SF9A 3T1YO 4A2NB 4LFAO 2IH3C 3CJHA 1KU9A 1Q8IA 5JSLA 5LGNA 4U7NA 2R7WA 4JF3A 1WP8A 4PD4F 4DVZA 3H9VA 5KUKA 3QNEA 3A0BZ 1B04A 2X51A 4PK4A 4CH4A 4J7YA 1GMGA 4JJGA 2TMVP 3OE7G 2PYJA 3C8GB 2JK5C 3JCZA 4YHHO 3HNIA 3VQYA 1S77D 1MNDA 1M1KW 5JQGB 1COWG 5L3DA 3JYHA 2JS5A 4B7EA 1Z6AA 1YYXA 2Y0PA 1FXHA 3GWOA 3IJ4A 1N8RW 1OW8A 4EHPA 2IH1C 3UO3A 2ZXWC 2XL6A 2Y39A 5LYJA 3W2WA 2ZE6A 2EJ7A 1YZBA 3EH1A 4WFAV 2AWYA 2YI8A 2AHYA 5A9GA 4P2ZA 1KECA 3E2EA 2A3QA 2HV7A 1YHQV 3JAWA 1K4CC 1RSOA 5KYXA 2G38A 2QTSA 4LFAB 3MHSC 2YL7A 4Z1VA 1RPRA 5EK0A 1YZCA 1NU7D 2OQMA 2WAMA 1MZEA 5BMVA 3U9MA 1BL8A 1IURA 1P4RA 1BR2A 1K33A 1X59A 5DN6G 1H2GA 3F7VC 5B1NA 2UUAO 4G7HF 3K9SA 3G80A 3CCUV 5JJJB 3CB2A 2ZKOA 1QR9A 1Y4CA 4LCUC 3SPGA 3AK2A 2OU6A 1C03A 3EHBB 4LC1A 4O2AB 3JASB 3NXSA 2R7TA 1PNKA 1RXQA 1AROP 4RAIA 1MMGA 2OTLV 3Q4HB 3ZHSA 2I8BA 2BTQA 2HUJA 1HW1A 2VCBA 5LL6Y 2DJVA 2UXDB 3RGBA 2YHSA 4CIHA 5COGA 4R8CA 3F7YC 1U89A 4OGQB 3A0RA 2JPUA 4J7KA 3DSQA 2AU5A 1DTOA 2J8WA 2Y3DA 2Y3HA 4CS8A 1EKYA 4X88A 1RPOA 4NTFA 3LUTB 1FKAO 3ETEA 4R7CA 4DYLA 4JZAA 4QI0A 2P7VA 3TCUA 4DV0B 4GKKO 1ZWIC 4TV9A 2IOQA 3FB6C 3HB3B 1R3KC 1CGME 1MZFA 3C18A 2QWNB 1SZIA 4UDVA 3CRCA 1N36B 4QGPA 4ULVA 3T1HB 3ZHTA 2Q7RA 2HSQA 4IGGA 2YI9A 3OUSA 3L1MA 1JFFB 5FNVB 4X20B 3K66A 1ZTEA 3JSLA 1SF8A 3VAYA 5J2UA 1GM9A 1GN3A 2B0HA 1AJQA 2ZINA 3A11A 2YSUB 4EKWA 2R7OA 3CC7V 2CNWA 4F4BA 3EVKA 2ZDIA 2EPOA 5LP6B 4Q6GA 3EG9B 1N34B 2GBOA 1E1RG 3K04A 3OTOB 2LO1A 3JAWB 3ABTA 4WBNB 4Z1MG 2NPUA 1Y74A 3JARB 3K79A 4DV1O 4OD5A 2EIJC 2Y69B 1OR3A 1TWAA 1G4US 2RMKB 3CCLV 1T6IA 5F5HA 3ZIAG 3IQTA 2X0CA 4KNWA 4I3MA 3WHNA 4DBQA 4YY3O 2UUCB 2A06H 1SA0A 2QE7G 2IM9A 4IHJA 3DC5A 3S28A 4JE9A 2YEVB 3OMNB 1V4AA 4FLTA 1QCEA 5H2FZ 1AEPA 4FLZA 2XAFA 4I50A 2PFDA 3L9DA 1QBZA 3MDSA 4UVCA 4B3MO 4XWJA 5LXTA 2QY9A 3DMDA 4I9WA 3E70C 1KP2A 3W7SA 2MWQA 5DS5A 2OTJV 2QTOA 3AGUA 1N4CA 2HLDG 3K57A 2H8PC 2J0WA 1JPXA 2BTQB 3FB5C 5L0FA 1TVKA 2ITCC 1LNQA 4UV8A 3FKSG 3RYHA 3ABLB 3FAJA 1T6QA 2L81A 3F47A 3SJBC 1SQPH 4K8ZA 2PYLA 2V3CC 2ZQMA 1RMVA 1XL4A 1XZPA 1YDXA 3HKEA 3TD7A 3AQBA 5HV9A 5L3QA 1P49A 2IXMA 1JR9A 3FMSA 3SNHA 1SS3A 3B9QA 4PA3A 5JH7B 1RM1C 1VQ9V 4G7OF 4IARA 1O87A 3B0VC 3KYJA 4JI6O 3ZRXA 4GQHA 4O79A 3B8MA 3QG5A 1QNMA 1UJWB 3B8NA 4OIQF 4NTWA 2RQ6A 2X7RB 1THZA 4DXWA 2BC5A 4PJ0Z 4AL1A 3K5LA 1IBLB 4E0HA 5LA6B 3APOA 3CRQA 4U9DA 3OAAG 3KKYA 1FD9A 2LFRA 2WA4A 1OXBA 3UQ8A 2XLEA 5IYZB 2W9YA 1PL4A 1XMQB 2EPMX 5L3VA 1I5YA 3WG7C 2M64A 2NUTA 3SXMA 3UR3C 3M8AA 4KI2A 1VF5B 4UCRA 4CS8C 2Q4PA 2IXPA 4QI2A 2JEXA 2P6VA 4DUZB 3FAPB 1MQVA 4I1MA 3E22B 1N32B 4O4HA 4LFCB 4F6EA 5DQTA 2ETNA 2JIZG 3TOMA 4XDLA 2KYHA 3ASNB 4MVSA 1ZVZA 2EILC 1CPQA 4MNDA 5CBGA 2WWWA 1SQVH 2Q7GA 1V74B 4UFZA 4JI2O 3UMIA 3E8HA 4MVZA 5EIBD 1HE1A 1XZQA 2YS8A 2R7SA 2IBFA 4WF9V 2N74A 1OKKA 1RFYA 1MOFA 3IGAC 2XAQA 1T01A 3DI5A 2WPDG 4OPHA 3NYMA 1HNXB 4DR7B 5FPRA 2ICWG 4L87A 3QO5A 5LGUA 4JAVA 5IT9N 1VOMA 3TULA 5LBQA 3HR0A 3CCEV 3W7TA 1SC5B 1WLEA 2DI3A 1JRAA 3AK1A 4DUYB 3FDQA 3D36A 2OJQA 3LNNA 1E84A 1IW7F 1NG1A 3RYHB 3JAMN 3UMKA 2DYRC 1VEWA 3RYFB 1PD3A 4YHHB 4TSFG 2E5LB 3O6XA 1A41A 1Z3IX 2PX3A 1QLEC 1M57B 4DK1A 1K8AW 2KG7A 1FPOA 4MTXA 4UCSA 4DR5B 5E3AA 5LMUB 1BCCH 1FFHA 1TWHA 4OINF 2AW9A 2E76B 3JCUZ 4U5CE 5GTHZ 3ETDA 3SYPA 4JIOA 5KYUB 4YIPA 4BJTA 4NTBA 4RUFA 3D36C 4NY3A 3ABKB 1LI7A 4DOZA 1OW6A 1S0VA 3A2FA 5GONA 3SEOA 2K9PA 1YXBA 3T6GB 5B1OA 3WU2Z 4HEAJ 1E2XA 2A6EF 1I5XA 2DMXA 2XLOA 2CE4A 3BA9A 1ZHTA 5F2VO 4PA4A 1WB7A 3L72H 1YA7O 1OJHA 2CW0F 4FAPB 1WA8B 4JTDB 4O4IA 3KCXA 4X1YB 4I4TA 3GM1A 2ZIMA 3J81N 1BDJB 2XUMA 3CJHB 1RKEA 5IWAB 1L3PA 5KA6A 3NR7A 4DR4B 3DXRA 3DTUB 4FFBA 1VLTA 5KYWB 2IJKA 3LLIA 5L3FA 1OCRC 3IC7A 1B6QA 1TWGA 3UT5A 4JCZA 4AQYO 4P30A 4DRJB 3SYQA 1OR2A 1ORQC 5KYNA 4GZRB 3C8GA 1R3IC 1WWPA 4ULWA 1OCOB 1ZZPA 4ZLDA 3CRMA 4DRHB 2VB6A 1RP3B 4JZ2A 2R9AA 1NFNA 4JV5B 1SESA 1JPJA 3QVZA 5BQHA 4PA9A 1J5EO 3I5PA 1V55B 1R3LC 5BR8O 3OTOO 3STLC 3T9OA 2XT9A 1AUEA 3IQ6A 2EJRA 2LGWA 4ANJA 4KXRA 2C2AA 1W2BU 2W0FC 5EZYB 3ZMZA 1HNZO 3K58A 2FAPB 4G78A 3H1LH 2UUBB 5CI8A 1I4YA 2YC0A 4DR4O 2F22A 2GFHA 2I15A 1TKNA 3ZMTA 1VK5A 2WLIA 3ZCCA 2QSAA 1K92A 2HJDA 5K1XA 1M57C 5FL7G 4CS2A 3RW0A 1K04A 4FLXA 1H7IA 1VIBA 3CCMV 4JI4O 2PP4A 5BQIA 1FFXA 5C93A 1DF4A 1S76D 5AC4A 4L6RA 2EIMC 4FZ1A 5BMVB 1KC8W 3OWTA 2WVOA 5LXTB 5L0JA 1M5IA 3BAAA 1KTMA 3O9OA 4JV5O 4O2BA 4X66B 3DAGA 2IJHA 5FZTA 2EX3A 5CA0A 3BRJA 3OFNG 2UU9B 5B66Z 2MW2B 2AZ0A 5JH7A 4LF6B 3I5QA 2B1GA 1GO3F 3CEIA 1SYQA 2X6BA 1AJPA 2WLMA 1SQQH 1A32A 1VLSA 3BPZA 2IXNA 2VCCA 1OV9A 3WB0A 2GV9A 1OCCC 1URFA 2WLLA 3JALB 1R6TA 2QDOA 2HFIA 3NMJA 2R7RA 2DYSB 4YT8A 1VYKA 1KYOF 1NTZH 3UGPA 5KYYB 3ZJZA 4JI7O 1W59A 3QW1A 3K1IA 4J80A 4NKGB 3SDLA 3AG1C 3UT5B 4X1KB 1Y6XA 2HR3A 3KCYA 4XEVA 2ZR2A 3WB1A 3L74H 1XNQB 3G4ZA 2DW4A 4J11A 3NMKA 3U10A 5FLXN 2EIKC 1V9PA 2PGGA 3PCVA 1MA1A 1XOUA 2GAQA 1AI7A 2E74B 3DXJF 2R7VA 3H2VA 1RCPA 4PACA 2HV6A 4RBNA 3UM7A 1L8DA 4U3FH 4DR1O 2Y3GA 4AE4B 4K7BA 3WB2A 1ZHYA 2VWKA 4X64O 4DR2O 4JI3B 2EPKX 1K05A 1GQAA 3K6BA 4JAUA 1OCOC 2YQYA 4M63A 5JQGA 1XREA 3ZMSA 3U0ZA 3SJCC 3ZG1A 4C3BA 4O6YA 2PY5A 1EI7A 4EBBA 2ZT9B 5D5PA 4RUEA 5ITZA 2QKAA 3A0HZ 1VQPV 4LF9B 4KBLA 4UB6Z 1QVGU 2OEXA 3BABA 2KC3A 1IX9A 2X6AA 5LHGA 3V5YA 4K0KO 4FJCC 5A6KA 1SZTA 4GX2A 4Z9HA 2H7OA 4J9YB 1FR0A 1G5ZA 3VOUA 4DV0O 2CDYA 4N21A 2VASA 3LLKA 2CNWD 3G4XA 3RYCA 1MMMA 3QF7A 4DR3B 4H4KC 2P5OA 2YL1A 3T4DA 2HG5C 4TWKA 4JI5O 5CA1B 5CBFA 4BWAA 1FXVA 4JASA 4DK0A 2PI4A 3JSNA 2F1MA 5GONB 5KAIZ 1R5ID 4LFBB 3FHDA 1AI6A 1XWJA 4DRIB 4RD9A 4U5BE 1F7YA 3TQOA 3PDMP 3CS5A 5LOVA 1AR1B 1XILA 4DR5O 3G50A 1RKCA 4ZOLA 2Z3YA 3ZWIA 2VC9A 4BW5A 2NSGA 2WLLB 2P22C 3B09A 4K8XA 3CCQV 1WPXA 4UB8Z 1JA8A 2ASRA 1I94B 3CC2V 4H44B 1XHXA 4PDVA 4PDRA 1MG1A 4QE7A 5J2TB 3K5MA 2HFEC 3FD9A 4LF4B 3ETGA 3R7CA 4NTXA 3X1OA 3U0CA 1EM1A 1WAZA 2H3OA 5DLJA 1JPNA 4IL6Z 2HMQA 2L35A 3ZHQA 1O3UA 5B3IA 4GLXA 3LEOA 4WGYA 4JC7A 4UUJC 4CC6A 2Y0IA 4JGSA 2PZSA 4U9EA 1QKRA 4MVQA 3JATA 3LS1A 1AILA 2PBEA 3JTLO 3ZTMA 1IBKO 4NXMO 4XTKA 4DR6B 4OIPF 4UVAA 4LFBO 1LIHA 4EBKA 4PV1B 1CPYA 3K9AA 2P7TC 1OQCA 2EILB 3K59A 5LMUO 3ASNC 5D91A 2LSEA 2OCCC 4D6TH 5FNVA 5CBHA 4UCOA 2XXAA 3IQ5A 1ZHWA 5COFA 3U9JA 3OEEG 3RT3C 1Q0KA 5IJ0A 3CAXA 4C7OB 5EZYA 5LMNO 1Z63A 1P84F 1BHAA 2FGYA 2VQFB 1T9KA 3ABMB 4HNAB 4P9FA 1NBBA 5L0HA 1GTOA 4IIJA 3EGDB 1VQLV 1FNTc 1J5EB 2YL3A 4JVSA 3CC4V 4H13B 1ZUQA 3ECSA 2CAZC 4Z9IA 1XDCA 1JJOA 1XMOO 1L1FA 1YI2V 1GRJA 5C8YA 2F93B 3H2UA 4E7SA 1TGOA 4NYKA 1EA8A 3B40A 4U5EE 1YYJA 3AG2B 5EC2C 4XQ1A 2AVKA 5E1AC 5F5FA 3WODF 3R66A 3OEHG 1PV3A 4C3EA 3M7MX 3OTFA 4YJ2A 4BPMA 4U5DE 1B3QA 1ZL8B 4KC9A 5KA5A 4AQYB 4LBEC 1RM1B 1TFOB 5KHJA 4B3SB 2AGAA 3OR7C 2EPNA 4XDKA 2V1DA 1N0JA 1HE9A 1FFTB 4ABMA 5KLVH 4CJOA 1MNGA 1S72V 2NN4A 1KQSU 1YJ9V 1XL6A 4LH7A 4HBNA 2YLGA 3VQXA 1WASA 5CA0B 2KB1A 1HMOA 4LACB 3T1CA 3FVYA 1F4MA 1I7FA 3SPHA 1Z5ZA 2G3KA 4J10A 4X1IA 3QZCA 3ABLC 1Q6HA 3POVA 4MVOA 4AL0A 3N2GA 4PFOA 4QPKA 1XEQA 4AHCA 1WB8A 1VQMV 2M4EA 1NQTA 2IBZH 1GH6A 2XNDG 1XMOB 5BY1A 2WSSG 5KYWA 2HZ8A 3FXHA 4XDJA 1HW7A 3PN1A 2KSFA 5D92A 4YK5A 4Q7CA 3K1HA 1H2LA 4I50B 1WP7A 2J45A 1E1QG 1IZMA 4OIRF 3JAKA 3HNJA 4KNVA 4D4XA 3W7UA 1WJZA 3C90A 2RDCA 2CUGA 2RNBA 1JQ0A 4FLVA 4CH6A 3RFYA 2G62A 3DE8A 1SERA 1EQ1A 3CSXA 2EIJB 4NTYA 1MMNA 1Z23A 2WZLA 4DRXB 3ZRSA 1ROPA 1GK9A 2Z5UA 2DOSA 3AG4C 1EN6A 2QE9A 1GS9A 4I0XA 4MVUA 4MS2A 4YT4A 4WABA 3UNGC 2KSDA 4K35A 3LNMB 3MFNA 2FL4A 2XAGA 1T5EA 4X64B 3C8GD 1IXMA 2J9WA 3ZHUA 4LF6O 2FTKA 4N23A 2PF4E 3OT7A 1OHHG 4XBFA 3ZVRA 1LUWA 1YJWV 4D4NA 1YTFB 2E3CA 3OD4A 2WL8A 4YY3B 2R03A 1NTKH 1S5JA 1MABG 3DM9B 3S27A 3Q6NA 1JFFA 4DVYP 3K08A 4LWSB 2Y3BA 2RD9A 1KKCA 4R32A 5ITZB 1PCXA 1YAUO 4U5HA 2QJ1A 4J7JA 1DLBA 1PV0A 3VYWA 3UCSC 2H7VC 1OCZC 1VF6C 2XHBA 1LKXA 4FLUA 1K9MW 4JYAB 1F51A 2P90A 2W6IG 2A1DD 3EFOA 3RQFA 3ZMUA 4B7KA 4BJ1A 4E0IA 4DV6B 3CRRA 3I5DA 1DGSA 1YVWA 1XBLA 2IJJA 2LP7A 1HW2A 4X20A 4JW1A 2H7BA 4PJMA 2NSFA 2XS1A 3HJCA 3K1IC 4MT8A 1KB9F 3FYIB 1JVMA 3SR2C 1A7EA 4JI3O 4PJLA 3RFRA 4U3JB 5B1AC 1ZAUA 1B68A 1YEWA 1WTYA 1NU1H 1IZ3A 3NRHA 2ZE5A 1JX9A 3M79A 4UCVA 2GUZB 2LFFA 1SQGA 1JMKC 4YT5A 1N32O 1R6NA 4PHZA 1LS1A 1TFKB 4B3RO 1NBMG 4NXNO 1O5HA 5KHHA 3ZX6A 2NUPA 2L9JA 3SJQC 1I94O 1H9GA 3BY6A 2JRIA 3JALA 1W0JG 1Q7YW 3EFOB 3E89A 3SXYA 3AG7A 1TWCA 3KMIA 1S05A 1TVKB 4DBRA 2X6CA 1XNRO 1D2DA 1M9NA 2MHRA 3H1IH 4O4LB 4X1KA 2QWQB 2UUBO 3N2KB 5KX5B 3TETA 1CGOA 5JVDA 3QTHA 3DZAA 4DW0A 4NVPA 3UKMA 3U8PA 4FWVA 1MMAA 3S3XA 3TXSA 1AVOB 1ZHXA 5EHHA 3CMEV 4HZ3A 3LSQA 2ZXRA 3ZN0A 1Q0FA 4G7ZF 2C04A 1NVPD 4HFFB 1WA8A 1Q90D 2Q4FA 1Q0DA 1KBHA 2EBOA 3MAQA 3U2LA 1NFOA 2ZCEA 3E83A 2W4BA 5LMNB 4F6RA 1Q82W 1Y6DA 3MD0A 5B1AB 5CA3A 2GUZA 1XI1A 1LE2A 1TA8A 4BAYA 4PFPA 3T4ZA 2UXXA 3H1JH 4DR7O 4EFEA 4BEMJ 1KNYA 4WGZA 3GM2A 4NCQA 3O39A 2NUTB 3RYCB 1DK1A 2F95B 2KKWA 1QLNA 1XNRB 1H2MA 1LE4A 2Q0OC 1D0YA 5LGTA 3FAVB 2OG2A 3ZHRA 4C3DA 1I4ZA 2LQTA 3JZ0A 4PJJA 1VTMP 3PHF2 4BJ5C 2YIBA 1OCZB 1SRYA 1JJ2U 3ASOB 3ITFA 5EC1C 2OIGA 5IJ9B 1NI8A 4FK5C 1QQ3A 1PM9A 5L3GA 1P7GA 2V26A 3SYOA 4PA6A 3W2VA 4MVMA 3VF0A 1Y76B 1E79G 4K1OA 1FS0G 4PA7A 4ZHQB 2Q73A 3RVZA 2EPLX 3N0TA 1VF6A 1YSCA 1Z7Qc 2R7QA 1G4WR 2ZXOA 3AGTA 4W4LA 3ASOC 4X62B 3F46A 4YJ3A 5LHIA 2F66C 3DE9A 4QDLA 3ICXA 4MTOA 5A2QN 4UVBA 3MYFA 2LGQA 3C8ZA 2A79B 4JURI 4C7UA 4DR2B 1PNMA 3L34A 3QMKA 4J9ZB 4CZZA 2P67A 1E83A 3P3PA 4FM2A 5H9CA 2JGDB 2WVNA 1QVFU 4LH6A 5F28E 1LR1A 3JARA 1HNWB 1BR4A 1FJGB 1BSMA 2EULA 1J8MF 3ABUA 1YA9A 3GEIA 2Q9CA 1Q6UA 2QR4A 2ZM6O 1GN2A 1Z2GA 4B3TO 3NKDA 3ZTZA 2Q68A 4H0LB 1GN4A 1HR0O 4F6RB 1Q5OA 1TUBA 2R9IA 5GW7A 1JOGA 1K40A 3GWLA 5KYYA 1D5AA 3K5OA 4B3SO 2CYDA 5KHKA 2UXCO 2EZOA 1WOLA 5COMA 2B1IA 1UG7A 1QZXA 2DQ3A 3BHPA 3S3WA 2W45A 3ZS8C 3HKEB 3EGDA 1R6KA 1N1CA 4Q20A 4IIJB 4CS9C 2QEXV 3SP1A 3Q7GA 3G4SV 3ZRWA 4NQFA 2QWPB 3WFVA 1R4TA 4JTCB 5EYPA 3OEOA 5IYCO 4JI4B 4DV4B 2ADQB 1AVMA 4RQFA 2A6HF 2KK1A 1SQBH 5T3WA 2R9RB 3H01A 3C63A 5IJ9A 3JD1A 1WN7A 1YLMA 4I7ZB 4I5SA 4FVMA 2XM0A 4CDVA 1JR8A 3M1CB 3OR6C 5T1DB 3TK1A 5CI9A 4GEHA 5H6RA 4X66O 1YJNV 1TR2A 2A68F 3CP1A 3EGXB 2YDEA 2YEVA 2BSKA 2UU9O 4JI0B 1SETA 3BCCH 5DEDA 4QNHB 2H8AA 3U8VA 1AI5A 2EZPA 1CGNA 3ZMVA 2JJ1G 4MSWC 1CPRA 3I56V 1EN5A 2YIAA 1IBLO 1D1AA 3LEVA 4GKKB 4B6IA 4E17A 1Q0GA 1IVSA 3ZBHA 3SYCA 1K3EA 4J41A 3AG2C 4P6IC 2RCVA 2IYLD 1M6TA 1BBHA 2NR5A 5IYZA 3ZIBA 4LF8B 1D0XA 3RWRD 2JS3A 1NKDA 4AK9A 1NH2B 4J7TA 3ZDLA 1M90W 1Q81W 4TT3G 1YVIA 2VQEB 4OX9O 4RDAA 4LLCA 1W2WA 3ABMC 3U2MA 3MBGA 2Q9BA 4JAAA 2XOKG 2VCAA 5JUAA 1OW7A 3HTKC 2H94A 3TJTA 2Q9AA 2VH3A 4I1OB 2WA3A 1KUQA 3CZ6A 2QKSA 4Z2WA 4LF7O 2JX0A 3QO7A 2PX0A 1QQCA 4JI0O 4UXNA 1ZSPA 2FKXA 4WFGA 1BMFG 3BVOA 5L3BA 4JI7B 2CH7A 2IJIA 3DJNB 1KMIZ 4EB6B 3CWBH 3AEIA 1WPBA 3H65A 3RQGA 4CDAA 3RN4A 2DE0X 3JD4A 1UPGA 1SA0B 4P9PA 3RYIB 4MW8A 3L8JA 3CXCU 1FXKB 5B3SB 2CGEA 4EBJA 2KW3C 4DV6O 3AG4B 5HFLA 1SQFA 4H54A 4B3MB 3ZC4A 2P4VA 3FOOA 3T1HO 1TAEA 5J2TA 4QE9A 4XPXA 4ZBMA 3E22A 2E87A 5A6AA 4UCUA 3SXKA 1ENVA 1VQ6V 1YTFD 4O4LA 3G6BA 4R50A 3A9CA 3GEEA 5JP7A 1FMWA 4OIOF 3UO2A 3MLGA 3SPJA 4OX9B 3C62A 3CRAA 2LW7A 2R72A 3EQLF 3JSZA 1H2KA 4WFBV 1N0NA 2HJFC 2XASA 4IYIA 1YCIA 4J32B 5L0IA 5BZBA 1AR4A 1FMVA 3RYFA 2UXNA 2ITDC 2M7WA 2QGNA 2XAJA 4BJ5A 2J9VA 4LR3A 5LHHA 3RQEA 4FFKA 2WLJA 4TUYA 1M2VA 1OZ0A 5CN0A 1FYJA 3M4BA 4PDLA 5T3TA 3KYIA 5KHGA 1VQ7V 5JCOC 4ZHQA 4BR6A 4L8JA 4TOIA 3U5SA 1Y76A 4CBEA 4CS7A 4MTGA 1RSOB 5KYXB 4NR1A 1Q86W 3FB7C 3LJBA 3T6JA 3JASA 4HFKB 2MK3A 2OCHA 2QNLA 3X2QB 2L6LA 3K06A 1NR7A 1HY5A 5H6QA 3U11A 3RYIA 1K73W 3EH2A 2R7XA 3E9VA 1XMQO 4WFEA 1FFTC 3SPIA 1ZL8A 1F23A 2ODMA 1TUBB 1VP7A 3EFFK 2OOCA 3E35A 4EB6A 2P61A 5JJEB 3M15A 2Y48A 3ZRVA 1WNSA 4NXMB 2FB5A 3SGIA 2CGOA 4W8PA 3Q4HA 4BJ6C 5A69A 4G28B 2Y4TA 4JEBA 4LP8A 4U3JA 4A5UB 3RVYA 1RKEB 3IHUA 3ZRWB 1MNEA 4N6HA 2OKUA 4BEJA 2JGDA 2R02A 3RF3A 4JI1B 1E86A 2GTSA 1ST6A 4FESA
chains in the Genus database with same CATH topology
4PJNA 3DD7A 1WJZA 4CS8C 4CS9A 2CUGA 2IXPA 4QI2A 2Y4UA 3RFYA 2G62A 1ZU4A 3MX3A 2P6VA 2Y69C 4I1MA 3EJNA 4C7OA 1MMNA 1Z23A 2WZLA 5B1BC 4IRUA 5DQTA 5KYUA 2IXOA 3AG4C 3APQA 1S7ZA 2EILC 4MNDA 5E3CA 4YT4A 3UNGC 3UMIA 2DYSC 2YS8A 2R7SA 1WGWA 1OKKA 2J9WA 3AG3C 2PF4E 3NYMA 3NYJA 3ZVRA 1M2OA 3CQZA 3L0IA 1FTSA 1D0ZA 1VOMA 1BQ0A 2WL8A 3DM9B 3I4UA 3S27A 3FDQA 3Q6NA 4DVYP 1IW7F 1NG1A 1OKKD 2Y3BA 4IJJA 3UMKA 3EHNA 2DYRC 3Q7LA 1PCXA 4U5HA 3GODA 5BUOA 3VYWA 3UCSC 4AE4A 2H7VC 1OCZC 1LKXA 4YN0B 2M6YA 4GYTA 2KGOA 3O6XA 1Z3IX 2PX3A 2A1DD 3EFOA 1QLEC 2CTRA 1FPOA 4BJ1A 2WZGA 5E3AA 1FFHA 4OINF 1TWHA 1XBLA 3LAYA 4JW1A 5DS6A 4O7GA 4U5CE 4RWUA 2H7BA 4PJMA 2C03A 4AX2A 2KJGA 3S0XA 3HJCA 5DQZA 3K1IC 1PD0A 2ZPAA 4BJTA 5KYUB 4NY3A 4PJLA 4DOZA 5B1AC 1ZYRF 4Q4ZF 3SEOA 3NRHA 4HEAJ 2GUZB 2A6EF 3V7OA 2DMXA 4YT5A 1LS1A 1ZHTA 2WVQA 4WJ0A 1O5HA 4YT2A 2CW0F 5DVWA 2NUPA 2L9JA 4HE8D 4I44A 1BQZA 2Q3TA 4JCHA 3EFOB 2KQ9A 3AG7A 1D1BA 1TWCA 3KMIA 3S29A 4DBRA 5EGYA 5KYWB 1MMDA 3AQCA 3LLIA 1OCRC 1TWGA 4EWCA 2CTQA 4XLPF 5KYNA 2QWQB 1ZU5A 2J9UA 4ULWA 3DZAA 4Q5SF 4ZLDA 4FWVA 2VB6A 4O6NA 2J46A 1MMAA 3SZRA 1ZHXA 5EHHA 4J7ZA 2ZXRA 1HDJA 3EGXA 3EPVA 1JPJA 4G7ZF 4J30B 2C04A 5FCLA 3I5PA 4HFFB 2NUPB 2W4MA 2FFHA 3GANA 2W4BA 5E33A 1M56C 1V54C 2G3VA 3PMRA 3EHMA 5IY5C 4W8KA 2LGWA 3EG9A 1NZ6A 2GUZA 3ABKC 4ANJA 2BE5F 3W8IA 4PFPA 4YWQA 3EZHA 2YUAA 1J8YF 5CI8A 2O9XA 3O39A 3Q6MA 2NUTB 3W8HA 3UGOA 2DGJA 2GFHA 1TKNA 1VK5A 3N2ZB 3NDBB 1D0YA 2J7PA 2QSAA 3DM5A 4N06A 2ZXPA 3CSKA 4X0RA 3JRTA 2OG2A 4E7ZA 1M57C 3JT1A 4C3DA 2XL4A 4PJJA 3PHF2 4JJFA 2PP4A 4BJ5C 3UMHA 2MYSA 3ITFA 3K33A 1RJ9B 2V26A 2EIMC 2CTWA 2XRHA 3W2VA 3OWTA 2WVOA 3KKBA 4U5FE 3T4RA 2J7PD 3N0TA 3DAGA 1KU2A 2R7QA 2ZXOA 1LVKA 2XXAB 3LS0A 3DJUB 2QTVA 3IEEA 3ASOC 3F46A 3OA1A 3I5QA 3LNRA 4QDLA 2IXNA 4A2NB 4CSAC 1OCCC 4JURI 3QMKA 3L34A 2R7WA 2R7RA 4YT8A 4YJWA 1VYKA 4DVZA 3UGPA 2X51A 4PK4A 5KYYB 1FAFA 4JJGA 2WVNA 4J80A 4LERA 1BR4A 4IAOA 3AG1C 4MQ9F 1J8MF 2Q9CA 3NKDA 3RKOF 2QWRB 1MNDA 4XLNF 2EIKC 3JYHA 3DXJF 1Z6AA 1V55C 2R7VA 5KYYA 2HV6A 4RBNA 2Y3GA 4AE4B 4K7BA 3UO3A 2ZXWC 2Y39A 1QZXA 1ZHYA 2W45A 3W2WA 2EJ7A 3EGDA 1N1CA 3ZSUA 3EH1A 4CS9C 3K6BA 3SP1A 1OCOC 3Q7GA 4M63A 2QWPB 2HV7A 1VMAA 1NZEA 3ZG1A 4C3BA 4EBBA 4O6YA 2D5RB 3OEOA 5KYXA 2N04A 2CTPA 2QWOB 2A6HF 5T3WA 4ZLCA 1NU7D 1M2VB 1RJ9A 4KBLA 1ZHZA 1IURA 3M1CB 2WZFA 5T1DB 1BR2A 3DAFA 4GEHA 5CI9A 2A69F 4G7HF 1TR2A 2A68F 3KL4A 2H7OA 3EGXB 2YEVA 3X2QC 2EINC 1SMYF 2VASA 2R7TA 3LLKA 2CNWD 1D1AA 1MMGA 3LEVA 4B6IA 4H4KC 1G8XA 3K7DA 2I8BA 4BJ6A 2DN9A 3FHDA 3AG2C 4CIHA 2YHSA 4P6IC 2B0JA 2IYLD 3NYLA 4RD9A 4U5BE 3ZIBA 1D0XA 2Y3HA 1PD1A 2Y3DA 4AK9A 3RH3A 4CS8A 4OD4A 3JCUQ 4U5GA 4QI0A 4JZAA 2P7VA 4RDAA 5DS4A 4LLCA 1W2WA 3ABMC 2IOQA 2Q9BA 3HTKC 2Q9AA 2VH3A 3X1OA 2QWNB 4I1OB 5DLJA 1SZIA 1JPNA 3CZ6A 3N24A 2PX0A 2CDQA 5B3SC 3B0UX 4IWBA 3BVOA 3DJNB 3K66A 3LS1A 1SF8A 3H65A 3VAYA 3T6BA 4XTKA 4OIPF 2R7OA 2CNWA 4F4BA 3HLZA 4G0HA 3LESA 2CGEA 3NG1A 2KW3C 3EG9B 3ASNC 5D91A 2NG1A 2LSEA 2OCCC 2XXAA 3ZC4A 2LO1A 1ZHWA 4OD5A 4C7OB 2E87A 2J0XA 2EIJC 1Z63A 2FGYA 1TWAA 3NKEA 2YZSA 5F5HA 4DBQA 4KNWA 4I3MA 1FMWA 4OIOF 3UO2A 3MLGA 3RIPA 3EGDB 4JVSA 3JSZA 3EQLF 4J32B 3S28A 3ECSA 2JD3A 1FMVA 2N05A 3KH2A 4BJ5A 2J9VA 2PFDA 4E7SA 1M2VA 3SYNA 4XWJA 5T3TA 3DMDA 2QY9A 3E70C 4U5EE 2MWQA 5DS5A 4CBEA 1N4CA 3B0PA 3WODF 5F5FA 2J0WA 4CS7A 4C3EA 4BG0A 2WB7A 4K0DA 3FAJA 4U5DE 5KYXB 2L81A 3F47A 4KC9A 3LJBA 3T6JA 5E2QA 3RYLA 4HFKB 2V3CC 2OCHA 2Z15A 2L6LA 3TD7A 3AQBA 5L3QA 5HSWA 4CSAA 2IXMA 3EH2A 2R7XA 3E9VA 1FFTC 3SNHA 3B9QA 4LACB 3FVYA 2XSEA 4G7OF 2KQXA 3B0VC 1O87A 1Z5ZA 2G3KA 3QZCA 3ABLC 3POVA 4O79A 4PFOA 1D1CA 4BJ6C 4OIQF 2M4EA 2Y4TA 1GH6A 1BR1A 2KNHA 1MNEA 5KYWA 4BEJA 4FX5A 4O6MA 3APOA 1VYIA 5D92A 4Q7CA 3K1HA 3EZIA 2W9YA 2R7UA 1NU9C 5L3VA 2J45A 4LLEA 1IZMA 4OIRF 2NUTA 3UR3C 3WG7C 4IT5A 4KNVA 1ST6A 4FESA 4KI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWR B;  1WJZ A;  2N04 A;  2M6Y A;  2CTP A;  2CUG A;  2PF4 E;  2CTQ A;  3UO2 A;  2GUZ B;  2Y4U A;  2QWO B;  2DMX A;  2QWQ B;  2CTR A;  1FPO A;  2LGW A;  1NZ6 A;  2GUZ A;  2Y4T A;  1BQ0 A;  1GH6 A;  2OCH A;  2CTW A;  2DN9 A;  1IUR A;  1XBL A;  2N05 A;  2QWN B;  2L6L A;  3UO3 A;  1FAF A;  3APO A;  2YUA A;  1BQZ A;  4J7Z A;  4RWU A;  2LO1 A;  1HDJ A;  3APQ A;  2EJ7 A;  4J80 A;  3AG7 A;  3BVO A;  2QWP B;  2YS8 A;  1N4C A;  4IT5 A;  2QSA A;  3UCS C;  2KQX A; 
#chains in the Genus database with same CATH topology
 4X1Y A;  4PJN A;  3B4S A;  3IPM O;  1HNW O;  1Q3E A;  4CS9 A;  4DJ9 A;  3RBZ A;  1HNZ B;  2EIK B;  2Y4U A;  2D3O W;  2NLJ C;  1ZU4 A;  3MX3 A;  5TIS Z;  2P1A A;  3BRC A;  4CS3 A;  1S5H C;  4FPP A;  5JS5 A;  2HP8 A;  3JD3 A;  1HR0 B;  4AI8 A;  4DUY O;  5B1B C;  1ORS C;  3AG1 B;  2OCC B;  4TUY B;  2DWE C;  1C02 A;  1R1B A;  3APQ A;  4WFF A;  4K3A A;  1ORJ A;  3JD0 A;  3L75 H;  2UXC B;  4GKJ O;  2DYS C;  5IE9 A;  1WGW A;  2FML A;  3OGI B;  2YL0 A;  1K34 A;  4DV3 B;  3AG3 C;  3NYJ A;  3QW0 A;  1M2O A;  3CQZ A;  3L0I A;  3K0D A;  1FTS A;  2YLD A;  1YAR O;  3N2K A;  1BQ0 A;  3LSS A;  4E2L A;  2LP4 A;  3CCV V;  2D2C B;  1AJN A;  5JLI A;  2A0L A;  1C17 M;  3HKC A;  1VQO V;  4I0X B;  3I4U A;  3OMI B;  4X9Q A;  4NB5 A;  5GTI Z;  3TK0 A;  1VQ8 V;  4RO2 A;  2OJE D;  4IJJ A;  1P7B A;  4FIP C;  3EHN A;  1FJG O;  5BUO A;  3HKD A;  1US6 A;  2D4U A;  2ZIO A;  4U7O A;  3GOR A;  4GYT A;  2KGO A;  4EFB A;  1H38 A;  1BS3 A;  2HKO A;  2GHY A;  3FAV A;  3JRM O;  1NR1 A;  2OYQ A;  3S90 A;  5KUM A;  2HVK C;  3LDD A;  2ZE8 A;  2HHH B;  1LI5 A;  4LF5 O;  3LAY A;  4O7G A;  3QTC A;  4AX2 A;  3T1Y B;  2KJG A;  2ILM A;  2ZPA A;  4UCT A;  1QU7 A;  4P9O A;  5JCO A;  1NLX A;  1YIT V;  3CE2 A;  2Q6A A;  4Q4Z F;  3DXR B;  3WAQ A;  4CDY A;  5EBW C;  1VQ4 V;  1QR8 A;  4DR1 B;  1YJG A;  3L70 H;  4E18 A;  3CD6 V;  3JYY A;  4LDK A;  2Q7E A;  5EBM C;  1J95 A;  2WVQ A;  2EIN B;  5CMU A;  2ETS A;  4WJ0 A;  3C3S A;  2V4D A;  5DVW A;  4O4I B;  1AB3 A;  2JDI G;  4HE8 D;  2WLN A;  3JYC A;  2Q3T A;  4JCH A;  4KP4 A;  2KQ9 A;  4FZ0 A;  1O9G A;  1MSW D;  3S29 A;  2A0U A;  2AHZ A;  4DV7 B;  2ZNI A;  5EGY A;  4LWS A;  1JAF A;  5K1P A;  3W7X A;  4DV5 O;  1U0B B;  4W4K A;  1MMD A;  4N4W A;  2L7A A;  2YXY A;  2HS5 A;  3MYI A;  4JI8 B;  4EWC A;  2LJ2 A;  5KMG B;  1LM3 B;  2CTQ A;  4NC3 A;  2HEP A;  1GN6 A;  1LPE A;  2J9U A;  1OCR B;  2OIE A;  2FYU H;  2XTA A;  4Q5S F;  4JI6 B;  4LF5 B;  4I4T B;  4O6N A;  1FXK A;  3SZR A;  4PI0 A;  1BZK A;  4IAQ A;  2P0N A;  3O10 A;  4J7Z A;  3VBB A;  1I5N A;  1HDJ A;  3S9O A;  1TQG A;  3LSU A;  1EBO A;  4DR3 O;  5FCL A;  1A0B A;  5J2U B;  3DC6 A;  1HWY A;  3K3W A;  5AC5 A;  5A6B A;  5A6J A;  2NUP B;  2W4M A;  2AWC A;  1A7D A;  1R73 A;  4BIU A;  4O4J A;  1S3J A;  4ER9 A;  4YIO A;  2V7Q G;  1GM8 A;  2ZDI C;  4KFM A;  5D5Q A;  3G71 V;  1M56 C;  2L6H A;  2G3V A;  3PMR A;  1NZ6 A;  3OGC C;  3ABK C;  1X4T A;  3CXH F;  4ZI7 B;  3W8I A;  3DGE A;  1DF5 A;  4O4H B;  3EZH A;  1M4U A;  1G8M A;  2YUA A;  1J8Y F;  2O9X A;  4PEL A;  2A9H A;  3Q6M A;  3W8H A;  4ICG A;  3UGO A;  3W4Y A;  3N2Z B;  1DOW A;  1OCC B;  4TV8 A;  2ZD9 A;  4LF4 O;  4I55 B;  4JYB A;  3JRT A;  4E7Z A;  3TJ5 A;  4P9T A;  3P32 A;  4MW3 A;  4JJF A;  1H9T A;  1NS1 A;  3JAT B;  4NXN B;  1YIJ V;  1RJ9 B;  4X65 B;  4XEK A;  2DYR B;  3N2G B;  1U96 A;  2YIB D;  3P3N A;  4DV2 B;  1EZV H;  2Q69 A;  4IB4 A;  4BIZ A;  3IFX A;  1CP9 A;  4B3T B;  1GGQ A;  3G67 A;  3KKB A;  2AXT Z;  2UUA B;  1KU2 A;  2CCY A;  2EIM B;  2XXA B;  2NNU A;  5AGF A;  3IEE A;  2QTV A;  4X8A A;  4DR6 O;  1H8H G;  3QVY A;  3GM3 A;  1EZJ A;  3CMA V;  3FOP A;  4KHP B;  2Q0A A;  1EN4 A;  1I08 A;  4ZIB A;  3LNR A;  5BQG A;  2HKV A;  1FFX B;  2LIG A;  1VB5 A;  1NSG B;  1A7V A;  1SKV A;  5JJN B;  5LYJ B;  1IDS A;  1Q43 A;  1VAR A;  3JAK B;  1N33 B;  4CSA C;  1O9H A;  4YJW A;  4I55 A;  5L0D A;  2J9B A;  1AP6 A;  3O65 A;  4ZI7 A;  2UXD O;  1FAF A;  3ZHV A;  3K03 A;  4WBN A;  2CH7 B;  4EIY A;  4LER A;  3F5W C;  5IJ0 B;  4IAO A;  4KL1 A;  4MQ9 F;  5KMG A;  4ONS A;  5L0G A;  5B1B B;  3KZI Z;  2JGU A;  5CB4 A;  4O4J B;  4HYO A;  1M56 B;  5EBL C;  3RKO F;  2QWR B;  3OUF A;  3KPH A;  4TQD A;  3V5Z A;  1XHZ A;  4XLN F;  3FFQ A;  4LF9 O;  4CC5 A;  1NH2 D;  5JVE A;  1H8E G;  3CCJ V;  1G1X B;  1Z5W A;  1KKD A;  2PNO A;  1PPJ H;  1V55 C;  2GWW A;  1VF7 A;  4H33 A;  4R6Z A;  4DV1 B;  5JRA A;  2QKC A;  2QM7 A;  2QLA A;  4K0K B;  4HNA A;  1MSD A;  4GX5 A;  1PKX A;  3ZSU A;  2CK3 G;  3OMA B;  3THO A;  3DKA A;  1VMA A;  5LA6 A;  1NZE A;  2YIC A;  2B5U A;  2D5R B;  3CHX A;  2N04 A;  5AG2 A;  1SQX H;  2CTP A;  2Q67 A;  1JOY A;  2QWO B;  2X0L A;  5J9P C;  2HVJ C;  4GKJ B;  2YWA A;  4ZLC A;  4X1I B;  1M2V B;  1RJ9 A;  2XAH A;  3ML0 A;  5B5E Z;  1ZHZ A;  1R3J C;  2E75 B;  3J7A U;  2JVD A;  2UXB B;  2WZF A;  2HSB A;  3HKB A;  3DAF A;  2ZNJ A;  2ARH A;  2A69 F;  2VS0 A;  4TV8 B;  3CCR V;  3KL4 A;  3X2Q C;  4CS4 A;  2VQE O;  2EIN C;  1T6U A;  3BA8 A;  4JI1 O;  3HKD B;  4FLW A;  2XLW A;  1NT2 B;  1SMY F;  2GDS A;  3HPL C;  1F4N A;  5DM6 V;  3G6E V;  2BCC H;  1G8X A;  3K7D A;  2LD6 A;  3F5T A;  5L0C A;  4HAM A;  3GWK C;  1VQN V;  3M4C A;  4BJ6 A;  1W0K G;  2XLD A;  2DN9 A;  2P4K A;  2YKZ A;  3R65 A;  2BSK B;  2F4V O;  2B0J A;  3NYL A;  3I55 V;  3BFR A;  2JEU A;  2OEV A;  2F43 G;  2DB4 A;  1BZ4 A;  1PD1 A;  3RH3 A;  1QLE B;  1Y66 A;  2Q00 A;  4OD4 A;  3U3F A;  1WAT A;  1BT8 A;  1ORY A;  1IBK B;  3JCU Q;  5IYD O;  4U5G A;  3J80 N;  2XLH A;  2WLK A;  4LNU B;  5K0I A;  1E85 A;  4X62 O;  2RSE B;  4WFH A;  5DS4 A;  3ZED A;  1SR2 A;  3ZN1 A;  1ZX3 A;  4CH5 A;  4KUM A;  1VQ5 V;  3O55 A;  4GCZ A;  2XLV A;  5KX5 A;  3TJ6 A;  4YL1 A;  1K4D C;  4PR9 A;  2OT5 A;  4J42 A;  4TQF A;  3VM6 A;  1XUQ A;  3N24 A;  2CDQ A;  5LP6 C;  3KG2 A;  1FXK C;  5B3S C;  2VQF O;  3B0U X;  4IWB A;  4Z9J A;  1HP8 A;  3OM3 B;  2XLM A;  1VMG A;  2XL8 A;  4N6C A;  3AG3 B;  1K97 A;  2AZ2 A;  1AI4 A;  3HNL A;  2R25 A;  4FM1 A;  1S5L Z;  1PNL A;  1TUE B;  3T6B A;  3L8I A;  2ZM6 B;  4DV5 B;  3ZQY A;  3HLZ A;  1H6G A;  2Q5Z A;  2ATK C;  2YRF A;  3GEH A;  4D7S A;  3B77 A;  3LES A;  3JSE O;  1M93 A;  4GX1 A;  2F4V B;  4G0H A;  3NG1 A;  3HKB B;  2NG1 A;  4UV9 A;  1BGY H;  1UFI A;  4FLY A;  3FYE B;  3U3B A;  4G2K A;  4JYA O;  5KHI A;  1Y74 B;  3OW2 U;  2J0X A;  3NKE A;  1LS4 A;  2YZS A;  1N36 O;  2K1E A;  2GA0 A;  2LW1 A;  2QM8 A;  5HFM A;  1L7C A;  4QIW F;  4DW1 A;  1G6U A;  2QA4 V;  3RIP A;  1F1M A;  1AR5 A;  3E8F A;  3PJS K;  4CH3 A;  3WG7 B;  5JT4 A;  2LQG A;  3MHH C;  4DUZ O;  1GAX A;  2JD3 A;  3B29 A;  3VQW A;  2N05 A;  3KH2 A;  1L0L H;  1QPU A;  3W7W A;  4BIO A;  2IU3 A;  3R2P A;  3IAY A;  1KD1 W;  1ZLZ A;  4LF8 O;  3SYN A;  2E5L O;  4OPA A;  3K5N A;  3M99 B;  1D5N A;  3LDC A;  2DWD C;  5BXZ A;  4JI2 B;  3B0P A;  4DV7 O;  4B3R B;  2YLI A;  4YJ2 B;  1NVP B;  1ZW3 A;  4BG0 A;  1JCH A;  3CPW U;  2WB7 A;  1VQK V;  4K0D A;  1I0H A;  1UFB A;  2YXH A;  4QPJ A;  1PL0 A;  2YXL A;  4TV9 B;  2VWJ A;  5E2Q A;  1IBM B;  3HKK A;  2UUI A;  3RYL A;  3GWN A;  2Z15 A;  1H2N A;  1K5Q A;  4GUN A;  2P06 A;  5HSW A;  4CSA A;  1L0N H;  1ZW2 A;  4X65 O;  2ADP A;  2F23 A;  3A8T A;  1IXB A;  3E8G A;  3IC9 A;  3QVN A;  1GM7 A;  2XSE A;  2KQX A;  4JYC A;  2XM4 A;  2GSM B;  2JJ2 G;  5GPG B;  2BOC C;  3K0G A;  4LDR A;  2ZR3 A;  1D1C A;  5CB4 B;  4ZKI A;  5JVD B;  3US6 A;  3C3T A;  3CCS V;  4CX9 A;  3FX7 A;  5IWA O;  1BR1 A;  2KNH A;  2HJM A;  4FX5 A;  2YVK A;  4JI5 B;  4O6M A;  2QM4 A;  1VYI A;  1GM5 A;  3EXA A;  3GB7 C;  4DV3 O;  3N27 A;  3EZI A;  5LOV B;  4F4L A;  2R7U A;  1NU9 C;  4LLE A;  3HNK A;  4IT5 A;  4A4A A;  1Q0M A;  4LF7 B;  1CEZ A;  3DD7 A;  5H5N A;  4IHJ B;  3AK3 A;  3D8C A;  1IBM O;  4MVR A;  2Y69 C;  4B08 A;  3EJN A;  4C7O A;  2XS8 A;  1CXZ B;  4DRX A;  4IRU A;  5KYU A;  2IXO A;  3ETQ A;  4E4E A;  3SYA A;  1S7Z A;  4X89 A;  2R05 A;  4EUK B;  5E3C A;  1Q6I A;  4GYC B;  3B71 A;  1GKF A;  1QVX A;  5LP6 A;  2RJZ A;  2RN9 A;  4JYY A;  1XQ8 A;  4EEQ A;  4XPY A;  4KHP O;  1BHB A;  2HHH O;  3B2E E;  4GT1 A;  4I9Q A;  4OXS A;  4FMT A;  1JMW A;  1D0Z A;  1N33 O;  4FM0 A;  5KAF Z;  1G4Y B;  3LDE A;  3TOL A;  2VRZ A;  1EFR G;  1KP3 A;  5IYB O;  4O2B B;  2AP3 A;  1OKK D;  2GTA A;  2CGN A;  2QUP A;  2UXB O;  3Q7L A;  4DO2 A;  3GOD A;  4AE4 A;  3VRC A;  2HJ3 A;  2BOB C;  4YN0 B;  2M6Y A;  2IU0 A;  2B9Z A;  2R70 A;  2PI5 A;  1YZA A;  4NTA A;  3QO8 A;  1WN0 A;  2Q9L A;  2CTR A;  3GVM A;  1YDI A;  2WZG A;  1K5S A;  1AP5 A;  4AIL C;  2PUS A;  5TJ5 E;  2UUH A;  1HNX O;  1APC A;  4CJG A;  3T2M A;  5DS6 A;  4RWU A;  2OWO A;  4YJ3 B;  4LDQ A;  4H37 A;  4JI8 O;  2C03 A;  3S0X A;  2DQ0 A;  2ZE7 A;  5EIB C;  5DQZ A;  1PD0 A;  3TGU H;  4MTF A;  3HKC B;  5IY5 B;  1ZYR F;  4PI2 A;  3E8B A;  1B06 A;  1V54 B;  3V5X A;  2W6J G;  4LNU A;  5DEC A;  3DWW A;  1K7D A;  3V7O A;  4FFB B;  2LFD A;  4JEA A;  2LCH A;  2Q7H A;  2BE3 A;  5JWP A;  1NTM H;  5C8Y B;  4YT2 A;  4O2A A;  2A0B A;  4ZOL B;  1OXK A;  3SXZ A;  3CYO A;  3TXQ A;  4I44 A;  3P30 A;  1BQZ A;  1SZX A;  1XNQ O;  1D1B A;  1YF2 A;  4DV4 O;  4RQE A;  2BTO A;  2YID A;  5L3E A;  2IM8 A;  3AQC A;  4JPR A;  4IYH A;  3FB8 C;  4PDM A;  5FPO A;  2IW5 A;  5A6B D;  4XLP F;  1N34 O;  1Y4M A;  4XEF A;  1ZU5 A;  4JKV A;  5E79 Z;  3SJA C;  3AJM A;  4YL3 A;  4BW9 A;  4D7T A;  1FAP B;  2L6G A;  2J46 A;  3SPC A;  2LK4 A;  3IQC A;  3BEH A;  2ZXW B;  4CBC A;  3EGX A;  2UUC O;  3JD2 A;  3EPV A;  2P6J A;  1HMD A;  4J30 B;  1H2S B;  1BE3 H;  4JRZ A;  2FFH A;  3H1K H;  3J06 A;  4JZG A;  3AOU A;  3GAN A;  2WLI B;  2L6F A;  3NMI A;  4G27 B;  3ZQV A;  4DV2 O;  5CA1 A;  3D3Q A;  1Z5V A;  5E33 A;  1V54 C;  5IY5 C;  3EHM A;  1T5O A;  4W8K A;  2HMZ A;  3EG9 A;  2BE5 F;  3STZ C;  4YWQ A;  5EYP B;  2BL2 A;  1DOV A;  3L73 H;  1Y67 A;  3VQV A;  3E86 A;  4WCE V;  2Z0A A;  5L3C A;  2A7W A;  2DGJ A;  4QJF B;  3NDB B;  2J7P A;  4YL0 A;  5CIV A;  2O57 A;  3CEX A;  3DM5 A;  4N06 A;  2ZXP A;  3CSK A;  4X0R A;  2KG7 B;  3JT1 A;  3D3I A;  3CX5 F;  2Q8V A;  2XL4 A;  4CIP A;  1U97 A;  1PP9 H;  3ATP A;  3H1H H;  5BR8 B;  2WLH A;  2MYS A;  3UMH A;  3S84 A;  4LFC O;  1LUV A;  3K33 A;  256B A;  2CTW A;  2XRH A;  1U6H A;  1NJI W;  1QHT A;  3C7J A;  4ASU G;  3L71 H;  4U5F E;  2LFS A;  3T4R A;  2J7P D;  4JTA B;  1QSP A;  2PTM A;  1LVK A;  3LS0 A;  3DJU B;  2GDC A;  4GX0 A;  3OA1 A;  4YXW G;  4XPW A;  5IDJ A;  2W0X A;  1SF9 A;  3T1Y O;  4A2N B;  4LFA O;  2IH3 C;  3CJH A;  1KU9 A;  1Q8I A;  5JSL A;  5LGN A;  4U7N A;  2R7W A;  4JF3 A;  1WP8 A;  4PD4 F;  4DVZ A;  3H9V A;  5KUK A;  3QNE A;  3A0B Z;  1B04 A;  2X51 A;  4PK4 A;  4CH4 A;  4J7Y A;  1GMG A;  4JJG A;  2TMV P;  3OE7 G;  2PYJ A;  3C8G B;  2JK5 C;  3JCZ A;  4YHH O;  3HNI A;  3VQY A;  1S77 D;  1MND A;  1M1K W;  5JQG B;  1COW G;  5L3D A;  3JYH A;  2JS5 A;  4B7E A;  1Z6A A;  1YYX A;  2Y0P A;  1FXH A;  3GWO A;  3IJ4 A;  1N8R W;  1OW8 A;  4EHP A;  2IH1 C;  3UO3 A;  2ZXW C;  2XL6 A;  2Y39 A;  5LYJ A;  3W2W A;  2ZE6 A;  2EJ7 A;  1YZB A;  3EH1 A;  4WFA V;  2AWY A;  2YI8 A;  2AHY A;  5A9G A;  4P2Z A;  1KEC A;  3E2E A;  2A3Q A;  2HV7 A;  1YHQ V;  3JAW A;  1K4C C;  1RSO A;  5KYX A;  2G38 A;  2QTS A;  4LFA B;  3MHS C;  2YL7 A;  4Z1V A;  1RPR A;  5EK0 A;  1YZC A;  1NU7 D;  2OQM A;  2WAM A;  1MZE A;  5BMV A;  3U9M A;  1BL8 A;  1IUR A;  1P4R A;  1BR2 A;  1K33 A;  1X59 A;  5DN6 G;  1H2G A;  3F7V C;  5B1N A;  2UUA O;  4G7H F;  3K9S A;  3G80 A;  3CCU V;  5JJJ B;  3CB2 A;  2ZKO A;  1QR9 A;  1Y4C A;  4LCU C;  3SPG A;  3AK2 A;  2OU6 A;  1C03 A;  3EHB B;  4LC1 A;  4O2A B;  3JAS B;  3NXS A;  2R7T A;  1PNK A;  1RXQ A;  1ARO P;  4RAI A;  1MMG A;  2OTL V;  3Q4H B;  3ZHS A;  2I8B A;  2BTQ A;  2HUJ A;  1HW1 A;  2VCB A;  5LL6 Y;  2DJV A;  2UXD B;  3RGB A;  2YHS A;  4CIH A;  5COG A;  4R8C A;  3F7Y C;  1U89 A;  4OGQ B;  3A0R A;  2JPU A;  4J7K A;  3DSQ A;  2AU5 A;  1DTO A;  2J8W A;  2Y3D A;  2Y3H A;  4CS8 A;  1EKY A;  4X88 A;  1RPO A;  4NTF A;  3LUT B;  1FKA O;  3ETE A;  4R7C A;  4DYL A;  4JZA A;  4QI0 A;  2P7V A;  3TCU A;  4DV0 B;  4GKK O;  1ZWI C;  4TV9 A;  2IOQ A;  3FB6 C;  3HB3 B;  1R3K C;  1CGM E;  1MZF A;  3C18 A;  2QWN B;  1SZI A;  4UDV A;  3CRC A;  1N36 B;  4QGP A;  4ULV A;  3T1H B;  3ZHT A;  2Q7R A;  2HSQ A;  4IGG A;  2YI9 A;  3OUS A;  3L1M A;  1JFF B;  5FNV B;  4X20 B;  3K66 A;  1ZTE A;  3JSL A;  1SF8 A;  3VAY A;  5J2U A;  1GM9 A;  1GN3 A;  2B0H A;  1AJQ A;  2ZIN A;  3A11 A;  2YSU B;  4EKW A;  2R7O A;  3CC7 V;  2CNW A;  4F4B A;  3EVK A;  2ZDI A;  2EPO A;  5LP6 B;  4Q6G A;  3EG9 B;  1N34 B;  2GBO A;  1E1R G;  3K04 A;  3OTO B;  2LO1 A;  3JAW B;  3ABT A;  4WBN B;  4Z1M G;  2NPU A;  1Y74 A;  3JAR B;  3K79 A;  4DV1 O;  4OD5 A;  2EIJ C;  2Y69 B;  1OR3 A;  1TWA A;  1G4U S;  2RMK B;  3CCL V;  1T6I A;  5F5H A;  3ZIA G;  3IQT A;  2X0C A;  4KNW A;  4I3M A;  3WHN A;  4DBQ A;  4YY3 O;  2UUC B;  2A06 H;  1SA0 A;  2QE7 G;  2IM9 A;  4IHJ A;  3DC5 A;  3S28 A;  4JE9 A;  2YEV B;  3OMN B;  1V4A A;  4FLT A;  1QCE A;  5H2F Z;  1AEP A;  4FLZ A;  2XAF A;  4I50 A;  2PFD A;  3L9D A;  1QBZ A;  3MDS A;  4UVC A;  4B3M O;  4XWJ A;  5LXT A;  2QY9 A;  3DMD A;  4I9W A;  3E70 C;  1KP2 A;  3W7S A;  2MWQ A;  5DS5 A;  2OTJ V;  2QTO A;  3AGU A;  1N4C A;  2HLD G;  3K57 A;  2H8P C;  2J0W A;  1JPX A;  2BTQ B;  3FB5 C;  5L0F A;  1TVK A;  2ITC C;  1LNQ A;  4UV8 A;  3FKS G;  3RYH A;  3ABL B;  3FAJ A;  1T6Q A;  2L81 A;  3F47 A;  3SJB C;  1SQP H;  4K8Z A;  2PYL A;  2V3C C;  2ZQM A;  1RMV A;  1XL4 A;  1XZP A;  1YDX A;  3HKE A;  3TD7 A;  3AQB A;  5HV9 A;  5L3Q A;  1P49 A;  2IXM A;  1JR9 A;  3FMS A;  3SNH A;  1SS3 A;  3B9Q A;  4PA3 A;  5JH7 B;  1RM1 C;  1VQ9 V;  4G7O F;  4IAR A;  1O87 A;  3B0V C;  3KYJ A;  4JI6 O;  3ZRX A;  4GQH A;  4O79 A;  3B8M A;  3QG5 A;  1QNM A;  1UJW B;  3B8N A;  4OIQ F;  4NTW A;  2RQ6 A;  2X7R B;  1THZ A;  4DXW A;  2BC5 A;  4PJ0 Z;  4AL1 A;  3K5L A;  1IBL B;  4E0H A;  5LA6 B;  3APO A;  3CRQ A;  4U9D A;  3OAA G;  3KKY A;  1FD9 A;  2LFR A;  2WA4 A;  1OXB A;  3UQ8 A;  2XLE A;  5IYZ B;  2W9Y A;  1PL4 A;  1XMQ B;  2EPM X;  5L3V A;  1I5Y A;  3WG7 C;  2M64 A;  2NUT A;  3SXM A;  3UR3 C;  3M8A A;  4KI2 A;  1VF5 B;  4UCR A;  4CS8 C;  2Q4P A;  2IXP A;  4QI2 A;  2JEX A;  2P6V A;  4DUZ B;  3FAP B;  1MQV A;  4I1M A;  3E22 B;  1N32 B;  4O4H A;  4LFC B;  4F6E A;  5DQT A;  2ETN A;  2JIZ G;  3TOM A;  4XDL A;  2KYH A;  3ASN B;  4MVS A;  1ZVZ A;  2EIL C;  1CPQ A;  4MND A;  5CBG A;  2WWW A;  1SQV H;  2Q7G A;  1V74 B;  4UFZ A;  4JI2 O;  3UMI A;  3E8H A;  4MVZ A;  5EIB D;  1HE1 A;  1XZQ A;  2YS8 A;  2R7S A;  2IBF A;  4WF9 V;  2N74 A;  1OKK A;  1RFY A;  1MOF A;  3IGA C;  2XAQ A;  1T01 A;  3DI5 A;  2WPD G;  4OPH A;  3NYM A;  1HNX B;  4DR7 B;  5FPR A;  2ICW G;  4L87 A;  3QO5 A;  5LGU A;  4JAV A;  5IT9 N;  1VOM A;  3TUL A;  5LBQ A;  3HR0 A;  3CCE V;  3W7T A;  1SC5 B;  1WLE A;  2DI3 A;  1JRA A;  3AK1 A;  4DUY B;  3FDQ A;  3D36 A;  2OJQ A;  3LNN A;  1E84 A;  1IW7 F;  1NG1 A;  3RYH B;  3JAM N;  3UMK A;  2DYR C;  1VEW A;  3RYF B;  1PD3 A;  4YHH B;  4TSF G;  2E5L B;  3O6X A;  1A41 A;  1Z3I X;  2PX3 A;  1QLE C;  1M57 B;  4DK1 A;  1K8A W;  2KG7 A;  1FPO A;  4MTX A;  4UCS A;  4DR5 B;  5E3A A;  5LMU B;  1BCC H;  1FFH A;  1TWH A;  4OIN F;  2AW9 A;  2E76 B;  3JCU Z;  4U5C E;  5GTH Z;  3ETD A;  3SYP A;  4JIO A;  5KYU B;  4YIP A;  4BJT A;  4NTB A;  4RUF A;  3D36 C;  4NY3 A;  3ABK B;  1LI7 A;  4DOZ A;  1OW6 A;  1S0V A;  3A2F A;  5GON A;  3SEO A;  2K9P A;  1YXB A;  3T6G B;  5B1O A;  3WU2 Z;  4HEA J;  1E2X A;  2A6E F;  1I5X A;  2DMX A;  2XLO A;  2CE4 A;  3BA9 A;  1ZHT A;  5F2V O;  4PA4 A;  1WB7 A;  3L72 H;  1YA7 O;  1OJH A;  2CW0 F;  4FAP B;  1WA8 B;  4JTD B;  4O4I A;  3KCX A;  4X1Y B;  4I4T A;  3GM1 A;  2ZIM A;  3J81 N;  1BDJ B;  2XUM A;  3CJH B;  1RKE A;  5IWA B;  1L3P A;  5KA6 A;  3NR7 A;  4DR4 B;  3DXR A;  3DTU B;  4FFB A;  1VLT A;  5KYW B;  2IJK A;  3LLI A;  5L3F A;  1OCR C;  3IC7 A;  1B6Q A;  1TWG A;  3UT5 A;  4JCZ A;  4AQY O;  4P30 A;  4DRJ B;  3SYQ A;  1OR2 A;  1ORQ C;  5KYN A;  4GZR B;  3C8G A;  1R3I C;  1WWP A;  4ULW A;  1OCO B;  1ZZP A;  4ZLD A;  3CRM A;  4DRH B;  2VB6 A;  1RP3 B;  4JZ2 A;  2R9A A;  1NFN A;  4JV5 B;  1SES A;  1JPJ A;  3QVZ A;  5BQH A;  4PA9 A;  1J5E O;  3I5P A;  1V55 B;  1R3L C;  5BR8 O;  3OTO O;  3STL C;  3T9O A;  2XT9 A;  1AUE A;  3IQ6 A;  2EJR A;  2LGW A;  4ANJ A;  4KXR A;  2C2A A;  1W2B U;  2W0F C;  5EZY B;  3ZMZ A;  1HNZ O;  3K58 A;  2FAP B;  4G78 A;  3H1L H;  2UUB B;  5CI8 A;  1I4Y A;  2YC0 A;  4DR4 O;  2F22 A;  2GFH A;  2I15 A;  1TKN A;  3ZMT A;  1VK5 A;  2WLI A;  3ZCC A;  2QSA A;  1K92 A;  2HJD A;  5K1X A;  1M57 C;  5FL7 G;  4CS2 A;  3RW0 A;  1K04 A;  4FLX A;  1H7I A;  1VIB A;  3CCM V;  4JI4 O;  2PP4 A;  5BQI A;  1FFX A;  5C93 A;  1DF4 A;  1S76 D;  5AC4 A;  4L6R A;  2EIM C;  4FZ1 A;  5BMV B;  1KC8 W;  3OWT A;  2WVO A;  5LXT B;  5L0J A;  1M5I A;  3BAA A;  1KTM A;  3O9O A;  4JV5 O;  4O2B A;  4X66 B;  3DAG A;  2IJH A;  5FZT A;  2EX3 A;  5CA0 A;  3BRJ A;  3OFN G;  2UU9 B;  5B66 Z;  2MW2 B;  2AZ0 A;  5JH7 A;  4LF6 B;  3I5Q A;  2B1G A;  1GO3 F;  3CEI A;  1SYQ A;  2X6B A;  1AJP A;  2WLM A;  1SQQ H;  1A32 A;  1VLS A;  3BPZ A;  2IXN A;  2VCC A;  1OV9 A;  3WB0 A;  2GV9 A;  1OCC C;  1URF A;  2WLL A;  3JAL B;  1R6T A;  2QDO A;  2HFI A;  3NMJ A;  2R7R A;  2DYS B;  4YT8 A;  1VYK A;  1KYO F;  1NTZ H;  3UGP A;  5KYY B;  3ZJZ A;  4JI7 O;  1W59 A;  3QW1 A;  3K1I A;  4J80 A;  4NKG B;  3SDL A;  3AG1 C;  3UT5 B;  4X1K B;  1Y6X A;  2HR3 A;  3KCY A;  4XEV A;  2ZR2 A;  3WB1 A;  3L74 H;  1XNQ B;  3G4Z A;  2DW4 A;  4J11 A;  3NMK A;  3U10 A;  5FLX N;  2EIK C;  1V9P A;  2PGG A;  3PCV A;  1MA1 A;  1XOU A;  2GAQ A;  1AI7 A;  2E74 B;  3DXJ F;  2R7V A;  3H2V A;  1RCP A;  4PAC A;  2HV6 A;  4RBN A;  3UM7 A;  1L8D A;  4U3F H;  4DR1 O;  2Y3G A;  4AE4 B;  4K7B A;  3WB2 A;  1ZHY A;  2VWK A;  4X64 O;  4DR2 O;  4JI3 B;  2EPK X;  1K05 A;  1GQA A;  3K6B A;  4JAU A;  1OCO C;  2YQY A;  4M63 A;  5JQG A;  1XRE A;  3ZMS A;  3U0Z A;  3SJC C;  3ZG1 A;  4C3B A;  4O6Y A;  2PY5 A;  1EI7 A;  4EBB A;  2ZT9 B;  5D5P A;  4RUE A;  5ITZ A;  2QKA A;  3A0H Z;  1VQP V;  4LF9 B;  4KBL A;  4UB6 Z;  1QVG U;  2OEX A;  3BAB A;  2KC3 A;  1IX9 A;  2X6A A;  5LHG A;  3V5Y A;  4K0K O;  4FJC C;  5A6K A;  1SZT A;  4GX2 A;  4Z9H A;  2H7O A;  4J9Y B;  1FR0 A;  1G5Z A;  3VOU A;  4DV0 O;  2CDY A;  4N21 A;  2VAS A;  3LLK A;  2CNW D;  3G4X A;  3RYC A;  1MMM A;  3QF7 A;  4DR3 B;  4H4K C;  2P5O A;  2YL1 A;  3T4D A;  2HG5 C;  4TWK A;  4JI5 O;  5CA1 B;  5CBF A;  4BWA A;  1FXV A;  4JAS A;  4DK0 A;  2PI4 A;  3JSN A;  2F1M A;  5GON B;  5KAI Z;  1R5I D;  4LFB B;  3FHD A;  1AI6 A;  1XWJ A;  4DRI B;  4RD9 A;  4U5B E;  1F7Y A;  3TQO A;  3PDM P;  3CS5 A;  5LOV A;  1AR1 B;  1XIL A;  4DR5 O;  3G50 A;  1RKC A;  4ZOL A;  2Z3Y A;  3ZWI A;  2VC9 A;  4BW5 A;  2NSG A;  2WLL B;  2P22 C;  3B09 A;  4K8X A;  3CCQ V;  1WPX A;  4UB8 Z;  1JA8 A;  2ASR A;  1I94 B;  3CC2 V;  4H44 B;  1XHX A;  4PDV A;  4PDR A;  1MG1 A;  4QE7 A;  5J2T B;  3K5M A;  2HFE C;  3FD9 A;  4LF4 B;  3ETG A;  3R7C A;  4NTX A;  3X1O A;  3U0C A;  1EM1 A;  1WAZ A;  2H3O A;  5DLJ A;  1JPN A;  4IL6 Z;  2HMQ A;  2L35 A;  3ZHQ A;  1O3U A;  5B3I A;  4GLX A;  3LEO A;  4WGY A;  4JC7 A;  4UUJ C;  4CC6 A;  2Y0I A;  4JGS A;  2PZS A;  4U9E A;  1QKR A;  4MVQ A;  3JAT A;  3LS1 A;  1AIL A;  2PBE A;  3JTL O;  3ZTM A;  1IBK O;  4NXM O;  4XTK A;  4DR6 B;  4OIP F;  4UVA A;  4LFB O;  1LIH A;  4EBK A;  4PV1 B;  1CPY A;  3K9A A;  2P7T C;  1OQC A;  2EIL B;  3K59 A;  5LMU O;  3ASN C;  5D91 A;  2LSE A;  2OCC C;  4D6T H;  5FNV A;  5CBH A;  4UCO A;  2XXA A;  3IQ5 A;  1ZHW A;  5COF A;  3U9J A;  3OEE G;  3RT3 C;  1Q0K A;  5IJ0 A;  3CAX A;  4C7O B;  5EZY A;  5LMN O;  1Z63 A;  1P84 F;  1BHA A;  2FGY A;  2VQF B;  1T9K A;  3ABM B;  4HNA B;  4P9F A;  1NBB A;  5L0H A;  1GTO A;  4IIJ A;  3EGD B;  1VQL V;  1FNT c;  1J5E B;  2YL3 A;  4JVS A;  3CC4 V;  4H13 B;  1ZUQ A;  3ECS A;  2CAZ C;  4Z9I A;  1XDC A;  1JJO A;  1XMO O;  1L1F A;  1YI2 V;  1GRJ A;  5C8Y A;  2F93 B;  3H2U A;  4E7S A;  1TGO A;  4NYK A;  1EA8 A;  3B40 A;  4U5E E;  1YYJ A;  3AG2 B;  5EC2 C;  4XQ1 A;  2AVK A;  5E1A C;  5F5F A;  3WOD F;  3R66 A;  3OEH G;  1PV3 A;  4C3E A;  3M7M X;  3OTF A;  4YJ2 A;  4BPM A;  4U5D E;  1B3Q A;  1ZL8 B;  4KC9 A;  5KA5 A;  4AQY B;  4LBE C;  1RM1 B;  1TFO B;  5KHJ A;  4B3S B;  2AGA A;  3OR7 C;  2EPN A;  4XDK A;  2V1D A;  1N0J A;  1HE9 A;  1FFT B;  4ABM A;  5KLV H;  4CJO A;  1MNG A;  1S72 V;  2NN4 A;  1KQS U;  1YJ9 V;  1XL6 A;  4LH7 A;  4HBN A;  2YLG A;  3VQX A;  1WAS A;  5CA0 B;  2KB1 A;  1HMO A;  4LAC B;  3T1C A;  3FVY A;  1F4M A;  1I7F A;  3SPH A;  1Z5Z A;  2G3K A;  4J10 A;  4X1I A;  3QZC A;  3ABL C;  1Q6H A;  3POV A;  4MVO A;  4AL0 A;  3N2G A;  4PFO A;  4QPK A;  1XEQ A;  4AHC A;  1WB8 A;  1VQM V;  2M4E A;  1NQT A;  2IBZ H;  1GH6 A;  2XND G;  1XMO B;  5BY1 A;  2WSS G;  5KYW A;  2HZ8 A;  3FXH A;  4XDJ A;  1HW7 A;  3PN1 A;  2KSF A;  5D92 A;  4YK5 A;  4Q7C A;  3K1H A;  1H2L A;  4I50 B;  1WP7 A;  2J45 A;  1E1Q G;  1IZM A;  4OIR F;  3JAK A;  3HNJ A;  4KNV A;  4D4X A;  3W7U A;  1WJZ A;  3C90 A;  2RDC A;  2CUG A;  2RNB A;  1JQ0 A;  4FLV A;  4CH6 A;  3RFY A;  2G62 A;  3DE8 A;  1SER A;  1EQ1 A;  3CSX A;  2EIJ B;  4NTY A;  1MMN A;  1Z23 A;  2WZL A;  4DRX B;  3ZRS A;  1ROP A;  1GK9 A;  2Z5U A;  2DOS A;  3AG4 C;  1EN6 A;  2QE9 A;  1GS9 A;  4I0X A;  4MVU A;  4MS2 A;  4YT4 A;  4WAB A;  3UNG C;  2KSD A;  4K35 A;  3LNM B;  3MFN A;  2FL4 A;  2XAG A;  1T5E A;  4X64 B;  3C8G D;  1IXM A;  2J9W A;  3ZHU A;  4LF6 O;  2FTK A;  4N23 A;  2PF4 E;  3OT7 A;  1OHH G;  4XBF A;  3ZVR A;  1LUW A;  1YJW V;  4D4N A;  1YTF B;  2E3C A;  3OD4 A;  2WL8 A;  4YY3 B;  2R03 A;  1NTK H;  1S5J A;  1MAB G;  3DM9 B;  3S27 A;  3Q6N A;  1JFF A;  4DVY P;  3K08 A;  4LWS B;  2Y3B A;  2RD9 A;  1KKC A;  4R32 A;  5ITZ B;  1PCX A;  1YAU O;  4U5H A;  2QJ1 A;  4J7J A;  1DLB A;  1PV0 A;  3VYW A;  3UCS C;  2H7V C;  1OCZ C;  1VF6 C;  2XHB A;  1LKX A;  4FLU A;  1K9M W;  4JYA B;  1F51 A;  2P90 A;  2W6I G;  2A1D D;  3EFO A;  3RQF A;  3ZMU A;  4B7K A;  4BJ1 A;  4E0I A;  4DV6 B;  3CRR A;  3I5D A;  1DGS A;  1YVW A;  1XBL A;  2IJJ A;  2LP7 A;  1HW2 A;  4X20 A;  4JW1 A;  2H7B A;  4PJM A;  2NSF A;  2XS1 A;  3HJC A;  3K1I C;  4MT8 A;  1KB9 F;  3FYI B;  1JVM A;  3SR2 C;  1A7E A;  4JI3 O;  4PJL A;  3RFR A;  4U3J B;  5B1A C;  1ZAU A;  1B68 A;  1YEW A;  1WTY A;  1NU1 H;  1IZ3 A;  3NRH A;  2ZE5 A;  1JX9 A;  3M79 A;  4UCV A;  2GUZ B;  2LFF A;  1SQG A;  1JMK C;  4YT5 A;  1N32 O;  1R6N A;  4PHZ A;  1LS1 A;  1TFK B;  4B3R O;  1NBM G;  4NXN O;  1O5H A;  5KHH A;  3ZX6 A;  2NUP A;  2L9J A;  3SJQ C;  1I94 O;  1H9G A;  3BY6 A;  2JRI A;  3JAL A;  1W0J G;  1Q7Y W;  3EFO B;  3E89 A;  3SXY A;  3AG7 A;  1TWC A;  3KMI A;  1S05 A;  1TVK B;  4DBR A;  2X6C A;  1XNR O;  1D2D A;  1M9N A;  2MHR A;  3H1I H;  4O4L B;  4X1K A;  2QWQ B;  2UUB O;  3N2K B;  5KX5 B;  3TET A;  1CGO A;  5JVD A;  3QTH A;  3DZA A;  4DW0 A;  4NVP A;  3UKM A;  3U8P A;  4FWV A;  1MMA A;  3S3X A;  3TXS A;  1AVO B;  1ZHX A;  5EHH A;  3CME V;  4HZ3 A;  3LSQ A;  2ZXR A;  3ZN0 A;  1Q0F A;  4G7Z F;  2C04 A;  1NVP D;  4HFF B;  1WA8 A;  1Q90 D;  2Q4F A;  1Q0D A;  1KBH A;  2EBO A;  3MAQ A;  3U2L A;  1NFO A;  2ZCE A;  3E83 A;  2W4B A;  5LMN B;  4F6R A;  1Q82 W;  1Y6D A;  3MD0 A;  5B1A B;  5CA3 A;  2GUZ A;  1XI1 A;  1LE2 A;  1TA8 A;  4BAY A;  4PFP A;  3T4Z A;  2UXX A;  3H1J H;  4DR7 O;  4EFE A;  4BEM J;  1KNY A;  4WGZ A;  3GM2 A;  4NCQ A;  3O39 A;  2NUT B;  3RYC B;  1DK1 A;  2F95 B;  2KKW A;  1QLN A;  1XNR B;  1H2M A;  1LE4 A;  2Q0O C;  1D0Y A;  5LGT A;  3FAV B;  2OG2 A;  3ZHR A;  4C3D A;  1I4Z A;  2LQT A;  3JZ0 A;  4PJJ A;  1VTM P;  3PHF 2;  4BJ5 C;  2YIB A;  1OCZ B;  1SRY A;  1JJ2 U;  3ASO B;  3ITF A;  5EC1 C;  2OIG A;  5IJ9 B;  1NI8 A;  4FK5 C;  1QQ3 A;  1PM9 A;  5L3G A;  1P7G A;  2V26 A;  3SYO A;  4PA6 A;  3W2V A;  4MVM A;  3VF0 A;  1Y76 B;  1E79 G;  4K1O A;  1FS0 G;  4PA7 A;  4ZHQ B;  2Q73 A;  3RVZ A;  2EPL X;  3N0T A;  1VF6 A;  1YSC A;  1Z7Q c;  2R7Q A;  1G4W R;  2ZXO A;  3AGT A;  4W4L A;  3ASO C;  4X62 B;  3F46 A;  4YJ3 A;  5LHI A;  2F66 C;  3DE9 A;  4QDL A;  3ICX A;  4MTO A;  5A2Q N;  4UVB A;  3MYF A;  2LGQ A;  3C8Z A;  2A79 B;  4JUR I;  4C7U A;  4DR2 B;  1PNM A;  3L34 A;  3QMK A;  4J9Z B;  4CZZ A;  2P67 A;  1E83 A;  3P3P A;  4FM2 A;  5H9C A;  2JGD B;  2WVN A;  1QVF U;  4LH6 A;  5F28 E;  1LR1 A;  3JAR A;  1HNW B;  1BR4 A;  1FJG B;  1BSM A;  2EUL A;  1J8M F;  3ABU A;  1YA9 A;  3GEI A;  2Q9C A;  1Q6U A;  2QR4 A;  2ZM6 O;  1GN2 A;  1Z2G A;  4B3T O;  3NKD A;  3ZTZ A;  2Q68 A;  4H0L B;  1GN4 A;  1HR0 O;  4F6R B;  1Q5O A;  1TUB A;  2R9I A;  5GW7 A;  1JOG A;  1K40 A;  3GWL A;  5KYY A;  1D5A A;  3K5O A;  4B3S O;  2CYD A;  5KHK A;  2UXC O;  2EZO A;  1WOL A;  5COM A;  2B1I A;  1UG7 A;  1QZX A;  2DQ3 A;  3BHP A;  3S3W A;  2W45 A;  3ZS8 C;  3HKE B;  3EGD A;  1R6K A;  1N1C A;  4Q20 A;  4IIJ B;  4CS9 C;  2QEX V;  3SP1 A;  3Q7G A;  3G4S V;  3ZRW A;  4NQF A;  2QWP B;  3WFV A;  1R4T A;  4JTC B;  5EYP A;  3OEO A;  5IYC O;  4JI4 B;  4DV4 B;  2ADQ B;  1AVM A;  4RQF A;  2A6H F;  2KK1 A;  1SQB H;  5T3W A;  2R9R B;  3H01 A;  3C63 A;  5IJ9 A;  3JD1 A;  1WN7 A;  1YLM A;  4I7Z B;  4I5S A;  4FVM A;  2XM0 A;  4CDV A;  1JR8 A;  3M1C B;  3OR6 C;  5T1D B;  3TK1 A;  5CI9 A;  4GEH A;  5H6R A;  4X66 O;  1YJN V;  1TR2 A;  2A68 F;  3CP1 A;  3EGX B;  2YDE A;  2YEV A;  2BSK A;  2UU9 O;  4JI0 B;  1SET A;  3BCC H;  5DED A;  4QNH B;  2H8A A;  3U8V A;  1AI5 A;  2EZP A;  1CGN A;  3ZMV A;  2JJ1 G;  4MSW C;  1CPR A;  3I56 V;  1EN5 A;  2YIA A;  1IBL O;  1D1A A;  3LEV A;  4GKK B;  4B6I A;  4E17 A;  1Q0G A;  1IVS A;  3ZBH A;  3SYC A;  1K3E A;  4J41 A;  3AG2 C;  4P6I C;  2RCV A;  2IYL D;  1M6T A;  1BBH A;  2NR5 A;  5IYZ A;  3ZIB A;  4LF8 B;  1D0X A;  3RWR D;  2JS3 A;  1NKD A;  4AK9 A;  1NH2 B;  4J7T A;  3ZDL A;  1M90 W;  1Q81 W;  4TT3 G;  1YVI A;  2VQE B;  4OX9 O;  4RDA A;  4LLC A;  1W2W A;  3ABM C;  3U2M A;  3MBG A;  2Q9B A;  4JAA A;  2XOK G;  2VCA A;  5JUA A;  1OW7 A;  3HTK C;  2H94 A;  3TJT A;  2Q9A A;  2VH3 A;  4I1O B;  2WA3 A;  1KUQ A;  3CZ6 A;  2QKS A;  4Z2W A;  4LF7 O;  2JX0 A;  3QO7 A;  2PX0 A;  1QQC A;  4JI0 O;  4UXN A;  1ZSP A;  2FKX A;  4WFG A;  1BMF G;  3BVO A;  5L3B A;  4JI7 B;  2CH7 A;  2IJI A;  3DJN B;  1KMI Z;  4EB6 B;  3CWB H;  3AEI A;  1WPB A;  3H65 A;  3RQG A;  4CDA A;  3RN4 A;  2DE0 X;  3JD4 A;  1UPG A;  1SA0 B;  4P9P A;  3RYI B;  4MW8 A;  3L8J A;  3CXC U;  1FXK B;  5B3S B;  2CGE A;  4EBJ A;  2KW3 C;  4DV6 O;  3AG4 B;  5HFL A;  1SQF A;  4H54 A;  4B3M B;  3ZC4 A;  2P4V A;  3FOO A;  3T1H O;  1TAE A;  5J2T A;  4QE9 A;  4XPX A;  4ZBM A;  3E22 A;  2E87 A;  5A6A A;  4UCU A;  3SXK A;  1ENV A;  1VQ6 V;  1YTF D;  4O4L A;  3G6B A;  4R50 A;  3A9C A;  3GEE A;  5JP7 A;  1FMW A;  4OIO F;  3UO2 A;  3MLG A;  3SPJ A;  4OX9 B;  3C62 A;  3CRA A;  2LW7 A;  2R72 A;  3EQL F;  3JSZ A;  1H2K A;  4WFB V;  1N0N A;  2HJF C;  2XAS A;  4IYI A;  1YCI A;  4J32 B;  5L0I A;  5BZB A;  1AR4 A;  1FMV A;  3RYF A;  2UXN A;  2ITD C;  2M7W A;  2QGN A;  2XAJ A;  4BJ5 A;  2J9V A;  4LR3 A;  5LHH A;  3RQE A;  4FFK A;  2WLJ A;  4TUY A;  1M2V A;  1OZ0 A;  5CN0 A;  1FYJ A;  3M4B A;  4PDL A;  5T3T A;  3KYI A;  5KHG A;  1VQ7 V;  5JCO C;  4ZHQ A;  4BR6 A;  4L8J A;  4TOI A;  3U5S A;  1Y76 A;  4CBE A;  4CS7 A;  4MTG A;  1RSO B;  5KYX B;  4NR1 A;  1Q86 W;  3FB7 C;  3LJB A;  3T6J A;  3JAS A;  4HFK B;  2MK3 A;  2OCH A;  2QNL A;  3X2Q B;  2L6L A;  3K06 A;  1NR7 A;  1HY5 A;  5H6Q A;  3U11 A;  3RYI A;  1K73 W;  3EH2 A;  2R7X A;  3E9V A;  1XMQ O;  4WFE A;  1FFT C;  3SPI A;  1ZL8 A;  1F23 A;  2ODM A;  1TUB B;  1VP7 A;  3EFF K;  2OOC A;  3E35 A;  4EB6 A;  2P61 A;  5JJE B;  3M15 A;  2Y48 A;  3ZRV A;  1WNS A;  4NXM B;  2FB5 A;  3SGI A;  2CGO A;  4W8P A;  3Q4H A;  4BJ6 C;  5A69 A;  4G28 B;  2Y4T A;  4JEB A;  4LP8 A;  4U3J A;  4A5U B;  3RVY A;  1RKE B;  3IHU A;  3ZRW B;  1MNE A;  4N6H A;  2OKU A;  4BEJ A;  2JGD A;  2R02 A;  3RF3 A;  4JI1 B;  1E86 A;  2GTS A;  1ST6 A;  4FES A; 
#chains in the Genus database with same CATH homology
 4PJN A;  3DD7 A;  1WJZ A;  4CS8 C;  4CS9 A;  2CUG A;  2IXP A;  4QI2 A;  2Y4U A;  3RFY A;  2G62 A;  1ZU4 A;  3MX3 A;  2P6V A;  2Y69 C;  4I1M A;  3EJN A;  4C7O A;  1MMN A;  1Z23 A;  2WZL A;  5B1B C;  4IRU A;  5DQT A;  5KYU A;  2IXO A;  3AG4 C;  3APQ A;  1S7Z A;  2EIL C;  4MND A;  5E3C A;  4YT4 A;  3UNG C;  3UMI A;  2DYS C;  2YS8 A;  2R7S A;  1WGW A;  1OKK A;  2J9W A;  3AG3 C;  2PF4 E;  3NYM A;  3NYJ A;  3ZVR A;  1M2O A;  3CQZ A;  3L0I A;  1FTS A;  1D0Z A;  1VOM A;  1BQ0 A;  2WL8 A;  3DM9 B;  3I4U A;  3S27 A;  3FDQ A;  3Q6N A;  4DVY P;  1IW7 F;  1NG1 A;  1OKK D;  2Y3B A;  4IJJ A;  3UMK A;  3EHN A;  2DYR C;  3Q7L A;  1PCX A;  4U5H A;  3GOD A;  5BUO A;  3VYW A;  3UCS C;  4AE4 A;  2H7V C;  1OCZ C;  1LKX A;  4YN0 B;  2M6Y A;  4GYT A;  2KGO A;  3O6X A;  1Z3I X;  2PX3 A;  2A1D D;  3EFO A;  1QLE C;  2CTR A;  1FPO A;  4BJ1 A;  2WZG A;  5E3A A;  1FFH A;  4OIN F;  1TWH A;  1XBL A;  3LAY A;  4JW1 A;  5DS6 A;  4O7G A;  4U5C E;  4RWU A;  2H7B A;  4PJM A;  2C03 A;  4AX2 A;  2KJG A;  3S0X A;  3HJC A;  5DQZ A;  3K1I C;  1PD0 A;  2ZPA A;  4BJT A;  5KYU B;  4NY3 A;  4PJL A;  4DOZ A;  5B1A C;  1ZYR F;  4Q4Z F;  3SEO A;  3NRH A;  4HEA J;  2GUZ B;  2A6E F;  3V7O A;  2DMX A;  4YT5 A;  1LS1 A;  1ZHT A;  2WVQ A;  4WJ0 A;  1O5H A;  4YT2 A;  2CW0 F;  5DVW A;  2NUP A;  2L9J A;  4HE8 D;  4I44 A;  1BQZ A;  2Q3T A;  4JCH A;  3EFO B;  2KQ9 A;  3AG7 A;  1D1B A;  1TWC A;  3KMI A;  3S29 A;  4DBR A;  5EGY A;  5KYW B;  1MMD A;  3AQC A;  3LLI A;  1OCR C;  1TWG A;  4EWC A;  2CTQ A;  4XLP F;  5KYN A;  2QWQ B;  1ZU5 A;  2J9U A;  4ULW A;  3DZA A;  4Q5S F;  4ZLD A;  4FWV A;  2VB6 A;  4O6N A;  2J46 A;  1MMA A;  3SZR A;  1ZHX A;  5EHH A;  4J7Z A;  2ZXR A;  1HDJ A;  3EGX A;  3EPV A;  1JPJ A;  4G7Z F;  4J30 B;  2C04 A;  5FCL A;  3I5P A;  4HFF B;  2NUP B;  2W4M A;  2FFH A;  3GAN A;  2W4B A;  5E33 A;  1M56 C;  1V54 C;  2G3V A;  3PMR A;  3EHM A;  5IY5 C;  4W8K A;  2LGW A;  3EG9 A;  1NZ6 A;  2GUZ A;  3ABK C;  4ANJ A;  2BE5 F;  3W8I A;  4PFP A;  4YWQ A;  3EZH A;  2YUA A;  1J8Y F;  5CI8 A;  2O9X A;  3O39 A;  3Q6M A;  2NUT B;  3W8H A;  3UGO A;  2DGJ A;  2GFH A;  1TKN A;  1VK5 A;  3N2Z B;  3NDB B;  1D0Y A;  2J7P A;  2QSA A;  3DM5 A;  4N06 A;  2ZXP A;  3CSK A;  4X0R A;  3JRT A;  2OG2 A;  4E7Z A;  1M57 C;  3JT1 A;  4C3D A;  2XL4 A;  4PJJ A;  3PHF 2;  4JJF A;  2PP4 A;  4BJ5 C;  3UMH A;  2MYS A;  3ITF A;  3K33 A;  1RJ9 B;  2V26 A;  2EIM C;  2CTW A;  2XRH A;  3W2V A;  3OWT A;  2WVO A;  3KKB A;  4U5F E;  3T4R A;  2J7P D;  3N0T A;  3DAG A;  1KU2 A;  2R7Q A;  2ZXO A;  1LVK A;  2XXA B;  3LS0 A;  3DJU B;  2QTV A;  3IEE A;  3ASO C;  3F46 A;  3OA1 A;  3I5Q A;  3LNR A;  4QDL A;  2IXN A;  4A2N B;  4CSA C;  1OCC C;  4JUR I;  3QMK A;  3L34 A;  2R7W A;  2R7R A;  4YT8 A;  4YJW A;  1VYK A;  4DVZ A;  3UGP A;  2X51 A;  4PK4 A;  5KYY B;  1FAF A;  4JJG A;  2WVN A;  4J80 A;  4LER A;  1BR4 A;  4IAO A;  3AG1 C;  4MQ9 F;  1J8M F;  2Q9C A;  3NKD A;  3RKO F;  2QWR B;  1MND A;  4XLN F;  2EIK C;  3JYH A;  3DXJ F;  1Z6A A;  1V55 C;  2R7V A;  5KYY A;  2HV6 A;  4RBN A;  2Y3G A;  4AE4 B;  4K7B A;  3UO3 A;  2ZXW C;  2Y39 A;  1QZX A;  1ZHY A;  2W45 A;  3W2W A;  2EJ7 A;  3EGD A;  1N1C A;  3ZSU A;  3EH1 A;  4CS9 C;  3K6B A;  3SP1 A;  1OCO C;  3Q7G A;  4M63 A;  2QWP B;  2HV7 A;  1VMA A;  1NZE A;  3ZG1 A;  4C3B A;  4EBB A;  4O6Y A;  2D5R B;  3OEO A;  5KYX A;  2N04 A;  2CTP A;  2QWO B;  2A6H F;  5T3W A;  4ZLC A;  1NU7 D;  1M2V B;  1RJ9 A;  4KBL A;  1ZHZ A;  1IUR A;  3M1C B;  2WZF A;  5T1D B;  1BR2 A;  3DAF A;  4GEH A;  5CI9 A;  2A69 F;  4G7H F;  1TR2 A;  2A68 F;  3KL4 A;  2H7O A;  3EGX B;  2YEV A;  3X2Q C;  2EIN C;  1SMY F;  2VAS A;  2R7T A;  3LLK A;  2CNW D;  1D1A A;  1MMG A;  3LEV A;  4B6I A;  4H4K C;  1G8X A;  3K7D A;  2I8B A;  4BJ6 A;  2DN9 A;  3FHD A;  3AG2 C;  4CIH A;  2YHS A;  4P6I C;  2B0J A;  2IYL D;  3NYL A;  4RD9 A;  4U5B E;  3ZIB A;  1D0X A;  2Y3H A;  1PD1 A;  2Y3D A;  4AK9 A;  3RH3 A;  4CS8 A;  4OD4 A;  3JCU Q;  4U5G A;  4QI0 A;  4JZA A;  2P7V A;  4RDA A;  5DS4 A;  4LLC A;  1W2W A;  3ABM C;  2IOQ A;  2Q9B A;  3HTK C;  2Q9A A;  2VH3 A;  3X1O A;  2QWN B;  4I1O B;  5DLJ A;  1SZI A;  1JPN A;  3CZ6 A;  3N24 A;  2PX0 A;  2CDQ A;  5B3S C;  3B0U X;  4IWB A;  3BVO A;  3DJN B;  3K66 A;  3LS1 A;  1SF8 A;  3H65 A;  3VAY A;  3T6B A;  4XTK A;  4OIP F;  2R7O A;  2CNW A;  4F4B A;  3HLZ A;  4G0H A;  3LES A;  2CGE A;  3NG1 A;  2KW3 C;  3EG9 B;  3ASN C;  5D91 A;  2NG1 A;  2LSE A;  2OCC C;  2XXA A;  3ZC4 A;  2LO1 A;  1ZHW A;  4OD5 A;  4C7O B;  2E87 A;  2J0X A;  2EIJ C;  1Z63 A;  2FGY A;  1TWA A;  3NKE A;  2YZS A;  5F5H A;  4DBQ A;  4KNW A;  4I3M A;  1FMW A;  4OIO F;  3UO2 A;  3MLG A;  3RIP A;  3EGD B;  4JVS A;  3JSZ A;  3EQL F;  4J32 B;  3S28 A;  3ECS A;  2JD3 A;  1FMV A;  2N05 A;  3KH2 A;  4BJ5 A;  2J9V A;  2PFD A;  4E7S A;  1M2V A;  3SYN A;  4XWJ A;  5T3T A;  3DMD A;  2QY9 A;  3E70 C;  4U5E E;  2MWQ A;  5DS5 A;  4CBE A;  1N4C A;  3B0P A;  3WOD F;  5F5F A;  2J0W A;  4CS7 A;  4C3E A;  4BG0 A;  2WB7 A;  4K0D A;  3FAJ A;  4U5D E;  5KYX B;  2L81 A;  3F47 A;  4KC9 A;  3LJB A;  3T6J A;  5E2Q A;  3RYL A;  4HFK B;  2V3C C;  2OCH A;  2Z15 A;  2L6L A;  3TD7 A;  3AQB A;  5L3Q A;  5HSW A;  4CSA A;  2IXM A;  3EH2 A;  2R7X A;  3E9V A;  1FFT C;  3SNH A;  3B9Q A;  4LAC B;  3FVY A;  2XSE A;  4G7O F;  2KQX A;  3B0V C;  1O87 A;  1Z5Z A;  2G3K A;  3QZC A;  3ABL C;  3POV A;  4O79 A;  4PFO A;  1D1C A;  4BJ6 C;  4OIQ F;  2M4E A;  2Y4T A;  1GH6 A;  1BR1 A;  2KNH A;  1MNE A;  5KYW A;  4BEJ A;  4FX5 A;  4O6M A;  3APO A;  1VYI A;  5D92 A;  4Q7C A;  3K1H A;  3EZI A;  2W9Y A;  2R7U A;  1NU9 C;  5L3V A;  2J45 A;  4LLE A;  1IZM A;  4OIR F;  2NUT A;  3UR3 C;  3WG7 C;  4IT5 A;  4KNV A;  1ST6 A;  4FES A;  4KI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...