2PF4E

Crystal structure of the full-length simian virus 40 small t antigen complexed with the protein phosphatase 2a aalpha subunit
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
172
structure length
163
Chain Sequence
MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWASSLNPGVDAIYCKQWPECVKKMSTNCICLLCLLRMKHENRKLYRKDPLVWVDCYCFDCFRMWFGLDLCEGTLLLWCDIIGQTTYRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
publication title Structural basis of PP2A inhibition by small t antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase regulator/viral protein
total genus 40
structure length 163
sequence length 172
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02380 Papo_T_antigen T-antigen specific domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2pf4E01
1.20.120.1860 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2pf4E02
1BQ0A 2PF4E 1FPOA 3APOA 1N4CA 2OCHA 1WJZA 2KQXA 2CTWA 2Y4TA 2CTRA 2N04A 1NZ6A 2QWOB 2N05A 2QWPB 1IURA 2YUAA 4IT5A 3UO3A 2LO1A 1HDJA 2GUZA 2EJ7A 3AG7A 2GUZB 3APQA 2CTPA 2DMXA 3BVOA 3UCSC 3UO2A 4RWUA 2DN9A 2M6YA 1XBLA 2QSAA 2CTQA 2QWQB 2QWRB 2LGWA 4J80A 4J7ZA 1FAFA 2CUGA 2L6LA 1GH6A 2YS8A 1BQZA 2Y4UA 2QWNB
chains in the Genus database with same CATH superfamily
1FPOA 2XUMA 4EKWA 2X6AA 1WAZA 4LC1A 1IBKB 5BQHA 1D0ZA 2Y3HA 2EZPA 4BIZA 4DV2B 2YICA 1RJ9B 4PHZA 3RYIA 3OTOO 3DJUB 4FZ1A 1OZ0A 3DE8A 3ZSUA 2HFEC 3LDDA 1PV3A 1M57B 3A11A 4NCQA 2J0WA 2E74B 4RWUA 4IRUA 3DAFA 2BL2A 2HR3A 2ZR3A 3AG3C 2VCAA 4KL1A 2Y69B 4J7TA 1TVKA 1QZXA 4MNDA 4YT5A 3H2VA 4TV8A 5L3QA 4DR7O 1HE9A 3IHUA 1J5EB 4LF6B 3KKYA 3OA1A 1D1BA 1G8MA 2A3QA 1Z5ZA 1K05A 2DYRB 2DW4A 2HHHO 4JVSA 3AK2A 2GUZA 5IDJA 2P06A 5HFMA 4LF4B 1QPUA 3K58A 2EINC 2YXHA 1E1RG 3UMKA 1ZHYA 3C8GD 3N24A 3ZIBA 2FAPB 2DYSB 4WFGA 3ZDLA 4C7OB 2YQYA 2ZQMA 2IU0A 2C2AA 2YIBD 3GODA 5LMUB 4CS7A 5H5NA 5KHHA 1Y74B 3TJTA 4EHPA 4F6RA 2Q69A 2DE0X 3NDBB 1HNZB 2TMVP 1VF5B 2O9XA 5KMGA 4JI2O 3IJ4A 4IIJA 1QLEC 3PMRA 2R02A 1PV0A 2GA0A 1SQGA 2ADPA 4E2LA 2L9JA 5D5QA 5FLXN 3GM3A 3SYNA 1W2WA 4MTFA 3S3WA 5ITZA 3R65A 2PTMA 4ANJA 1BE3H 2XLOA 3QMKA 4QPJA 2ICWG 1D2DA 5HSWA 4U9DA 2R7WA 2VCCA 1N0JA 1EBOA 2A7WA 5IYZB 2W4MA 3HTKC 1MNDA 3U9JA 3SNHA 2DYSC 4W8PA 3T9OA 4XLPF 5K1XA 3VAYA 3F46A 4O4HB 5IE9A 4X65B 1F4NA 1KP2A 2EIJC 2PFDA 4X89A 1OCCB 3S29A 2A0LA 2IJJA 3CWBH 3JASA 4DVYP 1VQ6V 1GN4A 4CIHA 2B5UA 4E0IA 3U10A 4PJJA 4LH7A 4GLXA 1AP6A 1ZL8B 3CJHB 1OQCA 4D6TH 2RCVA 3N2ZB 4DV1O 1DOWA 2HJFC 4D7TA 2ZINA 3CCQV 2WLNA 3CCVV 2A6EF 2LJ2A 4LF9B 1LVKA 3K7DA 4E18A 1HW7A 3JAMN 4G7OF 4O2BB 2XAHA 2H7OA 3K5MA 1B06A 4RUEA 3LSUA 2EZOA 4G7HF 4HNAB 4AQYO 4DUYO 3VQYA 5K1PA 1NKDA 5EK0A 4P30A 3R66A 4PK4A 1YVIA 2LQTA 4X20A 3FDQA 1HNWO 4JYYA 1YYXA 1VQ9V 2UUHA 4NB5A 3QTHA 3HLZA 4IJJA 2XNDG 1RSOB 2LFFA 1FJGB 1XOUA 4O7GA 1V74B 4U3JA 4U3JB 2NNUA 4I0XB 3B40A 2Y3GA 4CJGA 2IXPA 3NMKA 5B3IA 4JI5B 2Y3BA 4DR1O 4FLYA 5EBMC 4Z1VA 4G0HA 2WA3A 2R7XA 4F4LA 4P2ZA 2EPNA 2OQMA 1K73W 1WOLA 2KNHA 1ZX3A 3TCUA 4GEHA 1MMNA 1ZZPA 5KYUA 1H8HG 4DRIB 3V5XA 2WPDG 2OJED 1YA7O 1JR8A 1K33A 3JATB 3B0PA 3EQLF 3FB8C 3F7VC 5E79Z 2FFHA 4J7YA 3HKCA 3AGTA 4DR6B 2LP4A 4N23A 3CCRV 2ZKOA 3JSEO 3ZMVA 2F23A 3H01A 1PCXA 3IC9A 2UUBO 3A9CA 1M5IA 1F51A 4F4BA 5KYXA 3MYIA 1YZAA 3D36A 4TQDA 4JI0B 2CK3G 1P7BA 5GTHZ 1I5XA 3QW0A 1S76D 1R6NA 4DR4B 3G6EV 5IJ9A 1AP5A 1WN0A 4X88A 3CAXA 3T4DA 1H6GA 1IVSA 3ZHUA 2Q8VA 4JASA 1MNGA 3NR7A 2CNWD 2H7BA 2PI5A 2QSAA 1G1XB 3H1LH 2OIEA 2Q0AA 3OE7G 1QR8A 4MTGA 1Q81W 4L8JA 3RF3A 4H13B 4U9EA 4U7OA 2KKWA 3CP1A 4JI3B 3JRMO 4DBQA 1LUVA 1H38A 1IURA 5F2VO 1N33B 4CDVA 1SETA 3C18A 3D36C 4JKVA 2DQ3A 3VOUA 1R6KA 2UUCB 3CE2A 1XMQB 1WNSA 3BRCA 3Q4HB 2QNLA 3HB3B 4JI1B 4I44A 1H2KA 5E2QA 1Q82W 3BY6A 5B1OA 4CS2A 3BRJA 3O9OA 3RQFA 4UUJC 3H1IH 1IBLB 4O2AB 4XPYA 1BR2A 2ZXRA 1ZHZA 2ARHA 3NG1A 3AK3A 4DV7O 3K03A 5CN0A 4J42A 2Q4PA 2ZXWC 2A06H 1G5ZA 1WA8B 2R7RA 3ZRWA 2VQEO 3ASNB 5B3SC 1QR9A 1M6TA 3O55A 2P4VA 5JVEA 4JF3A 4QJFB 2QDOA 4F6EA 1YA9A 4UCRA 4YJ3B 3JSZA 1W0JG 2ZXPA 3HKBA 4I9QA 4JAUA 4NTBA 1SZXA 1YEWA 3BHPA 1W2BU 5E33A 4DXWA 2YLGA 4DR5O 4JW1A 1NZ6A 3H1KH 3C8GA 3CX5F 2CDQA 3K5LA 1K4CC 1SA0A 1SQPH 4O79A 1UPGA 1L1FA 2HMZA 4QNHB 5JLIA 3EGDA 2QUPA 2XRHA 3SZRA 3WU2Z 2YIBA 3RW0A 2GFHA 1TGOA 2WLIB 3AK1A 3TGUH 1OCZC 3P3NA 1MMGA 3RT3C 4NTFA 2WVOA 5K0IA 4N6CA 1LE4A 2GDCA 3C7JA 2ZE8A 4FIPC 4MVZA 2Y48A 3RWRD 3CYOA 3L74H 1XWJA 4B3SO 4ABMA 3W7UA 4UVCA 5TJ5E 3HNIA 4NTWA 3JCUQ 4I55A 3S0XA 3H65A 3TXQA 4LNUB 3VQWA 1ZVZA 2R7TA 4ASUG 3B0VC 4LF8B 1H2NA 4CS8A 4JV5O 3GORA 2PF4E 5H6RA 3CMAV 2BOCC 1NI8A 2ETSA 2E75B 1IBKO 3JD0A 3FD9A 3F5WC 4TT3G 2Q7RA 3GWNA 5IWAO 1H9GA 3K33A 4DV2O 2DJVA 3VF0A 5HV9A 4LFAB 1SQXH 3DXRA 1JMWA 3A0HZ 5JCOC 2LSEA 2UXNA 3IQTA 4CDAA 1LUWA 1FFTB 1EA8A 4BG0A 2IJKA 1OXBA 2KC3A 4DV1B 1N1CA 2YC0A 1G4US 1F7YA 4YJ2B 5AC4A 2JGDA 4X1KB 2XAGA 2YSUB 3SP1A 2W0FC 1J5EO 4LF6O 4A4AA 2KSFA 4GKJB 4PV1B 3DZAA 4CS8C 1AUEA 4EB6A 5JJJB 3TULA 4EB6B 4XEKA 1HWYA 1GGQA 4LF4O 4UCTA 4UB8Z 3U8VA 3W8HA 5EIBC 3W7TA 3N2KA 1SERA 2XXAA 1JPNA 4K0DA 5AGFA 2AZ2A 3ZS8C 4DV6B 1XZQA 2FMLA 2EIMC 2B0HA 3PJSK 3LNNA 5LMUO 2R7SA 4B7EA 1FFXB 1E2XA 2HJDA 2LGQA 1AVOB 1HP8A 4LBEC 4BR6A 1VQMV 1DGSA 4LF5B 2BC5A 2OKUA 3JSNA 4JTDB 1T5OA 2AW9A 4PFOA 3LEVA 1CGME 1BGYH 5IY5C 1Q86W 4WFAV 2QE7G 2JDIG 3N2GA 3J7AU 1NT2B 1Z23A 3N2GB 2UXCB 3OEHG 2LD6A 1BR1A 2DWEC 1MMAA 3S90A 2E3CA 4JPRA 3K1IC 4YJWA 2W0XA 2XT9A 2BOBC 4ZLCA 5A6AA 3APOA 2UXDB 5JVDB 4JRZA 1Z2GA 4R8CA 5F28E 4JI4B 4ZBMA 1KNYA 4U5HA 4CH6A 2PGGA 3STLC 3GWKC 1IX9A 4X65O 3ITFA 1XILA 4OX9B 2YHSA 2UUIA 1IBMB 1VQ7V 4JV5B 3I56V 1NU7D 2PX0A 1WPBA 4EEQA 3C90A 2WLHA 4JGSA 1BBHA 4FK5C 4JC7A 1R5ID 4WJ0A 1SKVA 1BQZA 1FXKB 4PDLA 4DK0A 1EN4A 5A9GA 2Q9LA 3CCSV 3CRCA 5A6BA 4LF9O 2CNWA 2ITDC 2NLJC 4UCUA 1MG1A 3AQCA 1VQKV 3SPIA 4LDRA 3UT5A 1WATA 3DE9A 5KX5A 3T1HB 4FM2A 1E86A 3N27A 4WBNA 2Q7HA 3KG2A 2A79B 1S3JA 3JALA 3WB2A 3CCUV 1FAFA 3FVYA 2P61A 5CBHA 5GPGB 3QZCA 1H2MA 1R3IC 1XNQB 4I50A 5EZYA 4MVUA 5EZYB 2E76B 1NVPD 1V55C 3E70C 1FJGO 4PA6A 4OIPF 1SQQH 2P0NA 3AOUA 2VS0A 4EBKA 4A5UB 3RBZA 5DM6V 4JI5O 1L0NH 1WN7A 1AEPA 1DF5A 2XTAA 2HKVA 5JRAA 4I4TB 1Q0DA 3FOPA 5JUAA 4BJ1A 4K1OA 1WTYA 2YIDA 2IJIA 2LW7A 4PA9A 1H2GA 3O10A 2JS3A 2VQFB 2OCHA 5BQGA 2XAQA 4IARA 1YCIA 2FGYA 1J8MF 3ZX6A 5J2TB 4CDYA 4DV7B 3BAAA 4DV4B 2IBZH 1VTMP 1RKCA 4XEVA 3E89A 4CSAC 1SRYA 4GT1A 1BSMA 3CEIA 3QF7A 3DKAA 3V5YA 1LE2A 4DR6O 1KP3A 4J80A 3GVMA 4CBCA 5L3CA 1LNQA 1TFOB 3N0TA 2NUTB 1QCEA 2Q67A 2YL1A 4BJTA 1OJHA 3NYMA 1M2VA 5JT4A 4JI0O 1AJQA 3G6BA 4FFBA 2YEVA 4NTYA 1ST6A 4DR4O 1XMOB 3QTCA 1C02A 2JGUA 1SQBH 1VB5A 2YL0A 2RDCA 3GANA 3R2PA 1QKRA 2JEXA 2F4VO 1H9TA 5DLJA 3JRTA 1PM9A 5LA6B 2MHRA 1A7VA 5B5EZ 4ULWA 4UV9A 1G4WR 4O6YA 1N34O 3OEEG 1K5QA 2MK3A 3H9VA 5KYWB 1YTFB 1K04A 4CH4A 1R73A 4YY3B 1D0XA 3IFXA 4NXNB 1W59A 2IH3C 2K1EA 3AEIA 2A9HA 4GX5A 4J9ZB 2HJ3A 4JI3O 2XL4A 4TUYB 1N33O 4O4LA 4O4LB 4R6ZA 2UUCO 3AG3B 1JOYA 2V4DA 5FNVB 1FTSA 2LFDA 1XMQO 4GQHA 2QEXV 3IAYA 4TWKA 4P9OA 5LGUA 3F47A 1VMAA 3RQGA 4JI1O 1MNEA 1BL8A 4E7ZA 2WLLA 2OYQA 1VYIA 2J9VA 1OW7A 1Q90D 4FLUA 2EINB 1AJNA 5IWAB 2KG7A 1IBLO 3NMJA 4HZ3A 2NR5A 3UGPA 1T01A 1DF4A 1IXMA 1GK9A 3L8IA 3RYIB 3KYIA 1P49A 4H0LB 3GB7C 2HUJA 2QWRB 1N8RW 4PJLA 1PNKA 3K5NA 4B6IA 2BSKA 1LM3B 4QI0A 2V3CC 2BCCH 1S05A 4U5BE 3L70H 1RP3B 3FAVA 1PP9H 5COGA 1GM7A 1VQOV 3RYFA 1TVKB 1WJZA 4DUZB 1QLEB 3JYHA 2PNOA 3EH2A 4TV8B 1P4RA 3NRHA 3B29A 2A69F 1M90W 5EBLC 2BTOA 1YSCA 4G27B 2OU6A 3CSXA 2GAQA 2IJHA 4IYHA 2J9UA 1G8XA 1IXBA 3LAYA 3EZIA 2GUZB 3US6A 3LUTB 3UKMA 3BA9A 5LBQA 2WVNA 1OV9A 1JPJA 3WG7C 4DW1A 4PI2A 2AZ0A 3DSQA 1D1AA 2Q73A 4HEAJ 4XTKA 2Q9CA 2ZIMA 2EIJB 3GM1A 2NG1A 1JFFA 1YIJV 1JRAA 3NKEA 3PHF2 3SJBC 3ATPA 3BEHA 3G71V 1VLSA 4F6RB 2H8AA 3AG4C 2P4KA 1LKXA 4UB6Z 3O65A 5CA0A 4KXRA 5KMGB 3ABMC 1AROP 3VYWA 4AE4A 4IIJB 3UMIA 4AE4B 1KQSU 1QQ3A 1YHQV 3LEOA 2Z0AA 5ITZB 3E8GA 2G3KA 2YWAA 3A0BZ 1EM1A 2M7WA 1HR0B 3CZ6A 2B9ZA 4DRXA 3K9AA 4LF8O 3OUSA 2AGAA 2UXXA 5B66Z 3RGBA 4HBNA 1MZFA 1MMMA 4PA7A 3ZMUA 1OCRB 1I5YA 1ZUQA 5GW7A 2YI8A 3E83A 5LGNA 3NYJA 5AC5A 5A69A 3GWLA 1FMVA 1K5SA 4OD4A 1KC8W 3THOA 4LFAO 1J8YF 1F1MA 1SYQA 3T1YB 3E22A 3JASB 2FKXA 2G3VA 2W45A 1XI1A 2ZDIA 3U3FA 4XDLA 5DS6A 3CCJV 1ORYA 4IYIA 3RYLA 4WABA 1GN3A 3AG2B 2AP3A 2A0BA 1VEWA 3RYCA 1Q8IA 3SDLA 3KCXA 5KYYA 3O6XA 5KYYB 3JSLA 4ZLDA 2OG2A 4LH6A 1BDJB 4IWBA 3EXAA 2Q00A 1WP8A 4JI6B 3EZHA 5BY1A 4FAPB 1S0VA 4GKJO 2XLEA 3E35A 2LIGA 4G7ZF 4TQFA 1Z63A 1OCRC 3E8BA 2P22C 2HMQA 1CPYA 4PDVA 2Z15A 1BS3A 3DJNB 5COFA 4WFEA 1Y4MA 5EHHA 2CCYA 4X20B 2ODMA 4BWAA 3CS5A 3KZIZ 3T1CA 4ZKIA 4DV6O 1WASA 1NR1A 1SR2A 1JX9A 3X2QB 2WAMA 3WHNA 3G4ZA 4K8XA 2ZDIC 4UFZA 4CC5A 1ORJA 3AG2C 3M4CA 5DEDA 1I94O 4LF5O 3ZHVA 2QR4A 1NU1H 2WLMA 1K34A 4GX0A 4OIRF 3RQEA 1XHXA 1YJ9V 1GQAA 2VRZA 2CE4A 2UXCO 1SQVH 2MW2B 2KK1A 2YZSA 5KYUB 4RD9A 2P67A 3ZRXA 5BR8O 2UXDO 2OJQA 4U5DE 1PD3A 2Q7GA 4JI4O 1YDIA 3HKDA 2Q0OC 3RFYA 5L3DA 3B77A 4MT8A 1ORQC 3X2QC 3HKCB 2JS5A 1QQCA 4DV0B 4OX9O 4LCUC 4WGYA 5CA3A 2RMKB 4Z9JA 2HVKC 1IBMO 4Q4ZF 2E5LB 1C17M 4HFKB 2JEUA 2JJ2G 5JQGA 4ZI7A 1CP9A 3UGOA 3C3SA 1VK5A 2FL4A 3Q7LA 4W4LA 5LL6Y 4NC3A 4X62B 5KYXB 4UV8A 1CEZA 2F43G 3LSSA 4YL1A 4BIOA 2QM7A 1TWHA 4P9PA 2IYLD 2OIGA 2EPOA 4U5FE 1M9NA 5IJ9B 2PP4A 1M56B 3GWOA 2F4VB 3T1HO 3U0CA 1ZHTA 3ZTMA 4HAMA 3I4UA 4X1YA 1JJ2U 4LDKA 1IZ3A 2RD9A 3DC6A 3I55V 1N34B 1GAXA 1YARO 2XSEA 2ZXWB 1XNQO 2KQXA 3RN4A 2KSDA 3VM6A 4L87A 2KW3C 2V7QG 3O39A 4EWCA 4FJCC 1EQ1A 5KUKA 4U3FH 2QKCA 5B3SB 2PX3A 1KECA 5JH7A 1R3JC 5LMNB 4CIPA 1HDJA 4YHHB 2XS1A 1NTKH 1NZEA 4OXSA 3UQ8A 2XLWA 4LFCB 5BXZA 2IM8A 1M56C 1Y76A 4OINF 3B71A 2YRFA 3FOOA 2F93B 3JD1A 2VQFO 1KKDA 2K9PA 5KYNA 1EN5A 2LFRA 5LHGA 2QM8A 4OPAA 1D0YA 3HNKA 1O5HA 2HP8A 3T4RA 1Q5OA 3RVZA 2ZT9B 3AJMA 3VQVA 4RQFA 3S27A 1OCZB 4DOZA 3S9OA 4DV4O 1V54B 1ZU5A 4BJ6A 4PDRA 4NR1A 5CBFA 1Q6IA 3ZRWB 2DN9A 3ZHTA 2CTQA 3DM9B 1L3PA 5COMA 3HKBB 5L3FA 1KBHA 3M8AA 5TISZ 3B9QA 2HFIA 5L3GA 3K66A 4DRJB 1KMIZ 3UM7A 3ABUA 3C8GB 1LS4A 2ZR2A 1LI7A 1SA0B 1T5EA 1VQ5V 3GM2A 2ILMA 1XMOO 3RKOF 5BZBA 1XL4A 3DXJF 3EGDB 3U8PA 3TETA 5LXTA 1LS1A 4JURI 5FPRA 2JVDA 1RPRA 4QDLA 1WWPA 4CX9A 2Y0PA 2MYSA 1HMDA 1V54C 1PPJH 2EILB 1ZU4A 4BJ6C 1LPEA 3OMNB 4JYCA 4E4EA 4LERA 3NYLA 3L72H 1HNXB 3TJ6A 4YY3O 1EZJA 2RJZA 4FX5A 4NXNO 4B08A 4DV5B 1UFBA 3CXCU 1APCA 2OEXA 4U5CE 3T6BA 4NTXA 4EUKB 2HS5A 4IT5A 3L73H 3M7MX 3OMIB 1TUBA 2G62A 3W4YA 2P6JA 3W8IA 3FFQA 3KCYA 4X66B 3BCCH 1Q7YW 1JJOA 4I55B 4KNVA 2QKSA 2GHYA 3G80A 2PBEA 2L6LA 1FR0A 1L8DA 2AHZA 3ZG1A 2D5RB 3G67A 1K4DC 5B1BC 3IQ6A 4PA3A 1J95A 2QLAA 3HJCA 3CC2V 1AI7A 4NKGB 3FAPB 1P7GA 1I7FA 4AILC 2ZNJA 3T2MA 1I5NA 2M64A 2EILC 1VQNV 5CA1A 5CA1B 1GN6A 2JK5C 3OR7C 3F7YC 3FB6C 4W4KA 2R9IA 4ZOLA 3DXRB 1JAFA 1UG7A 2NPUA 3W7XA 2PYLA 2EIMB 5FZTA 4DK1A 4O4JA 1O3UA 2L6GA 4FM0A 1SZTA 2GV9A 5KUMA 2ADQB 3SXZA 3DM5A 3T4ZA 1NG1A 1R1BA 1N32B 2JGDB 4CH3A 4DUZO 3CSKA 1HY5A 1WPXA 2EX3A 1O87A 5IY5B 1RXQA 4CJOA 1A32A 2X7RB 3BABA 4WFFA 3SR2C 1M2OA 4X9QA 4IHJA 4Q7CA 3ZIAG 5AG2A 4IHJB 2VCBA 3ZMTA 3K79A 3J80N 2J8WA 3HKEA 4BEMJ 5CI9A 3EFOA 4IB4A 3AQBA 3JZ0A 4MTXA 2WVQA 5IJ0A 4JI8B 3L71H 4Q6GA 3H1JH 4JYAB 3N2KB 2XXAB 4GX2A 1V9PA 4MW3A 3GEIA 2QWNB 3IC7A 4AHCA 1BHAA 4CS9A 4WFHA 1WGWA 4O4IA 1G6UA 4L6RA 3K5OA 4XEFA 3K1HA 1PKXA 2Q4FA 1D5NA 4P9TA 1WB7A 5A2QN 1I94B 3KPHA 5JP7A 1X4TA 3RVYA 5KAFZ 3E2EA 1SZIA 1NS1A 2H94A 4J10A 2CTPA 3FB7C 1RCPA 4LWSA 3E9VA 3ABTA 3CQZA 3CB2A 1BZKA 2ZIOA 3EGXA 3AG1B 2ZE7A 1TUEB 4DYLA 1HR0O 1Z3IX 3ZHQA 3CRAA 2FTKA 2RN9A 5BR8B 5L3VA 1GS9A 4XPXA 4CBEA 4MVRA 2IXNA 1MSDA 1Q43A 2KB1A 2UU9B 4K0KB 3EG9A 5HFLA 2KJGA 4B3TB 1EN6A 3LLIA 3OW2U 4YIOA 2WSSG 3T1YO 4LF7B 2CW0F 5LYJA 1Z5WA 5LYJB 4DR3B 3UO2A 1S77D 1RM1B 1V55B 1SS3A 4Q5SF 4NQFA 1E1QG 2F95B 5BMVA 3S3XA 3GEHA 5JSLA 3Q6MA 1BT8A 2QE9A 5IYCO 4PACA 3MBGA 4YWQA 3B09A 4QE7A 3TOMA 1EKYA 3IQ5A 4ICGA 2J46A 4QE9A 3AG1C 4RQEA 4JI6O 2EBOA 5FCLA 3UT5B 2Q5ZA 2Q9BA 1T6IA 3U0ZA 5KX5B 3K08A 1VOMA 5F5FA 3HPLC 2JRIA 4ZHQA 2XM4A 4LLCA 3ETQA 4FVMA 2CH7A 2PZSA 4J32B 4WBNB 3JALB 3MAQA 4EBBA 1CPRA 3NMIA 5J2UA 3W2VA 2ZM6O 3D3IA 1ZW2A 4EBJA 5EYPA 5KHJA 4FFKA 3I5DA 5EYPB 2NUPA 4K8ZA 3LJBA 3U9MA 1T9KA 2DWDC 1RM1C 3OR6C 4I50B 3FAJA 3AGUA 2ATKC 1B68A 2AU5A 4IL6Z 4MQ9F 1Y6DA 3U3BA 4DV3O 4I1MA 4PDMA 4Z9HA 2N74A 1QSPA 2L7AA 2ITCC 3QVZA 1TQGA 1QLNA 2CGNA 1P84F 2RQ6A 3DTUB 1AR4A 1TWGA 1BCCH 3OAAG 3RYHA 2QTVA 4C7UA 4HE8D 3ZJZA 1BQ0A 5KA6A 1VQ4V 4U5EE 3QVNA 5GONA 5EC2C 3SYOA 4Z2WA 1DLBA 3CC4V 1NBMG 4LDQA 2Q7EA 1KU2A 3KH2A 3FX7A 1NJIW 4DW0A 4GKKB 4GUNA 3V7OA 1ZTEA 2IU3A 4DV0O 4YT2A 3QO8A 2E5LO 3R7CA 4IAOA 2HJMA 5BQIA 3L8JA 2WB7A 1A0BA 1NR7A 1UJWB 5H6QA 5EBWC 5A6JA 3ZN0A 1N4CA 4X62O 2P90A 1K40A 2BTQA 4I9WA 1VQPV 1M2VB 3ETGA 2A6HF 3IGAC 4I3MA 3TOLA 4FFBB 1OXKA 4LLEA 2YEVB 4JE9A 1OKKD 4KC9A 1YJWV 4B3RB 2Y3DA 4CS3A 3LDCA 3P30A 4N6HA 1PL0A 2OEVA 4FLWA 4GYCB 3U5SA 1B6QA 5CB4A 2R05A 2R7OA 3WFVA 3T6JA 1Y6XA 4MS2A 4BIUA 3DI5A 3JD3A 1ZHXA 3HNLA 1KUQA 1K8AW 3C62A 1FFHA 1MSWD 3C8ZA 3EFFK 2Y4TA 2A0UA 2EPMX 4PJMA 4YK5A 4K3AA 2I15A 1HMOA 2R03A 3JARA 3LS1A 3FYEB 2HVJC 2HLDG 3SJAC 5LOVA 2B0JA 3JYYA 4E17A 4JZAA 5LMNO 1NFNA 3APQA 2PI4A 4YT8A 3MFNA 4NY3A 4YHHO 4C3EA 1JPXA 5LGTA 2ZNIA 3OWTA 4D4XA 5EC1C 1L7CA 1DK1A 1U96A 5D91A 4LP8A 4LFCO 1GH6A 4MSWC 1H7IA 1EZVH 4O6NA 1I0HA 4QGPA 5GTIZ 1WP7A 3EVKA 3L9DA 3JAWA 3JT1A 2GTAA 4DO2A 2AWCA 3ABKC 2WLLB 2YKZA 2WL8A 3IQCA 2XAJA 1ZHWA 1Q6UA 1JCHA 3ZBHA 1MZEA 3WG7B 1FAPB 2HSBA 2KG7B 5DN6G 2LCHA 4YL3A 3ABLB 2EJ7A 3SJQC 1VMGA 1WLEA 4IGGA 2XLMA 5DS5A 4X1IA 3BVOA 1YF2A 1PNLA 1O9HA 1PL4A 5CBGA 2KYHA 2BSKB 1A41A 5T3WA 3AG4B 3KYJA 2J9BA 4MVMA 3FAVB 1TR2A 3DGEA 1KTMA 1VF6A 2ZE6A 1AR1B 1AJPA 3ABMB 3RYFB 5IYBO 3POVA 1RJ9A 3EHBB 2VB6A 4RDAA 3ZCCA 1O9GA 3OT7A 4X0RA 3L75H 2WZGA 4N21A 3W7SA 3C3TA 1Y66A 2VWJA 4UCVA 4GCZA 1HE1A 3ZN1A 1AI5A 4E7SA 3QW1A 1FMWA 2XHBA 1PD0A 3J81N 3ABLC 3X1OA 1NFOA 3OGCC 3ZRVA 5KHKA 3G4SV 1T6UA 4NXMB 2R7VA 2XOKG 1DTOA 3SXYA 1H2LA 1K3EA 1HNXO 2MWQA 3MHHC 1JFFB 1QBZA 5F5HA 5JWPA 4DV5O 1OW6A 2CDYA 1XNRB 1IW7F 1LI5A 1ZSPA 4AI8A 1A7DA 2W6IG 3M99B 4DR2B 2XS8A 5CA0B 1CGOA 1VF6C 1K97A 5KAIZ 1ZLZA 4X66O 3NKDA 4ER9A 1M1KW 2NN4A 4JAVA 5JJEB 3OGIB 3C63A 4PA4A 1U0BB 4C7OA 4PR9A 3CD6V 3LNMB 1GKFA 4O6MA 2Y4UA 1BHBA 1M57C 4DRXB 5DECA 1Y74A 2J45A 4M63A 1YYJA 1VIBA 2H8PC 3LSQA 2JJ1G 4BPMA 1FD9A 2LK4A 3FXHA 1UFIA 3ZEDA 4KHPB 2N05A 2Y69C 3M1CB 3BPZA 3W7WA 1VQLV 2GSMB 5JJNB 5KA5A 2LP7A 3MDSA 4J7KA 1D5AA 4JZ2A 1QHTA 2GWWA 1XREA 3ETEA 1NSGB 5DQZA 2P5OA 2DI3A 4FMTA 4U5GA 2KGOA 1D1CA 4H33A 3E22B 1NLXA 2P7TC 2DYRC 1YAUO 4UXNA 5L3EA 3HNJA 4JEBA 2HZ8A 3A0RA 4PI0A 4JCHA 3ZMSA 5IYZA 4GZRB 2W6JG 2EPKX 1JA8A 1AILA 1NU9C 1YJNV 4UCOA 1L0LH 3VBBA 3RYCB 1N32O 4I5SA 1X59A 1G4YB 3ASOB 3E86A 2XM0A 3U11A 4O4HA 1QVXA 3EH1A 4K7BA 1F4MA 2QJ1A 1KKCA 1SESA 4MW8A 4LFBB 4N4WA 4AK9A 5LP6A 3SJCC 3ZHSA 3SPGA 3OMAB 5LP6B 4J30B 2X0LA 1NVPB 2AWYA 5EIBD 1ZL8A 3CJHA 1Q3EA 1KYOF 1WB8A 4H44B 4JI8O 5FPOA 3K9SA 4JYAO 2L81A 4OIQF 2EJRA 5L0HA 2ZM6B 2R7QA 2YLIA 1M93A 1VARA 1EFRG 1YLMA 5L0DA 2Q3TA 2PYJA 1XDCA 4O2BA 2CGOA 3CC7V 2IM9A 1S5JA 1EI7A 2XLHA 4G78A 4DV3B 1Y67A 2LO1A 4HNAA 4G28B 2DQ0A 3ETDA 2M4EA 1SF8A 3CCLV 3SYAA 2UXBB 3ASOC 2W4BA 3UMHA 2R25A 4J7ZA 5J9PC 3MHSC 1OCCC 2WWWA 3JAKA 3JAKB 4JZGA 3FYIB 2EIKB 4HYOA 1RSOA 1CPQA 2HSQA 5LP6C 3TQOA 2A1DD 1ZAUA 2WZLA 1CXZB 3DWWA 2EULA 4BW5A 4FM1A 5KLVH 4I0XA 3SYPA 2I8BA 4J41A 2V1DA 2Q6AA 3HKDB 1KD1W 1A7EA 2UU9O 3E8HA 1GRJA 1FYJA 1JOGA 5C93A 4K0KO 3WODF 1RFYA 4B3TO 4UCSA 1H2SB 1K9MW 4LF7O 3OM3B 2YDEA 4DR3O 2EPLX 3L1MA 4B3MO 5JQGB 4ZI7B 1U97A 1OKKA 4Z9IA 5E1AC 3B4SA 5L0JA 2FB5A 2X0CA 1MQVA 3JATA 2CTRA 1S5HC 1K7DA 4OPHA 3SYQA 3FKSG 2GDSA 2F22A 2EIKC 5LHHA 2KQ9A 2QTOA 1MOFA 3U2LA 3P3PA 4BW9A 4YL0A 4UDVA 3K3WA 1RPOA 2HV7A 4FESA 4X1YB 4AX2A 1BR4A 3BFRA 2YXYA 2YL3A 1HW2A 2D3OW 4XLNF 4RBNA 4PELA 3SYCA 4DJ9A 2R9AA 4PD4F 4AL0A 1GN2A 3JCUZ 3H1HH 1TAEA 3CEXA 1N36B 3WAQA 3JCZA 5KHIA 3L34A 3V5ZA 1ENVA 1RMVA 1NH2B 2J9WA 3KL4A 5BUOA 5JH7B 2IW5A 4MTOA 2H7VC 3EHNA 3FMSA 5A6BD 1YDXA 3KKBA 2Q68A 2M6YA 2CGEA 1VYKA 1TA8A 4FZ0A 1E79G 5E3CA 2D4UA 3MLGA 4RAIA 3K04A 3ZC4A 1Y76B 2LW1A 2XL8A 3OD4A 2WA4A 1I4YA 2UUAB 3ZHRA 2N04A 4U7NA 1VQ8V 2QWOB 4D4NA 2D2CB 2QTSA 4FLZA 3JD4A 4JJGA 3QNEA 3AG7A 4GKKO 4NYKA 1TKNA 2Z3YA 3A8TA 2QY9A 3ZWIA 2WLKA 4YIPA 3K59A 4JI7B 1XUQA 3Q4HA 3MYFA 3CMEV 3CHXA 4X64B 1C03A 1V4AA 5L3BA 1R4TA 2B1GA 3ZMZA 3LESA 2GTSA 4P9FA 3U2MA 1NBBA 5LHIA 2YVKA 3B8MA 3TK1A 1S72V 1Q0GA 1U6HA 4O2AA 3ZTZA 3CXHF 4NVPA 3LDEA 1COWG 3J06A 5FL7G 2J0XA 2W9YA 3OTOB 1WA8A 4MVSA 2RNBA 1T6QA 1XHZA 4B3RO 3EJNA 1OR2A 5B1BB 1YJGA 2DB4A 3Q7GA 4PJNA 1JQ0A 4WGZA 4J9YB 3CRQA 2DGJA 1URFA 5B1AB 4YJ3A 4R7CA 5LXTB 5IYDO 4KUMA 2XLDA 2ZPAA 1B3QA 1KB9F 3M4BA 3SXMA 2R72A 1OR3A 1AVMA 2OOCA 3OEOA 4Z1MG 4DR7B 3QO7A 4XPWA 2CTWA 2B1IA 1R3LC 1VLTA 2JPUA 1ROPA 1AI4A 4KFMA 3WB1A 2QKAA 3UO3A 2HHHB 4QIWF 4JCZA 3CRMA 4GYTA 1NTMH 3I5PA 4KBLA 3E8FA 2GBOA 1TUBB 2WLIA 3DAGA 4OGQB 1TFKB 4WF9V 3SGIA 2QM4A 2C04A 1Z7Qc 4JTAB 1GMGA 2LGWA 4J7JA 4XDKA 1U89A 1AR5A 1OCOB 3ASNC 4QPKA 4EFEA 3GEEA 4OIOF 4K35A 4TOIA 1Y4CA 2ZE5A 5B1AC 5JCOA 3ML0A 1K92A 3CPWU 1ZW3A 4JTCB 4XWJA 1BZ4A 1AI6A 4I7ZB 3OFNG 2YUAA 4JI2B 3K0GA 1ORSC 3MX3A 4CS4A 1US6A 4XBFA 1YTFD 4YXWG 2P6VA 2JD3A 2J7PD 3K6BA 3JTLO 4BJ5A 4LNUA 2VH3A 4ZOLB 3HR0A 1IZMA 4JAAA 4TV9A 1TWCA 1YZCA 4TV9B 3M79A 2O57A 4O4JB 1GM9A 1VP7A 4R32A 4OD5A 1OHHG 3B8NA 5IT9N 3A2FA 4C3DA 5CI8A 1XEQA 4JYBA 2XLVA 2HV6A 4PFPA 1ZYRF 3FB5C 4IAQA 2X6BA 3MD0A 4LR3A 1OCOC 3PDMP 256BA 3D3QA 3L0IA 3M15A 3IEEA 3B2EE 3HKEB 1N0NA 3EFOB 2VASA 5IJ0B 2OTJV 2A68F 2E87A 2P1AA 2ZXOA 1SC5B 2ASRA 1F23A 4RUFA 1FXVA 4YJ2A 2YLDA 1R6TA 2AXTZ 3JD2A 4X1KA 3CCMV 1Q0MA 1Q0KA 4DBRA 4JIOA 1GTOA 4BJ5C 5A6KA 3TXSA 1XZPA 4NXMO 3K0DA 4O4IB 3FHDA 5T1DB 4N06A 5D5PA 2HKOA 3K1IA 1XNRO 1E85A 1LR1A 2Q9AA 4AQYB 3ZRSA 4DUYB 1GM8A 3UNGC 1JVMA 4DR2O 3SXKA 4C3BA 1CGNA 3RH3A 5L0FA 3ECSA 1MA1A 4LWSB 1HNWB 1NTZH 1XBLA 2FYUH 4FWVA 3BA8A 1MABG 3W2WA 3LLKA 1HW1A 3EGXB 3PCVA 2XASA 4MVQA 5DVWA 3RIPA 1FFTC 1FFXA 4BEJA 3F5TA 3I5QA 5T3TA 1HNZO 2YL7A 4KHPO 3S84A 2JIZG 1XQ8A 2L6FA 4DR1B 3OTFA 4GX1A 1QVGU 5CIVA 1H8EG 4CS9C 3TD7A 2X6CA 1GM5A 1S7ZA 3EG9B 2X51A 4UVBA 4AL1A 4B3MB 2ZD9A 1QU7A 3PN1A 2L6HA 2NSGA 5BMVB 5JVDA 1KU9A 1SQFA 1OW8A 1B04A 1PNMA 3DD7A 1IDSA 1FKAO 2ETNA 4FLTA 4X8AA 2QWPB 4WFBV 5KHGA 1TWAA 2CYDA 3JYCA 5B1NA 2LFSA 1PD1A 4LFBO 4ULVA 2DMXA 1THZA 4CH5A 2G38A 3EHMA 4ZHQB 2F66C 2PUSA 4UVAA 2CH7B 2UUBB 1FXKA 4DRHB 2HG5C 2AHYA 2IXMA 5J2UB 5H2FZ 2PY5A 3K06A 2NUPB 3G4XA 4B7KA 4HFFB 1YXBA 2HEPA 4FPPA 3TK0A 2YXLA 4RO2A 2XAFA 3SEOA 3TJ5A 1S5LZ 3EPVA 4G2KA 2IOQA 2OCCB 2L35A 5E3AA 4YT4A 2UXBO 3DC5A 4H4KC 3CRRA 2IXOA 3HKKA 2YS8A 3SPJA 1FNTc 1Q6HA 2OT5A 3ZQYA 3RYHB 2DOSA 4W8KA 2LQGA 2BE5F 1I08A 4CSAA 2P7VA 1RKEA 5GONB 1RKEB 4I1OB 1E84A 3G50A 1YI2V 1FXKC 2R70A 4PJ0Z 3WB0A 3ZQVA 1W0KG 2H3OA 2NSFA 4I4TA 4FLVA 4EIYA 5D92A 3D8CA 2BE3A 2WZFA 1QVFU 1DOVA 2R7UA 2YI9A 2YIAA 4R50A 4XQ1A 2WLJA 4NTAA 2OCCC 1YVWA 2Z5UA 4LACB 4J11A 4CC6A 3SPCA 3S28A 2R9RB 1SMYF 4H37A 1BMFG 2BTQB 5J2TA 3VRCA 3KMIA 1ZWIC 3P32A 3K57A 3NXSA 2F1MA 1Z5VA 2V26A 3LNRA 2Y0IA 2IH1C 4JEAA 1Z6AA 4FLXA 2C03A 5L0GA 2VQEB 4D7SA 1FS0G 4MVOA 3Q6NA 3H2UA 3IPMO 1QNMA 5JS5A 3ABKB 1JR9A 2IBFA 4CZZA 1E83A 3RFRA 1Q0FA 2CUGA 5CB4B 1NQTA 2JX0A 2ZCEA 1YITV 2NUTA 3UR3C 2OWOA 5C8YA 5C8YB 3DMDA 4DR5B 4EFBA 1XL6A 3T6GB 4XDJA 4TSFG 3CCEV 4JJFA 1M4UA 3ICXA 3STZC 3JARB 5EGYA 1GO3F 1N36O 3QG5A 1FXHA 5LOVB 4KP4A 4P6IC 5DS4A 5L0CA 1MMDA 5LA6A 4QI2A 2XL6A 1R3KC 2RSEB 3QVYA 3VQXA 1LIHA 1JMKC 5H9CA 5L0IA 1YZBA 5KYWA 5CMUA 5DQTA 2VC9A 1SF9A 2J7PA 4Q20A 2Y39A 3JAWB 3QO5A 3LS0A 4YN0B 2UUAO 4WCEV 4H54A 2VWKA 2OTLV 3B0UX 4TUYA 4B3SB 4ONSA 4E0HA 5FNVA 4KI2A 4A2NB 3ZVRA 4BAYA 4ZIBA 3UCSC 1AB3A 2QA4V 2CAZC 4X1IB 4JI7O 1I4ZA 4DVZA 4KNWA 2QWQB 3OUFA 1NH2D 2QGNA 3SPHA 4X64O 2AVKA 1VF7A
chains in the Genus database with same CATH topology
1V54C 1ZU4A 1FPOA 4BJ6C 4LERA 3NYLA 2A1DD 2WZLA 2CNWA 4FX5A 1D0ZA 4U5CE 2Y3HA 2I8BA 3T6BA 3AQCA 4IT5A 1RJ9B 2G62A 3DJUB 3W8IA 3WODF 3ZSUA 2J0WA 4KNVA 4RWUA 4IRUA 3DAFA 1FAFA 3FVYA 2L6LA 3AG3C 3QZCA 1OKKA 3ZG1A 2D5RB 5B1BC 1QZXA 4MNDA 4YT5A 3HJCA 5L3QA 1V55C 3E70C 2CTRA 4OIPF 3OA1A 1D1BA 1Z5ZA 2EIKC 2EILC 2KQ9A 4JVSA 2GUZA 2EINC 4BJ1A 3UMKA 1ZHYA 2HV7A 4FESA 3N24A 3ZIBA 4AX2A 1BR4A 4C7OB 3DM5A 4RBNA 4XLNF 1NG1A 3GODA 4CS7A 2OCHA 3CSKA 1O87A 3NDBB 2FGYA 1J8MF 1M2OA 2O9XA 3L34A 4Q7CA 2J9WA 3KL4A 5BUOA 1QLEC 2H7VC 3PMRA 3EHNA 5CI9A 3EFOA 4CSAC 2L9JA 3AQBA 2WVQA 3SYNA 1W2WA 3KKBA 2M6YA 4ANJA 4J80A 2CGEA 2XXAB 3QMKA 1VYKA 2R7WA 5HSWA 5E3CA 2QWNB 3MLGA 4CS9A 3N0TA 3ZC4A 2NUTB 4BJTA 1WGWA 2W4MA 3HTKC 1MNDA 3NYMA 3SNHA 1M2VA 3K1HA 2N04A 2DYSC 4XLPF 2QWOB 2YEVA 3VAYA 1ST6A 3F46A 4JJGA 2EIJC 2PFDA 3GANA 3AG7A 3S29A 1TKNA 1SZIA 2QY9A 2CTPA 4DVYP 5DLJA 3JRTA 4CIHA 3E9VA 4PJJA 3CQZA 3EGXA 3N2ZB 4ULWA 4O6YA 3LESA 1Z3IX 5KYWB 2A6EF 1LVKA 5L3VA 1D0XA 3K7DA 4CBEA 4G7OF 2IXNA 2J0XA 2H7OA 2XL4A 2W9YA 4G7HF 3EG9A 2KJGA 3LLIA 1FTSA 2CW0F 3EJNA 4PJNA 3Q7GA 4PK4A 3UO2A 2DGJA 2ZPAA 3FDQA 4Q5SF 3F47A 1VMAA 1MNEA 4IJJA 3HLZA 3OEOA 4E7ZA 3Q6MA 1VYIA 2J9VA 2CTWA 4YWQA 4O7GA 2J46A 3AG1C 3UGPA 3UO3A 2Y3GA 2IXPA 2Y3BA 4GYTA 5FCLA 2Q9BA 3I5PA 4KBLA 3DAGA 1VOMA 5F5FA 4LLCA 4G0HA 2R7XA 4J32B 2C04A 2QWRB 2KNHA 4PJLA 2LGWA 4B6IA 4GEHA 4QI0A 4EBBA 2V3CC 1MMNA 3W2VA 4U5BE 5KYUA 3ASNC 2NUPA 4OIOF 3LJBA 1WJZA 5B1AC 3JYHA 3FAJA 3EH2A 3B0PA 3NRHA 4XWJA 2A69F 3EQLF 4MQ9F 2YUAA 3MX3A 2FFHA 2J9UA 1G8XA 4I1MA 3LAYA 3EZIA 2P6VA 2GUZB 2JD3A 2J7PD 3K6BA 4BJ5A 2WVNA 1JPJA 2VH3A 3WG7C 1IZMA 1TWCA 1D1AA 1PCXA 4HEAJ 1TWGA 2QTVA 4OD5A 4F4BA 5KYXA 4HE8D 4XTKA 1BQ0A 2Q9CA 4U5EE 4C3DA 5CI8A 2NG1A 3NKEA 2HV6A 4PFPA 1ZYRF 3PHF2 3AG4C 1KU2A 1LKXA 3KH2A 1OCOC 3ABMC 3V7OA 3VYWA 4AE4A 3UMIA 3L0IA 4AE4B 3IEEA 3EFOB 2CNWD 4YT2A 2H7BA 2VASA 2G3KA 2A68F 2QSAA 2E87A 4IAOA 2ZXOA 2WB7A 3CZ6A 4DBRA 4BJ5C 1N4CA 1M2VB 2A6HF 3FHDA 5T1DB 4I3MA 4N06A 4DBQA 4LLEA 1IURA 3NYJA 1FMVA 2Q9AA 4OD4A 1OKKD 1J8YF 4KC9A 2Y3DA 3UNGC 4C3BA 3RH3A 3ECSA 2G3VA 2W45A 1XBLA 2R7OA 3T6JA 4FWVA 5DS6A 3RYLA 4I44A 1ZHXA 3LLKA 3W2WA 3EGXB 5E2QA 5DVWA 3RIPA 1FFTC 4BEJA 1FFHA 5KYYA 2Y4TA 3O6XA 5KYYB 4PJMA 3I5QA 4ZLDA 2OG2A 5T3TA 1BR2A 2ZXRA 4IWBA 1ZHZA 3LS1A 3EZHA 3NG1A 2B0JA 2ZXWC 4JZAA 4CS9C 3TD7A 3APQA 4YT8A 2R7RA 1S7ZA 3EG9B 4G7ZF 1OCRC 1Z63A 4NY3A 2X51A 2Z15A 3DJNB 4C3EA 3OWTA 5B3SC 5D91A 3JSZA 5EHHA 1GH6A 2ZXPA 4O6NA 3JT1A 5E33A 3ABKC 2WL8A 4JW1A 3DD7A 1NZ6A 1ZHWA 2QWPB 2CDQA 1TWAA 3AG2C 4O79A 3EGDA 2EJ7A 2XRHA 3SZRA 1PD1A 2GFHA 5DS5A 2DMXA 3BVOA 4OIRF 3EHMA 1OCZC 1MMGA 2YZSA 2WVOA 5T3WA 2IXMA 5KYUB 4RD9A 1TR2A 2NUPB 4U5DE 4HFFB 3POVA 1RJ9A 3RFYA 3SEOA 2VB6A 4RDAA 4X0RA 3EPVA 3X2QC 2WZGA 2IOQA 5E3AA 4YT4A 3JCUQ 4Q4ZF 3S0XA 3H65A 4HFKB 2R7TA 4H4KC 4E7SA 1FMWA 3B0VC 1PD0A 2IXOA 2YS8A 3ABLC 3X1OA 3UGOA 1VK5A 4CS8A 2PF4E 3Q7LA 5KYXB 2R7VA 4W8KA 2BE5F 4CSAA 2P7VA 4I1OB 1TWHA 2MWQA 2IYLD 5F5HA 3K33A 1IW7F 4U5FE 2PP4A 3NKDA 5D92A 2LSEA 1ZHTA 2WZFA 3I4UA 4BG0A 2R7UA 4C7OA 1N1CA 4O6MA 2Y4UA 2OCCC 1M57C 4LACB 2XSEA 2J45A 4M63A 3S28A 2KQXA 1SMYF 2KW3C 3O39A 4EWCA 3SP1A 3KMIA 2N05A 2V26A 2PX3A 2Y69C 3LNRA 3M1CB 3DZAA 4CS8C 1HDJA 1Z6AA 2C03A 5DQZA 4U5GA 3Q6NA 2KGOA 1D1CA 1NZEA 3W8HA 2DYRC 2XXAA 1JPNA 4K0DA 2CUGA 1M56C 3UR3C 4JCHA 4OINF 2NUTA 2EIMC 3DMDA 5KYNA 1NU9C 2R7SA 1D0YA 1O5HA 3T4RA 4JJFA 3EH1A 4K7BA 3S27A 5EGYA 4DOZA 4PFOA 3LEVA 4P6IC 5DS4A 4AK9A 1ZU5A 4BJ6A 1MMDA 5IY5C 4QI2A 4J30B 1Z23A 2DN9A 2CTQA 1BR1A 2L81A 3DM9B 1MMAA 4OIQF 3K1IC 2R7QA 4YJWA 5KYWA 4ZLCA 5DQTA 3APOA 2J7PA 2Q3TA 2Y39A 3LS0A 4U5HA 3B9QA 4YN0B 3K66A 3B0UX 2LO1A 3RKOF 3ITFA 2M4EA 1SF8A 4KI2A 3DXJF 2YHSA 3EGDB 4A2NB 3ZVRA 3ASOC 3UCSC 1NU7D 1LS1A 2W4BA 4JURI 4DVZA 2PX0A 4KNWA 3UMHA 2QWQB 4J7ZA 1OCCC 4QDLA 2MYSA 4WJ0A 1BQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BQ0 A;  2PF4 E;  1FPO A;  3APO A;  1N4C A;  2OCH A;  1WJZ A;  2KQX A;  2CTW A;  2Y4T A;  2CTR A;  2N04 A;  1NZ6 A;  2QWO B;  2N05 A;  2QWP B;  1IUR A;  2YUA A;  4IT5 A;  3UO3 A;  2LO1 A;  1HDJ A;  2GUZ A;  2EJ7 A;  3AG7 A;  2GUZ B;  3APQ A;  2CTP A;  2DMX A;  3BVO A;  3UCS C;  3UO2 A;  4RWU A;  2DN9 A;  2M6Y A;  1XBL A;  2QSA A;  2CTQ A;  2QWQ B;  2QWR B;  2LGW A;  4J80 A;  4J7Z A;  1FAF A;  2CUG A;  2L6L A;  1GH6 A;  2YS8 A;  1BQZ A;  2Y4U A;  2QWN B; 
#chains in the Genus database with same CATH topology
 1FPO A;  2XUM A;  4EKW A;  2X6A A;  1WAZ A;  4LC1 A;  1IBK B;  5BQH A;  1D0Z A;  2Y3H A;  2EZP A;  4BIZ A;  4DV2 B;  2YIC A;  1RJ9 B;  4PHZ A;  3RYI A;  3OTO O;  3DJU B;  4FZ1 A;  1OZ0 A;  3DE8 A;  3ZSU A;  2HFE C;  3LDD A;  1PV3 A;  1M57 B;  3A11 A;  4NCQ A;  2J0W A;  2E74 B;  4RWU A;  4IRU A;  3DAF A;  2BL2 A;  2HR3 A;  2ZR3 A;  3AG3 C;  2VCA A;  4KL1 A;  2Y69 B;  4J7T A;  1TVK A;  1QZX A;  4MND A;  4YT5 A;  3H2V A;  4TV8 A;  5L3Q A;  4DR7 O;  1HE9 A;  3IHU A;  1J5E B;  4LF6 B;  3KKY A;  3OA1 A;  1D1B A;  1G8M A;  2A3Q A;  1Z5Z A;  1K05 A;  2DYR B;  2DW4 A;  2HHH O;  4JVS A;  3AK2 A;  2GUZ A;  5IDJ A;  2P06 A;  5HFM A;  4LF4 B;  1QPU A;  3K58 A;  2EIN C;  2YXH A;  1E1R G;  3UMK A;  1ZHY A;  3C8G D;  3N24 A;  3ZIB A;  2FAP B;  2DYS B;  4WFG A;  3ZDL A;  4C7O B;  2YQY A;  2ZQM A;  2IU0 A;  2C2A A;  2YIB D;  3GOD A;  5LMU B;  4CS7 A;  5H5N A;  5KHH A;  1Y74 B;  3TJT A;  4EHP A;  4F6R A;  2Q69 A;  2DE0 X;  3NDB B;  1HNZ B;  2TMV P;  1VF5 B;  2O9X A;  5KMG A;  4JI2 O;  3IJ4 A;  4IIJ A;  1QLE C;  3PMR A;  2R02 A;  1PV0 A;  2GA0 A;  1SQG A;  2ADP A;  4E2L A;  2L9J A;  5D5Q A;  5FLX N;  3GM3 A;  3SYN A;  1W2W A;  4MTF A;  3S3W A;  5ITZ A;  3R65 A;  2PTM A;  4ANJ A;  1BE3 H;  2XLO A;  3QMK A;  4QPJ A;  2ICW G;  1D2D A;  5HSW A;  4U9D A;  2R7W A;  2VCC A;  1N0J A;  1EBO A;  2A7W A;  5IYZ B;  2W4M A;  3HTK C;  1MND A;  3U9J A;  3SNH A;  2DYS C;  4W8P A;  3T9O A;  4XLP F;  5K1X A;  3VAY A;  3F46 A;  4O4H B;  5IE9 A;  4X65 B;  1F4N A;  1KP2 A;  2EIJ C;  2PFD A;  4X89 A;  1OCC B;  3S29 A;  2A0L A;  2IJJ A;  3CWB H;  3JAS A;  4DVY P;  1VQ6 V;  1GN4 A;  4CIH A;  2B5U A;  4E0I A;  3U10 A;  4PJJ A;  4LH7 A;  4GLX A;  1AP6 A;  1ZL8 B;  3CJH B;  1OQC A;  4D6T H;  2RCV A;  3N2Z B;  4DV1 O;  1DOW A;  2HJF C;  4D7T A;  2ZIN A;  3CCQ V;  2WLN A;  3CCV V;  2A6E F;  2LJ2 A;  4LF9 B;  1LVK A;  3K7D A;  4E18 A;  1HW7 A;  3JAM N;  4G7O F;  4O2B B;  2XAH A;  2H7O A;  3K5M A;  1B06 A;  4RUE A;  3LSU A;  2EZO A;  4G7H F;  4HNA B;  4AQY O;  4DUY O;  3VQY A;  5K1P A;  1NKD A;  5EK0 A;  4P30 A;  3R66 A;  4PK4 A;  1YVI A;  2LQT A;  4X20 A;  3FDQ A;  1HNW O;  4JYY A;  1YYX A;  1VQ9 V;  2UUH A;  4NB5 A;  3QTH A;  3HLZ A;  4IJJ A;  2XND G;  1RSO B;  2LFF A;  1FJG B;  1XOU A;  4O7G A;  1V74 B;  4U3J A;  4U3J B;  2NNU A;  4I0X B;  3B40 A;  2Y3G A;  4CJG A;  2IXP A;  3NMK A;  5B3I A;  4JI5 B;  2Y3B A;  4DR1 O;  4FLY A;  5EBM C;  4Z1V A;  4G0H A;  2WA3 A;  2R7X A;  4F4L A;  4P2Z A;  2EPN A;  2OQM A;  1K73 W;  1WOL A;  2KNH A;  1ZX3 A;  3TCU A;  4GEH A;  1MMN A;  1ZZP A;  5KYU A;  1H8H G;  4DRI B;  3V5X A;  2WPD G;  2OJE D;  1YA7 O;  1JR8 A;  1K33 A;  3JAT B;  3B0P A;  3EQL F;  3FB8 C;  3F7V C;  5E79 Z;  2FFH A;  4J7Y A;  3HKC A;  3AGT A;  4DR6 B;  2LP4 A;  4N23 A;  3CCR V;  2ZKO A;  3JSE O;  3ZMV A;  2F23 A;  3H01 A;  1PCX A;  3IC9 A;  2UUB O;  3A9C A;  1M5I A;  1F51 A;  4F4B A;  5KYX A;  3MYI A;  1YZA A;  3D36 A;  4TQD A;  4JI0 B;  2CK3 G;  1P7B A;  5GTH Z;  1I5X A;  3QW0 A;  1S76 D;  1R6N A;  4DR4 B;  3G6E V;  5IJ9 A;  1AP5 A;  1WN0 A;  4X88 A;  3CAX A;  3T4D A;  1H6G A;  1IVS A;  3ZHU A;  2Q8V A;  4JAS A;  1MNG A;  3NR7 A;  2CNW D;  2H7B A;  2PI5 A;  2QSA A;  1G1X B;  3H1L H;  2OIE A;  2Q0A A;  3OE7 G;  1QR8 A;  4MTG A;  1Q81 W;  4L8J A;  3RF3 A;  4H13 B;  4U9E A;  4U7O A;  2KKW A;  3CP1 A;  4JI3 B;  3JRM O;  4DBQ A;  1LUV A;  1H38 A;  1IUR A;  5F2V O;  1N33 B;  4CDV A;  1SET A;  3C18 A;  3D36 C;  4JKV A;  2DQ3 A;  3VOU A;  1R6K A;  2UUC B;  3CE2 A;  1XMQ B;  1WNS A;  3BRC A;  3Q4H B;  2QNL A;  3HB3 B;  4JI1 B;  4I44 A;  1H2K A;  5E2Q A;  1Q82 W;  3BY6 A;  5B1O A;  4CS2 A;  3BRJ A;  3O9O A;  3RQF A;  4UUJ C;  3H1I H;  1IBL B;  4O2A B;  4XPY A;  1BR2 A;  2ZXR A;  1ZHZ A;  2ARH A;  3NG1 A;  3AK3 A;  4DV7 O;  3K03 A;  5CN0 A;  4J42 A;  2Q4P A;  2ZXW C;  2A06 H;  1G5Z A;  1WA8 B;  2R7R A;  3ZRW A;  2VQE O;  3ASN B;  5B3S C;  1QR9 A;  1M6T A;  3O55 A;  2P4V A;  5JVE A;  4JF3 A;  4QJF B;  2QDO A;  4F6E A;  1YA9 A;  4UCR A;  4YJ3 B;  3JSZ A;  1W0J G;  2ZXP A;  3HKB A;  4I9Q A;  4JAU A;  4NTB A;  1SZX A;  1YEW A;  3BHP A;  1W2B U;  5E33 A;  4DXW A;  2YLG A;  4DR5 O;  4JW1 A;  1NZ6 A;  3H1K H;  3C8G A;  3CX5 F;  2CDQ A;  3K5L A;  1K4C C;  1SA0 A;  1SQP H;  4O79 A;  1UPG A;  1L1F A;  2HMZ A;  4QNH B;  5JLI A;  3EGD A;  2QUP A;  2XRH A;  3SZR A;  3WU2 Z;  2YIB A;  3RW0 A;  2GFH A;  1TGO A;  2WLI B;  3AK1 A;  3TGU H;  1OCZ C;  3P3N A;  1MMG A;  3RT3 C;  4NTF A;  2WVO A;  5K0I A;  4N6C A;  1LE4 A;  2GDC A;  3C7J A;  2ZE8 A;  4FIP C;  4MVZ A;  2Y48 A;  3RWR D;  3CYO A;  3L74 H;  1XWJ A;  4B3S O;  4ABM A;  3W7U A;  4UVC A;  5TJ5 E;  3HNI A;  4NTW A;  3JCU Q;  4I55 A;  3S0X A;  3H65 A;  3TXQ A;  4LNU B;  3VQW A;  1ZVZ A;  2R7T A;  4ASU G;  3B0V C;  4LF8 B;  1H2N A;  4CS8 A;  4JV5 O;  3GOR A;  2PF4 E;  5H6R A;  3CMA V;  2BOC C;  1NI8 A;  2ETS A;  2E75 B;  1IBK O;  3JD0 A;  3FD9 A;  3F5W C;  4TT3 G;  2Q7R A;  3GWN A;  5IWA O;  1H9G A;  3K33 A;  4DV2 O;  2DJV A;  3VF0 A;  5HV9 A;  4LFA B;  1SQX H;  3DXR A;  1JMW A;  3A0H Z;  5JCO C;  2LSE A;  2UXN A;  3IQT A;  4CDA A;  1LUW A;  1FFT B;  1EA8 A;  4BG0 A;  2IJK A;  1OXB A;  2KC3 A;  4DV1 B;  1N1C A;  2YC0 A;  1G4U S;  1F7Y A;  4YJ2 B;  5AC4 A;  2JGD A;  4X1K B;  2XAG A;  2YSU B;  3SP1 A;  2W0F C;  1J5E O;  4LF6 O;  4A4A A;  2KSF A;  4GKJ B;  4PV1 B;  3DZA A;  4CS8 C;  1AUE A;  4EB6 A;  5JJJ B;  3TUL A;  4EB6 B;  4XEK A;  1HWY A;  1GGQ A;  4LF4 O;  4UCT A;  4UB8 Z;  3U8V A;  3W8H A;  5EIB C;  3W7T A;  3N2K A;  1SER A;  2XXA A;  1JPN A;  4K0D A;  5AGF A;  2AZ2 A;  3ZS8 C;  4DV6 B;  1XZQ A;  2FML A;  2EIM C;  2B0H A;  3PJS K;  3LNN A;  5LMU O;  2R7S A;  4B7E A;  1FFX B;  1E2X A;  2HJD A;  2LGQ A;  1AVO B;  1HP8 A;  4LBE C;  4BR6 A;  1VQM V;  1DGS A;  4LF5 B;  2BC5 A;  2OKU A;  3JSN A;  4JTD B;  1T5O A;  2AW9 A;  4PFO A;  3LEV A;  1CGM E;  1BGY H;  5IY5 C;  1Q86 W;  4WFA V;  2QE7 G;  2JDI G;  3N2G A;  3J7A U;  1NT2 B;  1Z23 A;  3N2G B;  2UXC B;  3OEH G;  2LD6 A;  1BR1 A;  2DWE C;  1MMA A;  3S90 A;  2E3C A;  4JPR A;  3K1I C;  4YJW A;  2W0X A;  2XT9 A;  2BOB C;  4ZLC A;  5A6A A;  3APO A;  2UXD B;  5JVD B;  4JRZ A;  1Z2G A;  4R8C A;  5F28 E;  4JI4 B;  4ZBM A;  1KNY A;  4U5H A;  4CH6 A;  2PGG A;  3STL C;  3GWK C;  1IX9 A;  4X65 O;  3ITF A;  1XIL A;  4OX9 B;  2YHS A;  2UUI A;  1IBM B;  1VQ7 V;  4JV5 B;  3I56 V;  1NU7 D;  2PX0 A;  1WPB A;  4EEQ A;  3C90 A;  2WLH A;  4JGS A;  1BBH A;  4FK5 C;  4JC7 A;  1R5I D;  4WJ0 A;  1SKV A;  1BQZ A;  1FXK B;  4PDL A;  4DK0 A;  1EN4 A;  5A9G A;  2Q9L A;  3CCS V;  3CRC A;  5A6B A;  4LF9 O;  2CNW A;  2ITD C;  2NLJ C;  4UCU A;  1MG1 A;  3AQC A;  1VQK V;  3SPI A;  4LDR A;  3UT5 A;  1WAT A;  3DE9 A;  5KX5 A;  3T1H B;  4FM2 A;  1E86 A;  3N27 A;  4WBN A;  2Q7H A;  3KG2 A;  2A79 B;  1S3J A;  3JAL A;  3WB2 A;  3CCU V;  1FAF A;  3FVY A;  2P61 A;  5CBH A;  5GPG B;  3QZC A;  1H2M A;  1R3I C;  1XNQ B;  4I50 A;  5EZY A;  4MVU A;  5EZY B;  2E76 B;  1NVP D;  1V55 C;  3E70 C;  1FJG O;  4PA6 A;  4OIP F;  1SQQ H;  2P0N A;  3AOU A;  2VS0 A;  4EBK A;  4A5U B;  3RBZ A;  5DM6 V;  4JI5 O;  1L0N H;  1WN7 A;  1AEP A;  1DF5 A;  2XTA A;  2HKV A;  5JRA A;  4I4T B;  1Q0D A;  3FOP A;  5JUA A;  4BJ1 A;  4K1O A;  1WTY A;  2YID A;  2IJI A;  2LW7 A;  4PA9 A;  1H2G A;  3O10 A;  2JS3 A;  2VQF B;  2OCH A;  5BQG A;  2XAQ A;  4IAR A;  1YCI A;  2FGY A;  1J8M F;  3ZX6 A;  5J2T B;  4CDY A;  4DV7 B;  3BAA A;  4DV4 B;  2IBZ H;  1VTM P;  1RKC A;  4XEV A;  3E89 A;  4CSA C;  1SRY A;  4GT1 A;  1BSM A;  3CEI A;  3QF7 A;  3DKA A;  3V5Y A;  1LE2 A;  4DR6 O;  1KP3 A;  4J80 A;  3GVM A;  4CBC A;  5L3C A;  1LNQ A;  1TFO B;  3N0T A;  2NUT B;  1QCE A;  2Q67 A;  2YL1 A;  4BJT A;  1OJH A;  3NYM A;  1M2V A;  5JT4 A;  4JI0 O;  1AJQ A;  3G6B A;  4FFB A;  2YEV A;  4NTY A;  1ST6 A;  4DR4 O;  1XMO B;  3QTC A;  1C02 A;  2JGU A;  1SQB H;  1VB5 A;  2YL0 A;  2RDC A;  3GAN A;  3R2P A;  1QKR A;  2JEX A;  2F4V O;  1H9T A;  5DLJ A;  3JRT A;  1PM9 A;  5LA6 B;  2MHR A;  1A7V A;  5B5E Z;  4ULW A;  4UV9 A;  1G4W R;  4O6Y A;  1N34 O;  3OEE G;  1K5Q A;  2MK3 A;  3H9V A;  5KYW B;  1YTF B;  1K04 A;  4CH4 A;  1R73 A;  4YY3 B;  1D0X A;  3IFX A;  4NXN B;  1W59 A;  2IH3 C;  2K1E A;  3AEI A;  2A9H A;  4GX5 A;  4J9Z B;  2HJ3 A;  4JI3 O;  2XL4 A;  4TUY B;  1N33 O;  4O4L A;  4O4L B;  4R6Z A;  2UUC O;  3AG3 B;  1JOY A;  2V4D A;  5FNV B;  1FTS A;  2LFD A;  1XMQ O;  4GQH A;  2QEX V;  3IAY A;  4TWK A;  4P9O A;  5LGU A;  3F47 A;  1VMA A;  3RQG A;  4JI1 O;  1MNE A;  1BL8 A;  4E7Z A;  2WLL A;  2OYQ A;  1VYI A;  2J9V A;  1OW7 A;  1Q90 D;  4FLU A;  2EIN B;  1AJN A;  5IWA B;  2KG7 A;  1IBL O;  3NMJ A;  4HZ3 A;  2NR5 A;  3UGP A;  1T01 A;  1DF4 A;  1IXM A;  1GK9 A;  3L8I A;  3RYI B;  3KYI A;  1P49 A;  4H0L B;  3GB7 C;  2HUJ A;  2QWR B;  1N8R W;  4PJL A;  1PNK A;  3K5N A;  4B6I A;  2BSK A;  1LM3 B;  4QI0 A;  2V3C C;  2BCC H;  1S05 A;  4U5B E;  3L70 H;  1RP3 B;  3FAV A;  1PP9 H;  5COG A;  1GM7 A;  1VQO V;  3RYF A;  1TVK B;  1WJZ A;  4DUZ B;  1QLE B;  3JYH A;  2PNO A;  3EH2 A;  4TV8 B;  1P4R A;  3NRH A;  3B29 A;  2A69 F;  1M90 W;  5EBL C;  2BTO A;  1YSC A;  4G27 B;  2OU6 A;  3CSX A;  2GAQ A;  2IJH A;  4IYH A;  2J9U A;  1G8X A;  1IXB A;  3LAY A;  3EZI A;  2GUZ B;  3US6 A;  3LUT B;  3UKM A;  3BA9 A;  5LBQ A;  2WVN A;  1OV9 A;  1JPJ A;  3WG7 C;  4DW1 A;  4PI2 A;  2AZ0 A;  3DSQ A;  1D1A A;  2Q73 A;  4HEA J;  4XTK A;  2Q9C A;  2ZIM A;  2EIJ B;  3GM1 A;  2NG1 A;  1JFF A;  1YIJ V;  1JRA A;  3NKE A;  3PHF 2;  3SJB C;  3ATP A;  3BEH A;  3G71 V;  1VLS A;  4F6R B;  2H8A A;  3AG4 C;  2P4K A;  1LKX A;  4UB6 Z;  3O65 A;  5CA0 A;  4KXR A;  5KMG B;  3ABM C;  1ARO P;  3VYW A;  4AE4 A;  4IIJ B;  3UMI A;  4AE4 B;  1KQS U;  1QQ3 A;  1YHQ V;  3LEO A;  2Z0A A;  5ITZ B;  3E8G A;  2G3K A;  2YWA A;  3A0B Z;  1EM1 A;  2M7W A;  1HR0 B;  3CZ6 A;  2B9Z A;  4DRX A;  3K9A A;  4LF8 O;  3OUS A;  2AGA A;  2UXX A;  5B66 Z;  3RGB A;  4HBN A;  1MZF A;  1MMM A;  4PA7 A;  3ZMU A;  1OCR B;  1I5Y A;  1ZUQ A;  5GW7 A;  2YI8 A;  3E83 A;  5LGN A;  3NYJ A;  5AC5 A;  5A69 A;  3GWL A;  1FMV A;  1K5S A;  4OD4 A;  1KC8 W;  3THO A;  4LFA O;  1J8Y F;  1F1M A;  1SYQ A;  3T1Y B;  3E22 A;  3JAS B;  2FKX A;  2G3V A;  2W45 A;  1XI1 A;  2ZDI A;  3U3F A;  4XDL A;  5DS6 A;  3CCJ V;  1ORY A;  4IYI A;  3RYL A;  4WAB A;  1GN3 A;  3AG2 B;  2AP3 A;  2A0B A;  1VEW A;  3RYC A;  1Q8I A;  3SDL A;  3KCX A;  5KYY A;  3O6X A;  5KYY B;  3JSL A;  4ZLD A;  2OG2 A;  4LH6 A;  1BDJ B;  4IWB A;  3EXA A;  2Q00 A;  1WP8 A;  4JI6 B;  3EZH A;  5BY1 A;  4FAP B;  1S0V A;  4GKJ O;  2XLE A;  3E35 A;  2LIG A;  4G7Z F;  4TQF A;  1Z63 A;  1OCR C;  3E8B A;  2P22 C;  2HMQ A;  1CPY A;  4PDV A;  2Z15 A;  1BS3 A;  3DJN B;  5COF A;  4WFE A;  1Y4M A;  5EHH A;  2CCY A;  4X20 B;  2ODM A;  4BWA A;  3CS5 A;  3KZI Z;  3T1C A;  4ZKI A;  4DV6 O;  1WAS A;  1NR1 A;  1SR2 A;  1JX9 A;  3X2Q B;  2WAM A;  3WHN A;  3G4Z A;  4K8X A;  2ZDI C;  4UFZ A;  4CC5 A;  1ORJ A;  3AG2 C;  3M4C A;  5DED A;  1I94 O;  4LF5 O;  3ZHV A;  2QR4 A;  1NU1 H;  2WLM A;  1K34 A;  4GX0 A;  4OIR F;  3RQE A;  1XHX A;  1YJ9 V;  1GQA A;  2VRZ A;  2CE4 A;  2UXC O;  1SQV H;  2MW2 B;  2KK1 A;  2YZS A;  5KYU B;  4RD9 A;  2P67 A;  3ZRX A;  5BR8 O;  2UXD O;  2OJQ A;  4U5D E;  1PD3 A;  2Q7G A;  4JI4 O;  1YDI A;  3HKD A;  2Q0O C;  3RFY A;  5L3D A;  3B77 A;  4MT8 A;  1ORQ C;  3X2Q C;  3HKC B;  2JS5 A;  1QQC A;  4DV0 B;  4OX9 O;  4LCU C;  4WGY A;  5CA3 A;  2RMK B;  4Z9J A;  2HVK C;  1IBM O;  4Q4Z F;  2E5L B;  1C17 M;  4HFK B;  2JEU A;  2JJ2 G;  5JQG A;  4ZI7 A;  1CP9 A;  3UGO A;  3C3S A;  1VK5 A;  2FL4 A;  3Q7L A;  4W4L A;  5LL6 Y;  4NC3 A;  4X62 B;  5KYX B;  4UV8 A;  1CEZ A;  2F43 G;  3LSS A;  4YL1 A;  4BIO A;  2QM7 A;  1TWH A;  4P9P A;  2IYL D;  2OIG A;  2EPO A;  4U5F E;  1M9N A;  5IJ9 B;  2PP4 A;  1M56 B;  3GWO A;  2F4V B;  3T1H O;  3U0C A;  1ZHT A;  3ZTM A;  4HAM A;  3I4U A;  4X1Y A;  1JJ2 U;  4LDK A;  1IZ3 A;  2RD9 A;  3DC6 A;  3I55 V;  1N34 B;  1GAX A;  1YAR O;  2XSE A;  2ZXW B;  1XNQ O;  2KQX A;  3RN4 A;  2KSD A;  3VM6 A;  4L87 A;  2KW3 C;  2V7Q G;  3O39 A;  4EWC A;  4FJC C;  1EQ1 A;  5KUK A;  4U3F H;  2QKC A;  5B3S B;  2PX3 A;  1KEC A;  5JH7 A;  1R3J C;  5LMN B;  4CIP A;  1HDJ A;  4YHH B;  2XS1 A;  1NTK H;  1NZE A;  4OXS A;  3UQ8 A;  2XLW A;  4LFC B;  5BXZ A;  2IM8 A;  1M56 C;  1Y76 A;  4OIN F;  3B71 A;  2YRF A;  3FOO A;  2F93 B;  3JD1 A;  2VQF O;  1KKD A;  2K9P A;  5KYN A;  1EN5 A;  2LFR A;  5LHG A;  2QM8 A;  4OPA A;  1D0Y A;  3HNK A;  1O5H A;  2HP8 A;  3T4R A;  1Q5O A;  3RVZ A;  2ZT9 B;  3AJM A;  3VQV A;  4RQF A;  3S27 A;  1OCZ B;  4DOZ A;  3S9O A;  4DV4 O;  1V54 B;  1ZU5 A;  4BJ6 A;  4PDR A;  4NR1 A;  5CBF A;  1Q6I A;  3ZRW B;  2DN9 A;  3ZHT A;  2CTQ A;  3DM9 B;  1L3P A;  5COM A;  3HKB B;  5L3F A;  1KBH A;  3M8A A;  5TIS Z;  3B9Q A;  2HFI A;  5L3G A;  3K66 A;  4DRJ B;  1KMI Z;  3UM7 A;  3ABU A;  3C8G B;  1LS4 A;  2ZR2 A;  1LI7 A;  1SA0 B;  1T5E A;  1VQ5 V;  3GM2 A;  2ILM A;  1XMO O;  3RKO F;  5BZB A;  1XL4 A;  3DXJ F;  3EGD B;  3U8P A;  3TET A;  5LXT A;  1LS1 A;  4JUR I;  5FPR A;  2JVD A;  1RPR A;  4QDL A;  1WWP A;  4CX9 A;  2Y0P A;  2MYS A;  1HMD A;  1V54 C;  1PPJ H;  2EIL B;  1ZU4 A;  4BJ6 C;  1LPE A;  3OMN B;  4JYC A;  4E4E A;  4LER A;  3NYL A;  3L72 H;  1HNX B;  3TJ6 A;  4YY3 O;  1EZJ A;  2RJZ A;  4FX5 A;  4NXN O;  4B08 A;  4DV5 B;  1UFB A;  3CXC U;  1APC A;  2OEX A;  4U5C E;  3T6B A;  4NTX A;  4EUK B;  2HS5 A;  4IT5 A;  3L73 H;  3M7M X;  3OMI B;  1TUB A;  2G62 A;  3W4Y A;  2P6J A;  3W8I A;  3FFQ A;  3KCY A;  4X66 B;  3BCC H;  1Q7Y W;  1JJO A;  4I55 B;  4KNV A;  2QKS A;  2GHY A;  3G80 A;  2PBE A;  2L6L A;  1FR0 A;  1L8D A;  2AHZ A;  3ZG1 A;  2D5R B;  3G67 A;  1K4D C;  5B1B C;  3IQ6 A;  4PA3 A;  1J95 A;  2QLA A;  3HJC A;  3CC2 V;  1AI7 A;  4NKG B;  3FAP B;  1P7G A;  1I7F A;  4AIL C;  2ZNJ A;  3T2M A;  1I5N A;  2M64 A;  2EIL C;  1VQN V;  5CA1 A;  5CA1 B;  1GN6 A;  2JK5 C;  3OR7 C;  3F7Y C;  3FB6 C;  4W4K A;  2R9I A;  4ZOL A;  3DXR B;  1JAF A;  1UG7 A;  2NPU A;  3W7X A;  2PYL A;  2EIM B;  5FZT A;  4DK1 A;  4O4J A;  1O3U A;  2L6G A;  4FM0 A;  1SZT A;  2GV9 A;  5KUM A;  2ADQ B;  3SXZ A;  3DM5 A;  3T4Z A;  1NG1 A;  1R1B A;  1N32 B;  2JGD B;  4CH3 A;  4DUZ O;  3CSK A;  1HY5 A;  1WPX A;  2EX3 A;  1O87 A;  5IY5 B;  1RXQ A;  4CJO A;  1A32 A;  2X7R B;  3BAB A;  4WFF A;  3SR2 C;  1M2O A;  4X9Q A;  4IHJ A;  4Q7C A;  3ZIA G;  5AG2 A;  4IHJ B;  2VCB A;  3ZMT A;  3K79 A;  3J80 N;  2J8W A;  3HKE A;  4BEM J;  5CI9 A;  3EFO A;  4IB4 A;  3AQB A;  3JZ0 A;  4MTX A;  2WVQ A;  5IJ0 A;  4JI8 B;  3L71 H;  4Q6G A;  3H1J H;  4JYA B;  3N2K B;  2XXA B;  4GX2 A;  1V9P A;  4MW3 A;  3GEI A;  2QWN B;  3IC7 A;  4AHC A;  1BHA A;  4CS9 A;  4WFH A;  1WGW A;  4O4I A;  1G6U A;  4L6R A;  3K5O A;  4XEF A;  3K1H A;  1PKX A;  2Q4F A;  1D5N A;  4P9T A;  1WB7 A;  5A2Q N;  1I94 B;  3KPH A;  5JP7 A;  1X4T A;  3RVY A;  5KAF Z;  3E2E A;  1SZI A;  1NS1 A;  2H94 A;  4J10 A;  2CTP A;  3FB7 C;  1RCP A;  4LWS A;  3E9V A;  3ABT A;  3CQZ A;  3CB2 A;  1BZK A;  2ZIO A;  3EGX A;  3AG1 B;  2ZE7 A;  1TUE B;  4DYL A;  1HR0 O;  1Z3I X;  3ZHQ A;  3CRA A;  2FTK A;  2RN9 A;  5BR8 B;  5L3V A;  1GS9 A;  4XPX A;  4CBE A;  4MVR A;  2IXN A;  1MSD A;  1Q43 A;  2KB1 A;  2UU9 B;  4K0K B;  3EG9 A;  5HFL A;  2KJG A;  4B3T B;  1EN6 A;  3LLI A;  3OW2 U;  4YIO A;  2WSS G;  3T1Y O;  4LF7 B;  2CW0 F;  5LYJ A;  1Z5W A;  5LYJ B;  4DR3 B;  3UO2 A;  1S77 D;  1RM1 B;  1V55 B;  1SS3 A;  4Q5S F;  4NQF A;  1E1Q G;  2F95 B;  5BMV A;  3S3X A;  3GEH A;  5JSL A;  3Q6M A;  1BT8 A;  2QE9 A;  5IYC O;  4PAC A;  3MBG A;  4YWQ A;  3B09 A;  4QE7 A;  3TOM A;  1EKY A;  3IQ5 A;  4ICG A;  2J46 A;  4QE9 A;  3AG1 C;  4RQE A;  4JI6 O;  2EBO A;  5FCL A;  3UT5 B;  2Q5Z A;  2Q9B A;  1T6I A;  3U0Z A;  5KX5 B;  3K08 A;  1VOM A;  5F5F A;  3HPL C;  2JRI A;  4ZHQ A;  2XM4 A;  4LLC A;  3ETQ A;  4FVM A;  2CH7 A;  2PZS A;  4J32 B;  4WBN B;  3JAL B;  3MAQ A;  4EBB A;  1CPR A;  3NMI A;  5J2U A;  3W2V A;  2ZM6 O;  3D3I A;  1ZW2 A;  4EBJ A;  5EYP A;  5KHJ A;  4FFK A;  3I5D A;  5EYP B;  2NUP A;  4K8Z A;  3LJB A;  3U9M A;  1T9K A;  2DWD C;  1RM1 C;  3OR6 C;  4I50 B;  3FAJ A;  3AGU A;  2ATK C;  1B68 A;  2AU5 A;  4IL6 Z;  4MQ9 F;  1Y6D A;  3U3B A;  4DV3 O;  4I1M A;  4PDM A;  4Z9H A;  2N74 A;  1QSP A;  2L7A A;  2ITC C;  3QVZ A;  1TQG A;  1QLN A;  2CGN A;  1P84 F;  2RQ6 A;  3DTU B;  1AR4 A;  1TWG A;  1BCC H;  3OAA G;  3RYH A;  2QTV A;  4C7U A;  4HE8 D;  3ZJZ A;  1BQ0 A;  5KA6 A;  1VQ4 V;  4U5E E;  3QVN A;  5GON A;  5EC2 C;  3SYO A;  4Z2W A;  1DLB A;  3CC4 V;  1NBM G;  4LDQ A;  2Q7E A;  1KU2 A;  3KH2 A;  3FX7 A;  1NJI W;  4DW0 A;  4GKK B;  4GUN A;  3V7O A;  1ZTE A;  2IU3 A;  4DV0 O;  4YT2 A;  3QO8 A;  2E5L O;  3R7C A;  4IAO A;  2HJM A;  5BQI A;  3L8J A;  2WB7 A;  1A0B A;  1NR7 A;  1UJW B;  5H6Q A;  5EBW C;  5A6J A;  3ZN0 A;  1N4C A;  4X62 O;  2P90 A;  1K40 A;  2BTQ A;  4I9W A;  1VQP V;  1M2V B;  3ETG A;  2A6H F;  3IGA C;  4I3M A;  3TOL A;  4FFB B;  1OXK A;  4LLE A;  2YEV B;  4JE9 A;  1OKK D;  4KC9 A;  1YJW V;  4B3R B;  2Y3D A;  4CS3 A;  3LDC A;  3P30 A;  4N6H A;  1PL0 A;  2OEV A;  4FLW A;  4GYC B;  3U5S A;  1B6Q A;  5CB4 A;  2R05 A;  2R7O A;  3WFV A;  3T6J A;  1Y6X A;  4MS2 A;  4BIU A;  3DI5 A;  3JD3 A;  1ZHX A;  3HNL A;  1KUQ A;  1K8A W;  3C62 A;  1FFH A;  1MSW D;  3C8Z A;  3EFF K;  2Y4T A;  2A0U A;  2EPM X;  4PJM A;  4YK5 A;  4K3A A;  2I15 A;  1HMO A;  2R03 A;  3JAR A;  3LS1 A;  3FYE B;  2HVJ C;  2HLD G;  3SJA C;  5LOV A;  2B0J A;  3JYY A;  4E17 A;  4JZA A;  5LMN O;  1NFN A;  3APQ A;  2PI4 A;  4YT8 A;  3MFN A;  4NY3 A;  4YHH O;  4C3E A;  1JPX A;  5LGT A;  2ZNI A;  3OWT A;  4D4X A;  5EC1 C;  1L7C A;  1DK1 A;  1U96 A;  5D91 A;  4LP8 A;  4LFC O;  1GH6 A;  4MSW C;  1H7I A;  1EZV H;  4O6N A;  1I0H A;  4QGP A;  5GTI Z;  1WP7 A;  3EVK A;  3L9D A;  3JAW A;  3JT1 A;  2GTA A;  4DO2 A;  2AWC A;  3ABK C;  2WLL B;  2YKZ A;  2WL8 A;  3IQC A;  2XAJ A;  1ZHW A;  1Q6U A;  1JCH A;  3ZBH A;  1MZE A;  3WG7 B;  1FAP B;  2HSB A;  2KG7 B;  5DN6 G;  2LCH A;  4YL3 A;  3ABL B;  2EJ7 A;  3SJQ C;  1VMG A;  1WLE A;  4IGG A;  2XLM A;  5DS5 A;  4X1I A;  3BVO A;  1YF2 A;  1PNL A;  1O9H A;  1PL4 A;  5CBG A;  2KYH A;  2BSK B;  1A41 A;  5T3W A;  3AG4 B;  3KYJ A;  2J9B A;  4MVM A;  3FAV B;  1TR2 A;  3DGE A;  1KTM A;  1VF6 A;  2ZE6 A;  1AR1 B;  1AJP A;  3ABM B;  3RYF B;  5IYB O;  3POV A;  1RJ9 A;  3EHB B;  2VB6 A;  4RDA A;  3ZCC A;  1O9G A;  3OT7 A;  4X0R A;  3L75 H;  2WZG A;  4N21 A;  3W7S A;  3C3T A;  1Y66 A;  2VWJ A;  4UCV A;  4GCZ A;  1HE1 A;  3ZN1 A;  1AI5 A;  4E7S A;  3QW1 A;  1FMW A;  2XHB A;  1PD0 A;  3J81 N;  3ABL C;  3X1O A;  1NFO A;  3OGC C;  3ZRV A;  5KHK A;  3G4S V;  1T6U A;  4NXM B;  2R7V A;  2XOK G;  1DTO A;  3SXY A;  1H2L A;  1K3E A;  1HNX O;  2MWQ A;  3MHH C;  1JFF B;  1QBZ A;  5F5H A;  5JWP A;  4DV5 O;  1OW6 A;  2CDY A;  1XNR B;  1IW7 F;  1LI5 A;  1ZSP A;  4AI8 A;  1A7D A;  2W6I G;  3M99 B;  4DR2 B;  2XS8 A;  5CA0 B;  1CGO A;  1VF6 C;  1K97 A;  5KAI Z;  1ZLZ A;  4X66 O;  3NKD A;  4ER9 A;  1M1K W;  2NN4 A;  4JAV A;  5JJE B;  3OGI B;  3C63 A;  4PA4 A;  1U0B B;  4C7O A;  4PR9 A;  3CD6 V;  3LNM B;  1GKF A;  4O6M A;  2Y4U A;  1BHB A;  1M57 C;  4DRX B;  5DEC A;  1Y74 A;  2J45 A;  4M63 A;  1YYJ A;  1VIB A;  2H8P C;  3LSQ A;  2JJ1 G;  4BPM A;  1FD9 A;  2LK4 A;  3FXH A;  1UFI A;  3ZED A;  4KHP B;  2N05 A;  2Y69 C;  3M1C B;  3BPZ A;  3W7W A;  1VQL V;  2GSM B;  5JJN B;  5KA5 A;  2LP7 A;  3MDS A;  4J7K A;  1D5A A;  4JZ2 A;  1QHT A;  2GWW A;  1XRE A;  3ETE A;  1NSG B;  5DQZ A;  2P5O A;  2DI3 A;  4FMT A;  4U5G A;  2KGO A;  1D1C A;  4H33 A;  3E22 B;  1NLX A;  2P7T C;  2DYR C;  1YAU O;  4UXN A;  5L3E A;  3HNJ A;  4JEB A;  2HZ8 A;  3A0R A;  4PI0 A;  4JCH A;  3ZMS A;  5IYZ A;  4GZR B;  2W6J G;  2EPK X;  1JA8 A;  1AIL A;  1NU9 C;  1YJN V;  4UCO A;  1L0L H;  3VBB A;  3RYC B;  1N32 O;  4I5S A;  1X59 A;  1G4Y B;  3ASO B;  3E86 A;  2XM0 A;  3U11 A;  4O4H A;  1QVX A;  3EH1 A;  4K7B A;  1F4M A;  2QJ1 A;  1KKC A;  1SES A;  4MW8 A;  4LFB B;  4N4W A;  4AK9 A;  5LP6 A;  3SJC C;  3ZHS A;  3SPG A;  3OMA B;  5LP6 B;  4J30 B;  2X0L A;  1NVP B;  2AWY A;  5EIB D;  1ZL8 A;  3CJH A;  1Q3E A;  1KYO F;  1WB8 A;  4H44 B;  4JI8 O;  5FPO A;  3K9S A;  4JYA O;  2L81 A;  4OIQ F;  2EJR A;  5L0H A;  2ZM6 B;  2R7Q A;  2YLI A;  1M93 A;  1VAR A;  1EFR G;  1YLM A;  5L0D A;  2Q3T A;  2PYJ A;  1XDC A;  4O2B A;  2CGO A;  3CC7 V;  2IM9 A;  1S5J A;  1EI7 A;  2XLH A;  4G78 A;  4DV3 B;  1Y67 A;  2LO1 A;  4HNA A;  4G28 B;  2DQ0 A;  3ETD A;  2M4E A;  1SF8 A;  3CCL V;  3SYA A;  2UXB B;  3ASO C;  2W4B A;  3UMH A;  2R25 A;  4J7Z A;  5J9P C;  3MHS C;  1OCC C;  2WWW A;  3JAK A;  3JAK B;  4JZG A;  3FYI B;  2EIK B;  4HYO A;  1RSO A;  1CPQ A;  2HSQ A;  5LP6 C;  3TQO A;  2A1D D;  1ZAU A;  2WZL A;  1CXZ B;  3DWW A;  2EUL A;  4BW5 A;  4FM1 A;  5KLV H;  4I0X A;  3SYP A;  2I8B A;  4J41 A;  2V1D A;  2Q6A A;  3HKD B;  1KD1 W;  1A7E A;  2UU9 O;  3E8H A;  1GRJ A;  1FYJ A;  1JOG A;  5C93 A;  4K0K O;  3WOD F;  1RFY A;  4B3T O;  4UCS A;  1H2S B;  1K9M W;  4LF7 O;  3OM3 B;  2YDE A;  4DR3 O;  2EPL X;  3L1M A;  4B3M O;  5JQG B;  4ZI7 B;  1U97 A;  1OKK A;  4Z9I A;  5E1A C;  3B4S A;  5L0J A;  2FB5 A;  2X0C A;  1MQV A;  3JAT A;  2CTR A;  1S5H C;  1K7D A;  4OPH A;  3SYQ A;  3FKS G;  2GDS A;  2F22 A;  2EIK C;  5LHH A;  2KQ9 A;  2QTO A;  1MOF A;  3U2L A;  3P3P A;  4BW9 A;  4YL0 A;  4UDV A;  3K3W A;  1RPO A;  2HV7 A;  4FES A;  4X1Y B;  4AX2 A;  1BR4 A;  3BFR A;  2YXY A;  2YL3 A;  1HW2 A;  2D3O W;  4XLN F;  4RBN A;  4PEL A;  3SYC A;  4DJ9 A;  2R9A A;  4PD4 F;  4AL0 A;  1GN2 A;  3JCU Z;  3H1H H;  1TAE A;  3CEX A;  1N36 B;  3WAQ A;  3JCZ A;  5KHI A;  3L34 A;  3V5Z A;  1ENV A;  1RMV A;  1NH2 B;  2J9W A;  3KL4 A;  5BUO A;  5JH7 B;  2IW5 A;  4MTO A;  2H7V C;  3EHN A;  3FMS A;  5A6B D;  1YDX A;  3KKB A;  2Q68 A;  2M6Y A;  2CGE A;  1VYK A;  1TA8 A;  4FZ0 A;  1E79 G;  5E3C A;  2D4U A;  3MLG A;  4RAI A;  3K04 A;  3ZC4 A;  1Y76 B;  2LW1 A;  2XL8 A;  3OD4 A;  2WA4 A;  1I4Y A;  2UUA B;  3ZHR A;  2N04 A;  4U7N A;  1VQ8 V;  2QWO B;  4D4N A;  2D2C B;  2QTS A;  4FLZ A;  3JD4 A;  4JJG A;  3QNE A;  3AG7 A;  4GKK O;  4NYK A;  1TKN A;  2Z3Y A;  3A8T A;  2QY9 A;  3ZWI A;  2WLK A;  4YIP A;  3K59 A;  4JI7 B;  1XUQ A;  3Q4H A;  3MYF A;  3CME V;  3CHX A;  4X64 B;  1C03 A;  1V4A A;  5L3B A;  1R4T A;  2B1G A;  3ZMZ A;  3LES A;  2GTS A;  4P9F A;  3U2M A;  1NBB A;  5LHI A;  2YVK A;  3B8M A;  3TK1 A;  1S72 V;  1Q0G A;  1U6H A;  4O2A A;  3ZTZ A;  3CXH F;  4NVP A;  3LDE A;  1COW G;  3J06 A;  5FL7 G;  2J0X A;  2W9Y A;  3OTO B;  1WA8 A;  4MVS A;  2RNB A;  1T6Q A;  1XHZ A;  4B3R O;  3EJN A;  1OR2 A;  5B1B B;  1YJG A;  2DB4 A;  3Q7G A;  4PJN A;  1JQ0 A;  4WGZ A;  4J9Y B;  3CRQ A;  2DGJ A;  1URF A;  5B1A B;  4YJ3 A;  4R7C A;  5LXT B;  5IYD O;  4KUM A;  2XLD A;  2ZPA A;  1B3Q A;  1KB9 F;  3M4B A;  3SXM A;  2R72 A;  1OR3 A;  1AVM A;  2OOC A;  3OEO A;  4Z1M G;  4DR7 B;  3QO7 A;  4XPW A;  2CTW A;  2B1I A;  1R3L C;  1VLT A;  2JPU A;  1ROP A;  1AI4 A;  4KFM A;  3WB1 A;  2QKA A;  3UO3 A;  2HHH B;  4QIW F;  4JCZ A;  3CRM A;  4GYT A;  1NTM H;  3I5P A;  4KBL A;  3E8F A;  2GBO A;  1TUB B;  2WLI A;  3DAG A;  4OGQ B;  1TFK B;  4WF9 V;  3SGI A;  2QM4 A;  2C04 A;  1Z7Q c;  4JTA B;  1GMG A;  2LGW A;  4J7J A;  4XDK A;  1U89 A;  1AR5 A;  1OCO B;  3ASN C;  4QPK A;  4EFE A;  3GEE A;  4OIO F;  4K35 A;  4TOI A;  1Y4C A;  2ZE5 A;  5B1A C;  5JCO A;  3ML0 A;  1K92 A;  3CPW U;  1ZW3 A;  4JTC B;  4XWJ A;  1BZ4 A;  1AI6 A;  4I7Z B;  3OFN G;  2YUA A;  4JI2 B;  3K0G A;  1ORS C;  3MX3 A;  4CS4 A;  1US6 A;  4XBF A;  1YTF D;  4YXW G;  2P6V A;  2JD3 A;  2J7P D;  3K6B A;  3JTL O;  4BJ5 A;  4LNU A;  2VH3 A;  4ZOL B;  3HR0 A;  1IZM A;  4JAA A;  4TV9 A;  1TWC A;  1YZC A;  4TV9 B;  3M79 A;  2O57 A;  4O4J B;  1GM9 A;  1VP7 A;  4R32 A;  4OD5 A;  1OHH G;  3B8N A;  5IT9 N;  3A2F A;  4C3D A;  5CI8 A;  1XEQ A;  4JYB A;  2XLV A;  2HV6 A;  4PFP A;  1ZYR F;  3FB5 C;  4IAQ A;  2X6B A;  3MD0 A;  4LR3 A;  1OCO C;  3PDM P;  256B A;  3D3Q A;  3L0I A;  3M15 A;  3IEE A;  3B2E E;  3HKE B;  1N0N A;  3EFO B;  2VAS A;  5IJ0 B;  2OTJ V;  2A68 F;  2E87 A;  2P1A A;  2ZXO A;  1SC5 B;  2ASR A;  1F23 A;  4RUF A;  1FXV A;  4YJ2 A;  2YLD A;  1R6T A;  2AXT Z;  3JD2 A;  4X1K A;  3CCM V;  1Q0M A;  1Q0K A;  4DBR A;  4JIO A;  1GTO A;  4BJ5 C;  5A6K A;  3TXS A;  1XZP A;  4NXM O;  3K0D A;  4O4I B;  3FHD A;  5T1D B;  4N06 A;  5D5P A;  2HKO A;  3K1I A;  1XNR O;  1E85 A;  1LR1 A;  2Q9A A;  4AQY B;  3ZRS A;  4DUY B;  1GM8 A;  3UNG C;  1JVM A;  4DR2 O;  3SXK A;  4C3B A;  1CGN A;  3RH3 A;  5L0F A;  3ECS A;  1MA1 A;  4LWS B;  1HNW B;  1NTZ H;  1XBL A;  2FYU H;  4FWV A;  3BA8 A;  1MAB G;  3W2W A;  3LLK A;  1HW1 A;  3EGX B;  3PCV A;  2XAS A;  4MVQ A;  5DVW A;  3RIP A;  1FFT C;  1FFX A;  4BEJ A;  3F5T A;  3I5Q A;  5T3T A;  1HNZ O;  2YL7 A;  4KHP O;  3S84 A;  2JIZ G;  1XQ8 A;  2L6F A;  4DR1 B;  3OTF A;  4GX1 A;  1QVG U;  5CIV A;  1H8E G;  4CS9 C;  3TD7 A;  2X6C A;  1GM5 A;  1S7Z A;  3EG9 B;  2X51 A;  4UVB A;  4AL1 A;  4B3M B;  2ZD9 A;  1QU7 A;  3PN1 A;  2L6H A;  2NSG A;  5BMV B;  5JVD A;  1KU9 A;  1SQF A;  1OW8 A;  1B04 A;  1PNM A;  3DD7 A;  1IDS A;  1FKA O;  2ETN A;  4FLT A;  4X8A A;  2QWP B;  4WFB V;  5KHG A;  1TWA A;  2CYD A;  3JYC A;  5B1N A;  2LFS A;  1PD1 A;  4LFB O;  4ULV A;  2DMX A;  1THZ A;  4CH5 A;  2G38 A;  3EHM A;  4ZHQ B;  2F66 C;  2PUS A;  4UVA A;  2CH7 B;  2UUB B;  1FXK A;  4DRH B;  2HG5 C;  2AHY A;  2IXM A;  5J2U B;  5H2F Z;  2PY5 A;  3K06 A;  2NUP B;  3G4X A;  4B7K A;  4HFF B;  1YXB A;  2HEP A;  4FPP A;  3TK0 A;  2YXL A;  4RO2 A;  2XAF A;  3SEO A;  3TJ5 A;  1S5L Z;  3EPV A;  4G2K A;  2IOQ A;  2OCC B;  2L35 A;  5E3A A;  4YT4 A;  2UXB O;  3DC5 A;  4H4K C;  3CRR A;  2IXO A;  3HKK A;  2YS8 A;  3SPJ A;  1FNT c;  1Q6H A;  2OT5 A;  3ZQY A;  3RYH B;  2DOS A;  4W8K A;  2LQG A;  2BE5 F;  1I08 A;  4CSA A;  2P7V A;  1RKE A;  5GON B;  1RKE B;  4I1O B;  1E84 A;  3G50 A;  1YI2 V;  1FXK C;  2R70 A;  4PJ0 Z;  3WB0 A;  3ZQV A;  1W0K G;  2H3O A;  2NSF A;  4I4T A;  4FLV A;  4EIY A;  5D92 A;  3D8C A;  2BE3 A;  2WZF A;  1QVF U;  1DOV A;  2R7U A;  2YI9 A;  2YIA A;  4R50 A;  4XQ1 A;  2WLJ A;  4NTA A;  2OCC C;  1YVW A;  2Z5U A;  4LAC B;  4J11 A;  4CC6 A;  3SPC A;  3S28 A;  2R9R B;  1SMY F;  4H37 A;  1BMF G;  2BTQ B;  5J2T A;  3VRC A;  3KMI A;  1ZWI C;  3P32 A;  3K57 A;  3NXS A;  2F1M A;  1Z5V A;  2V26 A;  3LNR A;  2Y0I A;  2IH1 C;  4JEA A;  1Z6A A;  4FLX A;  2C03 A;  5L0G A;  2VQE B;  4D7S A;  1FS0 G;  4MVO A;  3Q6N A;  3H2U A;  3IPM O;  1QNM A;  5JS5 A;  3ABK B;  1JR9 A;  2IBF A;  4CZZ A;  1E83 A;  3RFR A;  1Q0F A;  2CUG A;  5CB4 B;  1NQT A;  2JX0 A;  2ZCE A;  1YIT V;  2NUT A;  3UR3 C;  2OWO A;  5C8Y A;  5C8Y B;  3DMD A;  4DR5 B;  4EFB A;  1XL6 A;  3T6G B;  4XDJ A;  4TSF G;  3CCE V;  4JJF A;  1M4U A;  3ICX A;  3STZ C;  3JAR B;  5EGY A;  1GO3 F;  1N36 O;  3QG5 A;  1FXH A;  5LOV B;  4KP4 A;  4P6I C;  5DS4 A;  5L0C A;  1MMD A;  5LA6 A;  4QI2 A;  2XL6 A;  1R3K C;  2RSE B;  3QVY A;  3VQX A;  1LIH A;  1JMK C;  5H9C A;  5L0I A;  1YZB A;  5KYW A;  5CMU A;  5DQT A;  2VC9 A;  1SF9 A;  2J7P A;  4Q20 A;  2Y39 A;  3JAW B;  3QO5 A;  3LS0 A;  4YN0 B;  2UUA O;  4WCE V;  4H54 A;  2VWK A;  2OTL V;  3B0U X;  4TUY A;  4B3S B;  4ONS A;  4E0H A;  5FNV A;  4KI2 A;  4A2N B;  3ZVR A;  4BAY A;  4ZIB A;  3UCS C;  1AB3 A;  2QA4 V;  2CAZ C;  4X1I B;  4JI7 O;  1I4Z A;  4DVZ A;  4KNW A;  2QWQ B;  3OUF A;  1NH2 D;  2QGN A;  3SPH A;  4X64 O;  2AVK A;  1VF7 A; 
#chains in the Genus database with same CATH homology
 1V54 C;  1ZU4 A;  1FPO A;  4BJ6 C;  4LER A;  3NYL A;  2A1D D;  2WZL A;  2CNW A;  4FX5 A;  1D0Z A;  4U5C E;  2Y3H A;  2I8B A;  3T6B A;  3AQC A;  4IT5 A;  1RJ9 B;  2G62 A;  3DJU B;  3W8I A;  3WOD F;  3ZSU A;  2J0W A;  4KNV A;  4RWU A;  4IRU A;  3DAF A;  1FAF A;  3FVY A;  2L6L A;  3AG3 C;  3QZC A;  1OKK A;  3ZG1 A;  2D5R B;  5B1B C;  1QZX A;  4MND A;  4YT5 A;  3HJC A;  5L3Q A;  1V55 C;  3E70 C;  2CTR A;  4OIP F;  3OA1 A;  1D1B A;  1Z5Z A;  2EIK C;  2EIL C;  2KQ9 A;  4JVS A;  2GUZ A;  2EIN C;  4BJ1 A;  3UMK A;  1ZHY A;  2HV7 A;  4FES A;  3N24 A;  3ZIB A;  4AX2 A;  1BR4 A;  4C7O B;  3DM5 A;  4RBN A;  4XLN F;  1NG1 A;  3GOD A;  4CS7 A;  2OCH A;  3CSK A;  1O87 A;  3NDB B;  2FGY A;  1J8M F;  1M2O A;  2O9X A;  3L34 A;  4Q7C A;  2J9W A;  3KL4 A;  5BUO A;  1QLE C;  2H7V C;  3PMR A;  3EHN A;  5CI9 A;  3EFO A;  4CSA C;  2L9J A;  3AQB A;  2WVQ A;  3SYN A;  1W2W A;  3KKB A;  2M6Y A;  4ANJ A;  4J80 A;  2CGE A;  2XXA B;  3QMK A;  1VYK A;  2R7W A;  5HSW A;  5E3C A;  2QWN B;  3MLG A;  4CS9 A;  3N0T A;  3ZC4 A;  2NUT B;  4BJT A;  1WGW A;  2W4M A;  3HTK C;  1MND A;  3NYM A;  3SNH A;  1M2V A;  3K1H A;  2N04 A;  2DYS C;  4XLP F;  2QWO B;  2YEV A;  3VAY A;  1ST6 A;  3F46 A;  4JJG A;  2EIJ C;  2PFD A;  3GAN A;  3AG7 A;  3S29 A;  1TKN A;  1SZI A;  2QY9 A;  2CTP A;  4DVY P;  5DLJ A;  3JRT A;  4CIH A;  3E9V A;  4PJJ A;  3CQZ A;  3EGX A;  3N2Z B;  4ULW A;  4O6Y A;  3LES A;  1Z3I X;  5KYW B;  2A6E F;  1LVK A;  5L3V A;  1D0X A;  3K7D A;  4CBE A;  4G7O F;  2IXN A;  2J0X A;  2H7O A;  2XL4 A;  2W9Y A;  4G7H F;  3EG9 A;  2KJG A;  3LLI A;  1FTS A;  2CW0 F;  3EJN A;  4PJN A;  3Q7G A;  4PK4 A;  3UO2 A;  2DGJ A;  2ZPA A;  3FDQ A;  4Q5S F;  3F47 A;  1VMA A;  1MNE A;  4IJJ A;  3HLZ A;  3OEO A;  4E7Z A;  3Q6M A;  1VYI A;  2J9V A;  2CTW A;  4YWQ A;  4O7G A;  2J46 A;  3AG1 C;  3UGP A;  3UO3 A;  2Y3G A;  2IXP A;  2Y3B A;  4GYT A;  5FCL A;  2Q9B A;  3I5P A;  4KBL A;  3DAG A;  1VOM A;  5F5F A;  4LLC A;  4G0H A;  2R7X A;  4J32 B;  2C04 A;  2QWR B;  2KNH A;  4PJL A;  2LGW A;  4B6I A;  4GEH A;  4QI0 A;  4EBB A;  2V3C C;  1MMN A;  3W2V A;  4U5B E;  5KYU A;  3ASN C;  2NUP A;  4OIO F;  3LJB A;  1WJZ A;  5B1A C;  3JYH A;  3FAJ A;  3EH2 A;  3B0P A;  3NRH A;  4XWJ A;  2A69 F;  3EQL F;  4MQ9 F;  2YUA A;  3MX3 A;  2FFH A;  2J9U A;  1G8X A;  4I1M A;  3LAY A;  3EZI A;  2P6V A;  2GUZ B;  2JD3 A;  2J7P D;  3K6B A;  4BJ5 A;  2WVN A;  1JPJ A;  2VH3 A;  3WG7 C;  1IZM A;  1TWC A;  1D1A A;  1PCX A;  4HEA J;  1TWG A;  2QTV A;  4OD5 A;  4F4B A;  5KYX A;  4HE8 D;  4XTK A;  1BQ0 A;  2Q9C A;  4U5E E;  4C3D A;  5CI8 A;  2NG1 A;  3NKE A;  2HV6 A;  4PFP A;  1ZYR F;  3PHF 2;  3AG4 C;  1KU2 A;  1LKX A;  3KH2 A;  1OCO C;  3ABM C;  3V7O A;  3VYW A;  4AE4 A;  3UMI A;  3L0I A;  4AE4 B;  3IEE A;  3EFO B;  2CNW D;  4YT2 A;  2H7B A;  2VAS A;  2G3K A;  2A68 F;  2QSA A;  2E87 A;  4IAO A;  2ZXO A;  2WB7 A;  3CZ6 A;  4DBR A;  4BJ5 C;  1N4C A;  1M2V B;  2A6H F;  3FHD A;  5T1D B;  4I3M A;  4N06 A;  4DBQ A;  4LLE A;  1IUR A;  3NYJ A;  1FMV A;  2Q9A A;  4OD4 A;  1OKK D;  1J8Y F;  4KC9 A;  2Y3D A;  3UNG C;  4C3B A;  3RH3 A;  3ECS A;  2G3V A;  2W45 A;  1XBL A;  2R7O A;  3T6J A;  4FWV A;  5DS6 A;  3RYL A;  4I44 A;  1ZHX A;  3LLK A;  3W2W A;  3EGX B;  5E2Q A;  5DVW A;  3RIP A;  1FFT C;  4BEJ A;  1FFH A;  5KYY A;  2Y4T A;  3O6X A;  5KYY B;  4PJM A;  3I5Q A;  4ZLD A;  2OG2 A;  5T3T A;  1BR2 A;  2ZXR A;  4IWB A;  1ZHZ A;  3LS1 A;  3EZH A;  3NG1 A;  2B0J A;  2ZXW C;  4JZA A;  4CS9 C;  3TD7 A;  3APQ A;  4YT8 A;  2R7R A;  1S7Z A;  3EG9 B;  4G7Z F;  1OCR C;  1Z63 A;  4NY3 A;  2X51 A;  2Z15 A;  3DJN B;  4C3E A;  3OWT A;  5B3S C;  5D91 A;  3JSZ A;  5EHH A;  1GH6 A;  2ZXP A;  4O6N A;  3JT1 A;  5E33 A;  3ABK C;  2WL8 A;  4JW1 A;  3DD7 A;  1NZ6 A;  1ZHW A;  2QWP B;  2CDQ A;  1TWA A;  3AG2 C;  4O79 A;  3EGD A;  2EJ7 A;  2XRH A;  3SZR A;  1PD1 A;  2GFH A;  5DS5 A;  2DMX A;  3BVO A;  4OIR F;  3EHM A;  1OCZ C;  1MMG A;  2YZS A;  2WVO A;  5T3W A;  2IXM A;  5KYU B;  4RD9 A;  1TR2 A;  2NUP B;  4U5D E;  4HFF B;  3POV A;  1RJ9 A;  3RFY A;  3SEO A;  2VB6 A;  4RDA A;  4X0R A;  3EPV A;  3X2Q C;  2WZG A;  2IOQ A;  5E3A A;  4YT4 A;  3JCU Q;  4Q4Z F;  3S0X A;  3H65 A;  4HFK B;  2R7T A;  4H4K C;  4E7S A;  1FMW A;  3B0V C;  1PD0 A;  2IXO A;  2YS8 A;  3ABL C;  3X1O A;  3UGO A;  1VK5 A;  4CS8 A;  2PF4 E;  3Q7L A;  5KYX B;  2R7V A;  4W8K A;  2BE5 F;  4CSA A;  2P7V A;  4I1O B;  1TWH A;  2MWQ A;  2IYL D;  5F5H A;  3K33 A;  1IW7 F;  4U5F E;  2PP4 A;  3NKD A;  5D92 A;  2LSE A;  1ZHT A;  2WZF A;  3I4U A;  4BG0 A;  2R7U A;  4C7O A;  1N1C A;  4O6M A;  2Y4U A;  2OCC C;  1M57 C;  4LAC B;  2XSE A;  2J45 A;  4M63 A;  3S28 A;  2KQX A;  1SMY F;  2KW3 C;  3O39 A;  4EWC A;  3SP1 A;  3KMI A;  2N05 A;  2V26 A;  2PX3 A;  2Y69 C;  3LNR A;  3M1C B;  3DZA A;  4CS8 C;  1HDJ A;  1Z6A A;  2C03 A;  5DQZ A;  4U5G A;  3Q6N A;  2KGO A;  1D1C A;  1NZE A;  3W8H A;  2DYR C;  2XXA A;  1JPN A;  4K0D A;  2CUG A;  1M56 C;  3UR3 C;  4JCH A;  4OIN F;  2NUT A;  2EIM C;  3DMD A;  5KYN A;  1NU9 C;  2R7S A;  1D0Y A;  1O5H A;  3T4R A;  4JJF A;  3EH1 A;  4K7B A;  3S27 A;  5EGY A;  4DOZ A;  4PFO A;  3LEV A;  4P6I C;  5DS4 A;  4AK9 A;  1ZU5 A;  4BJ6 A;  1MMD A;  5IY5 C;  4QI2 A;  4J30 B;  1Z23 A;  2DN9 A;  2CTQ A;  1BR1 A;  2L81 A;  3DM9 B;  1MMA A;  4OIQ F;  3K1I C;  2R7Q A;  4YJW A;  5KYW A;  4ZLC A;  5DQT A;  3APO A;  2J7P A;  2Q3T A;  2Y39 A;  3LS0 A;  4U5H A;  3B9Q A;  4YN0 B;  3K66 A;  3B0U X;  2LO1 A;  3RKO F;  3ITF A;  2M4E A;  1SF8 A;  4KI2 A;  3DXJ F;  2YHS A;  3EGD B;  4A2N B;  3ZVR A;  3ASO C;  3UCS C;  1NU7 D;  1LS1 A;  2W4B A;  4JUR I;  4DVZ A;  2PX0 A;  4KNW A;  3UMH A;  2QWQ B;  4J7Z A;  1OCC C;  4QDL A;  2MYS A;  4WJ0 A;  1BQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...