2PF4E

Crystal structure of the full-length simian virus 40 small t antigen complexed with the protein phosphatase 2a aalpha subunit
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
172
structure length
163
Chain Sequence
MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWASSLNPGVDAIYCKQWPECVKKMSTNCICLLCLLRMKHENRKLYRKDPLVWVDCYCFDCFRMWFGLDLCEGTLLLWCDIIGQTTYRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase regulator/viral protein
molecule keywords Serine/threonine-protein phosphatase 2A 65 kDa regulatory su
publication title Structural basis of PP2A inhibition by small t antigen.
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 163
sequence length 172
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2007-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02380 Papo_T_antigen T-antigen specific domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2pf4E01
1.20.120.1860 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2pf4E02
2QWOB 2DN9A 4J80A 1HDJA 4IT5A 3UO2A 2LGWA 1BQZA 1XBLA 2QWRB 2GUZB 3APQA 1NZ6A 2L6LA 2QWPB 1FPOA 3APOA 1N4CA 4J7ZA 2CTRA 2YS8A 1IURA 1WJZA 3UCSC 2Y4TA 2CTWA 3BVOA 2LO1A 4RWUA 2CTPA 2N05A 1BQ0A 2CUGA 2QSAA 2YUAA 2EJ7A 3UO3A 2QWQB 2Y4UA 1GH6A 2N04A 2M6YA 2KQXA 2PF4E 2OCHA 2DMXA 2GUZA 1FAFA 2QWNB 2CTQA 3AG7A
chains in the Genus database with same CATH superfamily
2ZDIA 1LVKA 1YXBA 4W8KA 4NTXA 4LWSB 4LACB 3ZMTA 4X62B 5E3AA 1GTOA 2A0BA 1HNWB 1N36B 1M56B 5JVDB 3J7AU 3EGXB 3RQGA 3LLIA 2L6GA 1GKFA 2EJRA 4WBNA 1T5EA 5C93A 1WASA 4F6RB 4KP4A 5LP6C 3T4DA 1XI1A 3AG7A 1BL8A 1ZYRF 3C90A 2Y3DA 3RYHA 4PD4F 2WZGA 2P67A 4JZ2A 5KYUB 1S5HC 2BTOA 4Q7CA 4YL0A 1VQ4V 1KD1W 2YI8A 2N74A 4PJNA 2UUBB 1MMAA 1JX9A 3NDBB 2A1DD 1TA8A 5LL6Y 4LF7O 3A0RA 2OQMA 2BE3A 1OXKA 4DRIB 1KNYA 1SA0A 4G0HA 4O2AB 5DQZA 1O5HA 2ZD9A 4LNUA 4O4HA 1N1CA 2NG1A 1K7DA 4DV6O 5CBGA 1IDSA 4KL1A 3CCRV 2YLGA 3K1HA 1HNZO 3EZHA 5CMUA 5KYWA 4DR1O 4K8ZA 4Z9JA 4I9QA 1LM3B 4AQYO 3C7JA 3OR6C 2KKWA 3CMEV 1YAUO 1XNQB 5CB4A 3CC7V 1LPEA 3OD4A 3B0PA 3JAWB 2P7VA 2P6JA 2WLLB 3EGDA 2YUAA 1VYIA 3POVA 3RBZA 2LFDA 3LDDA 1VB5A 1N0JA 2R7VA 3IC9A 4X64O 1K04A 1YITV 1PCXA 3F7VC 1BZKA 5JS5A 4B7KA 2WVOA 3SJCC 1M57C 2Y39A 3EG9B 5A6KA 3HNJA 2GUZB 2EZPA 4O2BA 2M4EA 5KA6A 1K05A 3US6A 1F23A 1FXKB 3JARA 3AK3A 1OZ0A 2PBEA 3K5NA 4DRHB 4DYLA 4MTXA 3LEOA 4Z1MG 4CS8C 4YJ3A 3A8TA 3OUFA 3S0XA 2LFRA 2H7BA 1G4US 1OW8A 2IXOA 1Q0GA 2JX0A 5FLXN 1OHHG 4G27B 4XTKA 3I5QA 4GKKO 4IARA 1RSOA 2QE9A 2YVKA 4KFMA 2OCCB 1JJOA 3K79A 3H65A 2VRZA 1M4UA 5EYPA 1PNKA 5JH7A 3CQZA 1D0YA 1HMOA 3SXZA 2F23A 3BAAA 3EPVA 3ZMVA 4RUEA 1FR0A 3ZIAG 3ABMB 2BSKA 1JR8A 2AU5A 3HKDA 1XQ8A 1U89A 2P0NA 1E79G 2B1GA 2DOSA 4WBNB 3CCSV 3WG7C 2NSFA 3V7OA 4OD4A 4NC3A 4CIHA 2PGGA 3R65A 3RYHB 3X2QC 1VQMV 4YIOA 4NY3A 5DEDA 5L3EA 5KHIA 5A69A 4X0RA 3U8VA 1F51A 3MX3A 1PV3A 1LUWA 3OMAB 4ONSA 1FJGB 3GODA 3L0IA 3AJMA 3JCZA 1YEWA 2LD6A 1YCIA 4HBNA 1FFXB 1SA0B 2X51A 1JQ0A 1YA9A 4O4HB 4EBJA 2Y69B 3PCVA 1U97A 3IJ4A 3CC2V 4G7HF 2KG7A 1YVIA 1Q82W 4X65O 1XDCA 2YXHA 1M6TA 1WJZA 3J06A 3GWOA 1FNTc 3RKOF 1D0XA 4U5BE 3KKYA 4GUNA 3UGOA 1Z3IX 5KHGA 1I7FA 4B3SB 5IYDO 2W0XA 4B3MO 2H8PC 2NUPA 2VB6A 2YI9A 4BAYA 4BIOA 3EGDB 1F7YA 3G4ZA 4DR3B 1K5SA 2IBFA 2AWCA 2YZSA 3F46A 1QLNA 4E0IA 3BCCH 3AGUA 4UDVA 2YXYA 2IU3A 3JSNA 1Z7Qc 4DV2B 3BABA 5JJEB 4MVZA 4FMTA 4K35A 4CDVA 2EPNA 2KSDA 4CH4A 2CUGA 3NRHA 4BEJA 5FPOA 1K9MW 2WLHA 1V55C 1Y4MA 4O2BB 3UT5B 3AG2C 1JOGA 4CS9A 4DV7O 5AC4A 2IXPA 3JARB 4DV0O 3LAYA 4LF8O 4RD9A 1W2BU 1NZEA 3E9VA 3TJ6A 1RPRA 2HKVA 2DQ0A 3QMKA 1FYJA 4YJ3B 2A6EF 2P6VA 4G78A 5L3BA 2UXDO 3IEEA 3RFRA 2OEXA 3T6JA 2LO1A 4ZHQA 3ZTMA 1ZW2A 3SJBC 2WZLA 2IH3C 3GB7C 2QSAA 1RSOB 3E83A 1Q0DA 3RF3A 1QVXA 4NYKA 1HE9A 2HHHO 4OIRF 2DQ3A 3JTLO 3ABTA 5FCLA 4XDKA 2XXAB 3RYCB 1FFHA 4WFEA 4IT5A 1FXVA 2ZXOA 4GEHA 5CIVA 2XT9A 3SYNA 1MSDA 2H7VC 4UUJC 2A3QA 1NU1H 5GTHZ 4LH6A 3N2GA 3DTUB 4EBKA 2XL6A 2DWEC 3ZRWA 5BQHA 5IYZA 5FPRA 4ER9A 1VQ9V 1O9GA 1K4DC 1QPUA 5B5EZ 1NSGB 2WVQA 1Z63A 1SR2A 1Q43A 2O57A 1AB3A 2DYSB 5KYNA 3I55V 3DM9B 5AG2A 2RD9A 4JTCB 2KJGA 1HR0B 3VQWA 2CYDA 3K1IA 3TOMA 3BFRA 3WHNA 3G4XA 4DVYP 5L0HA 3QVZA 4U3JA 2AVKA 5EC2C 2KSFA 1CPRA 4DK1A 3QZCA 2WLIB 1ZHZA 1D5NA 3IFXA 1VQLV 2OG2A 2R7SA 2PNOA 4UCVA 3AQBA 1KU9A 3MDSA 3A9CA 2JGDA 2KG7B 3JATA 2A6HF 2R9IA 4IRUA 4DR2B 3KYIA 1YIJV 4EKWA 2Q73A 3G6BA 3MD0A 5E79Z 4DV7B 4P9PA 1FXHA 2B9ZA 1AJQA 3OGIB 2RN9A 2NLJC 1TWAA 2VS0A 1I4ZA 4J30B 1T6QA 3I5PA 3OTOO 1I4YA 4RWUA 3CEIA 4O6MA 4PA7A 3CCUV 4DJ9A 2Y3GA 1QCEA 4X1IB 2GWWA 2XRHA 1QKRA 5BY1A 3NG1A 4LDKA 3X2QB 4UV8A 1GMGA 5TISZ 3UKMA 4AL1A 5BUOA 2QNLA 2NUTA 3SYAA 2HHHB 2PX3A 2CGNA 1CXZB 4GKJO 2XAGA 2D4UA 4UFZA 2V3CC 3W7SA 5F5HA 2Z0AA 3MYIA 3P3NA 3GWNA 2AWYA 3APQA 1OW7A 2UXBO 4GX5A 1VMAA 4IAQA 1TKNA 1TUEB 1EM1A 5H9CA 4BWAA 4XPWA 3KCXA 4I5SA 3DD7A 2NN4A 2EIMC 3VQXA 1HWYA 3QVNA 3G80A 4O4JA 4PJMA 1VLTA 2B0HA 5FL7G 4E18A 4KHPB 3BA9A 1URFA 2L35A 2Y48A 3AK1A 5B66Z 1IW7F 2QWPB 4UCTA 3NMKA 4JPRA 1KMIZ 4YN0B 5KMGA 3AEIA 2B0JA 1R4TA 3SPHA 3STZC 2VCAA 1AEPA 2CNWA 1HW2A 2RCVA 1AROP 2KK1A 4PFPA 3UM7A 3CCEV 4TV8A 3DKAA 1V55B 1DF5A 3IQ6A 4R8CA 1ZVZA 3AG2B 4DUZO 1I94B 4XWJA 2R7OA 3ZMUA 3RVZA 1WPXA 5B1AC 4D4NA 1GS9A 1K33A 3BHPA 5E2QA 1R3JC 2M7WA 2Q0OC 1JPNA 1EQ1A 2MW2B 4PK4A 2CH7B 1QVGU 3HR0A 3T9OA 5B1OA 1VQ6V 3DAGA 4JJGA 4MTGA 3CP1A 1IXBA 2EX3A 1HNXO 2XLHA 4K0KO 2RJZA 4YJ2A 1ZLZA 4KNVA 2R72A 4BJ5A 1OKKA 3MLGA 2XASA 2IJKA 3H9VA 1YHQV 1SC5B 4LFCB 4ZI7A 2FB5A 1DOWA 3FB5C 1RFYA 2FKXA 3HKBA 1ORSC 4UCUA 2WLMA 1M56C 3H1JH 2PI4A 3ZHVA 1VTMP 3ZN1A 3O10A 2Q8VA 5A6BA 3ZHQA 1YJ9V 3WAQA 4AK9A 3U9MA 1YZAA 4I50A 1AI4A 1HMDA 1XWJA 2JD3A 1CPYA 3I5DA 2R9AA 3FOPA 4PJLA 3LUTB 4NR1A 2A0UA 2PI5A 1X4TA 4PI0A 2EIKC 4FLYA 3OFNG 1Q86W 3FHDA 4I4TA 3H1HH 3NYLA 5CBHA 4NQFA 1KP2A 5KUKA 1AR1B 3C63A 2E87A 3S28A 2EIJC 2CW0F 3DJNB 1IURA 4U3FH 4CJGA 4UB8Z 3C8ZA 3JASA 4DV5B 2UUCB 2J46A 3QVYA 5GTIZ 1SERA 2HR3A 1MMNA 3QNEA 3CCJV 3NKEA 5LXTA 3B40A 2C04A 1XNRO 1GH6A 4C7UA 3A0HZ 4LF5B 3ITFA 1SQQH 1BHBA 4XEVA 1YSCA 1L8DA 1ZHYA 1XILA 5ITZB 1PV0A 3D36A 3NKDA 1W59A 4NVPA 4NXNO 2OIEA 2UXCB 2P7TC 4HYOA 1YDXA 4U9DA 4U5FE 3RYFA 3JZ0A 4ULVA 3O55A 1TGOA 1V74B 3ASOB 1Y66A 2QKAA 2R70A 3FAJA 2ZE5A 3QO5A 3B77A 3MYFA 1BS3A 1MABG 3JAMN 1RJ9B 2F66C 4MVRA 3EQLF 5KMGB 3EFOB 3U3BA 1LS4A 3RYIB 4K0KB 2ZE8A 1TWHA 2W4BA 5L0GA 5BMVA 3OTFA 5CA0A 5TJ5E 4PFOA 1AJNA 2RQ6A 4RDAA 1GM7A 2BOBC 1HNWO 1M2VA 1N36O 4E7SA 1FXKC 4ZBMA 4X66B 2R03A 1PL0A 1DTOA 2FL4A 2IU0A 2KGOA 3P3PA 1Y74A 4NTYA 5LGTA 3T1CA 3QTCA 3VAYA 2ZINA 4GX1A 1F4MA 2B5UA 3M4BA 1P7GA 1K4CC 5JSLA 5JP7A 2CGOA 3S84A 5GPGB 4YT4A 5EGYA 2G3VA 1O87A 4TQFA 4YJ2B 1IBLB 1VQ5V 4TUYB 2LGWA 1XBLA 4H33A 5F2VO 2ZDIC 2PYJA 3E70C 1KB9F 3N27A 4X20A 4L87A 1Z2GA 2UUBO 2BE5F 3ZQVA 3G71V 4ICGA 1AI5A 3HKBB 4AHCA 5KYYA 4Z2WA 2GFHA 4MVOA 1COWG 1T6UA 5LYJB 4JI7B 4NTAA 3I56V 3UGPA 2N04A 4K0DA 1S77D 4FM0A 4FLZA 4EHPA 1FS0G 2D5RB 4J41A 4FX5A 1TR2A 3M4CA 1KQSU 4ULWA 4QPKA 3UO2A 3LNRA 4Q4ZF 1LKXA 3K58A 1L1FA 4H13B 4CH5A 2E5LB 1Q3EA 2J9VA 5B1AB 4IHJA 3C62A 3SYCA 2ZNJA 4IL6Z 1YJNV 1XNQO 4U5HA 3BVOA 2YEVB 4LF6B 2PZSA 3ZX6A 1ZHWA 1AP5A 2UUIA 2FTKA 3CRCA 2KW3C 1GM5A 1HY5A 2L6HA 2XNDG 2J45A 1MZFA 1NH2B 3L73H 1BSMA 3JASB 4D6TH 3TJTA 5IYCO 2Q00A 1M5IA 3H1LH 1Y6XA 5JQGB 5BR8B 2OWOA 3V5XA 4OIQF 3KMIA 4GX2A 3VRCA 3B29A 4AE4A 2JS5A 2Z15A 4R32A 3ZRSA 2X6BA 1ZL8B 1P4RA 3NR7A 4JV5B 5L0FA 4FFBB 2VWJA 2HJ3A 2VASA 1UFIA 1T5OA 2Y4TA 5L3FA 2N05A 4CS7A 2Q5ZA 2I8BA 2YQYA 1Z5VA 2XAFA 3RYFB 1R6TA 1N0NA 2A79B 2AGAA 2EINB 2OOCA 3EZIA 4E17A 1VF7A 3MAQA 2V4DA 3SJAC 3FDQA 5H5NA 4W4KA 1APCA 2EPOA 4YY3B 4TSFG 4E2LA 1KECA 3CSXA 1EZVH 1SQBH 1T6IA 1IBKB 3HNKA 3B9QA 3HLZA 3DC5A 3ZHUA 4MVSA 4U5GA 2JK5C 3EVKA 1XHXA 3DAFA 1QBZA 2EIKB 1WA8A 3ZIBA 3CSKA 1PL4A 2K9PA 2CTRA 5BMVB 1B04A 1IZMA 1JCHA 2EIJB 2LQTA 1XHZA 4WGYA 2LP7A 4C3DA 1SZTA 2UXXA 4CSAC 4BPMA 1L0NH 3K03A 2G38A 2ZIMA 2HJMA 3VM6A 5DECA 1NT2B 3SYOA 1H8EG 1ORYA 2Y3BA 3KH2A 1Q6HA 2PTMA 3G4SV 1D1CA 2O9XA 5LGUA 3N2ZB 1NU9C 1H2LA 2W9YA 5FZTA 3OAAG 5L0JA 3D3IA 3W7XA 1I5YA 3W2WA 1FPOA 3HB3B 5KLVH 4GZRB 1OW6A 2VCCA 4OX9B 2Q3TA 5F28E 4X20B 5KHKA 5HV9A 3ETDA 3CCVV 1FJGO 1WPBA 4QPJA 3RFYA 4UVCA 5KYYB 4DR6B 2MYSA 1ZHTA 3DXRB 1K40A 1G8MA 3UNGC 3HTKC 1N34B 2I15A 4LR3A 3T1YB 3Q6NA 4J10A 2HJFC 1XMOB 2YDEA 1Y67A 4TWKA 4JAVA 3GEEA 3CD6V 1TWGA 5LOVA 3MFNA 3UQ8A 4JKVA 1NVPB 1TUBB 5L0CA 1WATA 1WTYA 3NYMA 1M93A 3VQVA 3JSLA 4IHJB 4B3SO 4TV9A 2LQGA 1ZAUA 2DYSC 1JPJA 3PMRA 4XQ1A 1NR1A 3ZTZA 5KHHA 1YJWV 4OGQB 1J5EB 3U9JA 4DR3O 1L0LH 2QM8A 2HV6A 3RGBA 4N4WA 2GV9A 4LF4B 1W2WA 2QKSA 4GT1A 1BR1A 1R3IC 4L6RA 4JYYA 1J8MF 3IQCA 4DV2O 3NMIA 2Z5UA 4JEBA 1Y76B 4K3AA 4LDRA 5IWAB 3W4YA 1VLSA 2CTWA 1SZIA 5L3QA 4EEQA 1PD3A 3T4RA 2HFEC 2IM9A 4DUYB 3UO3A 3F47A 4UCSA 3SDLA 1NU7D 3B8NA 2CCYA 2KNHA 2V26A 1U96A 2CK3G 2PUSA 3KYJA 2WZFA 2RMKB 1XL4A 1KU2A 1OCZB 5CI9A 1ZW3A 1Q6UA 3FB6C 1OCRC 1QU7A 4LFAB 1S76D 1PD0A 2IOQA 2LGQA 3MHHC 1NBMG 4KC9A 1NTKH 3ZRXA 3L8IA 2XLOA 5KAIZ 1ORQC 4KBLA 3U10A 3W8HA 4EUKB 1DGSA 4IYHA 4CS9C 3EH2A 4IAOA 3THOA 2Q9LA 4JI4B 5AC5A 2XL8A 3JD1A 2ATKC 4BJ6A 1U0BB 4LNUB 2P1AA 1WWPA 4XEFA 5DQTA 3LNMB 1Y4CA 2R05A 1BZ4A 3GORA 2R9RB 5HFLA 3T1HB 1E85A 2KB1A 4U5EE 5KYWB 1H9TA 5JJJB 1JRAA 4FZ0A 1HE1A 2XOKG 4JCZA 3JCUQ 3DSQA 5J2TA 3SXYA 2XSEA 3K5OA 5CB4B 2K1EA 5HFMA 4ASUG 2YIAA 1HR0O 3R66A 1QQ3A 2JJ2G 2J9WA 1MG1A 1ORJA 1SQXH 4I7ZB 2DWDC 4XPXA 4RUFA 4PDLA 1BQ0A 2C2AA 1WN0A 2L7AA 4PI2A 5DS5A 2ILMA 1ZTEA 3Q4HA 4ZIBA 3LEVA 4DR2O 3SP1A 1ROPA 2WWWA 1NTZH 3GWLA 3M79A 4TT3G 3QO7A 1NS1A 3G6EV 3HKKA 3K0GA 1BBHA 2LCHA 1SS3A 5IDJA 4TV9B 2BL2A 2ZM6B 2HP8A 4MTOA 5EC1C 2HUJA 2UUAB 5DLJA 3EHMA 4UCRA 3L8JA 3EXAA 1IBMB 4NTBA 3HNIA 3K1IC 3FAVA 4I9WA 2A69F 1CEZA 5JLIA 4CH6A 2FYUH 4LFBB 1Q90D 2VQEB 3CRQA 2IYLD 3VOUA 4DR7B 1ST6A 5EK0A 1Q81W 2IM8A 4DV4B 4EFEA 4LC1A 1S72V 5EYPB 1YZCA 4MVUA 5FNVA 5JH7B 4MSWC 3LDCA 3J80N 1N33B 2WLJA 1E1RG 1RKEA 2BSKB 4B3TB 1KYOF 3HKDB 1AUEA 5J2UA 2CNWD 3TOLA 3OMIB 3OE7G 3B71A 2YS8A 4I0XA 4HE8D 4XEKA 4YT2A 2JRIA 3CAXA 3CZ6A 4MVMA 4BJTA 2OTLV 4U7NA 3E22A 1YZBA 4Z9IA 4DRXA 1WN7A 1RP3B 2CDYA 2OKUA 5T1DB 4F4LA 1GK9A 3CB2A 2GSMB 5CA3A 2PP4A 3CXHF 3AG4B 4KHPO 1GRJA 3LSSA 2H7OA 2R25A 4FESA 2J0WA 2Q4FA 1AVMA 3DXJF 4B6IA 1EN6A 4R6ZA 3JYYA 1JMKC 1OJHA 1M1KW 3ZG1A 3SPCA 4PA3A 2AHZA 4J11A 2OJED 1WP8A 1X59A 2XLDA 2YC0A 1EBOA 3K7DA 3LSQA 2D2CB 1D2DA 3K08A 3GWKC 3FVYA 4U9EA 1K34A 1I94O 4JI0B 1UG7A 1VQ8V 2Y69C 1JAFA 5IJ0A 5A6BD 3JALA 1NKDA 4U5CE 4G7ZF 5L3CA 1GO3F 2F4VB 4LLEA 3E89A 1WB8A 3ASOC 3SR2C 4JYAB 1D1AA 2NUPB 1MNDA 4NXMB 4FWVA 3J81N 2Q4PA 2Q68A 5D92A 2AHYA 1FFTB 4PA6A 4OPAA 5KYXA 3A11A 1LE2A 4HEAJ 2BC5A 3AG1C 4LLCA 2XL4A 1OCRB 1NJIW 4GX0A 1R3KC 3K3WA 2X0CA 3JRTA 1H2KA 3ABLB 4MS2A 4CBCA 4LFCO 2IH1C 1FAFA 1WOLA 3Q4HB 5JT4A 1SYQA 1NH2D 2XM0A 3CX5F 2GA0A 2NNUA 1VQ7V 2FMLA 4FLTA 1FAPB 3JD3A 4X1KA 2ZQMA 3K5MA 1QVFU 2R7TA 4Z9HA 2PY5A 2LK4A 2B1IA 3GM1A 3C3SA 2J9UA 4NB5A 1MNGA 4D7SA 4FLXA 1NLXA 3DJUB 2TMVP 4FJCC 4F6EA 5IT9N 4NKGB 4WFFA 4RBNA 5D5QA 3N2KA 4I44A 3FAVB 3H2UA 4QI0A 3OW2U 2YHSA 4ZHQB 1TFKB 3CCQV 4JI8B 4JTAB 1TFOB 4BJ5C 1IVSA 3FB7C 2F95B 4YJWA 2KC3A 1LR1A 3C3TA 3OWTA 3U3FA 4N21A 2P5OA 5KHJA 5FNVB 4I55A 3JAKA 2HMZA 4DV5O 3HKEA 1DK1A 2UUCO 2YRFA 1RKEB 2ZNIA 4K7BA 5JVEA 5COMA 2ICWG 1QNMA 4KUMA 4LF5O 5E33A 4I0XB 2EPLX 1AI6A 2IW5A 3TXSA 4O4IA 1C17M 4N06A 3N2GB 1MMMA 3IPMO 3M15A 3TQOA 3K9AA 3FB8C 4PV1B 3SPJA 2ITCC 3ZRWB 3E8HA 5IYZB 1VEWA 3BPZA 1M90W 2UXCO 3K33A 4JRZA 1OR2A 2LFFA 2YL0A 1VF5B 4KI2A 3TGUH 3DC6A 3BA8A 1QHTA 1S05A 1VQPV 5CN0A 1MNEA 4IIJA 3IGAC 1JA8A 3VBBA 3CRMA 4NTWA 4GCZA 3RVYA 3OEEG 1E2XA 1ZX3A 4JI3B 3ZMZA 3K06A 4J7KA 1VF6A 4X9QA 1FD9A 2XS1A 3ZHTA 2DE0X 2JGUA 4U3JB 4PDRA 1SMYF 1XZQA 1QQCA 2Z3YA 2UU9O 1KP3A 3NMJA 5L3GA 2JGDB 3JATB 4WFAV 3FXHA 4WJ0A 1K3EA 2XLMA 5T3WA 4PHZA 3LESA 3D36C 4YT8A 4X66O 1RMVA 3JALB 4BR6A 2WLKA 4O4LA 2EINC 4LP8A 1J8YF 4EB6A 2R7UA 1SQVH 1PNLA 5LGNA 1NVPD 3OM3B 3ZN0A 2Q7HA 2C03A 2X6CA 4B3RB 1KTMA 3CYOA 1BHAA 5BQIA 2M64A 1IBLO 3Q7LA 1H2GA 3ABKB 4LCUC 3OGCC 2XM4A 1XUQA 5EZYA 2IXMA 2NUTB 3ML0A 3JSEO 1BGYH 3FFQA 3QW0A 3H1KH 3S3WA 3IAYA 3T2MA 4LDQA 3CXCU 4X1KB 2WVNA 4IJJA 3S27A 1PPJH 1NI8A 3DM5A 3W8IA 4JI7O 4FK5C 2L81A 4JC7A 4HZ3A 4PR9A 2CE4A 1RM1B 2J0XA 1A7VA 3TXQA 1MMDA 4A2NB 4JI6B 4FLUA 4AILC 1LI5A 256BA 2E5LO 1QR8A 3DE9A 2ADQB 1A41A 4EFBA 1LNQA 4JASA 4O4JB 4W4LA 1JVMA 1VP7A 2Q9AA 2HSQA 4G2KA 4LF6O 2EILC 3HKCA 4U5DE 4EIYA 4Q5SF 4CDAA 1CGOA 4FM1A 3K0DA 2XAJA 2Y0PA 1JR9A 3CJHA 3WU2Z 4FVMA 1Q0KA 1OCOB 4BW9A 2QWQB 4B08A 2DW4A 5DN6G 3OEOA 4EBBA 2GAQA 5BR8O 3L1MA 4FFKA 4XLPF 3L70H 4LWSA 4P6IC 2QM4A 3AG1B 4MQ9F 2Q9CA 1H2MA 3N24A 1R73A 5JVDA 3OR7C 3EGXA 4JV5O 2ZE6A 4TV8B 3K6BA 1R1BA 4PJJA 4LF9B 1WLEA 2P61A 1FMWA 2OEVA 4R7CA 2GBOA 3K57A 2QLAA 3JYHA 1YTFB 1R6NA 4JI1B 4C3BA 5A6AA 1GN6A 2HVKC 3ETQA 4YY3O 2R7QA 5F5FA 2J9BA 1IBKO 2R7XA 4OINF 3W7WA 3WODF 4QE7A 2HV7A 4AX2A 2NPUA 1QR9A 2P90A 4U7OA 2YIBA 5E3CA 2DN9A 2ZXWB 2IJHA 2ZXPA 2W4MA 1I08A 2HEPA 4WFGA 3BY6A 3GM3A 2DGJA 2L9JA 2VH3A 2EULA 2R02A 4X88A 1E83A 1YARO 1S3JA 4ZI7B 4O2AA 5JCOA 1OQCA 4QNHB 5BZBA 1PKXA 3AK2A 1BE3H 2HZ8A 1E84A 4J9ZB 3U11A 3N0TA 1VMGA 1H9GA 2Q69A 1ZHXA 3JCUZ 3K04A 1NBBA 3TULA 5LMUB 3ZVRA 4YHHB 3RN4A 4DR4B 3LJBA 2JEUA 2PFDA 2X7RB 2IXNA 3ZDLA 2E76B 2KYHA 3SPIA 4I50B 4O6YA 4M63A 4UVAA 2H94A 2Q67A 2HKOA 1G8XA 4EWCA 4C7OA 1OCZC 5EBMC 1R3LC 3JAWA 4L8JA 4MW8A 4DR5B 3P32A 4DV3B 3SEOA 4F4BA 4H44B 2EZOA 5KAFZ 3SNHA 1IXMA 4OX9O 4IWBA 4I4TB 1CGME 1QZXA 2YLDA 2YLIA 2ODMA 3BEHA 4DV1B 3NXSA 3T6BA 3ZHSA 3P30A 1Q7YW 2DJVA 2IJJA 4DR6O 1P49A 2KQXA 3EG9A 2AP3A 1XZPA 1NQTA 2F1MA 5A2QN 2GUZA 2ZIOA 1N34O 5HSWA 3PHF2 3T1YO 3FOOA 5LXTB 1XMOO 3ZC4A 2XUMA 1YI2V 4NCQA 3UMKA 1OCCB 4WFHA 5K1PA 1L7CA 1H2NA 1FXKA 2MK3A 2RDCA 3B2EE 4CH3A 4W8PA 4OIOF 2YWAA 1U6HA 2J7PA 2ZE7A 2JVDA 5JJNB 1O9HA 3DWWA 2QTVA 4ZOLA 4Z1VA 3VF0A 4CJOA 3SXMA 3CS5A 4KXRA 3HKCB 4JI2B 3LDEA 3OEHG 4CC5A 1KC8W 3QG5A 1VQOV 1J5EO 2CDQA 5A6JA 1BR2A 3CC4V 2LIGA 2VQFB 4LF4O 2BTQA 2CTQA 5DVWA 1TVKA 4P30A 1EI7A 4ZLCA 1NG1A 1ZZPA 4WF9V 1ZU5A 4GQHA 5IWAO 4R50A 1G4WR 3U2LA 5CI8A 1Z5ZA 1Y6DA 5CA0B 4DUYO 2AZ0A 5H6QA 3FYEB 1F1MA 1M2VB 1AJPA 2E74B 2JJ1G 3SZRA 2A06H 1Y74B 4MNDA 5CA1A 3C8GA 4JGSA 3RQEA 3ASNB 4BIZA 4D4XA 1N32B 2ZPAA 4O79A 3K9SA 3QO8A 4JI5B 3W7TA 2OU6A 1N4CA 3JD0A 3GM2A 3CCLV 2HJDA 4LFAO 4OPHA 4CX9A 3HJCA 2Q7EA 2EILB 1D0ZA 1GAXA 1FFXA 4OIPF 3GANA 3ZCCA 2DYRB 2GHYA 5IJ9A 2XLWA 5L0DA 1XMQB 3DMDA 2ETNA 2P4VA 2QGNA 4JI4O 5B1NA 3CE2A 3AQCA 5CBFA 3CRAA 3ZJZA 1TWCA 5COFA 3JRMO 1HDJA 3V5YA 3FX7A 3K5LA 3KCYA 1SZXA 4Q6GA 3OUSA 2YICA 1EKYA 1PM9A 3KZIZ 3QTHA 5DS6A 1XEQA 5D5PA 3RH3A 4C7OB 3T1HO 2IJIA 3F5TA 4DXWA 1MOFA 2Q7GA 2ARHA 2VCBA 1JOYA 2VC9A 3AG4C 4JE9A 2ZR3A 3SGIA 5LP6A 4CS2A 3E8BA 1US6A 5JWPA 3ZBHA 2P06A 3A2FA 4P9TA 4CBEA 2UU9B 2LP4A 2E3CA 2GDSA 1V9PA 2LW7A 2XS8A 1O3UA 4BJ6C 3UT5A 5KUMA 4RAIA 4AE4B 4CSAA 4DBRA 3H01A 3A0BZ 1RCPA 4I3MA 2QA4V 1GM9A 1SQGA 4UCOA 5B3SC 3F7YC 1I0HA 4BEMJ 1FMVA 3T6GB 2FGYA 5KA5A 1GM8A 4ZOLB 3AG3B 2Q7RA 2ZM6O 3HPLC 1BCCH 2UUAO 2UUHA 2RSEB 3L9DA 3IQ5A 1K8AW 1E1QG 1R5ID 4DVZA 4JF3A 1R6KA 3SYQA 1IBMO 2Q9BA 2BTQB 1FFTC 3APOA 1TVKB 1GQAA 3E35A 3TETA 2XXAA 4LFBO 3RYCA 2VQEO 2W45A 3M7MX 4DR7O 1WA8B 3FYIB 1J95A 3ABLC 4N6CA 4LF7B 3IQTA 1G6UA 4DV4O 1RXQA 3ECSA 2NR5A 1C02A 1Q8IA 4XLNF 3IHUA 1JJ2U 2W6IG 4JEAA 1Z5WA 1N33O 2KQ9A 4DBQA 5B3IA 3ABUA 4H0LB 2QTSA 2H8AA 4DV6B 4JW1A 3HNLA 4B3TO 4WGZA 4PDVA 1VOMA 3ETEA 1BR4A 4CIPA 5CA1B 1HNZB 2YKZA 3C8GB 1LI7A 2W0FC 4GLXA 4YL1A 4DR1B 2G62A 3WB2A 3EH1A 2YXLA 3L75H 4AQYB 4JIOA 4O6NA 3FD9A 3FAPB 4CS8A 4A5UB 3OT7A 3KKBA 2P22C 1QLEB 1Q6IA 1SF8A 1F4NA 4FPPA 1XREA 1V4AA 4AI8A 2HVJC 1YDIA 5EHHA 4YT5A 3IC7A 4X64B 2MWQA 3LLKA 5B1BC 2WLIA 5IJ9B 4JCHA 2WSSG 2R7RA 2XLEA 2FAPB 2FFHA 3B09A 5A9GA 2EPMX 3RQFA 5KX5A 4P2ZA 3KL4A 2XTAA 3JT1A 5GONA 1MMGA 4QJFB 4N6HA 1NTMH 1G5ZA 3WFVA 4JI0O 5LOVB 1KUQA 1YVWA 4TQDA 1AILA 1XOUA 2Q6AA 3Q7GA 3L71H 2F4VO 2HLDG 4PDMA 1B3QA 4JYAO 1GGQA 3LS1A 5LP6B 5H6RA 3DE8A 4H54A 4NXMO 1LIHA 4X1IA 4RO2A 1PD1A 4GKKB 2HSBA 3O65A 2Y0IA 1SRYA 1B68A 2ASRA 2HMQA 4K1OA 5EIBD 4XDLA 2A0LA 2PYLA 1G4YB 3K59A 1MA1A 2IBZH 1CPQA 2ITDC 1A7DA 1A0BA 2OTJV 4I1OB 3KPHA 4J9YB 2JEXA 1RPOA 4WFBV 2WAMA 4E4EA 2AXTZ 4D7TA 3L72H 1EFRG 1WNSA 4DRJB 1YF2A 1NFNA 4YIPA 2BCCH 3OMNB 2UXNA 2XAHA 2PF4E 1YTFD 2QKCA 4ZKIA 3ABKC 5H2FZ 5BXZA 4JI8O 3ICXA 3U0ZA 1NFOA 4H37A 3DI5A 3S9OA 3R7CA 1HP8A 1M9NA 1CP9A 4UV9A 2G3KA 2QWRB 3TCUA 3JYCA 3W2VA 1M57B 2F43G 4UXNA 4C3EA 3JSZA 1GN2A 1SETA 4X65B 4E7ZA 1OKKD 1P84F 1WGWA 4CS4A 1RM1C 3JD4A 1T9KA 2Y3HA 3RWRD 2RNBA 1LUVA 1UJWB 1C03A 3U2MA 2AZ2A 4B3MB 5B3SB 1VIBA 2A7WA 3EHBB 2CH7A 3R2PA 1ZUQA 2Q0AA 5EIBC 2P4KA 4X8AA 2OIGA 4FIPC 3ZWIA 1AP6A 5J2TB 4J32B 1SQPH 2A68F 1I5XA 3B4SA 4JI3O 5D91A 3CPWU 4HFKB 1OCOC 4FM2A 2WL8A 1H2SB 3ZS8C 2PX0A 3UR3C 5IYBO 1ENVA 5COGA 5KX5B 3O39A 3ZEDA 1S5JA 2HS5A 5GONB 2XAQA 3SXKA 4DV0B 1IX9A 4LF8B 2WB7A 3EJNA 4J80A 1L3PA 4LERA 4XBFA 3F5WC 1FKAO 3ETGA 4RQFA 3RT3C 4PACA 2QEXV 3WG7B 5K0IA 3STLC 1DOVA 4JURI 2UXDB 5LMNO 2CTPA 3EHNA 1IZ3A 3CWBH 1WB7A 2V7QG 3B0VC 4B3RO 4A4AA 1VF6C 3E8GA 4CZZA 4HFFB 1THZA 3B0UX 4JAUA 2ZXWC 4YXWG 3D3QA 2R7WA 2QWOB 4XPYA 3G67A 4JAAA 1S5LZ 1SF9A 4MVQA 4DK0A 3CMAV 1OV9A 3NYJA 1EN5A 4E0HA 5JRAA 5B1BB 3QF7A 4AL0A 4FZ1A 1MSWD 1BMFG 3MHSC 2HFIA 5ITZA 1V54C 2F93B 4FLWA 1OXBA 5J2UB 3LNNA 1H38A 4IYIA 2M6YA 1H6GA 4QDLA 3CRRA 1S7ZA 1HW1A 4JI6O 4JVSA 4K8XA 3FKSG 3E22B 1MZEA 4X1YA 4DRXB 4QI2A 2HG5C 4KNWA 1SESA 5LA6A 4DW1A 1RJ9A 1D1BA 1UFBA 2E75B 4J7TA 4IB4A 3EFOA 3UMIA 3CEXA 3H2VA 4ANJA 3RYIA 5IY5C 1B6QA 3X1OA 3SJQC 4DO2A 2YIBD 1W0JG 4JZAA 3M1CB 2QR4A 4P9FA 2A9HA 4RQEA 1YYJA 1KKCA 2YSUB 5J9PC 2ZCEA 1K5QA 1OCCC 3K66A 1K92A 2ZXRA 1E86A 4DW0A 3ATPA 2ZT9B 1BQZA 2GDCA 4IGGA 4YK5A 4LF9O 4BIUA 1DF4A 2WA3A 3RYLA 2H3OA 2QTOA 4HNAA 3OTOB 5IJ0B 1BDJB 2CAZC 3S3XA 4UVBA 5LMNB 1VQNV 4JI1O 1VK5A 2L6FA 1KBHA 1JFFA 2ZR2A 4TUYA 3EFFK 3PN1A 2AW9A 1CGNA 4WCEV 1Z6AA 5KYXB 2ADPA 4PA4A 5EBWC 5DM6V 3VQYA 3AGTA 1MQVA 4J42A 2LW1A 1VARA 1FTSA 3U5SA 2OT5A 5E1AC 1XL6A 4GKJB 3RW0A 3ZSUA 3GVMA 5LYJA 4CC6A 3CCMV 2JDIG 3TJ5A 1B06A 5L3VA 1EZJA 4TOIA 1G1XB 2JS3A 2UXBB 2QY9A 2YL3A 4I1MA 1EN4A 5LMUO 4FLVA 3FMSA 4YHHO 1OR3A 3TD7A 4DR4O 3OA1A 1JPXA 2ZKOA 3PJSK 4O7GA 5L3DA 3I4UA 3KG2A 3ASNC 4PA9A 2LSEA 2J7PD 3BRJA 3RIPA 3N2KB 2YEVA 3ZQYA 2D3OW 4QGPA 4OD5A 4BJ1A 4DR5O 1KKDA 2DI3A 4DV3O 1EA8A 3ZMSA 5C8YA 3TK0A 3CHXA 4JYCA 4DV1O 1Q0FA 2QUPA 4JTDB 3L74H 2VWKA 2X0LA 5JCOC 5JQGA 1YJGA 5GW7A 2DYRC 1AR4A 1LS1A 4I55B 1WAZA 4ABMA 1JMWA 3JAKB 1TAEA 1YYXA 4LBEC 3HKEB 2JPUA 1ZL8A 3G50A 4QE9A 1HW7A 1NR7A 1K73W 3UMHA 2GTAA 2DMXA 4PJ0Z 4FFBA 5AGFA 2QWNB 1PP9H 1N8RW 4DUZB 3M8AA 4O4IB 1Q0MA 3WB0A 4B7EA 2LFSA 4QIWF 5L0IA 5BQGA 3V5ZA 4JYBA 1NZ6A 4JZGA 4J7ZA 4X1YB 2EPKX 3BRCA 5LBQA 4YWQA 3WB1A 3DGEA 3E8FA 1I5NA 1W0KG 5LA6B 4BG0A 3C8GD 2YL7A 1BT8A 4F6RA 4JI2O 1SQFA 4JJFA 3H1IH 4IIJB 1H8HG 1AVOB 1HNXB 4N23A 3B8MA 1WP7A 2VQFO 5KYUA 5LHGA 2QDOA 2OJQA 3VYWA 4J7YA 4G7OF 2QM7A 1VYKA 4UB6Z 1RKCA 3AOUA 3E86A 3O6XA 4DOZA 1ZWIC 4ZLDA 1T01A 4X62O 5JUAA 4CDYA 1AR5A 3ZRVA 1M2OA 1ZU4A 1VQKV 2W6JG 2L6LA 2QE7G 2YL1A 3JD2A 3UCSC 2MHRA 2J8WA 1PNMA 1YA7O 1ZSPA 2CGEA 4GYCB 4J7JA 2YIDA 5LHHA 2WLNA 5IE9A 4OXSA 2Y4UA 4HNAB 1H7IA 4NTFA 3MBGA 3TK1A 3U0CA 3AG3C 4LH7A 4CS3A 4O4LB 1Q5OA 1GN3A 1V54B 2XHBA 1A7EA 3ZHRA 2WPDG 4H4KC 4YL3A 2X6AA 2ETSA 1AI7A 1DLBA 1JFFB 2EIMB 4EB6B 4HAMA 4FAPB 3C18A 1N32O 2OCCC 2F22A 4JI5O 3LS0A 3SYPA 2WLLA 4X89A 4XDJA 3PDMP 3DZAA 3LSUA 2XLVA 1K97A 4WABA 1QSPA 2BOCC 4PELA 3DXRA 3ABMC 4BW5A 5LHIA 5EZYB 1S0VA 2EJ7A 1D5AA 3SPGA 5IY5B 1XMQO 3S90A 5EBLC 1XNRB 4MW3A 5K1XA 2V1DA 3U8PA 5T3TA 3O9OA 2DB4A 1TUBA 4P9OA 3GEHA 4NXNB 1UPGA 1TQGA 3E2EA 3L34A 2WA4A 1GN4A 3M99B 3D8CA 3W7UA 5DS4A 2JIZG 1QLEC 3S29A 3Q6MA 1SKVA 4G28B 4MT8A 2NSGA 4GYTA 3T4ZA 3QW1A 5C8YB 2EBOA 1A32A 2OYQA 1LE4A 2GTSA 1Z23A 1P7BA 3GEIA 2OCHA 4Q20A 2LJ2A 3CJHB 2QJ1A 1Y76A 1YLMA 4MTFA
chains in the Genus database with same CATH topology
3FHDA 1LVKA 3NYLA 4JW1A 4U5CE 4LLEA 4G7ZF 4W8KA 3ASOC 1VOMA 1D1AA 1BR4A 2NUPB 4LACB 1MNDA 2E87A 2EIJC 3S28A 4FWVA 2CW0F 5E3AA 3DJNB 5D92A 2G62A 1IURA 3EH1A 3EGXB 5KYXA 2J46A 4O6NA 3LLIA 1MMNA 3NKEA 4HEAJ 4CS8A 2C04A 3KKBA 3AG1C 4LLCA 2XL4A 1GH6A 3JRTA 3ITFA 1SF8A 1FAFA 1ZHYA 3AG7A 5EHHA 1ZYRF 4YT5A 3NKDA 2MWQA 2Y3DA 3LLKA 2WZGA 4JCHA 5B1BC 5KYUB 2R7RA 2R7TA 4Q7CA 4U5FE 2FFHA 2J9UA 4PJNA 1MMAA 3FAJA 3NDBB 3DJUB 2A1DD 3KL4A 3JT1A 1MMGA 4RBNA 4I44A 1RJ9B 4G0HA 4QI0A 3EQLF 5DQZA 2YHSA 1O5HA 3EFOB 1N1CA 2W4BA 1TWHA 2NG1A 3Q7GA 4BJ5C 4YJWA 3LS1A 3K1HA 4PFOA 3EZHA 3OWTA 4RDAA 5KYWA 1PD1A 1M2VA 4E7SA 2KGOA 4K7BA 3B0PA 2P7VA 3EGDA 3VAYA 2YUAA 5E33A 1VYIA 3POVA 4N06A 2R7VA 4YT4A 5EGYA 1PCXA 2G3VA 1O87A 3K33A 4I1OB 2LGWA 2WVOA 1M57C 2Y39A 3EG9B 1XBLA 4KI2A 3E70C 2GUZB 1MNEA 2BE5F 2M4EA 5KYYA 2GFHA 3UGPA 2N04A 4K0DA 4CS8C 2PF4E 1SMYF 3ABKC 3S0XA 2H7BA 2IXOA 2D5RB 4FX5A 1TR2A 4WJ0A 4ULWA 3UO2A 3LNRA 5T3WA 4Q4ZF 4XTKA 3LESA 1LKXA 2G3KA 3I5QA 4YT8A 2QWRB 2J9VA 3W2VA 4C3EA 3JSZA 3BVOA 4U5HA 2EINC 1ZHWA 3H65A 4E7ZA 1OKKD 1WGWA 1J8YF 2KW3C 3CQZA 1D0YA 2Y3HA 2R7UA 2J45A 3EPVA 2C03A 4OIQF 3KMIA 3Q7LA 3WG7C 4AE4A 2Z15A 3V7OA 4OD4A 2NUTB 2IXMA 4J32B 2VASA 2A68F 4CIHA 3X2QC 2Y4TA 5D91A 4NY3A 2WVNA 2N05A 1OCOC 4HFKB 4IJJA 3S27A 2I8BA 3W8IA 4CS7A 3DM5A 2L81A 2WL8A 2PX0A 4X0RA 3MX3A 3EZIA 3UR3C 3FDQA 2J0XA 3O39A 3GODA 1MMDA 3L0IA 4A2NB 3B9QA 3HLZA 2WB7A 3EJNA 4J80A 2X51A 4U5GA 4LERA 3DAFA 3ZIBA 4G7HF 3CSKA 2Q9AA 4JURI 2CTRA 1IZMA 2EILC 1WJZA 4U5DE 4Q5SF 2CTPA 3EHNA 3RKOF 1D0XA 4U5BE 4C3DA 3UGOA 1Z3IX 4CSAC 2QWQB 3B0VC 3OEOA 4EBBA 4XLPF 4HFFB 2NUPA 3B0UX 4P6IC 2VB6A 2ZXWC 4MQ9F 3EGDB 2Q9CA 3N24A 2R7WA 2Y3BA 2QWOB 3KH2A 3EGXA 1D1CA 2O9XA 3N2ZB 1NU9C 2W9YA 2YZSA 3F46A 3K6BA 3NYJA 4PJJA 3W2WA 1FPOA 1FMWA 3JYHA 2Q3TA 3NRHA 2CUGA 4BEJA 1V54C 1V55C 4C3BA 3AG2C 2R7QA 4QDLA 2M6YA 3RFYA 4CS9A 5KYYB 1S7ZA 5F5FA 2IXPA 2MYSA 1ZHTA 3LAYA 4JVSA 4RD9A 4OINF 1NZEA 3E9VA 3WODF 2HV7A 4AX2A 3UNGC 3HTKC 5E3CA 3Q6NA 2DN9A 4QI2A 2ZXPA 3QMKA 2A6EF 2W4MA 2P6VA 4KNWA 2DGJA 2L9JA 2VH3A 3IEEA 1RJ9A 1D1BA 1TWGA 3T6JA 3EFOA 3UMIA 2LO1A 4ANJA 5IY5C 2WZLA 3NYMA 3X1OA 3N0TA 2QSAA 4JZAA 1ZHXA 3M1CB 4OIRF 2DYSC 1JPJA 3PMRA 3ZVRA 3LJBA 5FCLA 2PFDA 2IXNA 2HV6A 2XXAB 1OCCC 1FFHA 3K66A 2ZXRA 1W2WA 4O6YA 4M63A 4IT5A 2ZXOA 4GEHA 1BQZA 1BR1A 1G8XA 4EWCA 1OCZC 3SYNA 4C7OA 2H7VC 1J8MF 3RYLA 3SEOA 4F4BA 3SNHA 2CTWA 1SZIA 4IWBA 5L3QA 1QZXA 1VK5A 3T6BA 3T4RA 3UO3A 3F47A 2KQXA 3EG9A 1NU7D 1Z6AA 2WVQA 5KYXB 2GUZA 2KNHA 1Z63A 5HSWA 3PHF2 2V26A 5KYNA 3DM9B 1FTSA 3ZC4A 2KJGA 3UMKA 2WZFA 3ZSUA 4OIOF 4DVYP 1KU2A 5CI9A 5L3VA 2J7PA 3QZCA 1OCRC 1ZHZA 2OG2A 1PD0A 2IOQA 2QTVA 2QY9A 2R7SA 3AQBA 4I1MA 4KC9A 2A6HF 4IRUA 3TD7A 4KBLA 3W8HA 3OA1A 2CDQA 4O7GA 3I4UA 1BR2A 4CS9C 3EH2A 3ASNC 4IAOA 2CTQA 2J7PD 2LSEA 3RIPA 5DVWA 2YEVA 4ZLCA 1NG1A 4BJ6A 4OD5A 1ZU5A 4BJ1A 1TWAA 4J30B 3I5PA 5DQTA 5CI8A 4RWUA 1Z5ZA 4O6MA 2Y3GA 3NG1A 2XRHA 2DYRC 5KYWB 4U5EE 1LS1A 1M2VB 5BUOA 2NUTA 3JCUQ 3SZRA 3UMHA 2DMXA 2XSEA 4MNDA 2PX3A 2QWNB 2J9WA 2V3CC 5F5HA 2ZPAA 4O79A 3APQA 1NZ6A 4J7ZA 1N4CA 4YWQA 1BQ0A 3HJCA 4BG0A 5DS5A 1VMAA 3LEVA 1TKNA 3SP1A 1D0ZA 4JJFA 4OIPF 3GANA 3DD7A 2EIMC 3DMDA 5KYUA 4PJMA 4G7OF 3VYWA 3AQCA 1VYKA 3O6XA 1TWCA 4DOZA 1HDJA 5DLJA 4ZLDA 3EHMA 1M2OA 1ZU4A 1IW7F 2L6LA 2QWPB 3K1IC 5DS6A 3UCSC 2A69F 4YN0B 3RH3A 4C7OB 2CGEA 2B0JA 2IYLD 2Y4UA 2CNWA 3AG3C 1ST6A 3AG4C 4PFPA 4H4KC 4XWJA 2R7OA 5B1AC 4CBEA 2OCCC 5E2QA 3LS0A 4BJ6C 2CNWD 1JPNA 4PK4A 2YS8A 4HE8D 4YT2A 3DZAA 4AE4B 4CSAA 2R7XA 3CZ6A 4DBRA 3DAGA 4I3MA 4JJGA 4BJTA 3ABMC 2EJ7A 5B3SC 5T1DB 1FMVA 4KNVA 2FGYA 4BJ5A 1OKKA 3MLGA 2PP4A 5T3TA 2H7OA 4FESA 2J0WA 3DXJF 4B6IA 4DVZA 1M56C 2Q9BA 1FFTC 3L34A 3APOA 3ZG1A 5DS4A 1QLEC 3S29A 4AK9A 3Q6MA 2XXAA 2W45A 4GYTA 3K7DA 3ABLC 2JD3A 1Z23A 3ECSA 3FVYA 2OCHA 4PJLA 4XLNF 2KQ9A 4DBQA 2EIKC 2Y69C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWO B;  2DN9 A;  4J80 A;  1HDJ A;  4IT5 A;  3UO2 A;  2LGW A;  1BQZ A;  1XBL A;  2QWR B;  2GUZ B;  3APQ A;  1NZ6 A;  2L6L A;  2QWP B;  1FPO A;  3APO A;  1N4C A;  4J7Z A;  2CTR A;  2YS8 A;  1IUR A;  1WJZ A;  3UCS C;  2Y4T A;  2CTW A;  3BVO A;  2LO1 A;  4RWU A;  2CTP A;  2N05 A;  1BQ0 A;  2CUG A;  2QSA A;  2YUA A;  2EJ7 A;  3UO3 A;  2QWQ B;  2Y4U A;  1GH6 A;  2N04 A;  2M6Y A;  2KQX A;  2PF4 E;  2OCH A;  2DMX A;  2GUZ A;  1FAF A;  2QWN B;  2CTQ A;  3AG7 A; 
#chains in the Genus database with same CATH topology
 2ZDI A;  1LVK A;  1YXB A;  4W8K A;  4NTX A;  4LWS B;  4LAC B;  3ZMT A;  4X62 B;  5E3A A;  1GTO A;  2A0B A;  1HNW B;  1N36 B;  1M56 B;  5JVD B;  3J7A U;  3EGX B;  3RQG A;  3LLI A;  2L6G A;  1GKF A;  2EJR A;  4WBN A;  1T5E A;  5C93 A;  1WAS A;  4F6R B;  4KP4 A;  5LP6 C;  3T4D A;  1XI1 A;  3AG7 A;  1BL8 A;  1ZYR F;  3C90 A;  2Y3D A;  3RYH A;  4PD4 F;  2WZG A;  2P67 A;  4JZ2 A;  5KYU B;  1S5H C;  2BTO A;  4Q7C A;  4YL0 A;  1VQ4 V;  1KD1 W;  2YI8 A;  2N74 A;  4PJN A;  2UUB B;  1MMA A;  1JX9 A;  3NDB B;  2A1D D;  1TA8 A;  5LL6 Y;  4LF7 O;  3A0R A;  2OQM A;  2BE3 A;  1OXK A;  4DRI B;  1KNY A;  1SA0 A;  4G0H A;  4O2A B;  5DQZ A;  1O5H A;  2ZD9 A;  4LNU A;  4O4H A;  1N1C A;  2NG1 A;  1K7D A;  4DV6 O;  5CBG A;  1IDS A;  4KL1 A;  3CCR V;  2YLG A;  3K1H A;  1HNZ O;  3EZH A;  5CMU A;  5KYW A;  4DR1 O;  4K8Z A;  4Z9J A;  4I9Q A;  1LM3 B;  4AQY O;  3C7J A;  3OR6 C;  2KKW A;  3CME V;  1YAU O;  1XNQ B;  5CB4 A;  3CC7 V;  1LPE A;  3OD4 A;  3B0P A;  3JAW B;  2P7V A;  2P6J A;  2WLL B;  3EGD A;  2YUA A;  1VYI A;  3POV A;  3RBZ A;  2LFD A;  3LDD A;  1VB5 A;  1N0J A;  2R7V A;  3IC9 A;  4X64 O;  1K04 A;  1YIT V;  1PCX A;  3F7V C;  1BZK A;  5JS5 A;  4B7K A;  2WVO A;  3SJC C;  1M57 C;  2Y39 A;  3EG9 B;  5A6K A;  3HNJ A;  2GUZ B;  2EZP A;  4O2B A;  2M4E A;  5KA6 A;  1K05 A;  3US6 A;  1F23 A;  1FXK B;  3JAR A;  3AK3 A;  1OZ0 A;  2PBE A;  3K5N A;  4DRH B;  4DYL A;  4MTX A;  3LEO A;  4Z1M G;  4CS8 C;  4YJ3 A;  3A8T A;  3OUF A;  3S0X A;  2LFR A;  2H7B A;  1G4U S;  1OW8 A;  2IXO A;  1Q0G A;  2JX0 A;  5FLX N;  1OHH G;  4G27 B;  4XTK A;  3I5Q A;  4GKK O;  4IAR A;  1RSO A;  2QE9 A;  2YVK A;  4KFM A;  2OCC B;  1JJO A;  3K79 A;  3H65 A;  2VRZ A;  1M4U A;  5EYP A;  1PNK A;  5JH7 A;  3CQZ A;  1D0Y A;  1HMO A;  3SXZ A;  2F23 A;  3BAA A;  3EPV A;  3ZMV A;  4RUE A;  1FR0 A;  3ZIA G;  3ABM B;  2BSK A;  1JR8 A;  2AU5 A;  3HKD A;  1XQ8 A;  1U89 A;  2P0N A;  1E79 G;  2B1G A;  2DOS A;  4WBN B;  3CCS V;  3WG7 C;  2NSF A;  3V7O A;  4OD4 A;  4NC3 A;  4CIH A;  2PGG A;  3R65 A;  3RYH B;  3X2Q C;  1VQM V;  4YIO A;  4NY3 A;  5DED A;  5L3E A;  5KHI A;  5A69 A;  4X0R A;  3U8V A;  1F51 A;  3MX3 A;  1PV3 A;  1LUW A;  3OMA B;  4ONS A;  1FJG B;  3GOD A;  3L0I A;  3AJM A;  3JCZ A;  1YEW A;  2LD6 A;  1YCI A;  4HBN A;  1FFX B;  1SA0 B;  2X51 A;  1JQ0 A;  1YA9 A;  4O4H B;  4EBJ A;  2Y69 B;  3PCV A;  1U97 A;  3IJ4 A;  3CC2 V;  4G7H F;  2KG7 A;  1YVI A;  1Q82 W;  4X65 O;  1XDC A;  2YXH A;  1M6T A;  1WJZ A;  3J06 A;  3GWO A;  1FNT c;  3RKO F;  1D0X A;  4U5B E;  3KKY A;  4GUN A;  3UGO A;  1Z3I X;  5KHG A;  1I7F A;  4B3S B;  5IYD O;  2W0X A;  4B3M O;  2H8P C;  2NUP A;  2VB6 A;  2YI9 A;  4BAY A;  4BIO A;  3EGD B;  1F7Y A;  3G4Z A;  4DR3 B;  1K5S A;  2IBF A;  2AWC A;  2YZS A;  3F46 A;  1QLN A;  4E0I A;  3BCC H;  3AGU A;  4UDV A;  2YXY A;  2IU3 A;  3JSN A;  1Z7Q c;  4DV2 B;  3BAB A;  5JJE B;  4MVZ A;  4FMT A;  4K35 A;  4CDV A;  2EPN A;  2KSD A;  4CH4 A;  2CUG A;  3NRH A;  4BEJ A;  5FPO A;  1K9M W;  2WLH A;  1V55 C;  1Y4M A;  4O2B B;  3UT5 B;  3AG2 C;  1JOG A;  4CS9 A;  4DV7 O;  5AC4 A;  2IXP A;  3JAR B;  4DV0 O;  3LAY A;  4LF8 O;  4RD9 A;  1W2B U;  1NZE A;  3E9V A;  3TJ6 A;  1RPR A;  2HKV A;  2DQ0 A;  3QMK A;  1FYJ A;  4YJ3 B;  2A6E F;  2P6V A;  4G78 A;  5L3B A;  2UXD O;  3IEE A;  3RFR A;  2OEX A;  3T6J A;  2LO1 A;  4ZHQ A;  3ZTM A;  1ZW2 A;  3SJB C;  2WZL A;  2IH3 C;  3GB7 C;  2QSA A;  1RSO B;  3E83 A;  1Q0D A;  3RF3 A;  1QVX A;  4NYK A;  1HE9 A;  2HHH O;  4OIR F;  2DQ3 A;  3JTL O;  3ABT A;  5FCL A;  4XDK A;  2XXA B;  3RYC B;  1FFH A;  4WFE A;  4IT5 A;  1FXV A;  2ZXO A;  4GEH A;  5CIV A;  2XT9 A;  3SYN A;  1MSD A;  2H7V C;  4UUJ C;  2A3Q A;  1NU1 H;  5GTH Z;  4LH6 A;  3N2G A;  3DTU B;  4EBK A;  2XL6 A;  2DWE C;  3ZRW A;  5BQH A;  5IYZ A;  5FPR A;  4ER9 A;  1VQ9 V;  1O9G A;  1K4D C;  1QPU A;  5B5E Z;  1NSG B;  2WVQ A;  1Z63 A;  1SR2 A;  1Q43 A;  2O57 A;  1AB3 A;  2DYS B;  5KYN A;  3I55 V;  3DM9 B;  5AG2 A;  2RD9 A;  4JTC B;  2KJG A;  1HR0 B;  3VQW A;  2CYD A;  3K1I A;  3TOM A;  3BFR A;  3WHN A;  3G4X A;  4DVY P;  5L0H A;  3QVZ A;  4U3J A;  2AVK A;  5EC2 C;  2KSF A;  1CPR A;  4DK1 A;  3QZC A;  2WLI B;  1ZHZ A;  1D5N A;  3IFX A;  1VQL V;  2OG2 A;  2R7S A;  2PNO A;  4UCV A;  3AQB A;  1KU9 A;  3MDS A;  3A9C A;  2JGD A;  2KG7 B;  3JAT A;  2A6H F;  2R9I A;  4IRU A;  4DR2 B;  3KYI A;  1YIJ V;  4EKW A;  2Q73 A;  3G6B A;  3MD0 A;  5E79 Z;  4DV7 B;  4P9P A;  1FXH A;  2B9Z A;  1AJQ A;  3OGI B;  2RN9 A;  2NLJ C;  1TWA A;  2VS0 A;  1I4Z A;  4J30 B;  1T6Q A;  3I5P A;  3OTO O;  1I4Y A;  4RWU A;  3CEI A;  4O6M A;  4PA7 A;  3CCU V;  4DJ9 A;  2Y3G A;  1QCE A;  4X1I B;  2GWW A;  2XRH A;  1QKR A;  5BY1 A;  3NG1 A;  4LDK A;  3X2Q B;  4UV8 A;  1GMG A;  5TIS Z;  3UKM A;  4AL1 A;  5BUO A;  2QNL A;  2NUT A;  3SYA A;  2HHH B;  2PX3 A;  2CGN A;  1CXZ B;  4GKJ O;  2XAG A;  2D4U A;  4UFZ A;  2V3C C;  3W7S A;  5F5H A;  2Z0A A;  3MYI A;  3P3N A;  3GWN A;  2AWY A;  3APQ A;  1OW7 A;  2UXB O;  4GX5 A;  1VMA A;  4IAQ A;  1TKN A;  1TUE B;  1EM1 A;  5H9C A;  4BWA A;  4XPW A;  3KCX A;  4I5S A;  3DD7 A;  2NN4 A;  2EIM C;  3VQX A;  1HWY A;  3QVN A;  3G80 A;  4O4J A;  4PJM A;  1VLT A;  2B0H A;  5FL7 G;  4E18 A;  4KHP B;  3BA9 A;  1URF A;  2L35 A;  2Y48 A;  3AK1 A;  5B66 Z;  1IW7 F;  2QWP B;  4UCT A;  3NMK A;  4JPR A;  1KMI Z;  4YN0 B;  5KMG A;  3AEI A;  2B0J A;  1R4T A;  3SPH A;  3STZ C;  2VCA A;  1AEP A;  2CNW A;  1HW2 A;  2RCV A;  1ARO P;  2KK1 A;  4PFP A;  3UM7 A;  3CCE V;  4TV8 A;  3DKA A;  1V55 B;  1DF5 A;  3IQ6 A;  4R8C A;  1ZVZ A;  3AG2 B;  4DUZ O;  1I94 B;  4XWJ A;  2R7O A;  3ZMU A;  3RVZ A;  1WPX A;  5B1A C;  4D4N A;  1GS9 A;  1K33 A;  3BHP A;  5E2Q A;  1R3J C;  2M7W A;  2Q0O C;  1JPN A;  1EQ1 A;  2MW2 B;  4PK4 A;  2CH7 B;  1QVG U;  3HR0 A;  3T9O A;  5B1O A;  1VQ6 V;  3DAG A;  4JJG A;  4MTG A;  3CP1 A;  1IXB A;  2EX3 A;  1HNX O;  2XLH A;  4K0K O;  2RJZ A;  4YJ2 A;  1ZLZ A;  4KNV A;  2R72 A;  4BJ5 A;  1OKK A;  3MLG A;  2XAS A;  2IJK A;  3H9V A;  1YHQ V;  1SC5 B;  4LFC B;  4ZI7 A;  2FB5 A;  1DOW A;  3FB5 C;  1RFY A;  2FKX A;  3HKB A;  1ORS C;  4UCU A;  2WLM A;  1M56 C;  3H1J H;  2PI4 A;  3ZHV A;  1VTM P;  3ZN1 A;  3O10 A;  2Q8V A;  5A6B A;  3ZHQ A;  1YJ9 V;  3WAQ A;  4AK9 A;  3U9M A;  1YZA A;  4I50 A;  1AI4 A;  1HMD A;  1XWJ A;  2JD3 A;  1CPY A;  3I5D A;  2R9A A;  3FOP A;  4PJL A;  3LUT B;  4NR1 A;  2A0U A;  2PI5 A;  1X4T A;  4PI0 A;  2EIK C;  4FLY A;  3OFN G;  1Q86 W;  3FHD A;  4I4T A;  3H1H H;  3NYL A;  5CBH A;  4NQF A;  1KP2 A;  5KUK A;  1AR1 B;  3C63 A;  2E87 A;  3S28 A;  2EIJ C;  2CW0 F;  3DJN B;  1IUR A;  4U3F H;  4CJG A;  4UB8 Z;  3C8Z A;  3JAS A;  4DV5 B;  2UUC B;  2J46 A;  3QVY A;  5GTI Z;  1SER A;  2HR3 A;  1MMN A;  3QNE A;  3CCJ V;  3NKE A;  5LXT A;  3B40 A;  2C04 A;  1XNR O;  1GH6 A;  4C7U A;  3A0H Z;  4LF5 B;  3ITF A;  1SQQ H;  1BHB A;  4XEV A;  1YSC A;  1L8D A;  1ZHY A;  1XIL A;  5ITZ B;  1PV0 A;  3D36 A;  3NKD A;  1W59 A;  4NVP A;  4NXN O;  2OIE A;  2UXC B;  2P7T C;  4HYO A;  1YDX A;  4U9D A;  4U5F E;  3RYF A;  3JZ0 A;  4ULV A;  3O55 A;  1TGO A;  1V74 B;  3ASO B;  1Y66 A;  2QKA A;  2R70 A;  3FAJ A;  2ZE5 A;  3QO5 A;  3B77 A;  3MYF A;  1BS3 A;  1MAB G;  3JAM N;  1RJ9 B;  2F66 C;  4MVR A;  3EQL F;  5KMG B;  3EFO B;  3U3B A;  1LS4 A;  3RYI B;  4K0K B;  2ZE8 A;  1TWH A;  2W4B A;  5L0G A;  5BMV A;  3OTF A;  5CA0 A;  5TJ5 E;  4PFO A;  1AJN A;  2RQ6 A;  4RDA A;  1GM7 A;  2BOB C;  1HNW O;  1M2V A;  1N36 O;  4E7S A;  1FXK C;  4ZBM A;  4X66 B;  2R03 A;  1PL0 A;  1DTO A;  2FL4 A;  2IU0 A;  2KGO A;  3P3P A;  1Y74 A;  4NTY A;  5LGT A;  3T1C A;  3QTC A;  3VAY A;  2ZIN A;  4GX1 A;  1F4M A;  2B5U A;  3M4B A;  1P7G A;  1K4C C;  5JSL A;  5JP7 A;  2CGO A;  3S84 A;  5GPG B;  4YT4 A;  5EGY A;  2G3V A;  1O87 A;  4TQF A;  4YJ2 B;  1IBL B;  1VQ5 V;  4TUY B;  2LGW A;  1XBL A;  4H33 A;  5F2V O;  2ZDI C;  2PYJ A;  3E70 C;  1KB9 F;  3N27 A;  4X20 A;  4L87 A;  1Z2G A;  2UUB O;  2BE5 F;  3ZQV A;  3G71 V;  4ICG A;  1AI5 A;  3HKB B;  4AHC A;  5KYY A;  4Z2W A;  2GFH A;  4MVO A;  1COW G;  1T6U A;  5LYJ B;  4JI7 B;  4NTA A;  3I56 V;  3UGP A;  2N04 A;  4K0D A;  1S77 D;  4FM0 A;  4FLZ A;  4EHP A;  1FS0 G;  2D5R B;  4J41 A;  4FX5 A;  1TR2 A;  3M4C A;  1KQS U;  4ULW A;  4QPK A;  3UO2 A;  3LNR A;  4Q4Z F;  1LKX A;  3K58 A;  1L1F A;  4H13 B;  4CH5 A;  2E5L B;  1Q3E A;  2J9V A;  5B1A B;  4IHJ A;  3C62 A;  3SYC A;  2ZNJ A;  4IL6 Z;  1YJN V;  1XNQ O;  4U5H A;  3BVO A;  2YEV B;  4LF6 B;  2PZS A;  3ZX6 A;  1ZHW A;  1AP5 A;  2UUI A;  2FTK A;  3CRC A;  2KW3 C;  1GM5 A;  1HY5 A;  2L6H A;  2XND G;  2J45 A;  1MZF A;  1NH2 B;  3L73 H;  1BSM A;  3JAS B;  4D6T H;  3TJT A;  5IYC O;  2Q00 A;  1M5I A;  3H1L H;  1Y6X A;  5JQG B;  5BR8 B;  2OWO A;  3V5X A;  4OIQ F;  3KMI A;  4GX2 A;  3VRC A;  3B29 A;  4AE4 A;  2JS5 A;  2Z15 A;  4R32 A;  3ZRS A;  2X6B A;  1ZL8 B;  1P4R A;  3NR7 A;  4JV5 B;  5L0F A;  4FFB B;  2VWJ A;  2HJ3 A;  2VAS A;  1UFI A;  1T5O A;  2Y4T A;  5L3F A;  2N05 A;  4CS7 A;  2Q5Z A;  2I8B A;  2YQY A;  1Z5V A;  2XAF A;  3RYF B;  1R6T A;  1N0N A;  2A79 B;  2AGA A;  2EIN B;  2OOC A;  3EZI A;  4E17 A;  1VF7 A;  3MAQ A;  2V4D A;  3SJA C;  3FDQ A;  5H5N A;  4W4K A;  1APC A;  2EPO A;  4YY3 B;  4TSF G;  4E2L A;  1KEC A;  3CSX A;  1EZV H;  1SQB H;  1T6I A;  1IBK B;  3HNK A;  3B9Q A;  3HLZ A;  3DC5 A;  3ZHU A;  4MVS A;  4U5G A;  2JK5 C;  3EVK A;  1XHX A;  3DAF A;  1QBZ A;  2EIK B;  1WA8 A;  3ZIB A;  3CSK A;  1PL4 A;  2K9P A;  2CTR A;  5BMV B;  1B04 A;  1IZM A;  1JCH A;  2EIJ B;  2LQT A;  1XHZ A;  4WGY A;  2LP7 A;  4C3D A;  1SZT A;  2UXX A;  4CSA C;  4BPM A;  1L0N H;  3K03 A;  2G38 A;  2ZIM A;  2HJM A;  3VM6 A;  5DEC A;  1NT2 B;  3SYO A;  1H8E G;  1ORY A;  2Y3B A;  3KH2 A;  1Q6H A;  2PTM A;  3G4S V;  1D1C A;  2O9X A;  5LGU A;  3N2Z B;  1NU9 C;  1H2L A;  2W9Y A;  5FZT A;  3OAA G;  5L0J A;  3D3I A;  3W7X A;  1I5Y A;  3W2W A;  1FPO A;  3HB3 B;  5KLV H;  4GZR B;  1OW6 A;  2VCC A;  4OX9 B;  2Q3T A;  5F28 E;  4X20 B;  5KHK A;  5HV9 A;  3ETD A;  3CCV V;  1FJG O;  1WPB A;  4QPJ A;  3RFY A;  4UVC A;  5KYY B;  4DR6 B;  2MYS A;  1ZHT A;  3DXR B;  1K40 A;  1G8M A;  3UNG C;  3HTK C;  1N34 B;  2I15 A;  4LR3 A;  3T1Y B;  3Q6N A;  4J10 A;  2HJF C;  1XMO B;  2YDE A;  1Y67 A;  4TWK A;  4JAV A;  3GEE A;  3CD6 V;  1TWG A;  5LOV A;  3MFN A;  3UQ8 A;  4JKV A;  1NVP B;  1TUB B;  5L0C A;  1WAT A;  1WTY A;  3NYM A;  1M93 A;  3VQV A;  3JSL A;  4IHJ B;  4B3S O;  4TV9 A;  2LQG A;  1ZAU A;  2DYS C;  1JPJ A;  3PMR A;  4XQ1 A;  1NR1 A;  3ZTZ A;  5KHH A;  1YJW V;  4OGQ B;  1J5E B;  3U9J A;  4DR3 O;  1L0L H;  2QM8 A;  2HV6 A;  3RGB A;  4N4W A;  2GV9 A;  4LF4 B;  1W2W A;  2QKS A;  4GT1 A;  1BR1 A;  1R3I C;  4L6R A;  4JYY A;  1J8M F;  3IQC A;  4DV2 O;  3NMI A;  2Z5U A;  4JEB A;  1Y76 B;  4K3A A;  4LDR A;  5IWA B;  3W4Y A;  1VLS A;  2CTW A;  1SZI A;  5L3Q A;  4EEQ A;  1PD3 A;  3T4R A;  2HFE C;  2IM9 A;  4DUY B;  3UO3 A;  3F47 A;  4UCS A;  3SDL A;  1NU7 D;  3B8N A;  2CCY A;  2KNH A;  2V26 A;  1U96 A;  2CK3 G;  2PUS A;  3KYJ A;  2WZF A;  2RMK B;  1XL4 A;  1KU2 A;  1OCZ B;  5CI9 A;  1ZW3 A;  1Q6U A;  3FB6 C;  1OCR C;  1QU7 A;  4LFA B;  1S76 D;  1PD0 A;  2IOQ A;  2LGQ A;  3MHH C;  1NBM G;  4KC9 A;  1NTK H;  3ZRX A;  3L8I A;  2XLO A;  5KAI Z;  1ORQ C;  4KBL A;  3U10 A;  3W8H A;  4EUK B;  1DGS A;  4IYH A;  4CS9 C;  3EH2 A;  4IAO A;  3THO A;  2Q9L A;  4JI4 B;  5AC5 A;  2XL8 A;  3JD1 A;  2ATK C;  4BJ6 A;  1U0B B;  4LNU B;  2P1A A;  1WWP A;  4XEF A;  5DQT A;  3LNM B;  1Y4C A;  2R05 A;  1BZ4 A;  3GOR A;  2R9R B;  5HFL A;  3T1H B;  1E85 A;  2KB1 A;  4U5E E;  5KYW B;  1H9T A;  5JJJ B;  1JRA A;  4FZ0 A;  1HE1 A;  2XOK G;  4JCZ A;  3JCU Q;  3DSQ A;  5J2T A;  3SXY A;  2XSE A;  3K5O A;  5CB4 B;  2K1E A;  5HFM A;  4ASU G;  2YIA A;  1HR0 O;  3R66 A;  1QQ3 A;  2JJ2 G;  2J9W A;  1MG1 A;  1ORJ A;  1SQX H;  4I7Z B;  2DWD C;  4XPX A;  4RUF A;  4PDL A;  1BQ0 A;  2C2A A;  1WN0 A;  2L7A A;  4PI2 A;  5DS5 A;  2ILM A;  1ZTE A;  3Q4H A;  4ZIB A;  3LEV A;  4DR2 O;  3SP1 A;  1ROP A;  2WWW A;  1NTZ H;  3GWL A;  3M79 A;  4TT3 G;  3QO7 A;  1NS1 A;  3G6E V;  3HKK A;  3K0G A;  1BBH A;  2LCH A;  1SS3 A;  5IDJ A;  4TV9 B;  2BL2 A;  2ZM6 B;  2HP8 A;  4MTO A;  5EC1 C;  2HUJ A;  2UUA B;  5DLJ A;  3EHM A;  4UCR A;  3L8J A;  3EXA A;  1IBM B;  4NTB A;  3HNI A;  3K1I C;  3FAV A;  4I9W A;  2A69 F;  1CEZ A;  5JLI A;  4CH6 A;  2FYU H;  4LFB B;  1Q90 D;  2VQE B;  3CRQ A;  2IYL D;  3VOU A;  4DR7 B;  1ST6 A;  5EK0 A;  1Q81 W;  2IM8 A;  4DV4 B;  4EFE A;  4LC1 A;  1S72 V;  5EYP B;  1YZC A;  4MVU A;  5FNV A;  5JH7 B;  4MSW C;  3LDC A;  3J80 N;  1N33 B;  2WLJ A;  1E1R G;  1RKE A;  2BSK B;  4B3T B;  1KYO F;  3HKD B;  1AUE A;  5J2U A;  2CNW D;  3TOL A;  3OMI B;  3OE7 G;  3B71 A;  2YS8 A;  4I0X A;  4HE8 D;  4XEK A;  4YT2 A;  2JRI A;  3CAX A;  3CZ6 A;  4MVM A;  4BJT A;  2OTL V;  4U7N A;  3E22 A;  1YZB A;  4Z9I A;  4DRX A;  1WN7 A;  1RP3 B;  2CDY A;  2OKU A;  5T1D B;  4F4L A;  1GK9 A;  3CB2 A;  2GSM B;  5CA3 A;  2PP4 A;  3CXH F;  3AG4 B;  4KHP O;  1GRJ A;  3LSS A;  2H7O A;  2R25 A;  4FES A;  2J0W A;  2Q4F A;  1AVM A;  3DXJ F;  4B6I A;  1EN6 A;  4R6Z A;  3JYY A;  1JMK C;  1OJH A;  1M1K W;  3ZG1 A;  3SPC A;  4PA3 A;  2AHZ A;  4J11 A;  2OJE D;  1WP8 A;  1X59 A;  2XLD A;  2YC0 A;  1EBO A;  3K7D A;  3LSQ A;  2D2C B;  1D2D A;  3K08 A;  3GWK C;  3FVY A;  4U9E A;  1K34 A;  1I94 O;  4JI0 B;  1UG7 A;  1VQ8 V;  2Y69 C;  1JAF A;  5IJ0 A;  5A6B D;  3JAL A;  1NKD A;  4U5C E;  4G7Z F;  5L3C A;  1GO3 F;  2F4V B;  4LLE A;  3E89 A;  1WB8 A;  3ASO C;  3SR2 C;  4JYA B;  1D1A A;  2NUP B;  1MND A;  4NXM B;  4FWV A;  3J81 N;  2Q4P A;  2Q68 A;  5D92 A;  2AHY A;  1FFT B;  4PA6 A;  4OPA A;  5KYX A;  3A11 A;  1LE2 A;  4HEA J;  2BC5 A;  3AG1 C;  4LLC A;  2XL4 A;  1OCR B;  1NJI W;  4GX0 A;  1R3K C;  3K3W A;  2X0C A;  3JRT A;  1H2K A;  3ABL B;  4MS2 A;  4CBC A;  4LFC O;  2IH1 C;  1FAF A;  1WOL A;  3Q4H B;  5JT4 A;  1SYQ A;  1NH2 D;  2XM0 A;  3CX5 F;  2GA0 A;  2NNU A;  1VQ7 V;  2FML A;  4FLT A;  1FAP B;  3JD3 A;  4X1K A;  2ZQM A;  3K5M A;  1QVF U;  2R7T A;  4Z9H A;  2PY5 A;  2LK4 A;  2B1I A;  3GM1 A;  3C3S A;  2J9U A;  4NB5 A;  1MNG A;  4D7S A;  4FLX A;  1NLX A;  3DJU B;  2TMV P;  4FJC C;  4F6E A;  5IT9 N;  4NKG B;  4WFF A;  4RBN A;  5D5Q A;  3N2K A;  4I44 A;  3FAV B;  3H2U A;  4QI0 A;  3OW2 U;  2YHS A;  4ZHQ B;  1TFK B;  3CCQ V;  4JI8 B;  4JTA B;  1TFO B;  4BJ5 C;  1IVS A;  3FB7 C;  2F95 B;  4YJW A;  2KC3 A;  1LR1 A;  3C3T A;  3OWT A;  3U3F A;  4N21 A;  2P5O A;  5KHJ A;  5FNV B;  4I55 A;  3JAK A;  2HMZ A;  4DV5 O;  3HKE A;  1DK1 A;  2UUC O;  2YRF A;  1RKE B;  2ZNI A;  4K7B A;  5JVE A;  5COM A;  2ICW G;  1QNM A;  4KUM A;  4LF5 O;  5E33 A;  4I0X B;  2EPL X;  1AI6 A;  2IW5 A;  3TXS A;  4O4I A;  1C17 M;  4N06 A;  3N2G B;  1MMM A;  3IPM O;  3M15 A;  3TQO A;  3K9A A;  3FB8 C;  4PV1 B;  3SPJ A;  2ITC C;  3ZRW B;  3E8H A;  5IYZ B;  1VEW A;  3BPZ A;  1M90 W;  2UXC O;  3K33 A;  4JRZ A;  1OR2 A;  2LFF A;  2YL0 A;  1VF5 B;  4KI2 A;  3TGU H;  3DC6 A;  3BA8 A;  1QHT A;  1S05 A;  1VQP V;  5CN0 A;  1MNE A;  4IIJ A;  3IGA C;  1JA8 A;  3VBB A;  3CRM A;  4NTW A;  4GCZ A;  3RVY A;  3OEE G;  1E2X A;  1ZX3 A;  4JI3 B;  3ZMZ A;  3K06 A;  4J7K A;  1VF6 A;  4X9Q A;  1FD9 A;  2XS1 A;  3ZHT A;  2DE0 X;  2JGU A;  4U3J B;  4PDR A;  1SMY F;  1XZQ A;  1QQC A;  2Z3Y A;  2UU9 O;  1KP3 A;  3NMJ A;  5L3G A;  2JGD B;  3JAT B;  4WFA V;  3FXH A;  4WJ0 A;  1K3E A;  2XLM A;  5T3W A;  4PHZ A;  3LES A;  3D36 C;  4YT8 A;  4X66 O;  1RMV A;  3JAL B;  4BR6 A;  2WLK A;  4O4L A;  2EIN C;  4LP8 A;  1J8Y F;  4EB6 A;  2R7U A;  1SQV H;  1PNL A;  5LGN A;  1NVP D;  3OM3 B;  3ZN0 A;  2Q7H A;  2C03 A;  2X6C A;  4B3R B;  1KTM A;  3CYO A;  1BHA A;  5BQI A;  2M64 A;  1IBL O;  3Q7L A;  1H2G A;  3ABK B;  4LCU C;  3OGC C;  2XM4 A;  1XUQ A;  5EZY A;  2IXM A;  2NUT B;  3ML0 A;  3JSE O;  1BGY H;  3FFQ A;  3QW0 A;  3H1K H;  3S3W A;  3IAY A;  3T2M A;  4LDQ A;  3CXC U;  4X1K B;  2WVN A;  4IJJ A;  3S27 A;  1PPJ H;  1NI8 A;  3DM5 A;  3W8I A;  4JI7 O;  4FK5 C;  2L81 A;  4JC7 A;  4HZ3 A;  4PR9 A;  2CE4 A;  1RM1 B;  2J0X A;  1A7V A;  3TXQ A;  1MMD A;  4A2N B;  4JI6 B;  4FLU A;  4AIL C;  1LI5 A;  256B A;  2E5L O;  1QR8 A;  3DE9 A;  2ADQ B;  1A41 A;  4EFB A;  1LNQ A;  4JAS A;  4O4J B;  4W4L A;  1JVM A;  1VP7 A;  2Q9A A;  2HSQ A;  4G2K A;  4LF6 O;  2EIL C;  3HKC A;  4U5D E;  4EIY A;  4Q5S F;  4CDA A;  1CGO A;  4FM1 A;  3K0D A;  2XAJ A;  2Y0P A;  1JR9 A;  3CJH A;  3WU2 Z;  4FVM A;  1Q0K A;  1OCO B;  4BW9 A;  2QWQ B;  4B08 A;  2DW4 A;  5DN6 G;  3OEO A;  4EBB A;  2GAQ A;  5BR8 O;  3L1M A;  4FFK A;  4XLP F;  3L70 H;  4LWS A;  4P6I C;  2QM4 A;  3AG1 B;  4MQ9 F;  2Q9C A;  1H2M A;  3N24 A;  1R73 A;  5JVD A;  3OR7 C;  3EGX A;  4JV5 O;  2ZE6 A;  4TV8 B;  3K6B A;  1R1B A;  4PJJ A;  4LF9 B;  1WLE A;  2P61 A;  1FMW A;  2OEV A;  4R7C A;  2GBO A;  3K57 A;  2QLA A;  3JYH A;  1YTF B;  1R6N A;  4JI1 B;  4C3B A;  5A6A A;  1GN6 A;  2HVK C;  3ETQ A;  4YY3 O;  2R7Q A;  5F5F A;  2J9B A;  1IBK O;  2R7X A;  4OIN F;  3W7W A;  3WOD F;  4QE7 A;  2HV7 A;  4AX2 A;  2NPU A;  1QR9 A;  2P90 A;  4U7O A;  2YIB A;  5E3C A;  2DN9 A;  2ZXW B;  2IJH A;  2ZXP A;  2W4M A;  1I08 A;  2HEP A;  4WFG A;  3BY6 A;  3GM3 A;  2DGJ A;  2L9J A;  2VH3 A;  2EUL A;  2R02 A;  4X88 A;  1E83 A;  1YAR O;  1S3J A;  4ZI7 B;  4O2A A;  5JCO A;  1OQC A;  4QNH B;  5BZB A;  1PKX A;  3AK2 A;  1BE3 H;  2HZ8 A;  1E84 A;  4J9Z B;  3U11 A;  3N0T A;  1VMG A;  1H9G A;  2Q69 A;  1ZHX A;  3JCU Z;  3K04 A;  1NBB A;  3TUL A;  5LMU B;  3ZVR A;  4YHH B;  3RN4 A;  4DR4 B;  3LJB A;  2JEU A;  2PFD A;  2X7R B;  2IXN A;  3ZDL A;  2E76 B;  2KYH A;  3SPI A;  4I50 B;  4O6Y A;  4M63 A;  4UVA A;  2H94 A;  2Q67 A;  2HKO A;  1G8X A;  4EWC A;  4C7O A;  1OCZ C;  5EBM C;  1R3L C;  3JAW A;  4L8J A;  4MW8 A;  4DR5 B;  3P32 A;  4DV3 B;  3SEO A;  4F4B A;  4H44 B;  2EZO A;  5KAF Z;  3SNH A;  1IXM A;  4OX9 O;  4IWB A;  4I4T B;  1CGM E;  1QZX A;  2YLD A;  2YLI A;  2ODM A;  3BEH A;  4DV1 B;  3NXS A;  3T6B A;  3ZHS A;  3P30 A;  1Q7Y W;  2DJV A;  2IJJ A;  4DR6 O;  1P49 A;  2KQX A;  3EG9 A;  2AP3 A;  1XZP A;  1NQT A;  2F1M A;  5A2Q N;  2GUZ A;  2ZIO A;  1N34 O;  5HSW A;  3PHF 2;  3T1Y O;  3FOO A;  5LXT B;  1XMO O;  3ZC4 A;  2XUM A;  1YI2 V;  4NCQ A;  3UMK A;  1OCC B;  4WFH A;  5K1P A;  1L7C A;  1H2N A;  1FXK A;  2MK3 A;  2RDC A;  3B2E E;  4CH3 A;  4W8P A;  4OIO F;  2YWA A;  1U6H A;  2J7P A;  2ZE7 A;  2JVD A;  5JJN B;  1O9H A;  3DWW A;  2QTV A;  4ZOL A;  4Z1V A;  3VF0 A;  4CJO A;  3SXM A;  3CS5 A;  4KXR A;  3HKC B;  4JI2 B;  3LDE A;  3OEH G;  4CC5 A;  1KC8 W;  3QG5 A;  1VQO V;  1J5E O;  2CDQ A;  5A6J A;  1BR2 A;  3CC4 V;  2LIG A;  2VQF B;  4LF4 O;  2BTQ A;  2CTQ A;  5DVW A;  1TVK A;  4P30 A;  1EI7 A;  4ZLC A;  1NG1 A;  1ZZP A;  4WF9 V;  1ZU5 A;  4GQH A;  5IWA O;  4R50 A;  1G4W R;  3U2L A;  5CI8 A;  1Z5Z A;  1Y6D A;  5CA0 B;  4DUY O;  2AZ0 A;  5H6Q A;  3FYE B;  1F1M A;  1M2V B;  1AJP A;  2E74 B;  2JJ1 G;  3SZR A;  2A06 H;  1Y74 B;  4MND A;  5CA1 A;  3C8G A;  4JGS A;  3RQE A;  3ASN B;  4BIZ A;  4D4X A;  1N32 B;  2ZPA A;  4O79 A;  3K9S A;  3QO8 A;  4JI5 B;  3W7T A;  2OU6 A;  1N4C A;  3JD0 A;  3GM2 A;  3CCL V;  2HJD A;  4LFA O;  4OPH A;  4CX9 A;  3HJC A;  2Q7E A;  2EIL B;  1D0Z A;  1GAX A;  1FFX A;  4OIP F;  3GAN A;  3ZCC A;  2DYR B;  2GHY A;  5IJ9 A;  2XLW A;  5L0D A;  1XMQ B;  3DMD A;  2ETN A;  2P4V A;  2QGN A;  4JI4 O;  5B1N A;  3CE2 A;  3AQC A;  5CBF A;  3CRA A;  3ZJZ A;  1TWC A;  5COF A;  3JRM O;  1HDJ A;  3V5Y A;  3FX7 A;  3K5L A;  3KCY A;  1SZX A;  4Q6G A;  3OUS A;  2YIC A;  1EKY A;  1PM9 A;  3KZI Z;  3QTH A;  5DS6 A;  1XEQ A;  5D5P A;  3RH3 A;  4C7O B;  3T1H O;  2IJI A;  3F5T A;  4DXW A;  1MOF A;  2Q7G A;  2ARH A;  2VCB A;  1JOY A;  2VC9 A;  3AG4 C;  4JE9 A;  2ZR3 A;  3SGI A;  5LP6 A;  4CS2 A;  3E8B A;  1US6 A;  5JWP A;  3ZBH A;  2P06 A;  3A2F A;  4P9T A;  4CBE A;  2UU9 B;  2LP4 A;  2E3C A;  2GDS A;  1V9P A;  2LW7 A;  2XS8 A;  1O3U A;  4BJ6 C;  3UT5 A;  5KUM A;  4RAI A;  4AE4 B;  4CSA A;  4DBR A;  3H01 A;  3A0B Z;  1RCP A;  4I3M A;  2QA4 V;  1GM9 A;  1SQG A;  4UCO A;  5B3S C;  3F7Y C;  1I0H A;  4BEM J;  1FMV A;  3T6G B;  2FGY A;  5KA5 A;  1GM8 A;  4ZOL B;  3AG3 B;  2Q7R A;  2ZM6 O;  3HPL C;  1BCC H;  2UUA O;  2UUH A;  2RSE B;  3L9D A;  3IQ5 A;  1K8A W;  1E1Q G;  1R5I D;  4DVZ A;  4JF3 A;  1R6K A;  3SYQ A;  1IBM O;  2Q9B A;  2BTQ B;  1FFT C;  3APO A;  1TVK B;  1GQA A;  3E35 A;  3TET A;  2XXA A;  4LFB O;  3RYC A;  2VQE O;  2W45 A;  3M7M X;  4DR7 O;  1WA8 B;  3FYI B;  1J95 A;  3ABL C;  4N6C A;  4LF7 B;  3IQT A;  1G6U A;  4DV4 O;  1RXQ A;  3ECS A;  2NR5 A;  1C02 A;  1Q8I A;  4XLN F;  3IHU A;  1JJ2 U;  2W6I G;  4JEA A;  1Z5W A;  1N33 O;  2KQ9 A;  4DBQ A;  5B3I A;  3ABU A;  4H0L B;  2QTS A;  2H8A A;  4DV6 B;  4JW1 A;  3HNL A;  4B3T O;  4WGZ A;  4PDV A;  1VOM A;  3ETE A;  1BR4 A;  4CIP A;  5CA1 B;  1HNZ B;  2YKZ A;  3C8G B;  1LI7 A;  2W0F C;  4GLX A;  4YL1 A;  4DR1 B;  2G62 A;  3WB2 A;  3EH1 A;  2YXL A;  3L75 H;  4AQY B;  4JIO A;  4O6N A;  3FD9 A;  3FAP B;  4CS8 A;  4A5U B;  3OT7 A;  3KKB A;  2P22 C;  1QLE B;  1Q6I A;  1SF8 A;  1F4N A;  4FPP A;  1XRE A;  1V4A A;  4AI8 A;  2HVJ C;  1YDI A;  5EHH A;  4YT5 A;  3IC7 A;  4X64 B;  2MWQ A;  3LLK A;  5B1B C;  2WLI A;  5IJ9 B;  4JCH A;  2WSS G;  2R7R A;  2XLE A;  2FAP B;  2FFH A;  3B09 A;  5A9G A;  2EPM X;  3RQF A;  5KX5 A;  4P2Z A;  3KL4 A;  2XTA A;  3JT1 A;  5GON A;  1MMG A;  4QJF B;  4N6H A;  1NTM H;  1G5Z A;  3WFV A;  4JI0 O;  5LOV B;  1KUQ A;  1YVW A;  4TQD A;  1AIL A;  1XOU A;  2Q6A A;  3Q7G A;  3L71 H;  2F4V O;  2HLD G;  4PDM A;  1B3Q A;  4JYA O;  1GGQ A;  3LS1 A;  5LP6 B;  5H6R A;  3DE8 A;  4H54 A;  4NXM O;  1LIH A;  4X1I A;  4RO2 A;  1PD1 A;  4GKK B;  2HSB A;  3O65 A;  2Y0I A;  1SRY A;  1B68 A;  2ASR A;  2HMQ A;  4K1O A;  5EIB D;  4XDL A;  2A0L A;  2PYL A;  1G4Y B;  3K59 A;  1MA1 A;  2IBZ H;  1CPQ A;  2ITD C;  1A7D A;  1A0B A;  2OTJ V;  4I1O B;  3KPH A;  4J9Y B;  2JEX A;  1RPO A;  4WFB V;  2WAM A;  4E4E A;  2AXT Z;  4D7T A;  3L72 H;  1EFR G;  1WNS A;  4DRJ B;  1YF2 A;  1NFN A;  4YIP A;  2BCC H;  3OMN B;  2UXN A;  2XAH A;  2PF4 E;  1YTF D;  2QKC A;  4ZKI A;  3ABK C;  5H2F Z;  5BXZ A;  4JI8 O;  3ICX A;  3U0Z A;  1NFO A;  4H37 A;  3DI5 A;  3S9O A;  3R7C A;  1HP8 A;  1M9N A;  1CP9 A;  4UV9 A;  2G3K A;  2QWR B;  3TCU A;  3JYC A;  3W2V A;  1M57 B;  2F43 G;  4UXN A;  4C3E A;  3JSZ A;  1GN2 A;  1SET A;  4X65 B;  4E7Z A;  1OKK D;  1P84 F;  1WGW A;  4CS4 A;  1RM1 C;  3JD4 A;  1T9K A;  2Y3H A;  3RWR D;  2RNB A;  1LUV A;  1UJW B;  1C03 A;  3U2M A;  2AZ2 A;  4B3M B;  5B3S B;  1VIB A;  2A7W A;  3EHB B;  2CH7 A;  3R2P A;  1ZUQ A;  2Q0A A;  5EIB C;  2P4K A;  4X8A A;  2OIG A;  4FIP C;  3ZWI A;  1AP6 A;  5J2T B;  4J32 B;  1SQP H;  2A68 F;  1I5X A;  3B4S A;  4JI3 O;  5D91 A;  3CPW U;  4HFK B;  1OCO C;  4FM2 A;  2WL8 A;  1H2S B;  3ZS8 C;  2PX0 A;  3UR3 C;  5IYB O;  1ENV A;  5COG A;  5KX5 B;  3O39 A;  3ZED A;  1S5J A;  2HS5 A;  5GON B;  2XAQ A;  3SXK A;  4DV0 B;  1IX9 A;  4LF8 B;  2WB7 A;  3EJN A;  4J80 A;  1L3P A;  4LER A;  4XBF A;  3F5W C;  1FKA O;  3ETG A;  4RQF A;  3RT3 C;  4PAC A;  2QEX V;  3WG7 B;  5K0I A;  3STL C;  1DOV A;  4JUR I;  2UXD B;  5LMN O;  2CTP A;  3EHN A;  1IZ3 A;  3CWB H;  1WB7 A;  2V7Q G;  3B0V C;  4B3R O;  4A4A A;  1VF6 C;  3E8G A;  4CZZ A;  4HFF B;  1THZ A;  3B0U X;  4JAU A;  2ZXW C;  4YXW G;  3D3Q A;  2R7W A;  2QWO B;  4XPY A;  3G67 A;  4JAA A;  1S5L Z;  1SF9 A;  4MVQ A;  4DK0 A;  3CMA V;  1OV9 A;  3NYJ A;  1EN5 A;  4E0H A;  5JRA A;  5B1B B;  3QF7 A;  4AL0 A;  4FZ1 A;  1MSW D;  1BMF G;  3MHS C;  2HFI A;  5ITZ A;  1V54 C;  2F93 B;  4FLW A;  1OXB A;  5J2U B;  3LNN A;  1H38 A;  4IYI A;  2M6Y A;  1H6G A;  4QDL A;  3CRR A;  1S7Z A;  1HW1 A;  4JI6 O;  4JVS A;  4K8X A;  3FKS G;  3E22 B;  1MZE A;  4X1Y A;  4DRX B;  4QI2 A;  2HG5 C;  4KNW A;  1SES A;  5LA6 A;  4DW1 A;  1RJ9 A;  1D1B A;  1UFB A;  2E75 B;  4J7T A;  4IB4 A;  3EFO A;  3UMI A;  3CEX A;  3H2V A;  4ANJ A;  3RYI A;  5IY5 C;  1B6Q A;  3X1O A;  3SJQ C;  4DO2 A;  2YIB D;  1W0J G;  4JZA A;  3M1C B;  2QR4 A;  4P9F A;  2A9H A;  4RQE A;  1YYJ A;  1KKC A;  2YSU B;  5J9P C;  2ZCE A;  1K5Q A;  1OCC C;  3K66 A;  1K92 A;  2ZXR A;  1E86 A;  4DW0 A;  3ATP A;  2ZT9 B;  1BQZ A;  2GDC A;  4IGG A;  4YK5 A;  4LF9 O;  4BIU A;  1DF4 A;  2WA3 A;  3RYL A;  2H3O A;  2QTO A;  4HNA A;  3OTO B;  5IJ0 B;  1BDJ B;  2CAZ C;  3S3X A;  4UVB A;  5LMN B;  1VQN V;  4JI1 O;  1VK5 A;  2L6F A;  1KBH A;  1JFF A;  2ZR2 A;  4TUY A;  3EFF K;  3PN1 A;  2AW9 A;  1CGN A;  4WCE V;  1Z6A A;  5KYX B;  2ADP A;  4PA4 A;  5EBW C;  5DM6 V;  3VQY A;  3AGT A;  1MQV A;  4J42 A;  2LW1 A;  1VAR A;  1FTS A;  3U5S A;  2OT5 A;  5E1A C;  1XL6 A;  4GKJ B;  3RW0 A;  3ZSU A;  3GVM A;  5LYJ A;  4CC6 A;  3CCM V;  2JDI G;  3TJ5 A;  1B06 A;  5L3V A;  1EZJ A;  4TOI A;  1G1X B;  2JS3 A;  2UXB B;  2QY9 A;  2YL3 A;  4I1M A;  1EN4 A;  5LMU O;  4FLV A;  3FMS A;  4YHH O;  1OR3 A;  3TD7 A;  4DR4 O;  3OA1 A;  1JPX A;  2ZKO A;  3PJS K;  4O7G A;  5L3D A;  3I4U A;  3KG2 A;  3ASN C;  4PA9 A;  2LSE A;  2J7P D;  3BRJ A;  3RIP A;  3N2K B;  2YEV A;  3ZQY A;  2D3O W;  4QGP A;  4OD5 A;  4BJ1 A;  4DR5 O;  1KKD A;  2DI3 A;  4DV3 O;  1EA8 A;  3ZMS A;  5C8Y A;  3TK0 A;  3CHX A;  4JYC A;  4DV1 O;  1Q0F A;  2QUP A;  4JTD B;  3L74 H;  2VWK A;  2X0L A;  5JCO C;  5JQG A;  1YJG A;  5GW7 A;  2DYR C;  1AR4 A;  1LS1 A;  4I55 B;  1WAZ A;  4ABM A;  1JMW A;  3JAK B;  1TAE A;  1YYX A;  4LBE C;  3HKE B;  2JPU A;  1ZL8 A;  3G50 A;  4QE9 A;  1HW7 A;  1NR7 A;  1K73 W;  3UMH A;  2GTA A;  2DMX A;  4PJ0 Z;  4FFB A;  5AGF A;  2QWN B;  1PP9 H;  1N8R W;  4DUZ B;  3M8A A;  4O4I B;  1Q0M A;  3WB0 A;  4B7E A;  2LFS A;  4QIW F;  5L0I A;  5BQG A;  3V5Z A;  4JYB A;  1NZ6 A;  4JZG A;  4J7Z A;  4X1Y B;  2EPK X;  3BRC A;  5LBQ A;  4YWQ A;  3WB1 A;  3DGE A;  3E8F A;  1I5N A;  1W0K G;  5LA6 B;  4BG0 A;  3C8G D;  2YL7 A;  1BT8 A;  4F6R A;  4JI2 O;  1SQF A;  4JJF A;  3H1I H;  4IIJ B;  1H8H G;  1AVO B;  1HNX B;  4N23 A;  3B8M A;  1WP7 A;  2VQF O;  5KYU A;  5LHG A;  2QDO A;  2OJQ A;  3VYW A;  4J7Y A;  4G7O F;  2QM7 A;  1VYK A;  4UB6 Z;  1RKC A;  3AOU A;  3E86 A;  3O6X A;  4DOZ A;  1ZWI C;  4ZLD A;  1T01 A;  4X62 O;  5JUA A;  4CDY A;  1AR5 A;  3ZRV A;  1M2O A;  1ZU4 A;  1VQK V;  2W6J G;  2L6L A;  2QE7 G;  2YL1 A;  3JD2 A;  3UCS C;  2MHR A;  2J8W A;  1PNM A;  1YA7 O;  1ZSP A;  2CGE A;  4GYC B;  4J7J A;  2YID A;  5LHH A;  2WLN A;  5IE9 A;  4OXS A;  2Y4U A;  4HNA B;  1H7I A;  4NTF A;  3MBG A;  3TK1 A;  3U0C A;  3AG3 C;  4LH7 A;  4CS3 A;  4O4L B;  1Q5O A;  1GN3 A;  1V54 B;  2XHB A;  1A7E A;  3ZHR A;  2WPD G;  4H4K C;  4YL3 A;  2X6A A;  2ETS A;  1AI7 A;  1DLB A;  1JFF B;  2EIM B;  4EB6 B;  4HAM A;  4FAP B;  3C18 A;  1N32 O;  2OCC C;  2F22 A;  4JI5 O;  3LS0 A;  3SYP A;  2WLL A;  4X89 A;  4XDJ A;  3PDM P;  3DZA A;  3LSU A;  2XLV A;  1K97 A;  4WAB A;  1QSP A;  2BOC C;  4PEL A;  3DXR A;  3ABM C;  4BW5 A;  5LHI A;  5EZY B;  1S0V A;  2EJ7 A;  1D5A A;  3SPG A;  5IY5 B;  1XMQ O;  3S90 A;  5EBL C;  1XNR B;  4MW3 A;  5K1X A;  2V1D A;  3U8P A;  5T3T A;  3O9O A;  2DB4 A;  1TUB A;  4P9O A;  3GEH A;  4NXN B;  1UPG A;  1TQG A;  3E2E A;  3L34 A;  2WA4 A;  1GN4 A;  3M99 B;  3D8C A;  3W7U A;  5DS4 A;  2JIZ G;  1QLE C;  3S29 A;  3Q6M A;  1SKV A;  4G28 B;  4MT8 A;  2NSG A;  4GYT A;  3T4Z A;  3QW1 A;  5C8Y B;  2EBO A;  1A32 A;  2OYQ A;  1LE4 A;  2GTS A;  1Z23 A;  1P7B A;  3GEI A;  2OCH A;  4Q20 A;  2LJ2 A;  3CJH B;  2QJ1 A;  1Y76 A;  1YLM A;  4MTF A; 
#chains in the Genus database with same CATH homology
 3FHD A;  1LVK A;  3NYL A;  4JW1 A;  4U5C E;  4LLE A;  4G7Z F;  4W8K A;  3ASO C;  1VOM A;  1D1A A;  1BR4 A;  2NUP B;  4LAC B;  1MND A;  2E87 A;  2EIJ C;  3S28 A;  4FWV A;  2CW0 F;  5E3A A;  3DJN B;  5D92 A;  2G62 A;  1IUR A;  3EH1 A;  3EGX B;  5KYX A;  2J46 A;  4O6N A;  3LLI A;  1MMN A;  3NKE A;  4HEA J;  4CS8 A;  2C04 A;  3KKB A;  3AG1 C;  4LLC A;  2XL4 A;  1GH6 A;  3JRT A;  3ITF A;  1SF8 A;  1FAF A;  1ZHY A;  3AG7 A;  5EHH A;  1ZYR F;  4YT5 A;  3NKD A;  2MWQ A;  2Y3D A;  3LLK A;  2WZG A;  4JCH A;  5B1B C;  5KYU B;  2R7R A;  2R7T A;  4Q7C A;  4U5F E;  2FFH A;  2J9U A;  4PJN A;  1MMA A;  3FAJ A;  3NDB B;  3DJU B;  2A1D D;  3KL4 A;  3JT1 A;  1MMG A;  4RBN A;  4I44 A;  1RJ9 B;  4G0H A;  4QI0 A;  3EQL F;  5DQZ A;  2YHS A;  1O5H A;  3EFO B;  1N1C A;  2W4B A;  1TWH A;  2NG1 A;  3Q7G A;  4BJ5 C;  4YJW A;  3LS1 A;  3K1H A;  4PFO A;  3EZH A;  3OWT A;  4RDA A;  5KYW A;  1PD1 A;  1M2V A;  4E7S A;  2KGO A;  4K7B A;  3B0P A;  2P7V A;  3EGD A;  3VAY A;  2YUA A;  5E33 A;  1VYI A;  3POV A;  4N06 A;  2R7V A;  4YT4 A;  5EGY A;  1PCX A;  2G3V A;  1O87 A;  3K33 A;  4I1O B;  2LGW A;  2WVO A;  1M57 C;  2Y39 A;  3EG9 B;  1XBL A;  4KI2 A;  3E70 C;  2GUZ B;  1MNE A;  2BE5 F;  2M4E A;  5KYY A;  2GFH A;  3UGP A;  2N04 A;  4K0D A;  4CS8 C;  2PF4 E;  1SMY F;  3ABK C;  3S0X A;  2H7B A;  2IXO A;  2D5R B;  4FX5 A;  1TR2 A;  4WJ0 A;  4ULW A;  3UO2 A;  3LNR A;  5T3W A;  4Q4Z F;  4XTK A;  3LES A;  1LKX A;  2G3K A;  3I5Q A;  4YT8 A;  2QWR B;  2J9V A;  3W2V A;  4C3E A;  3JSZ A;  3BVO A;  4U5H A;  2EIN C;  1ZHW A;  3H65 A;  4E7Z A;  1OKK D;  1WGW A;  1J8Y F;  2KW3 C;  3CQZ A;  1D0Y A;  2Y3H A;  2R7U A;  2J45 A;  3EPV A;  2C03 A;  4OIQ F;  3KMI A;  3Q7L A;  3WG7 C;  4AE4 A;  2Z15 A;  3V7O A;  4OD4 A;  2NUT B;  2IXM A;  4J32 B;  2VAS A;  2A68 F;  4CIH A;  3X2Q C;  2Y4T A;  5D91 A;  4NY3 A;  2WVN A;  2N05 A;  1OCO C;  4HFK B;  4IJJ A;  3S27 A;  2I8B A;  3W8I A;  4CS7 A;  3DM5 A;  2L81 A;  2WL8 A;  2PX0 A;  4X0R A;  3MX3 A;  3EZI A;  3UR3 C;  3FDQ A;  2J0X A;  3O39 A;  3GOD A;  1MMD A;  3L0I A;  4A2N B;  3B9Q A;  3HLZ A;  2WB7 A;  3EJN A;  4J80 A;  2X51 A;  4U5G A;  4LER A;  3DAF A;  3ZIB A;  4G7H F;  3CSK A;  2Q9A A;  4JUR I;  2CTR A;  1IZM A;  2EIL C;  1WJZ A;  4U5D E;  4Q5S F;  2CTP A;  3EHN A;  3RKO F;  1D0X A;  4U5B E;  4C3D A;  3UGO A;  1Z3I X;  4CSA C;  2QWQ B;  3B0V C;  3OEO A;  4EBB A;  4XLP F;  4HFF B;  2NUP A;  3B0U X;  4P6I C;  2VB6 A;  2ZXW C;  4MQ9 F;  3EGD B;  2Q9C A;  3N24 A;  2R7W A;  2Y3B A;  2QWO B;  3KH2 A;  3EGX A;  1D1C A;  2O9X A;  3N2Z B;  1NU9 C;  2W9Y A;  2YZS A;  3F46 A;  3K6B A;  3NYJ A;  4PJJ A;  3W2W A;  1FPO A;  1FMW A;  3JYH A;  2Q3T A;  3NRH A;  2CUG A;  4BEJ A;  1V54 C;  1V55 C;  4C3B A;  3AG2 C;  2R7Q A;  4QDL A;  2M6Y A;  3RFY A;  4CS9 A;  5KYY B;  1S7Z A;  5F5F A;  2IXP A;  2MYS A;  1ZHT A;  3LAY A;  4JVS A;  4RD9 A;  4OIN F;  1NZE A;  3E9V A;  3WOD F;  2HV7 A;  4AX2 A;  3UNG C;  3HTK C;  5E3C A;  3Q6N A;  2DN9 A;  4QI2 A;  2ZXP A;  3QMK A;  2A6E F;  2W4M A;  2P6V A;  4KNW A;  2DGJ A;  2L9J A;  2VH3 A;  3IEE A;  1RJ9 A;  1D1B A;  1TWG A;  3T6J A;  3EFO A;  3UMI A;  2LO1 A;  4ANJ A;  5IY5 C;  2WZL A;  3NYM A;  3X1O A;  3N0T A;  2QSA A;  4JZA A;  1ZHX A;  3M1C B;  4OIR F;  2DYS C;  1JPJ A;  3PMR A;  3ZVR A;  3LJB A;  5FCL A;  2PFD A;  2IXN A;  2HV6 A;  2XXA B;  1OCC C;  1FFH A;  3K66 A;  2ZXR A;  1W2W A;  4O6Y A;  4M63 A;  4IT5 A;  2ZXO A;  4GEH A;  1BQZ A;  1BR1 A;  1G8X A;  4EWC A;  1OCZ C;  3SYN A;  4C7O A;  2H7V C;  1J8M F;  3RYL A;  3SEO A;  4F4B A;  3SNH A;  2CTW A;  1SZI A;  4IWB A;  5L3Q A;  1QZX A;  1VK5 A;  3T6B A;  3T4R A;  3UO3 A;  3F47 A;  2KQX A;  3EG9 A;  1NU7 D;  1Z6A A;  2WVQ A;  5KYX B;  2GUZ A;  2KNH A;  1Z63 A;  5HSW A;  3PHF 2;  2V26 A;  5KYN A;  3DM9 B;  1FTS A;  3ZC4 A;  2KJG A;  3UMK A;  2WZF A;  3ZSU A;  4OIO F;  4DVY P;  1KU2 A;  5CI9 A;  5L3V A;  2J7P A;  3QZC A;  1OCR C;  1ZHZ A;  2OG2 A;  1PD0 A;  2IOQ A;  2QTV A;  2QY9 A;  2R7S A;  3AQB A;  4I1M A;  4KC9 A;  2A6H F;  4IRU A;  3TD7 A;  4KBL A;  3W8H A;  3OA1 A;  2CDQ A;  4O7G A;  3I4U A;  1BR2 A;  4CS9 C;  3EH2 A;  3ASN C;  4IAO A;  2CTQ A;  2J7P D;  2LSE A;  3RIP A;  5DVW A;  2YEV A;  4ZLC A;  1NG1 A;  4BJ6 A;  4OD5 A;  1ZU5 A;  4BJ1 A;  1TWA A;  4J30 B;  3I5P A;  5DQT A;  5CI8 A;  4RWU A;  1Z5Z A;  4O6M A;  2Y3G A;  3NG1 A;  2XRH A;  2DYR C;  5KYW B;  4U5E E;  1LS1 A;  1M2V B;  5BUO A;  2NUT A;  3JCU Q;  3SZR A;  3UMH A;  2DMX A;  2XSE A;  4MND A;  2PX3 A;  2QWN B;  2J9W A;  2V3C C;  5F5H A;  2ZPA A;  4O79 A;  3APQ A;  1NZ6 A;  4J7Z A;  1N4C A;  4YWQ A;  1BQ0 A;  3HJC A;  4BG0 A;  5DS5 A;  1VMA A;  3LEV A;  1TKN A;  3SP1 A;  1D0Z A;  4JJF A;  4OIP F;  3GAN A;  3DD7 A;  2EIM C;  3DMD A;  5KYU A;  4PJM A;  4G7O F;  3VYW A;  3AQC A;  1VYK A;  3O6X A;  1TWC A;  4DOZ A;  1HDJ A;  5DLJ A;  4ZLD A;  3EHM A;  1M2O A;  1ZU4 A;  1IW7 F;  2L6L A;  2QWP B;  3K1I C;  5DS6 A;  3UCS C;  2A69 F;  4YN0 B;  3RH3 A;  4C7O B;  2CGE A;  2B0J A;  2IYL D;  2Y4U A;  2CNW A;  3AG3 C;  1ST6 A;  3AG4 C;  4PFP A;  4H4K C;  4XWJ A;  2R7O A;  5B1A C;  4CBE A;  2OCC C;  5E2Q A;  3LS0 A;  4BJ6 C;  2CNW D;  1JPN A;  4PK4 A;  2YS8 A;  4HE8 D;  4YT2 A;  3DZA A;  4AE4 B;  4CSA A;  2R7X A;  3CZ6 A;  4DBR A;  3DAG A;  4I3M A;  4JJG A;  4BJT A;  3ABM C;  2EJ7 A;  5B3S C;  5T1D B;  1FMV A;  4KNV A;  2FGY A;  4BJ5 A;  1OKK A;  3MLG A;  2PP4 A;  5T3T A;  2H7O A;  4FES A;  2J0W A;  3DXJ F;  4B6I A;  4DVZ A;  1M56 C;  2Q9B A;  1FFT C;  3L34 A;  3APO A;  3ZG1 A;  5DS4 A;  1QLE C;  3S29 A;  4AK9 A;  3Q6M A;  2XXA A;  2W45 A;  4GYT A;  3K7D A;  3ABL C;  2JD3 A;  1Z23 A;  3ECS A;  3FVY A;  2OCH A;  4PJL A;  4XLN F;  2KQ9 A;  4DBQ A;  2EIK C;  2Y69 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...