2PF4E

Crystal structure of the full-length simian virus 40 small t antigen complexed with the protein phosphatase 2a aalpha subunit
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
172
structure length
163
Chain Sequence
MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWASSLNPGVDAIYCKQWPECVKKMSTNCICLLCLLRMKHENRKLYRKDPLVWVDCYCFDCFRMWFGLDLCEGTLLLWCDIIGQTTYRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
publication title Structural basis of PP2A inhibition by small t antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase regulator/viral protein
total genus 40
structure length 163
sequence length 172
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02380 Papo_T_antigen T-antigen specific domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2pf4E01
1.20.120.1860 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2pf4E02
3AG7A 2GUZA 1GH6A 3APQA 1BQZA 2DMXA 2CTQA 4RWUA 1BQ0A 1N4CA 2EJ7A 2CTPA 2Y4UA 2LO1A 2DN9A 2KQXA 2QWOB 1WJZA 4IT5A 2CTWA 1FPOA 2N04A 3APOA 2M6YA 2L6LA 3UO2A 4J7ZA 2N05A 2QWPB 2QSAA 2Y4TA 4J80A 3UO3A 2CTRA 2CUGA 3BVOA 2YUAA 1FAFA 1NZ6A 1IURA 2QWNB 1HDJA 2GUZB 2YS8A 2QWRB 1XBLA 2OCHA 2PF4E 2QWQB 3UCSC 2LGWA
chains in the Genus database with same CATH superfamily
1K8AW 4YIOA 1XNRO 2IXMA 4YWQA 2KG7A 1MMMA 4O4IA 2EJ7A 3HPLC 3BAAA 5COGA 3A11A 1J5EB 1NQTA 5C8YB 2LQTA 1JX9A 3H1JH 3CJHB 4Z9HA 1NU9C 2E5LB 4FFKA 1J5EO 2BL2A 5T3TA 2HS5A 1G4YB 5EK0A 1GN6A 1K7DA 2E5LO 3SEOA 5EBLC 3VQWA 1PL0A 4JI4B 2FGYA 4MW8A 3O39A 2I15A 4JI4O 3EFFK 2Y3GA 1S7ZA 3E8FA 2JVDA 5JVDA 3BCCH 2QM7A 4FM2A 3SJQC 1QR9A 3DI5A 3D36A 4DW1A 4HYOA 4X62B 3CC7V 2PBEA 4NTFA 3RYIB 4X62O 2LJ2A 2NPUA 1YJNV 2YDEA 4JAUA 2UXNA 1H9TA 3BRCA 2CH7A 3FOPA 1WATA 4DRIB 4JI2B 3P30A 4XQ1A 4IYHA 5EZYB 3TK0A 2XLOA 4IARA 4FLWA 2H94A 1SYQA 3EZHA 4JE9A 4AE4B 2DW4A 2A68F 4UVCA 3K58A 2XAFA 1RKEA 2Q7RA 3LLKA 3TCUA 4P30A 2EPMX 4DOZA 1ORSC 3D8CA 4QDLA 4L6RA 3UM7A 3H2UA 2OIEA 3L75H 3T4ZA 4NYKA 3OFNG 1CGME 4ABMA 3QG5A 1IBMB 2XAGA 3DAGA 4NTYA 3I56V 5CA3A 1IBMO 2IU3A 2JX0A 3KZIZ 4DV5B 2MWQA 3HKDB 4Z9JA 4FZ1A 4NTBA 4DV5O 1JMKC 3K79A 3E2EA 2Q8VA 2HKOA 4PJ0Z 5AC5A 1PNLA 3AG3C 5KYYB 1B04A 5IJ0B 2W0XA 2GUZB 1L8DA 2A79B 1JAFA 3ZC4A 1Z5ZA 4X1IB 2MHRA 2DMXA 2ZQMA 3ZHTA 1RP3B 1VB5A 2CTPA 3JAKA 2GDSA 3O65A 3ETGA 1BMFG 4F4BA 1MMDA 1PD1A 2B0HA 1WN7A 3B77A 3TGUH 4P9FA 2J7PA 3I55V 1H8EG 3STLC 2RSEB 1Z5WA 1JOYA 1LE4A 2XTAA 1DF4A 1Y74A 1FFTC 2B0JA 2PX3A 4DXWA 1Q6UA 4JV5B 3AEIA 3IJ4A 4BJ5C 4B3RB 4MTGA 4JV5O 2Q9AA 3EG9B 3CSKA 3V5YA 4B3RO 4U5FE 5CMUA 5A9GA 4MVUA 1YI2V 4YJ3A 4I7ZB 4A2NB 1ST6A 2DN9A 5LOVA 3OWTA 3E86A 3DTUB 4UV9A 4MVQA 2GWWA 1I4YA 1JFFA 1Y4CA 3ASNB 3ZHVA 4LC1A 3P32A 1S5LZ 5LA6A 3ZRVA 3ABMB 4MTOA 1QLEC 3JSLA 2AZ0A 2LD6A 3FAVB 4LBEC 1AVMA 4O4HB 5LL6Y 5JH7A 3CS5A 1A7VA 1AI4A 4ZOLA 1YVIA 2PX0A 4DVYP 3ZEDA 1YHQV 1SR2A 1TQGA 4JEAA 1KTMA 2YLGA 5EC1C 1H8HG 3N27A 1EFRG 3L8JA 5FLXN 2HV7A 2Z0AA 1ZVZA 3AG4B 2WZLA 3KMIA 1YF2A 3W4YA 4E0HA 1FS0G 5LXTB 1HP8A 2LCHA 1MMGA 4WFAV 2BCCH 5LGNA 5DS6A 3W8IA 3RIPA 1ORQC 1VF6A 4GX1A 1W0KG 4O2AA 4U7OA 1L7CA 1MNEA 3CAXA 4DV7B 2EJRA 2CGOA 4LH6A 4DV7O 5EYPA 2YXYA 2HUJA 3FD9A 4CDYA 5B1BB 1PKXA 1YVWA 3X1OA 2B1IA 3K04A 5LGTA 4B3SB 4HEAJ 3OR6C 1WASA 4B3SO 1Q8IA 3NYJA 1VARA 1YXBA 5FL7G 2WZFA 2HMZA 4U9EA 1KQSU 3BABA 4MVZA 2EPNA 3RH3A 2Y3DA 2Y3BA 1J8MF 4G28B 5KAFZ 4DV4B 3T6JA 5JQGB 1FMVA 3MHHC 4DV4O 1YA9A 4KBLA 2Y3HA 4JAAA 4GKJB 5KYUA 4IJJA 4GKJO 2VH3A 1ORYA 5BXZA 3OMAB 2VWKA 2DYRB 3MFNA 3UO2A 2D4UA 3TULA 2A1DD 1IDSA 4BEJA 3EHBB 4J10A 2ATKC 1CGOA 2LK4A 4UVAA 3F47A 5IYCO 2QEXV 1TWHA 5K0IA 5JUAA 3PN1A 3OTOB 2WLMA 3K3WA 1ZHYA 2ZE5A 1PNMA 3OTOO 4AI8A 4EBKA 4TV8B 1YZAA 1YTFD 3E8GA 2XXAB 4K0KB 5K1XA 4JI3B 3C63A 3OAAG 4K0KO 3AG1B 3J06A 4JI3O 3O10A 3RVZA 2LP7A 3JSNA 1HE9A 3M4CA 4DR3B 1QQCA 3RWRD 4DR3O 5ITZA 2ZXWB 2PI4A 2Q9CA 5KHJA 1JRAA 1FFTB 3T6GB 4I4TA 3CP1A 4X1YA 4N6HA 4CH6A 1BDJB 2IBFA 5EBWC 3CRQA 2PY5A 3IFXA 4L8JA 1L3PA 4X66O 1XHZA 1A0BA 2QKCA 3DZAA 5DS4A 1AJPA 1G6UA 3E22B 4CC6A 2PUSA 4BPMA 4X9QA 2XLDA 4CS3A 1EN6A 5L3CA 2LW7A 2X6CA 5BMVA 4UCVA 4P9PA 4PFPA 1KP2A 5DEDA 3S84A 1M9NA 3FFQA 4C7UA 2IJJA 3B71A 3TJ5A 4PJLA 2ODMA 1V55C 4WBNB 2WLLB 3X2QC 1P7GA 2YS8A 1JOGA 2J45A 3CRCA 2GAQA 2XS1A 2NLJC 5T1DB 1XWJA 2OT5A 2Q4PA 1D1BA 3JAWA 3OEEG 2NNUA 2H3OA 1W59A 2XM4A 3T1HB 4JRZA 1H6GA 3T1HO 5LYJB 1S77D 1Q82W 1VQ4V 4JW1A 2Y69B 2ETSA 1BHAA 1AP6A 1PM9A 3F7YC 3LSUA 5H6RA 1S72V 1M5IA 3W2WA 5L3DA 3HNIA 4PJJA 1R1BA 2ZDIA 3OW2U 3HKCB 3SYQA 2WAMA 3L73H 2IU0A 4WFFA 3JSEO 2HLDG 4Q7CA 3JARA 2F93B 3GANA 3HNLA 1UFBA 4NB5A 5D5PA 2IYLD 3OTFA 3BRJA 3T6BA 1Y76B 5IYDO 5FCLA 4YN0B 5FPRA 2ZE8A 1ZU4A 1Y66A 3QF7A 4G0HA 4LF5B 3ZHSA 5EGYA 4GEHA 4LF5O 3GWOA 2KYHA 3K1HA 1SESA 1NFOA 4EBBA 2Q68A 3US6A 4CX9A 4OX9B 1PV3A 4G2KA 1SZIA 4OX9O 2OU6A 1JA8A 3S28A 1SETA 2ZIOA 3DSQA 3WAQA 1B3QA 1D2DA 1R3JC 2P0NA 3S0XA 3S3WA 2A6EF 2Q7HA 4XPXA 4OIQF 2NG1A 1NZEA 4G7ZF 4MSWC 5BQIA 1UG7A 4Z1MG 3NKDA 4CSAC 4I0XA 2L7AA 2X6BA 2OIGA 1HMOA 4DR5B 3CRAA 2NN4A 4DR5O 3K33A 3SXYA 1SQGA 3SJAC 4UFZA 3C8GD 3P3PA 4U3JA 4CS8A 5J2TB 2OKUA 1J95A 3G80A 3STZC 3KL4A 5B1AC 4PELA 1KUQA 3ABKB 3JSZA 1YSCA 2M7WA 2GV9A 2FL4A 3BFRA 2EILC 3BA9A 3ICXA 2XT9A 1P4RA 3ZJZA 2NSFA 3SYOA 3OUFA 1ZHXA 2A69F 1SS3A 1NTKH 4JTAB 3GWKC 2CW0F 2H8AA 4Z2WA 5F5FA 3LEVA 4LCUC 3M7MX 3LNNA 2EIJB 1LPEA 3CCLV 3K59A 2ZE6A 2B5UA 5L0JA 3UMKA 3RF3A 5IT9N 1BR1A 4ZI7B 1IW7F 2HEPA 1Y6XA 2JPUA 1YJWV 4ICGA 1SQFA 3RYFA 3CZ6A 1XOUA 4Z9IA 4H44B 5LP6C 2AGAA 1SQQH 3OUSA 4J42A 4J7TA 1BBHA 1WA8A 1PV0A 1AR1B 3JT1A 3FOOA 4CJGA 1YARO 4O4JA 4RUFA 3HKEA 2UXDB 4BG0A 3S9OA 2N74A 2LFRA 3JATA 3K03A 4ASUG 1BCCH 3ZIAG 2OWOA 2UXDO 1LS4A 1H2NA 4CBEA 4UDVA 3SJBC 1BSMA 3N2KA 3DAFA 2VCAA 5KYXA 3G67A 1Z7Qc 1U97A 5IY5C 2PI5A 2F66C 3EGDA 1U0BB 3CYOA 4NVPA 5H2FZ 1VQ8V 3T9OA 4AK9A 3CRMA 1S3JA 1I08A 2M6YA 1AJNA 1L0NH 2OCCB 4F6RB 3RYHA 3Q4HB 3Q6MA 3Q7LA 4IAOA 1FAPB 2NUPA 3OT7A 3CE2A 4D7SA 4FLTA 1N8RW 4O7GA 4PD4F 4LWSA 3TD7A 5A6AA 4PI2A 1WN0A 2XLWA 4MVSA 4AL0A 5JCOC 4D4XA 3A0BZ 3QO7A 2YL1A 2R25A 2RCVA 5L3BA 2LO1A 1K40A 3G4SV 1N32B 1WPBA 2WVNA 4MTFA 4CBCA 3ZMTA 1N32O 4FZ0A 3JAMN 4QIWF 3THOA 1OCRC 1V54B 2Q0AA 1R3IC 3MX3A 5COFA 4DK1A 2P6VA 1FXKC 2RDCA 3ZCCA 1KD1W 3U10A 2QWOB 3ZHQA 1VQ9V 1MG1A 2JGDB 4DRXA 5GPGB 4P9OA 4F4LA 1MSWD 1CXZB 1IZMA 2G3KA 4JAVA 2R9AA 4IIJB 3EH2A 1TR2A 4WGYA 2HJ3A 4WFBV 4OINF 4NC3A 3ASOB 2AP3A 3K66A 4ZBMA 1ZAUA 1RMVA 3ZX6A 1TA8A 2K1EA 1K4CC 3CSXA 4PA9A 3LDDA 1OR3A 3E9VA 2HKVA 5FNVA 2OCHA 4BIOA 2WL8A 1GS9A 5KLVH 2YEVB 4CS9C 1BS3A 3LDCA 1RKCA 5B1AB 5JWPA 3TOLA 1T6UA 2B9ZA 1D0ZA 3FMSA 1H2GA 1WP8A 5JS5A 1Q43A 4GZRB 4YT5A 4XTKA 4FLVA 2W6IG 2A0UA 4DRJB 3CEXA 1LUWA 1VQMV 2AZ2A 4DR1B 3UR3C 1EI7A 1R5ID 1SERA 4DR1O 4XDLA 2YI9A 1G4US 3T1CA 1VF5B 2V7QG 1ENVA 1D0YA 2LGQA 3Q7GA 2NUTB 1WOLA 4FK5C 3OEOA 5LP6B 4QE9A 2GFHA 4H37A 5CA1A 3K5MA 2AWCA 3FKSG 3CCVV 1RXQA 2OQMA 1N33B 1E85A 1NZ6A 1N33O 3VOUA 1QZXA 3MHSC 3B0PA 4QI0A 2ARHA 2L6HA 1XBLA 4DV2B 2XL6A 1E86A 4DR2B 1KKDA 2UXBB 4QNHB 4DV2O 3ZMSA 4DR2O 2YXLA 5IYZB 2YLIA 3JD0A 2UXBO 5F28E 1NI8A 4PV1B 4YT8A 1BHBA 1EKYA 4KP4A 4PJMA 2WLIB 3OA1A 4OIPF 1BE3H 1Q6HA 5BUOA 3PMRA 4NKGB 1ROPA 1SZXA 4UCTA 5BQHA 4D6TH 4CH5A 2HFIA 2P7VA 4J80A 1TFOB 4XPWA 2KKWA 2QTOA 4H13B 2R05A 3A9CA 3BA8A 4FLUA 1OV9A 3ASNC 3C3SA 3B4SA 3SPIA 3EZIA 1P7BA 3ABMC 3JALB 2M4EA 3MYFA 1NS1A 2R7UA 3WHNA 2EIMB 1SA0A 1MSDA 1FFXA 2P4KA 4YL3A 5IJ9A 1YDIA 1G8MA 4B7EA 1OW7A 4OIRF 3O55A 3H1LH 3PHF2 2IXNA 1YEWA 4XDKA 4W8KA 2WWWA 1OCRB 4I1MA 3H65A 3MDSA 4FLZA 1OKKD 3AG4C 1F7YA 1FXKB 3GORA 3EFOA 4EEQA 4EB6A 1LS1A 1TVKB 2GTAA 4GT1A 4O2BB 1Q3EA 4LDQA 1M56C 1MOFA 2OYQA 5LHIA 3SP1A 4Q4ZF 1YITV 3GODA 5IJ0A 5E1AC 2R7QA 3QW1A 3V5ZA 4JI7B 4OPAA 1R6NA 2E74B 3C62A 4BJ6A 4JI7O 3SXKA 4A4AA 3U2MA 4PI0A 1ZX3A 4X20B 3BY6A 3FYIB 3T2MA 4DV1B 4TUYA 2AU5A 2QTVA 2IW5A 4DV1O 4CC5A 5B1BC 1TGOA 2NR5A 3ZRWA 3CC2V 5KMGA 3NYLA 1K4DC 3LLIA 2QKAA 3QVNA 1RSOB 2R72A 4LERA 4JVSA 2WVQA 4EFEA 2QGNA 4WJ0A 3UCSC 1GK9A 1D1CA 3FYEB 2HMQA 4WFHA 2DWEC 5A6JA 3AGTA 1U89A 2CE4A 4JEBA 1H2KA 3FB6C 3IAYA 1ZYRF 5B66Z 5B3SC 3C8ZA 3JASB 1K05A 3ZMVA 4HNAB 5CIVA 1ZTEA 5GTIZ 2X51A 2RJZA 5CA0A 4JZAA 1FD9A 3P3NA 3GEEA 4LH7A 1F1MA 3GWNA 1KP3A 2DYRC 1AILA 5K1PA 1I5YA 5KHHA 4ZKIA 4I44A 4KC9A 4NTXA 2HSBA 2QUPA 2R02A 1M2VB 4EUKB 1JMWA 3GEIA 1NU7D 3E35A 4IWBA 4QE7A 1F51A 1BL8A 1M2VA 2R9RB 3ZG1A 2W0FC 4LF8B 4QJFB 4RUEA 2KG7B 4O4IB 1ZHZA 4LF8O 3AK3A 5GTHZ 1P84F 2F23A 4W8PA 2F1MA 1T5EA 3RQEA 3U8VA 3VYWA 4G7OF 1LKXA 4GKKB 3FX7A 3WB1A 4B08A 2LFDA 4GKKO 3RFRA 2L6GA 3APOA 1B68A 4WGZA 1RJ9A 3AG1C 4A5UB 5JVDB 3H1KH 1KU9A 4TSFG 1ZWIC 3B8MA 4LNUB 4I50A 1O3UA 1EZJA 2VWJA 1E79G 2MK3A 5CN0A 4J41A 1ZL8A 3CPWU 2GDCA 4XDJA 3GM1A 2ZXWC 3RFYA 4NR1A 3W7UA 1D1AA 4K1OA 5DS5A 2ADQB 1I4ZA 2CH7B 4BJ1A 2R9IA 2EULA 5CBFA 2X7RB 3B2EE 3ECSA 1WB8A 4FFBA 5JJNB 2HJFC 2J9BA 2KQXA 1MZFA 3W7XA 3GWLA 3TK1A 3IEEA 4BIZA 2VCBA 4KHPB 3C8GA 3LESA 2ZXRA 2E87A 3V7OA 4KHPO 5HFLA 2HZ8A 4YL1A 1I5NA 1GM7A 1EN4A 4OD5A 2QJ1A 2QWQB 1K5SA 2HP8A 4C3EA 2AW9A 4KL1A 3L9DA 3MAQA 2WPDG 4OPHA 5EIBD 4FMTA 1M57C 3JD3A 1AEPA 3E89A 4FM0A 2JD3A 3CWBH 1KC8W 3QTHA 3E83A 5BZBA 1AI6A 3WODF 2N04A 4ZIBA 3CRRA 1VLTA 2D5RB 1M56B 1GN3A 5H5NA 1XNQB 1IURA 2KSFA 3E70C 4YJ2A 3JTLO 5L0GA 2Y69C 1XNQO 2XLEA 3H2VA 4PJNA 2O57A 5DECA 3UT5A 1U96A 1S0VA 1GN4A 2YLDA 3GVMA 2BE3A 4LR3A 1NVPD 3ABTA 4DUZO 3ZWIA 4Z1VA 3NKEA 3LEOA 2YQYA 5HFMA 3VQXA 2PZSA 1Y74B 2YUAA 1CGNA 3J81N 4O6YA 2A0LA 3LSSA 2BE5F 1GM9A 4AHCA 3UGOA 2KQ9A 5F2VO 3B40A 3Q6NA 4PA4A 2Q69A 5JLIA 4YJ3B 5B3SB 3S27A 1VYKA 5LOVB 1YZBA 4GQHA 1QSPA 5GONA 2JJ1G 4K8XA 2BC5A 2CNWA 2KNHA 2DJVA 1Q7YW 1S05A 1JFFB 1PL4A 2XASA 4UXNA 3J80N 3SXZA 3CQZA 5LA6B 2KW3C 4YY3B 1O87A 4YY3O 2QR4A 4PDLA 5JH7B 2M64A 1QU7A 2R7RA 4ZOLB 2LQGA 5JJJB 2H8PC 2P5OA 2ZT9B 1E83A 1YA7O 2QE9A 3G71V 3PJSK 4TQFA 1BT8A 1M1KW 4K8ZA 2LP4A 3GEHA 3OM3B 3SZRA 2HJDA 1F4NA 4M63A 2XOKG 3K1IC 3NR7A 3H9VA 4XBFA 2IOQA 3LDEA 3S3XA 3FXHA 3RW0A 2KK1A 2Y4TA 4FAPB 1NG1A 3G6BA 3ABKC 4O2AB 4RAIA 1RPRA 3LSQA 4H33A 3DE8A 3SXMA 5JSLA 1SRYA 5EYPB 4X66B 3MD0A 1LR1A 1PPJH 2OTJV 3FB8C 3B09A 3F5WC 2ZINA 3HKCA 1E1QG 4DV6B 2EIJC 3L8IA 3CXHF 4DV6O 4E18A 3E8HA 2W45A 4X89A 4PR9A 3DGEA 1SQXH 2JS5A 4G27B 4MTXA 4B3TB 5L0IA 4B3MB 3HKBA 3VAYA 1THZA 3L71H 4B3TO 1LIHA 1SQPH 4B3MO 4LDRA 4K3AA 1JPNA 2QM4A 4JYYA 1OQCA 3NG1A 3PDMP 2QA4V 4C7OA 5D91A 3BEHA 1M57B 1UFIA 2RD9A 4JI5B 4CJOA 5KYUB 4JI5O 3AQBA 3JD1A 5TJ5E 3QNEA 2Q7GA 4YIPA 2R7VA 4O6NA 4MT8A 4OIOF 2Y0PA 3TJ6A 1TWAA 3JCZA 4YL0A 4O4LA 4W4LA 2F4VB 1G5ZA 1ZHTA 5E3CA 4CDAA 4ONSA 2F4VO 3FAJA 2OCCC 1GN2A 2UXCB 5JT4A 2JDIG 4MNDA 4KNVA 2UXCO 4JC7A 1FYJA 1MNDA 3A0HZ 1Y4MA 2I8BA 3KCXA 4JF3A 4CS8C 3C7JA 4AL1A 1QR8A 3ITFA 1VQ6V 4EBJA 1SF9A 2CTWA 4U9DA 5ITZB 2P61A 3ZRXA 2R7SA 4BIUA 4I4TB 2VASA 2C2AA 2P7TC 2Q00A 3ETDA 3N2GB 1V54C 2ZNJA 1DOVA 5J2UA 3DXRA 4J7KA 1VQPV 3EH1A 3M99B 5L3QA 3UMHA 1H2SB 5A6KA 1T5OA 1DTOA 1H9GA 1ORJA 1T6IA 4CDVA 3DJUB 4LF9B 2XAQA 5KHIA 4LF9O 3NYMA 4I5SA 1CPRA 1WPXA 1NTMH 1Q81W 1H2LA 3ASOC 5IE9A 1BR4A 1R73A 1GM5A 1ZU5A 1OKKA 3ZMZA 4U5BE 3JAWB 2C04A 4E4EA 2YKZA 2FMLA 2WA4A 1B06A 1GQAA 2YWAA 5B1NA 3L74H 4JYAB 1YJGA 2FFHA 1APCA 4JYAO 5A6BD 1VQKV 2XL8A 4PDRA 1V4AA 4NCQA 2XL4A 1N34B 4E0IA 2YSUB 2P22C 3TXQA 3RYCA 1N34O 4LFCB 5KYWA 2Z3YA 3QVYA 3VF0A 4P6IC 4LFCO 4H4KC 1HR0B 4WABA 2VRZA 3K08A 2HHHB 3DD7A 1HNXB 4GUNA 1HR0O 1Z23A 3T1YB 2HHHO 2R7OA 3EGXA 3ZMUA 1HNXO 1LVKA 5GW7A 3T1YO 1N36B 4RBNA 4LLCA 2L81A 1N36O 1M6TA 1TWGA 4MVRA 4ER9A 1PCXA 2CGEA 2CDYA 4JTDB 3U2LA 1CEZA 3TETA 1PD3A 3F46A 2LFFA 4QI2A 3RQGA 4XEKA 4W4KA 2CYDA 1K97A 1HW2A 3K6BA 2A0BA 2DWDC 1Y6DA 4PDMA 4I55A 2D3OW 3FB7C 2YL7A 2AHZA 4UB6Z 2CGNA 3W7WA 1HNWB 1L0LH 1HNWO 3B8NA 2IJIA 3DE9A 5KYNA 2Q6AA 3SYPA 1CPYA 2BSKA 1XZQA 2YL0A 3AQCA 1Q0MA 3G50A 4I0XB 2HVJC 1G1XB 5JP7A 2YICA 4MW3A 1TUBA 2QWRB 4JURI 2CNWD 2Z15A 1K34A 3RYLA 2W4BA 4U3JB 3GB7C 2BTQA 2F22A 3KCYA 2ITDC 2QM8A 2ZE7A 4BAYA 5E3AA 1SZTA 2FAPB 4JASA 5LMUB 4UUJC 2EIMC 4UCRA 5LGUA 1K73W 3QTCA 2QDOA 2WLNA 5LMUO 4XEFA 4FLXA 3HB3B 2Q4FA 1Z2GA 5BR8B 1NR1A 3U11A 4Q5SF 1D5NA 1K3EA 5BR8O 1HY5A 3KKBA 1Q0KA 1T01A 1HWYA 1M4UA 3K06A 3KKYA 4JGSA 5KHKA 3DC5A 1FFHA 4IB4A 3CCJV 3CB2A 3SPJA 1EM1A 1LNQA 1NTZH 3RYFB 1QHTA 1YLMA 4MVMA 4PDVA 1RPOA 3KYIA 4X1KA 2H7BA 2NUTA 4EIYA 2XAJA 5KX5A 3CMEV 4FLYA 3W8HA 1K92A 3O6XA 3HKEB 3AG2C 5HSWA 4LP8A 4E17A 1OCOC 3K0GA 5KYXB 3B29A 2QKSA 2K9PA 4O6MA 3V5XA 4RWUA 3EGDB 2VQFB 2ASRA 1VLSA 4CIHA 2Y48A 4QGPA 2VQFO 2J9VA 4DV0B 4XLPF 3RYHB 5B5EZ 3DC6A 4DO2A 3I4UA 4DV0O 3RVYA 1M93A 2IXPA 3EJNA 2NUPB 4XLNF 2N05A 2QSAA 3W7SA 4AQYB 2IXOA 3LS1A 3ZHUA 1IXMA 2WA3A 3ZBHA 4LWSB 4AQYO 3U0ZA 2CAZC 4IHJA 4Q20A 4TV9A 4IAQA 3K5OA 4BW9A 2W9YA 4ZHQA 1AI7A 1O5HA 1GH6A 1WLEA 2J8WA 4LF6B 3IQCA 5CB4A 4J9ZB 2BTOA 5D5QA 1GO3F 4LF6O 2OEXA 4CS7A 1B6QA 3H1IH 4I1OB 3BHPA 4Q6GA 5IWAB 2C03A 4DR4O 3IQ5A 1F4MA 5C8YA 5IWAO 1LE2A 3ZN0A 3CJHA 1Z3IX 2LSEA 3C90A 3MYIA 1UJWB 4DR7B 4JJGA 1XZPA 1O9HA 1VP7A 1TKNA 2VB6A 1BZKA 1VQ5V 4FM1A 4DR7O 1HMDA 2V3CC 1QBZA 4DRXB 2DQ0A 4KFMA 4O2BA 4U5HA 2IJHA 1WNSA 2LGWA 3D36C 3ETQA 4FIPC 4XWJA 4X88A 5E33A 4PHZA 2UU9B 4PA7A 1TFKB 4FESA 2GBOA 2Y39A 2UU9O 4QPJA 1OCCB 3ETEA 3RYIA 3KH2A 4UB8Z 2G3VA 3M4BA 2ZXOA 3ZIBA 1SKVA 3WB2A 1SMYF 5COMA 4ZLDA 3H1HH 3K5NA 1FJGB 4NTAA 1FJGO 1Q86W 5EZYA 1NKDA 4JI8B 1URFA 3D3IA 5FNVB 4JI8O 4AE4A 1GM8A 1HE1A 4PACA 5T3WA 4JCHA 3BPZA 2X0CA 4CS9A 1I94B 1QKRA 1AJQA 5J9PC 2A9HA 2X0LA 1I94O 1F23A 3IGAC 3C3TA 3K0DA 3T4RA 1Z63A 2VS0A 1RM1C 5LBQA 3B9QA 4N6CA 5L3GA 2XNDG 4FPPA 4J7ZA 4F6EA 4LF4B 2ZPAA 3TQOA 3U9MA 1NVPB 4BR6A 3HKDA 4LF4O 2JGUA 3ZHRA 5LHHA 1MA1A 2YIAA 1JR9A 4IRUA 4GYTA 1OR2A 1Y67A 5KYYA 2GUZA 2DOSA 4LDKA 4I9QA 5CA1B 4FJCC 1YYJA 1XHXA 4X1IA 2YHSA 5DQZA 3E8BA 3DKAA 2ADPA 4LACB 3CXCU 5KA5A 4DRHB 3AG2B 2PFDA 1FTSA 4RDAA 4GCZA 2IH3C 1A7EA 2W6JG 1OCOB 2P1AA 1X59A 3ML0A 1Q0GA 1GAXA 2IH1C 3FDQA 4LNUA 3CCRV 3EHMA 1HW1A 1ZZPA 3U3FA 4HFFB 2G38A 1VK5A 1NU1H 3DWWA 3U3BA 1Q0DA 1DGSA 4J32B 4TOIA 3TOMA 5KUMA 1S76D 2E3CA 1C17M 2P6JA 1EN5A 1YTFB 3EG9A 1IVSA 2Q67A 4JI2O 3T4DA 2EBOA 3VQYA 3U0CA 4GYCB 5L3FA 1OXBA 4G7HF 3QZCA 1N1CA 1JJOA 4HAMA 4U5DE 2JS3A 3CCQV 2H7VC 3R65A 3SR2C 4UVBA 5E79Z 1JPXA 3CEIA 1VQNV 1SA0B 3FAVA 1FFXB 1MABG 4JIOA 4O4HA 5IJ9B 4HE8D 4IGGA 4H54A 5L0FA 2YL3A 5DQTA 3AK2A 1N4CA 1NSGB 1EQ1A 1D0XA 1K33A 2HR3A 2ITCC 2ZR2A 3ZTZA 5TISZ 1BZ4A 3N0TA 4NTWA 4CIPA 2CCYA 4EKWA 4NXNB 4DK0A 2A6HF 3UGPA 3EFOB 4EB6B 4NXNO 3M79A 3H01A 4NQFA 1IZ3A 1SC5B 3ABLB 3TXSA 5LXTA 5BQGA 4PA6A 2A3QA 1A41A 1L1FA 2A7WA 1VF6C 1XUQA 4B7KA 1TWCA 1FMWA 1NBBA 3ZQVA 2J9UA 2XAHA 3UKMA 1QVGU 3QVZA 3W2VA 4TUYB 2DI3A 5AGFA 2LW1A 3QMKA 2YIBD 5EHHA 3ZRWB 3AOUA 1AUEA 2Z5UA 4RQEA 2G62A 5KMGB 1NH2D 2GSMB 2KSDA 3SPCA 3OEHG 1RKEB 1WTYA 3K9AA 1NLXA 2PYJA 4ZLCA 2UUIA 3IC9A 4CZZA 3OR7C 2EIKB 3HLZA 2R03A 4U3FH 5H6QA 5A6BA 1NJIW 3EVKA 1WAZA 1AROP 1RM1B 2DYSB 3M1CB 1MMAA 4CH3A 2P4VA 3JRTA 1R6TA 5JQGA 3IHUA 2VQEB 4MQ9F 5CA0B 5JRAA 3LS0A 2VQEO 1FPOA 5D92A 4JI0B 2JIZG 1KNYA 4FX5A 1XL4A 1YDXA 4JI0O 4DW0A 2KJGA 1E2XA 3EQLF 1JQ0A 3OE7G 1XEQA 2W4MA 4J7JA 3FVYA 3K9SA 4ULVA 4NY3A 4X64B 1R6KA 2FTKA 4X64O 4JZ2A 3J7AU 3TJTA 4U5EE 4UCOA 2ZCEA 3JAKB 1VQLV 1RFYA 4IYIA 4TV8A 2XXAA 2WB7A 2OTLV 1RJ9B 1LI7A 4GX2A 3EHNA 3ZN1A 4DUZB 3R2PA 4LFBB 4EHPA 4I50B 4X0RA 4LFBO 4K35A 5EBMC 1ZW2A 4G78A 1SF8A 3BVOA 1ZL8B 1OW6A 1FKAO 1A32A 2XRHA 1PP9H 2L35A 2UUCB 4C3DA 5L0DA 1ZW3A 4R32A 2UUCO 4HBNA 3R66A 2H7OA 3AG7A 4BJ5A 3IC7A 1O9GA 4FFBB 1Q6IA 4K0DA 2ILMA 2R70A 1OW8A 4HFKB 4PFOA 4DYLA 1V9PA 1I7FA 1WP7A 3E22A 1RCPA 1WJZA 5A2QN 3C8GB 1VMAA 3U8PA 2Q7EA 3JCUQ 1COWG 2LFSA 1QVFU 1IBLB 2IBZH 2CUGA 5JVEA 1IBLO 2E75B 3LNMB 3AGUA 2Q73A 3L0IA 5CBGA 1W0JG 1HDJA 5FPOA 1G4WR 4J7YA 2YVKA 4WBNA 2WLLA 1SQBH 2KB1A 4RD9A 1OCZC 2P90A 3EPVA 3ZVRA 1SQVH 4JI1B 1AP5A 4OXSA 4KUMA 3SNHA 2YI8A 4YT2A 4JI1O 3CMAV 3ZS8C 2UUAB 1XMOB 3RN4A 1K9MW 1YZCA 1N0NA 3AG3B 3DJNB 3JZ0A 2UUAO 1XMOO 1JR8A 2ZD9A 3HR0A 1GMGA 4YJ2B 3S29A 4D4NA 4I3MA 5LYJA 5EC2C 4KXRA 4N06A 1W2WA 2RQ6A 3UT5B 1U6HA 2BOBC 1H38A 4AX2A 2ZDIC 5KAIZ 1T9KA 3NRHA 4JJFA 1K5QA 3HKKA 1OJHA 1I0HA 2GA0A 1ZUQA 4LF7B 3L70H 1CPQA 2QY9A 3RQFA 1Q5OA 4LF7O 2HFEC 4IT5A 3IQTA 2J0WA 2GTSA 1M2OA 1W2BU 3FB5C 3DMDA 2RMKB 1Y76A 2AVKA 4EFBA 4JPRA 2IM8A 1TUEB 4TT3G 2QTSA 3RT3C 2HJMA 1H7IA 2R7TA 1E1RG 3N2GA 3K5LA 3B0VC 1PNKA 2L9JA 5GONB 3APQA 1KU2A 2F43G 1VYIA 2EZPA 3SPGA 4D7TA 4GX5A 2KC3A 4FVMA 4CS4A 4DBRA 1QLEB 4OGQB 1HW7A 1JPJA 3QO5A 2WSSG 2UUHA 2QWPB 1X4TA 3QO8A 3NXSA 2ZXPA 2YRFA 3ZQYA 1T6QA 1DF5A 5CBHA 1JVMA 1MQVA 2ZNIA 4RQFA 1XDCA 3WG7C 1V74B 3QW0A 3L72H 2EZOA 4JYBA 3CCEV 3SYCA 3N24A 1KBHA 1QNMA 4UV8A 4K7BA 1VMGA 2Y4UA 3LNRA 3K1IA 1QQ3A 3A0RA 5J2TA 2UUBB 3G4ZA 3S90A 4KI2A 5KUKA 2UUBO 3KPHA 2EPOA 5HV9A 3ABUA 2QLAA 3UQ8A 2WVOA 4P2ZA 4X1YB 3A2FA 3I5PA 2XS8A 2QWNB 1NFNA 2Y0IA 2VCCA 1VQ7V 1Z5VA 2PF4E 3WB0A 4IL6Z 1EBOA 5IYBO 1OXKA 2Q9LA 3DXJF 1GTOA 3NMIA 1XQ8A 2EPKX 1AR4A 3FHDA 5BMVB 5L3VA 2EINC 4BWAA 3LAYA 3ZSUA 3HKBB 4ZI7A 4H0LB 2B1GA 2XM0A 2F95B 1YJ9V 3CD6V 2AHYA 4C7OB 1XILA 1QVXA 3GM2A 2CTRA 3LUTB 3NMKA 3EXAA 3JRMO 1R4TA 4JZGA 2DE0X 2X6AA 4XPYA 4PK4A 1OCZB 1JJ2U 5C93A 2E76B 1MNGA 2ZM6B 1YCIA 4JYCA 3I5QA 4X8AA 1Q90D 5DN6G 2ZM6O 3NDBB 5A69A 2J7PD 2YIDA 4B6IA 5LHGA 4JCZA 5AC4A 5B1OA 3ZDLA 1ZSPA 3HNKA 1WB7A 2PP4A 3WU2Z 2EX3A 3JYHA 2LIGA 2V26A 1ZHWA 3G4XA 2ZIMA 4O4LB 2OEVA 4EWCA 1D5AA 1S5JA 1DK1A 4E7ZA 2OOCA 2WZGA 3I5DA 2JRIA 3M8AA 4F6RA 3Q4HA 3OD4A 2XLVA 2KGOA 2Q9BA 5DVWA 2CK3G 4WFGA 2YXHA 3JARB 1MZEA 2CTQA 4MVOA 3OMIB 3HNJA 4RO2A 4N21A 3A8TA 4NXMB 3CX5F 5CI9A 1US6A 4NXMO 3JD4A 1H2MA 3R7CA 2FKXA 3PCVA 4FWVA 2XUMA 1IX9A 1NBMG 4E2LA 5J2UB 3DXRB 1OHHG 2XHBA 2QNLA 4J9YB 3VM6A 4YK5A 1J8YF 4DBQA 3SPHA 2WLHA 256BA 2HV6A 3SGIA 1UPGA 2JGDA 4WF9V 1AVOB 2WLJA 1OCCC 2L6LA 2TMVP 1V55B 1VIBA 1BR2A 5DLJA 2JJ2G 5EIBC 3X2QB 4IIJA 1QLNA 3IPMO 1LI5A 5IDJA 1CP9A 1YYXA 2J46A 3WG7B 1XREA 3CHXA 1QPUA 1BGYH 3UNGC 4CSAA 3CCMV 4J11A 2P06A 4YT4A 4R50A 3L34A 4PA3A 4GLXA 4N4WA 2NSGA 2YEVA 3AJMA 4U5GA 2XSEA 3SYAA 1KECA 1KYOF 1KKCA 5DM6V 2DB4A 2Q3TA 3MLGA 1R3KC 2D2CB 4DV3B 4ANJA 3RYCB 2DQ3A 4DV3O 2OJED 4TWKA 5KYWB 1OZ0A 2HVKC 1JCHA 3C18A 5AG2A 2YIBA 1N0JA 3G6EV 2UXXA 2J0XA 2OG2A 2RN9A 1EA8A 3MBGA 2PYLA 1FNTc 5FZTA 2FB5A 3EGXB 2EINB 3OGIB 2Q0OC 4OD4A 3U5SA 3RBZA 3WFVA 3CCSV 2AWYA 3K7DA 1QCEA 2VC9A 2XLMA 4L87A 3CCUV 3D3QA 4JKVA 4JTCB 4CS2A 5L0CA 3DM9B 2V4DA 5H9CA 3HTKC 2O9XA 3HJCA 3W7TA 3RKOF 5LP6A 3VBBA 2HSQA 1WA8B 1FXVA 3OGCC 5L0HA 3IQ6A 4N23A 4O4JB 1PD0A 3AK1A 3JATB 4HZ3A 4YXWG 1AI5A 2JK5C 4I9WA 1C02A 4C3BA 3N2KB 1P49A 4I55B 4R6ZA 5KA6A 1BQZA 3VRCA 1BQ0A 2MW2B 4BW5A 5BY1A 5IYZA 4DVZA 4R8CA 1DLBA 1ZLZA 2BSKB 4R7CA 2WLIA 1GRJA 3KG2A 4KNWA 3O9OA 1LM3B 3LJBA 2V1DA 2PNOA 1TUBB 4AILC 3ZTMA 1VEWA 1Q0FA 3SJCC 2MYSA 2J9WA 5B3IA 3B0UX 2BTQB 3RGBA 1I5XA 2BOCC 2PTMA 3NMJA 1XL6A 1K04A 3M15A 1TAEA 3JD2A 2IM9A 3JALA 3VQVA 5JCOA 1EZVH 1S5HC 4LFAB 3ZRSA 4XEVA 4ULWA 3OMNB 2OJQA 3POVA 2EILB 4LFAO 3KYJA 2ZKOA 4DR4B 4U5CE 3UMIA 1KB9F 5E2QA 5L3EA 5F5HA 2YC0A 5LMNB 4DJ9A 1VOMA 2CDQA 1IXBA 5LMNO 1YIJV 1VF7A 3UO3A 2IJKA 1NH2B 2FYUH 4QPKA 1WWPA 1IBKB 1G8XA 3U9JA 2RNBA 1FXKA 1IBKO 1AR5A 3FAPB 2A06H 3ABLC 3ATPA 1TVKA 2P67A 4CH4A 2HG5C 1XI1A 1MMNA 4MS2A 3CC4V 2EPLX 4BJ6C 4YHHB 3SYNA 4J30B 3L1MA 2R7XA 4X1KB 3JYCA 4YHHO 2JEXA 5KX5B 3JCUZ 3F7VC 4YJWA 3N2ZB 2JEUA 4X20A 1AB3A 2XLHA 1WGWA 3GM3A 5KHGA 3JYYA 1FXHA 2Q5ZA 2GHYA 1A7DA 1Z6AA 4O79A 4WCEV 4GX0A 4X65B 1FAFA 2AXTZ 4X65O 4P9TA 1VTMP 2ZR3A 1HNZB 5IY5B 1LUVA 1RSOA 5JJEB 5CI8A 4DR6B 1HNZO 4LLEA 2EIKC 4WFEA 2YZSA 4DR6O 1NT2B 1FR0A 1DOWA 3F5TA 2R7WA 2PGGA 4BEMJ 2DYSC 2L6FA 1M90W 4JI6B 1R3LC 4UCUA 3K57A 4E7SA 3DM5A 2ETNA 1VQOV 4JI6O 1GGQA 1XMQB 3JASA 4DUYB 4HNAA 1XMQO 2DGJA 4IHJB 1GKFA 4DUYO 4TV9B 1E84A 2QE7G 4ZHQB 4BJTA 4TQDA 2ICWG 3SDLA 1NR7A 2WLKA 4U7NA 4UCSA 1YAUO 5CB4B 1C03A 1XNRB 1KMIZ
chains in the Genus database with same CATH topology
4U5EE 1MNDA 2IXMA 4YWQA 2I8BA 2EJ7A 4CS8C 2LO1A 2XXAA 2WB7A 1RJ9B 1NU9C 3ITFA 2WVNA 5T3TA 3EHNA 2CTWA 3SEOA 2R7SA 4X0RA 2FGYA 1OCRC 2VASA 3O39A 1SF8A 3BVOA 3MX3A 2Y3GA 1S7ZA 2P6VA 2XRHA 4C3DA 1V54C 4MNDA 2QWOB 2H7OA 3EH1A 3AG7A 4BJ5A 3UMHA 5L3QA 4K0DA 1IZMA 2G3KA 4HFKB 3DJUB 4PFOA 3EH2A 1TR2A 1WJZA 1VMAA 4OINF 3NYMA 3JCUQ 3EZHA 3K66A 4AE4B 2CUGA 2A68F 3ASOC 3LLKA 1BR4A 4DOZA 3L0IA 1HDJA 3E9VA 4QDLA 2OCHA 1ZU5A 2WL8A 1OKKA 4CS9C 4RD9A 1OCZC 3EPVA 4U5BE 2C04A 3ZVRA 3DAGA 3SNHA 4YT2A 1D0ZA 2FFHA 2MWQA 4YT5A 3DJNB 4XTKA 2XL4A 3S29A 4I3MA 3UR3C 3AG3C 1W2WA 4N06A 5KYYB 5KYWA 2GUZB 4P6IC 4H4KC 4AX2A 3ZC4A 3NRHA 3DD7A 4JJFA 1Z5ZA 1Z23A 2R7OA 2DMXA 3EGXA 1D0YA 1LVKA 2CTPA 3Q7GA 2NUTB 4LLCA 2QY9A 4RBNA 3OEOA 2L81A 2GFHA 4IT5A 4F4BA 1MMDA 1PD1A 2J0WA 1M2OA 1TWGA 2J7PA 1PCXA 2CGEA 3DMDA 3F46A 1NZ6A 4QI2A 1QZXA 3B0PA 4QI0A 2R7TA 1XBLA 1FFTC 2B0JA 2PX3A 3B0VC 2L9JA 4BJ5C 3K6BA 3APQA 1KU2A 2Q9AA 4YT8A 3EG9B 3CSKA 4U5FE 4PJMA 1VYIA 3OA1A 4OIPF 5BUOA 4A2NB 1ST6A 2DN9A 3PMRA 3OWTA 4DBRA 1JPJA 2P7VA 5KYNA 2QWPB 4J80A 3AQCA 2ZXPA 1QLEC 3ASNC 2QWRB 3EZIA 4JURI 3WG7C 2CNWD 2Z15A 3ABMC 3RYLA 2M4EA 2W4BA 2PX0A 3N24A 4DVYP 2R7UA 4K7BA 5E3AA 2Y4UA 4OIRF 2HV7A 3PHF2 3LNRA 2IXNA 4W8KA 2WZLA 2EIMC 3KMIA 4I1MA 4KI2A 3H65A 1MMGA 1OKKD 3AG4C 2WVOA 3EFOA 5DS6A 4Q5SF 3W8IA 1LS1A 3RIPA 3I5PA 3KKBA 2QWNB 1M56C 3SP1A 4Q4ZF 2PF4E 3GODA 1FFHA 2R7QA 1MNEA 3DXJF 4BJ6A 3FHDA 5L3VA 2EINC 3LAYA 3ZSUA 3X1OA 2H7BA 2NUTA 2QTVA 4HEAJ 5B1BC 3W8HA 3O6XA 4C7OB 3AG2C 3NYJA 2CTRA 5HSWA 3NYLA 2WZFA 3LLIA 4LERA 1OCOC 4PK4A 4JVSA 3RH3A 2WVQA 2Y3DA 4WJ0A 3UCSC 1D1CA 1J8MF 2Y3BA 3I5QA 5KYXB 3T6JA 3NDBB 1FMVA 4O6MA 2J7PD 4RWUA 4KBLA 3EGDB 2Y3HA 4B6IA 5KYUA 2PP4A 1ZYRF 5B3SC 4IJJA 4CIHA 2J9VA 2VH3A 3JYHA 4XLPF 2V26A 1ZHWA 3I4UA 3UO2A 4EWCA 2X51A 2A1DD 2IXPA 3EJNA 4BEJA 2NUPB 4JZAA 4E7ZA 4XLNF 2N05A 2QSAA 2IXOA 2WZGA 3LS1A 2DYRC 3F47A 4KC9A 4I44A 1TWHA 1M2VB 1NU7D 4IWBA 3ZG1A 1ZHYA 2KGOA 2Q9BA 5DVWA 2W9YA 1O5HA 1ZHZA 1GH6A 2XXAB 3VYWA 4G7OF 2CTQA 1LKXA 4CS7A 5CI9A 4I1OB 2C03A 3APOA 1RJ9A 1Z3IX 3AG1C 2LSEA 4FWVA 2Q9CA 4JJGA 1TKNA 2VB6A 2V3CC 3RFYA 4U5HA 2ZXWC 1D1AA 5DS5A 2LGWA 4XWJA 5E33A 3DZAA 1J8YF 4BJ1A 4DBQA 5DS4A 4FESA 2Y39A 2HV6A 3ECSA 3KH2A 2G3VA 2ZXOA 3ZIBA 1SMYF 2KQXA 4PFPA 4ZLDA 1OCCC 2L6LA 1BR2A 3IEEA 5DLJA 3LESA 2ZXRA 2J46A 2E87A 3V7OA 4PJLA 1V55C 3X2QC 4AE4A 3UNGC 2YS8A 2J45A 4CSAA 5T3WA 4OD5A 2QWQB 4JCHA 4CS9A 4YT4A 4C3EA 3L34A 5T1DB 1M57C 2YEVA 1D1BA 4U5GA 3T4RA 1Z63A 2JD3A 2XSEA 3B9QA 3WODF 2N04A 2Q3TA 3MLGA 4J7ZA 2ZPAA 4JW1A 4ANJA 2D5RB 5KYWB 1IURA 3E70C 2J0XA 2OG2A 4IRUA 3W2WA 2Y69C 4GYTA 4PJJA 5KYYA 3EGXB 4PJNA 2GUZA 4OD4A 3K7DA 4Q7CA 3GANA 5DQZA 2YHSA 4LACB 3DM9B 2IYLD 2PFDA 1FTSA 4RDAA 3HTKC 3T6BA 2O9XA 3HJCA 5FCLA 4YN0B 3RKOF 1ZU4A 3NKEA 4G0HA 1PD0A 5EGYA 2YUAA 3FDQA 4GEHA 4O6YA 3K1HA 2BE5F 3EHMA 4EBBA 3UGOA 2KQ9A 4C3BA 4HFFB 3Q6NA 1VK5A 1SZIA 1BQZA 3S27A 3S28A 1BQ0A 1VYKA 4J32B 3S0XA 2CNWA 2KNHA 4DVZA 3EG9A 2A6EF 3CQZA 2KW3C 4KNWA 1O87A 4G7HF 3QZCA 4OIQF 1N1CA 1NZEA 2NG1A 4G7ZF 3LJBA 4U5DE 2H7VC 2R7RA 2MYSA 2J9WA 3NKDA 4CSAC 3B0UX 4HE8D 3K33A 5DQTA 1N4CA 4CS8A 3SZRA 1D0XA 4ULWA 3POVA 4U5CE 4M63A 3KL4A 3N0TA 3K1IC 5E2QA 5B1AC 3UMIA 5F5HA 2A6HF 3UGPA 3JSZA 3EFOB 2IOQA 1VOMA 2CDQA 2EILC 2Y4TA 1ZHXA 3UO3A 1NG1A 2A69F 3ABKC 1G8XA 2CW0F 5F5FA 3LEVA 3ABLC 1TWCA 1FMWA 2J9UA 1MMNA 3UMKA 1BR1A 4BJ6C 1IW7F 3SYNA 4J30B 2EIJC 3W2VA 2R7XA 3QMKA 2W45A 5EHHA 4YJWA 3N2ZB 3CZ6A 2G62A 3VAYA 1WGWA 4O79A 1Z6AA 1JPNA 4ZLCA 3JT1A 3NG1A 1FAFA 4C7OA 4BG0A 5D91A 3HLZA 4CBEA 5CI8A 4LLEA 5KYUB 2EIKC 3M1CB 1MMAA 2YZSA 3AQBA 3DAFA 5KYXA 3JRTA 2R7WA 5IY5C 2R7VA 4O6NA 4MQ9F 2DYSC 3EGDA 4AK9A 3LS0A 4E7SA 4OIOF 1FPOA 3DM5A 5D92A 2M6YA 4FX5A 1TWAA 3EQLF 2KJGA 1ZHTA 3Q6MA 3Q7LA 2DGJA 4IAOA 5E3CA 2W4MA 2NUPA 3FAJA 2OCCC 3FVYA 4BJTA 4NY3A 4O7GA 3TD7A 1M2VA 4KNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG7 A;  2GUZ A;  1GH6 A;  3APQ A;  1BQZ A;  2DMX A;  2CTQ A;  4RWU A;  1BQ0 A;  1N4C A;  2EJ7 A;  2CTP A;  2Y4U A;  2LO1 A;  2DN9 A;  2KQX A;  2QWO B;  1WJZ A;  4IT5 A;  2CTW A;  1FPO A;  2N04 A;  3APO A;  2M6Y A;  2L6L A;  3UO2 A;  4J7Z A;  2N05 A;  2QWP B;  2QSA A;  2Y4T A;  4J80 A;  3UO3 A;  2CTR A;  2CUG A;  3BVO A;  2YUA A;  1FAF A;  1NZ6 A;  1IUR A;  2QWN B;  1HDJ A;  2GUZ B;  2YS8 A;  2QWR B;  1XBL A;  2OCH A;  2PF4 E;  2QWQ B;  3UCS C;  2LGW A; 
#chains in the Genus database with same CATH topology
 1K8A W;  4YIO A;  1XNR O;  2IXM A;  4YWQ A;  2KG7 A;  1MMM A;  4O4I A;  2EJ7 A;  3HPL C;  3BAA A;  5COG A;  3A11 A;  1J5E B;  1NQT A;  5C8Y B;  2LQT A;  1JX9 A;  3H1J H;  3CJH B;  4Z9H A;  1NU9 C;  2E5L B;  4FFK A;  1J5E O;  2BL2 A;  5T3T A;  2HS5 A;  1G4Y B;  5EK0 A;  1GN6 A;  1K7D A;  2E5L O;  3SEO A;  5EBL C;  3VQW A;  1PL0 A;  4JI4 B;  2FGY A;  4MW8 A;  3O39 A;  2I15 A;  4JI4 O;  3EFF K;  2Y3G A;  1S7Z A;  3E8F A;  2JVD A;  5JVD A;  3BCC H;  2QM7 A;  4FM2 A;  3SJQ C;  1QR9 A;  3DI5 A;  3D36 A;  4DW1 A;  4HYO A;  4X62 B;  3CC7 V;  2PBE A;  4NTF A;  3RYI B;  4X62 O;  2LJ2 A;  2NPU A;  1YJN V;  2YDE A;  4JAU A;  2UXN A;  1H9T A;  3BRC A;  2CH7 A;  3FOP A;  1WAT A;  4DRI B;  4JI2 B;  3P30 A;  4XQ1 A;  4IYH A;  5EZY B;  3TK0 A;  2XLO A;  4IAR A;  4FLW A;  2H94 A;  1SYQ A;  3EZH A;  4JE9 A;  4AE4 B;  2DW4 A;  2A68 F;  4UVC A;  3K58 A;  2XAF A;  1RKE A;  2Q7R A;  3LLK A;  3TCU A;  4P30 A;  2EPM X;  4DOZ A;  1ORS C;  3D8C A;  4QDL A;  4L6R A;  3UM7 A;  3H2U A;  2OIE A;  3L75 H;  3T4Z A;  4NYK A;  3OFN G;  1CGM E;  4ABM A;  3QG5 A;  1IBM B;  2XAG A;  3DAG A;  4NTY A;  3I56 V;  5CA3 A;  1IBM O;  2IU3 A;  2JX0 A;  3KZI Z;  4DV5 B;  2MWQ A;  3HKD B;  4Z9J A;  4FZ1 A;  4NTB A;  4DV5 O;  1JMK C;  3K79 A;  3E2E A;  2Q8V A;  2HKO A;  4PJ0 Z;  5AC5 A;  1PNL A;  3AG3 C;  5KYY B;  1B04 A;  5IJ0 B;  2W0X A;  2GUZ B;  1L8D A;  2A79 B;  1JAF A;  3ZC4 A;  1Z5Z A;  4X1I B;  2MHR A;  2DMX A;  2ZQM A;  3ZHT A;  1RP3 B;  1VB5 A;  2CTP A;  3JAK A;  2GDS A;  3O65 A;  3ETG A;  1BMF G;  4F4B A;  1MMD A;  1PD1 A;  2B0H A;  1WN7 A;  3B77 A;  3TGU H;  4P9F A;  2J7P A;  3I55 V;  1H8E G;  3STL C;  2RSE B;  1Z5W A;  1JOY A;  1LE4 A;  2XTA A;  1DF4 A;  1Y74 A;  1FFT C;  2B0J A;  2PX3 A;  4DXW A;  1Q6U A;  4JV5 B;  3AEI A;  3IJ4 A;  4BJ5 C;  4B3R B;  4MTG A;  4JV5 O;  2Q9A A;  3EG9 B;  3CSK A;  3V5Y A;  4B3R O;  4U5F E;  5CMU A;  5A9G A;  4MVU A;  1YI2 V;  4YJ3 A;  4I7Z B;  4A2N B;  1ST6 A;  2DN9 A;  5LOV A;  3OWT A;  3E86 A;  3DTU B;  4UV9 A;  4MVQ A;  2GWW A;  1I4Y A;  1JFF A;  1Y4C A;  3ASN B;  3ZHV A;  4LC1 A;  3P32 A;  1S5L Z;  5LA6 A;  3ZRV A;  3ABM B;  4MTO A;  1QLE C;  3JSL A;  2AZ0 A;  2LD6 A;  3FAV B;  4LBE C;  1AVM A;  4O4H B;  5LL6 Y;  5JH7 A;  3CS5 A;  1A7V A;  1AI4 A;  4ZOL A;  1YVI A;  2PX0 A;  4DVY P;  3ZED A;  1YHQ V;  1SR2 A;  1TQG A;  4JEA A;  1KTM A;  2YLG A;  5EC1 C;  1H8H G;  3N27 A;  1EFR G;  3L8J A;  5FLX N;  2HV7 A;  2Z0A A;  1ZVZ A;  3AG4 B;  2WZL A;  3KMI A;  1YF2 A;  3W4Y A;  4E0H A;  1FS0 G;  5LXT B;  1HP8 A;  2LCH A;  1MMG A;  4WFA V;  2BCC H;  5LGN A;  5DS6 A;  3W8I A;  3RIP A;  1ORQ C;  1VF6 A;  4GX1 A;  1W0K G;  4O2A A;  4U7O A;  1L7C A;  1MNE A;  3CAX A;  4DV7 B;  2EJR A;  2CGO A;  4LH6 A;  4DV7 O;  5EYP A;  2YXY A;  2HUJ A;  3FD9 A;  4CDY A;  5B1B B;  1PKX A;  1YVW A;  3X1O A;  2B1I A;  3K04 A;  5LGT A;  4B3S B;  4HEA J;  3OR6 C;  1WAS A;  4B3S O;  1Q8I A;  3NYJ A;  1VAR A;  1YXB A;  5FL7 G;  2WZF A;  2HMZ A;  4U9E A;  1KQS U;  3BAB A;  4MVZ A;  2EPN A;  3RH3 A;  2Y3D A;  2Y3B A;  1J8M F;  4G28 B;  5KAF Z;  4DV4 B;  3T6J A;  5JQG B;  1FMV A;  3MHH C;  4DV4 O;  1YA9 A;  4KBL A;  2Y3H A;  4JAA A;  4GKJ B;  5KYU A;  4IJJ A;  4GKJ O;  2VH3 A;  1ORY A;  5BXZ A;  3OMA B;  2VWK A;  2DYR B;  3MFN A;  3UO2 A;  2D4U A;  3TUL A;  2A1D D;  1IDS A;  4BEJ A;  3EHB B;  4J10 A;  2ATK C;  1CGO A;  2LK4 A;  4UVA A;  3F47 A;  5IYC O;  2QEX V;  1TWH A;  5K0I A;  5JUA A;  3PN1 A;  3OTO B;  2WLM A;  3K3W A;  1ZHY A;  2ZE5 A;  1PNM A;  3OTO O;  4AI8 A;  4EBK A;  4TV8 B;  1YZA A;  1YTF D;  3E8G A;  2XXA B;  4K0K B;  5K1X A;  4JI3 B;  3C63 A;  3OAA G;  4K0K O;  3AG1 B;  3J06 A;  4JI3 O;  3O10 A;  3RVZ A;  2LP7 A;  3JSN A;  1HE9 A;  3M4C A;  4DR3 B;  1QQC A;  3RWR D;  4DR3 O;  5ITZ A;  2ZXW B;  2PI4 A;  2Q9C A;  5KHJ A;  1JRA A;  1FFT B;  3T6G B;  4I4T A;  3CP1 A;  4X1Y A;  4N6H A;  4CH6 A;  1BDJ B;  2IBF A;  5EBW C;  3CRQ A;  2PY5 A;  3IFX A;  4L8J A;  1L3P A;  4X66 O;  1XHZ A;  1A0B A;  2QKC A;  3DZA A;  5DS4 A;  1AJP A;  1G6U A;  3E22 B;  4CC6 A;  2PUS A;  4BPM A;  4X9Q A;  2XLD A;  4CS3 A;  1EN6 A;  5L3C A;  2LW7 A;  2X6C A;  5BMV A;  4UCV A;  4P9P A;  4PFP A;  1KP2 A;  5DED A;  3S84 A;  1M9N A;  3FFQ A;  4C7U A;  2IJJ A;  3B71 A;  3TJ5 A;  4PJL A;  2ODM A;  1V55 C;  4WBN B;  2WLL B;  3X2Q C;  1P7G A;  2YS8 A;  1JOG A;  2J45 A;  3CRC A;  2GAQ A;  2XS1 A;  2NLJ C;  5T1D B;  1XWJ A;  2OT5 A;  2Q4P A;  1D1B A;  3JAW A;  3OEE G;  2NNU A;  2H3O A;  1W59 A;  2XM4 A;  3T1H B;  4JRZ A;  1H6G A;  3T1H O;  5LYJ B;  1S77 D;  1Q82 W;  1VQ4 V;  4JW1 A;  2Y69 B;  2ETS A;  1BHA A;  1AP6 A;  1PM9 A;  3F7Y C;  3LSU A;  5H6R A;  1S72 V;  1M5I A;  3W2W A;  5L3D A;  3HNI A;  4PJJ A;  1R1B A;  2ZDI A;  3OW2 U;  3HKC B;  3SYQ A;  2WAM A;  3L73 H;  2IU0 A;  4WFF A;  3JSE O;  2HLD G;  4Q7C A;  3JAR A;  2F93 B;  3GAN A;  3HNL A;  1UFB A;  4NB5 A;  5D5P A;  2IYL D;  3OTF A;  3BRJ A;  3T6B A;  1Y76 B;  5IYD O;  5FCL A;  4YN0 B;  5FPR A;  2ZE8 A;  1ZU4 A;  1Y66 A;  3QF7 A;  4G0H A;  4LF5 B;  3ZHS A;  5EGY A;  4GEH A;  4LF5 O;  3GWO A;  2KYH A;  3K1H A;  1SES A;  1NFO A;  4EBB A;  2Q68 A;  3US6 A;  4CX9 A;  4OX9 B;  1PV3 A;  4G2K A;  1SZI A;  4OX9 O;  2OU6 A;  1JA8 A;  3S28 A;  1SET A;  2ZIO A;  3DSQ A;  3WAQ A;  1B3Q A;  1D2D A;  1R3J C;  2P0N A;  3S0X A;  3S3W A;  2A6E F;  2Q7H A;  4XPX A;  4OIQ F;  2NG1 A;  1NZE A;  4G7Z F;  4MSW C;  5BQI A;  1UG7 A;  4Z1M G;  3NKD A;  4CSA C;  4I0X A;  2L7A A;  2X6B A;  2OIG A;  1HMO A;  4DR5 B;  3CRA A;  2NN4 A;  4DR5 O;  3K33 A;  3SXY A;  1SQG A;  3SJA C;  4UFZ A;  3C8G D;  3P3P A;  4U3J A;  4CS8 A;  5J2T B;  2OKU A;  1J95 A;  3G80 A;  3STZ C;  3KL4 A;  5B1A C;  4PEL A;  1KUQ A;  3ABK B;  3JSZ A;  1YSC A;  2M7W A;  2GV9 A;  2FL4 A;  3BFR A;  2EIL C;  3BA9 A;  3ICX A;  2XT9 A;  1P4R A;  3ZJZ A;  2NSF A;  3SYO A;  3OUF A;  1ZHX A;  2A69 F;  1SS3 A;  1NTK H;  4JTA B;  3GWK C;  2CW0 F;  2H8A A;  4Z2W A;  5F5F A;  3LEV A;  4LCU C;  3M7M X;  3LNN A;  2EIJ B;  1LPE A;  3CCL V;  3K59 A;  2ZE6 A;  2B5U A;  5L0J A;  3UMK A;  3RF3 A;  5IT9 N;  1BR1 A;  4ZI7 B;  1IW7 F;  2HEP A;  1Y6X A;  2JPU A;  1YJW V;  4ICG A;  1SQF A;  3RYF A;  3CZ6 A;  1XOU A;  4Z9I A;  4H44 B;  5LP6 C;  2AGA A;  1SQQ H;  3OUS A;  4J42 A;  4J7T A;  1BBH A;  1WA8 A;  1PV0 A;  1AR1 B;  3JT1 A;  3FOO A;  4CJG A;  1YAR O;  4O4J A;  4RUF A;  3HKE A;  2UXD B;  4BG0 A;  3S9O A;  2N74 A;  2LFR A;  3JAT A;  3K03 A;  4ASU G;  1BCC H;  3ZIA G;  2OWO A;  2UXD O;  1LS4 A;  1H2N A;  4CBE A;  4UDV A;  3SJB C;  1BSM A;  3N2K A;  3DAF A;  2VCA A;  5KYX A;  3G67 A;  1Z7Q c;  1U97 A;  5IY5 C;  2PI5 A;  2F66 C;  3EGD A;  1U0B B;  3CYO A;  4NVP A;  5H2F Z;  1VQ8 V;  3T9O A;  4AK9 A;  3CRM A;  1S3J A;  1I08 A;  2M6Y A;  1AJN A;  1L0N H;  2OCC B;  4F6R B;  3RYH A;  3Q4H B;  3Q6M A;  3Q7L A;  4IAO A;  1FAP B;  2NUP A;  3OT7 A;  3CE2 A;  4D7S A;  4FLT A;  1N8R W;  4O7G A;  4PD4 F;  4LWS A;  3TD7 A;  5A6A A;  4PI2 A;  1WN0 A;  2XLW A;  4MVS A;  4AL0 A;  5JCO C;  4D4X A;  3A0B Z;  3QO7 A;  2YL1 A;  2R25 A;  2RCV A;  5L3B A;  2LO1 A;  1K40 A;  3G4S V;  1N32 B;  1WPB A;  2WVN A;  4MTF A;  4CBC A;  3ZMT A;  1N32 O;  4FZ0 A;  3JAM N;  4QIW F;  3THO A;  1OCR C;  1V54 B;  2Q0A A;  1R3I C;  3MX3 A;  5COF A;  4DK1 A;  2P6V A;  1FXK C;  2RDC A;  3ZCC A;  1KD1 W;  3U10 A;  2QWO B;  3ZHQ A;  1VQ9 V;  1MG1 A;  2JGD B;  4DRX A;  5GPG B;  4P9O A;  4F4L A;  1MSW D;  1CXZ B;  1IZM A;  2G3K A;  4JAV A;  2R9A A;  4IIJ B;  3EH2 A;  1TR2 A;  4WGY A;  2HJ3 A;  4WFB V;  4OIN F;  4NC3 A;  3ASO B;  2AP3 A;  3K66 A;  4ZBM A;  1ZAU A;  1RMV A;  3ZX6 A;  1TA8 A;  2K1E A;  1K4C C;  3CSX A;  4PA9 A;  3LDD A;  1OR3 A;  3E9V A;  2HKV A;  5FNV A;  2OCH A;  4BIO A;  2WL8 A;  1GS9 A;  5KLV H;  2YEV B;  4CS9 C;  1BS3 A;  3LDC A;  1RKC A;  5B1A B;  5JWP A;  3TOL A;  1T6U A;  2B9Z A;  1D0Z A;  3FMS A;  1H2G A;  1WP8 A;  5JS5 A;  1Q43 A;  4GZR B;  4YT5 A;  4XTK A;  4FLV A;  2W6I G;  2A0U A;  4DRJ B;  3CEX A;  1LUW A;  1VQM V;  2AZ2 A;  4DR1 B;  3UR3 C;  1EI7 A;  1R5I D;  1SER A;  4DR1 O;  4XDL A;  2YI9 A;  1G4U S;  3T1C A;  1VF5 B;  2V7Q G;  1ENV A;  1D0Y A;  2LGQ A;  3Q7G A;  2NUT B;  1WOL A;  4FK5 C;  3OEO A;  5LP6 B;  4QE9 A;  2GFH A;  4H37 A;  5CA1 A;  3K5M A;  2AWC A;  3FKS G;  3CCV V;  1RXQ A;  2OQM A;  1N33 B;  1E85 A;  1NZ6 A;  1N33 O;  3VOU A;  1QZX A;  3MHS C;  3B0P A;  4QI0 A;  2ARH A;  2L6H A;  1XBL A;  4DV2 B;  2XL6 A;  1E86 A;  4DR2 B;  1KKD A;  2UXB B;  4QNH B;  4DV2 O;  3ZMS A;  4DR2 O;  2YXL A;  5IYZ B;  2YLI A;  3JD0 A;  2UXB O;  5F28 E;  1NI8 A;  4PV1 B;  4YT8 A;  1BHB A;  1EKY A;  4KP4 A;  4PJM A;  2WLI B;  3OA1 A;  4OIP F;  1BE3 H;  1Q6H A;  5BUO A;  3PMR A;  4NKG B;  1ROP A;  1SZX A;  4UCT A;  5BQH A;  4D6T H;  4CH5 A;  2HFI A;  2P7V A;  4J80 A;  1TFO B;  4XPW A;  2KKW A;  2QTO A;  4H13 B;  2R05 A;  3A9C A;  3BA8 A;  4FLU A;  1OV9 A;  3ASN C;  3C3S A;  3B4S A;  3SPI A;  3EZI A;  1P7B A;  3ABM C;  3JAL B;  2M4E A;  3MYF A;  1NS1 A;  2R7U A;  3WHN A;  2EIM B;  1SA0 A;  1MSD A;  1FFX A;  2P4K A;  4YL3 A;  5IJ9 A;  1YDI A;  1G8M A;  4B7E A;  1OW7 A;  4OIR F;  3O55 A;  3H1L H;  3PHF 2;  2IXN A;  1YEW A;  4XDK A;  4W8K A;  2WWW A;  1OCR B;  4I1M A;  3H65 A;  3MDS A;  4FLZ A;  1OKK D;  3AG4 C;  1F7Y A;  1FXK B;  3GOR A;  3EFO A;  4EEQ A;  4EB6 A;  1LS1 A;  1TVK B;  2GTA A;  4GT1 A;  4O2B B;  1Q3E A;  4LDQ A;  1M56 C;  1MOF A;  2OYQ A;  5LHI A;  3SP1 A;  4Q4Z F;  1YIT V;  3GOD A;  5IJ0 A;  5E1A C;  2R7Q A;  3QW1 A;  3V5Z A;  4JI7 B;  4OPA A;  1R6N A;  2E74 B;  3C62 A;  4BJ6 A;  4JI7 O;  3SXK A;  4A4A A;  3U2M A;  4PI0 A;  1ZX3 A;  4X20 B;  3BY6 A;  3FYI B;  3T2M A;  4DV1 B;  4TUY A;  2AU5 A;  2QTV A;  2IW5 A;  4DV1 O;  4CC5 A;  5B1B C;  1TGO A;  2NR5 A;  3ZRW A;  3CC2 V;  5KMG A;  3NYL A;  1K4D C;  3LLI A;  2QKA A;  3QVN A;  1RSO B;  2R72 A;  4LER A;  4JVS A;  2WVQ A;  4EFE A;  2QGN A;  4WJ0 A;  3UCS C;  1GK9 A;  1D1C A;  3FYE B;  2HMQ A;  4WFH A;  2DWE C;  5A6J A;  3AGT A;  1U89 A;  2CE4 A;  4JEB A;  1H2K A;  3FB6 C;  3IAY A;  1ZYR F;  5B66 Z;  5B3S C;  3C8Z A;  3JAS B;  1K05 A;  3ZMV A;  4HNA B;  5CIV A;  1ZTE A;  5GTI Z;  2X51 A;  2RJZ A;  5CA0 A;  4JZA A;  1FD9 A;  3P3N A;  3GEE A;  4LH7 A;  1F1M A;  3GWN A;  1KP3 A;  2DYR C;  1AIL A;  5K1P A;  1I5Y A;  5KHH A;  4ZKI A;  4I44 A;  4KC9 A;  4NTX A;  2HSB A;  2QUP A;  2R02 A;  1M2V B;  4EUK B;  1JMW A;  3GEI A;  1NU7 D;  3E35 A;  4IWB A;  4QE7 A;  1F51 A;  1BL8 A;  1M2V A;  2R9R B;  3ZG1 A;  2W0F C;  4LF8 B;  4QJF B;  4RUE A;  2KG7 B;  4O4I B;  1ZHZ A;  4LF8 O;  3AK3 A;  5GTH Z;  1P84 F;  2F23 A;  4W8P A;  2F1M A;  1T5E A;  3RQE A;  3U8V A;  3VYW A;  4G7O F;  1LKX A;  4GKK B;  3FX7 A;  3WB1 A;  4B08 A;  2LFD A;  4GKK O;  3RFR A;  2L6G A;  3APO A;  1B68 A;  4WGZ A;  1RJ9 A;  3AG1 C;  4A5U B;  5JVD B;  3H1K H;  1KU9 A;  4TSF G;  1ZWI C;  3B8M A;  4LNU B;  4I50 A;  1O3U A;  1EZJ A;  2VWJ A;  1E79 G;  2MK3 A;  5CN0 A;  4J41 A;  1ZL8 A;  3CPW U;  2GDC A;  4XDJ A;  3GM1 A;  2ZXW C;  3RFY A;  4NR1 A;  3W7U A;  1D1A A;  4K1O A;  5DS5 A;  2ADQ B;  1I4Z A;  2CH7 B;  4BJ1 A;  2R9I A;  2EUL A;  5CBF A;  2X7R B;  3B2E E;  3ECS A;  1WB8 A;  4FFB A;  5JJN B;  2HJF C;  2J9B A;  2KQX A;  1MZF A;  3W7X A;  3GWL A;  3TK1 A;  3IEE A;  4BIZ A;  2VCB A;  4KHP B;  3C8G A;  3LES A;  2ZXR A;  2E87 A;  3V7O A;  4KHP O;  5HFL A;  2HZ8 A;  4YL1 A;  1I5N A;  1GM7 A;  1EN4 A;  4OD5 A;  2QJ1 A;  2QWQ B;  1K5S A;  2HP8 A;  4C3E A;  2AW9 A;  4KL1 A;  3L9D A;  3MAQ A;  2WPD G;  4OPH A;  5EIB D;  4FMT A;  1M57 C;  3JD3 A;  1AEP A;  3E89 A;  4FM0 A;  2JD3 A;  3CWB H;  1KC8 W;  3QTH A;  3E83 A;  5BZB A;  1AI6 A;  3WOD F;  2N04 A;  4ZIB A;  3CRR A;  1VLT A;  2D5R B;  1M56 B;  1GN3 A;  5H5N A;  1XNQ B;  1IUR A;  2KSF A;  3E70 C;  4YJ2 A;  3JTL O;  5L0G A;  2Y69 C;  1XNQ O;  2XLE A;  3H2V A;  4PJN A;  2O57 A;  5DEC A;  3UT5 A;  1U96 A;  1S0V A;  1GN4 A;  2YLD A;  3GVM A;  2BE3 A;  4LR3 A;  1NVP D;  3ABT A;  4DUZ O;  3ZWI A;  4Z1V A;  3NKE A;  3LEO A;  2YQY A;  5HFM A;  3VQX A;  2PZS A;  1Y74 B;  2YUA A;  1CGN A;  3J81 N;  4O6Y A;  2A0L A;  3LSS A;  2BE5 F;  1GM9 A;  4AHC A;  3UGO A;  2KQ9 A;  5F2V O;  3B40 A;  3Q6N A;  4PA4 A;  2Q69 A;  5JLI A;  4YJ3 B;  5B3S B;  3S27 A;  1VYK A;  5LOV B;  1YZB A;  4GQH A;  1QSP A;  5GON A;  2JJ1 G;  4K8X A;  2BC5 A;  2CNW A;  2KNH A;  2DJV A;  1Q7Y W;  1S05 A;  1JFF B;  1PL4 A;  2XAS A;  4UXN A;  3J80 N;  3SXZ A;  3CQZ A;  5LA6 B;  2KW3 C;  4YY3 B;  1O87 A;  4YY3 O;  2QR4 A;  4PDL A;  5JH7 B;  2M64 A;  1QU7 A;  2R7R A;  4ZOL B;  2LQG A;  5JJJ B;  2H8P C;  2P5O A;  2ZT9 B;  1E83 A;  1YA7 O;  2QE9 A;  3G71 V;  3PJS K;  4TQF A;  1BT8 A;  1M1K W;  4K8Z A;  2LP4 A;  3GEH A;  3OM3 B;  3SZR A;  2HJD A;  1F4N A;  4M63 A;  2XOK G;  3K1I C;  3NR7 A;  3H9V A;  4XBF A;  2IOQ A;  3LDE A;  3S3X A;  3FXH A;  3RW0 A;  2KK1 A;  2Y4T A;  4FAP B;  1NG1 A;  3G6B A;  3ABK C;  4O2A B;  4RAI A;  1RPR A;  3LSQ A;  4H33 A;  3DE8 A;  3SXM A;  5JSL A;  1SRY A;  5EYP B;  4X66 B;  3MD0 A;  1LR1 A;  1PPJ H;  2OTJ V;  3FB8 C;  3B09 A;  3F5W C;  2ZIN A;  3HKC A;  1E1Q G;  4DV6 B;  2EIJ C;  3L8I A;  3CXH F;  4DV6 O;  4E18 A;  3E8H A;  2W45 A;  4X89 A;  4PR9 A;  3DGE A;  1SQX H;  2JS5 A;  4G27 B;  4MTX A;  4B3T B;  5L0I A;  4B3M B;  3HKB A;  3VAY A;  1THZ A;  3L71 H;  4B3T O;  1LIH A;  1SQP H;  4B3M O;  4LDR A;  4K3A A;  1JPN A;  2QM4 A;  4JYY A;  1OQC A;  3NG1 A;  3PDM P;  2QA4 V;  4C7O A;  5D91 A;  3BEH A;  1M57 B;  1UFI A;  2RD9 A;  4JI5 B;  4CJO A;  5KYU B;  4JI5 O;  3AQB A;  3JD1 A;  5TJ5 E;  3QNE A;  2Q7G A;  4YIP A;  2R7V A;  4O6N A;  4MT8 A;  4OIO F;  2Y0P A;  3TJ6 A;  1TWA A;  3JCZ A;  4YL0 A;  4O4L A;  4W4L A;  2F4V B;  1G5Z A;  1ZHT A;  5E3C A;  4CDA A;  4ONS A;  2F4V O;  3FAJ A;  2OCC C;  1GN2 A;  2UXC B;  5JT4 A;  2JDI G;  4MND A;  4KNV A;  2UXC O;  4JC7 A;  1FYJ A;  1MND A;  3A0H Z;  1Y4M A;  2I8B A;  3KCX A;  4JF3 A;  4CS8 C;  3C7J A;  4AL1 A;  1QR8 A;  3ITF A;  1VQ6 V;  4EBJ A;  1SF9 A;  2CTW A;  4U9D A;  5ITZ B;  2P61 A;  3ZRX A;  2R7S A;  4BIU A;  4I4T B;  2VAS A;  2C2A A;  2P7T C;  2Q00 A;  3ETD A;  3N2G B;  1V54 C;  2ZNJ A;  1DOV A;  5J2U A;  3DXR A;  4J7K A;  1VQP V;  3EH1 A;  3M99 B;  5L3Q A;  3UMH A;  1H2S B;  5A6K A;  1T5O A;  1DTO A;  1H9G A;  1ORJ A;  1T6I A;  4CDV A;  3DJU B;  4LF9 B;  2XAQ A;  5KHI A;  4LF9 O;  3NYM A;  4I5S A;  1CPR A;  1WPX A;  1NTM H;  1Q81 W;  1H2L A;  3ASO C;  5IE9 A;  1BR4 A;  1R73 A;  1GM5 A;  1ZU5 A;  1OKK A;  3ZMZ A;  4U5B E;  3JAW B;  2C04 A;  4E4E A;  2YKZ A;  2FML A;  2WA4 A;  1B06 A;  1GQA A;  2YWA A;  5B1N A;  3L74 H;  4JYA B;  1YJG A;  2FFH A;  1APC A;  4JYA O;  5A6B D;  1VQK V;  2XL8 A;  4PDR A;  1V4A A;  4NCQ A;  2XL4 A;  1N34 B;  4E0I A;  2YSU B;  2P22 C;  3TXQ A;  3RYC A;  1N34 O;  4LFC B;  5KYW A;  2Z3Y A;  3QVY A;  3VF0 A;  4P6I C;  4LFC O;  4H4K C;  1HR0 B;  4WAB A;  2VRZ A;  3K08 A;  2HHH B;  3DD7 A;  1HNX B;  4GUN A;  1HR0 O;  1Z23 A;  3T1Y B;  2HHH O;  2R7O A;  3EGX A;  3ZMU A;  1HNX O;  1LVK A;  5GW7 A;  3T1Y O;  1N36 B;  4RBN A;  4LLC A;  2L81 A;  1N36 O;  1M6T A;  1TWG A;  4MVR A;  4ER9 A;  1PCX A;  2CGE A;  2CDY A;  4JTD B;  3U2L A;  1CEZ A;  3TET A;  1PD3 A;  3F46 A;  2LFF A;  4QI2 A;  3RQG A;  4XEK A;  4W4K A;  2CYD A;  1K97 A;  1HW2 A;  3K6B A;  2A0B A;  2DWD C;  1Y6D A;  4PDM A;  4I55 A;  2D3O W;  3FB7 C;  2YL7 A;  2AHZ A;  4UB6 Z;  2CGN A;  3W7W A;  1HNW B;  1L0L H;  1HNW O;  3B8N A;  2IJI A;  3DE9 A;  5KYN A;  2Q6A A;  3SYP A;  1CPY A;  2BSK A;  1XZQ A;  2YL0 A;  3AQC A;  1Q0M A;  3G50 A;  4I0X B;  2HVJ C;  1G1X B;  5JP7 A;  2YIC A;  4MW3 A;  1TUB A;  2QWR B;  4JUR I;  2CNW D;  2Z15 A;  1K34 A;  3RYL A;  2W4B A;  4U3J B;  3GB7 C;  2BTQ A;  2F22 A;  3KCY A;  2ITD C;  2QM8 A;  2ZE7 A;  4BAY A;  5E3A A;  1SZT A;  2FAP B;  4JAS A;  5LMU B;  4UUJ C;  2EIM C;  4UCR A;  5LGU A;  1K73 W;  3QTC A;  2QDO A;  2WLN A;  5LMU O;  4XEF A;  4FLX A;  3HB3 B;  2Q4F A;  1Z2G A;  5BR8 B;  1NR1 A;  3U11 A;  4Q5S F;  1D5N A;  1K3E A;  5BR8 O;  1HY5 A;  3KKB A;  1Q0K A;  1T01 A;  1HWY A;  1M4U A;  3K06 A;  3KKY A;  4JGS A;  5KHK A;  3DC5 A;  1FFH A;  4IB4 A;  3CCJ V;  3CB2 A;  3SPJ A;  1EM1 A;  1LNQ A;  1NTZ H;  3RYF B;  1QHT A;  1YLM A;  4MVM A;  4PDV A;  1RPO A;  3KYI A;  4X1K A;  2H7B A;  2NUT A;  4EIY A;  2XAJ A;  5KX5 A;  3CME V;  4FLY A;  3W8H A;  1K92 A;  3O6X A;  3HKE B;  3AG2 C;  5HSW A;  4LP8 A;  4E17 A;  1OCO C;  3K0G A;  5KYX B;  3B29 A;  2QKS A;  2K9P A;  4O6M A;  3V5X A;  4RWU A;  3EGD B;  2VQF B;  2ASR A;  1VLS A;  4CIH A;  2Y48 A;  4QGP A;  2VQF O;  2J9V A;  4DV0 B;  4XLP F;  3RYH B;  5B5E Z;  3DC6 A;  4DO2 A;  3I4U A;  4DV0 O;  3RVY A;  1M93 A;  2IXP A;  3EJN A;  2NUP B;  4XLN F;  2N05 A;  2QSA A;  3W7S A;  4AQY B;  2IXO A;  3LS1 A;  3ZHU A;  1IXM A;  2WA3 A;  3ZBH A;  4LWS B;  4AQY O;  3U0Z A;  2CAZ C;  4IHJ A;  4Q20 A;  4TV9 A;  4IAQ A;  3K5O A;  4BW9 A;  2W9Y A;  4ZHQ A;  1AI7 A;  1O5H A;  1GH6 A;  1WLE A;  2J8W A;  4LF6 B;  3IQC A;  5CB4 A;  4J9Z B;  2BTO A;  5D5Q A;  1GO3 F;  4LF6 O;  2OEX A;  4CS7 A;  1B6Q A;  3H1I H;  4I1O B;  3BHP A;  4Q6G A;  5IWA B;  2C03 A;  4DR4 O;  3IQ5 A;  1F4M A;  5C8Y A;  5IWA O;  1LE2 A;  3ZN0 A;  3CJH A;  1Z3I X;  2LSE A;  3C90 A;  3MYI A;  1UJW B;  4DR7 B;  4JJG A;  1XZP A;  1O9H A;  1VP7 A;  1TKN A;  2VB6 A;  1BZK A;  1VQ5 V;  4FM1 A;  4DR7 O;  1HMD A;  2V3C C;  1QBZ A;  4DRX B;  2DQ0 A;  4KFM A;  4O2B A;  4U5H A;  2IJH A;  1WNS A;  2LGW A;  3D36 C;  3ETQ A;  4FIP C;  4XWJ A;  4X88 A;  5E33 A;  4PHZ A;  2UU9 B;  4PA7 A;  1TFK B;  4FES A;  2GBO A;  2Y39 A;  2UU9 O;  4QPJ A;  1OCC B;  3ETE A;  3RYI A;  3KH2 A;  4UB8 Z;  2G3V A;  3M4B A;  2ZXO A;  3ZIB A;  1SKV A;  3WB2 A;  1SMY F;  5COM A;  4ZLD A;  3H1H H;  3K5N A;  1FJG B;  4NTA A;  1FJG O;  1Q86 W;  5EZY A;  1NKD A;  4JI8 B;  1URF A;  3D3I A;  5FNV B;  4JI8 O;  4AE4 A;  1GM8 A;  1HE1 A;  4PAC A;  5T3W A;  4JCH A;  3BPZ A;  2X0C A;  4CS9 A;  1I94 B;  1QKR A;  1AJQ A;  5J9P C;  2A9H A;  2X0L A;  1I94 O;  1F23 A;  3IGA C;  3C3T A;  3K0D A;  3T4R A;  1Z63 A;  2VS0 A;  1RM1 C;  5LBQ A;  3B9Q A;  4N6C A;  5L3G A;  2XND G;  4FPP A;  4J7Z A;  4F6E A;  4LF4 B;  2ZPA A;  3TQO A;  3U9M A;  1NVP B;  4BR6 A;  3HKD A;  4LF4 O;  2JGU A;  3ZHR A;  5LHH A;  1MA1 A;  2YIA A;  1JR9 A;  4IRU A;  4GYT A;  1OR2 A;  1Y67 A;  5KYY A;  2GUZ A;  2DOS A;  4LDK A;  4I9Q A;  5CA1 B;  4FJC C;  1YYJ A;  1XHX A;  4X1I A;  2YHS A;  5DQZ A;  3E8B A;  3DKA A;  2ADP A;  4LAC B;  3CXC U;  5KA5 A;  4DRH B;  3AG2 B;  2PFD A;  1FTS A;  4RDA A;  4GCZ A;  2IH3 C;  1A7E A;  2W6J G;  1OCO B;  2P1A A;  1X59 A;  3ML0 A;  1Q0G A;  1GAX A;  2IH1 C;  3FDQ A;  4LNU A;  3CCR V;  3EHM A;  1HW1 A;  1ZZP A;  3U3F A;  4HFF B;  2G38 A;  1VK5 A;  1NU1 H;  3DWW A;  3U3B A;  1Q0D A;  1DGS A;  4J32 B;  4TOI A;  3TOM A;  5KUM A;  1S76 D;  2E3C A;  1C17 M;  2P6J A;  1EN5 A;  1YTF B;  3EG9 A;  1IVS A;  2Q67 A;  4JI2 O;  3T4D A;  2EBO A;  3VQY A;  3U0C A;  4GYC B;  5L3F A;  1OXB A;  4G7H F;  3QZC A;  1N1C A;  1JJO A;  4HAM A;  4U5D E;  2JS3 A;  3CCQ V;  2H7V C;  3R65 A;  3SR2 C;  4UVB A;  5E79 Z;  1JPX A;  3CEI A;  1VQN V;  1SA0 B;  3FAV A;  1FFX B;  1MAB G;  4JIO A;  4O4H A;  5IJ9 B;  4HE8 D;  4IGG A;  4H54 A;  5L0F A;  2YL3 A;  5DQT A;  3AK2 A;  1N4C A;  1NSG B;  1EQ1 A;  1D0X A;  1K33 A;  2HR3 A;  2ITC C;  2ZR2 A;  3ZTZ A;  5TIS Z;  1BZ4 A;  3N0T A;  4NTW A;  4CIP A;  2CCY A;  4EKW A;  4NXN B;  4DK0 A;  2A6H F;  3UGP A;  3EFO B;  4EB6 B;  4NXN O;  3M79 A;  3H01 A;  4NQF A;  1IZ3 A;  1SC5 B;  3ABL B;  3TXS A;  5LXT A;  5BQG A;  4PA6 A;  2A3Q A;  1A41 A;  1L1F A;  2A7W A;  1VF6 C;  1XUQ A;  4B7K A;  1TWC A;  1FMW A;  1NBB A;  3ZQV A;  2J9U A;  2XAH A;  3UKM A;  1QVG U;  3QVZ A;  3W2V A;  4TUY B;  2DI3 A;  5AGF A;  2LW1 A;  3QMK A;  2YIB D;  5EHH A;  3ZRW B;  3AOU A;  1AUE A;  2Z5U A;  4RQE A;  2G62 A;  5KMG B;  1NH2 D;  2GSM B;  2KSD A;  3SPC A;  3OEH G;  1RKE B;  1WTY A;  3K9A A;  1NLX A;  2PYJ A;  4ZLC A;  2UUI A;  3IC9 A;  4CZZ A;  3OR7 C;  2EIK B;  3HLZ A;  2R03 A;  4U3F H;  5H6Q A;  5A6B A;  1NJI W;  3EVK A;  1WAZ A;  1ARO P;  1RM1 B;  2DYS B;  3M1C B;  1MMA A;  4CH3 A;  2P4V A;  3JRT A;  1R6T A;  5JQG A;  3IHU A;  2VQE B;  4MQ9 F;  5CA0 B;  5JRA A;  3LS0 A;  2VQE O;  1FPO A;  5D92 A;  4JI0 B;  2JIZ G;  1KNY A;  4FX5 A;  1XL4 A;  1YDX A;  4JI0 O;  4DW0 A;  2KJG A;  1E2X A;  3EQL F;  1JQ0 A;  3OE7 G;  1XEQ A;  2W4M A;  4J7J A;  3FVY A;  3K9S A;  4ULV A;  4NY3 A;  4X64 B;  1R6K A;  2FTK A;  4X64 O;  4JZ2 A;  3J7A U;  3TJT A;  4U5E E;  4UCO A;  2ZCE A;  3JAK B;  1VQL V;  1RFY A;  4IYI A;  4TV8 A;  2XXA A;  2WB7 A;  2OTL V;  1RJ9 B;  1LI7 A;  4GX2 A;  3EHN A;  3ZN1 A;  4DUZ B;  3R2P A;  4LFB B;  4EHP A;  4I50 B;  4X0R A;  4LFB O;  4K35 A;  5EBM C;  1ZW2 A;  4G78 A;  1SF8 A;  3BVO A;  1ZL8 B;  1OW6 A;  1FKA O;  1A32 A;  2XRH A;  1PP9 H;  2L35 A;  2UUC B;  4C3D A;  5L0D A;  1ZW3 A;  4R32 A;  2UUC O;  4HBN A;  3R66 A;  2H7O A;  3AG7 A;  4BJ5 A;  3IC7 A;  1O9G A;  4FFB B;  1Q6I A;  4K0D A;  2ILM A;  2R70 A;  1OW8 A;  4HFK B;  4PFO A;  4DYL A;  1V9P A;  1I7F A;  1WP7 A;  3E22 A;  1RCP A;  1WJZ A;  5A2Q N;  3C8G B;  1VMA A;  3U8P A;  2Q7E A;  3JCU Q;  1COW G;  2LFS A;  1QVF U;  1IBL B;  2IBZ H;  2CUG A;  5JVE A;  1IBL O;  2E75 B;  3LNM B;  3AGU A;  2Q73 A;  3L0I A;  5CBG A;  1W0J G;  1HDJ A;  5FPO A;  1G4W R;  4J7Y A;  2YVK A;  4WBN A;  2WLL A;  1SQB H;  2KB1 A;  4RD9 A;  1OCZ C;  2P90 A;  3EPV A;  3ZVR A;  1SQV H;  4JI1 B;  1AP5 A;  4OXS A;  4KUM A;  3SNH A;  2YI8 A;  4YT2 A;  4JI1 O;  3CMA V;  3ZS8 C;  2UUA B;  1XMO B;  3RN4 A;  1K9M W;  1YZC A;  1N0N A;  3AG3 B;  3DJN B;  3JZ0 A;  2UUA O;  1XMO O;  1JR8 A;  2ZD9 A;  3HR0 A;  1GMG A;  4YJ2 B;  3S29 A;  4D4N A;  4I3M A;  5LYJ A;  5EC2 C;  4KXR A;  4N06 A;  1W2W A;  2RQ6 A;  3UT5 B;  1U6H A;  2BOB C;  1H38 A;  4AX2 A;  2ZDI C;  5KAI Z;  1T9K A;  3NRH A;  4JJF A;  1K5Q A;  3HKK A;  1OJH A;  1I0H A;  2GA0 A;  1ZUQ A;  4LF7 B;  3L70 H;  1CPQ A;  2QY9 A;  3RQF A;  1Q5O A;  4LF7 O;  2HFE C;  4IT5 A;  3IQT A;  2J0W A;  2GTS A;  1M2O A;  1W2B U;  3FB5 C;  3DMD A;  2RMK B;  1Y76 A;  2AVK A;  4EFB A;  4JPR A;  2IM8 A;  1TUE B;  4TT3 G;  2QTS A;  3RT3 C;  2HJM A;  1H7I A;  2R7T A;  1E1R G;  3N2G A;  3K5L A;  3B0V C;  1PNK A;  2L9J A;  5GON B;  3APQ A;  1KU2 A;  2F43 G;  1VYI A;  2EZP A;  3SPG A;  4D7T A;  4GX5 A;  2KC3 A;  4FVM A;  4CS4 A;  4DBR A;  1QLE B;  4OGQ B;  1HW7 A;  1JPJ A;  3QO5 A;  2WSS G;  2UUH A;  2QWP B;  1X4T A;  3QO8 A;  3NXS A;  2ZXP A;  2YRF A;  3ZQY A;  1T6Q A;  1DF5 A;  5CBH A;  1JVM A;  1MQV A;  2ZNI A;  4RQF A;  1XDC A;  3WG7 C;  1V74 B;  3QW0 A;  3L72 H;  2EZO A;  4JYB A;  3CCE V;  3SYC A;  3N24 A;  1KBH A;  1QNM A;  4UV8 A;  4K7B A;  1VMG A;  2Y4U A;  3LNR A;  3K1I A;  1QQ3 A;  3A0R A;  5J2T A;  2UUB B;  3G4Z A;  3S90 A;  4KI2 A;  5KUK A;  2UUB O;  3KPH A;  2EPO A;  5HV9 A;  3ABU A;  2QLA A;  3UQ8 A;  2WVO A;  4P2Z A;  4X1Y B;  3A2F A;  3I5P A;  2XS8 A;  2QWN B;  1NFN A;  2Y0I A;  2VCC A;  1VQ7 V;  1Z5V A;  2PF4 E;  3WB0 A;  4IL6 Z;  1EBO A;  5IYB O;  1OXK A;  2Q9L A;  3DXJ F;  1GTO A;  3NMI A;  1XQ8 A;  2EPK X;  1AR4 A;  3FHD A;  5BMV B;  5L3V A;  2EIN C;  4BWA A;  3LAY A;  3ZSU A;  3HKB B;  4ZI7 A;  4H0L B;  2B1G A;  2XM0 A;  2F95 B;  1YJ9 V;  3CD6 V;  2AHY A;  4C7O B;  1XIL A;  1QVX A;  3GM2 A;  2CTR A;  3LUT B;  3NMK A;  3EXA A;  3JRM O;  1R4T A;  4JZG A;  2DE0 X;  2X6A A;  4XPY A;  4PK4 A;  1OCZ B;  1JJ2 U;  5C93 A;  2E76 B;  1MNG A;  2ZM6 B;  1YCI A;  4JYC A;  3I5Q A;  4X8A A;  1Q90 D;  5DN6 G;  2ZM6 O;  3NDB B;  5A69 A;  2J7P D;  2YID A;  4B6I A;  5LHG A;  4JCZ A;  5AC4 A;  5B1O A;  3ZDL A;  1ZSP A;  3HNK A;  1WB7 A;  2PP4 A;  3WU2 Z;  2EX3 A;  3JYH A;  2LIG A;  2V26 A;  1ZHW A;  3G4X A;  2ZIM A;  4O4L B;  2OEV A;  4EWC A;  1D5A A;  1S5J A;  1DK1 A;  4E7Z A;  2OOC A;  2WZG A;  3I5D A;  2JRI A;  3M8A A;  4F6R A;  3Q4H A;  3OD4 A;  2XLV A;  2KGO A;  2Q9B A;  5DVW A;  2CK3 G;  4WFG A;  2YXH A;  3JAR B;  1MZE A;  2CTQ A;  4MVO A;  3OMI B;  3HNJ A;  4RO2 A;  4N21 A;  3A8T A;  4NXM B;  3CX5 F;  5CI9 A;  1US6 A;  4NXM O;  3JD4 A;  1H2M A;  3R7C A;  2FKX A;  3PCV A;  4FWV A;  2XUM A;  1IX9 A;  1NBM G;  4E2L A;  5J2U B;  3DXR B;  1OHH G;  2XHB A;  2QNL A;  4J9Y B;  3VM6 A;  4YK5 A;  1J8Y F;  4DBQ A;  3SPH A;  2WLH A;  256B A;  2HV6 A;  3SGI A;  1UPG A;  2JGD A;  4WF9 V;  1AVO B;  2WLJ A;  1OCC C;  2L6L A;  2TMV P;  1V55 B;  1VIB A;  1BR2 A;  5DLJ A;  2JJ2 G;  5EIB C;  3X2Q B;  4IIJ A;  1QLN A;  3IPM O;  1LI5 A;  5IDJ A;  1CP9 A;  1YYX A;  2J46 A;  3WG7 B;  1XRE A;  3CHX A;  1QPU A;  1BGY H;  3UNG C;  4CSA A;  3CCM V;  4J11 A;  2P06 A;  4YT4 A;  4R50 A;  3L34 A;  4PA3 A;  4GLX A;  4N4W A;  2NSG A;  2YEV A;  3AJM A;  4U5G A;  2XSE A;  3SYA A;  1KEC A;  1KYO F;  1KKC A;  5DM6 V;  2DB4 A;  2Q3T A;  3MLG A;  1R3K C;  2D2C B;  4DV3 B;  4ANJ A;  3RYC B;  2DQ3 A;  4DV3 O;  2OJE D;  4TWK A;  5KYW B;  1OZ0 A;  2HVK C;  1JCH A;  3C18 A;  5AG2 A;  2YIB A;  1N0J A;  3G6E V;  2UXX A;  2J0X A;  2OG2 A;  2RN9 A;  1EA8 A;  3MBG A;  2PYL A;  1FNT c;  5FZT A;  2FB5 A;  3EGX B;  2EIN B;  3OGI B;  2Q0O C;  4OD4 A;  3U5S A;  3RBZ A;  3WFV A;  3CCS V;  2AWY A;  3K7D A;  1QCE A;  2VC9 A;  2XLM A;  4L87 A;  3CCU V;  3D3Q A;  4JKV A;  4JTC B;  4CS2 A;  5L0C A;  3DM9 B;  2V4D A;  5H9C A;  3HTK C;  2O9X A;  3HJC A;  3W7T A;  3RKO F;  5LP6 A;  3VBB A;  2HSQ A;  1WA8 B;  1FXV A;  3OGC C;  5L0H A;  3IQ6 A;  4N23 A;  4O4J B;  1PD0 A;  3AK1 A;  3JAT B;  4HZ3 A;  4YXW G;  1AI5 A;  2JK5 C;  4I9W A;  1C02 A;  4C3B A;  3N2K B;  1P49 A;  4I55 B;  4R6Z A;  5KA6 A;  1BQZ A;  3VRC A;  1BQ0 A;  2MW2 B;  4BW5 A;  5BY1 A;  5IYZ A;  4DVZ A;  4R8C A;  1DLB A;  1ZLZ A;  2BSK B;  4R7C A;  2WLI A;  1GRJ A;  3KG2 A;  4KNW A;  3O9O A;  1LM3 B;  3LJB A;  2V1D A;  2PNO A;  1TUB B;  4AIL C;  3ZTM A;  1VEW A;  1Q0F A;  3SJC C;  2MYS A;  2J9W A;  5B3I A;  3B0U X;  2BTQ B;  3RGB A;  1I5X A;  2BOC C;  2PTM A;  3NMJ A;  1XL6 A;  1K04 A;  3M15 A;  1TAE A;  3JD2 A;  2IM9 A;  3JAL A;  3VQV A;  5JCO A;  1EZV H;  1S5H C;  4LFA B;  3ZRS A;  4XEV A;  4ULW A;  3OMN B;  2OJQ A;  3POV A;  2EIL B;  4LFA O;  3KYJ A;  2ZKO A;  4DR4 B;  4U5C E;  3UMI A;  1KB9 F;  5E2Q A;  5L3E A;  5F5H A;  2YC0 A;  5LMN B;  4DJ9 A;  1VOM A;  2CDQ A;  1IXB A;  5LMN O;  1YIJ V;  1VF7 A;  3UO3 A;  2IJK A;  1NH2 B;  2FYU H;  4QPK A;  1WWP A;  1IBK B;  1G8X A;  3U9J A;  2RNB A;  1FXK A;  1IBK O;  1AR5 A;  3FAP B;  2A06 H;  3ABL C;  3ATP A;  1TVK A;  2P67 A;  4CH4 A;  2HG5 C;  1XI1 A;  1MMN A;  4MS2 A;  3CC4 V;  2EPL X;  4BJ6 C;  4YHH B;  3SYN A;  4J30 B;  3L1M A;  2R7X A;  4X1K B;  3JYC A;  4YHH O;  2JEX A;  5KX5 B;  3JCU Z;  3F7V C;  4YJW A;  3N2Z B;  2JEU A;  4X20 A;  1AB3 A;  2XLH A;  1WGW A;  3GM3 A;  5KHG A;  3JYY A;  1FXH A;  2Q5Z A;  2GHY A;  1A7D A;  1Z6A A;  4O79 A;  4WCE V;  4GX0 A;  4X65 B;  1FAF A;  2AXT Z;  4X65 O;  4P9T A;  1VTM P;  2ZR3 A;  1HNZ B;  5IY5 B;  1LUV A;  1RSO A;  5JJE B;  5CI8 A;  4DR6 B;  1HNZ O;  4LLE A;  2EIK C;  4WFE A;  2YZS A;  4DR6 O;  1NT2 B;  1FR0 A;  1DOW A;  3F5T A;  2R7W A;  2PGG A;  4BEM J;  2DYS C;  2L6F A;  1M90 W;  4JI6 B;  1R3L C;  4UCU A;  3K57 A;  4E7S A;  3DM5 A;  2ETN A;  1VQO V;  4JI6 O;  1GGQ A;  1XMQ B;  3JAS A;  4DUY B;  4HNA A;  1XMQ O;  2DGJ A;  4IHJ B;  1GKF A;  4DUY O;  4TV9 B;  1E84 A;  2QE7 G;  4ZHQ B;  4BJT A;  4TQD A;  2ICW G;  3SDL A;  1NR7 A;  2WLK A;  4U7N A;  4UCS A;  1YAU O;  5CB4 B;  1C03 A;  1XNR B;  1KMI Z; 
#chains in the Genus database with same CATH homology
 4U5E E;  1MND A;  2IXM A;  4YWQ A;  2I8B A;  2EJ7 A;  4CS8 C;  2LO1 A;  2XXA A;  2WB7 A;  1RJ9 B;  1NU9 C;  3ITF A;  2WVN A;  5T3T A;  3EHN A;  2CTW A;  3SEO A;  2R7S A;  4X0R A;  2FGY A;  1OCR C;  2VAS A;  3O39 A;  1SF8 A;  3BVO A;  3MX3 A;  2Y3G A;  1S7Z A;  2P6V A;  2XRH A;  4C3D A;  1V54 C;  4MND A;  2QWO B;  2H7O A;  3EH1 A;  3AG7 A;  4BJ5 A;  3UMH A;  5L3Q A;  4K0D A;  1IZM A;  2G3K A;  4HFK B;  3DJU B;  4PFO A;  3EH2 A;  1TR2 A;  1WJZ A;  1VMA A;  4OIN F;  3NYM A;  3JCU Q;  3EZH A;  3K66 A;  4AE4 B;  2CUG A;  2A68 F;  3ASO C;  3LLK A;  1BR4 A;  4DOZ A;  3L0I A;  1HDJ A;  3E9V A;  4QDL A;  2OCH A;  1ZU5 A;  2WL8 A;  1OKK A;  4CS9 C;  4RD9 A;  1OCZ C;  3EPV A;  4U5B E;  2C04 A;  3ZVR A;  3DAG A;  3SNH A;  4YT2 A;  1D0Z A;  2FFH A;  2MWQ A;  4YT5 A;  3DJN B;  4XTK A;  2XL4 A;  3S29 A;  4I3M A;  3UR3 C;  3AG3 C;  1W2W A;  4N06 A;  5KYY B;  5KYW A;  2GUZ B;  4P6I C;  4H4K C;  4AX2 A;  3ZC4 A;  3NRH A;  3DD7 A;  4JJF A;  1Z5Z A;  1Z23 A;  2R7O A;  2DMX A;  3EGX A;  1D0Y A;  1LVK A;  2CTP A;  3Q7G A;  2NUT B;  4LLC A;  2QY9 A;  4RBN A;  3OEO A;  2L81 A;  2GFH A;  4IT5 A;  4F4B A;  1MMD A;  1PD1 A;  2J0W A;  1M2O A;  1TWG A;  2J7P A;  1PCX A;  2CGE A;  3DMD A;  3F46 A;  1NZ6 A;  4QI2 A;  1QZX A;  3B0P A;  4QI0 A;  2R7T A;  1XBL A;  1FFT C;  2B0J A;  2PX3 A;  3B0V C;  2L9J A;  4BJ5 C;  3K6B A;  3APQ A;  1KU2 A;  2Q9A A;  4YT8 A;  3EG9 B;  3CSK A;  4U5F E;  4PJM A;  1VYI A;  3OA1 A;  4OIP F;  5BUO A;  4A2N B;  1ST6 A;  2DN9 A;  3PMR A;  3OWT A;  4DBR A;  1JPJ A;  2P7V A;  5KYN A;  2QWP B;  4J80 A;  3AQC A;  2ZXP A;  1QLE C;  3ASN C;  2QWR B;  3EZI A;  4JUR I;  3WG7 C;  2CNW D;  2Z15 A;  3ABM C;  3RYL A;  2M4E A;  2W4B A;  2PX0 A;  3N24 A;  4DVY P;  2R7U A;  4K7B A;  5E3A A;  2Y4U A;  4OIR F;  2HV7 A;  3PHF 2;  3LNR A;  2IXN A;  4W8K A;  2WZL A;  2EIM C;  3KMI A;  4I1M A;  4KI2 A;  3H65 A;  1MMG A;  1OKK D;  3AG4 C;  2WVO A;  3EFO A;  5DS6 A;  4Q5S F;  3W8I A;  1LS1 A;  3RIP A;  3I5P A;  3KKB A;  2QWN B;  1M56 C;  3SP1 A;  4Q4Z F;  2PF4 E;  3GOD A;  1FFH A;  2R7Q A;  1MNE A;  3DXJ F;  4BJ6 A;  3FHD A;  5L3V A;  2EIN C;  3LAY A;  3ZSU A;  3X1O A;  2H7B A;  2NUT A;  2QTV A;  4HEA J;  5B1B C;  3W8H A;  3O6X A;  4C7O B;  3AG2 C;  3NYJ A;  2CTR A;  5HSW A;  3NYL A;  2WZF A;  3LLI A;  4LER A;  1OCO C;  4PK4 A;  4JVS A;  3RH3 A;  2WVQ A;  2Y3D A;  4WJ0 A;  3UCS C;  1D1C A;  1J8M F;  2Y3B A;  3I5Q A;  5KYX B;  3T6J A;  3NDB B;  1FMV A;  4O6M A;  2J7P D;  4RWU A;  4KBL A;  3EGD B;  2Y3H A;  4B6I A;  5KYU A;  2PP4 A;  1ZYR F;  5B3S C;  4IJJ A;  4CIH A;  2J9V A;  2VH3 A;  3JYH A;  4XLP F;  2V26 A;  1ZHW A;  3I4U A;  3UO2 A;  4EWC A;  2X51 A;  2A1D D;  2IXP A;  3EJN A;  4BEJ A;  2NUP B;  4JZA A;  4E7Z A;  4XLN F;  2N05 A;  2QSA A;  2IXO A;  2WZG A;  3LS1 A;  2DYR C;  3F47 A;  4KC9 A;  4I44 A;  1TWH A;  1M2V B;  1NU7 D;  4IWB A;  3ZG1 A;  1ZHY A;  2KGO A;  2Q9B A;  5DVW A;  2W9Y A;  1O5H A;  1ZHZ A;  1GH6 A;  2XXA B;  3VYW A;  4G7O F;  2CTQ A;  1LKX A;  4CS7 A;  5CI9 A;  4I1O B;  2C03 A;  3APO A;  1RJ9 A;  1Z3I X;  3AG1 C;  2LSE A;  4FWV A;  2Q9C A;  4JJG A;  1TKN A;  2VB6 A;  2V3C C;  3RFY A;  4U5H A;  2ZXW C;  1D1A A;  5DS5 A;  2LGW A;  4XWJ A;  5E33 A;  3DZA A;  1J8Y F;  4BJ1 A;  4DBQ A;  5DS4 A;  4FES A;  2Y39 A;  2HV6 A;  3ECS A;  3KH2 A;  2G3V A;  2ZXO A;  3ZIB A;  1SMY F;  2KQX A;  4PFP A;  4ZLD A;  1OCC C;  2L6L A;  1BR2 A;  3IEE A;  5DLJ A;  3LES A;  2ZXR A;  2J46 A;  2E87 A;  3V7O A;  4PJL A;  1V55 C;  3X2Q C;  4AE4 A;  3UNG C;  2YS8 A;  2J45 A;  4CSA A;  5T3W A;  4OD5 A;  2QWQ B;  4JCH A;  4CS9 A;  4YT4 A;  4C3E A;  3L34 A;  5T1D B;  1M57 C;  2YEV A;  1D1B A;  4U5G A;  3T4R A;  1Z63 A;  2JD3 A;  2XSE A;  3B9Q A;  3WOD F;  2N04 A;  2Q3T A;  3MLG A;  4J7Z A;  2ZPA A;  4JW1 A;  4ANJ A;  2D5R B;  5KYW B;  1IUR A;  3E70 C;  2J0X A;  2OG2 A;  4IRU A;  3W2W A;  2Y69 C;  4GYT A;  4PJJ A;  5KYY A;  3EGX B;  4PJN A;  2GUZ A;  4OD4 A;  3K7D A;  4Q7C A;  3GAN A;  5DQZ A;  2YHS A;  4LAC B;  3DM9 B;  2IYL D;  2PFD A;  1FTS A;  4RDA A;  3HTK C;  3T6B A;  2O9X A;  3HJC A;  5FCL A;  4YN0 B;  3RKO F;  1ZU4 A;  3NKE A;  4G0H A;  1PD0 A;  5EGY A;  2YUA A;  3FDQ A;  4GEH A;  4O6Y A;  3K1H A;  2BE5 F;  3EHM A;  4EBB A;  3UGO A;  2KQ9 A;  4C3B A;  4HFF B;  3Q6N A;  1VK5 A;  1SZI A;  1BQZ A;  3S27 A;  3S28 A;  1BQ0 A;  1VYK A;  4J32 B;  3S0X A;  2CNW A;  2KNH A;  4DVZ A;  3EG9 A;  2A6E F;  3CQZ A;  2KW3 C;  4KNW A;  1O87 A;  4G7H F;  3QZC A;  4OIQ F;  1N1C A;  1NZE A;  2NG1 A;  4G7Z F;  3LJB A;  4U5D E;  2H7V C;  2R7R A;  2MYS A;  2J9W A;  3NKD A;  4CSA C;  3B0U X;  4HE8 D;  3K33 A;  5DQT A;  1N4C A;  4CS8 A;  3SZR A;  1D0X A;  4ULW A;  3POV A;  4U5C E;  4M63 A;  3KL4 A;  3N0T A;  3K1I C;  5E2Q A;  5B1A C;  3UMI A;  5F5H A;  2A6H F;  3UGP A;  3JSZ A;  3EFO B;  2IOQ A;  1VOM A;  2CDQ A;  2EIL C;  2Y4T A;  1ZHX A;  3UO3 A;  1NG1 A;  2A69 F;  3ABK C;  1G8X A;  2CW0 F;  5F5F A;  3LEV A;  3ABL C;  1TWC A;  1FMW A;  2J9U A;  1MMN A;  3UMK A;  1BR1 A;  4BJ6 C;  1IW7 F;  3SYN A;  4J30 B;  2EIJ C;  3W2V A;  2R7X A;  3QMK A;  2W45 A;  5EHH A;  4YJW A;  3N2Z B;  3CZ6 A;  2G62 A;  3VAY A;  1WGW A;  4O79 A;  1Z6A A;  1JPN A;  4ZLC A;  3JT1 A;  3NG1 A;  1FAF A;  4C7O A;  4BG0 A;  5D91 A;  3HLZ A;  4CBE A;  5CI8 A;  4LLE A;  5KYU B;  2EIK C;  3M1C B;  1MMA A;  2YZS A;  3AQB A;  3DAF A;  5KYX A;  3JRT A;  2R7W A;  5IY5 C;  2R7V A;  4O6N A;  4MQ9 F;  2DYS C;  3EGD A;  4AK9 A;  3LS0 A;  4E7S A;  4OIO F;  1FPO A;  3DM5 A;  5D92 A;  2M6Y A;  4FX5 A;  1TWA A;  3EQL F;  2KJG A;  1ZHT A;  3Q6M A;  3Q7L A;  2DGJ A;  4IAO A;  5E3C A;  2W4M A;  2NUP A;  3FAJ A;  2OCC C;  3FVY A;  4BJT A;  4NY3 A;  4O7G A;  3TD7 A;  1M2V A;  4KNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...