3VAYA

Crystal structure of 2-haloacid dehalogenase from pseudomonas syringae pv. tomato dc3000
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
230
structure length
230
Chain Sequence
MIKLVTFDLDDTLWDTAPAIVGAEAALRDWLAEQAPKLGPVPVEHLWEIRSRLLDEDPSFKHRISALRRRVLFHALEDAGYDSDEAQQLADESFEVFLHGRHQVQIFPEVQPTLEILAKTFTLGVITNGNADVRRLGLADYFAFALCAEDLGIGKPDPAPFLEALRRAKVDASAAVHVGDHPSDDIAGAQQAGMRAIWYNPQGKAWDADRLPDAEIHNLSQLPEVLARWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAD-superfamily hydrolase
publication title Structure of 2-haloacid dehalogenase from Pseudomonas syringae pv. tomato DC3000
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Hydrolase
total genus 80
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1600 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3vayA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3vayA01
1ZJJA 4ZEVA 2C8LA 4FFDA 3PGVA 5AICA 3SLRA 1TE2A 2P69A 1U7PA 2R8ZA 3M9LA 5T41A 5AW9A 5AI6A 1LVHA 4KX3A 1U2SA 3WGVA 1SWWA 1J8DA 2FPSA 2VKQA 3A3YA 4CF5A 3OCUA 1AQ6A 5ALKA 3QUCA 5ALVA 3WGUA 1YV9A 4Y2QA 2WM8A 2HI0A 3AR3A 2ZBDA 4CF3A 3N07A 2G80A 2B1QA 3SHQA 3EPRA 3SKYA 5ALNA 3L0YA 4B6JA 5ALPA 4EENA 4MWOA 1T9ZA 1YS9A 2OBBA 5AVXA 4OFZA 2MU1A 1Y8AA 5A3RA 1YJ5A 3SF0A 2C4NA 1RMYA 4I9GA 2ODAA 5ALWA 3R4CA 4UMVA 4OCZA 5AK5A 5AM1A 3L8FA 4UU0A 2WF8A 2GFHA 3ZWKA 3ZX4A 5A3QA 4GXTA 3DNPA 2YMLA 1U7OA 1T5SA 3L1UA 1ZRNA 2RARA 1ZS9A 5AKGA 3QLEA 5ALTA 1Z88A 3FZQA 2PR7A 2JARA 2JAWA 2R8YA 3OCVA 1L6RA 3ZWDA 3B8EA 2IOHA 4JDPA 4J2TA 2WF9A 3WKEA 2P11A 4ZEWA 4Y2RA 3UMBA 3E58A 3KDPA 5ALYA 3QU9A 5AW6A 2WF5A 4KYTA 4NFLA 4UMEA 3RF6A 3UMCA 2ZXEA 3EF0A 5ALEA 4BBJA 2G08A 1XVIA 3N28A 3A1EA 4EX6A 3L0BA 2PKEA 3IRUA 2D2VA 4FYPA 4C4SA 5ALRA 2HDOA 5ALUA 3W5DA 4AS3A 4HGNA 3R09A 5AKEA 3P96A 4BNDA 2C9MA 4UATA 3U26A 1RDFA 3A1CA 1LTQA 1RMQA 1Z4LA 2FPRA 3E8MA 4XQ0A 4O8CA 3ZX5A 3QUBA 2B1RA 3QGMA 5AVSA 2HF7A 3KZXA 2I54A 3WK4A 2G06A 2MSNA 2O2XA 3J7TA 4UASA 3R9KA 2HOQA 1L8OA 3L8GA 2ZBEA 4UARA 4Y2JA 4DWOA 5AW1A 1T5TA 2FPWA 1S8OA 3QUTA 1CR6A 3QU7A 1FEZA 2FUEA 4UM5A 3ZVLA 1CQZA 1RKVA 5AKKA 3OTQA 5ALDA 1Z4PX 3ZI4A 1IWOA 2B30A 3I76A 3AR8A 3WK9A 3U7FB 2IA5A 3E84A 3S6JA 5AKJA 4UAVA 2YMQA 4HAIA 3M1YA 1L7PA 5AHXA 4AP9A 4YCLA 2YMMA 2R8EA 5AM2A 4YCMA 1Z5UA 5AW8A 2EAUA 3WK8A 3N1UA 3E81A 1QYIA 4EZEA 5JJBA 1JUDA 4NWIA 1TJ4A 1Z4JA 3D6JA 5AVVA 4ZEXA 3ZU6A 3QX7A 2NYVA 5AVZA 4CNQA 5AW7A 3NRJA 2JAUA 1L7OA 2HCFA 4BEWA 3QXGA 2P27A 2HSZA 2YN4A 1WVIA 4QQFA 1XPJA 5AKLA 5AM5A 3SMVA 3QYPA 4BX2A 2WF7A 4Y2UA 4AS2A 4I9FA 2QLTA 2YJ6A 5ALSA 1WZCA 3FPBA 2CN1A 4FE3A 3A1DA 4OHFA 2ZBGA 2EARA 1SWVA 3K1ZA 4UU1A 3SD7A 5AW2A 3OCXA 1RC8A 2CFRA 4Y2XA 2Q4TA 2B82A 3CZ4A 1TJ5A 5IT0A 4KX5A 4RETA 2NO5A 2GHTA 4E88A 2HO4A 2YMPA 3L7YA 5AI9A 3OCZA 3QNMA 3L8HA 1ZD2P 5IS2A 4L6AA 5AW3A 1RQNA 3ESRA 2R8XA 3AR6A 2RBKA 2FPUA 1U02A 4XPZA 3OCYA 2YJ5A 1MH9A 4BX3A 2BDUA 5AM4A 1K1EA 1S2OA 3IJ5A 2C88A 3NIWA 5AI8A 4BX0A 5ALLA 2HEGA 3L5KA 5AVUA 3ET5A 1QH9A 3U7HB 1Q91A 4XOUA 5ALQA 2AMYA 3ZUPA 1U2TA 5AK3A 4EX7A 4NABA 1F5SA 2G09A 4F72A 3ZVMA 2YJ3A 3AR2A 3U13A 1Z4NA 2OM6A 3WKCA 3FM9A 5ALHA 5AI0A 3NANA 2I6XA 4HGOA 1VJRA 1Z4IA 4YIKA 5ALXA 1N9KA 3AR7A 2B8EA 4F71A 2NO4A 2IOFA 3ZTWA 2Q4RA 5AW5A 4UMFA 5AESA 4HYTA 4CF4A 1EK2A 1Z4OA 2BDEA 4EELA 4Y2SA 4BYGA 1QQ6A 4CE6A 1X42A 1L7NA 1EK1A 3KBBA 3VAYA 2X4DA 2PQ0A 1RLOA 4EEKA 4HGQA 3NASA 3U19A 3ET4A 3UM9A 2C8KA 3AR9A 3DAOA 2JGAA 2YJ4A 2FI1A 2G1AA 2W4MA 1RQLA 2EATA 5AIBA 4BKMA 5AKZA 5E0OA 3OCWA 2W43A 3QU2A 3I6BA 5AVWA 3WKAA 5AIAA 4XE5A 3MC1A 4L57A 5ALZA 4H1WA 2CFTA 1YNSA 1Z4KA 1VFPA 4Y2PA 4NV0A 5AKXA 3W5BA 4KN8A 2QYHA 2Q5EA 5IT4A 5AI4A 3UMGA 2FDRA 3W5CA 2DQSA 3L1VA 3BA6A 4IFTA 1QQ7A 4IG4A 2G07A 3RFUA 3WK6A 2B0CA 3AR5A 3B9RA 3OPXA 3ZTYA 5AVYA 1ZOLA 4QJBA 5A3SA 2FEAA 1Z4QA 1ZRMA 2FPXA 1YDFA 3KD3A 2G0AA 3CNHA 2HHLA 4DCCA 3MMZA 1XP5A 1YMQA 4Y2TA 2P9JA 5AW0A 4OD0A 4L6CA 1QQ5A 3ONNA 1TJ3A 4RESA 3DV9A 2GHQA 1RKUA 1SU4A 1TA0A 4YH1A 5AKYA 5AM3A 5AI5A 3I1YA 1PW5A 2YFYA 4MUMA 2O9JA 3ZW7A 1RRCA 3WK5A 5ALJA 1VJ5A 4J03A 2I7DA 2JAOA 3AR4A 3PCTA 2OYCA 2IOFK 3WKDA 4YGYA 1WPGA 2GO7A 4YCNA 1Z4MA 3FGOA 3QU4A 3DDHA 3IB6A 1ZD5A 4PNHA 1RLTA 1RKQA 3GYGA 4HGRA 3MPOA 3SKXA 3PGLA 5AK4A 3ESQA 2WF6A 2W11A 1WR8A 4BNDB 4Y2VA 3FPSA 3N8GA 2WFAA 3PDWA 2YBDA 5FP0A 5AKIA 2B8JA 4UMDA 3NALA 3WKBA 1J97A 3EWIA 3QU5A 4Y3UA 5ALFA 5AVTA 3N5KA 3L0CA 4Y2YA 3BWVA 5AM0A 2RB5A 5ALIA 1RPZA 2RAVA 2BY4A 2AH5A 4UM7A 3KOOA 1N8NA 4DW8A 2IYEA 5AVRA 4HGPA 5AKHA 4NAVA 3KC2A 3QUQA 5AVQA 3ED5A 2OA0A 2WHEA 3U7EB 3B9BA 3EF1A 3L8EA 4UAUA 5AK6A 1KYTA 4GIBA 4KNVA 1NF2A 4JB3A 2HF2A 2I55A 5AW4A 1RMTA 4UW9A 1RLMA 1NNLA 3ZVNA 1Z5GA 2ZOSA 1ZD4A 2FUCA 4KNWA 4G9BA 1O08A 3W5AA 4G63A 2HX1A 2GMWA 2YY6A 3NUQA 4C4TA 3NAMA 2I34A 2I33A 2ZBFA 2AUTA 3FVVA 5ALOA 3HYCA 4BEVA 5ALMA 4YIHA 3U7GA 1ZD3A 3F9RA 1NRWA 4C4RA 5ALGA 3I28A 2CFSA 1L7MA 2AGVA 3MN1A 1L8LA 1O03A 1Q92A 3HLTA 4DFDA 3TLMA 2ZG6A 3WK7A
chains in the Genus database with same CATH superfamily
2KSFA 4EW2A 3Q88A 4Y6SA 1XPUA 2Y76A 2VTDA 2OCGA 5K45A 4HZGA 4CLOB 3F6YA 4M0LA 4J0QA 3GC6A 4J43A 4U7PB 1O3UA 5JMOA 4IJWA 5TIIA 2WAYA 5CXSA 3K2BA 4XLNF 3DW1X 4KJXA 2JCSA 3NFRA 3W77A 4KQXA 4DJAA 1YRQA 2XNDD 2NU6A 4YJHA 2IU0A 3ZX4A 1T01A 1CUEA 1Z07A 4NS1A 3S1AA 3OEYA 2NO7A 3SVZA 1T6NA 1NW6A 3U4DA 3QNUA 2OCBA 1VYIA 4XSVA 3IAEA 1IOVA 3RV3A 3PNPA 2IPXA 1E3QA 1A71A 4MUXA 1X77A 4U1RA 3TGWA 2FSGA 4CCAA 3NLLA 3L1JA 3ZDFA 2CJFA 1QHNA 1W0JD 1LV7A 3ZR4B 1E66A 5DX1A 1FQWA 3FYUA 5FAXA 3E9CA 3ZQYA 1QG2A 2PUFA 3TEFA 3F6BX 4KN6A 3MMSA 2DT8A 3VU9A 4R2KA 3QGMA 4B6OA 3POVA 1WUKS 3ZDRA 2JBAA 3J7TA 2ETSA 3TF5A 2XITA 3K73O 2IHKA 1B0ZA 2B35A 3U9JA 1XF1A 3WY9A 2KWIA 5JAIA 1QZTA 1IXZA 4DADA 4N5IX 4NZ9A 2J3HA 2AG6A 3QMVA 4KO3S 2PPLA 5FD8A 2JGNA 1E69A 1NP3A 4MO9A 2JDIA 4KC9A 1W2GA 2IWHA 3ZLJA 3GGSA 3KJXA 2C5HA 2WWXA 1QQAA 1VA4A 1K4MA 4UUNA 3ZNNA 2VDOB 1DFIA 3AKZA 2BT4A 4N82A 2JJYA 1CD5A 4JBYA 4URWR 4XTKA 2RK4A 5MHTA 3EMKA 4LK3A 3PDUA 4G26A 1I7QB 5BQPA 4L7VA 1CY1A 4II7A 3IUYA 2X51A 5DASA 5I8ZA 4JR0A 1RQNA 4TXHA 1JFVA 1ZW1A 4TKVB 2PL9A 2EF0A 1QX4A 1E2EA 2R6GA 4L8YA 4RSGA 1FFGA 4YJFB 1PT8A 4UDYX 5A4KA 4EH1A 4LECA 1IBCA 5ECGC 1WF6A 3L8CA 2QP9X 2EOAA 3X2EA 4LC0A 2P2GA 5LOVF 2DSTA 3VKVA 3QKSB 4MVWA 1TYAE 3UT6A 3R3VA 1TT7A 1ZD8A 1K3UB 2GRJA 4W5QA 2GCPA 1GZHB 1ORDA 5IAEA 1FNTc 4UD2A 3EIXA 1I3KA 2XLOA 1XAIA 2JC3A 1WOLA 3FBGA 3FUVA 3DMGA 2I2XB 2QD4A 3NASA 4AG3A 3KG2A 2WNSA 4JBGA 4JNKA 2E18A 4OQZA 1ZHXA 5EA2A 4YL3A 3PEFA 2ZJ3A 1OFVA 2BGKA 1B26A 1YGPA 2QMEA 5DBEX 1A5TA 4FFOA 1XZFA 4BJTA 2OCYC 4LZNA 3L7NA 5EUQB 2PANA 3UB4A 1TRHA 4XWKA 1H6CA 4F45A 3FWPA 2FE1A 1HRKA 4UEQA 1GZDA 2YWCA 3K16A 2QMHA 4WN9A 1Z18A 3P20A 1TYZA 4DA4A 5GV8A 3C43A 3Q7EA 1XLTC 1N2BA 2F7SA 1A7JA 2ZS8A 3TNYA 1E7YA 2AN5A 5LQSA 1RCPA 4BO7A 4H31A 3T7AA 4HXGA 4PZUA 2B3TA 4CDYA 1KYVA 4UVEA 5JLIA 1Y3HA 1QHHA 1DSSG 3QFRA 2VG8A 3L8EA 4ZGBA 4ZO6A 2O8FB 2HF2A 1RMTA 5L4NA 2G8LA 1Q0GA 2AOWA 4K9DA 2PL1A 4EZBA 3MFNA 1QVWA 5KOHA 3DDCA 2ZZKA 4LHZA 2VK2A 1TJYA 3RTAA 1I4EB 1QRTA 5DMHA 1EUCB 4MVJI 1KKMA 3L05A 4DQXA 1P3JA 5DIFA 3EBOA 3FHOA 1VI5A 2JIDA 2VAPA 4P7BA 1ZM7A 3IB3A 3IOMA 5ITVA 4BQIA 1YCFA 5FFFA 4I4TB 2WABA 1HKHA 3FJ1A 3JZMA 4RF2A 1XA3A 3A1TA 5CK5A 1QF9A 4UE2A 3U9LA 4HDMB 3LUFA 2C1XA 3MBIA 5CJ2A 5JH7A 5E6SA 2GPBA 5B5SA 3ICCA 3I52A 2AR0A 1NXXA 2A1DD 4OHVA 2R96A 4AO7A 3GJTA 4BE7B 4M55A 2V3VA 5FTWA 1DS6A 2C7OA 4YBRA 3D5TA 4DA8A 4HEA1 4GEHA 3FH0A 4AMUA 2ODPA 4LHSA 5FOTA 4C0LA 5FBVB 5EP1A 3GM1A 1A27A 4H7KA 4KC0A 3DZHA 3CU5A 3R1IA 4IZIA 4KPEC 1T26A 3KOXA 1Y89A 3U37A 3BILA 2GN9A 5ICEA 1QK3A 1PAUA 5HYVA 3RYIA 1TT5A 4OB7A 5CIQA 4WZAA 3SX4A 5A62A 1Y48E 4C21A 4XIGS 1HI9A 4PGGA 3LD9A 1T5TA 5JQGF 3MW8A 3VZQA 4PG4A 1CV2A 1LRJA 1T0PA 1TXGA 1IEVA 4AX4A 3RS5A 3PC3A 1M6VB 2HIMA 3E81A 1ZKDA 4WXPA 5FWYB 1TIPA 3LX4A 2R44A 5AVZA 5A5VA 2Y1XA 1ZBDA 4FD2A 2XYQA 2VJKA 3HCEA 2RHLA 2FKNA 4TTQA 5F35A 2FHPA 4TL7A 2V59A 2CBGA 3DB2A 5M34A 3A6KA 2XWSA 1W2WB 4ITRC 1ONPA 3L7YA 4K2HA 4MIOA 4B9EA 2H1IA 3ZCRA 5EESA 2A94A 2Q4OA 4YMVA 4IAQA 1D6JA 2JLRA 3FYDA 4D74A 1B7GO 3BSYA 2EWWA 1NXOA 2V98A 3O8OA 1U7DA 3P0RA 1CRZA 1WASA 4R7TA 3PJRA 1HZZA 4IB4A 2O7QA 3D02A 2WVGA 4JFAA 1QP0A 2XMZA 1VLLA 5DHAA 4MVRA 2KJQA 2DQYA 1QBKC 3MWEA 3GEGA 1R12A 1U3FA 4EHDA 4IMJB 5AXCA 1JPJA 3WIOA 1QBGA 1QE3A 3HVRA 3OEEA 3BEDA 4Q18A 1YFKA 1TK2A 1HORA 3NT2A 1AU9A 4ZEMA 2G76A 2FFBA 3MGBA 3ED1A 1NN0A 5IU6A 5DPMA 3L18A 4UEJA 1AUQA 3G8BA 3TAUA 2NVWA 4IQ8A 4PHFA 3N0TA 4U6SA 1RXSA 4ONSA 2Z6QA 3BEHA 1G5HA 4OM8A 3HO8A 1GQOA 4ZOAA 4IPTA 1F51E 1P60A 1RZVA 1VQ1A 1IH8A 2BEUA 5BSUA 4S1OA 3C62A 4PN7A 2YL7A 2BGWA 3W2WA 3D54D 4MDHA 4Y2GA 3RWBA 1E2LA 4HE8D 1WY5A 5K05A 4H35A 2X22A 3QBDA 2GKOA 3O55A 1DEAA 1FMTA 1T2UA 4Y2YA 2AG0A 5FH9A 5L45A 3JVVA 4G5FA 4RHYA 2L0XA 3TRKA 1BVRA 1CUZA 4D9IA 4AE4B 1JIIA 4URZR 3ITFA 4N5MA 1DJLA 2VDUE 2VTEA 5EWJA 1FXWF 4EUEA 5I01A 5I9IA 3Q8KA 2FUCA 3ZDAA 4KNWA 2X5JO 5J2UF 1PVVA 5D84A 1CVRA 1MC5A 5IANA 5HRUA 1PUJA 1HLDA 4QUAA 4BQEA 1A7EA 3HUTA 3SHFA 2UUBB 4NZPA 5AW9A 2OQ2A 3H9JA 4XD7A 3PPVA 2D0OB 3D6HA 1MMNA 1OCRC 4QGHA 4YWHA 2WOJA 3FNEA 2NVUB 4DR4B 1JECA 4F2HA 3WGJA 3ZDCA 2BM1A 1T8YA 4PO9A 3ER8A 1QPZA 3A6GA 3UG7A 4MEAA 3OCJA 1ZI8A 1XEXB 4GLFA 5ALWA 3JTLO 1DBQA 2I4OA 1LF5A 4QYTA 2FGJA 2VWPA 4KSYA 2LP4Y 4IGIA 3R6TA 4ZVTA 4EECA 3CZ6A 3OZWA 4MUYA 4XR9A 1QCCA 3PPWA 3CZQA 1Y1TA 2F9MA 1C14A 5DYYA 3DZAA 5B3JC 1Q15A 4LTMA 3ESDA 4BRZA 2P4HX 3GRAA 1JMYA 3V97A 3IEUA 5IDQA 4GI7A 2VIIA 3WLSA 4ZYZA 3I9KA 3SSNA 1G60A 4KVAA 1DAHA 1GG8A 3IBTA 4LOIA 2FW8A 4TUYB 4JYBA 1Z38A 5BQ5A 3W7AA 3TNDA 2HMSA 4N7MA 2HFKA 4E5KA 4DRHB 1NGSA 3OURA 3DR3A 4Y2JA 2FOXA 4Q82A 4FYVA 3WSTA 4QARA 1S7ZA 3LUDA 2ZZMA 4JWTA 1UOEA 1OYYA 3I30X 2ZQ5A 3CJTA 3FR8A 3U0VA 2XX3A 1QGZA 3WAQA 5B12A 2O3TA 2B8WA 1IPHA 1UMBA 3HTXA 2QBYB 1ORYA 1OXBB 3QX7A 3ADKA 3SIXA 2QENA 3TJMA 2FZVA 1KI1A 3UR3C 3UN1A 1UF9A 1K7EB 1NRIA 5SZHB 2QNRA 3HJAA 1NN3A 2Z1DA 2WG2A 1NPTO 3CF6R 3T99A 4Q1AA 4HQKA 1B76A 4IMIB 1AKWA 3PNKA 2A7XA 5KVCA 1JQLB 1R6AA 1RYYA 4Z9AA 1XF9A 2RB4A 1MTOA 1Y4CA 5JCJA 3L49A 1XWJA 3PQ7A 2Q27A 5D1NA 1XFDA 2G4LA 1EDZA 3Q7RA 5AP9A 5C8DA 1RU3A 1B3BA 2VYNA 2F17A 3WJ7A 3O2QB 3DMYA 5LQRA 4N9WA 4JT8A 4X91A 2H4WA 2OOKA 3KV1A 4CM4A 5CVEA 5FV7A 1L7NA 5EJ5A 3VAAA 4KVGA 1T10A 1FYFA 4Z2YA 2NZ8A 1TLTA 2VT6A 4C3VA 1R8YA 1N6KA 2J30A 3NMIA 3ZIBA 1II9A 5IWAB 3SC4A 4KQ1A 3ZGOA 3C63A 3K09C 4R9NA 1XAHA 3WA7A 1CNMA 3O31A 1H22A 1AHHA 3K0SA 1G2OA 5CHEA 1F7UA 3TYXA 5M04A 2O2GA 1A9XB 5DLYA 4ANJA 2AYYA 3DUFA 5B7NA 2X14A 2J9UA 2WD9A 2FB9A 4ND2A 5FLEX 1BFUA 3VSAA 1TYDE 4EY4A 4H0CA 4DSAA 1NBMD 2C7RA 2WT4A 3B5EA 3CF4G 3TPFA 3IILA 4HOYA 3AIKA 4P0TA 4B2IA 1OCEA 4WNAB 3UGJA 4H27A 4DTIA 3SZLA 4YAUA 3EEBA 4LC1A 5AVRA 3AW8A 1HY5A 1FYWA 4UM8B 4QUJA 4CJGA 4TT8A 1GR0A 1X9GA 4NY3A 1W0CA 13PKA 4O63O 1BGWA 2DWQA 1AK2A 2ZI3A 3PWSA 2XLEA 3KPVA 4KLCA 2ZRIA 4O2AA 1G3IA 4CIBA 4FEAA 4M49A 1L8LA 3LUGA 3FNQA 4IP0A 1GQ2A 4HCJA 5CYGA 1D9ZA 2EJVA 4EL0A 4XVUA 2UYYA 5DW0A 1U7PA 3JZ0A 2WWHA 2Z9BA 3ZW9A 4HAUA 4QATA 3LDUA 2FDCA 3VI4B 1JFSA 1VPDA 1AOXA 4FWBA 5FTKA 3WGUA 4RZHA 2IHTA 1BG6A 1E0AA 1G42A 3PITA 1EK5A 4N3BA 3ASYA 1KH2A 2QN6A 5D92A 2QZPA 4LW8A 1NX9A 1NJ5A 2EZ9A 3BD8A 4XUDA 5BUQA 1GFWA 2R1TA 3VRCA 2HQSA 2BFAA 1E2FA 2YIJA 3NHBA 3SC2A 4UTVA 5ITZB 3G5AA 2C2OA 2OM2A 3WKEA 3UCFA 3KJIA 4UMEA 1I30A 4I99A 2W42A 1CJSA 2O3UA 3JALA 5BVHB 6AT1A 1M0WA 3EGOA 2ZYSA 3Q7PA 1N5JA 4P35A 1HZJA 4MYUA 1JAIA 2PU5A 3AFGA 3RVOA 5BN5B 1YDWA 1Z5PA 2G67A 1V4NA 3Q11A 2W2NA 2QRKA 4OFXA 1COWA 2AN1A 4WJLA 1ATIA 4MVYA 1NF3A 3WQQA 4DG5A 2EYUA 1G63A 4YYEA 2ZBEA 3SNKA 2ZUFA 5HE8A 4DY4A 1GPUA 2Z43A 3HYRA 4EKGA 1KZYC 5JAUA 1O97C 3B1VA 1JIKA 5BSWA 1EFPA 5COQA 4MV1A 4ZOLA 3SQLA 2R6DA 4INPA 3II6X 3Q7TA 1RNLA 4XM0A 3T0IA 1I94B 2QPTA 3AF3A 2SCUA 1CG6A 4F2GA 5KIAA 3BH0A 2BUAA 1SVSA 5DF1A 4TTAA 1YZHA 2YHIA 3G8DA 2Y77A 1AVTA 4A0HA 1DBIA 2Q5IA 4TLEA 1WMAA 3UJ3X 1DKRA 1G8MA 4B46A 2M6RA 1M1YE 5KTOA 3QKRA 5EFOA 2YXDA 3R5XA 5AM4A 4LI0A 3IJ5A 4JIMA 3JD3A 3R20A 3VSDA 4JP8A 1WHSB 5GONB 5B1HA 3S2SA 3MS2A 4KFTA 4D43A 2Z5GA 5KYWA 1XA0A 2XDWA 2X3YA 2B8EA 1L2TA 3FOFC 5FO0A 1UAAA 4RA9B 1CUFA 5HJ2A 221PA 1BJTA 3B3JA 1DC7A 2YXEA 1RKEA 1Z68A 3DAPA 1UEJA 1P1FA 3EIFA 4EEKA 1BE0A 2Q5QA 3DD1A 3GXBA 3UJDA 3FA2A 1LS4A 2CVHA 2CZQA 3VGPA 4GVXA 1AQJA 4R8SA 1OW3B 4WBXC 4XDZA 1TVKA 1C3OA 3MT9A 1QV6A 3V4RA 5DTIA 3WP1B 3RSCA 1B3RA 3PFHA 1V5GA 2H65A 4AL0A 3QVXA 3FUCA 1LDMA 3T1YB 4O4HF 5E33A 3U61B 4R9VA 2FE4A 1SCIA 1N2HA 1NW4A 1CUIA 2FX5A 4PIPA 2ZUCA 5HF6A 5BV0A 1QVZA 1U1CA 1SCJA 5B53A 5I7OA 1JU9A 4YCNA 2WMNB 3T4PA 3LT0A 4HYQA 1M6NA 1PFUA 1FAPB 2IYWA 4Q4ZF 4MTLA 3ZGZA 2YVAA 3S8MA 5BQHA 1ZCJA 1JFFA 4NMXB 3VNAA 4R31A 3QG5A 2QV0A 2BE7A 4US1R 3KC2A 5JAHA 5AVQA 4GF5A 2W5UA 4DSUA 2Z8ZA 1GG2A 1VBNA 2J5KA 4GIBA 4M0EA 2H4HA 4B0PA 1NNLA 1D7AA 4TL9A 3Q7GA 5JVDA 2GMWA 3EIOA 2NT4A 3NUQA 5IJZA 3BRWA 2TMYA 4WEOA 4KV9A 4DE5A 5J5CA 3PLNA 3N2ZB 3GI1A 5HPYB 2XGMA 3AEZA 2IF2A 5FEMA 3R7SA 4EQZA 4IS3A 2HUPA 3TS1A 2HC9A 3OICA 2EL9A 3D2AA 4GDMA 2OFFA 3QLUA 1PR0A 1GRCA 4EVSA 1PEDA 4L7QA 1YRAA 1XPRA 4AJKA 1XZKA 5HX7A 4CF6A 1TLFA 4JK3A 3ZZMA 3EVFA 1CYDA 2VF4X 3CISA 2REBA 1P62B 4I3FA 4UNQA 1PDWA 2F9FA 3SF8B 4M89A 4G86A 3L34A 4II2A 4Q3EA 3T3OA 2WF5A 3PI6A 2RMKA 4INOA 2OCPA 3EF0A 4LTNA 3VPAA 1PK7A 3SPXA 1WTCA 5ADWA 1RAFA 2B0JA 4GL4A 2CL6X 3SU8A 4ZRNA 2GN2A 2JIBA 1KI3A 3LG2A 3WLMA 4DSOA 4UEOA 1DUIA 2HMVA 5B3AA 1DEKA 1KS9A 4A1OA 3GNTA 4JLUA 5JC8A 4MOWA 4JT9A 2VHJA 2ZP1A 1XXHE 5L3QA 1MZVA 4FMBB 1K06A 3HA3A 4MLPA 3QZCA 3B0VC 2Y66A 4O59O 4RTPA 1ZHYA 1ID1A 3I42A 2X7XA 1YFLA 3PU6A 4MVZA 3FGPA 4Z0NA 3OOHA 4XEUA 4COKA 4F04A 4PJLA 5FRDA 4E46A 3GOQA 1JVSA 4RIIA 1DIAA 4M22A 1LI7A 4K9PA 1WXEA 2VTBB 1DKPA 2AUNA 2V74B 1KK2A 5IC4A 1CF9A 4NDAA 3BC1A 4MUAA 2RH9B 2FPUA 3TFWA 4NFHA 5KQPA 1WNTA 3PRKE 3GUHA 4C2UA 3GHHA 3EIUA 5CG2A 2XKAA 1F5SA 1W59A 1K5DA 1R0SA 3C3AA 3V8NA 2EFJA 3ZWNA 4MVQA 3R5SA 5HQTA 2EVWX 1KPHA 1BA2A 1E64A 1JKXA 1LLDA 4UDXX 2QNIA 3E9ZA 2GZMA 1XWWA 2QRQA 1MH1A 2IVZA 1BYUA 2O3SA 4AY5A 1F2DA 4NBTA 2CUZA 2OXRA 2Z6AA 4QDLA 5E6RB 5K8IA 4HPJB 1EDEA 2CYCA 5KTRA 5CLGA 4I6EA 3MD0A 5AVKA 3V8EA 4N49A 4F4JA 1PL0A 1H0KA 4IG4A 1QH1B 3MERA 1F2VA 4XPIA 3OPXA 1UKBA 1VZ3A 2FY8A 1LK5A 3A04A 4XCXA 3VOBA 3SJZA 4C7OB 2P9CA 1R5ID 1HSOA 3EULA 1EQUA 5M5BA 1OKKD 2WUVA 1GCIA 4QUHA 4ZCMA 1JEAA 5DCUA 4JMPA 3RK0A 1L5RA 2R00A 4DOZA 2GEFA 1FJXA 2CJPA 4IWXA 4L9WA 2FSIA 4OTZA 2H92A 3OY2A 5KEIA 3WLKX 1CSEE 1Q0ZA 3TTUA 2Q9BA 1GNVA 3FBTA 2WTMA 3NH9A 2XNJA 3UCXA 3RVJA 5CT9A 5CVJA 1OWOA 1VDMA 2V8OA 3KWLA 1U1GA 5HNKA 4ZVRA 4UUQA 5CDGA 1GL9B 4F3RA 4EMBA 5IW8A 1YIAA 1CEXA 1N2CA 1RCTE 1M8KA 3MJVA 4B6PA 5H68A 1P5RA 1U3GA 2GN1A 2HAEA 2HSEA 4NI5A 5G3ZA 4YCSA 4TPKA 4BMNA 4X60A 2GTIA 4TWIA 4EQ6B 3A3NA 1L7BA 3MJ4A 1JLKA 3DKVA 2QW1A 2XY4A 2HDHA 3GUZA 5KVQA 2QF7A 4JNCA 3NVMB 3IKVA 5AICA 1UFRA 4EFLA 4DEYA 4FIZA 2X0IA 3UC5A 3V46A 4HN2A 2WZFA 1MO6A 1SWWA 2JL1A 3OO1A 4D4IA 2Z3WA 3IJRA 5CLHA 3LBFA 3LV8A 2R6JA 2HS5A 1VPVA 1GNQA 5EJAA 1MFZA 1TM1E 3PJGA 3LC0A 1KAOA 2A78A 1SQ0A 5DI9A 1NBWB 4V3CA 1ZITA 3L4SO 2ZXPA 1H42A 5LQAA 1TQ6A 4IJQA 3HNKA 5FV4A 4ZCLA 3U4GA 2H85A 5EE3A 1EJBA 3PUZA 1W0KD 4RNCA 1LV8A 2A92A 1YFZA 3U7QB 2D2VA 3G0IA 3R7BA 1Y5LA 3ONWA 2J6IA 3JRXA 4OHOA 4CS9C 1SOWA 3CRNA 3EEYA 4WFIA 4NYJQ 5LQJA 4ZV7A 5CR9A 1ZSYA 2KMLA 1H0SA 1PZFA 2BM9A 3KETA 3AL0C 3EWAA 3IIIA 1JQKA 2FUEA 4WKGA 2ANBA 3AY3A 3A6ZA 3H5VA 4JLBA 4YQFA 3BHNA 2VNSA 1U2GA 2Y8EA 2IA5A 1GQSA 3L2OB 3K35A 1REQB 2BTQA 4ND4A 3GL9A 4LE2A 3A3OA 1FIUA 2A0XA 1C8VB 4WCDA 5EZ5A 1U9CA 5TGZA 1BX3A 3CR8A 2WF7A 3IPCA 4C0HA 4E4TA 3JD1A 3U4QA 1F1JA 1P9LA 3GQBA 2NZYA 2B82A 2QR5A 3SZOA 4CCYB 2HADA 2NO5A 3QYFA 1DOAA 4FC6A 4KIUA 4QGGA 3K0KA 3V4VB 4OHYA 4ALIA 4AWAA 4TTIA 2J67A 2ZU0C 4Z3KA 4WDRA 4WADA 2Y1DA 1MKYA 4A10A 3ET5A 4R2WA 1GGEA 1M74A 2R6ZA 3A1FA 1C3EA 3A10A 5JQWA 2QE7D 1I0ZA 1UWKA 3PEEA 2NZ2A 1J0DA 3OHPA 2BP7A 3SSMA 1F6BA 1GTMA 4K9OA 1TAQA 3I37X 3GGDA 1QO9A 1E62A 2K4MA 5HUJA 1E63A 2AFRA 4FFWA 3N7AA 1IPFA 4D5EA 4U9UA 2J45A 1C9MA 5FBWB 4BASA 3ZS8A 1MA0A 4J0HA 5KYYA 4GYYA 2ZJ2A 1N1GA 3TOCA 2TMGA 3KT8A 3K05A 4IIBA 3QPUA 4MI1A 3FYSA 2EERA 3AUTA 2J6HA 2LR0A 3ECSA 3B3FA 3JRNA 3JTMA 2NU9B 2EFGA 3EXIA 4JSRA 1O6CA 4PC7A 1TTHA 5BUCA 2DXIA 4DUGD 1E83A 3WYFA 4DPLA 4ZMRA 3KKOA 1LW7A 3ZWYA 1YFJA 1UFVA 2ZRGA 1II8A 1A8UA 3BWBA 3H11B 4N0PA 2JFOA 2LD4A 4RPGA 4YJ2A 1Y8ZA 1WW3A 1HMYA 2J9FA 3P0HA 2WJJA 2QPAA 3LC1O 1L5MA 2PKQO 4JLWA 2JFHA 4DRXB 4DMRA 2Q5FA 1I9GA 4AI6A 2ZE5A 1JR6A 2XWJI 5DYNA 3NIFB 3KQUA 1IXYA 5IZCA 2FPGA 3NHWA 1CUCA 4N6NA 5JJ5A 2CKDA 4ENUA 2CXOA 1JYEA 2B6NA 4YRTA 3OQ1A 3AQIA 1MHPA 4YQYA 2ID8A 3UPTA 3Q3HA 4BO4A 3I9MA 2DHDA 4YT5A 2ZSKA 5LL6P 2QYSA 2O07A 2IEAA 3SLRA 4MS4B 5IBRA 1Y5RA 2JASA 2AYZA 4G25A 4V0SA 1SOMA 4UU7A 1FTGA 3EIQA 2EU8A 4CWAA 1J49A 5I9BA 3WOHA 3E18A 4ZC1A 4LDNA 4U5HA 1CJMA 2EIHA 3WZ2A 3Q8LA 4MV3A 3WYCA 2PMDA 2QVXX 5EMLA 4LTDA 4BEJA 1DT3A 4ID3A 4CQNA 1JU4A 4OBWA 1Q1GA 2GPTA 1KH1A 4D4GA 1JL3A 3DBRB 5EE0A 1QIIA 5I4CA 4LJSA 3BB4A 3GT7A 1Z0ZA 1OXVA 4Q3BA 1JKJA 1MAWA 4KAJA 1AM4D 1Y3BE 2IOHA 3TOXA 4QU0A 1KFEB 4D5GA 3CUUA 4ZREA 3MTIA 1XZIA 4BMZA 2YCBA 5DH9A 1GTVA 2V0GA 2ZBUA 2PJDA 1TUIA 2VH3A 3GP5A 1H3EA 1LKZA 1WATA 4HSEA 2FAPB 5KSYA 3RCBA 4D4NA 4IDHA 4BNKA 2RGAA 4G4SO 1EUQA 4R3WA 5AJYA 2QM0A 3BGOS 3WODF 1W44A 2PR2A 2YWBA 5EK0A 1EXDA 1P5HA 4E07A 4MS3B 1CR6A 3WLOA 2C42A 3G7SA 4J2HA 4KWTA 1KZ1A 4RLQA 1YC5A 3A4VA 4WXRA 5CFNA 4MNDA 4QC2A 3ZK7A 3DFFA 4B47A 1JSZA 2A67A 3G9ZA 4M87A 8ATCA 5F73A 4K03A 5L0JA 5B37A 2F1HA 1I4OA 2VL7A 1V37A 1Z8NA 1GNPA 2A9OA 4MW2A 1G55A 2VUHB 3OE4A 3QOXA 3ZBTA 3NKVA 1R66A 4CLOA 1TF5A 3AEQB 3EZHA 1D3AA 2ZIZA 4BFZA 1USWA 2EIXA 1XKLA 4OH7A 3KMIA 4D0SA 1SFRA 3O5AA 4D81A 5K0IA 3TW8B 4BX3A 1SCBA 1GHTA 1YE8A 5LLSA 5A6AA 3L5KA 1SVMA 4PHGA 4P5EA 2GAQA 3LY5A 5A4FS 4O6MA 4YREA 3JQ9A 2CK3D 1TPZA 4AF7A 4QUDA 1RAAA 2Q1SA 4LRSB 5GWXA 3WNBA 4AQYB 2YLDA 1CQJA 1V2HE 3NHYA 3RKUA 1SCKA 2RHMA 4HYTA 2A1TS 4XWWA 3EQLF 2P6NA 2I4TA 2KB0A 2CCYA 1IVYA 1KZ4A 2HW8A 3T9AA 4ZICA 1KP3A 2D8MA 3WIBA 2YJ4A 1X1TA 3FY4A 4DLRA 3A6FA 5IH3A 4LBYA 1CDDA 4WT7A 4DC1A 3DPSA 4Q93A 3L1HA 2VXOA 3UW1A 5J4LA 5IJXA 4DWVA 2HU7A 1AKYA 2HJVA 5DN6A 2E4YA 2B25A 1T4GA 1TWGA 1AQNA 2FPXA 3HGTA 2PJZA 3H7AA 2BOVA 4W5JA 2A9KA 4P2BA 4RU1A 2XIJA 3L40A 4LRWA 4IOMA 4DEVA 2HUNA 4LXGA 3B3GA 1OY1A 2IODA 1Q0DA 1Z28A 3QU4A 3CT6A 3D2BA 5BRAA 1D4ZA 2XMPA 3K1IA 2A5DA 2QTLA 4DR7B 1MDBA 4I9NA 2O7NA 3FSRA 3KYJA 3NBKA 2H52A 4BNHA 2RB5A 1WXHA 5IAJA 1IUPA 5SZIA 4RK1A 1DL5A 1KVSA 1XTQA 2Z5LA 2YEVA 3TVDA 2AR7A 2VSYA 5FFMA 1D1TA 2R4QA 1WV0A 2FVXA 2W2QA 4ZZ2A 2N0SA 4B71A 3SBEA 2I6TA 3OI7A 2I99A 2ZJ8A 3QKSA 3WB0A 3EOZA 3OM0A 1Z2PX 4DLYA 2V7VA 3VR4A 4Z0HO 1M6WA 4AMZA 3WWZA 2IXDA 2HCRA 4C4ZA 1D07A 5JBIA 3LDAA 4FYKA 4L5IA 2WM9B 2C97A 4HH3C 2FZCA 1T2CA 4DSZA 3U8VA 1JR8A 1EWRA 1A7UA 1RBMA 4TTSA 2IHBA 4H7DA 4XLLA 3ZHYA 4GSLA 1COZA 3D8RA 1PL6A 1HUQA 1I10A 2QTRA 1VCOA 1J1UA 3ITEA 4FYIA 3I2FA 3CKYA 1XO1A 3IAFA 4QD3A 2RI1A 1I6WA 1DBVO 1HOXA 5TMDA 3WBFA 4WFQA 2J46A 3A1WA 3ICQB 2B4KA 4ABTA 2PS3A 5IYZF 1BW9A 3KFXA 4OD5A 1T5SA 1OT5A 3D2CA 2VAVA 5FOWA 4TYYA 4BMVA 3CZ9A 1NY5A 3CX3A 1NLXA 4JGBA 3QM1A 2QVLA 3T5CA 4WZBB 4RADA 3H42B 1ENZA 3PC4A 1QGAA 2J9XB 5SY4A 2PKEA 4GL2A 3PHJA 1Q12A 2HPHA 1U2PA 1PWYE 4XJSA 3I6YA 2CSXA 3LP6A 2FWJA 4DCOA 4WGYA 3AYZB 3A70A 5JSZB 5LQCA 5DGIA 1EBFA 4IHAA 3PLRA 4ES6A 1SBCA 3QUSA 3IVCA 1YAHA 1EA8A 4RANA 1PWHA 3CYFA 1AKRA 3S70A 3MMPA 1V5FA 3SCZA 1VCMA 4Q3DA 5EWMA 2O8FA 4QBKA 2PMWB 3KPYA 3C8GD 2PUVA 2ODNA 4M63A 4XQGA 3R2PA 1PL7A 1G2PA 1GNRA 2J7KA 3PUHA 1ZHOA 4KQCA 4Y9DA 2VDVE 2Y0EA 1YJAA 2E5FA 3S7ZA 4FVTA 4Z1MA 3IR6A 2MDTA 2R60A 1O0CA 4BEMJ 3JQ8B 3S8YA 1TUBA 3CSUA 1QH8A 4BXOA 3ME5A 1GPJA 3DL0A 1PJ2A 1HMPA 2C04A 1ACLA 4HDMA 3KFLA 2OUKA 4K0DA 3ZEIA 1NQOA 4XQ9A 5IN5A 4EY7A 1EEXB 3KSRA 7ABPA 4YRMA 1PP4A 1WUTA 5TPWA 4CKWA 4PZZA 2UU9B 3T7KA 4D3FA 1R6DA 2ZZNA 4WZ6A 3CRW1 2EJUA 4KPYA 1FDIA 4QNRA 1U28A 1XEAA 2NPIA 5FNZA 2DBRA 2VQEB 2HB6A 4OIFA 5HQ3B 1U0NA 4OP1A 4HBGA 1T43A 5KAPA 3QH4A 1YNSA 4PWYA 1Y9DA 1PU2A 2XMBA 3R75A 5F2OA 4OXYA 3DV0A 4OHBA 1TI7A 1V16B 1PZXA 2GYUA 1KJ8A 4C6TB 1JHYA 4JZYA 1YULA 3LKDA 1UINA 2I8BA 2OV2A 5A6SB 4Y2TA 3O8QB 5EE9A 2ZIVB 3DBOB 2H2AA 2VPWA 1EFRD 1LFDB 2JAOA 3D0OA 1CQIA 4F4DA 1WPGA 1TZKA 4UVGA 1MB4A 3GU3A 1RKQA 2EW1A 4PYNA 4YVFA 2XEDA 5EIOA 3L4JA 4B3IA 4KODA 3FZEA 3URKA 1C0IA 2FCAA 3BWVA 1E6EA 2IE0A 4H7IA 4JP3A 2IXNA 4B83A 2CD7A 1XIVA 1AN0A 3IR5A 3U7EB 3DE3X 4N54A 4OQQA 2FSSA 4CS9A 3UG6A 3BEOA 2QAGA 1Z5GA 3ICOA 2I65A 2Y4OA 4G63A 1AKVA 1T6YA 4BNFA 3FVVA 3HKEA 3DOHA 2OFOA 3PFIA 4C7MA 4FXOA 4CKBB 4JTCB 3NYMA 4GKAA 3L0ZA 5FL7D 4ESVA 1E92A 1RI3A 4AMBA 2PNJA 1RRVA 5REQB 4RVGA 1BWPA 3AUKA 3RIGA 1YASA 1W73A 4MP6A 5JXIA 1LX6A 3PFGA 4DQ0A 2XNDA 5CBKA 2VOJA 5EZSA 2Z9CA 4XOIA 2XUJA 1T0JB 2BI7A 3AGQA 4NBLA 3X1KA 3VJLA 2J9ZB 1NV8A 2REXB 3RFVA 1J2EA 1J23A 1D4OA 3L9XA 3DWIA 4TV8F 2P41A 3M4ZA 4ZI7A 5EYPA 1NDQA 2BGIA 4WBNB 5EUMA 2QUAA 5H16A 4D9EA 5ER6A 4IX9A 2OOSA 4P22A 4HNHA 6LDHA 2IQ5A 4MYTA 3ETGA 3DQPA 1C8LA 2A1IA 2WSBA 5BMOA 1W0JA 4J1TC 3FI0A 4OQ4A 4Q39A 4AN0A 5CW1A 1LVUA 4C4SA 1QVVA 2HH9A 3UJHA 1ZK2A 1B2RA 4XSGA 1J0CA 4I8XA 4NFSA 1ZQ1A 1UJBA 4M83A 5A6JA 1DCMA 4GBED 3CF2A 3BJZA 3HJBA 5CYPA 2PGLA 2FX3A 3HS3A 3ZTZA 3C3DA 3E5MA 5FNVA 3DZDA 5DRYA 3IQCA 1X1QA 2UUHA 2RKBA 4RQAA 5LIRA 2B30A 4BNIA 4MVOA 5LLDA 4K0RA 4G5SA 2H3HA 1WSAA 2XA9A 3BBPA 2ZTSA 4R9SA 4CJXA 4GSKA 1Q0LA 4Q34A 3D7RA 1E0DA 3DGFC 5FF9A 1HKUA 4U0KA 3OQIA 2WHRA 4QREA 3X1DA 1A76A 3RAJA 4X45A 3T9DA 2QXTA 2YXBA 3Q40A 4RV4A 1VPTA 2XR1A 2DE0X 1X7WB 2ODBA 1H2AS 3N05A 3KJGA 1INLA 421PA 1PG0A 3F6RA 4CW7A 3X3HA 2PZJA 4H0FA 1GO2A 5CLLA 4N6OA 4UTPA 2NVUA 3PHBE 1B23P 2IGBA 2YJ5A 3G2HA 4PTLA 1UXHA 3HA7A 3EEOA 1R0RE 3OQPA 4L8GA 2J5QA 4FT4A 1ZYUA 2VBGA 3V7OA 4C07A 1YZKA 2PK3A 5KNDH 4FESA 1SEPA 5B30A 1NUSA 1TRKA 1CQXA 1IMJA 1K8RA 3ZK8A 4IIHA 4QQRA 4XJXA 3LHKA 3WLEA 4OXIA 2VZ0A 4PZLA 2J0UB 4QOFA 2X41A 5LU8A 2CWWA 5J4KA 3C70A 3O0DA 2QVCA 4AS1A 2XAAA 2XCUA 2WE8A 4FYYA 1FOEB 2IGTA 3AG2C 2IRWA 3CE6A 1W2HA 3MCAA 2CE2X 2QTVA 4HFFB 1KRXA 1X86B 1A9TA 4BPBA 1YCGA 4NE9A 4JBNA 2OZEA 4DIBA 4E0HA 1XNJA 3HYLA 4JL6A 4DDMA 5H3LA 4W5WA 1DIGA 3MMZA 2JJMA 3QJYA 1GILA 5DDIP 1R5OA 2C3YA 4V0LA 4FC7A 4BLSA 1JGTA 2CYAA 1GAWA 4F85A 2UAGA 1WUYA 4RVDA 6REQB 5CA0B 5JPIA 1JNXX 3BXPA 2SKCA 1RPZA 1JLRA 3RFYA 1XNQB 4P6IC 3OIYA 1WUIS 4DNOA 3GGJA 2XCSB 2PAAA 4RUKA 4B3MB 2XDYA 2JLQA 3C8GB 4CL2A 3QIVA 2PRYA 2OEVA 5KTMA 2OQRA 1FSSA 2Z9DA 3AJMA 4GI1A 5K3FB 2HA7A 2JLYA 1KY3A 1K3TA 3A9VA 1SBIA 3FF4A 3I1IA 2UZ4A 4JUBA 1L7MA 3MN1A 4OYHA 2RSLA 4K6OA 2P4UA 1UMCA 4P9TA 4GC5A 3RSQA 1RWXA 1U2SA 3CUWA 3U3DA 8OHMA 1J0XO 4Q9IA 3AYXB 4LJ5A 4R8RA 3FNBA 4XEVA 5FPKA 5L9AA 3TUZC 2G80A 1QU2A 4NAHA 3G4XA 4UVDA 3K1JA 2C4VA 4DL9A 3LXRA 5KC9A 4ZVKA 4NEHB 2RJOA 1S0UA 4R1PA 1AKTA 3A1NA 4TT3D 5A3QA 1W52X 2HK9A 2ZS7A 3EAFA 3MBGA 4RF4A 1SUAA 1XLUA 2JS7A 1TKBA 4CLRB 4PAWA 2Q49A 2VH5R 4NOLA 3V8MA 2VQ6A 3T1OA 3VR3A 4P32A 1QCZA 3KM0A 3LO8A 4Q1CA 3KKQA 5LP6A 2WR8A 4EEZA 3T15A 2PS0A 3ZH9B 1LFAA 4REOA 3RSZA 3KX2A 3DVAA 5JI2E 4R2XA 3E8MA 1SBQA 1BMTA 5K8TA 5DVZA 4OHRA 1IWOA 3PIDA 4WK6A 4HGZA 3EGWA 2W0MA 2F1KA 3TD7A 3RGGA 5IM5A 3LDGA 3PR1A 2C7BA 5EQDA 2EAUA 2C4WA 1VMAA 1DT5A 1NWHA 3F4LA 1CJCA 4YEDA 2X6RA 3HVKA 3WMGA 4YAWA 3OSUA 5KBYA 3ZQVA 3I53A 3X1WA 1ML4A 1NVTA 3INTA 3CG0A 3H1EA 1ZCFA 3HYSA 3LUTB 2R2GA 5DOVA 4WERA 3ELDA 4NE2A 4DPKA 4W5TA 2R65A 1OXMA 1L5HA 3KQKA 4EAAA 3HKCB 1HLGA 3VH3A 1L4GA 5HOEA 3T0GA 1UDXA 1YS6A 4EA7A 3UCEA 1OAOC 1YUBA 3KYIB 5KZMB 4YFVA 2PRKA 1J4AA 1W75A 3VO1A 3KCQA 2FP4A 5KYVA 5KS2A 5J9FA 1OB5A 4IJKA 5JD5A 2E87A 5LBUA 1ZOSA 3WJ2A 1Z15A 1N9KA 3GT3A 4ZD6A 2H06A 4ND1A 4GX2A 2W2OA 4PNEA 3AKDA 2YC2C 3P9PA 2H2FA 2C7PA 4LDZA 1GZ3A 2IYYA 1AUPA 1WG8A 1X8JA 3Q9UA 4Y6PA 4RS3A 2W8BB 5KREA 3OCWA 3V1NA 3SN6A 4B4DA 2IXFA 4E18A 4EDFA 4CMBA 5K3SA 5CDTA 3FWZA 1PS9A 3NOXA 2VN8A 3TM4A 4WZZA 3HCRA 1M5TA 4IR7A 3IDSA 1QU3A 1Q1NA 4YJ3B 3MYIA 5A6KA 1EVIA 3CCCA 4JITA 2VNAA 5AI5A 2QHXA 3WWYA 4EKIA 1X87A 1SA0B 3RS2A 2ORYA 5F12A 2IOFK 1QYCA 4L4UA 1DDOA 2R751 1M1UA 2HJSA 3M3DA 2ARKA 2V3WA 3KUDA 4G89A 2P78A 2BFMA 4MV8A 3JWEA 1EGQA 3HE3A 1PFYA 2HMTA 2B94A 1KXZA 2P3LA 1YBMA 1UP6A 4LJLA 4UXJA 1O87A 3V8QA 2F1IA 2DTDA 1LQUA 1TCBA 1AA6A 3TWOA 4PYKA 4L0MA 2IXBA 1N6LA 3VNQA 1K08A 3ZGLA 4RGBA 3FDFA 1T8PA 2I2WA 1AXGA 1KJJA 2XNSA 2NU7A 1XDDA 1NBAA 3HYCA 2CLIB 1NURA 4RE6A 3GEIA 4OP3A 4BV9A 4FE4A 1KXJA 16PKA 3DPIA 1NRWA 5A71A 5CITA 5DLQC 1IB0A 1X14A 1Y1KE 3TI9A 1KYQA 4N6HA 3OX1A 4JENA 1Q1EA 1FFSA 1XC7A 3IMFA 5LWQA 4HADA 4E94A 4NNJA 2VJMA 3ETCA 4PLCA 3WHLA 4FFMA 2R7XA 1KEVA 3PXBA 4MPPA 3SSOA 1B6SA 3ZZ1A 2BR5A 3T95A 4IDGA 2FZLA 3HNJA 2AZMA 4WGGA 1FFDA 2JA1A 2MYSA 3HEAA 3MCUA 1JE0A 3ZWWA 2JFVA 3K3PA 1SGWA 3MLAA 2BSQA 3IO3A 4ZV9A 1PQWA 1A5ZA 4NYIQ 3PJEA 2P11A 1XLTA 2Y0PA 5JRAA 2IH4A 2MSKA 1PYDA 1PDOA 2R1VB 4ZAVA 3EFHA 4LGYA 4C43A 2DBYA 4WQMA 4JU9A 4N65A 4DCVA 4K9NA 3CR7A 4NKRA 3DYIA 4KXVA 5ALRA 1PVOA 1YTLA 3EZNA 3T41A 4NCNA 2EGHA 3PK0A 4DZZA 3QNWA 2FPRA 1U65A 1RI4A 3L7DA 1U7TA 4NNPA 4IGAA 1P7VA 4ABYA 3VR6D 3VC1A 4OAOA 1RJ9B 4QZVA 3PNQA 1IXKA 5BP7A 5JU6A 4A2CA 2QP4A 1KNYA 3PXGA 4GQAA 1GQFA 2C4KA 1OD6A 3I92A 5ALDA 2J0VA 4GM4A 3BPSA 1GTJ1 4PYIA 4UAVA 4BFYA 3KQNA 1MB2A 2C2YA 4DLKA 2BEWB 3IHTA 5ILQA 4LWZA 5DSXA 2YL0A 3EGXB 3D8HA 5IDWA 2AQIA 1QTIA 5AW7A 3V1UA 3UFXA 3GP8A 2JIPA 5AOAA 2HMYB 1RBQA 3HJFA 3H6GA 3SD7A 1N3IA 5EHZA 3D81A 1DG1G 4D9JA 2V6JA 3I62A 1WZEA 2PKQP 1EUYA 2XMDA 4GO1A 2EBUA 3K0EA 2IUTA 4RDAA 5CPBA 2Z0MA 2LWIA 5GAJA 1QRAA 3OHMA 5IKMA 3TQSA 3VZCA 4DCPA 4GUAA 2X9NA 3D64A 3RS7A 1CE8A 3CWZA 1Q91A 2Q2WA 1JH8A 1ZX1A 3O4JA 2WMOB 4P0QB 4R9RA 1QMPA 5U4QA 3I6MA 1VJRA 2QNBA 3SF8A 2C0PA 3OAAD 3OKAA 4I2VA 4BO6A 4IFEA 4E6EA 1NQ5A 1QQ6A 1OV4A 3UJ9A 1DXHA 4I4NA 1XQWA 2KSQA 4EJ2A 3PTZA 1A9SA 4BWFB 1X1BA 4YROA 5FBQB 2ERYA 4I4IA 3M49A 1BN7A 1V3QE 4UBOA 4IUCS 3CXRA 4EG1A 3U3FA 3D4OA 3P2JA 3K7DA 3GBPA 3TB6A 2LKCA 2CDQA 4GWGA 3DA8A 5E3HA 2DQSA 3ZSUA 2GBGA 4R2LA 2XVZA 4Q3KA 1ZOLA 2C7GA 1EFLA 3KT6A 4N8SA 2JLSA 2Q3DA 2OUIA 2JKYA 4JVSA 3H4MA 1QWOA 3TW4A 3UV6A 1XK6A 3ZHSA 4F5ZA 4GZLA 3I2YX 1Z0FA 1EBUA 3GLFB 2R4UA 4WIAA 5AQEA 5A2QA 1XLWA 1NBMA 1O96A 2HTFA 4H54A 3LUPA 3AP2A 4X92A 4RY8A 4PRYA 4JI6B 2G3YA 2Q41A 4LRXA 4G4SP 3L02A 4OLHA 3GJXC 4TV9F 4MLCA 2PY6A 1ZIDA 1SVWA 4CEHA 2ZI4A 3RQSA 3ADCA 2OMEA 4DBLC 3GZNB 4C06A 3DKAA 4RHEA 4I8DA 4OB8A 2BL4A 3OHSX 2ADOA 2I34A 2IIQA 2RK6A 1C7JA 1LNZA 1IG3A 2OEPA 2IBTA 4ZHQF 3OOYA 1QP4A 1CFZA 4BHTA 2V7EA 1O03A 1XQYA 4P38A 1IG0A 3I0NA 3K0AB 1DUVG 4H7JA 3UJPA 4WVFA 4OU5A 5AI6A 1WLSA 3ZLUA 1CR2A 2FPSA 3T5AA 3CHYA 3DJYA 2W2LA 1YQUA 3SJBA 3FSEA 4PR0A 4Q15A 1EDDA 3OIUA 2JGKA 2YY7A 3W8RA 3ZDXB 3NHJA 4XEKA 4I6JA 1BXGB 4C03A 4U8HA 5JRDS 2BEVA 4Y9TA 3H0CA 1V6AA 4QVGA 4QLBA 1Z8HA 3W6ZA 3L7AA 1FNDA 1MFPA 3H17A 3QV2A 3GT4A 5AR1A 1YBAA 2AIRA 2JBHA 1U0GA 3NS7A 1AQUA 1FBTA 4B4UA 1P61B 1YZYA 2X7HA 3IRUA 4QGBA 4J3FA 1O4VA 1BXRB 1A1VA 5GJCA 2J9GA 4JI8B 2RHCA 1Y6DA 1ICEA 2JAXA 4C4XA 2BEJA 1KVUA 5F52A 1ESDA 2Q62A 5B2ZA 4HRVA 4IWYA 2OT3B 5A5GA 2GD1O 3L8GA 1GPKA 3TTTA 3NORA 3VV2A 4F6LA 2QR2A 3OZBA 5IN4A 4GWLA 1X7ZB 2CJYA 4XXHA 4MP8A 2W6CX 2G9NA 3GLQA 4POAA 1Y8RA 3UAWA 1P91A 1MW9X 1ARZA 4NESA 3SBXA 4PLYA 2ZSAA 2D2IA 2CW0F 1F2UA 3T38A 2EKLA 5LWHA 1JBEA 3D1LA 1DJMA 1JAHA 3PXEA 2DQZA 1OX4A 1MB3A 3JQAA 4IHJA 4DV7B 2DM6A 5JD3A 4UM9D 4CMIB 3SHVA 3O21A 3IV7A 1LQ2A 3INGA 4OHXA 4KI0A 2HK6A 1KJWA 3RRJA 4AKSA 2XW6A 2GZ1A 1PK9A 4PSAA 1QS0B 3U16A 4GOND 5GZ1A 1BEZA 5B3JA 4EHAA 4YRIA 4M3NA 3THYA 4NV1A 3GRCA 1JDPA 4TWZA 1Z4NA 2OM6A 4A0QA 2PFGA 4QVIA 2IYOA 3ADDA 1X1AA 3DMFA 3GZTB 2HZ7A 2M64A 5FORA 4MVJD 2PX6A 4DG9A 1GPWB 4A15A 3R0IA 1TQ2A 2GBLC 3AM3A 4ZOBA 4WUVA 3VAYA 4Z4IA 1QYWA 2GPWA 4FLFA 2R03A 5TEWA 4GLJA 1JTEA 5EMHA 1GZ4A 4QL3A 1MGPA 2XUDA 3TRDA 4BKMA 1W49A 5KYXB 3QTHA 3MJDA 2W4IA 2I8LA 4Q4HB 1O94D 1M34A 3TLJA 4PRKA 3R0ZA 5EVCA 1QHGA 3CJRA 1JAYA 3C4QA 1DX4A 1Z6XA 1B0PA 3OEHD 4JHXA 1UBRS 1V8DA 1OW7A 2BN4A 2QDXA 4NPHA 3MPUA 4E7ZA 5LA6F 1EWTA 1JDUA 1UK9A 2DTXA 4O79A 4JR1A 4DVZA 4KSBA 1MAUA 1XTPA 4E32A 1CHDA 2EHJA 4IDBA 1OH6A 3Q7LA 4MMZB 1M2FA 2R7VA 3AFHA 5K0FA 4Q5IA 3ADOA 2YWFA 3EDOA 3G0DA 1M33A 5FFNA 1JHPA 1XDWA 5IEBA 1IAVA 1PD0A 3VOSA 2P2SA 4XWJA 3RKOF 3L0CA 1SQSA 3MJEA 4DVGA 3MTBA 4FYHA 1GUDA 1MA3A 4N01A 5AUNB 2FU5C 3PCVA 3RAGA 4RYLA 3U2MA 1QKKA 1J2YA 5EEGA 4K87A 1OVMA 3QEAZ 2BMFA 4JAVC 3PUXA 1N77A 4YI3A 2P4QA 2QK4A 3KK0A 4ZWNA 1ZJZA 4I55F 4BEVA 4HWSA 1EUDB 5AJUA 4DJ5X 4BQOA 4JJZA 3FMFA 3F9IA 3JYOA 2YTZA 1BS2A 1Q92A 4ZAFA 4D4MA 1DV2A 4J1NA 4KO1S 3LSTA 2PMCA 3TLXA 8GPBA 4E3ZA 3SYKA 5DW3A 3VNBA 3QVKA 1XZJA 1XROA 2X19A 3QHAA 4QXPA 1NZDA 1DAPA 3K09A 1TMKA 1IY2A 3B60A 5ALPA 4IYJA 3TLBA 1YS9A 1P29A 4X20B 3J81k 4DDTA 8LDHA 1RYDA 5MN4A 4D56A 1SB8A 1FLNA 4DR6B 1H6AA 3DAHA 3QPVA 2UZAA 3PDIB 1OOEA 3ZY2A 4CCWA 4ZDWA 3CVUA 4H4DA 3DSRA 3VDMA 1WLYA 3QOWA 3NTQA 4DDWA 1AKEA 2RHDA 3QXJA 3GLIE 3L0IB 2VEDA 4WKNA 2NU9A 4YMHA 4Q48A 4WY8A 1O95D 2EYQA 4ZZ0A 1VGRA 1DHRA 2ACVA 4B3XA 1JG6A 3PC7A 1XP8A 2MMGA 3UGPA 3NTRA 5CHYA 3RVBA 1T4BA 1KMQA 5EKTA 1JI3A 2Z5FA 5EZYB 1MR3F 3W5DA 3PDHA 4TKMA 2ZUSA 2FZEA 1I7PA 2C78A 3LVFO 3RRYA 4AXXA 4X54A 1MO3A 3R7WA 4UJ5A 2MSNA 1FSFA 1XNGA 4CV3A 4GGPA 1BR2A 4JJ6A 4DRXA 1TF7A 1ZA1A 5A5FA 1FEZA 1WWPA 4NICA 3ZJYA 1VHWA 1G18A 3UK7A 2BSAA 2XB8A 3HBFA 4HAIA 4KIWA 2WP0A 1E3SA 3ERCA 4OJMX 4KUHA 3B48A 2I1WA 2H8KA 5CB4A 3SYMA 1EKXA 3FZYA 1QCDA 3CGGA 1G8JA 3EGVA 4CNQA 5CCXA 4X7MA 1UK6A 2FPKA 3QXGA 1QO7A 1UKAA 3K1YA 3AEYA 4ER6A 1DRVA 3VX4A 3BIFA 4B8WA 4O2BB 3K1ZA 1GGNA 3S5JA 1TQDA 3AIOA 4B6GA 3TBFA 5LMZA 2J9WA 3EFOB 4N7RA 2PLNA 1CJTC 5K3OA 1TEHA 4HX5A 1WBDA 3B70A 4QDZA 1YJ8A 4MWZA 1MUUA 2IX9A 5KAMA 3UAZA 2IU3A 2WB4A 5IEJA 4KWCA 4X97A 3O4GA 3P9NA 1AURA 3REOA 2HXYA 4FT2A 1EVJA 4MRNA 4TTJA 1Y4ZA 2QGNA 3ODPA 2Q0HA 4JN6B 4PS1A 1W85B 5C37A 1GCGA 3NHLA 2YZGA 2DKFA 2CNWA 5AESA 3ZG1A 4S2EA 3WDSA 1G3RA 3LLCA 2EILC 1L5OA 4FZJA 1F9EA 2WU8A 3COPA 4V1CI 5CCEA 4QOHA 4NXMB 1V35A 2J3LA 2KQ9A 3D6AA 4YCCA 3B12A 5INTA 2H17A 4RAOA 1MPTA 4YDRA 2VI5A 3NIBA 2J3KA 5HE9A 4WMLA 4R2HA 4JBWA 5AC5A 1M2JA 4PF1A 5JVEA 2GZ2A 2VYVD 1Y34E 5BMVB 1BGXT 1E32A 1XB2A 4QXMA 5NLLA 1R8SA 3M5DA 5T3WA 3WYDA 1OKKA 2WV7A 1OF1A 1ZNWA 3DV9A 1V3VA 2WVQA 3JAMA 4LCBA 4POOA 2ZJ4A 3DDZX 1E5XA 4EO7A 3PCTA 1J5XA 2V65A 4QULA 2Q1UA 2R6R1 2XI4A 2ZI7A 4BNDB 1JOGA 4CMEC 2WYHA 1ZN9A 5DE3A 3I0MA 4MJ3A 1A9PA 4DB2A 2COKA 1N6NA 3LVQE 4NULA 4ONEA 5HZHA 4CKCA 1OC4A 3AEQA 3T3NA 3JT1A 2BY4A 1H9BA 1RLIA 4UFNA 5DNUA 2D13A 2O23A 2ZREA 2A5LA 4INZA 4UOQA 2Q50A 1AZWA 4YTEA 2BJWA 2BC5A 3EXAA 3DMTC 1SR2A 4ZU3A 2BZ1A 4D02A 4EPVA 4D3YA 2YXNA 5G0WA 3GVCA 3TRJA 5IP5A 5ITSA 1FDVA 2VDWA 4LAFA 1IBRA 4DGSA 4BUZA 2IKQA 1SQ5A 3EDRA 4NBVA 2W2MA 3TIVA 4UM9B 3X1YA 1NFRA 4GPBA 5I51A 1YZTA 3ECAA 3K5HA 4FN4A 2COEA 4CTNA 4BB5A 1KAMA 2J8WA 2FG6C 4DBRA 3LYHA 5LNK6 3A6HA 3FNFA 1G8HA 1UBUS 3RO7A 2ADFA 1VG9B 4EENA 5K7SA 2IPMA 3CLVA 1YS4A 3UV7A 4P5DA 2PMFA 2IS1A 5KWIA 3RADC 1KGSA 2VP3A 3HDJA 5C1PA 1JT9A 4EHHA 3VR5D 1S2DA 3IQTA 1U99A 4O6VA 1CUYA 1W0KA 1AMUA 3RF6A 3HCFA 2DFLA 4M36A 1N3BA 3JSXA 2F00A 3NWJA 3KD2A 4RDHA 3U26A 1UWLA 1X0XA 3M0EA 1VE9A 1HMDA 2WU1A 3FAKA 2PLAA 2L6FA 4HY3A 4X7BA 3P32A 2OHOA 3BD9A 2P5SA 3NJ4A 1U0BB 1IXSB 4HFMA 3K71B 3ABLC 2KS6A 1XTRA 5ER9A 1YJCA 3NUGA 1RABA 2FQYA 3PDCA 1J5EB 2XB6A 2FA9A 4H4EA 4WBSA 7GPBA 3NWOA 4OJQA 4BU1A 2G6TA 4X62B 2HV9A 3WK9A 1T15A 4IH9A 1U8UA 1YIOA 1YR1A 1P75A 3L8DA 3SOZA 1N7HA 2QXUA 3QLVC 1KY2A 3NDJA 3ZU6A 4ZMSA 1XRMA 1G21B 3KB6A 4GGMX 1YAJA 4D9NA 1UBFA 1SIOA 4F21A 2PWZA 3NYQA 3ENVA 1NF9A 5F3WB 4LSMA 2QLBA 1E3LA 4EL5A 1G8KA 1BA3A 2JFNA 2YX1A 4KLZA 4P86A 2ODQA 1ZHZA 5EHNA 2O2HA 2Q5CA 4Q7EA 3MJTA 1ZCZA 3B2EA 1Q0MA 4J7AA 2KX7A 1Y3CE 4PBRA 1ULZA 2BE9A 2WJYA 2JIOA 1C0KA 4I50F 3M9XA 4JI7B 1JBKA 2VZEA 1E77A 2QE7A 4N4AA 2QNLA 4MX8A 2HYIC 1FYEA 4ZI2A 2YUIA 3P9ZA 4HLNA 3G89A 1U0TA 1T24A 2B2CA 4EMSA 1SC1A 3KAQA 1YZ3A 1VHTA 2A57A 3A3KA 4TKVA 5A0TA 1FUIA 4YJFA 4QOIA 2FZ4A 5H82A 3UUFA 5GV7A 3CH4B 2W22A 5A9SB 3AP3A 1BEEA 4I08A 2PT6A 1KSJA 1VOTA 2EJCA 3I04M 1A41A 1QB8A 1B00A 3PQ5A 1PJQA 5B3LA 5AIAA 2GZAA 5JSZA 1YZCA 3FFXA 2BMDA 5TEVA 5DYIA 5EMJA 2P67A 4KN8A 5C81A 2B2XA 1T6XA 2AZDA 5JXWA 4BDSA 4LDJA 1TTTA 1CCWA 3I01A 1QIGA 1P6QA 2H7YA 3MGCA 2R8RA 3I58A 1JJAA 3ER6A 2XTNA 1RXYA 4PEVA 1EB8A 1FVOA 3KKZA 3USES 1P5ZB 2BPOA 4DUGA 4Z7NB 4DCJA 4HAVA 2R7QA 3STWA 2HXGA 5DU2A 2IIBA 4LDQA 4ILKA 4PC2A 2UUPA 3AG6A 3O3CA 5LUAA 3ACDA 4BP8A 2WU4A 2W98A 3CLRD 3FRIA 3GFPA 6PFKA 3JPWA 2XL6A 3IAAA 4HB0A 1MJGM 3OQOA 3JQ8A 2F62A 2HZ8A 1RQ2A 5B64A 1L8XA 2FSPA 1WS6A 1BE1A 3L1KA 5F5NA 1XVLA 4YRQA 3NHPA 3ZC3A 4NU8X 2OBFA 4CETA 1T3LA 2G1KA 4NFYA 1YQQA 3AK4A 5K51A 5DEOA 4P33A 4KQMA 4B7ZA 2HK8A 2YWXA 1M2KA 4EY8A 3PPXA 1E3DA 4JD5A 4YMIA 5EHIA 3GWLA 1L1FA 2PT9A 1VYHA 4KL8S 1PUIA 4B2LA 2CNDA 1DFGA 5CT4A 3U80A 5I9TA 2R9RB 1ZYRF 1E2PA 2XVAA 3BXEA 1W6RA 3FAPB 3D8UA 1R50A 3X0DA 5JC1A 1YZNA 4B3FX 2Q2QA 5JFOA 4LIPD 3ZQ4A 1GQAA 1GGVA 5JECA 3EPRA 3A0RB 3DTVB 5J2TF 4OATA 1VHLA 3EBLA 4BVHA 4MWOA 4IAOA 5TX7A 1EUCA 1PJ3A 2GAAA 1O54A 4YRKA 4XVHA 3LK7A 3H87A 3BXFA 1WU8A 2OD7A 3L1UA 4LWPA 3IO5A 4D8UA 2W9YA 1AA9A 2R8YA 1Q57A 4PSVA 4BS9A 2AW3A 3VR2A 4DV1B 1ST6A 2G1JA 3FCEA 1F6DA 2QT9A 2BHLA 4I4TA 3PA8A 4J91A 3B6KA 1YI1A 1KBQA 1OGYA 1WSWA 4BBJA 4IDQA 1QAOA 4UCWA 3A27A 4F46A 2IUYA 4W1QA 4MW8A 3DTNA 3TL2A 1KDOA 1P4GA 3E05A 3I5PA 3CWCA 1JX6A 2O2XA 4Y67A 3DVLA 3F98A 4R1QA 2ZI5A 4FGWA 1V2GA 2A86A 4OBXA 3OMXA 2BYTA 4QT0A 3A06A 1RKVA 1W93A 1F14A 1KIAA 1ZINA 4QLAA 3GVXA 1NMXA 2OHHA 2RIPA 4HFNA 3F2VA 2XBLA 2QVBA 1ZRHA 4G1VA 1Z4JA 1EVZA 3N2EA 2LK4A 9ATCA 2B6HA 3FYCA 1BDBA 4MQMA 5KHAA 1EWQA 3IYLW 1DKQA 1A4UA 1OXXK 4OL9A 2F64A 1M6VA 4YUXA 2QWXA 3AL2A 4YCAA 5FWYA 1ZMRA 3A4TA 1HQDA 4GXRA 1O9BA 4ZANA 2ZKLA 3LZDA 2ZUEA 3MAAC 5F76A 3EA0A 3LNMB 1FTYA 2PGJA 4LJ4A 4A9AA 3DO6A 1EFAA 2P9EA 2WKWA 3BH6A 2CK3A 1J00A 1W2WA 3F3KA 3R4VA 1QRDA 3AETB 4WBNA 3IVRA 3RVQA 5J5AA 2I6XA 2F59A 4ZDIA 3W06A 1SBHA 3DJNB 2I03A 5ILOA 2A8YA 2GX6A 3LQ4A 2IXGA 1M5RA 3AY7A 1OYWA 2OV1A 2W70A 3IEEA 3OEOA 4C14A 2Z83A 3B7GA 1KTMA 3H2UA 2Z8XA 2WSMA 3WGMA 4KV7A 4EY6A 4N41A 4W8HA 4IIJB 1ZOIA 1N7JA 3ITNA 4LG1A 3GCDA 1ZR4A 1ZY2A 1QKIA 4IIDA 5AVYA 1MN6A 3GNQA 5A3SA 1GU1A 1ZRMA 4E7SA 4BTVA 2IZOA 4CIAA 2LFDA 2QM7A 1R3DA 3F3MA 3OTGA 2EBHX 1PD1A 2QT0A 4MUMA 4IHKA 4L51A 3K5IA 1GL6A 3I2GA 1SCUB 1SKYE 1SKMA 1L5GB 2JD0A 3U44B 1LM3B 5L0HA 1F8XA 1QGUB 4YT8A 5AHKA 3PDWA 1THTA 1Z0KA 2PO7A 1QHFA 1X7WA 3DDSA 1U81A 3MM4A 4TWRA 2DAPA 3TJ6A 1CIVA 2QL9A 3BD7A 4D0LB 1KP9A 2HQ1A 5GJWC 2FVYA 3RJMA 5AVOA 5AJWA 5IBPA 3AY6A 1PRYA 1J70A 2HWWA 5GADl 3GMIA 1D2MA 3K0FB 3F46A 3LMKA 3V3KA 3C18A 4K9SA 1ZD3A 1E6MA 4C4RA 3RUEA 2MSCB 3ENWA 1KEZA 1HLPA 3EN0A 4JBIA 5HMLA 1S9HA 3I4FA 4AE4A 3BB3A 2ZATA 5HUQA 4MLZA 2IPAB 3O10A 1JDZA 2NGRA 2GN4A 4U6NA 5T3UA 1GTG1 4WJZA 1SBZA 4Y2QA 1AQLA 1ZZGA 4GMGA 1TZCA 3A14A 1E1LA 2QJWA 3GAFA 3EFBA 4KGDA 4KWEA 4TQ9A 3LPMA 3M6UA 4MGYR 3C8UA 2HRDA 1M7GA 4ZODA 3MGAA 2WA1A 4TMWA 3IUJA 3MYFA 1YMUA 3GDFA 3QSGA 2XECA 3KPJA 3IMEA 1L9KA 2F4NA 1UBJS 4PLHA 4RHUA 3JWIA 1ETHA 1VLQA 2H7VC 1LDGA 2F55A 1FS4A 2EFYA 3RROA 1D04A 1FXUA 5D8DA 5CA1F 4QPCA 3FCUB 1XEXA 2E5LB 4N7BA 1T1RA 5JNLA 4X8MA 2V9ZA 3QK7A 1X8KA 1PJLA 2P2YA 1DQZA 5E7IA 3FKSD 1NJ6A 3K53A 3EZ2A 5KQMA 3BDIA 1J5PA 3Q9SA 5B2FA 4UHFA 4YJDA 5TDHA 1FSGA 5ULLA 1L5YA 2PKRA 5IVPA 3A2KA 4HEQA 4TUYA 4FOLA 5BPFA 1E4EB 1M54A 2FMFA 3K4PA 3DT8A 4RHCA 3HDVA 1AVOB 4TWJA 1HY3A 2Y3GA 1DG3A 3RHSA 3WGYA 3PFFA 1G2IA 9LDTA 1KPIA 4YMTA 4YMLA 2YHBA 2CN1A 4FE3A 4R69A 3FN4A 4WKCA 4HO1X 2CHQA 4JCHA 1ODIA 1RZ3A 3X1XA 1GOTA 3U7JA 4KMSA 1HT3A 1Z7YA 1LF0A 2QBYA 1C7RA 1OXBA 4B8ZA 1G8FA 3DXYA 1NJ2A 3U7RA 2MMCA 3H9EO 2ZPTX 2BDUA 1S2OA 4OIQF 1FJ2A 2PWPA 1TVCA 3FCOA 4JBXA 4MW6A 5CFPA 1B4DA 3MSXA 3H3FA 5KYGA 2EW8A 4BFTA 3AFMA 1ONSA 2WDPA 4Q3NA 2VF2A 1SXJE 4BBPA 4CG0A 4Q3AA 1N5KA 3DB1A 4RABA 4AWBA 1HYGA 3PFBA 1YA6A 3DMTA 4GLBA 4EW1A 4Z53A 2A4MA 5FUVA 1XDSA 5KWVA 2IU6A 3G17A 1U9YA 1MG0A 4G23A 1KO4A 3IT0A 1VBKA 1E6KA 3AUFA 4JKYA 4L57A 1ZJ5A 1UQRA 1GZ7A 2WEKA 5K0BA 3HA5A 1L5SA 2QZJA 5CAEB 4OKNA 3FE2A 1I3OA 3OPYI 2CJWB 4R81A 1GPAA 3Q41A 2GPYA 4L78A 1BJRE 2O0JA 3WGHA 1PNOA 4P7GA 1Z39A 1XN4A 3DF7A 1EFRA 1V11B 2P30A 1WP4A 4E5SA 2CZGA 3BH7A 3PG5A 4P3YA 4Y6LA 2IS4A 2OECA 2C03A 2AFIB 2B9EA 1GQRA 4JJGA 4G85A 3DLAA 3IUMA 2P9FA 3AVPA 1PJ8A 2B8JA 1A9XA 3NALA 3H2BA 2VNIA 1JG3A 2EFDB 1W36D 3SWWA 2HCJB 3A58B 2XLHA 2OJED 3PL5A 2A2ZA 1NRJB 4D8VA 2YWJA 2LGJA 3FTCA 3MGGA 1WPRA 2DR0A 5A2GA 1EFTA 1GV0A 5C4GB 1L5NA 4RZ3A 2JFQA 3KYIA 4PZYA 3GO4A 3LXXA 3PRYA 4YDSA 3F3YA 3NRBA 2CV0A 4WNAA 2W6JD 5DXJA 3AIMA 5DRTA 4OBBA 3UWKA 3FVQA 1YUNA 6ADHA 1L5FA 3D3QA 1ESMA 3GDOA 5FL7A 2A3RA 1TEXA 1GR1A 3VJMA 1J07A 1IFXA 3BRSA 2FF5A 4P58A 3FMIA 5LR6A 1JEDA 1LDNA 5CDFE 4L07A 5MFPA 3HMQA 4IIXA 1T3SA 1JQ5A 2HRZA 3QLVA 4HYYA 2EFEB 4B2YA 3D7SA 4OXNA 4HD8A 2VJDA 4KE7A 1YJGA 3TCKA 4CIYA 1XBTA 4K0KB 2CCGA 5LMNB 1WBBA 5K0TA 1D1CA 4EVQA 4HQFA 1T0UA 4E03A 1OH7A 4R0VA 1YCHA 4WN3A 2G40A 1NYLA 4PLWA 4IIVA 3LNRA 1T9KA 4CFZA 2AMFA 1VIVA 1YR8A 1CPRA 4R71A 1IYZA 3H2HA 3U2LA 2Q1TA 2YRXA 4M37A 5JZBA 1KU0A 2ZRFA 2XZDA 2F67A 5HILA 1IW7F 1JDSA 3MWDB 5AQ1A 3RTGA 2IEYA 3QE0A 4G0VA 1LTQA 2A0YA 5ITZA 4LX8A 2EW2A 4JCOA 5B6JA 1AUXA 1GRQA 1GKYA 1M2NA 3BHIA 2IYUA 4BO0A 2ZSEA 4HVAA 4FM9A 3Q8XB 2RHRA 4OHZA 1Q1AA 1KDVA 5BVHA 1DBSA 1VL1A 4MW5A 1QMGA 2RJ3A 1JJVA 5JSQA 2UZIR 3U7FB 2VZ9A 3IAXA 4C1BA 1OW8A 5BN5A 2F9LA 3KHKA 3DMDA 5FTJA 1J9GA 2XB9A 5HDQA 3KTOA 1NVGA 1YOVB 5BRJA 5ECYA 3SVTA 4W7HA 3LKVA 5AKLA 4IXDA 2NNLD 2SHKA 4ZTUB 5DWDA 1V7QA 4WL0A 2I2AA 3PD7A 3OU2A 4DA6A 4C78A 4IICA 2QTTA 5AMXA 3KTFA 4L4ZA 1J1ZA 2WINI 1BKDR 3U62A 4HTAA 2P6PA 4X8LA 1PR5A 2IHZA 1XCJA 1M1ZA 1K6MA 3THWB 4QTZA 2CMKA 4NV3A 1H1LB 2C4TA 4EI8A 4XVCA 2OR3A 3EAGA 1CU1A 5HR5A 1VSBA 4V0NA 5DM2A 3MUOA 1WBJB 5LZ7A 4KJZA 2YNMC 4WECA 2YLIA 4UZFA 3HBJA 2HU8A 1S6YA 1YZUA 1FMWA 4YAGA 1IN6A 4UMFA 1SB9A 2JLXA 2WP8J 1RHQA 4MSUA 1U3CA 2PWYA 2I62A 3H1PA 2GJ8A 5KQSA 1VC2A 1VE3A 1OBHA 1WHSA 5GONA 4FLMA 2DBVO 3U60B 3VNSA 1WHTB 5AVWA 3A6DA 3N24A 2CFTA 2FRDC 4HEJA 3HK2A 3CW8X 2EDAA 3ECCA 3EMVA 4RA9A 1Z0IA 3TVTA 1VYTA 1QPUA 1FNMA 2O0LA 3M1IA 2P9QA 1UPCA 2Y71A 4U7WA 1LRKA 1G5IA 4GQBA 2CLLB 4EG3A 3WGKA 2A9JA 3Q3JB 1TCVA 4Q4DA 3LFTA 3KOWA 5IT5A 5BNFA 4NCJA 4ZT7A 3K96A 4JXJA 5KMGB 2Y1EA 1FSZA 2HZBA 1QZZA 2DMRA 1WCWA 3EIWA 3VX3A 2XHEA 3L1IA 1IZ8A 3BFPA 1K7CA 2P2CA 3AMVA 2I6UA 3Q10A 1BX0A 1ZEJA 1KDTA 2TMDA 5KPJA 4A8JB 1KWKA 2IPNA 4JU8A 4BAUA 1TWAA 5AM0A 2H63A 1VCIA 4MK4A 3KOOA 5I7EA 2D54A 2JB9A 1P72A 3AFIA 1PX2A 2C2GA 2QLMA 5EJ7A 5DYWA 3MF4A 4QJ3A 4LGCA 7REQB 3GA5A 4YP0A 1GRNA 2I55A 3C16C 3ANSA 4FHDA 3COYA 1QAMA 4RCVA 1CDOA 4MP3A 5DP2A 3D6UA 4AKIA 5HMMA 5BN3B 2VSOA 1RLJA 3FD8A 4U7HA 1O94C 4PLZA 5EHHA 2ZG6A 521PA 1CY2A 4MYCA 2LXNA 1GVHA 3MA0A 4REQB 2R8ZA 4WXHA 5BSGA 4WKOA 4U0JA 3STTA 2I15A 4IWBA 3THXB 3IP6A 4WINA 5ENDA 3FRHA 1E7QA 1XTBA 3HRHA 3NC4A 2CZCA 2ZRHA 3U9MA 3R40A 4UQLA 2JFGA 4TT3A 4C4OA 4E21A 4PC1A 2JA2A 4YHBA 1ZI6A 1U6HA 3FUTA 1MENA 3L8FA 2B5WA 3LT2A 4RF5A 2UYQA 1X9HA 4CX9A 4HQOA 1PEYA 2AVDA 4AJ4A 1N8TA 2CLMB 1NU7D 2MSWA 1ZR2A 1NUAA 4G0UA 4U7JA 1PCXA 5H83A 3ZHZA 3ND6A 5DLPA 4B33A 2RONA 4EHPA 3FFBA 4BB0A 5EIEA 3E2MA 3NTLA 4IDPA 4F9FA 3G6KA 1YQDA 4ARIA 2ZGVA 1SK9A 2J4CA 1CUWA 3NKDA 5KI6A 3V4PB 1TCCA 3PUYA 2ECKA 1NW9B 3BA1A 5EZQA 3WQSB 4F92B 3IEIA 3MMXA 2WYWA 1JKFA 3MWLA 3U3OA 2R85A 1SG6A 2I1LA 3ZN2A 3AJ9A 4XJVA 3MJRA 4GX5A 2ZRQA 1I2AA 2A59A 2OQMA 5D51S 4KQ2A 4TWAA 4OIRF 3TTYA 4I1MA 2NUTB 1LCIA 4MW9A 1P4AA 4LMPA 1HE1C 4QT4A 1T8UA 3AESB 3ZXIA 1C4WA 4YJWA 1DC4A 1OBCA 5ALSA 5A02A 2D1QA 3MB5A 3FPLA 4ARBA 4XYGA 1NN5A 3GH3A 4Y9UA 4GPTA 1W36B 2QXYA 2XLVA 3LX6A 3WLPA 4LERA 2GHTA 1ZJWA 4G84A 5DCWA 2GASA 1O95C 1HRDA 5LXTB 5CB8A 4ETMA 3GT0A 4DABA 1BMDA 1BXGA 4XWGA 3Q7SA 1S5PA 2GF2A 4RA6B 1E3TA 4CTJA 3U7IA 2WQZA 2O0HA 4CFYA 2P5TB 4R8MA 4FI3C 4DDHA 1Z08A 1ZOOA 1GKLA 4LF8B 1NYRA 2VTBA 3L8IA 2GSWA 1WZUA 4MDEA 4BG0A 4FFVA 4BJ3A 1GSIA 4PC6A 4J1TA 3KALA 5I7SA 3ESCA 5F7ZA 1P9OA 3WYBA 3P27A 4PWZA 5FPSA 1BXRA 1C9YA 5FHQA 1NU9C 4QOJA 4M38A 2FN4A 3WLHA 3JPYA 3GWZA 3T3EA 5A0VA 4CHGA 2UZ0A 3HDQA 2C2ZA 2I78A 4K5QA 5LDGA 2GBFA 3CEJA 2I8CA 3MWKA 3CSSA 2PAFA 2LQGA 1AGPA 4G1EB 5K0CA 3V8VA 1FNCA 1P19A 4ESOA 1U9IC 5HGJA 1NU6A 4JOBA 2GVDC 3QV1A 3ABIA 3DNMA 1FVXA 1HL3A 4W63A 1QLWA 1NTRA 5GQSA 2F22A 1YL7A 2IU4A 1MAAA 2F3TA 1X7ZA 1SG9A 5JAQA 5E6RA 3ONNA 5FOSA 1A50B 3QW4B 3L4KA 4RMHA 1EVLA 4UDOA 1E61A 1VJCA 5AM3A 4OY3A 1WUJS 3M6AA 3WK5A 3PF8A 5CXXA 3LLVA 4CDAA 2AC4A 1OCZC 1QH1A 3PGLA 4GRAA 4YDQA 2OGWA 3OMWA 2WFAA 5KJEA 4C7OA 5LYJB 2G8NA 2NYRA 1TJPB 2AE1A 3SIPA 1T3ZA 3NIGB 2XT0A 2J85A 4BBZA 5TJ5E 1HV8A 1MNDA 2R5FA 1Y8CA 1V41E 2CMGA 1FPQA 1L4UA 2YNMD 4YRNA 3JYYA 2B8TA 4M7OA 1L3IA 1Z0SA 4DLAA 3NPAA 3A36A 3WMWA 1YL5A 2GHRA 1E5DA 4WESB 5L4SA 2H4XA 1YR9A 3LRXA 4CMJA 4HUTA 2FFRA 2WJHA 1M8PA 4MPTA 4MQEB 1W87A 5ANRB 1YVDA 1RTKA 4FBMA 3FB4A 2XAUA 2Y2UA 3DWWA 3SXYA 1CUXA 1I7NA 2ONJA 4MQ5A 1T1EA 3FF1A 1WY7A 4EQ6A 3IERA 3KHUA 4EF4A 4IVRA 4PFJA 3VMFA 2MU1A 2OBNA 3L7BA 1YJ5A 4NCAA 1XNHA 4CMGA 3VPDA 4YECA 2BFWA 2BFCB 2W2KB 2XCRB 1EGVB 1E6WA 4QAQA 5AKGA 1DADA 1H4QA 3C8HA 1I4ZA 2DR3A 1RSZA 3IP3A 3OCVA 2XUQA <