2PF4E

Crystal structure of the full-length simian virus 40 small t antigen complexed with the protein phosphatase 2a aalpha subunit
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
172
structure length
163
Chain Sequence
b'MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWASSLNPGVDAIYCKQWPECVKKMSTNCICLLCLLRMKHENRKLYRKDPLVWVDCYCFDCFRMWFGLDLCEGTLLLWCDIIGQTTYRDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
publication title Structural basis of PP2A inhibition by small t antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase regulator/viral protein
total genus 40
structure length 163
sequence length 172
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02380 Papo_T_antigen T-antigen specific domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2pf4E01
1.20.120.1860 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2pf4E02
2DN9A 3BVOA 1N4CA 3UO2A 1IURA 2YUAA 2CTQA 2N05A 1GH6A 3UO3A 1BQ0A 3APQA 2DMXA 2PF4E 2Y4UA 1HDJA 2CTRA 3APOA 2LGWA 2KQXA 4RWUA 1FAFA 1BQZA 2GUZB 2M6YA 2QWQB 3UCSC 2CUGA 2QWOB 2CTPA 2Y4TA 2QWRB 1FPOA 4J80A 2CTWA 1XBLA 2LO1A 2N04A 2QWPB 1WJZA 2L6LA 2QSAA 4J7ZA 2GUZA 2YS8A 2OCHA 4IT5A 2QWNB 3AG7A 1NZ6A 2EJ7A
chains in the Genus database with same CATH superfamily
2AXTZ 5E79Z 2V1DA 4WFBV 1GM9A 2R7OA 4O4HB 3EGXA 4PD4F 3CCLV 4G7OF 2WLMA 2P7TC 2NUTA 1P49A 2P4VA 2IXNA 2OCCC 5JJNB 1MMGA 3IQTA 3CEIA 4WGZA 2HG5C 1KBHA 4WJ0A 1ROPA 5KMGB 4EFBA 3R65A 1F23A 4GX5A 2WVQA 3JD0A 3VYWA 3X1OA 4JYYA 4DR5O 2JJ1G 4P9PA 3K5NA 2UXDO 1BCCH 1KD1W 2EIMB 5KHJA 4YIOA 4X62O 4U9EA 1VIBA 3D36A 5CB4A 3JCUZ 1RM1C 3LESA 1THZA 4EKWA 2IBFA 1QCEA 3O10A 1NVPB 2I8BA 1D0XA 5GTIZ 2D5RB 2RQ6A 2F4VB 3UGOA 4W8KA 1MG1A 4YHHB 4G27B 2WA3A 3ABKC 1Y4CA 3MYFA 1NQTA 4UCRA 1FXKC 4D7TA 3KH2A 2WZFA 2H8PC 1QR9A 3AK2A 1PP9H 1RKEA 4DRIB 4WFEA 2CTQA 1F7YA 3U2LA 2XS1A 3E89A 1OCCC 3EG9A 2ZIOA 2EIKB 3OTOB 3JD1A 1YA7O 4HBNA 5KYWA 4PJLA 3H01A 2BE3A 4EFEA 3UM7A 1ZLZA 3K66A 5IY5C 5A6KA 3JATB 4YL1A 3OM3B 5COGA 5L3DA 3RW0A 3ZS8C 4U3JA 2A0BA 3EGXB 3NG1A 2X6AA 4JAVA 5LOVB 4BJTA 2A06H 3FB8C 3F5TA 2A0UA 4NQFA 3RQGA 1RXQA 3DSQA 2YUAA 2XASA 3HKCB 1Q6HA 2FL4A 2FMLA 3QNEA 4X89A 1N8RW 2HHHB 2HKVA 2O9XA 4KC9A 1GN6A 3APQA 5DS6A 5LP6C 2HEPA 1TFKB 3BAAA 3CQZA 4JF3A 1K73W 2E76B 3S29A 1OKKD 5IJ9B 1OW8A 3Q7LA 2PI4A 1GN2A 2R9RB 5JH7B 2UUIA 1A7DA 1AILA 3I5DA 1N32B 3GWNA 3U11A 5EC1C 4CS4A 2I15A 4WCEV 5KX5A 2M64A 3C62A 3HKKA 3AEIA 2XAHA 1KP3A 1F4NA 1NLXA 1BE3H 2P67A 3P32A 3O9OA 4DV5O 1LS4A 4JV5B 3T1HB 3QW0A 4N6CA 3V5XA 3CC4V 4QIWF 2HV7A 4RUFA 3RVYA 4P2ZA 4ICGA 2W6IG 3VBBA 3RYFA 3JTLO 1S05A 1LE2A 2M6YA 3JRMO 3QTHA 5CI9A 3RVZA 1LS1A 3WODF 4J10A 1AB3A 4JZGA 4J32B 2UU9O 3EFOB 2XTAA 3B8NA 5BR8B 4BEMJ 3ABMC 2E87A 2PX3A 2YS8A 1MZEA 2OEXA 4MVMA 4GX0A 2CNWD 2IM8A 4X0RA 1I7FA 5KYWB 2ZE7A 3B29A 1Y4MA 1PD3A 1YVWA 1Q0GA 4JCHA 1M6TA 2NR5A 5B1AB 5DEDA 1U89A 4U5BE 4DBQA 2F93B 2LK4A 4XDKA 3FX7A 3SPJA 2Q6AA 2ZD9A 1XILA 4RBNA 1AVMA 3K57A 5L0FA 1K34A 3ML0A 2RN9A 3ABLB 3ZN1A 2Q00A 2N04A 1HNZO 2QTOA 2LQGA 3OW2U 4I4TB 3VOUA 1CEZA 2YEVA 1NI8A 4JCZA 4JI5O 1AEPA 4OPAA 1AI4A 3I55V 3T4RA 2KYHA 1SQFA 4IB4A 2ZXWC 3NXSA 5GTHZ 1QR8A 1HNXB 1Q0MA 1ZZPA 4W4LA 4JC7A 3OEHG 1ST6A 3M7MX 1S72V 1PPJH 1PNMA 2EILB 4IARA 3W7SA 5F28E 2J9WA 1K33A 1RFYA 4U5FE 3RYHB 2WZGA 5LMUB 1EA8A 1VLSA 4D4XA 4JI3B 4PJNA 4YT5A 2KSDA 3I56V 4JYCA 4O4LA 3SYAA 3UMHA 4MNDA 2WVOA 1SR2A 3MDSA 2HSQA 4CBCA 3EH1A 4ANJA 2IBZH 5FNVB 1CGOA 5L3VA 3B9QA 2BSKA 2XLVA 4DO2A 2IOQA 2OYQA 5LMNB 4X20B 2XM0A 1NT2B 5FLXN 4MVQA 2EINB 2JRIA 3ZIAG 3U8VA 5B1NA 4XDLA 5CMUA 2N74A 4I0XA 1JPNA 1N34B 5KYUB 5DS5A 1ZTEA 1Q8IA 4PDMA 4LACB 4QPKA 4MQ9F 1YTFD 1SKVA 2GV9A 3F7YC 4AK9A 3RH3A 2AHZA 4NB5A 5IJ0A 5BQGA 4OD4A 2HJ3A 1V74B 4UVBA 1K8AW 3HKEA 5JT4A 4KFMA 3GWLA 5GPGB 5EBLC 2YC0A 4OX9B 2HV6A 5L0CA 2R7VA 2Q5ZA 3CRQA 4DR2O 4JI8B 3KKBA 1D1AA 4QI2A 1YXBA 1WGWA 2UUHA 2JJ2G 2BCCH 1K5QA 4DK1A 2Y3DA 2JEUA 3DXJF 4YY3O 1NFOA 1YJGA 2LGQA 4FLVA 4EHPA 2YEVB 5CBFA 2R02A 3C8GB 3K6BA 1T6QA 1NR1A 1U97A 2QWPB 2Y69C 5LXTB 5JCOA 3J80N 3SXZA 2YKZA 4LF5O 3EGDB 2IJHA 3FB6C 5KHHA 3MHSC 1K9MW 2ASRA 4AI8A 4ZKIA 2EJRA 4JEAA 2AU5A 3E22B 1ZAUA 3Q4HA 2CGOA 3DC5A 1G4US 2KQXA 2Q67A 1WWPA 3K5LA 1HE1A 2HP8A 2YLDA 1XWJA 4E17A 4O4IA 2NN4A 2P1AA 4CS8A 3WG7B 1MMNA 2QDOA 3A2FA 3JYYA 1AR1B 1IBLO 1DOWA 2P90A 2BSKB 2P61A 1J95A 1GGQA 5T3WA 1APCA 3GB7C 4DR5B 3DKAA 3A11A 3A8TA 2F43G 3K79A 4CZZA 1N4CA 2ADQB 3HNJA 3KL4A 3FKSG 4X62B 1M56C 1T6UA 1VQKV 1OCZC 2Z3YA 5LGNA 2H7OA 1MNDA 3NMJA 3DZAA 5L0IA 1JQ0A 1WN0A 4ZI7A 4DR1O 2C03A 3LSSA 3LEOA 4LDQA 4LF8O 3JSLA 4I50B 2CUGA 3HKEB 3JAMN 3ETDA 1ZYRF 2B0HA 2YL0A 3B4SA 3U0CA 4DV2O 4LDRA 3S3XA 1Q0KA 2OEVA 4U5HA 5JP7A 2UUCO 5A6BA 4LF9B 5L0GA 2IJKA 4JTDB 2Y3HA 2DYRC 3HKDB 5CA3A 3MD0A 2YIBA 4G78A 2P6JA 3DE9A 1SF9A 1NH2D 1LUVA 1WNSA 1OXBA 1IZ3A 3V5YA 2Y4UA 3SYCA 3ATPA 4JW1A 4DVYP 1I5NA 2MHRA 5JUAA 4TV9B 1WPBA 3EVKA 1LIHA 5D92A 3SJCC 5J2UA 1VTMP 2PX0A 1F4MA 3Q4HB 2HMZA 5IYBO 5JLIA 1HW7A 3G4XA 2NPUA 2WLKA 2KNHA 3IPMO 3NMKA 1MQVA 5EYPA 1A41A 3CB2A 1XHXA 3QF7A 4CH5A 5EHHA 1EFRG 3LSQA 4U5DE 3G80A 2G3KA 2NSFA 1F51A 5L0JA 4BJ1A 1GTOA 3AG7A 1NU7D 4ZI7B 2OQMA 5KYXA 1TUBA 3B0VC 1VARA 3JCUQ 1JX9A 4UCUA 1JOGA 1JR9A 3OR6C 2Q8VA 3T6BA 3CCMV 4UV9A 4C7OB 4MVSA 2R7TA 1Y76B 1VF6A 2V7QG 4NKGB 1VEWA 1AR5A 4YHHO 3GEEA 3J81N 2R7XA 2YXLA 2H8AA 4UB6Z 1TWHA 3JASA 3AG1B 2YRFA 2E3CA 2JIZG 4LF7B 2EJ7A 1T9KA 2EIJC 1NTKH 1LR1A 4OGQB 4YL0A 1FXHA 2QA4V 3T1YB 3DMDA 4DR6O 2G3VA 1FFTB 4LR3A 4NVPA 4PK4A 3TXSA 3BABA 1UJWB 4LFBO 3JARB 1FFXB 1G5ZA 3WFVA 4O79A 5CA0A 5KHKA 1P7GA 5FPRA 4OIRF 1FR0A 1JJ2U 1DK1A 1U6HA 5B5EZ 2JD3A 2DQ0A 1NZ6A 3B8MA 4HNAA 4JI5B 3OUSA 4UVCA 2HHHO 2AWYA 2LP7A 4PV1B 1UG7A 1DF4A 1VF7A 2DMXA 1BL8A 2IU0A 4G28B 4A2NB 1K4CC 2Z15A 1XL4A 4L8JA 1QVFU 5KLVH 2HS5A 1S5LZ 1K5SA 1Q0FA 1TR2A 4I3MA 2LO1A 1TUBB 2FAPB 1ZW2A 2QE7G 2MW2B 4F6EA 2PBEA 3OGIB 1TUEB 2WSSG 3CXHF 2AVKA 3F7VC 4JV5O 3RYCB 4IRUA 2Q7EA 4DRXB 4XPXA 4CDYA 4JGSA 4YN0B 2R9AA 4HAMA 4FZ1A 2FYUH 2O57A 3D36C 1V54C 4KI2A 2FTKA 1FYJA 1ENVA 2OTLV 3DC6A 2QJ1A 3C3SA 3AG2C 3TULA 4JI0O 4YXWG 4JI1B 3VQXA 1TWCA 2DWDC 3OEOA 4JEBA 1H2SB 2FKXA 4GYTA 2YDEA 3NDBB 2WVNA 4K35A 3DD7A 2HMQA 1NJIW 2HVKC 4QDLA 3CD6V 4FESA 3ZHVA 3KMIA 3HNLA 3M1CB 4YT4A 4FLZA 4GX1A 4N4WA 3A0HZ 1T5EA 1QPUA 5CA0B 4DR2B 2KW3C 2MYSA 3TJ5A 3P3NA 4NTFA 3QVZA 3APOA 3G67A 2LD6A 1WB7A 2HR3A 1QNMA 5LYJA 2DYSC 1K05A 2BE5F 1H8EG 4NTYA 4YY3B 4FM1A 4FFBA 2JGDB 2UXNA 3ASOB 4JI4O 4F6RA 3E8FA 2KG7B 4JVSA 1EZVH 1GO3F 1S77D 1HE9A 2NUPA 3CJHA 3E8HA 3OWTA 3DJNB 4LNUA 3ZRXA 1FD9A 1YCIA 3LSUA 1H38A 5LHHA 1JMKC 2FGYA 5A69A 3M99B 2Q9CA 4TSFG 3CCQV 3S28A 3W2WA 5C8YA 4BJ5C 5GONA 4B3RB 2YHSA 3GVMA 3NR7A 1TWAA 3ETEA 3CMAV 2EPLX 4D7SA 4PJMA 4O4HA 4EBKA 4JI3O 4NTWA 5L3QA 4CH3A 2WPDG 5D5PA 4YT8A 1IBLB 2VH3A 3ZC4A 1GM8A 3T1CA 1ORYA 3A0BZ 4DR3B 5DVWA 3TGUH 1YJNV 3RBZA 4FFKA 5KMGA 4LP8A 4B08A 5KA6A 4GQHA 3VRCA 3IQCA 2A9HA 5JRAA 4MW8A 4DXWA 3EPVA 4J7YA 2F95B 2W4MA 2YLIA 2UUAO 2EPMX 2J8WA 1H2MA 4JTAB 4XWJA 3OUFA 1D1BA 2D2CB 4KHPO 1QHTA 3ZHQA 3FAVA 2P06A 3CEXA 2ITCC 1GN4A 1E79G 3AG3B 4LF8B 2R05A 3ZBHA 4DV2B 1AVOB 4H54A 1VB5A 3PCVA 1O5HA 1I94B 2UUCB 4J7JA 3TK0A 1R5ID 3IC7A 4OX9O 4NYKA 1WOLA 4DJ9A 4JI8O 1LPEA 3IQ5A 1HMOA 5JQGA 3FAPB 2XT9A 4NXMO 1RCPA 4F6RB 1WASA 1RP3B 4YWQA 4XDJA 2XLMA 3WHNA 2VQFO 3CJHB 4LNUB 1CGNA 2R7QA 2E5LO 2HJMA 4TQDA 1VLTA 3W4YA 3MAQA 3KYIA 1C17M 2ILMA 4DW0A 4ER9A 1MZFA 1PV0A 3JATA 5B3SC 4PA9A 3ZHSA 3SXKA 1ZHTA 1SRYA 4A5UB 4MVRA 4YT2A 4LH6A 1RJ9B 1FNTc 5LOVA 3UR3C 4PJJA 4JAUA 2ZXPA 3JSZA 2PI5A 1K3EA 4PACA 4LFCB 3POVA 5A9GA 3GEIA 2KKWA 2QTSA 3ZX6A 3HKCA 1DF5A 3MBGA 5H2FZ 5KHGA 4B3SO 1YTFB 2LQTA 2AWCA 4OIOF 2F22A 4ABMA 5JJJB 1HWYA 3N2KB 5BQHA 5IJ9A 2D4UA 5JH7A 3QZCA 3RQEA 3AOUA 1ZU4A 3CXCU 3FAVB 1UFBA 2EX3A 2ARHA 5EGYA 1NBBA 2VASA 1KUQA 3QO7A 4BG0A 2R03A 4Z2WA 3U0ZA 3QG5A 1PD0A 2XUMA 2R25A 3W8IA 2K9PA 3JAKB 2EBOA 4L6RA 2PYJA 4BEJA 1HP8A 4LF9O 1LM3B 3EFFK 3WAQA 3BEHA 5JQGB 3ASNC 5IYDO 3TCUA 2PYLA 2J9BA 1L0LH 1U96A 2KQ9A 1O87A 3EFOA 4CS2A 3JSNA 3CSXA 2R7WA 2CTRA 1E1RG 2XS8A 4DR6B 1VQMV 3T6GB 1JPXA 2XL8A 3T6JA 1X4TA 1OV9A 1QQ3A 4LFBB 3OT7A 1D0ZA 3EHMA 4I7ZB 4Q5SF 4B7EA 5JSLA 4N6HA 4GLXA 3E8GA 3O55A 3V5ZA 3HPLC 1B04A 2J7PD 1XREA 3GM1A 3C90A 4BJ6A 1WP8A 4CIHA 4NTBA 3CCSV 3ZIBA 1HW2A 2JS5A 1Z3IX 2IXOA 5FZTA 4F4BA 3RWRD 4I4TA 4FLUA 1I4ZA 1JMWA 4ZLCA 4LBEC 4W4KA 1N36O 3LDEA 1SC5B 4ZOLA 1GKFA 4JASA 1Z5VA 2VS0A 5BZBA 4BW9A 3DJUB 1FPOA 2GTAA 3KKYA 1Z5WA 1OXKA 4E0HA 3AQBA 3BA9A 4CS8C 3BPZA 3QO8A 1DTOA 1E2XA 3PJSK 3DTUB 1GS9A 3FYIB 3RYHA 5J9PC 4MS2A 2QUPA 2HJDA 3BVOA 1QU7A 2ODMA 5CN0A 3RYIB 4QI0A 1NH2B 4Z9IA 1ZHWA 4MTXA 3UO3A 1BQ0A 2A3QA 1VQ4V 5IWAO 5ITZA 3K9AA 4Q20A 3CRMA 3TXQA 3H1IH 3UQ8A 2NSGA 1CXZB 1WA8B 5FNVA 5L3CA 1VQ9V 5F5HA 3SPGA 5CIVA 3TK1A 4X1KA 4PI0A 3EQLF 5L3GA 2ZCEA 4X20A 3AK3A 2A79B 5HFMA 3SYOA 4JI0B 2P4KA 1G6UA 3T9OA 1XEQA 3CRRA 4LF7O 4Z1MG 5EZYB 4FLYA 3EHNA 1OZ0A 1NFNA 5KYUA 4TUYB 3AGUA 1R73A 1LI7A 2IJJA 3T1YO 1T6IA 1KP2A 1VQLV 3U3FA 1AROP 2VRZA 3W7XA 1SESA 4XEVA 4IIJB 4D6TH 5B1BC 3NRHA 4YJ2B 2E75B 5CA1B 4K3AA 4OINF 2R7RA 1TAEA 1G4WR 1XQ8A 4JI4B 1YZBA 3X2QB 1SQPH 1EBOA 3DXRA 2OCHA 5AG2A 1QVGU 5LGTA 4DR7B 3C8GA 3IEEA 1SZIA 3N27A 4OIPF 4ZOLB 3O6XA 3JRTA 3K0DA 5LXTA 4RDAA 4EEQA 1VQPV 1TWGA 4M63A 3ZMZA 3EGDA 3DGEA 1LKXA 2Q9BA 3GWOA 3CCVV 2GAQA 2CW0F 2M4EA 1A7VA 2QM8A 3K3WA 3E22A 1F1MA 2Q4PA 1SQGA 4LDKA 1BHBA 1PL4A 3JD3A 4ZHQB 2LW7A 2JPUA 3JYCA 3RFRA 2QNLA 1Z63A 5HFLA 5ITZB 2YWAA 1PCXA 4LF4O 4JRZA 5H9CA 3M15A 2PGGA 2GWWA 3K1IA 3PMRA 2QKSA 4KNWA 1H2KA 3E2EA 4X1KB 1QLEB 4CSAC 1P4RA 3DE8A 2UUAB 1M93A 5E3AA 2V4DA 1PNLA 4DV7B 4KHPB 3LS1A 3A9CA 3S27A 4XTKA 2GTSA 4Z9JA 3ZSUA 3H9VA 3C18A 1JFFB 4GEHA 2LFRA 4MTGA 3ZRSA 2IJIA 4JI1O 2ZR2A 3CRAA 1WJZA 2L6LA 2X7RB 2GHYA 3GWKC 1VF6C 2GUZA 3CPWU 4H0LB 3BY6A 4I50A 2XNDG 3ZMVA 4H33A 4O2AB 3FB5C 1TFOB 3S3WA 1OCRB 3S9OA 4BIZA 4TV8B 5EC2C 4AE4A 2PNOA 1YF2A 3HKDA 3LUTB 4NXMB 4R32A 3I5PA 2MK3A 4I1MA 3DXRB 3SJAC 1YIJV 2Q4FA 3NYLA 2VQFB 2R7SA 1FXKA 2CTWA 2XRHA 2E5LB 3JSEO 2WAMA 4LLCA 1L0NH 2YVKA 3LLKA 2JGUA 3S0XA 4XLPF 4TV9A 2ZE5A 1TVKA 2H3OA 2WLJA 1I08A 3U10A 1D0YA 3MX3A 5B66Z 3D3IA 4MVUA 3TOMA 3OMNB 1BHAA 4ZIBA 4J30B 1GMGA 4B3RO 1NVPD 3CS5A 4FAPB 1V55C 5CBHA 1Q81W 4EIYA 3C3TA 2WZLA 2W6JG 4X66B 2CK3G 1ZHZA 4O6YA 3AG4C 1M57C 1W59A 3NYMA 2OCCB 1JA8A 4B3SB 2RD9A 4R6ZA 3K06A 4PA3A 1JAFA 1OQCA 1AR4A 4DR3O 4GCZA 4CJGA 2B1IA 5LP6A 4BR6A 4HEAJ 1Q90D 3P3PA 1IURA 2PTMA 1PNKA 3CCUV 1Q6UA 2A6HF 1VF5B 5JWPA 2OKUA 2Y0IA 3LNMB 2GUZB 3TQOA 1ZHXA 1RM1B 1YYJA 1M2VB 2OG2A 1ZX3A 1COWG 3UT5B 4FJCC 5LHGA 2Z5UA 1BBHA 2CDYA 1AI7A 2DOSA 2LCHA 1I94O 3CYOA 1VK5A 4NTXA 2P0NA 3L9DA 4C7OA 4AE4B 4DUYB 1SQXH 1S5JA 4ZLDA 1Y76A 2OT5A 3F47A 3BHPA 1RKCA 3UMKA 3ABKB 4F4LA 3WB1A 2QM4A 5E3CA 3ZMTA 256BA 1GM5A 1YJWV 1FXKB 1B68A 4Q7CA 2WA4A 3K59A 1R6TA 1LI5A 2E74B 2PP4A 4FPPA 3LLIA 2XOKG 1OCCB 5DM6V 3U8PA 4UUJC 1TVKB 4DUZO 1XHZA 2IU3A 3DM5A 4RQEA 2IW5A 2A1DD 5LGUA 1YITV 2R9IA 3NKEA 4W8PA 3N2GB 2OOCA 4LH7A 5IY5B 3OR7C 1S5HC 3JARA 4DV6B 3SPCA 3AGTA 1FFXA 2DN9A 1JRAA 3K0GA 4O6NA 1EN4A 2QEXV 1QLNA 3E9VA 3FOPA 5KYNA 1E86A 1OHHG 2J9VA 2CAZC 4X1YB 4FM2A 3VM6A 1VOMA 3E8BA 3G6BA 2RMKB 2ETNA 3ABTA 4LFCO 3OEEG 2WLIB 4E18A 1N36B 1MA1A 1ZL8B 4K1OA 4CS9A 5LP6B 2L6FA 2RCVA 1Z7Qc 3CSKA 4B3MO 2BC5A 3CWBH 2ETSA 1CP9A 4Q4ZF 1K04A 2WLHA 1HW1A 2R7UA 2YLGA 2UXBO 4ASUG 3EZIA 3ZEDA 1KU9A 1VQ5V 4GKJO 2N05A 2R72A 3M79A 2ZIMA 4FMTA 4YK5A 4MTOA 1H7IA 1J8YF 5IWAB 3PDMP 2PUSA 3MYIA 1M5IA 1R6NA 5CBGA 3RYCA 5J2TB 4O7GA 4DRXA 4OIQF 2EIMC 3ZDLA 2QY9A 4PA4A 1AUEA 4JAAA 2VWKA 3MFNA 3HLZA 1ORQC 2QSAA 1XUQA 3SPHA 1XL6A 3MHHC 2ZDIA 5IYZB 1NS1A 3B0PA 3ABMB 1DLBA 2YL1A 4I44A 3ZTZA 3HKBB 4KL1A 2YI8A 1KYOF 1QKRA 2YICA 4KXRA 4J11A 2HKOA 1IXMA 1IBKO 4K8XA 2OTJV 2RDCA 3KCXA 1PL0A 4I1OB 2A68F 1PD1A 1KNYA 3ZRWB 4AILC 4K8ZA 4LERA 3JALB 3ZHUA 5H5NA 4TWKA 2AGAA 3QVNA 2EIKC 1NG1A 1OKKA 2DGJA 1W2WA 1OR3A 2JGDA 1CPQA 3ZG1A 4U7NA 4B7KA 2KG7A 1R3LC 2YXHA 3OMAB 3L73H 2QTVA 2XAQA 4B6IA 1R3KC 4TT3G 2ZXWB 4JZAA 5BMVB 2XLEA 1SETA 1ZW3A 2WLLB 3ZHRA 3ZTMA 2Q73A 2JX0A 2JK5C 2IH1C 1ZHYA 4FZ0A 4IT5A 1KTMA 1EZJA 2XSEA 5T3TA 3CCJV 1QBZA 1EQ1A 1P7BA 3BCCH 2LFFA 4LF4B 1NKDA 2QM7A 1HR0O 1SF8A 5HV9A 3H1HH 3H2VA 4DW1A 1IW7F 3SXMA 1NBMG 3ZJZA 2VCAA 5KYYB 3Q7GA 3GODA 4Q6GA 1R4TA 2CNWA 1JVMA 1BR2A 2CTPA 1N0NA 3ZRVA 1X59A 1Z5ZA 4XQ1A 3KZIZ 4DV0O 5KAFZ 4RAIA 3E70C 3KCYA 3R66A 3SR2C 2AZ2A 1CGME 4FLWA 1YI2V 4DRHB 4LCUC 1IXBA 1HDJA 2L9JA 2YQYA 1G1XB 2Y3GA 1GN3A 1R3JC 1ZWIC 3OGCC 4YJ3B 1D5NA 1YLMA 5KHIA 4FWVA 3JAWB 1SQQH 4XEKA 5BQIA 1K97A 1DOVA 5B1AC 2C2AA 4FM0A 4JI6O 3Q6MA 4DR7O 3L75H 5F5FA 1E84A 2Y39A 2Y69B 4NXNB 1WAZA 5JVDB 1IDSA 3FMSA 3U5SA 4AL0A 1FXVA 2DB4A 2BTQB 2R70A 3ABLC 1YYXA 2DJVA 3SNHA 4GKKO 3FXHA 3NMIA 1L8DA 2ZE8A 2QWOB 5DQZA 2Y4TA 2JS3A 4LWSB 3UNGC 5AC5A 1MNGA 3H1JH 4OXSA 1V4AA 1YARO 1RJ9A 2X0CA 2VQEO 4BW5A 3IC9A 3CE2A 2ICWG 1OJHA 1ZUQA 3C63A 1YHQV 3K58A 1KMIZ 3PHF2 1RPOA 5EBMC 1E83A 3RN4A 2EILC 4I9QA 4PA7A 3U9JA 1FJGB 1MMAA 3FHDA 1U0BB 3IQ6A 3H1LH 4IHJB 2NNUA 1G8XA 1BT8A 1YZCA 3N2KA 2LSEA 4WBNB 2QKCA 4DV7O 3SGIA 2GDSA 2Y0PA 2J9UA 1QQCA 3RFYA 1M56B 1H8HG 1G4YB 1OCZB 1BR1A 1T5OA 4KNVA 1EM1A 1H9GA 5H6QA 2Q9LA 3ECSA 2NG1A 2QE9A 1S0VA 5DLJA 2J0XA 2JDIG 4G2KA 4O4JB 2EINC 1GAXA 3ICXA 5IT9N 2Q7HA 5HSWA 3JAKA 1XNQO 2OJED 3B0UX 2AZ0A 2DYRB 3B71A 4HYOA 5C93A 2MWQA 3K7DA 3ZN0A 2JEXA 4O6MA 2AP3A 3UGPA 1Y6DA 4MSWC 1WTYA 3GEHA 4PELA 3H1KH 3ETQA 3OE7G 2ZM6O 1S76D 1AJQA 1QSPA 4DUZB 3L0IA 3TJ6A 1FTSA 4QGPA 4IL6Z 4N06A 3SPIA 4QNHB 1XMOB 2Q68A 2B1GA 2L81A 1J5EB 3W7WA 4O2BB 5IYCO 2WL8A 4XBFA 4WF9V 4DYLA 1N33O 3GM3A 2G38A 4DK0A 5T1DB 2FB5A 5A6BD 1XZQA 2D3OW 3FVYA 4CJOA 1BS3A 1Y74B 3RKOF 3QW1A 1A32A 4KP4A 4X66O 2VB6A 2YIBD 3M4CA 1NSGB 1SMYF 4EB6A 3HTKC 4XLNF 1DGSA 3UKMA 2XXAA 3VQYA 2VC9A 3R7CA 4B3MB 1C02A 4JYAB 4DBRA 1D2DA 1B06A 5LBQA 1SA0B 3H2UA 2YXYA 1M4UA 3T4DA 4X65O 2UXBB 2PFDA 4CIPA 5AC4A 3WG7C 4GKJB 1YVIA 3SJBC 5DN6G 2BL2A 3K1IC 4E4EA 3K5MA 2QLAA 2CGEA 3IHUA 3RYIA 3SYNA 3ZQYA 4YIPA 4IYHA 3LJBA 4D4NA 3CCRV 4BPMA 1KC8W 1O9GA 4MVOA 1H2GA 1WA8A 4DUYO 2Q9AA 3T2MA 4ULVA 2GSMB 2IXMA 2EULA 3A0RA 4RD9A 2V26A 3WB0A 3THOA 1M90W 2OJQA 3CP1A 2HSBA 5EZYA 4CDAA 2EIJB 1MNEA 3PN1A 1NTMH 3WB2A 4BAYA 3UCSC 2UXXA 4TUYA 1PM9A 1KKDA 3B40A 2ZE6A 4QE9A 5KA5A 1IBKB 4CC6A 1VQ7V 1OW6A 3FDQA 1GM7A 4HZ3A 1YJ9V 4K0KO 2B9ZA 4J7ZA 4X1IB 3ETGA 4IIJA 1ZU5A 3W7TA 4DV6O 4YJ2A 1R1BA 2ZXRA 5CA1A 4N21A 1Y66A 5JCOC 4BIUA 2QGNA 5EBWC 3N2ZB 4TQFA 5COFA 4JI2O 2OU6A 1SZTA 4EB6B 2GDCA 4U7OA 3HNIA 4NTAA 2H7BA 5F2VO 4WFAV 2XLHA 2CCYA 2XXAB 3CC2V 3HR0A 4MW3A 1AJNA 2FFHA 3ZWIA 4IGGA 3TETA 1OCOB 1H6GA 4KBLA 3OFNG 4NCQA 4U5EE 1YZAA 4U5GA 1AP5A 1EKYA 4G0HA 2NUTB 4BWAA 4BJ5A 3QVYA 5JS5A 2GBOA 5COMA 2VCCA 4I9WA 3ZMUA 4X9QA 4ZHQA 4DV4O 1HR0B 2PF4E 3ZMSA 1SS3A 2OIGA 3E83A 4WFHA 4PFOA 4OD5A 1IVSA 1S3JA 3EHBB 4H13B 3FYEB 5CB4B 1V54B 4YJWA 2M7WA 3G4ZA 2DQ3A 4DV0B 3U9MA 1FKAO 1VQ8V 1OW7A 3AG2B 1NTZH 2XLOA 1Q0DA 1AJPA 1JFFA 2XAFA 1BZ4A 3U3BA 1N1CA 1S7ZA 2LW1A 3UO2A 3L8IA 2F66C 2Q3TA 5EIBC 2KSFA 2W9YA 4XPYA 3OD4A 4FLXA 2Z0AA 1LUWA 2Q7GA 2XAGA 3BRCA 5EK0A 5H6RA 4O2AA 3AG1C 3E86A 2L7AA 2QWRB 1RKEB 4TV8A 5KUKA 2UXCB 1YSCA 1T01A 2IH3C 5BXZA 3K04A 4OPHA 1UFIA 2DYSB 3EG9B 2P5OA 4C7UA 3JD2A 2DWEC 1EN6A 4JI6B 1FFTC 1WLEA 5AGFA 3V7OA 3BFRA 1YEWA 1XI1A 1ZSPA 2DW4A 3LAYA 3US6A 3D8CA 2B0JA 2A7WA 1O9HA 5LA6A 1P84F 4DR4O 2W45A 4R7CA 4DV1O 4FVMA 2HFIA 1YDXA 2LFDA 4U3JB 1I4YA 3D3QA 1HMDA 4P6IC 4GKKB 3FOOA 3ABUA 4LF6O 4E7ZA 2CGNA 2LIGA 1IBMO 3CX5F 4HFKB 3FB7C 2Q0AA 2VQEB 4CS9C 1BSMA 4QE7A 2X6BA 3RGBA 3ZCCA 1D5AA 1VQNV 3L1MA 4Z1VA 4WABA 2EPOA 4DV3O 4I5SA 2X51A 2HJFC 5IDJA 2TMVP 2YI9A 3FAJA 4CC5A 5KX5B 3LNRA 3M8AA 4H44B 2EPNA 1AI5A 4LFAB 4CH6A 2XM4A 3G50A 3LEVA 4QPJA 3IAYA 3U2MA 2W0XA 4NC3A 1SZXA 1M2VA 3KPHA 2Y48A 2ZT9B 3IJ4A 3RYFB 3UT5A 3IFXA 1XNQB 2W0FC 2ZDIC 1WPXA 1XNRO 3M4BA 2L6GA 3B2EE 3NYJA 1NU9C 4XEFA 4JJGA 3G4SV 3K5OA 3QO5A 4UVAA 3CMEV 2CYDA 2ATKC 2YL3A 2HLDG 4JI7O 1BZKA 4AL1A 1RSOA 2ZM6B 2YL7A 4E0IA 1QZXA 5LA6B 4B3TB 1ORJA 3K1HA 3O39A 1M1KW 4NXNO 4K7BA 5L0HA 2JVDA 1US6A 4CS7A 4FIPC 4JPRA 3UMIA 3N2GA 1AP6A 1N33B 1M2OA 2G62A 3SEOA 3CHXA 3ASOC 5B3SB 3Q6NA 5TJ5E 3CC7V 3LS0A 3SP1A 4CDVA 1MMMA 1YDIA 2CE4A 3VF0A 5FPOA 4N23A 3QMKA 3C8ZA 4X1YA 2LFSA 4J41A 3FD9A 4UCOA 2WLIA 4MTFA 1L1FA 2QR4A 1ZL8A 1M9NA 1FJGO 1TKNA 1MSWD 2A6EF 2IXPA 2KGOA 4EBJA 1XMQO 5E2QA 4X65B 3DAFA 4O4LB 4GX2A 4C3BA 2LP4A 4IAOA 1I5YA 1PKXA 4NR1A 5IE9A 4HE8D 5D91A 3CCEV 2YSUB 4PI2A 3I4UA 4GT1A 3H65A 3JD4A 5E1AC 1K40A 4AQYO 3F46A 2QKAA 3L34A 1Z2GA 2X0LA 2UXDB 2LJ2A 5J2TA 3HB3B 2UUBO 4MT8A 4JYBA 4I0XB 3B09A 3L71H 1VP7A 3F5WC 4PA6A 3AG3C 3ASNB 1BDJB 3JT1A 2KK1A 4DVZA 2P6VA 1RSOB 2LGWA 4E2LA 5IJ0B 3J06A 1V9PA 3RQFA 3GANA 3SJQC 5IYZA 3N0TA 2EZOA 2IM9A 1L7CA 2VCBA 3CZ6A 1MABG 3HKBA 2HVJC 5A6AA 2RNBA 4K0KB 4Z9HA 1XMOO 2KB1A 1B3QA 1J5EO 4RQFA 4XPWA 1Y67A 4UFZA 1HNWO 3AQCA 3JYHA 3S84A 3ZRWA 4JI2B 4EUKB 4ONSA 2F23A 3JALA 1W0KG 2AW9A 2WWWA 4WGYA 4X64O 1FMVA 1IX9A 1YA9A 2WB7A 4PDRA 3VQVA 1O3UA 4C3DA 5A6JA 4PDVA 1Q6IA 4U5CE 1HY5A 2C04A 4DOZA 4JYAO 1XOUA 5BMVA 1KU2A 2WLLA 2A69F 3KYJA 4E7SA 5B3IA 4X88A 1NZEA 2ZXOA 4O4IB 4CS3A 2XHBA 3T4ZA 5KUMA 2OIEA 1I5XA 3LDDA 1JOYA 4P9FA 3JCZA 1WN7A 2NLJC 4DV4B 3CAXA 4FLTA 3MLGA 4JJFA 4A4AA 1FMWA 1I0HA 4UDVA 4JE9A 4U3FH 1R6KA 1E85A 5KYYA 1Q82W 1H9TA 4H37A 1CPYA 3GORA 4IYIA 3DI5A 3K08A 4CSAA 2ZNIA 1SERA 1VQ6V 3J7AU 4DV5B 1TQGA 5DECA 2B5UA 1R3IC 1JR8A 1A7EA 2J7PA 4CX9A 1GRJA 4JZ2A 2F4VO 4J7KA 3ZVRA 2EPKX 3OMIB 3RT3C 2ZR3A 3SXYA 1K7DA 1XBLA 5JJEB 2UU9B 3LDCA 4RUEA 1PV3A 3K9SA 5B1BB 3SZRA 1RPRA 3I5QA 2QWNB 5FL7G 2KJGA 1XZPA 2ZKOA 2Y3BA 4JTCB 4YJ3A 3ZHTA 2J45A 2AHYA 3ITFA 3RF3A 2HUJA 1MSDA 3JAWA 1UPGA 1SQBH 3OTOO 5J2UB 3G71V 4DR4B 1SQVH 3BA8A 4DV1B 4FK5C 4IWBA 5L3EA 1FAFA 4CH4A 3JZ0A 2RSEB 4LLEA 1TGOA 5JVDA 3C7JA 2CH7A 4PFPA 1NR7A 1MOFA 2BTQA 5L3BA 4LF6B 3DAGA 4GUNA 3L8JA 3W7UA 3L72H 4PDLA 1HNZB 1IBMB 1KB9F 2K1EA 3SDLA 5EYPB 1Q7YW 4LWSA 3IGAC 4GYCB 3GM2A 1VYIA 1Q5OA 4G7HF 1OCOC 2WLNA 4GZRB 3ZQVA 4DV3B 3LNNA 4PHZA 1GK9A 4WFGA 5LL6Y 1WP7A 3C8GD 2BOCC 2ZQMA 5KYXB 4IHJA 1N32O 4RO2A 3RYLA 2XAJA 4AHCA 4R8CA 4G7ZF 4WFFA 4WBNA 1GQAA 4EBBA 1BR4A 1QVXA 3EZHA 2V3CC 2X6CA 3EXAA 5DS4A 5K1PA 3DM9B 1XDCA 1KECA 4L87A 1WB8A 1K92A 3T1HO 1JJOA 3QTCA 1EI7A 1Q43A 4LC1A 2HZ8A 3VAYA 4C3EA 1J8MF 2H94A 5JVEA 1RMVA 4O4JA 5TISZ 2ZINA 3P30A 2J0WA 3OTFA 4YL3A 3JASB 4I55A 2XLWA 1XNRB 1ZVZA 5E33A 3KG2A 2BOBC 1N0JA 4UXNA 2UXCO 4IAQA 5BR8O 1FAPB 4JI7B 3L74H 5LHIA 3L70H 4UCTA 1Z6AA 3AJMA 2Q0OC 1KQSU 4H4KC 1FS0G 4TOIA 5GW7A 2YIAA 1LNQA 4J42A 2XL6A 4JURI 2CH7B 3EJNA 3TOLA 2P22C 5DQTA 4BJ6C 1AI6A 4ZBMA 3W2VA 3FFQA 1MMDA 1TA8A 1WATA 1BGYH 3G6EV 2L35A 3DWWA 3X2QC 4UCSA 3STZC 5A2QN 4O2BA 1B6QA 3WU2Z 1H2LA 4HNAB 2A0LA 2L6HA 3EH2A 2GFHA 3K33A 1URFA 5FCLA 4AX2A 1V55B 2OWOA 3CRCA 1Y74A 4LF5B 1JPJA 2RJZA 2DE0X 3AG4B 1M57B 1CPRA 1HNXO 4UV8A 4J7TA 1ORSC 3HNKA 1IZMA 4J9YB 4PJ0Z 2J46A 1BMFG 2EZPA 2XL4A 2VWJA 5B1OA 4X8AA 1Y6XA 1XMQB 1L3PA 2ITDC 1FFHA 5L3FA 3TD7A 1SA0A 5LMUO 5BUOA 1LVKA 1K4DC 4NY3A 1Q86W 3OAAG 4LFAO 2ZPAA 1Q3EA 2YIDA 1VQOV 5BY1A 4MVZA 3W8HA 3B77A 2XLDA 4UCVA 1QLEC 3K03A 2GA0A 4P9TA 2H7VC 3STLC 4AQYB 1C03A 2P7VA 4PR9A 4I55B 3N24A 2HFEC 3O65A 1Z23A 2UUBB 3HJCA 5LMNO 3RIPA 1D1CA 4J9ZB 1H2NA 1NU1H 4IJJA 1YAUO 4RWUA 2ADPA 2PZSA 5D5QA 4DR1B 1W2BU 2YZSA 2QWQB 4HFFB 1N34O 1LE4A 1G8MA 1A0BA 4EWCA 5KAIZ 3TJTA 2PY5A 1VMAA 4J80A 4CBEA 4DRJB 4BIOA 1OCRC 4B3TO 1SYQA 3OA1A 3AK1A 2BTOA 2F1MA 3E35A 3BRJA 4R50A 2W4BA 3NKDA 5LYJB 3SYQA 4P30A 4FFBB 1HNWB 4JKVA 5K0IA 4QJFB 1GH6A 4X1IA 2Q69A 3SYPA 1JCHA 4UB8Z 2NUPB 2ZNJA 4K0DA 1VMGA 1E1QG 5K1XA 4U9DA 3VQWA 1BQZA 4JIOA 2IYLD 2CDQA 5EIBD 2KC3A 1W0JG 4X64B 4ULWA 4FX5A 1EN5A 3R2PA 5CI8A 2Q7RA 4KUMA 3S90A 1KKCA 5C8YB 4P9OA 5GONB 5L0DA 1OR2A 1VYKA 2DI3A
chains in the Genus database with same CATH topology
4ZLDA 3V7OA 3F47A 3LAYA 2R7OA 4IRUA 3UMKA 3EGXA 2B0JA 4G7OF 2W45A 5E3CA 4YN0B 4Q7CA 1V54C 2NUTA 3LLIA 2IXNA 4KI2A 2PP4A 1MMGA 2OCCC 4P6IC 4WJ0A 4E7ZA 3AG2C 3DM5A 2A1DD 4HFKB 3NKEA 2WVQA 3VYWA 3X1OA 1TWCA 3OEOA 4GYTA 4CS9C 3NDBB 2WVNA 3DD7A 2DN9A 4O6NA 4QDLA 4FESA 3KMIA 3M1CB 3E9VA 3LESA 4YT4A 5KYNA 2J9VA 2KW3C 2MYSA 2X51A 2I8BA 1VOMA 3APOA 1D0XA 2D5RB 3FAJA 2DYSC 3UGOA 3LNRA 2BE5F 4W8KA 4CS9A 4JVSA 3CSKA 2NUPA 3ABKC 3LEVA 3OWTA 4Q4ZF 3DJNB 3KH2A 1M2VA 2WZFA 2R7UA 2FGYA 3EZIA 2CTQA 2N05A 2Q9CA 3S28A 3W2WA 1OCCC 3EG9A 4BJ5C 3NYJA 2YHSA 1NU9C 1J8YF 1TWAA 5KYWA 4JJGA 4PJLA 4PJMA 3K66A 5IY5C 4O7GA 5L3QA 4OIQF 2EIMC 2QY9A 3EGXB 3NG1A 4YT8A 3HLZA 2VH3A 1QZXA 2QSAA 3K1HA 3O39A 3ZC4A 4BJTA 5DVWA 4K7BA 3B0PA 2YUAA 4CS7A 2O9XA 3EPVA 2W4MA 3UMIA 4KC9A 4I44A 5DS6A 1M2OA 3APQA 2G62A 4XWJA 3SEOA 3ASOC 1D1BA 3Q6NA 3LS0A 3CQZA 3SP1A 3S29A 1OKKD 3Q7LA 3QMKA 4I1OB 2A68F 1PD1A 4LERA 1O5HA 2DGJA 1NG1A 2EIKC 1OKKA 1W2WA 3ZG1A 1TKNA 2A6EF 2IXPA 2KGOA 5E2QA 3DAFA 2QTVA 4B6IA 4YWQA 2HV7A 4C3BA 4JZAA 2M6YA 4IAOA 5CI9A 1LS1A 4HE8D 3WODF 2R7QA 5D91A 4J32B 3EFOB 3I4UA 3H65A 2E87A 2PX3A 3ABMC 3F46A 2YS8A 3L34A 1ZHYA 4IT5A 2XSEA 5T3TA 2CNWD 4X0RA 5B3SC 5KYWB 1ZHTA 4JCHA 1SF8A 3AG3C 4YT2A 1IW7F 3JT1A 4DVZA 1RJ9B 5KYYB 4U5BE 2P6VA 3UR3C 4PJJA 3Q7GA 2ZXPA 3GODA 4DBQA 2LGWA 3JSZA 2CNWA 4RBNA 3POVA 3GANA 1BR2A 3N0TA 2CTPA 1Z5ZA 2N04A 3CZ6A 4OIOF 3E70C 2YEVA 3QZCA 3T4RA 1ZU4A 3AQCA 2ZXWC 5EGYA 3JYHA 2VASA 1ST6A 4BG0A 1HDJA 2L9JA 2Y3GA 1PD0A 2J9WA 4U5FE 1FMVA 2WZGA 3W8IA 2WB7A 4PJNA 4YT5A 4C3DA 4FWVA 4U5CE 4MNDA 3UMHA 4BEJA 2C04A 5B1AC 4DOZA 3Q6MA 3ASNC 2WVOA 1KU2A 3EH1A 4ANJA 5F5FA 2A69F 4E7SA 2Y39A 1NZEA 2ZXOA 2KQ9A 3B9QA 5L3VA 1O87A 3EFOA 2IOQA 3ABLC 2R7WA 2CTRA 3SNHA 4JJFA 3MLGA 1FMWA 3T6JA 1JPNA 2QWOB 5DQZA 2Y4TA 3UNGC 1D0ZA 5KYUB 3EHMA 5DS5A 4Q5SF 4LACB 4MQ9F 1RJ9A 4AK9A 5KYYA 3RH3A 4OD4A 2J7PD 3PHF2 4CSAA 4BJ6A 2EILC 2HV6A 4CIHA 3ZIBA 1MMAA 3FHDA 2R7VA 3KKBA 4QI2A 1D1AA 1Z3IX 4F4BA 2IXOA 1WGWA 1G8XA 4ZLCA 2J7PA 2Y3DA 2LSEA 3DXJF 3ZVRA 2J9UA 3RFYA 3K6BA 1BR1A 3DJUB 4KNVA 1FPOA 1XBLA 2QWPB 2Y69C 3AQBA 4CS8C 3ECSA 2NG1A 3SZRA 3EGDB 5DLJA 3I5QA 2J0XA 2QWNB 2KJGA 2EINC 2Y3BA 2J45A 3BVOA 3ITFA 5HSWA 4QI0A 3B0UX 1ZHWA 3UO3A 1BQ0A 2MWQA 3K7DA 2KQXA 4IWBA 1FAFA 5F5HA 4O6MA 4LLEA 4CS8A 3UGPA 4PFPA 3EQLF 1MMNA 3DAGA 3L0IA 5T3WA 1FTSA 4N06A 3EHNA 2L81A 5KYUA 1N4CA 2WL8A 1VYIA 3KL4A 4G7HF 1M56C 1OCOC 1OCZC 2H7OA 5T1DB 1MNDA 3DZAA 3FVYA 2C03A 3RKOF 3NRHA 5B1BC 2VB6A 1ZYRF 2CUGA 4OINF 2R7RA 1SMYF 3HTKC 5KYXB 3RYLA 4XLNF 4U5HA 2XXAA 4G7ZF 4EBBA 2OCHA 1BR4A 2DYRC 2Y3HA 3EZHA 2V3CC 5DS4A 3DM9B 3IEEA 4DBRA 1SZIA 4OIPF 3O6XA 3JRTA 4C3EA 3VAYA 4RDAA 1J8MF 2PFDA 1TWGA 4M63A 3WG7C 3EGDA 2Y4UA 2J0WA 3K1IC 1LKXA 2Q9BA 4JW1A 4DVYP 2CGEA 2M4EA 2CW0F 5E33A 3SYNA 3LJBA 5D92A 2PX0A 1Z6AA 2Q9AA 1Z63A 4H4KC 1PCXA 2IXMA 4RD9A 2V26A 3PMRA 4JURI 2KNHA 3EJNA 4KNWA 4CSAC 5DQTA 4BJ6C 3W2VA 1MMDA 5E3AA 1MNEA 5EHHA 3X2QC 3LS1A 3S27A 3UCSC 4XTKA 3ZSUA 4GEHA 4U5DE 3EH2A 2GFHA 3K33A 3FDQA 2G3KA 5FCLA 4AX2A 1WJZA 2L6LA 4J7ZA 2GUZA 4BJ1A 1JPJA 1ZU5A 3AG7A 2ZXRA 1NU7D 3N2ZB 5KYXA 3B0VC 1IZMA 3JCUQ 2J46A 2XL4A 4AE4A 2H7BA 3T6BA 1FFHA 2XXAB 3I5PA 3TD7A 4C7OB 4I1MA 5BUOA 1LVKA 3NYLA 2FFHA 4NY3A 2R7TA 4KBLA 2R7SA 2R7XA 2CTWA 2ZPAA 4U5EE 2XRHA 4U5GA 1TWHA 3W8HA 1QLEC 4LLCA 3LLKA 2H7VC 2EJ7A 2NUTB 4G0HA 3S0XA 4XLPF 2P7VA 4BJ5A 1D0YA 2EIJC 3N24A 3MX3A 1Z23A 3HJCA 3RIPA 4J30B 3DMDA 2PF4E 1D1CA 2G3VA 4IJJA 4RWUA 4PK4A 4PFOA 1V55C 4OD5A 2YZSA 4HFFB 2QWQB 2WZLA 1ZHZA 4O6YA 3AG4C 4EWCA 1M57C 1VMAA 4J80A 4O79A 4CBEA 4YJWA 3NYMA 4OIRF 3OA1A 1OCRC 2JD3A 1NZ6A 2W4BA 3NKDA 4HEAJ 1N1CA 1S7ZA 3UO2A 1IURA 2A6HF 2Q3TA 1GH6A 2DMXA 2W9YA 2NUPB 4K0DA 4A2NB 2Z15A 1BQZA 2GUZB 1ZHXA 3AG1C 2CDQA 2IYLD 1M2VB 2OG2A 2QWRB 4ULWA 1TR2A 4FX5A 4I3MA 2LO1A 5CI8A 1VK5A 3EG9B 4C7OA 4AE4B 1VYKA 1FFTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DN9 A;  3BVO A;  1N4C A;  3UO2 A;  1IUR A;  2YUA A;  2CTQ A;  2N05 A;  1GH6 A;  3UO3 A;  1BQ0 A;  3APQ A;  2DMX A;  2PF4 E;  2Y4U A;  1HDJ A;  2CTR A;  3APO A;  2LGW A;  2KQX A;  4RWU A;  1FAF A;  1BQZ A;  2GUZ B;  2M6Y A;  2QWQ B;  3UCS C;  2CUG A;  2QWO B;  2CTP A;  2Y4T A;  2QWR B;  1FPO A;  4J80 A;  2CTW A;  1XBL A;  2LO1 A;  2N04 A;  2QWP B;  1WJZ A;  2L6L A;  2QSA A;  4J7Z A;  2GUZ A;  2YS8 A;  2OCH A;  4IT5 A;  2QWN B;  3AG7 A;  1NZ6 A;  2EJ7 A; 
#chains in the Genus database with same CATH topology
 2AXT Z;  5E79 Z;  2V1D A;  4WFB V;  1GM9 A;  2R7O A;  4O4H B;  3EGX A;  4PD4 F;  3CCL V;  4G7O F;  2WLM A;  2P7T C;  2NUT A;  1P49 A;  2P4V A;  2IXN A;  2OCC C;  5JJN B;  1MMG A;  3IQT A;  3CEI A;  4WGZ A;  2HG5 C;  1KBH A;  4WJ0 A;  1ROP A;  5KMG B;  4EFB A;  3R65 A;  1F23 A;  4GX5 A;  2WVQ A;  3JD0 A;  3VYW A;  3X1O A;  4JYY A;  4DR5 O;  2JJ1 G;  4P9P A;  3K5N A;  2UXD O;  1BCC H;  1KD1 W;  2EIM B;  5KHJ A;  4YIO A;  4X62 O;  4U9E A;  1VIB A;  3D36 A;  5CB4 A;  3JCU Z;  1RM1 C;  3LES A;  1THZ A;  4EKW A;  2IBF A;  1QCE A;  3O10 A;  1NVP B;  2I8B A;  1D0X A;  5GTI Z;  2D5R B;  2RQ6 A;  2F4V B;  3UGO A;  4W8K A;  1MG1 A;  4YHH B;  4G27 B;  2WA3 A;  3ABK C;  1Y4C A;  3MYF A;  1NQT A;  4UCR A;  1FXK C;  4D7T A;  3KH2 A;  2WZF A;  2H8P C;  1QR9 A;  3AK2 A;  1PP9 H;  1RKE A;  4DRI B;  4WFE A;  2CTQ A;  1F7Y A;  3U2L A;  2XS1 A;  3E89 A;  1OCC C;  3EG9 A;  2ZIO A;  2EIK B;  3OTO B;  3JD1 A;  1YA7 O;  4HBN A;  5KYW A;  4PJL A;  3H01 A;  2BE3 A;  4EFE A;  3UM7 A;  1ZLZ A;  3K66 A;  5IY5 C;  5A6K A;  3JAT B;  4YL1 A;  3OM3 B;  5COG A;  5L3D A;  3RW0 A;  3ZS8 C;  4U3J A;  2A0B A;  3EGX B;  3NG1 A;  2X6A A;  4JAV A;  5LOV B;  4BJT A;  2A06 H;  3FB8 C;  3F5T A;  2A0U A;  4NQF A;  3RQG A;  1RXQ A;  3DSQ A;  2YUA A;  2XAS A;  3HKC B;  1Q6H A;  2FL4 A;  2FML A;  3QNE A;  4X89 A;  1N8R W;  2HHH B;  2HKV A;  2O9X A;  4KC9 A;  1GN6 A;  3APQ A;  5DS6 A;  5LP6 C;  2HEP A;  1TFK B;  3BAA A;  3CQZ A;  4JF3 A;  1K73 W;  2E76 B;  3S29 A;  1OKK D;  5IJ9 B;  1OW8 A;  3Q7L A;  2PI4 A;  1GN2 A;  2R9R B;  5JH7 B;  2UUI A;  1A7D A;  1AIL A;  3I5D A;  1N32 B;  3GWN A;  3U11 A;  5EC1 C;  4CS4 A;  2I15 A;  4WCE V;  5KX5 A;  2M64 A;  3C62 A;  3HKK A;  3AEI A;  2XAH A;  1KP3 A;  1F4N A;  1NLX A;  1BE3 H;  2P67 A;  3P32 A;  3O9O A;  4DV5 O;  1LS4 A;  4JV5 B;  3T1H B;  3QW0 A;  4N6C A;  3V5X A;  3CC4 V;  4QIW F;  2HV7 A;  4RUF A;  3RVY A;  4P2Z A;  4ICG A;  2W6I G;  3VBB A;  3RYF A;  3JTL O;  1S05 A;  1LE2 A;  2M6Y A;  3JRM O;  3QTH A;  5CI9 A;  3RVZ A;  1LS1 A;  3WOD F;  4J10 A;  1AB3 A;  4JZG A;  4J32 B;  2UU9 O;  3EFO B;  2XTA A;  3B8N A;  5BR8 B;  4BEM J;  3ABM C;  2E87 A;  2PX3 A;  2YS8 A;  1MZE A;  2OEX A;  4MVM A;  4GX0 A;  2CNW D;  2IM8 A;  4X0R A;  1I7F A;  5KYW B;  2ZE7 A;  3B29 A;  1Y4M A;  1PD3 A;  1YVW A;  1Q0G A;  4JCH A;  1M6T A;  2NR5 A;  5B1A B;  5DED A;  1U89 A;  4U5B E;  4DBQ A;  2F93 B;  2LK4 A;  4XDK A;  3FX7 A;  3SPJ A;  2Q6A A;  2ZD9 A;  1XIL A;  4RBN A;  1AVM A;  3K57 A;  5L0F A;  1K34 A;  3ML0 A;  2RN9 A;  3ABL B;  3ZN1 A;  2Q00 A;  2N04 A;  1HNZ O;  2QTO A;  2LQG A;  3OW2 U;  4I4T B;  3VOU A;  1CEZ A;  2YEV A;  1NI8 A;  4JCZ A;  4JI5 O;  1AEP A;  4OPA A;  1AI4 A;  3I55 V;  3T4R A;  2KYH A;  1SQF A;  4IB4 A;  2ZXW C;  3NXS A;  5GTH Z;  1QR8 A;  1HNX B;  1Q0M A;  1ZZP A;  4W4L A;  4JC7 A;  3OEH G;  1ST6 A;  3M7M X;  1S72 V;  1PPJ H;  1PNM A;  2EIL B;  4IAR A;  3W7S A;  5F28 E;  2J9W A;  1K33 A;  1RFY A;  4U5F E;  3RYH B;  2WZG A;  5LMU B;  1EA8 A;  1VLS A;  4D4X A;  4JI3 B;  4PJN A;  4YT5 A;  2KSD A;  3I56 V;  4JYC A;  4O4L A;  3SYA A;  3UMH A;  4MND A;  2WVO A;  1SR2 A;  3MDS A;  2HSQ A;  4CBC A;  3EH1 A;  4ANJ A;  2IBZ H;  5FNV B;  1CGO A;  5L3V A;  3B9Q A;  2BSK A;  2XLV A;  4DO2 A;  2IOQ A;  2OYQ A;  5LMN B;  4X20 B;  2XM0 A;  1NT2 B;  5FLX N;  4MVQ A;  2EIN B;  2JRI A;  3ZIA G;  3U8V A;  5B1N A;  4XDL A;  5CMU A;  2N74 A;  4I0X A;  1JPN A;  1N34 B;  5KYU B;  5DS5 A;  1ZTE A;  1Q8I A;  4PDM A;  4LAC B;  4QPK A;  4MQ9 F;  1YTF D;  1SKV A;  2GV9 A;  3F7Y C;  4AK9 A;  3RH3 A;  2AHZ A;  4NB5 A;  5IJ0 A;  5BQG A;  4OD4 A;  2HJ3 A;  1V74 B;  4UVB A;  1K8A W;  3HKE A;  5JT4 A;  4KFM A;  3GWL A;  5GPG B;  5EBL C;  2YC0 A;  4OX9 B;  2HV6 A;  5L0C A;  2R7V A;  2Q5Z A;  3CRQ A;  4DR2 O;  4JI8 B;  3KKB A;  1D1A A;  4QI2 A;  1YXB A;  1WGW A;  2UUH A;  2JJ2 G;  2BCC H;  1K5Q A;  4DK1 A;  2Y3D A;  2JEU A;  3DXJ F;  4YY3 O;  1NFO A;  1YJG A;  2LGQ A;  4FLV A;  4EHP A;  2YEV B;  5CBF A;  2R02 A;  3C8G B;  3K6B A;  1T6Q A;  1NR1 A;  1U97 A;  2QWP B;  2Y69 C;  5LXT B;  5JCO A;  3J80 N;  3SXZ A;  2YKZ A;  4LF5 O;  3EGD B;  2IJH A;  3FB6 C;  5KHH A;  3MHS C;  1K9M W;  2ASR A;  4AI8 A;  4ZKI A;  2EJR A;  4JEA A;  2AU5 A;  3E22 B;  1ZAU A;  3Q4H A;  2CGO A;  3DC5 A;  1G4U S;  2KQX A;  2Q67 A;  1WWP A;  3K5L A;  1HE1 A;  2HP8 A;  2YLD A;  1XWJ A;  4E17 A;  4O4I A;  2NN4 A;  2P1A A;  4CS8 A;  3WG7 B;  1MMN A;  2QDO A;  3A2F A;  3JYY A;  1AR1 B;  1IBL O;  1DOW A;  2P90 A;  2BSK B;  2P61 A;  1J95 A;  1GGQ A;  5T3W A;  1APC A;  3GB7 C;  4DR5 B;  3DKA A;  3A11 A;  3A8T A;  2F43 G;  3K79 A;  4CZZ A;  1N4C A;  2ADQ B;  3HNJ A;  3KL4 A;  3FKS G;  4X62 B;  1M56 C;  1T6U A;  1VQK V;  1OCZ C;  2Z3Y A;  5LGN A;  2H7O A;  1MND A;  3NMJ A;  3DZA A;  5L0I A;  1JQ0 A;  1WN0 A;  4ZI7 A;  4DR1 O;  2C03 A;  3LSS A;  3LEO A;  4LDQ A;  4LF8 O;  3JSL A;  4I50 B;  2CUG A;  3HKE B;  3JAM N;  3ETD A;  1ZYR F;  2B0H A;  2YL0 A;  3B4S A;  3U0C A;  4DV2 O;  4LDR A;  3S3X A;  1Q0K A;  2OEV A;  4U5H A;  5JP7 A;  2UUC O;  5A6B A;  4LF9 B;  5L0G A;  2IJK A;  4JTD B;  2Y3H A;  2DYR C;  3HKD B;  5CA3 A;  3MD0 A;  2YIB A;  4G78 A;  2P6J A;  3DE9 A;  1SF9 A;  1NH2 D;  1LUV A;  1WNS A;  1OXB A;  1IZ3 A;  3V5Y A;  2Y4U A;  3SYC A;  3ATP A;  4JW1 A;  4DVY P;  1I5N A;  2MHR A;  5JUA A;  4TV9 B;  1WPB A;  3EVK A;  1LIH A;  5D92 A;  3SJC C;  5J2U A;  1VTM P;  2PX0 A;  1F4M A;  3Q4H B;  2HMZ A;  5IYB O;  5JLI A;  1HW7 A;  3G4X A;  2NPU A;  2WLK A;  2KNH A;  3IPM O;  3NMK A;  1MQV A;  5EYP A;  1A41 A;  3CB2 A;  1XHX A;  3QF7 A;  4CH5 A;  5EHH A;  1EFR G;  3LSQ A;  4U5D E;  3G80 A;  2G3K A;  2NSF A;  1F51 A;  5L0J A;  4BJ1 A;  1GTO A;  3AG7 A;  1NU7 D;  4ZI7 B;  2OQM A;  5KYX A;  1TUB A;  3B0V C;  1VAR A;  3JCU Q;  1JX9 A;  4UCU A;  1JOG A;  1JR9 A;  3OR6 C;  2Q8V A;  3T6B A;  3CCM V;  4UV9 A;  4C7O B;  4MVS A;  2R7T A;  1Y76 B;  1VF6 A;  2V7Q G;  4NKG B;  1VEW A;  1AR5 A;  4YHH O;  3GEE A;  3J81 N;  2R7X A;  2YXL A;  2H8A A;  4UB6 Z;  1TWH A;  3JAS A;  3AG1 B;  2YRF A;  2E3C A;  2JIZ G;  4LF7 B;  2EJ7 A;  1T9K A;  2EIJ C;  1NTK H;  1LR1 A;  4OGQ B;  4YL0 A;  1FXH A;  2QA4 V;  3T1Y B;  3DMD A;  4DR6 O;  2G3V A;  1FFT B;  4LR3 A;  4NVP A;  4PK4 A;  3TXS A;  3BAB A;  1UJW B;  4LFB O;  3JAR B;  1FFX B;  1G5Z A;  3WFV A;  4O79 A;  5CA0 A;  5KHK A;  1P7G A;  5FPR A;  4OIR F;  1FR0 A;  1JJ2 U;  1DK1 A;  1U6H A;  5B5E Z;  2JD3 A;  2DQ0 A;  1NZ6 A;  3B8M A;  4HNA A;  4JI5 B;  3OUS A;  4UVC A;  2HHH O;  2AWY A;  2LP7 A;  4PV1 B;  1UG7 A;  1DF4 A;  1VF7 A;  2DMX A;  1BL8 A;  2IU0 A;  4G28 B;  4A2N B;  1K4C C;  2Z15 A;  1XL4 A;  4L8J A;  1QVF U;  5KLV H;  2HS5 A;  1S5L Z;  1K5S A;  1Q0F A;  1TR2 A;  4I3M A;  2LO1 A;  1TUB B;  2FAP B;  1ZW2 A;  2QE7 G;  2MW2 B;  4F6E A;  2PBE A;  3OGI B;  1TUE B;  2WSS G;  3CXH F;  2AVK A;  3F7V C;  4JV5 O;  3RYC B;  4IRU A;  2Q7E A;  4DRX B;  4XPX A;  4CDY A;  4JGS A;  4YN0 B;  2R9A A;  4HAM A;  4FZ1 A;  2FYU H;  2O57 A;  3D36 C;  1V54 C;  4KI2 A;  2FTK A;  1FYJ A;  1ENV A;  2OTL V;  3DC6 A;  2QJ1 A;  3C3S A;  3AG2 C;  3TUL A;  4JI0 O;  4YXW G;  4JI1 B;  3VQX A;  1TWC A;  2DWD C;  3OEO A;  4JEB A;  1H2S B;  2FKX A;  4GYT A;  2YDE A;  3NDB B;  2WVN A;  4K35 A;  3DD7 A;  2HMQ A;  1NJI W;  2HVK C;  4QDL A;  3CD6 V;  4FES A;  3ZHV A;  3KMI A;  3HNL A;  3M1C B;  4YT4 A;  4FLZ A;  4GX1 A;  4N4W A;  3A0H Z;  1T5E A;  1QPU A;  5CA0 B;  4DR2 B;  2KW3 C;  2MYS A;  3TJ5 A;  3P3N A;  4NTF A;  3QVZ A;  3APO A;  3G67 A;  2LD6 A;  1WB7 A;  2HR3 A;  1QNM A;  5LYJ A;  2DYS C;  1K05 A;  2BE5 F;  1H8E G;  4NTY A;  4YY3 B;  4FM1 A;  4FFB A;  2JGD B;  2UXN A;  3ASO B;  4JI4 O;  4F6R A;  3E8F A;  2KG7 B;  4JVS A;  1EZV H;  1GO3 F;  1S77 D;  1HE9 A;  2NUP A;  3CJH A;  3E8H A;  3OWT A;  3DJN B;  4LNU A;  3ZRX A;  1FD9 A;  1YCI A;  3LSU A;  1H38 A;  5LHH A;  1JMK C;  2FGY A;  5A69 A;  3M99 B;  2Q9C A;  4TSF G;  3CCQ V;  3S28 A;  3W2W A;  5C8Y A;  4BJ5 C;  5GON A;  4B3R B;  2YHS A;  3GVM A;  3NR7 A;  1TWA A;  3ETE A;  3CMA V;  2EPL X;  4D7S A;  4PJM A;  4O4H A;  4EBK A;  4JI3 O;  4NTW A;  5L3Q A;  4CH3 A;  2WPD G;  5D5P A;  4YT8 A;  1IBL B;  2VH3 A;  3ZC4 A;  1GM8 A;  3T1C A;  1ORY A;  3A0B Z;  4DR3 B;  5DVW A;  3TGU H;  1YJN V;  3RBZ A;  4FFK A;  5KMG A;  4LP8 A;  4B08 A;  5KA6 A;  4GQH A;  3VRC A;  3IQC A;  2A9H A;  5JRA A;  4MW8 A;  4DXW A;  3EPV A;  4J7Y A;  2F95 B;  2W4M A;  2YLI A;  2UUA O;  2EPM X;  2J8W A;  1H2M A;  4JTA B;  4XWJ A;  3OUF A;  1D1B A;  2D2C B;  4KHP O;  1QHT A;  3ZHQ A;  3FAV A;  2P06 A;  3CEX A;  2ITC C;  1GN4 A;  1E79 G;  3AG3 B;  4LF8 B;  2R05 A;  3ZBH A;  4DV2 B;  1AVO B;  4H54 A;  1VB5 A;  3PCV A;  1O5H A;  1I94 B;  2UUC B;  4J7J A;  3TK0 A;  1R5I D;  3IC7 A;  4OX9 O;  4NYK A;  1WOL A;  4DJ9 A;  4JI8 O;  1LPE A;  3IQ5 A;  1HMO A;  5JQG A;  3FAP B;  2XT9 A;  4NXM O;  1RCP A;  4F6R B;  1WAS A;  1RP3 B;  4YWQ A;  4XDJ A;  2XLM A;  3WHN A;  2VQF O;  3CJH B;  4LNU B;  1CGN A;  2R7Q A;  2E5L O;  2HJM A;  4TQD A;  1VLT A;  3W4Y A;  3MAQ A;  3KYI A;  1C17 M;  2ILM A;  4DW0 A;  4ER9 A;  1MZF A;  1PV0 A;  3JAT A;  5B3S C;  4PA9 A;  3ZHS A;  3SXK A;  1ZHT A;  1SRY A;  4A5U B;  4MVR A;  4YT2 A;  4LH6 A;  1RJ9 B;  1FNT c;  5LOV A;  3UR3 C;  4PJJ A;  4JAU A;  2ZXP A;  3JSZ A;  2PI5 A;  1K3E A;  4PAC A;  4LFC B;  3POV A;  5A9G A;  3GEI A;  2KKW A;  2QTS A;  3ZX6 A;  3HKC A;  1DF5 A;  3MBG A;  5H2F Z;  5KHG A;  4B3S O;  1YTF B;  2LQT A;  2AWC A;  4OIO F;  2F22 A;  4ABM A;  5JJJ B;  1HWY A;  3N2K B;  5BQH A;  5IJ9 A;  2D4U A;  5JH7 A;  3QZC A;  3RQE A;  3AOU A;  1ZU4 A;  3CXC U;  3FAV B;  1UFB A;  2EX3 A;  2ARH A;  5EGY A;  1NBB A;  2VAS A;  1KUQ A;  3QO7 A;  4BG0 A;  2R03 A;  4Z2W A;  3U0Z A;  3QG5 A;  1PD0 A;  2XUM A;  2R25 A;  3W8I A;  2K9P A;  3JAK B;  2EBO A;  4L6R A;  2PYJ A;  4BEJ A;  1HP8 A;  4LF9 O;  1LM3 B;  3EFF K;  3WAQ A;  3BEH A;  5JQG B;  3ASN C;  5IYD O;  3TCU A;  2PYL A;  2J9B A;  1L0L H;  1U96 A;  2KQ9 A;  1O87 A;  3EFO A;  4CS2 A;  3JSN A;  3CSX A;  2R7W A;  2CTR A;  1E1R G;  2XS8 A;  4DR6 B;  1VQM V;  3T6G B;  1JPX A;  2XL8 A;  3T6J A;  1X4T A;  1OV9 A;  1QQ3 A;  4LFB B;  3OT7 A;  1D0Z A;  3EHM A;  4I7Z B;  4Q5S F;  4B7E A;  5JSL A;  4N6H A;  4GLX A;  3E8G A;  3O55 A;  3V5Z A;  3HPL C;  1B04 A;  2J7P D;  1XRE A;  3GM1 A;  3C90 A;  4BJ6 A;  1WP8 A;  4CIH A;  4NTB A;  3CCS V;  3ZIB A;  1HW2 A;  2JS5 A;  1Z3I X;  2IXO A;  5FZT A;  4F4B A;  3RWR D;  4I4T A;  4FLU A;  1I4Z A;  1JMW A;  4ZLC A;  4LBE C;  4W4K A;  1N36 O;  3LDE A;  1SC5 B;  4ZOL A;  1GKF A;  4JAS A;  1Z5V A;  2VS0 A;  5BZB A;  4BW9 A;  3DJU B;  1FPO A;  2GTA A;  3KKY A;  1Z5W A;  1OXK A;  4E0H A;  3AQB A;  3BA9 A;  4CS8 C;  3BPZ A;  3QO8 A;  1DTO A;  1E2X A;  3PJS K;  3DTU B;  1GS9 A;  3FYI B;  3RYH A;  5J9P C;  4MS2 A;  2QUP A;  2HJD A;  3BVO A;  1QU7 A;  2ODM A;  5CN0 A;  3RYI B;  4QI0 A;  1NH2 B;  4Z9I A;  1ZHW A;  4MTX A;  3UO3 A;  1BQ0 A;  2A3Q A;  1VQ4 V;  5IWA O;  5ITZ A;  3K9A A;  4Q20 A;  3CRM A;  3TXQ A;  3H1I H;  3UQ8 A;  2NSG A;  1CXZ B;  1WA8 B;  5FNV A;  5L3C A;  1VQ9 V;  5F5H A;  3SPG A;  5CIV A;  3TK1 A;  4X1K A;  4PI0 A;  3EQL F;  5L3G A;  2ZCE A;  4X20 A;  3AK3 A;  2A79 B;  5HFM A;  3SYO A;  4JI0 B;  2P4K A;  1G6U A;  3T9O A;  1XEQ A;  3CRR A;  4LF7 O;  4Z1M G;  5EZY B;  4FLY A;  3EHN A;  1OZ0 A;  1NFN A;  5KYU A;  4TUY B;  3AGU A;  1R73 A;  1LI7 A;  2IJJ A;  3T1Y O;  1T6I A;  1KP2 A;  1VQL V;  3U3F A;  1ARO P;  2VRZ A;  3W7X A;  1SES A;  4XEV A;  4IIJ B;  4D6T H;  5B1B C;  3NRH A;  4YJ2 B;  2E75 B;  5CA1 B;  4K3A A;  4OIN F;  2R7R A;  1TAE A;  1G4W R;  1XQ8 A;  4JI4 B;  1YZB A;  3X2Q B;  1SQP H;  1EBO A;  3DXR A;  2OCH A;  5AG2 A;  1QVG U;  5LGT A;  4DR7 B;  3C8G A;  3IEE A;  1SZI A;  3N27 A;  4OIP F;  4ZOL B;  3O6X A;  3JRT A;  3K0D A;  5LXT A;  4RDA A;  4EEQ A;  1VQP V;  1TWG A;  4M63 A;  3ZMZ A;  3EGD A;  3DGE A;  1LKX A;  2Q9B A;  3GWO A;  3CCV V;  2GAQ A;  2CW0 F;  2M4E A;  1A7V A;  2QM8 A;  3K3W A;  3E22 A;  1F1M A;  2Q4P A;  1SQG A;  4LDK A;  1BHB A;  1PL4 A;  3JD3 A;  4ZHQ B;  2LW7 A;  2JPU A;  3JYC A;  3RFR A;  2QNL A;  1Z63 A;  5HFL A;  5ITZ B;  2YWA A;  1PCX A;  4LF4 O;  4JRZ A;  5H9C A;  3M15 A;  2PGG A;  2GWW A;  3K1I A;  3PMR A;  2QKS A;  4KNW A;  1H2K A;  3E2E A;  4X1K B;  1QLE B;  4CSA C;  1P4R A;  3DE8 A;  2UUA B;  1M93 A;  5E3A A;  2V4D A;  1PNL A;  4DV7 B;  4KHP B;  3LS1 A;  3A9C A;  3S27 A;  4XTK A;  2GTS A;  4Z9J A;  3ZSU A;  3H9V A;  3C18 A;  1JFF B;  4GEH A;  2LFR A;  4MTG A;  3ZRS A;  2IJI A;  4JI1 O;  2ZR2 A;  3CRA A;  1WJZ A;  2L6L A;  2X7R B;  2GHY A;  3GWK C;  1VF6 C;  2GUZ A;  3CPW U;  4H0L B;  3BY6 A;  4I50 A;  2XND G;  3ZMV A;  4H33 A;  4O2A B;  3FB5 C;  1TFO B;  3S3W A;  1OCR B;  3S9O A;  4BIZ A;  4TV8 B;  5EC2 C;  4AE4 A;  2PNO A;  1YF2 A;  3HKD A;  3LUT B;  4NXM B;  4R32 A;  3I5P A;  2MK3 A;  4I1M A;  3DXR B;  3SJA C;  1YIJ V;  2Q4F A;  3NYL A;  2VQF B;  2R7S A;  1FXK A;  2CTW A;  2XRH A;  2E5L B;  3JSE O;  2WAM A;  4LLC A;  1L0N H;  2YVK A;  3LLK A;  2JGU A;  3S0X A;  4XLP F;  4TV9 A;  2ZE5 A;  1TVK A;  2H3O A;  2WLJ A;  1I08 A;  3U10 A;  1D0Y A;  3MX3 A;  5B66 Z;  3D3I A;  4MVU A;  3TOM A;  3OMN B;  1BHA A;  4ZIB A;  4J30 B;  1GMG A;  4B3R O;  1NVP D;  3CS5 A;  4FAP B;  1V55 C;  5CBH A;  1Q81 W;  4EIY A;  3C3T A;  2WZL A;  2W6J G;  4X66 B;  2CK3 G;  1ZHZ A;  4O6Y A;  3AG4 C;  1M57 C;  1W59 A;  3NYM A;  2OCC B;  1JA8 A;  4B3S B;  2RD9 A;  4R6Z A;  3K06 A;  4PA3 A;  1JAF A;  1OQC A;  1AR4 A;  4DR3 O;  4GCZ A;  4CJG A;  2B1I A;  5LP6 A;  4BR6 A;  4HEA J;  1Q90 D;  3P3P A;  1IUR A;  2PTM A;  1PNK A;  3CCU V;  1Q6U A;  2A6H F;  1VF5 B;  5JWP A;  2OKU A;  2Y0I A;  3LNM B;  2GUZ B;  3TQO A;  1ZHX A;  1RM1 B;  1YYJ A;  1M2V B;  2OG2 A;  1ZX3 A;  1COW G;  3UT5 B;  4FJC C;  5LHG A;  2Z5U A;  1BBH A;  2CDY A;  1AI7 A;  2DOS A;  2LCH A;  1I94 O;  3CYO A;  1VK5 A;  4NTX A;  2P0N A;  3L9D A;  4C7O A;  4AE4 B;  4DUY B;  1SQX H;  1S5J A;  4ZLD A;  1Y76 A;  2OT5 A;  3F47 A;  3BHP A;  1RKC A;  3UMK A;  3ABK B;  4F4L A;  3WB1 A;  2QM4 A;  5E3C A;  3ZMT A;  256B A;  1GM5 A;  1YJW V;  1FXK B;  1B68 A;  4Q7C A;  2WA4 A;  3K59 A;  1R6T A;  1LI5 A;  2E74 B;  2PP4 A;  4FPP A;  3LLI A;  2XOK G;  1OCC B;  5DM6 V;  3U8P A;  4UUJ C;  1TVK B;  4DUZ O;  1XHZ A;  2IU3 A;  3DM5 A;  4RQE A;  2IW5 A;  2A1D D;  5LGU A;  1YIT V;  2R9I A;  3NKE A;  4W8P A;  3N2G B;  2OOC A;  4LH7 A;  5IY5 B;  3OR7 C;  1S5H C;  3JAR A;  4DV6 B;  3SPC A;  3AGT A;  1FFX A;  2DN9 A;  1JRA A;  3K0G A;  4O6N A;  1EN4 A;  2QEX V;  1QLN A;  3E9V A;  3FOP A;  5KYN A;  1E86 A;  1OHH G;  2J9V A;  2CAZ C;  4X1Y B;  4FM2 A;  3VM6 A;  1VOM A;  3E8B A;  3G6B A;  2RMK B;  2ETN A;  3ABT A;  4LFC O;  3OEE G;  2WLI B;  4E18 A;  1N36 B;  1MA1 A;  1ZL8 B;  4K1O A;  4CS9 A;  5LP6 B;  2L6F A;  2RCV A;  1Z7Q c;  3CSK A;  4B3M O;  2BC5 A;  3CWB H;  2ETS A;  1CP9 A;  4Q4Z F;  1K04 A;  2WLH A;  1HW1 A;  2R7U A;  2YLG A;  2UXB O;  4ASU G;  3EZI A;  3ZED A;  1KU9 A;  1VQ5 V;  4GKJ O;  2N05 A;  2R72 A;  3M79 A;  2ZIM A;  4FMT A;  4YK5 A;  4MTO A;  1H7I A;  1J8Y F;  5IWA B;  3PDM P;  2PUS A;  3MYI A;  1M5I A;  1R6N A;  5CBG A;  3RYC A;  5J2T B;  4O7G A;  4DRX A;  4OIQ F;  2EIM C;  3ZDL A;  2QY9 A;  4PA4 A;  1AUE A;  4JAA A;  2VWK A;  3MFN A;  3HLZ A;  1ORQ C;  2QSA A;  1XUQ A;  3SPH A;  1XL6 A;  3MHH C;  2ZDI A;  5IYZ B;  1NS1 A;  3B0P A;  3ABM B;  1DLB A;  2YL1 A;  4I44 A;  3ZTZ A;  3HKB B;  4KL1 A;  2YI8 A;  1KYO F;  1QKR A;  2YIC A;  4KXR A;  4J11 A;  2HKO A;  1IXM A;  1IBK O;  4K8X A;  2OTJ V;  2RDC A;  3KCX A;  1PL0 A;  4I1O B;  2A68 F;  1PD1 A;  1KNY A;  3ZRW B;  4AIL C;  4K8Z A;  4LER A;  3JAL B;  3ZHU A;  5H5N A;  4TWK A;  2AGA A;  3QVN A;  2EIK C;  1NG1 A;  1OKK A;  2DGJ A;  1W2W A;  1OR3 A;  2JGD A;  1CPQ A;  3ZG1 A;  4U7N A;  4B7K A;  2KG7 A;  1R3L C;  2YXH A;  3OMA B;  3L73 H;  2QTV A;  2XAQ A;  4B6I A;  1R3K C;  4TT3 G;  2ZXW B;  4JZA A;  5BMV B;  2XLE A;  1SET A;  1ZW3 A;  2WLL B;  3ZHR A;  3ZTM A;  2Q73 A;  2JX0 A;  2JK5 C;  2IH1 C;  1ZHY A;  4FZ0 A;  4IT5 A;  1KTM A;  1EZJ A;  2XSE A;  5T3T A;  3CCJ V;  1QBZ A;  1EQ1 A;  1P7B A;  3BCC H;  2LFF A;  4LF4 B;  1NKD A;  2QM7 A;  1HR0 O;  1SF8 A;  5HV9 A;  3H1H H;  3H2V A;  4DW1 A;  1IW7 F;  3SXM A;  1NBM G;  3ZJZ A;  2VCA A;  5KYY B;  3Q7G A;  3GOD A;  4Q6G A;  1R4T A;  2CNW A;  1JVM A;  1BR2 A;  2CTP A;  1N0N A;  3ZRV A;  1X59 A;  1Z5Z A;  4XQ1 A;  3KZI Z;  4DV0 O;  5KAF Z;  4RAI A;  3E70 C;  3KCY A;  3R66 A;  3SR2 C;  2AZ2 A;  1CGM E;  4FLW A;  1YI2 V;  4DRH B;  4LCU C;  1IXB A;  1HDJ A;  2L9J A;  2YQY A;  1G1X B;  2Y3G A;  1GN3 A;  1R3J C;  1ZWI C;  3OGC C;  4YJ3 B;  1D5N A;  1YLM A;  5KHI A;  4FWV A;  3JAW B;  1SQQ H;  4XEK A;  5BQI A;  1K97 A;  1DOV A;  5B1A C;  2C2A A;  4FM0 A;  4JI6 O;  3Q6M A;  4DR7 O;  3L75 H;  5F5F A;  1E84 A;  2Y39 A;  2Y69 B;  4NXN B;  1WAZ A;  5JVD B;  1IDS A;  3FMS A;  3U5S A;  4AL0 A;  1FXV A;  2DB4 A;  2BTQ B;  2R70 A;  3ABL C;  1YYX A;  2DJV A;  3SNH A;  4GKK O;  3FXH A;  3NMI A;  1L8D A;  2ZE8 A;  2QWO B;  5DQZ A;  2Y4T A;  2JS3 A;  4LWS B;  3UNG C;  5AC5 A;  1MNG A;  3H1J H;  4OXS A;  1V4A A;  1YAR O;  1RJ9 A;  2X0C A;  2VQE O;  4BW5 A;  3IC9 A;  3CE2 A;  2ICW G;  1OJH A;  1ZUQ A;  3C63 A;  1YHQ V;  3K58 A;  1KMI Z;  3PHF 2;  1RPO A;  5EBM C;  1E83 A;  3RN4 A;  2EIL C;  4I9Q A;  4PA7 A;  3U9J A;  1FJG B;  1MMA A;  3FHD A;  1U0B B;  3IQ6 A;  3H1L H;  4IHJ B;  2NNU A;  1G8X A;  1BT8 A;  1YZC A;  3N2K A;  2LSE A;  4WBN B;  2QKC A;  4DV7 O;  3SGI A;  2GDS A;  2Y0P A;  2J9U A;  1QQC A;  3RFY A;  1M56 B;  1H8H G;  1G4Y B;  1OCZ B;  1BR1 A;  1T5O A;  4KNV A;  1EM1 A;  1H9G A;  5H6Q A;  2Q9L A;  3ECS A;  2NG1 A;  2QE9 A;  1S0V A;  5DLJ A;  2J0X A;  2JDI G;  4G2K A;  4O4J B;  2EIN C;  1GAX A;  3ICX A;  5IT9 N;  2Q7H A;  5HSW A;  3JAK A;  1XNQ O;  2OJE D;  3B0U X;  2AZ0 A;  2DYR B;  3B71 A;  4HYO A;  5C93 A;  2MWQ A;  3K7D A;  3ZN0 A;  2JEX A;  4O6M A;  2AP3 A;  3UGP A;  1Y6D A;  4MSW C;  1WTY A;  3GEH A;  4PEL A;  3H1K H;  3ETQ A;  3OE7 G;  2ZM6 O;  1S76 D;  1AJQ A;  1QSP A;  4DUZ B;  3L0I A;  3TJ6 A;  1FTS A;  4QGP A;  4IL6 Z;  4N06 A;  3SPI A;  4QNH B;  1XMO B;  2Q68 A;  2B1G A;  2L81 A;  1J5E B;  3W7W A;  4O2B B;  5IYC O;  2WL8 A;  4XBF A;  4WF9 V;  4DYL A;  1N33 O;  3GM3 A;  2G38 A;  4DK0 A;  5T1D B;  2FB5 A;  5A6B D;  1XZQ A;  2D3O W;  3FVY A;  4CJO A;  1BS3 A;  1Y74 B;  3RKO F;  3QW1 A;  1A32 A;  4KP4 A;  4X66 O;  2VB6 A;  2YIB D;  3M4C A;  1NSG B;  1SMY F;  4EB6 A;  3HTK C;  4XLN F;  1DGS A;  3UKM A;  2XXA A;  3VQY A;  2VC9 A;  3R7C A;  4B3M B;  1C02 A;  4JYA B;  4DBR A;  1D2D A;  1B06 A;  5LBQ A;  1SA0 B;  3H2U A;  2YXY A;  1M4U A;  3T4D A;  4X65 O;  2UXB B;  2PFD A;  4CIP A;  5AC4 A;  3WG7 C;  4GKJ B;  1YVI A;  3SJB C;  5DN6 G;  2BL2 A;  3K1I C;  4E4E A;  3K5M A;  2QLA A;  2CGE A;  3IHU A;  3RYI A;  3SYN A;  3ZQY A;  4YIP A;  4IYH A;  3LJB A;  4D4N A;  3CCR V;  4BPM A;  1KC8 W;  1O9G A;  4MVO A;  1H2G A;  1WA8 A;  4DUY O;  2Q9A A;  3T2M A;  4ULV A;  2GSM B;  2IXM A;  2EUL A;  3A0R A;  4RD9 A;  2V26 A;  3WB0 A;  3THO A;  1M90 W;  2OJQ A;  3CP1 A;  2HSB A;  5EZY A;  4CDA A;  2EIJ B;  1MNE A;  3PN1 A;  1NTM H;  3WB2 A;  4BAY A;  3UCS C;  2UXX A;  4TUY A;  1PM9 A;  1KKD A;  3B40 A;  2ZE6 A;  4QE9 A;  5KA5 A;  1IBK B;  4CC6 A;  1VQ7 V;  1OW6 A;  3FDQ A;  1GM7 A;  4HZ3 A;  1YJ9 V;  4K0K O;  2B9Z A;  4J7Z A;  4X1I B;  3ETG A;  4IIJ A;  1ZU5 A;  3W7T A;  4DV6 O;  4YJ2 A;  1R1B A;  2ZXR A;  5CA1 A;  4N21 A;  1Y66 A;  5JCO C;  4BIU A;  2QGN A;  5EBW C;  3N2Z B;  4TQF A;  5COF A;  4JI2 O;  2OU6 A;  1SZT A;  4EB6 B;  2GDC A;  4U7O A;  3HNI A;  4NTA A;  2H7B A;  5F2V O;  4WFA V;  2XLH A;  2CCY A;  2XXA B;  3CC2 V;  3HR0 A;  4MW3 A;  1AJN A;  2FFH A;  3ZWI A;  4IGG A;  3TET A;  1OCO B;  1H6G A;  4KBL A;  3OFN G;  4NCQ A;  4U5E E;  1YZA A;  4U5G A;  1AP5 A;  1EKY A;  4G0H A;  2NUT B;  4BWA A;  4BJ5 A;  3QVY A;  5JS5 A;  2GBO A;  5COM A;  2VCC A;  4I9W A;  3ZMU A;  4X9Q A;  4ZHQ A;  4DV4 O;  1HR0 B;  2PF4 E;  3ZMS A;  1SS3 A;  2OIG A;  3E83 A;  4WFH A;  4PFO A;  4OD5 A;  1IVS A;  1S3J A;  3EHB B;  4H13 B;  3FYE B;  5CB4 B;  1V54 B;  4YJW A;  2M7W A;  3G4Z A;  2DQ3 A;  4DV0 B;  3U9M A;  1FKA O;  1VQ8 V;  1OW7 A;  3AG2 B;  1NTZ H;  2XLO A;  1Q0D A;  1AJP A;  1JFF A;  2XAF A;  1BZ4 A;  3U3B A;  1N1C A;  1S7Z A;  2LW1 A;  3UO2 A;  3L8I A;  2F66 C;  2Q3T A;  5EIB C;  2KSF A;  2W9Y A;  4XPY A;  3OD4 A;  4FLX A;  2Z0A A;  1LUW A;  2Q7G A;  2XAG A;  3BRC A;  5EK0 A;  5H6R A;  4O2A A;  3AG1 C;  3E86 A;  2L7A A;  2QWR B;  1RKE B;  4TV8 A;  5KUK A;  2UXC B;  1YSC A;  1T01 A;  2IH3 C;  5BXZ A;  3K04 A;  4OPH A;  1UFI A;  2DYS B;  3EG9 B;  2P5O A;  4C7U A;  3JD2 A;  2DWE C;  1EN6 A;  4JI6 B;  1FFT C;  1WLE A;  5AGF A;  3V7O A;  3BFR A;  1YEW A;  1XI1 A;  1ZSP A;  2DW4 A;  3LAY A;  3US6 A;  3D8C A;  2B0J A;  2A7W A;  1O9H A;  5LA6 A;  1P84 F;  4DR4 O;  2W45 A;  4R7C A;  4DV1 O;  4FVM A;  2HFI A;  1YDX A;  2LFD A;  4U3J B;  1I4Y A;  3D3Q A;  1HMD A;  4P6I C;  4GKK B;  3FOO A;  3ABU A;  4LF6 O;  4E7Z A;  2CGN A;  2LIG A;  1IBM O;  3CX5 F;  4HFK B;  3FB7 C;  2Q0A A;  2VQE B;  4CS9 C;  1BSM A;  4QE7 A;  2X6B A;  3RGB A;  3ZCC A;  1D5A A;  1VQN V;  3L1M A;  4Z1V A;  4WAB A;  2EPO A;  4DV3 O;  4I5S A;  2X51 A;  2HJF C;  5IDJ A;  2TMV P;  2YI9 A;  3FAJ A;  4CC5 A;  5KX5 B;  3LNR A;  3M8A A;  4H44 B;  2EPN A;  1AI5 A;  4LFA B;  4CH6 A;  2XM4 A;  3G50 A;  3LEV A;  4QPJ A;  3IAY A;  3U2M A;  2W0X A;  4NC3 A;  1SZX A;  1M2V A;  3KPH A;  2Y48 A;  2ZT9 B;  3IJ4 A;  3RYF B;  3UT5 A;  3IFX A;  1XNQ B;  2W0F C;  2ZDI C;  1WPX A;  1XNR O;  3M4B A;  2L6G A;  3B2E E;  3NYJ A;  1NU9 C;  4XEF A;  4JJG A;  3G4S V;  3K5O A;  3QO5 A;  4UVA A;  3CME V;  2CYD A;  2ATK C;  2YL3 A;  2HLD G;  4JI7 O;  1BZK A;  4AL1 A;  1RSO A;  2ZM6 B;  2YL7 A;  4E0I A;  1QZX A;  5LA6 B;  4B3T B;  1ORJ A;  3K1H A;  3O39 A;  1M1K W;  4NXN O;  4K7B A;  5L0H A;  2JVD A;  1US6 A;  4CS7 A;  4FIP C;  4JPR A;  3UMI A;  3N2G A;  1AP6 A;  1N33 B;  1M2O A;  2G62 A;  3SEO A;  3CHX A;  3ASO C;  5B3S B;  3Q6N A;  5TJ5 E;  3CC7 V;  3LS0 A;  3SP1 A;  4CDV A;  1MMM A;  1YDI A;  2CE4 A;  3VF0 A;  5FPO A;  4N23 A;  3QMK A;  3C8Z A;  4X1Y A;  2LFS A;  4J41 A;  3FD9 A;  4UCO A;  2WLI A;  4MTF A;  1L1F A;  2QR4 A;  1ZL8 A;  1M9N A;  1FJG O;  1TKN A;  1MSW D;  2A6E F;  2IXP A;  2KGO A;  4EBJ A;  1XMQ O;  5E2Q A;  4X65 B;  3DAF A;  4O4L B;  4GX2 A;  4C3B A;  2LP4 A;  4IAO A;  1I5Y A;  1PKX A;  4NR1 A;  5IE9 A;  4HE8 D;  5D91 A;  3CCE V;  2YSU B;  4PI2 A;  3I4U A;  4GT1 A;  3H65 A;  3JD4 A;  5E1A C;  1K40 A;  4AQY O;  3F46 A;  2QKA A;  3L34 A;  1Z2G A;  2X0L A;  2UXD B;  2LJ2 A;  5J2T A;  3HB3 B;  2UUB O;  4MT8 A;  4JYB A;  4I0X B;  3B09 A;  3L71 H;  1VP7 A;  3F5W C;  4PA6 A;  3AG3 C;  3ASN B;  1BDJ B;  3JT1 A;  2KK1 A;  4DVZ A;  2P6V A;  1RSO B;  2LGW A;  4E2L A;  5IJ0 B;  3J06 A;  1V9P A;  3RQF A;  3GAN A;  3SJQ C;  5IYZ A;  3N0T A;  2EZO A;  2IM9 A;  1L7C A;  2VCB A;  3CZ6 A;  1MAB G;  3HKB A;  2HVJ C;  5A6A A;  2RNB A;  4K0K B;  4Z9H A;  1XMO O;  2KB1 A;  1B3Q A;  1J5E O;  4RQF A;  4XPW A;  1Y67 A;  4UFZ A;  1HNW O;  3AQC A;  3JYH A;  3S84 A;  3ZRW A;  4JI2 B;  4EUK B;  4ONS A;  2F23 A;  3JAL A;  1W0K G;  2AW9 A;  2WWW A;  4WGY A;  4X64 O;  1FMV A;  1IX9 A;  1YA9 A;  2WB7 A;  4PDR A;  3VQV A;  1O3U A;  4C3D A;  5A6J A;  4PDV A;  1Q6I A;  4U5C E;  1HY5 A;  2C04 A;  4DOZ A;  4JYA O;  1XOU A;  5BMV A;  1KU2 A;  2WLL A;  2A69 F;  3KYJ A;  4E7S A;  5B3I A;  4X88 A;  1NZE A;  2ZXO A;  4O4I B;  4CS3 A;  2XHB A;  3T4Z A;  5KUM A;  2OIE A;  1I5X A;  3LDD A;  1JOY A;  4P9F A;  3JCZ A;  1WN7 A;  2NLJ C;  4DV4 B;  3CAX A;  4FLT A;  3MLG A;  4JJF A;  4A4A A;  1FMW A;  1I0H A;  4UDV A;  4JE9 A;  4U3F H;  1R6K A;  1E85 A;  5KYY A;  1Q82 W;  1H9T A;  4H37 A;  1CPY A;  3GOR A;  4IYI A;  3DI5 A;  3K08 A;  4CSA A;  2ZNI A;  1SER A;  1VQ6 V;  3J7A U;  4DV5 B;  1TQG A;  5DEC A;  2B5U A;  1R3I C;  1JR8 A;  1A7E A;  2J7P A;  4CX9 A;  1GRJ A;  4JZ2 A;  2F4V O;  4J7K A;  3ZVR A;  2EPK X;  3OMI B;  3RT3 C;  2ZR3 A;  3SXY A;  1K7D A;  1XBL A;  5JJE B;  2UU9 B;  3LDC A;  4RUE A;  1PV3 A;  3K9S A;  5B1B B;  3SZR A;  1RPR A;  3I5Q A;  2QWN B;  5FL7 G;  2KJG A;  1XZP A;  2ZKO A;  2Y3B A;  4JTC B;  4YJ3 A;  3ZHT A;  2J45 A;  2AHY A;  3ITF A;  3RF3 A;  2HUJ A;  1MSD A;  3JAW A;  1UPG A;  1SQB H;  3OTO O;  5J2U B;  3G71 V;  4DR4 B;  1SQV H;  3BA8 A;  4DV1 B;  4FK5 C;  4IWB A;  5L3E A;  1FAF A;  4CH4 A;  3JZ0 A;  2RSE B;  4LLE A;  1TGO A;  5JVD A;  3C7J A;  2CH7 A;  4PFP A;  1NR7 A;  1MOF A;  2BTQ A;  5L3B A;  4LF6 B;  3DAG A;  4GUN A;  3L8J A;  3W7U A;  3L72 H;  4PDL A;  1HNZ B;  1IBM B;  1KB9 F;  2K1E A;  3SDL A;  5EYP B;  1Q7Y W;  4LWS A;  3IGA C;  4GYC B;  3GM2 A;  1VYI A;  1Q5O A;  4G7H F;  1OCO C;  2WLN A;  4GZR B;  3ZQV A;  4DV3 B;  3LNN A;  4PHZ A;  1GK9 A;  4WFG A;  5LL6 Y;  1WP7 A;  3C8G D;  2BOC C;  2ZQM A;  5KYX B;  4IHJ A;  1N32 O;  4RO2 A;  3RYL A;  2XAJ A;  4AHC A;  4R8C A;  4G7Z F;  4WFF A;  4WBN A;  1GQA A;  4EBB A;  1BR4 A;  1QVX A;  3EZH A;  2V3C C;  2X6C A;  3EXA A;  5DS4 A;  5K1P A;  3DM9 B;  1XDC A;  1KEC A;  4L87 A;  1WB8 A;  1K92 A;  3T1H O;  1JJO A;  3QTC A;  1EI7 A;  1Q43 A;  4LC1 A;  2HZ8 A;  3VAY A;  4C3E A;  1J8M F;  2H94 A;  5JVE A;  1RMV A;  4O4J A;  5TIS Z;  2ZIN A;  3P30 A;  2J0W A;  3OTF A;  4YL3 A;  3JAS B;  4I55 A;  2XLW A;  1XNR B;  1ZVZ A;  5E33 A;  3KG2 A;  2BOB C;  1N0J A;  4UXN A;  2UXC O;  4IAQ A;  5BR8 O;  1FAP B;  4JI7 B;  3L74 H;  5LHI A;  3L70 H;  4UCT A;  1Z6A A;  3AJM A;  2Q0O C;  1KQS U;  4H4K C;  1FS0 G;  4TOI A;  5GW7 A;  2YIA A;  1LNQ A;  4J42 A;  2XL6 A;  4JUR I;  2CH7 B;  3EJN A;  3TOL A;  2P22 C;  5DQT A;  4BJ6 C;  1AI6 A;  4ZBM A;  3W2V A;  3FFQ A;  1MMD A;  1TA8 A;  1WAT A;  1BGY H;  3G6E V;  2L35 A;  3DWW A;  3X2Q C;  4UCS A;  3STZ C;  5A2Q N;  4O2B A;  1B6Q A;  3WU2 Z;  1H2L A;  4HNA B;  2A0L A;  2L6H A;  3EH2 A;  2GFH A;  3K33 A;  1URF A;  5FCL A;  4AX2 A;  1V55 B;  2OWO A;  3CRC A;  1Y74 A;  4LF5 B;  1JPJ A;  2RJZ A;  2DE0 X;  3AG4 B;  1M57 B;  1CPR A;  1HNX O;  4UV8 A;  4J7T A;  1ORS C;  3HNK A;  1IZM A;  4J9Y B;  4PJ0 Z;  2J46 A;  1BMF G;  2EZP A;  2XL4 A;  2VWJ A;  5B1O A;  4X8A A;  1Y6X A;  1XMQ B;  1L3P A;  2ITD C;  1FFH A;  5L3F A;  3TD7 A;  1SA0 A;  5LMU O;  5BUO A;  1LVK A;  1K4D C;  4NY3 A;  1Q86 W;  3OAA G;  4LFA O;  2ZPA A;  1Q3E A;  2YID A;  1VQO V;  5BY1 A;  4MVZ A;  3W8H A;  3B77 A;  2XLD A;  4UCV A;  1QLE C;  3K03 A;  2GA0 A;  4P9T A;  2H7V C;  3STL C;  4AQY B;  1C03 A;  2P7V A;  4PR9 A;  4I55 B;  3N24 A;  2HFE C;  3O65 A;  1Z23 A;  2UUB B;  3HJC A;  5LMN O;  3RIP A;  1D1C A;  4J9Z B;  1H2N A;  1NU1 H;  4IJJ A;  1YAU O;  4RWU A;  2ADP A;  2PZS A;  5D5Q A;  4DR1 B;  1W2B U;  2YZS A;  2QWQ B;  4HFF B;  1N34 O;  1LE4 A;  1G8M A;  1A0B A;  4EWC A;  5KAI Z;  3TJT A;  2PY5 A;  1VMA A;  4J80 A;  4CBE A;  4DRJ B;  4BIO A;  1OCR C;  4B3T O;  1SYQ A;  3OA1 A;  3AK1 A;  2BTO A;  2F1M A;  3E35 A;  3BRJ A;  4R50 A;  2W4B A;  3NKD A;  5LYJ B;  3SYQ A;  4P30 A;  4FFB B;  1HNW B;  4JKV A;  5K0I A;  4QJF B;  1GH6 A;  4X1I A;  2Q69 A;  3SYP A;  1JCH A;  4UB8 Z;  2NUP B;  2ZNJ A;  4K0D A;  1VMG A;  1E1Q G;  5K1X A;  4U9D A;  3VQW A;  1BQZ A;  4JIO A;  2IYL D;  2CDQ A;  5EIB D;  2KC3 A;  1W0J G;  4X64 B;  4ULW A;  4FX5 A;  1EN5 A;  3R2P A;  5CI8 A;  2Q7R A;  4KUM A;  3S90 A;  1KKC A;  5C8Y B;  4P9O A;  5GON B;  5L0D A;  1OR2 A;  1VYK A;  2DI3 A; 
#chains in the Genus database with same CATH homology
 4ZLD A;  3V7O A;  3F47 A;  3LAY A;  2R7O A;  4IRU A;  3UMK A;  3EGX A;  2B0J A;  4G7O F;  2W45 A;  5E3C A;  4YN0 B;  4Q7C A;  1V54 C;  2NUT A;  3LLI A;  2IXN A;  4KI2 A;  2PP4 A;  1MMG A;  2OCC C;  4P6I C;  4WJ0 A;  4E7Z A;  3AG2 C;  3DM5 A;  2A1D D;  4HFK B;  3NKE A;  2WVQ A;  3VYW A;  3X1O A;  1TWC A;  3OEO A;  4GYT A;  4CS9 C;  3NDB B;  2WVN A;  3DD7 A;  2DN9 A;  4O6N A;  4QDL A;  4FES A;  3KMI A;  3M1C B;  3E9V A;  3LES A;  4YT4 A;  5KYN A;  2J9V A;  2KW3 C;  2MYS A;  2X51 A;  2I8B A;  1VOM A;  3APO A;  1D0X A;  2D5R B;  3FAJ A;  2DYS C;  3UGO A;  3LNR A;  2BE5 F;  4W8K A;  4CS9 A;  4JVS A;  3CSK A;  2NUP A;  3ABK C;  3LEV A;  3OWT A;  4Q4Z F;  3DJN B;  3KH2 A;  1M2V A;  2WZF A;  2R7U A;  2FGY A;  3EZI A;  2CTQ A;  2N05 A;  2Q9C A;  3S28 A;  3W2W A;  1OCC C;  3EG9 A;  4BJ5 C;  3NYJ A;  2YHS A;  1NU9 C;  1J8Y F;  1TWA A;  5KYW A;  4JJG A;  4PJL A;  4PJM A;  3K66 A;  5IY5 C;  4O7G A;  5L3Q A;  4OIQ F;  2EIM C;  2QY9 A;  3EGX B;  3NG1 A;  4YT8 A;  3HLZ A;  2VH3 A;  1QZX A;  2QSA A;  3K1H A;  3O39 A;  3ZC4 A;  4BJT A;  5DVW A;  4K7B A;  3B0P A;  2YUA A;  4CS7 A;  2O9X A;  3EPV A;  2W4M A;  3UMI A;  4KC9 A;  4I44 A;  5DS6 A;  1M2O A;  3APQ A;  2G62 A;  4XWJ A;  3SEO A;  3ASO C;  1D1B A;  3Q6N A;  3LS0 A;  3CQZ A;  3SP1 A;  3S29 A;  1OKK D;  3Q7L A;  3QMK A;  4I1O B;  2A68 F;  1PD1 A;  4LER A;  1O5H A;  2DGJ A;  1NG1 A;  2EIK C;  1OKK A;  1W2W A;  3ZG1 A;  1TKN A;  2A6E F;  2IXP A;  2KGO A;  5E2Q A;  3DAF A;  2QTV A;  4B6I A;  4YWQ A;  2HV7 A;  4C3B A;  4JZA A;  2M6Y A;  4IAO A;  5CI9 A;  1LS1 A;  4HE8 D;  3WOD F;  2R7Q A;  5D91 A;  4J32 B;  3EFO B;  3I4U A;  3H65 A;  2E87 A;  2PX3 A;  3ABM C;  3F46 A;  2YS8 A;  3L34 A;  1ZHY A;  4IT5 A;  2XSE A;  5T3T A;  2CNW D;  4X0R A;  5B3S C;  5KYW B;  1ZHT A;  4JCH A;  1SF8 A;  3AG3 C;  4YT2 A;  1IW7 F;  3JT1 A;  4DVZ A;  1RJ9 B;  5KYY B;  4U5B E;  2P6V A;  3UR3 C;  4PJJ A;  3Q7G A;  2ZXP A;  3GOD A;  4DBQ A;  2LGW A;  3JSZ A;  2CNW A;  4RBN A;  3POV A;  3GAN A;  1BR2 A;  3N0T A;  2CTP A;  1Z5Z A;  2N04 A;  3CZ6 A;  4OIO F;  3E70 C;  2YEV A;  3QZC A;  3T4R A;  1ZU4 A;  3AQC A;  2ZXW C;  5EGY A;  3JYH A;  2VAS A;  1ST6 A;  4BG0 A;  1HDJ A;  2L9J A;  2Y3G A;  1PD0 A;  2J9W A;  4U5F E;  1FMV A;  2WZG A;  3W8I A;  2WB7 A;  4PJN A;  4YT5 A;  4C3D A;  4FWV A;  4U5C E;  4MND A;  3UMH A;  4BEJ A;  2C04 A;  5B1A C;  4DOZ A;  3Q6M A;  3ASN C;  2WVO A;  1KU2 A;  3EH1 A;  4ANJ A;  5F5F A;  2A69 F;  4E7S A;  2Y39 A;  1NZE A;  2ZXO A;  2KQ9 A;  3B9Q A;  5L3V A;  1O87 A;  3EFO A;  2IOQ A;  3ABL C;  2R7W A;  2CTR A;  3SNH A;  4JJF A;  3MLG A;  1FMW A;  3T6J A;  1JPN A;  2QWO B;  5DQZ A;  2Y4T A;  3UNG C;  1D0Z A;  5KYU B;  3EHM A;  5DS5 A;  4Q5S F;  4LAC B;  4MQ9 F;  1RJ9 A;  4AK9 A;  5KYY A;  3RH3 A;  4OD4 A;  2J7P D;  3PHF 2;  4CSA A;  4BJ6 A;  2EIL C;  2HV6 A;  4CIH A;  3ZIB A;  1MMA A;  3FHD A;  2R7V A;  3KKB A;  4QI2 A;  1D1A A;  1Z3I X;  4F4B A;  2IXO A;  1WGW A;  1G8X A;  4ZLC A;  2J7P A;  2Y3D A;  2LSE A;  3DXJ F;  3ZVR A;  2J9U A;  3RFY A;  3K6B A;  1BR1 A;  3DJU B;  4KNV A;  1FPO A;  1XBL A;  2QWP B;  2Y69 C;  3AQB A;  4CS8 C;  3ECS A;  2NG1 A;  3SZR A;  3EGD B;  5DLJ A;  3I5Q A;  2J0X A;  2QWN B;  2KJG A;  2EIN C;  2Y3B A;  2J45 A;  3BVO A;  3ITF A;  5HSW A;  4QI0 A;  3B0U X;  1ZHW A;  3UO3 A;  1BQ0 A;  2MWQ A;  3K7D A;  2KQX A;  4IWB A;  1FAF A;  5F5H A;  4O6M A;  4LLE A;  4CS8 A;  3UGP A;  4PFP A;  3EQL F;  1MMN A;  3DAG A;  3L0I A;  5T3W A;  1FTS A;  4N06 A;  3EHN A;  2L81 A;  5KYU A;  1N4C A;  2WL8 A;  1VYI A;  3KL4 A;  4G7H F;  1M56 C;  1OCO C;  1OCZ C;  2H7O A;  5T1D B;  1MND A;  3DZA A;  3FVY A;  2C03 A;  3RKO F;  3NRH A;  5B1B C;  2VB6 A;  1ZYR F;  2CUG A;  4OIN F;  2R7R A;  1SMY F;  3HTK C;  5KYX B;  3RYL A;  4XLN F;  4U5H A;  2XXA A;  4G7Z F;  4EBB A;  2OCH A;  1BR4 A;  2DYR C;  2Y3H A;  3EZH A;  2V3C C;  5DS4 A;  3DM9 B;  3IEE A;  4DBR A;  1SZI A;  4OIP F;  3O6X A;  3JRT A;  4C3E A;  3VAY A;  4RDA A;  1J8M F;  2PFD A;  1TWG A;  4M63 A;  3WG7 C;  3EGD A;  2Y4U A;  2J0W A;  3K1I C;  1LKX A;  2Q9B A;  4JW1 A;  4DVY P;  2CGE A;  2M4E A;  2CW0 F;  5E33 A;  3SYN A;  3LJB A;  5D92 A;  2PX0 A;  1Z6A A;  2Q9A A;  1Z63 A;  4H4K C;  1PCX A;  2IXM A;  4RD9 A;  2V26 A;  3PMR A;  4JUR I;  2KNH A;  3EJN A;  4KNW A;  4CSA C;  5DQT A;  4BJ6 C;  3W2V A;  1MMD A;  5E3A A;  1MNE A;  5EHH A;  3X2Q C;  3LS1 A;  3S27 A;  3UCS C;  4XTK A;  3ZSU A;  4GEH A;  4U5D E;  3EH2 A;  2GFH A;  3K33 A;  3FDQ A;  2G3K A;  5FCL A;  4AX2 A;  1WJZ A;  2L6L A;  4J7Z A;  2GUZ A;  4BJ1 A;  1JPJ A;  1ZU5 A;  3AG7 A;  2ZXR A;  1NU7 D;  3N2Z B;  5KYX A;  3B0V C;  1IZM A;  3JCU Q;  2J46 A;  2XL4 A;  4AE4 A;  2H7B A;  3T6B A;  1FFH A;  2XXA B;  3I5P A;  3TD7 A;  4C7O B;  4I1M A;  5BUO A;  1LVK A;  3NYL A;  2FFH A;  4NY3 A;  2R7T A;  4KBL A;  2R7S A;  2R7X A;  2CTW A;  2ZPA A;  4U5E E;  2XRH A;  4U5G A;  1TWH A;  3W8H A;  1QLE C;  4LLC A;  3LLK A;  2H7V C;  2EJ7 A;  2NUT B;  4G0H A;  3S0X A;  4XLP F;  2P7V A;  4BJ5 A;  1D0Y A;  2EIJ C;  3N24 A;  3MX3 A;  1Z23 A;  3HJC A;  3RIP A;  4J30 B;  3DMD A;  2PF4 E;  1D1C A;  2G3V A;  4IJJ A;  4RWU A;  4PK4 A;  4PFO A;  1V55 C;  4OD5 A;  2YZS A;  4HFF B;  2QWQ B;  2WZL A;  1ZHZ A;  4O6Y A;  3AG4 C;  4EWC A;  1M57 C;  1VMA A;  4J80 A;  4O79 A;  4CBE A;  4YJW A;  3NYM A;  4OIR F;  3OA1 A;  1OCR C;  2JD3 A;  1NZ6 A;  2W4B A;  3NKD A;  4HEA J;  1N1C A;  1S7Z A;  3UO2 A;  1IUR A;  2A6H F;  2Q3T A;  1GH6 A;  2DMX A;  2W9Y A;  2NUP B;  4K0D A;  4A2N B;  2Z15 A;  1BQZ A;  2GUZ B;  1ZHX A;  3AG1 C;  2CDQ A;  2IYL D;  1M2V B;  2OG2 A;  2QWR B;  4ULW A;  1TR2 A;  4FX5 A;  4I3M A;  2LO1 A;  5CI8 A;  1VK5 A;  3EG9 B;  4C7O A;  4AE4 B;  1VYK A;  1FFT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...