3VAYA

Crystal structure of 2-haloacid dehalogenase from pseudomonas syringae pv. tomato dc3000
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
230
structure length
230
Chain Sequence
MIKLVTFDLDDTLWDTAPAIVGAEAALRDWLAEQAPKLGPVPVEHLWEIRSRLLDEDPSFKHRISALRRRVLFHALEDAGYDSDEAQQLADESFEVFLHGRHQVQIFPEVQPTLEILAKTFTLGVITNGNADVRRLGLADYFAFALCAEDLGIGKPDPAPFLEALRRAKVDASAAVHVGDHPSDDIAGAQQAGMRAIWYNPQGKAWDADRLPDAEIHNLSQLPEVLARWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of 2-haloacid dehalogenase from Pseudomonas syringae pv. tomato DC3000
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Hydrolase
molecule keywords HAD-superfamily hydrolase
total genus 80
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1600 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3vayA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3vayA01
3SKYA 4Y2QA 3PCTA 2B1RA 3A3YA 4EZEA 2G09A 3N28A 2VKQA 3ET5A 4UAVA 2R8XA 3WKEA 2P27A 3A1CA 4EEKA 3VAYA 4BBJA 4YH1A 3B9BA 4IG4A 3WGVA 2JARA 3UM9A 3I1YA 1IWOA 2FUCA 4UASA 1ZS9A 5AVRA 5AVVA 2ZBFA 5ALJA 5AW8A 4O8CA 2ZBEA 4NABA 1U2TA 4DFDA 3W5BA 2W11A 4CE6A 5AI0A 5E0OA 3IB6A 2NYVA 2IA5A 1YNSA 3DDHA 3K1ZA 2B8JA 2PQ0A 1ZD3A 3M9LA 3QGMA 4YCLA 2QYHA 3WKAA 2CN1A 2WF5A 5IT4A 4RETA 4BNDA 3FPBA 4Y2VA 5AVYA 5AIAA 4B6JA 3B8EA 3E81A 1NF2A 5AICA 3ZVLA 3NRJA 3WK5A 3QUQA 5ALHA 3N07A 4Y2JA 1U7OA 2ZXEA 4CF3A 2P69A 4GIBA 2GFHA 5AIBA 2PR7A 1Z5UA 2GMWA 4XOUA 1QH9A 3HLTA 3QLEA 1NNLA 2HCFA 1L7MA 1TE2A 3PDWA 4HGNA 2RB5A 3OCZA 5ALMA 1RLTA 1YJ5A 3FM9A 3ET4A 5ALZA 4UMDA 4UM7A 2QLTA 4UU0A 4I9FA 5AKXA 5AVSA 2RARA 4G63A 5AM4A 4QJBA 2R8YA 2D2VA 5AI4A 3QYPA 3WKCA 1ZRNA 1RDFA 1VJRA 2IYEA 1LTQA 3CZ4A 3NASA 2JAUA 4MWOA 2IOFK 2I54A 3ZUPA 1SWWA 4BYGA 4AP9A 1Z4OA 5AI5A 3ZWDA 5AKYA 5ALFA 3QUBA 3MC1A 3U7GA 3P96A 5ALDA 5AK5A 1YMQA 3A1DA 4YGYA 1ZD4A 5ALUA 5AW5A 3OTQA 5AKKA 4CF5A 2JAOA 1EK1A 1X42A 5AK4A 3AR4A 4KX5A 3R09A 3QU2A 4NAVA 4H1WA 5A3QA 3ED5A 3OCXA 3WK7A 2I33A 3ZTWA 3R4CA 3FGOA 4YCMA 3E58A 2YJ4A 3W5DA 3MPOA 2C8KA 2WM8A 2G06A 5AW4A 2W4MA 4Y2RA 3RFUA 5AW7A 1FEZA 3ESQA 3AR5A 2G08A 1Z4QA 4Y2YA 5AI6A 2I6XA 2AGVA 1U7PA 3ZVNA 4UATA 4EELA 3W5AA 2YMQA 1AQ6A 5IT0A 3AR2A 2HDOA 1RLOA 4AS2A 3S6JA 3U26A 2ZBGA 2P9JA 3WK4A 1WPGA 1T9ZA 1RMYA 3M1YA 3F9RA 5AM3A 3PGVA 5ALSA 4Y2PA 3ESRA 4FYPA 4KN8A 2C9MA 1WVIA 3CNHA 3E84A 3UMBA 2ZOSA 3QU4A 4EX6A 3KD3A 4XE5A 3NIWA 3IJ5A 2FPRA 1RQLA 1ZJJA 1QQ7A 5AK6A 1ZD5A 5ALXA 3GYGA 1ZRMA 4EX7A 1L6RA 3U7FB 5ALOA 2G80A 3FVVA 4E88A 4C4RA 5ALEA 1RQNA 4OD0A 3AR9A 4Y2TA 3J7TA 1S8OA 1QQ6A 1XPJA 3RF6A 2O9JA 3L8FA 1RMTA 5ALIA 4YIHA 2I34A 4XPZA 4ZEXA 2FPSA 3B9RA 3EF0A 2MU1A 1RKUA 2B1QA 2MSNA 5AVXA 4RESA 1O03A 2RAVA 2RBKA 3AR8A 3ZW7A 4YIKA 4J2TA 4BX3A 2CFTA 4Y2SA 2EATA 2YJ5A 4NV0A 4HGQA 4UARA 1Z4JA 1XVIA 2B82A 3WK9A 2WFAA 3FZQA 2OBBA 1YV9A 2HOQA 3MMZA 4BKMA 4G9BA 1N9KA 2R8ZA 3HYCA 4I9GA 3L0YA 1L8LA 2HI0A 2FPXA 3L0CA 1S2OA 4PNHA 3UMGA 5A3RA 3L8HA 3FPSA 2OYCA 4AS3A 3DAOA 4C4SA 3KDPA 2GHTA 4Y2UA 3KC2A 4NWIA 3SF0A 4L6CA 4BEWA 5AKHA 3AR6A 2HHLA 3QXGA 4ZEVA 1RKQA 1TJ3A 5ALLA 2FUEA 1YS9A 1Q92A 5AM5A 3L0BA 1EK2A 3ZWKA 3KOOA 1L7PA 2WF7A 3EWIA 2FEAA 4ZEWA 3UMCA 3QU5A 1Z4PX 1TJ5A 3QU9A 2HO4A 4DCCA 1RRCA 4UAUA 5AW6A 1ZD2P 5AW0A 1Z4IA 4OCZA 2OA0A 4OHFA 5AKGA 2YMLA 5AM0A 2YBDA 2G1AA 3QUCA 4UMVA 4F72A 1MH9A 2AUTA 1L7NA 2FPWA 4HGOA 5ALRA 4EENA 5AW3A 1VFPA 2C8LA 2JGAA 2YN4A 2BY4A 4HAIA 5ALNA 2HX1A 4BNDB 3WK8A 1RPZA 2NO4A 3OCUA 4KNVA 2BDEA 2GHQA 3WKDA 1XP5A 1TA0A 5AKZA 3QX7A 2HEGA 3NALA 3BWVA 3U13A 4UMFA 1T5SA 4C4TA 5AKLA 3A1EA 1LVHA 3U7HB 1VJ5A 2FPUA 1U02A 3SMVA 1Z4NA 5AI8A 2YMPA 2X4DA 3ZX4A 3WKBA 3ZTYA 5T41A 1F5SA 3AR7A 2FDRA 2C88A 3OPXA 4NFLA 5AW2A 2B8EA 3NANA 3EF1A 1WZCA 4CF4A 3U19A 2G0AA 1O08A 3QUTA 4DWOA 3I76A 5ALWA 1RKVA 4CNQA 3ONNA 1Z4MA 2I7DA 1U2SA 3I28A 4F71A 1ZOLA 3N8GA 1Q91A 5AVTA 1Z4KA 3OCWA 1SU4A 1QQ5A 3SD7A 2HF7A 2WHEA 2JAWA 1NRWA 3WGUA 5IS2A 3DNPA 2B0CA 2WF8A 1WR8A 2Q4RA 2YFYA 5ALQA 2Q5EA 3R9KA 3KZXA 3L5KA 3SLRA 5AVWA 5A3SA 2GO7A 4L57A 4QQFA 2HF2A 5ALGA 3TLMA 4UMEA 2YY6A 3PGLA 3L8EA 2ODAA 3W5CA 4Y3UA 5ALPA 3N5KA 3L1VA 4IFTA 2W43A 5ALTA 4JDPA 2OM6A 2YJ3A 4KYTA 3L7YA 1QYIA 2EARA 1CR6A 5ALKA 2IOFA 3KBBA 1Z88A 2FI1A 2YMMA 3ZX5A 4BX2A 1J97A 5AM2A 4YCNA 3ZVMA 1PW5A 1Z5GA 5FP0A 4KNWA 2C4NA 5AK3A 1K1EA 4HGPA 4J03A 2BDUA 3ZU6A 2G07A 5ALYA 5AW9A 2CFRA 4FE3A 1TJ4A 3D6JA 1CQZA 2ZBDA 5ALVA 4Y2XA 3DV9A 5AKEA 3AR3A 1YDFA 2WF9A 3WK6A 4OFZA 3U7EB 4UU1A 3E8MA 4FFDA 3OCVA 3NAMA 2AH5A 2Q4TA 4L6AA 3EPRA 2B30A 3NUQA 4UW9A 4BX0A 1KYTA 2CFSA 2I55A 3MN1A 4HGRA 2PKEA 1Y8AA 4UM5A 4XQ0A 3SHQA 3SKXA 4HYTA 2NO5A 1JUDA 3OCYA 5AKIA 5AKJA 1T5TA 2YJ6A 1SWVA 1J8DA 2HSZA 4KX3A 5JJBA 4BEVA 2EAUA 3QU7A 2ZG6A 2IOHA 3IRUA 1L8OA 2P11A 3N1UA 4DW8A 2R8EA 5AVQA 3ZI4A 4JB3A 3L1UA 3I6BA 4MUMA 2DQSA 3L8GA 1N8NA 2AMYA 5AW1A 1RLMA 1L7OA 1RMQA 3QNMA 5AHXA 5AVUA 1Z4LA 1RC8A 5AM1A 2WF6A 4GXTA 2O2XA 3BA6A 5AESA 5AI9A 5AVZA
chains in the Genus database with same CATH superfamily
5LCXA 4CTOA 3CZAA 3BDIA 2FY8A 2HK7A 2QU7A 1WU7A 5EVJA 4YUYA 2I22A 3JVDA 1RHMA 4DA9A 1A1SA 4O59O 3KOWA 5LXTA 3WKEA 4RXUA 3O91A 4IXNA 5A5DA 3O4JA 1Z9BA 1NDQA 2P62A 3EXEB 4MEAA 1QRSA 2ZS9A 3UTDA 5GM2A 1BWQA 1YARO 1OGJA 3H2KA 4PLCA 4OHWA 4CHGA 5DNYB 3NMIA 4O4LB 1KOFA 3RSSA 2C2OA 2JARA 1YBHA 2Q6IA 1K92A 4EK9A 1KEKA 5AVVA 1A9RA 3H4TA 4E0HA 4GVXA 3K0SA 1W5BA 2B9EA 3L4JA 2RONA 4JEAA 1U2TA 4MWEA 5GJCA 5BXYA 2OC4A 1N8KA 3N2LA 4QUEA 1KC1A 4E5MA 1GGJA 5IMSA 4B8ZA 3Q7QA 1VJ1A 4FUQA 3DVAB 3PEFA 4UZEA 3RRNA 5C5EA 3G0HA 3EHNA 3H83A 3LHSA 5CCDA 2WM9B 5LUBA 1KSGA 3E6AA 4ZK2A 5IU6A 1Z39A 5DNDA 3RS7A 1OA1A 4Z7QB 1MB3A 1X13A 4FN5A 1JH8A 4X3CA 3NX4A 3ZXYA 5JZBA 4DLPA 3W1EA 3K70C 4BNDA 3LNCA 1DDOA 1QU3A 3D4OA 2QTVB 4CV2A 1JLKA 3FWPA 1PJTA 3PLAE 3ZIBA 4PQGA 3RB8A 5D5QA 3MCUA 4JXXA 3LCUA 4L15A 2FAPB 3DC7A 1N25A 3ADBA 5ALHA 2DR3A 2FZEA 2Q45A 2ZDHA 1ZFNA 4GIBA 3AGTA 5CIVA 3ZS9A 3VM6A 1JR2A 2Z0MA 2WFLB 3KE8A 1Z47A 2DLNA 1QH9A 2A0YA 2V8BA 3CUVA 3NC0C 521PA 2WZBA 3ABIA 3MOIA 1LM3B 4ONSA 2QIOA 3E9DA 2HYDA 3PNSA 2VK4A 4NU0A 3T35A 1F1MA 3U2QA 4ZGWA 4XLLA 1E5QA 5B53A 2H2HA 3NR2A 4B6PA 4OQZA 4OUDA 3WJ2A 4HGNA 4OJKA 5K8VA 1HT3A 4K8OA 3G6WA 5B7QA 2V0NA 2VRNA 1DSSG 5TMEA 5EOVA 5CVUA 3KELA 3FM9A 4IJUA 3VHRA 3VZDA 5KSYA 2XGJA 1B1CA 4M88A 3HLZA 1HDEA 3L1HA 3OT5A 5JTTA 1I1NA 3IOYA 5KOIA 3OM1A 4OYRA 2C9CA 2CZCA 3OU2A 4KE6A 4YL1A 1DC7A 1YRHA 1Y1LA 3EOBI 4A8JA 1S1MA 1VFNA 5AM4A 1EM8A 3IVAA 1THZA 3EW9A 2A69F 1BW9A 1R4NB 4WK6A 4CI0B 2EFYA 3E9QA 3H7AA 3JZIA 4HGZA 5BUCA 2I78A 4MAFA 4EYQA 821PA 3IEPA 4C7MA 5CU7A 1E9VA 2HPZA 3R6LA 3MX3A 3NASA 4I4LA 3KQTA 1XD8A 1ZL0A 2COUA 4OAQA 3IJEB 4G7OF 2ADMA 5FBKA 5M34A 3TG8A 2JIMA 1B26A 2BGJA 1MO3A 1PN3A 2ZIWB 4TYQA 3BRWA 2X0RA 3GMDA 2H85A 2GZDA 4XYBA 3HJHA 3K9HA 4A7PA 3OJXA 1NXOA 4YALA 2VZ8A 1K7YA 3MWKA 1NJ1A 2BLLA 5ALDA 3T7EA 2OGUA 2FH5B 2ISSD 3KJFA 4YPFA 1DQPA 1K8QA 2PX6A 1NJGA 3DCIA 5B1YA 5I8WA 2EJWA 4N0PA 4CF5A 2PH3A 3GRPA 5E7JA 5AK4A 5JQGA 2ZSDA 3MCAA 3IQIX 2JGLA 1DAHA 2D1RA 1KIMA 3BB3A 1LZLA 2ZE5A 4PIVA 2IF2A 4O1HA 3OCXA 5JT4A 5KKCA 5F1PA 2LRHA 4I5FA 1AUPA 4XQ9A 4IO1A 5HXAA 2PSSA 5P21A 1ODIA 3W5DA 1IBRA 4OGWA 1GNTA 2P2DA 3S9OA 1P0FA 5BV8A 2BBSA 1CR0A 2QVCA 3NWEA 5C8YA 2KYRA 3VSAA 1TT5B 1OC2A 2CDRA 3NI2A 4BASA 4B81A 3JQFA 4I3FA 2FRXA 3OU7A 4KREA 4FX2A 4IZ6A 4NYJR 4C4PA 4DV5B 1XEFA 1CHNA 3TZEA 5AI6A 5EHQA 4UREA 3SFVA 4EPWA 4OX9Y 1UXIA 1B73A 4NMMA 3TQQA 1U7PA 2BMJA 2WU0A 4IXTA 3B1JA 2QD3A 1RQPA 2BRUA 2LWIA 1CZHA 3CBQA 3HL0A 3JZFA 5B37A 3RC8A 1I13A 1VRCA 2JCYA 3C3EA 2O2SA 2ZVJA 3L7LA 4JJGA 1BDBA 3QK7A 3GJ0A 3GUUA 1T4GA 4YP1A 1AUVA 1S5PA 3BB4A 5LYYA 1XZKA 1DRVA 4PW0A 2QENA 3S6JA 4F9EA 3WAGA 2QGFA 1ZSNA 2ZBGA 1QTNA 1V9LA 4OQFA 4I50F 4RF3A 5C8DA 1HT0A 1JB9A 1NKVA 3BEOA 5AJYA 4HH0A 4K2HA 3UPUA 4AFNA 4BDTA 5DLJA 5JSLA 1MQ8B 4QD3A 3FPKA 3MBIA 1FTGA 1IB6A 2G76A 5K3OA 4BLOA 3OE1A 3ZKWA 1GTSA 4ZV9A 5B7NA 2ISQA 4PG6A 3GT3A 4G24A 2QAGB 2QRPA 3ADCA 3ZK8A 1UKAA 5F7XA 2X42A 2Q9AA 3DJNB 5JAHA 4YECA 3EEOA 4BPMA 5JAIA 2K2QB 3BFJA 4KOAA 3B12A 3IJ5A 1QE5A 1BO6A 2KBFA 3MAAC 1MXHA 4FDUA 4QPJC 4BVFA 3ZCVA 3YASA 4JKVA 1GZHB 3FR8A 5K2MA 2B5OA 5I4IA 4DSOA 1WABA 3P2KA 2O8FA 5JMOA 2CL6X 1FNNA 1U8YA 1YOBA 3GQBB 1N3IA 3JVVA 4G23A 1UJ6A 4Y9UA 1G8GA 2FG6C 3FPLA 4A92A 1A9TA 5L53A 1T2DA 3Q7RA 2HLDA 4HX9A 4HEJA 4NK5A 4CV3A 4K0RA 4UVDA 2DHQA 1IRXA 4DCMA 5HKKD 1MX5A 2G71A 3FUVA 4JVSA 3QNUA 4JJ4A 4QG7A 1DGQA 1Q0FA 3H9CA 2J9UA 3GJ6A 3K31A 3KFVA 1LU9A 2ZVDA 4JP1A 3TLYA 4C6TB 3U4MA 1XMSA 1VZ3A 3A8TA 4BBZA 2NP7A 2OCIA 4HYQA 1BCRB 3G89A 1YOVB 3L8FA 2HNKA 5TJ9A 4TMVA 4DJ9A 4YIHA 1L6IA 1ISJA 3OZIA 3NHBA 4LJ9A 4AUEA 3R9XA 3B13B 1DI0A 2LKCA 2RKBA 2MU1A 4I8DA 1YTLA 2B2NA 1QTRA 3G5LA 2R7OA 1JEQB 2BTQA 3NUZA 3ACDA 3AR8A 4DVYP 1OREA 3D4BA 3C6BA 2VHEA 2FW9A 2O8CA 4WZBA 3L7MA 3UIEA 2YL7A 1GG5A 4OBXA 4H4DA 1GJRA 2JAHA 5CA1B 4CJOA 3OOEA 4ZKEA 1QO0D 2H7BA 1HLPA 4N3NA 2IH5A 3H2JA 3OIFA 5F23A 1GV0A 1UQRA 2W83A 3FZQA 3L8CA 4URZR 1KWGA 3G9XA 3I6MA 3A31A 2NZUG 5DO9A 3H6KA 3ZDZB 4KVFA 5A4FS 3ZDBA 4I08A 3RVKA 4Y6QA 1KPGA 3SFTA 5LWQA 1DOZA 4G0WA 3ZHUA 4PHHA 3H4VA 1AS0A 4ZMBA 5CLJA 1PR2A 2XYPA 3Q1KA 4NHEA 2JF0A 2JEYA 1ZJZA 2XZTA 2J30A 3KR0A 4UBKA 5EEGA 1QVZA 1A0BA 5T6MA 1QHXA 2CCYA 1IATA 1MF7A 3UMGA 2H06A 1QWSA 3HA7A 4IRXA 3ELBA 4PLZA 1UFVA 3GB9A 5IDQA 2VSXA 4IB4A 3I9JA 3VPCA 2OE2A 2XLHA 4MUFA 2GTIA 1YSCA 2AQKA 3MOSA 4BO7A 2R25A 2FMKA 3FVTA 1BQEA 1YULA 4C3BA 2Z5LA 1WXQA 1RWWA 4ZREA 2P91A 3HNKA 3IP5A 4E5SA 2OFPA 1U28A 1VMIA 2XZLA 3OLWA 2Q21A 5IPFA 3G9ZA 2R8PA 2VHVA 3ZWVA 4D4NA 3NHZA 4OHMA 3V4RA 1GAXA 4IY1A 4P81A 3VR2A 4BKRA 3HB1A 3H2IA 2I2AA 3JYPA 3KSUA 5IVHA 2PYDA 3T1HB 3O8QA 3L0IB 4ZEWA 5EE5B 5KPDA 1JDVA 1OAKA 1OU0A 1OYOA 3MUOA 1S2DA 4YWHA 4PYQA 4M0KA 1OW8A 2PUAA 2XT6A 1RRMA 3GRZA 1JR3D 1PQWA 4G4GA 3T3PB 5BWMA 5A9TA 3PYMA 1BCSB 1FQKA 1OFUA 1RYBA 4J7CA 3R7FA 2FGKA 2ZFUA 3DFIA 3K92A 3SICE 4KUHA 4KQ9A 1LF5A 3IOEA 4EL0A 2JBAA 3JAKB 3G2PA 4E3ZA 3KXLA 3A11A 2ZR8A 4QPDA 4UCWA 4V0ME 4BP1A 5EMKA 1YFLA 1RJ9B 1PT9A 2H11A 3HGQA 1CLUA 4KE8A 3HI4A 1Y80A 2OVBA 4PZYA 4RL6A 4WKOA 1MA0A 5BRNA 3WWDA 1ISIA 1HDYA 5KWJA 3JSZA 4NQRA 4R41A 5FUYA 3KOYA 3N2KA 3OECA 4Z8XA 1TFKB 4WV3A 5DZSA 2BY4A 5IDWA 1F0PA 4J7XA 1A9SA 1BCRA 4OG2A 2IYFA 1EXNA 1U0EA 2X4LA 3X1YA 3M4YA 2WUWE 1QZ3A 2AN1A 2J32A 3P9IA 2BM0A 1VMKA 3T0FA 4ZVTA 4DZZA 5BRAA 1ORSC 2DVMA 2FN7A 5E38A 4B0OA 4U9EA 1TQHA 4R54A 3LLIA 1NU9C 4GI7A 4UMFA 1HO3A 4NQZA 8AT1A 4C4TA 2PSEA 2H51A 4MQEA 5BUZA 5MGBA 3EXIA 1Z68A 4QOIA 1MV8A 4RFVA 3STWA 6NULA 4TWIA 1HE5A 1CGNA 1U02A 2FPUA 2GPBA 2P0EA 5TDHA 3WP0A 2EZUA 4L9SA 4TKVA 3NRCA 3WKBA 1U8EA 3MYRA 4XWKA 4FUTA 1E9AA 4P36A 3SP1A 3CNNA 5G1OA 1KY5A 1OZAA 4H6XA 4BS9A 1QH1B 2ZYSA 3MD0A 4YRPA 5ER9A 2G40A 1EYZA 3LHDA 3ETGA 3ZCQA 1G291 4L3WA 5F7OA 3EW7A 5H80A 3P7MA 3N0WA 4RY9A 4TM8A 3V1YA 2PPLA 4RMIA 2G0AA 2YOHA 1NPYA 2QE7D 4HX5A 4OTZA 3HB0A 4TRJA 5KYVA 4DWOA 2JLSA 4DSAA 2HUNA 3B0VC 4V0QA 3GORA 3Q6NA 1RE1A 3I2YX 5K4GA 2QJWA 2QIPA 1OI4A 1Q0SA 5EK0A 2WBLC 4IDCA 2R1VA 4P7GA 3RQIA 4HUTA 5DSTA 1UEJA 3KL2A 3MRTA 1ILWA 1L4KA 1MMFB 5CFZA 4AYTA 4EJSC 4E0BA 4JYCA 3SD7A 4BQQA 2O8FB 2QTFA 4FGUA 2AWYA 1C5KA 2CNLA 4QGBA 3WL3A 4RTSA 3EPKA 1FJGB 1X92A 1RAGA 4OHPA 3T61A 3D59A 3WGUA 1QHEA 4PN3A 2R0QC 4PTYA 1VA4A 2O2ZA 3H05A 4RK5A 3RF3A 2YXPX 4QJ3A 5IT5A 2JPUA 3DYBA 1CUVA 3J06A 2PRZA 4JQOA 3PL5A 2MSLA 5DI3B 3UVEA 5HSGA 3QI7A 3G2OA 3GJ4A 4L16A 1Y1PA 3DOUA 4PWZA 4BQNA 2XE4A 1XSEA 3BRCA 4IG9A 4JYPA 3TUJC 3N5KA 2IPOA 4JWTA 2QZPA 2W43A 4DNQA 3GEEA 1FBTA 2OM6A 3B71A 3W7BA 1HC7A 4R2HA 3A3PA 2B1GA 4EY7A 5TPZD 3LY5A 1GKYA 5ALKA 1U94A 3L92A 1ORJA 3JD0A 4BFZA 5IKOA 4ARZB 1E8MA 4BJ1A 2B1IA 2YMMA 3AJRA 4LOKA 3DZGA 3VDXA 1KO4A 3U3KA 4A4DA 5JQGB 2JIBA 2XKKA 1G2OA 1IHUA 2IY7A 3EVFA 3HN6A 2YKGA 4KNWA 5JD5A 2FWMX 3ZDEA 3GPBA 2HA3A 2W22A 4E09A 1WVMA 5AK3A 3AQBA 1KIAA 1W76A 1T1IA 4ID3A 5DW0A 1VJ0A 5ALYA 1NG9A 5FHRA 1ESCA 3SS8A 3NKLA 4KMRA 3HA2A 2O52A 1ITZA 4I5IA 1ZNZA 1UK7A 2FVYA 5H3LA 1VYUA 4JUAA 3N8HA 1TMGE 4PYRA 2C9ZA 3LL4A 4RC9A 4INZA 1KDOA 1V54C 1L4UA 2CKDA 2QQGA 4O2BB 3NTOA 3F97A 3MJCA 4FZ5A 2BE9A 4WXRA 3T6GB 3KX2A 3CE9A 3GLRA 3TI7A 1E9DA 3PWSA 2HPAA 2W58A 2B92A 3A4MA 2HHAA 3AP2A 4QBHA 2VK8A 4TROA 1HE3A 5HJ2A 3GGDA 5LYJF 2PU5A 1TXGA 2LD4A 2VSOA 3EXIB 1D1QA 1NULA 4JODA 4M55A 3RRFA 2C4TA 4UM5A 2RJ3A 4EWCA 1HKHA 4P7FA 3WLTA 2WTXA 5TIIA 5B1SA 4I50B 2NXWA 5EIXA 1NLZA 2ATXA 3A04A 3D7LA 3M1AA 3R7AA 4V38A 2BSXA 3TIGA 2HSZA 4FJ2A 3EDMA 4WW0A 2EAUA 4ARSA 3UZUA 1QPUA 4DLZA 2IODA 4UU8A 3V3TA 2V7GA 3WBKA 4NXMB 4CUKA 1QHHA 4O5AA 3GEGA 4JFRA 5IH7A 3IRUA 5B36A 3GP8A 3F4BA 4IIFA 1MR3F 1ECCA 4TSRA 2JLWA 3O83A 2QT9A 3TCKA 5ADWA 1FFYA 1I3CA 1S4MA 2FPGB 1TVEA 3LSTA 5E1DA 3VMMA 3ZBTA 3L1UA 3F46A 4E2XA 1UT6A 3GLGA 1E5VA 2ETVA 3O2SB 2DPGA 2DQSA 4I14A 3AY0A 1O95D 2CFCA 1RLMA 3LPDA 1K8YB 3AU9A 4PZCA 3RRJA 1BR1A 5PNTA 3HKCA 4ZVKA 5KWIA 3K1YA 4MWSA 1T26A 5COBA 1Q0TA 5NLLA 1V48A 4LJLA 1Z0SA 1MGPA 5H3HA 1ENZA 4DIMA 1ENYA 2XAAA 2GN4A 2VA9A 4G65A 2DZDA 4AU1A 3TE7A 2J4DA 3FFTA 2Z2JA 4CG1A 1O6FA 3HUDA 2ZTHA 1DOAA 1GSAA 3EMDA 4J7YA 5EPEA 3LQ2A 4EY4A 3ESBA 3ET5A 3KSAC 3AG2C 1Z26A 3LFTA 4IF6A 3MWEB 4Q4CA 3KOXA 4L4YA 2O2HA 4F21A 2L6GA 2P27A 4OOFA 1T1EA 5JT1A 5THXA 4BLWA 1FVOA 5ED4A 4HDMA 5E3AA 3QVYA 2YNMD 4DY4A 1YBMA 1PYOA 1XAGA 3RYTC 4B48A 1R18A 4F2GA 1EA7A 1X7GA 4HEA1 4YRMA 1P4GA 1MJGA 2WWRA 2WWWA 2ZBEA 1JDPA 2CLSA 4F6RB 4HSGA 3MTDA 4E7PA 1HSOA 4G7HF 3EAGA 3R76A 5J1SB 1PJ2A 1APCA 1ZU5A 2OKCA 4KO8A 1RSZA 1QR2A 3PIDA 1U7TA 3NLLA 3THXA 1VB5A 1ZD3A 2FFRA 4HAZA 3U1BA 4YCLA 4X1KA 2AI1A 4NMHA 5JRAA 2NZXA 3AW8A 3EZYA 3FUTA 4ZCRA 5B3IA 1ZGJA 4RU1A 5DGIA 1G7SA 3KYBA 1E92A 4I44A 2OBLA 4X97A 5DYTA 1SR8A 2AVNA 1GU0A 2O9XA 1P9NA 2JIQA 4LCJA 4I36A 4MTFA 4Q6BA 4U6SA 3D54D 1NN3A 3ZLUA 5EZYB 1I5OA 1X8JA 3F4LA 3NRJA 4L72A 5AJVB 1KZ4A 2HNBA 2WKQA 5FO1A 3RYIB 3SE0A 5BN4A 1NVMB 4HUQB 2GM9A 5AUOB 2XVAA 1EFRA 1MC8A 1MCZA 2P69A 1KI6B 3SPXA 3WGTA 1CYEA 1JAHA 5AIBA 4FR5A 4B3XA 4NARA 3OKFA 3VC7A 1DDGA 7MDHA 1PU2A 1U28C 1V8DA 4R2JA 5KCMA 1XRLA 3EXHB 4LYFA 4NYIQ 3M79A 5LBTA 3UPDA 2AZTA 1UKEA 2Z8YM 4I3GA 1JIXA 1QONA 2EG5A 2NQ2C 1S3FA 3I52A 4EOGA 2BONA 1YVEI 1L5RA 4X20A 1V6CA 3PC8A 5EZSA 1Q1EA 4D9JA 4ZEMA 1YAHA 3EVDA 5C7IO 1H8ED 5KSOA 2O50A 1DAOA 1HDXA 2XCIA 3OPYI 2G9RA 4W8PA 3GW8A 5ARDA 1QG6A 3TB6A 3GLGB 1ZIYA 5AKXA 5IRCD 4KQ2A 4MJ7A 5EJAA 5LMUB 3WO1A 3EK2A 2QUZA 1GP2A 4Q4DA 2M6KA 4O2AA 5KYXB 1JJAA 1Z12A 4Z3KA 2D2VA 2A0BA 3ONWA 4FVTA 4YCBA 5DBGA 4OSEA 4AUNA 3GEPA 1J7KA 1GR1A 1K68A 2RBEA 4V1CB 1IXYA 1KZ6A 3FI0A 4KC9A 2IYEA 1ZLXA 1E63A 3N2KB 2IE8A 1J00A 4GZLA 3S5UA 3SWWA 4PCAA 4XWWA 4Q24A 4FFBB 2VJBA 3R2JA 4TTQA 1T15A 4NE9A 1DO0A 3JQ7A 4TMYA 4BYGA 2WI8A 4N6CA 5AOAA 5KQPA 4EB6B 4G0OA 4MKIA 5ISMA 2FG7C 4BNUA 3NHFA 2FZGA 4J2OA 3X1OA 2QTZA 1E5XA 3BZWA 4CDRA 1JKJA 1M75A 5HQ3B 2XBUA 4DKXA 2YRFA 1GOTA 2B21A 2OBNA 1P91A 4KRGA 3I5PA 3PKIA 4PCVA 1AZWA 1ZD4A 3T9FA 3PGXA 1VYIA 5KYYB 1L5ZA 2P4EA 2D7DA 3CUKA 3LYHA 2UYGA 4IQFA 4Z9AA 3G8BA 3NYQA 2QZ9A 4BX8A 2X8AA 1O1YA 2OCDA 3AR4A 3JSAA 3KPJA 3OJWA 3TLAA 4D02A 4N18A 4NAVA 5BQXA 4G37A 5EINA 4WKGA 4D9EA 1BX0A 2JA2A 4C89A 5LOVB 3RQGA 1IVSA 3G88A 5C5DA 2X9NA 4WOCA 1H3NA 3I04M 3HGMA 1LVUA 4JL5A 3NKEA 2ZUFA 1OXUA 3TCXB 4C87A 4EITA 3T5PA 1NJFA 1QYCA 5EUCA 1U1CA 4QWWA 3K6RA 1NFRA 3OF3A 3ZV6A 2B5WA 1KMMA 2IEZA 2OHFA 1NATA 3PEUA 1M8PA 3VHXB 2BELA 4H1HA 5J2TB 2K4MA 4ENUA 9GPBA 4OVKA 2I6XA 1JQDA 3OM0A 3KMIA 5B7GA 2BSAA 1HW2A 2JI8A 3DR5A 1ZI6A 2GOYA 2VJAA 3OOSA 5CT9A 1IQ0A 2VCHA 1P9OA 1BXZA 3BTSA 4ND3A 4BMOB 4OQLA 1GUDA 4O4IA 5IT0A 5B2FA 3PHJA 4BQOA 1HURA 2QNIA 1J0XO 1XZEA 3WK4A 1IHOA 3K5HA 1ISSA 1FVXA 3MERA 5LQCA 2HFKA 5FAKA 4X71A 3BCUA 3B1XA 4WFQA 2A5JA 2Y4NA 1XAHA 3OIVA 3GZNB 1TUBB 1W5SA 1JDBB 3ESRA 3EUAA 4TSFD 3CNOA 3ABKC 1FR0A 1KK0A 2HCJB 4FOLA 1QPZA 1NMQA 1XBTA 2PRKA 1LI4A 1SG0A 3IBCA 4F8YA 3Q9LA 4GC5A 5LQKA 2CZGA 3CZPA 1JXMA 2P3OA 2XXAA 2JI9A 2ZIXB 3QU4A 1ZITA 3JYNA 4RE6A 1WEHA 5F51A 3ROPA 4BTVA 2NQTA 4Y6OA 4YP5A 3SNHA 4X5OA 1Q7BA 3ZSUA 1G8HA 4U5FE 3FB1A 4PPYA 2IS1A 1W581 2C3YA 2P7IA 2YFHA 5ALXA 4EUHA 3UUGA 1T34A 2HF8A 4GEKA 1ZRMA 1QOQB 3NT4A 3X1XA 1NA5A 1LDEA 1V1RB 3N2EA 2QNBA 4Y9DA 3DXFA 1SBIA 3BC1A 1A7AA 2IE0A 3ZG1A 2DG2A 3FVYA 4CDYA 3FVVA 1QS0B 3MRXA 3IP1A 1XVVA 2LCFA 5FD8A 4EX6A 2DQKA 2EKPA 3WWEA 4GBGA 1A72A 3ZV5A 2W0SA 3U8VA 3LOPA 4AJ4A 3E9CA 2DPYA 2W4IA 1GAWA 1GITA 5B2EA 3PCXA 4H0NA 4TWRA 4JX9A 1H2EA 1Z0KA 3H1BA 3DKRA 5JQGF 1G6HA 2CXXA 1L9KA 2ZP1A 2L7AA 2NU9B 1CS4C 1OFVA 3LCRA 4OK5A 4H1VA 1YIDA 4RJIA 5A2GA 3DE0X 1E62A 1K6MA 1KRWA 1N1MA 1E1LA 3FW1A 1YZUA 5JDIA 1SF8A 3OC0A 4YRKA 4FTWA 2R7KA 4JLVA 3ZPXA 3AJ8A 1UOQA 3BD6A 3GPCA 1GT91 1MTOA 1ULBA 2NVWA 1JQ5A 4PVDA 3GRAA 3EIFA 4PQRA 1TJYA 1FUKA 3AUYA 3G7NA 1YV9A 3HYTA 4A26A 1Q19A 5ICSA 2C1ZA 1RWPA 2B0JA 2Q8NA 3IAFA 5EGYA 2R79A 3KCQA 3GPLA 3ORSA 1KP3A 3MLBA 1J9GA 3QW2A 3ZBQA 4IDEA 5B3LA 1IZYA 1Y4DE 5LMNB 1LLQA 1N5JA 1TIPA 4XLTA 3GLFA 1SU8A 3JSEO 2CYAA 3CFYA 1T1GA 2IPXA 5KVQA 5HBGA 4QPCA 4JLBA 3TK1A 2M6LA 5CI9A 1O94A 3UA4A 1V25A 2VAXA 3U4GA 3F3YA 1QWOA 4XUGB 1D0SA 4RVFA 1QGUA 2C54A 1W46A 3IR6A 4W5RA 2IXBA 2GZRA 2H4JA 1W87A 5JPIA 4R7GA 4E3WA 1SA0B 3WA7A 4KWHA 4ZV4A 4FSXA 3KQYA 2YL2A 3SF0A 1ZESA 2XUPA 3DBHB 3AONB 3MK31 2G62A 2K7ZA 1PAUA 1WA5A 5KEIA 2O4UX 4IDHA 1VE5A 3UJAA 3AVUA 4R1UA 1AV7A 1RKXA 4HMQA 2UVQA 1SOVA 3IKMB 3TUZC 4F45A 5E6UA 1YDIA 3BTOA 4PAQA 4EHNA 2EPLX 4XOIA 1CNMA 2GDZA 2ZZNA 2BWJA 3EPJA 4HG2A 1LFAA 3LMKA 2HYIC 1H2ZA 3GZ4A 1XEXA 2P5YA 3ADOA 3LA6A 4YJKA 2XM0A 2ZAGA 3H9UA 1GG2A 5ECWA 3ZWMA 3VTKA 2ZXUA 1KAHA 2J3JA 1TB4A 2ARKA 2CXQA 1DCFA 2RGXA 2G5GX 3QU9A 4M1WA 2HO4A 5DTEA 5JD6A 1GZVA 2PANA 3JQBC 3SS7X 3EEYA 3ZCSA 3BGSA 4L4XA 3ZKAA 3DT9A 4MRSA 5K3DA 5EIAA 5HFNA 4OP1A 1BTOA 2R7NA 4MYRA 2A0XA 2C0CA 4IGEA 4JL6A 3I5QA 2VHJA 3ZXXA 5F77A 4KAXA 1TFRA 2RIRA 3BKXA 4ZOAA 2YMLA 2AK3A 4LE0A 2VOJA 3PFIA 4LGVA 3NBMA 4XXHA 4Q6WA 3MFNA 1KMHA 4RD2A 5D3ZA 3S40A 4HBGA 3KKOA 4WZAE 3RAPR 4W8KA 4PSKA 3JAMA 4DT1A 3D5TA 2PUGA 5ALRA 3DWEX 1EFAA 1TA9A 1OWLA 4MQ5A 2B0HA 3FA2A 2ZJBA 3DLHA 4DLYA 1L0BA 1U7DA 1XL0A 3PDIA 4PGMA 3HB9A 3ZYZA 3ZJUA 2HX1A 4NMXB 2OKGA 4ZQCB 4I55B 1YZLA 1DQZA 3AEYA 1DKLA 5FADA 1FFBA 2G9ZA 2C57A 2A5LA 2P6RA 3VZPA 4R31A 1W9MA 2X3UA 3KZNA 4WI1A 2QN7A 4B6QA 3FYHA 4BBAA 4HQRA 4C5AA 2HXGA 2JFFA 3FGZA 2HBYA 3L0SA 2PG3A 3IMFA 2JATA 4B9EA 1XD2A 1JHDA 3UHFA 3RKSA 4GOMD 4RCZA 1AKTA 5DBHX 2QUKA 3KRTA 4Q4AB 5G3ZA 3EXHA 2GILA 2WHQA 3EIOA 2KQ9A 5T5QA 4CU5A 3U56A 2O1SA 3P5SA 3U7HB 3CRNA 2C8VA 4H08A 1SBZA 3QNWA 4NPAA 5A5FA 3DLCA 4RKFA 5FDFA 3ZX4A 3WLKX 1I30A 1F5SA 4OQYA 4TT3D 4BO3A 1L5QA 5LDDC 1YQXA 3E9RA 3EY9A 1BVUA 1H3FA 4YAKA 4R5MA 3CEPB 5LNK1 5IC5A 5IF9A 1J1ZA 3QFCA 1PJ3A 3AZQA 4OU5A 4JKIA 1KAMA 3DCYA 3M5CA 3QELA 5EFOA 2ZRMA 4LKRA 1AMNA 4N76A 1KNQA 3TTSA 1DT3A 2J9YB 3WNQA 4DLTA 2VAWA 4EYKA 3S2ZA 2BFNA 1CUJA 1P1RA 4MV6A 1DJNA 3GFRA 2JZCA 2KLHA 1PJRA 3TOMA 2OLKA 2QTMA 1HMYA 1MPXA 3MGGA 3V48A 4F71A 3KETA 4MVYA 3LRXA 1WBDA 1PD1A 4RD3A 4JC5A 3SYMA 2QR5A 2X0DA 3WA6A 1FNBA 2BT4A 2VOEA 1PNRA 5CIQA 5GOTA 4LPKA 1Y8RB 1NVXQ 1JQLB 1T8YA 3ANXA 4KLCA 4NZMA 4WPGA 3F1LA 1SNYA 2G5PA 1SD2A 2O2JA 4IV5A 4BN4A 4EJSB 2GN9A 5FWNA 3NH9A 1ZI9A 4MVJF 3KKKA 1N32B 3ZJ5A 4PQYA 1J5XA 1WR8A 2Q3LA 5JEEA 2I3DA 4O4LF 4RM2A 3OTGA 4ZCLA 2JAQA 5IK2A 3TQOA 4A73A 4P92A 2YHIA 3AZPA 4HB2A 3RVMA 1C1DA 4NTAA 5G53C 4YQEA 2X51A 1AO3A 4D6YA 1W36D 2G4VA 4CQNA 1JMWA 1VKNA 2GPWA 4UBMA 4DR4B 3QOXA 4ND7A 1GGHA 5G2OA 4HC4A 1DQNA 4OAPA 1KO1A 4H27A 2Y0DA 3NIFB 1Z13A 4FHCA 1VHWA 1OOEA 4WE3A 4JBIA 1NURA 3O9ZA 4FLMA 1F2TA 4OQPA 1NTRA 3INNA 2PQ6A 1QO7A 4BOYA 1RHUA 4CKEB 1T3SA 5FOXA 3BGWA 2H7VC 2RAFA 3W5HA 1RD4A 4BEBA 2NO0A 2JRCA 2Q3JA 3GJQA 1GAQA 1DXHA 1XAIA 3HL4A 2I4MA 1ZW2A 2BFFA 5F7JA 3HLYA 5FNVA 3FDJA 4GKVA 4HYYA 1TI7A 5FNZA 5AW9A 2IW1A 6YASA 4QI2A 3FNRA 2EL7A 2YBEA 3ZE8A 1TJ4A 1CC1S 1JIUA 1CQZA 1XMIA 3SX2A 4JI5B 3SE7A 1QRDA 2Q4EA 5FPPA 3PICA 2GWHA 3THSA 4Q48A 1BVYF 6GPBA 4DREA 2QLLA 2OAP1 4EQ6A 4MHOA 3QVJA 4PYIA 1M2KA 3BK7A 1A9XB 1ZL2A 1QIKA 2OUIA 1VECA 2Q99A 3NAGA 4QXAA 1H5QA 5K6AC 3ZU5A 1W0KA 1JAZA 2KJQA 1UM9A 1R5JA 1F1BA 1A82A 2G77B 2X2PA 4DS3A 1XXHB 3Q7IA 2I55A 4X63A 5K3CA 1JNXX 1Y5LA 2JKVA 1NE7A 3EYWA 3FZYA 2IP2A 1WCIA 4J2HA 4KKVA 5FYDA 1XWJA 1QYDA 3B7GA 3T5TA 4IICA 4K86A 4ZJUA 2O19A 4C0KA 2XXBA 4GP9A 4EFMA 5CFQA 5K2OA 4MS3B 2P5SA 4NCBA 4MUNA 2HA7A 4BNGA 4Q15A 2WP0A 4JNCA 2O2CA 1DBQA 2NZ2A 3G59A 3ON5A 3GZNA 1WD5A 2C96A 3AWIA 4A2QA 3ND9A 1SFRA 3LZDA 1FMFA 4MYCA 4D82A 5J4KA 1HG1A 2YJNA 4G97A 2P6VA 4K87A 4RH1A 4G5FA 1TECE 4I1SA 3X1DA 4P8RA 4BBPA 1TTTA 3COYA 1BOFA 3U09A 3JRTA 1M0TA 3AVOA 1RI4A 3O38A 4FHDA 1RPJA 4PTLA 4U7FA 3D1LA 4KC0A 2NVOA 5DDIP 1QHYA 1GRRA 1WNTA 4FIZA 3TVDA 1TU3A 4GDMA 2FMUA 4H7PA 5BQIA 3OPNA 3B5JA 4W7SA 5CG2A 1ZOPA 4URUR 4ER0A 2L17A 3HXQA 1KYXA 1IJFA 2E4UA 1VIAA 3K5WA 4DDKA 1TEXA 3UK2A 3TAHA 5AVUA 5J43A 2WD7A 3EQZA 2LQGA 3JQ9C 4TMTA 4TKUB 5KVSA 5C5CA 4OL9A 3KEOA 4QUJA 1CIVA 2A58A 1L7QA 3HABA 1M1NB 4Q03A 1RQRA 1QM5A 1UJBA 4GM1A 2QMOA 2F1IA 1HRKA 3OPYA 4EG7A 3VH4A 3AJMA 3USZA 3SDSA 4YUVA 1W7AA 4FOTA 3FCSB 4RVGA 5BOVA 2RKWA 2YRXA 4RHXA 4INAA 3JVEA 3TEMA 3KJXA 5EXEA 4AD8A 5BN3B 4LLCA 2GZMA 5G4LA 3FCEA 4XARA 4BFSA 2J6CA 1ZUWA 2V8OA 4G1CA 4KMOA 4EEKA 2PYIA 4KFUA 2YV1A 2XNHA 3SCZA 4HNTA 4J3JA 1U1FA 1W4AA 3CCFA 4HTAA 4ER3A 1TTQB 3DEKA 3VH1A 2YZ2A 3WGVA 4I6GA 3FTQA 1J0BA 1ZS9A 2QT1A 5F2NA 1U2GC 3U5TA 2P2ZA 3I9V6 1NV9A 4OXYA 1CRLA 2HA2A 1CTQA 2VDRB 4GHWA 1AQIA 5DKFA 4LY6A 5AI0A 4MARA 4MWCA 1P2DA 4BFTA 1CIJA 1PJBA 3UAGA 5KTNA 2QM0A 1X80B 4JU8A 2AFIA 3QE3A 5G4KB 3SJZA 5IUNC 1YNSA 5KB3A 1HNXB 1S7CA 2BP7B 1VBKA 3L8IA 1GZUA 4D0LB 3LJBA 4UPDA 1Y6QA 4MRRA 3PRHA 1PDOA 3DM5A 1CRZA 3BDAA 4M1ZA 3EIUA 3SC2A 3VJMA 2WSSD 4RETA 5C53B 1MNAA 2X3YA 4OJNA 2AMJA 2Q7OE 4ETMA 1II8B 2IZ7A 3IHKA 5F2EA 1HBJA 2XKJE 4ESVA 3W9BA 4NBSA 3ZVLA 5IVIA 3QKSA 3QLJA 1F8XA 1K89A 1ZJ5A 7ABPA 1GRVA 4YR9A 1ZGHA 5G0VA 1QGUB 1ZH0A 3IYLW 3EYAA 2JCXA 1SIWA 3ZU2A 3WIOA 5BR1A 1SHTX 1QX4A 1QKJA 2O07A 1B93A 4MVJG 4QUDA 1H1DA 1MC5A 1WN0A 3ZZUA 4B74A 1E85A 3R0IA 4NBLA 5I47A 4P93A 1ILEA 2DPMA 2H0RA 1AM4D 1FYWA 3J80A 4KQFA 2QRKA 4WEQA 4EG0A 4HGYA 2BI4A 4RO0A 4MR9A 5L3SB 4OREX 4D81A 2ETXA 2MT9A 2YZGA 5EPUA 3KG2A 3LUPA 3VAAA 2A3NA 1SQ5A 3A6EA 2R25B 1ORHA 3BREA 4Q3KA 4TL9A 3ET4A 4TS1A 4ZQIA 2NYUA 3SR0A 4C08A 2G8NA 5BSEA 3CUUA 5KWSA 4AKGA 2VCCA 3HBFA 3D1JA 5DCLA 2HRRA 2DR2A 5CUQA 5A9RA 4HDOB 2P2SA 1YR6A 3BCRA 3GCZA 3NQ41 4KGZA 2XEDA 4Z1MA 5G1NA 5TY0A 4CLDA 2UXBB 3A70A 4HADA 2XV1A 1GNSA 3ESXA 4Q7MB 3RIGA 3WJ1A 2HA0A 4BFLA 2W98A 1YDGA 3AVWA 1Q3KA 3RSQA 1DJLA 1ICEA 2FN4A 1O0BA 2YJGA 3BTVA 2GAFA 4HDSA 4B3DA 3H7IA 3IT1A 2GBGA 1RLIA 2VPPA 1NJ5A 2XQFA 5B7PA 3H5NA 2NPFA 2ETSA 5BR4A 3OEHA 3X2FA 3DE9A 1DVRA 3C63A 2QAIA 2VDMB 3IODA 3U17A 1MC4A 1NP3A 4CDNA 3K4QA 3NONA 4EARA 3BXPA 3QVMA 2O7RA 3KU4A 4ZCIA 2C2GA 3TNFA 1GSIA 4RY8A 3HNRA 3EEFA 3PUIA 4FMPA 1YMQA 2C4WA 4G86A 4NZYA 3UFXB 4YMVA 4YYEA 3FYUB 4X3OA 2B8WA 5DN6D 2IU4A 4QM7A 4JC4A 4J9VA 2DQZA 3FHJA 3GLGE 4MKZA 4MGYR 2DH6A 2LGJA 5DEIA 3KZOA 4W8HA 5FO0A 2VHCA 4YRZA 4ZI7A 5IM4F 4KL8S 1HUQA 2ZI4A 1I4LD 3HCOA 1AKQA 3W9YA 4OD4A 1EDOA 1NYQA 3QLVA 4LNUB 4DRYA 2UZ4A 1X39A 3KU1A 1RP1A 3ED5A 4LTDA 1YZAA 1RJ9A 1DOWA 4LV5B 4M8NE 3A0UA 5H8WA 2WHPB 2QZZA 1RBMA 1WL8A 3QPUA 4G5QA 3M6IA 4DTIA 3WHLA 2AIRA 5F5LA 3V5YA 2F43B 4ZODA 2WRZA 4DRJB 2Z2IA 3PYXA 1Q0DA 1ZGCA 3LKVA 1RFLA 1GPDG 2QV0A 3K09C 4Y2RA 5F1KA 5JNSA 1SXPA 3V9AA 3K70B 1FEZA 1JP7A 3NS7A 2CVZA 1Y48E 2GTHA 1OWPA 2DPLA 1JTVA 2Q3HA 4OGLA 3E3MA 4N03A 4MOWA 5CB4F 5FR1A 4JI3B 4YXWD 1JLRA 2BGLA 1R6VA 1U0FA 3Q0EA 1XJQA 1Y89A 3HVKA 3K8QA 2ZWMA 4IYJA 3IEKA 1Z7Qc 1C1YA 3LPMA 4R1TA 2DQ4A 4YB8A 3HZZA 5HFJA 4RNCA 4F56A 4C07A 1VLVA 4MQEB 5KYWB 2WZCA 3UMVA 5I4BA 2OGSA 1RXYA 1G59A 3S7TA 3G0GA 4BLVA 5CX1B 3NDJA 5JAOA 4TXLA 4KR0A 3I5XA 3VDNB 5HYVA 2R60A 2X6QA 3WTBA 1C3OA 2CZQA 1AQUA 1E3TA 4Y2PA 4KPEC 1JFVA 2NT3A 2JX0A 2IRWA 1R5OA 1B6TA 1WKCA 1NXWA 2VBGA 2W2OA 3KEMA 2R7VA 1V5FA 2EKQA 3B3QA 3PFGA 1TWCA 2BJHA 4WXYB 1V95A 2C9BA 4ZOLB 3NTLA 2Y6UA 3HR8A 1G8MA 4O4IF 3B3FA 1T4MA 2K2WA 2XKBA 5NULA 3MMNA 1VI6A 3TJ6A 2G83A 3K1TA 5HDBB 4X6LA 4PYOA 1YVIA 4ACBA 5L51A 1BMTA 2RC6A 3AFNA 1QHIA 3DBLB 1FXWF 2PZAA 2XMZA 3DP9A 3IV7A 3KD3A 3L77A 4G5GA 4H1UA 2Y92A 4B7AA 4E5YA 2IX3A 3ZV3A 3JQGB 4GOLD 1P29A 5JC1A 1FFTC 1ODCA 1ZJJA 2AUNA 2BKEA 4EFDA 2EYQA 3KXKA 5I6DA 1O4VA 4I4TF 5FLEX 3SX4A 1NOJA 1AQLA 2CMKA 1RWBA 2F59A 4NBTA 4WABA 1A3CA 2KJGA 5HQTA 3L0DA 1F3LA 4MS1B 3D6NB 3U37A 5D00A 3OTOB 3U60B 2FEXA 4HZGA 2H3EA 2FSPA 1OI7A 2X8LA 2XNCA 4GH5A 3PZRA 4C76A 1PX0A 3BBLA 1V47A 1ZC3A 1U0OC 5DFAA 1CG6A 5ESXA 4D5EA 4N9WA 4DADA 2ID9A 3ESDA 3NETA 2C20A 4O4JA 4OLHA 2G67A 3DYVA 3WWZA 2FJPA 3LCVB 4OD0A 2V7BA 1YUNA 3G6KA 1EVKA 1SZJG 1AB6A 5JNRA 1UQUA 1Y1QA 1I51A 3R5TA 3VNRA 3HJFA 3CURA 4ZVQA 3HHEA 5TJHA 4M7OA 1KI7A 1NBOA 4BECA 1WP9A 5KVAA 5COAA 3K0KA 2GZ1A 3BYZA 2ZRLA 4DLUA 4B3JA 4B73A 2I4LA 5FIUA 3RU7A 2H2WA 3R3HA 4QDUA 3FPCA 1P0QA 2XWBF 4NC3A 8ADHA 1E86A 3O4VA 1Y4UA 2B82A 3KB2A 2Z5FA 3IUEA 3RNOA 2J3MA 1EUZA 2F3RA 5EA2A 4YRJA 1WHSB 1IMOA 1S9DA 4HN9A 2VNSA 2NSJA 3K71B 1KI6A 1VIVA 2IS4A 3FR7A 3HYCA 1E6CA 3LUFA 4KE7A 1XJ5A 5CH5A 2HR1A 3GWNA 3BQNB 1DXYA 2QT0A 1O54A 2R84A 5DYGA 1SKAA 3PXXA 4AMBA 1O7JA 1WXDA 2YVUA 1DBPA 3JQ9A 2P4QA 3L0CA 1MX9A 5FI5A 4L75A 2Y0EA 3HM2A 4AY5A 1K5DA 4H1TA 3OJOA 1E7SA 4I6EA 1I4DD 1ZW6A 4P3KA 3S2GA 4BATA 3RDPA 1KEEA 1CY2A 2IBFA 6REQA 4Z4CA 3G13A 4C4SA 3R7DA 3STUA 5FAXA 5DXJA 1QP7A 4MWGA 4XIGS 1DX9A 1EKYA 2EKLA 4ZVVA 5SY4A 1OLSB 3IT3A 4KE9A 3V3KA 3VYUB 4NWIA 2JJ8A 1W0JA 3RT1A 4PXSA 4AWAA 4CUJA 2OQMA 1NM5C 1HEUA 3IBYA 5BN1A 4JTDB 3CU5A 4L5IA 1RKQA 1QDUA 2RHHA 5IWAB 4C7KA 4FSHA 1F3OA 4QRIA 3UV6A 2HTEA 3L93A 4ESHA 5IHXA 2CBGA 3MYFA 3OUZA 4R81A 1FLNA 5AM5A 4YWJA 2Y0BA 1RNLA 2N1MA 5L7TA 2W90A 5C8ZA 3IEUA 2MIIA 2NZ8A 3ILSA 1KBZA 1Y5MA 1QF9A 4PSVA 1Q74A 2GJKA 3C85A 3QU5A 3EFOB 2YHIB 3C3DA 4K46A 2WE8A 1QR6A 1W93A 3CSSA 3DW3X 1V11B 3G8YA 3UJPA 3QKTA 4MA4A 1OBVA 5FT9A 2JZOA 3F8WA 3GUZA 5CDGA 4C5BA 1MENA 3PQ7A 1LSJA 1PFQA 1W2GA 2VSQA 3A6JA 1GYPA 5U1PA 4Z9BA 3CN9A 4YI5A 4MR8A 2B20A 4ENPA 5HA5A 3GF4A 4IQ8A 4EB8A 1JL3A 4LHSA 2WQ6A 3VR5H 4ZZ0A 3I6YA 2IIQA 4GZ5A 4Z4EA 4KIFA 4P4LA 1WY7A 5CPFA 2X2OA 1NMYA 3P0EA 4M86A 4EG4A 1NPDA 2IYRA 4HV4A 1GNPA 4IIVA 1J70A 2FW1A 4CGYA 2QWXA 5CNMA 1CRPA 3WKDA 2ZSUA 4KIJA 3BJIC 4DMMA 2XD9A 2ONCA 1R8QA 2IHYA 1FMCA 3NHRA 1TZKA 3F47A 4KVAA 4OFXA 5FEMA 1KO5A 4ANFA 3O92A 5DISB 5JR3A 3IIJA 2XXJA 2ZIEA 4XEUA 5CB4A 3CW9A 3ICCA 2P35A 5JXJA 3WMRA 1V8ZA 2Z3ZA 4IX9A 1FTNA 2GK7A 3BMOB 2NSFA 4MW1A 3A1EA 4OMFG 4WX2B 4XFKA 4YUXA 4OAOA 1Z5VA 1YQWA 1UPAA 1VJ5A 4IRUA 1F51E 4F9GA 2EFDB 1B8OA 2XUIA 2G70A 3GELA 1E2GA 1XWIA 2VP9A 3IP7A 3T9CA 5L95A 1BDIA 4RACA 1OXKB 4S35A 4X91A 4J6EA 4X9XA 5IXSA 2MCFA 3A25A 5B1BC 2V03A 4WFIA 1JN0A 2FWIA 3HP7A 2UUHA 4LZPA 2BJWA 2UDPA 1RR6A 3D0OA 3EF1A 1L5MA 1A4IA 4B6OA 5CCBA 2I2DA 4ALLA 1JSRA 5IM5A 4K0KB 3OBIA 4TV9F 1GA1A 3UK0A 4ABTA 8MHTA 2Q1XA 2NO7A 2W2KB 5BUQA 4MICA 4CLRA 1C4KA 3LO8A 2WFLA 5CT5A 3RQEA 4MVSA 4A8JC 3N8GA 4KGVA 3E3OA 3F6BX 3OCWA 2VH3A 4BLTA 1HDZA 3B2EA 3V42A 1PDWA 1Y33E 4K3VA 1VQ1A 1SU6A 3AG3C 2YINC 5BVHB 5I8PA 2GDCA 3VR5A 3EXAA 2XT0A 3CS3A 1SKYE 2C3OA 1MJFA 3EEIA 5KOHB 1BYIA 1P7WA 2FJUA 3ZE7A 1GL7A 1HKUA 1T1JA 1Z5OA 2LTAA 2XNDA 3ABRB 2J9FA 4YQFA 3C6YA 5B6IA 2R6AA 1YCDA 1YYJA 2YW9A 2YRWA 4JDUA 4DQUA 3M0EA 4UNPA 2CL0X 4UMEA 5FBVB 3FLAA 4FNMA 1NJSA 4PJNA 5LXTB 4RA6A 4OOEA 4RQBA 5K4HA 3E5HA 2O7NA 3FVWA 4G2NA 4YN0B 2QPAA 4WLNA 2EBHX 1ZH8A 2HHCA 5ALPA 2EWMA 1JFSA 4M9UA 4NCNA 1VI2A 3LQFA 5A3VA 4RFSA 5LUAA 3L7YA 2Z9CA 2YS7A 3FNHA 3CQZA 2J0XA 3OA1A 1HETA 3RUCA 3Q3JB 5DNVA 2E4AA 4GI1A 4FFBA 4G41A 1E2NA 1KP9A 1GPJA 2HBRA 4Z0TA 4F86A 1HH4A 4ZJYA 4FKMA 4CS8C 5F76A 4ALMA 2W2VA 1TK2A 3EDRA 3U0VA 4WNYA 2GN6A 4ZO8A 1ZMTA 3V1TC 1O8CA 1N75A 1Y9JA 1D7OA 5AOCA 3AINA 5BOSB 3Q1LA 1PS0A 4L5JA 2WHRA 5EP1A 1TD1A 1ZH4A 2C2BA 2JDID 2YV2A 3DEAA 5L7WA 1ML4A 3RR2A 2YHSA 4K9NA 2FZWA 4X8OA 2GARA 2GA0A 1JR3A 2C95A 1WATA 1UJ2A 1SC6A 3T99A 4R51A 1N6IA 3SBDA 3N6RA 3NTVA 4I4CA 1MIHA 3ANTA 3GJSA 1F8FA 1CNEA 3DO8A 2CW0F 2ZSKA 3B60A 3ZYCA 1H6BA 1IFXA 2QOEA 1DADA 1R6TA 3QV2A 4DCPA 1F4VA 2XTZA 4BFCA 5IASA 2GFIA 3VR6A 2B6HA 1VP9A 2H16A 1BXGB 3F7OA 1E4VA 3GA0A 3KKZA 1NI5A 2GA8A 1U9IA 1YDHA 3CX6A 3EPRA 3OSZA 4OYLA 5CLHA 4B34A 4MDFA 2WWXA 1RKCA 2C58A 2FXIA 4BNLA 1P19A 3I73A 3TTTA 1GQSA 4KHPB 2LDXA 2AB0A 5FBWB 3H2HA 1BOOA 1WSWA 4XKJA 3QTBA 5HHTA 4P0QB 5ABPA 5HGXA 2XWJI 3JARA 4WSOA 5CMLA 1PVVA 1LKXA 3A9TA 4CTJA 1ESEA 3HCWA 1J21A 3INRA 4DY6A 1RXCA 3SXPA 2QBYA 3AVYA 3CZQA 3LPNA 2ZB8A 2PUWA 4OQ4A 4BEVA 3PEVA 5FA5A 4KLRA 2M64A 1Q95A 2ZG6A 3GBPA 3GJZA 3N70A 3L07A 4NC9A 4O4IB 2XDQB 4W5WA 5E6RB 1L8OA 1NX6A 3WSVA 5CVJA 3EOAI 4Y1FA 5B3AA 1HYHA 2H9IA 3QTLA 1LNSA 2H4FA 5EI5A 1JHMA 2ZATA 1BSVA 3RRXA 2IUYA 1NSYA 1JVSA 2XE6A 4HDKA 1B68A 3V55A 2BAGA 4RDCA 3INGA 3DTNA 4Q0MA 1HQYE 1VCMA 1X70A 2JCVA 3ZHTA 3ZNQA 4IARA 3BS4A 4D1YA 5F64A 1O95A 4MH0R 3U39A 4CMEA 1E1CA 1G7CA 1S1CA 2WV9A 4GXTA 4EBKA 4PPQA 5JI3E 2O2XA 2GEKA 3GZJA 1KE2A 2D8AA 1EVIA 1JIJA 1GRCA 1TCUA 3BA6A 5KS2A 1T0UA 2JK0A 4N3BA 3FVQA 1QRUA 4LNHA 1YL5A 5JE8A 4Y2QA 3PCTA 1PZNA 2HQ1A 4ECAA 2XGOA 2G09A 2FOXA 3ECAA 3RG8A 5E3HA 3A1FA 3JR3A 3TS1A 2X22A 2OPBA 2P30A 3QHAA 4ETNA 4YL0A 3HY4A 1U0JA 4J75A 3B3AA 3PC4A 3ODGA 1LH0A 3Q8WA 4JB2A 2N3ZA 1IDOA 1S2GA 2VR1A 3MBOA 2FQXA 3GC6A 1C9YA 1T9AA 4IINA 4OD5A 1E3IA 2DBVO 3JW8A 2ZJ2A 2ZYVX 1DEKA 3PFKA 5BW5A 5HKKA 1BR4A 4Z0NA 4HXGA 1LZKA 3FZNA 1UZUA 2FOIA 1ZK1A 4MI1A 1MXFA 1RWOA 1DX6A 1RRVA 3DTVB 5E0OA 4YPOA 1OV6A 1ZW1A 3QHPA 4DWWA 1CF4A 5BOSA 2AI2A 4HB0A 4DXDA 4AL4A 2PEYA 2OYSA 1JTFA 3ICQB 2YWFA 3TQFA 4F4BA 3IO5A 1XZLA 1BRTA 1QMGA 1FJ2A 2VZ0A 4XVHA 2FZKA 4CIHA 3WWYA 3C15C 3PFCA 5EJ5A 3FE2A 2NO6A 2PGIA 1QC5B 3WGOA 4XJTA 1BBHA 5CNJA 3W8NA 5C9ZA 4Z3OA 2J5XA 3W7VA 4MKFA 1CT9A 3CF6R 3V8NA 1YE8A 2RI0A 3OQ1A 4B6JA 4F7WA 1Z7YA 3AB7A 3BJZA 2BC5A 5BT8A 1U9IC 3JD3A 1HTTA 1J06A 2A9FA 2F8MA 4N5LA 2QTAA 4OKIA 1C1XB 1TYAE 1UMBB 5K9ZA 4F11A 1OZGA 5K3FA 1V4VA 2ZXEA 4CF3A 1K98A 5H70A 2WM3A 1N2SA 2DWQA 1CUIA 4KJZA 4X95A 2WSYB 2PS3A 5TR9A 4A2CA 5BW4A 4GNKA 4OGGA 4AX8A 4EUEA 1Z06A 1A7DA 1UXOA 2A5GA 4KNYA 5AHRA 4L7QA 4W5NA 1TVCA 4IMJB 3T4EA 3O1HB 4HPWA 2Q2OA 1SQ0A 4YJ2F 4IUCS 2JFZA 3QYAA 4ENSA 3DZ8A 1H42A 2Y1GA 1WW8A 3QXXA 1SC4A 1HEIA 4W6ZA 4UU0A 1WS6A 2RGBA 2NUTB 1D6SA 1WX1A 2PKXA 4FIDA 4I9FA 2ZM6B 4IJVA 3TW6A 4XD2A 5CA0B 2YNMA 3E27A 4PSCA 4MRPA 1KYYA 4PC3A 1YFJA 2ROQA 2ZULA 5LQRA 3UNGC 1AA9A 4XD7A 2WAAA 4JZYA 3WGHA 5CXUA 4Y6PA 2EILC 1BS1A 4FINA 2IP1A 3BWCA 2OHHA 4PC6A 2HWKA 2Z15A 2C98A 2DC1A 3AETA 3R3ZA 3NRBA 1XLVA 4GYKA 4RENA 2VB6A 2NWQA 2JLYA 3IQEA 2X6RA 1ZWLA 4AT1A 4UDXX 1DAKA 1GFIA 3CF2A 1EP1B 3CH4B 1NU8A 2GBLA 3QUBA 3VYTB 4D9NA 4U0JA 4BQRA 4WBNF 3BOSA 3C8HA 1R6XA 1S2LA 2BGUA 1I9GA 2BH2A 3DKKA 4X1IA 1ZVVA 4QQKA 3VOAA 1SUBA 3JS5A 7AT1A 1ZP6A 2R8RA 4V3BA 4F6LA 3UK1A 2PWYA 3FCUB 3GVXA 3KSRA 4P22A 1IBCA 1N5KA 4JCOA 4OEHA 1LW6E 1RYFA 3EIEA 4DGQA 3E8SA 4X41A 5TQ0B 3WK7A 2I2WA 2QN1A 5DHRA 2I6UA 1N78A 2O1EA 5DNCA 3N0XA 3NXKA 4RABA 1LTKA 1H0KA 1RC0A 1QMPA 2CJFA 2H7VA 1YB5A 1ONBA 1XQ9A 2VXCA 2G06A 3K0AA 3V46A 3CRW1 4DUGD 4FYYA 1N2XA 1UJ5A 4I55A 4EBJA 3CX7A 4RJLA 4ZDWA 3GFPA 5JSZB 2BE5F 4LDAA 2OV3A 1P1HA 1USUA 1GTMA 1CQIA 4D97A 1DWQA 1ADCA 3F2VA 2HMYB 5DYNA 4Y2YA 4IJKA 3UG7A 3C5EA 4RHCA 3A2MA 4X1KB 3HCCA 3VYRB 4RKRA 2IS2A 1HDIA 3MBKA 3SQWA 1E5DA 3QKRA 2AQ8A 3GU3A 1A9PA 1T9DA 1HMDA 1AQ6A 2GYVA 1VOMA 1R6BX 1U7UA 1DEXA 1C8VB 2VDKB 2IWHA 1PV4A 1OYYA 4EYOA 1ONPA 1E9SA 3H11B 2BCJQ 1P77A 3WLMA 4DCGA 4LF9B 1G2QA 1UBHS 1OXXK 1E96A 4IIJA 1SYQA 1TZMA 3FAPB 1B23P 1M57C 3ZGNA 2Y1FA 5EIBC 2R7WA 5H9VA 1Y6FA 3JYQA 1PG2A 3INTA 3OJFA 4XDGA 4QPNA 4Z1MD 3NIBA 1UMDA 3GK3A 4FE7A 2REQB 2ZROA 3AY6A 2I2BA 2QF7A 3C3WA 3AUTA 3ICVA 2DUNA 3LLUA 4MINA 1H69A 3T8YA 4MDEA 1FAPB 1GM5A 3IAS1 3KK0A 2DXIA 2FR8A 2ENUA 2B61A 2P6UA 3DEJA 1DC8A 1GXSB 3Q2KA 2POCA 1P44A 3D3KA 2VF8A 3EXFA 2I6QA 1HSZA 4QFCA 4XE5A 3WLOA 5C46F 5ICGA 3EX7C 3U61B 1BU8A 3UATA 4DC1A 4RTLA 1NBBA 1HR0B 1KI1A 2HFJA 1CUYA 5CDHA 4TTVA 2V55B 3EVAA 3LC1O 5LBUA 4MXDA 4IUBS 2XSEA 1M1YB 4LRYA 1N2IA 4QOGA 1NBME 3COWA 3HKCB 2GLXA 2EP8A 2ALJA 4KI2A 2IYPA 2QMUA 3R5SA 4LPSA 4CBEA 2XOKD 1SUDA 1XLUA 3U7FB 4LBVA 4TV8B 3M4NA 2ZT6A 4IGAA 3BSWA 4LE2A 1WNFA 4LZLA 4P84A 5GV7A 3M4JA 3LP8A 3OT1A 5F52A 4F5YA 4KN6A 2BRUC 3FPFA 4TYNA 1S8NA 1WD7A 1EEHA 1DAMA 4HFRA 3JCUQ 2I62A 3EXHC 4PXAA 1X2BA 2JFHA 2XIJA 3EGOA 3C16C 1G20B 3NYMA 3SR4A 3N9IA 3V2IA 4F9TA 1X7XB 2PKQP 2PFGA 1VL5A 2EG9A 4D0RA 3F4KA 1ZNXA 2B98A 5HF6A 1KR2A 3NM6B 2LD6A 3OY2A 1O03A 3UH1A 4FW8A 1QQAA 4MGEA 5EPOA 3ZW7A 4D3XA 2VT7A 1AGYA 1R15A 2IP4A 3VPFA 2XB8A 4WWHA 2P7HA 4EW6A 3EUWA 4ZPXA 2E1RA 3WK9A 1IOWA 2N42A 5B3SC 3HMKA 3QX8A 1GGQA 5FTNA 5C7YA 4N0EA 2GCOB 3CYFA 2KW3C 4E70A 5HX7A 5LP6F 1QG4A 1YR8A 5F78A 4CQMA 3TSOA 2ZRPA 1DBRA 3N59A 1IG3A 4QWMA 1KQ3A 2CW5A 1DCTA 2CYCA 3EDCA 2GK3A 3IAM6 4A1OA 5F9MA 1A9YA 1L8LA 4II7A 6AT1A 3P0HA 1RBYA 2VHXA 3D7KA 1NAIA 2O0LA 3DLIA 1OB5A 1LPNA 1UBLS 3GCGA 3O73A 1Q1GA 2RH5A 4G36A 4KAFA 1M56C 1RJDA 3UWOA 4IVRA 2VHTA 4PLVA 4DKJA 1F7VA 4ME6A 3I6ZA 1W0CA 1SZIA 1P7ZA 1PV1A 1E3SA 1TAQA 3K1AA 4HWPA 4JUCA 4KYVA 4UDYX 3SKVA 3KC2A 4LWOA 3V7NA 4LQ4A 4D9GA 5GPGB 1O96A 2ZWAA 4E2ZA 2AR9A 3NO4A 5CJPA 1DEHA 1DX4A 1KVTA 2V6JA 4XTRA 4ZEVA 1FW8A 2KQUA 2GVZC 2YXBA 2UZ1A 2HCRA 4B79A 3U44A 5H81A 4TSKA 2RHDA 3ZVRA 1Q83A 1XG5A 4Q3AA 1Q92A 2XTNA 3DR3A 2O7QA 2PR2A 1PL6A 4O3MA 2RHWA 3LT5A 1GCGA 1R5NA 2C4UA 1Z8HA 3UTCA 1X87A 1KGDA 2RHMA 5KTOA 4ZZIA 3S5JA 2J85A 3BMNA 4UC0A 2XJ4A 1CKEA 2OQ2A 1UC8A 4KDFA 5CYGA 2PVCA 1N5LA 1IQUA 3TE6A 2C92A 4RPHA 1KH3A 3E9NA 4ED9A 1I5RA 1EM8B 1H6GA 5BV7A 1PNVA 2ZIXA 4ILKA 4QODA 5IW8A 4Y7CA 4DANA 1IMJA 1IOVA 1SUFA 2IU6A 3GH3A 3C8UA 3R23A 4MUXA 1V39A 3E70C 4G5SA 1QTIA 4DV2B 4Q12A 3H17A 1ZQ1A 3CNQS 3TNYA 1HDOA 3A0RB 2G6TA 4MVRA 1A8SA 4OCZA 1KJIA 3VGPA 4OHBA 4ZC8A 4QM6A 3IAS6 3JPWA 2W6ID 3KQLA 5EXPA 4GOOD 1T01A 3QUCA 1AZSC 4UMVA 4GMFA 3B1YA 3TGPA 2HCTA 1GQAA 4H4EA 1GU1A 2JJ1D 1W0KD 4OH1A 3X2SA 3JY6A 4OLJA 4H7KA 4HGOA 2FSHA 4QLBA 4R3WA 2WWYA 1L1QA 1XNRB 4AKSA 4Y1RB 2CSXA 1R4TA 5JANA 3U3FA 3KCNA 1QZUA 2D5BA 2OK7A 3BAZA 4UTOA 1YQ9A 4KAJA 4CKWA 1C03A 1EI7A 1W5AA 2JIZD 2YFKA 2IYNA 5JY6A 1QH8A 2MSKA 2QMZA 2FN9A 5LZ7A 2VYNA 4HDNA 2W00A 2A1TS 1ELOA 3PE4A 3RTAA 4NDZA 2F17A 3HB5X 2YUTA 2J0WA 1RJGA 3OQ6A 3DUWA 3AOUA 2GI4A 3IUNA 3QVGB 3NGLA 4IHJA 3TLKA 2C7QA 2WNIA 2XF8A 2AX4A 4BZZA 5KTMA 5KU1A 2VUTA 1G19A 3QLVC 4UNNA 2BL2A 1SPBS 3LFUA 3RS3A 3SY8A 4CMJA 5HOEA 4IIDA 1TVKB 2VT3A 4X24A 1J07A 4A16A 5M2QA 1HYBA 3MWGA 1WEKA 1J8FA 1FDRA 1NZFA 3VPDA 2F62A 4JQSA 3R8CA 1Z4NA 3R40A 1E2UA 1Z5WA 3CVXA 2HJHA 3TDMA 1XMPA 4RF4A 2EHJA 2Z6AA 4WLEA 3KKBA 1E3JA 4NFLA 4DV3B 3SVLA 1T2NA 1O97D 1PT8A 4N6NA 4L8FA 1KKLA 4QUAA 1Z6QA 3SXUA 1C3VA 3OJ0A 3FH0A 4YBRA 3GMTA 1R4MA 2C4KA 2I1WA 3E1KA 4KLNA 4P2GA 3RJMA 4QGFA 1KGSA 3VHXA 2OB1A 1C80A 3H1TA 3S8EA 4B6EA 1LJUA 4G4SO 2JASA 2C5EA 5JXHA 1AHHA 4ENQA 5I7EA 5TLSA 2PHZA 2RAPA 4CIXA 1GZDA 2H07A 2EJBA 3NHWA 2FRDC 4JGBA 4MQLA 1ES9A 4LHYA 4J7TA 4NYMR 1M1YE 1DMRA 2SKCA 5EE0A 1CP2A 2GCPA 3MJTA 4OQDA 4M6WA 4DAOA 2I91A 2OWEA 1SK8A 3U9LA 1ZVQA 4KGDA 5HF9A 1D2HA 1KORA 4TRMA 5CD1A 4X20B 2H4HA 1K06A 3UXMA 4AECA 1NHGA 3EH1A 1Q1AA 3EFHA 1TUBA 1NF3A 3IMKA 2VP0A 3KTOA 5ALQA 3R9KA 1XVAA 3OEYA 3KZXA 1NNI1 5FOSA 3TMKA 2GF9A 2O6LA 5JSHA 1VPTA 1Y5RA 3CKMA 3B0UX 4A2NB 2WSMA 5J5CA 3RC9A 3GQBA 3ROGA 2D1YA 1ZHFA 1XDZA 2BHLA 2D4HA 3BE6A 4J91A 4FLEA 1GNLA 4LDZA 4UEJA 4KOEC 4LXIA 3E5MA 4UDNA 1GZ5A 4ETWA 1XZGA 1BCSA 4G0YA 5JVDA 5BWOA 5DSZA 2D59A 4N7MA 2IIPA 1H65A 1TO1E 3IHWA 1M6NA 4QXPA 4RYLA 3LPAA 1Y98A 2O2YA 3HGTA 5K4AA 2GBIA 2NM0A 1YA7O 4MVCA 3M4CA 3A9UA 1EM6A 1AJEA 1CEYA 2GPNA 4Q3NA 3DWIA 4TWZA 3GVHA 3RHZA 1A71A 2CC2A 3P0IA 3W78A 3FKSD 2YWXA 2C4NA 2CJPA 1PJSA 3IS3A 4MCAA 5KMGA 3EPLA 2CGEA 1KFKB 2H2AA 3I05A 1BXKA 2EQ5A 3EDQA 2V6BA 4LDQA 4JLAA 1CB0A 1MMDA 1OCCC 1G18A 4JMLA 2C1EA 1QF7A 2XSZA 3C24A 3NHYA 3TD9A 3F67A 3JWJA 3K2EA 4RDIA 3AIKA 3HVRA 1D1PA 2GX6A 3UJ6A 4PR0A 3L9WA 1NYLA 2GEBA 3KXIA 3T0GA 4BNFA 1B0AA 3IQDB 5CEFA 5DW3A 5LPNA 1Y8CA 2ZPUA 4UU1A 2IYQA 4A0QA 4WQMA 3F7MA 3K0BA 4FFDA 3AI7A 2XLOA 4L6AA 4C0QC 1ECBA 3OEED 1RAEA 1EGVB 1M67A 1T10A 1T9BA 4GP7A 3GM1A 2KB0A 1I36A 1XK6A 2Q1SA 2QTNA 2JHCA 2VHQA 2H4ZA 4CKYA 5CDYA 1GFWA 3OM8A 3MAJA 1UAYA 1GXSA 1V2HE 3L1KA 1KY4A 1QANA 2GUGA 3OCYA 3PXUA 1TWAA 2ZT7A 2P79A 3W6ZA 4AJIA 3MBGA 2XLDA 4ZVNA 2PBRA 4YCSA 3PXAA 3RTEA 3ETJA 3QY9A 3QPAA 5EWMB 2O3RA 3I9NA 1YU6A 1HPLA 1Q0HA 2VDQB 3FNIA 3TKLA 3K16A 4UE6A 2G1KA 2VDJA 3ZD9A 3MIZA 2IELA 3VAZA 4JBWA 5D5HA 3VDRA 4ML3A 1X15A 2O3QA 4IM7A 5E6SA 4B2IA 4EIWA 1ULZA 3KJQA 2D54A 2HMSA 3OFKA 4HAVA 1MNEA 1R4NA 3LDAA 4FYXA 3HQ4O 3ZI4A 2YJTD 4M8SA 2G8LA 3WGZA 5A2QA 4RV5A 1ZBDA 2FVXA 3PJDA 3SXZA 1LI5A 3BH0A 1EX7A 5CD9A 4Z4HA 5FWXB 2A7QA 4DQKA 4YLYA 3A9WA 5M5BA 2HIHA 3OE4A 5C4IA 3SG0A 3ZWNA 4MSUA 5CH8A 1N1GA 3QNMA 5DLDA 1VLZA 2QE9A 3ABLC 1G3MA 1XTQA 1Z07A 2ZRQA 3KLNA 1NGSA 1HV8A 1SB9A 1XMVA 3M6WA 2P2NA 3L7CA 4A23A 1B6RA 1EDBA 2EKBA 4CG2A 1HT2E 2JRLA 4YRDA 5AESA 1LDNA 1H2HA 3QE4A 1JLLA 5H02A 2C0QA 3BMQB 1ECLA 1W4CA 4YHHB 3RKOF 2X9LA 3T5AA 2Z08A 1HRDA 1OIXA 5LZ9A 2CF5A 1E66A 1SBTA 2AX3A 4B7CA 2FWBA 2JGDA 5SZJA 4N8SA 5EHNA 5ILQA 5AP9A 3VAYA 1KMQA 4WOPA 5EKTA 5P8WA 5JNWA 1FRFS 1X7XA 2HLNA 3HP4A 3R0XA 5IBCA 2I99A 1QFJA 4J32B 2YEVA 2XMSA 4IZOA 5A6VA 3AGQA 1QQTA 2JVKA 4EBFA 2Y1XA 4N54A 5CB4B 2MWMA 4XWJA 4FAPB 3BH6A 3BXXA 5ILGA 3C7TA 1OTXA 3GN1A 3W2HA 2W11A 4JE9A 1J8QA 4M0UA 4ITUA 4QUHA 1SB8A 2IXTA 3KT8A 4WBXC 4YP6A 2UAGA 1DV2A 4FBLA 3RVBA 4UQLA 2FJ0A 4GPEA 4KPGA 3DDHA 4BGIA 5BRJA 4NH0A 2DY0A 1SVUA 1V9CA 3AF2A 3M9XA 1PS8A 4JC7A 1TA4A 4TWBA 3KQPA 1PHRA 2PGNA 3QGMA 4LXQA 1JV2B 3U4AA 3PX2A 4BVAA 5ELXA 1N3BA 1RXIA 3QTHA 5EJGA 4U39A 4TX1A 4Y2VA 2QW1A 5AVYA 3O1LA 3UCEA 4B4OA 5IUKC 1QK3A 4R84A 5ERYA 3DT8A 5HCNA 3TOZA 3ZE1B 4RVOA 1OI3A 3IQWA 4Q1BA 4MGZR 4UXHA 3UGKA 3W2FA 4KFCA 1Z22A 3MGAA 3W4JA 5HZKA 4ABYA 4G1MB 3R9IA 3RT7A 4NBVA 1U89A 4U5GA 2GQ0A 3PD7A 1GNRA 4IIJF 4W9RA 4ZAGA 2HPHA 3AUXA 2W2KA 2WVQA 1NJ2A 1QH1A 4ZOCA 5EZQA 2GFHA 4N8DA 3WLQA 3ZEIA 1GV1A 2PVPA 1MRNA 3W0LB 1IHDA 4MW4A 3KLPX 1R0LA 5FZTA 2PO5A 2TMGA 2O2EA 4RULA 1RXWA 2H65A 2R1TB 2QD5A 3N3BC 1UXHA 2HH9A 3HKKA 1XFAA 2J5RA 1TQ8A 1XXLA 4JUBA 4WNIA 4ZJZA 3TKYA 4BJ6A 1B43A 3PHHA 2AF4C 2E21A 1CPRA 3ZDDA 1YJ5A 4FYKA 3WS7A 5I5EA 2GD0A 3TQCA 3ZGVA 1PR9A 3AK4A 3PSAA 1ZMBA 1CS0B 3KQOA 1OBCA 3OJCA 4M83A 2BMAA 4D8WA 4DEVA 5FOTA 3FMFA 3IH5A 1XZNA 4OQQA 4XSGA 2B69A 4KACA 4ZANA 3LC2O 2VJDA 5ELMA 1ZM4A 2QJTA 3KEQA 2R8YA 1B0ZA 3S44A 1K8RA 3G5UA 3ZTYA 3C7JA 5JVDB 1OA0A 3HRKA 5CLFA 1LKZA 5HSWA 1XALA 1S05A 2D4AA 4W1PA 2G7MC 1N2CB 1U2ZA 2FR0A 3EA4A 3CZMA 3I30X 4X94A 4JXKA 2OXTA 4B83A 5IWCA 3I23A 3EFBA 3VFDA 1SURA 1PEAA 3ZXIA 4YRAA 3TNJA 5FL7D 4PZAA 4O2RA 4F06A 5TQJA 1BE6A 2DY1A 2SKDA 1CZKA 4G78A 4Q3CA 4DR7B 1KI2A 1RJFA 2H29A 2IEDA 4JZKA 3T7DA 1MEEA 3DGFC 1X3SA 1XU4A 4IMPA 3WR5A 5BN5A 2CXSA 2VH2A 5BY2A 1U9ZA 4YJ3F 3G9QA 3L4BA 1QRTA 3PDHA 5HMLA 3RU2A 4E7OA 2J46A 3JWIA 3E05A 4AE4A 1MOPA 2L0XA 3RNLA 4D4MA 4IVNA 1O3YA 3QJGA 1QH8B 3H5LA 3OTIA 4LGYA 3SJBA 1HFEL 2QP4A 2PL1A 1GCOA 2R7TA 4OMUA 1X1RA 4W5QA 1LS4A 1E5TA 1KI8A 1M2WA 2P0AA 3Q10A 1JKXA 3RE1A 3ZWXA 5JNUA 3D43A 5FNVF 4XIIA 1GLNA 1AE1A 1IY1A 5T6BA 3DWFA 3BGDA 3ZY4A 2QX7A 3I34X 5KO2A 5LQJA 4XYMA 2W2MA 3IP3A 5A7GA 4QUIA 4JV5B 2TECE 2XLCA 2X2FA 1UG7A 2Z3VA 1V1MA 4U2GA 3S8YA 3FAJA 2BV3A 4MP6A 1TQDA 4YXFA 3T12A 5KVCA 3ZDYB 1OAAA 1YQUA 1K08A 2G08A 4GWGA 5IAJA 1A77A 4XB2A 3ZCPA 4G8JA 1AXEA 2KS6A 4TT8A 1W4RA 3WIEA 3A1TA 4BN0A 4ETIA 4BPBA 1Z36A 3QW1A 5IHPA 3HACA 1MLDA 1NJ6A 1AF7A 3ZCXA 3SHFA 1WMDA 5LU9A 4M1QA 2SBTA 4BMYA 1FUIA 3UCXA 4WN9B 3TLGA 4D79A 4FILA 1TM2A 2X1LA 4KB5A 2PMBA 2QQ0A 3CZ9A 2JIOA 5JWHA 3QA9A 3FBWA 1ZK0A 2J33A 4MV0A 3DD7A 4WKBA 3CTPA 1ZUHA 4JBGA 3G4XA 4D43A 2YHBA 3IJPA 3RARA 1GRQA 3D5QA 2OEXA 1MABB 3GO4A 1ABEA 3Q41A 4L76A 4UQPA 1P6XA 2ES4A 3NWOA 1ZONA 2Q1YA 5A02A 1RYZA 4FOSA 2PZJA 2Y93A 2A9KA 3V80A 3VU8A 1LNZA 2WFZA 4NZZA 5HTKA 3JZMA 4PYKA 4Q05A 2OO7A 4PZ0A 3HBNA 1ZD5A 2Z8ZA 1Q84A 3LLVA 4XUEA 2FZCA 3MF4A 3BD8A 3PHGA 1JA9A 4FZJA 4IDDA 3B29A 3BRWD 5DSXA 4MUHA 1IEXA 3Q6MA 3GYGA 1V3UA 4E5NA 4HX2A 3AKCA 2FK7A 3PL1A 2GK4A 2O23A 3FOFC 5FPSA 2Y3BA 1YNOA 2V6IA 4R2IA 4XJXA 2XB4A 5LLSA 1TVMA 1E5LA 2OOCA 3UMIA 2XWSA 2VJMA 2VWHA 4MLDA 1EIZA 5EIEA 4NDNE 1Z2CA 4QBIA 5DWQA 1RQNA 2WA1A 2J48A 2VCEA 1VL1A 3GBSA 4ZCPA 1I2BA 1GZ4A 5DHPA 1U7XA 1P2TA 2Q41A 3A36A 4OFBA 4YRQA 1XPJA 4ZRDA 2Q0SA 3IJRA 3SEAA 1Z6AA 2O9JA 5ALIA 1V7ZA 3GRKA 2I34A 4B71A 3JRWA 3NHSA 4M7PA 2EJCA 5JXWA 5TF4A 3LLCA 4LBWA 5CVEA 1X9HA 4G1BA 4ZARA 2VPQA 3AV3A 4C0LA 3GNQA 3QMKA 2FB9A 2L81A 2IUTA 4J2TA 2V26A 1KBOA 4QICA 2JLRA 3PF8A 4Y2SA 1FU8A 3T7RA 5DLPA 5KVVA 2PSJA 4JIGA 4K6CA 1XTPA 4MR7A 3HV2A 3QVTA 3BWYA 3TX2A 3THXB 3H5IA 4M1YA 4Q1AA 1Q0RA 3DXYA 1NP7A 5D6OA 4NRDA 4NX2A 2C7RA 4KH1A 1TF5A 3D7NA 3WSWA 1PK7A 3F0TA 4OHVA 1Z2AA 4ZVOA 5G3YA 2XUJA 4JENA 3UHOA 5E9AA 1N9GA 3HBLA 3PXCX 1VRWA 3RK1A 2N46A 3M3PA 2CCGA 4MO2A 2VQEB 1KYQA 1XPRA 3N7AA 4I1RA 4MUKA 4R2MA 1IZ0A 1S2OA 2LCIA 5CH3A 3IUJA 5GY7A 4QE3A 2Q4BA 1OHHA 5A3RA 3GMSA 1ISRA 1QKIA 3G2QA