3VAYA

Crystal structure of 2-haloacid dehalogenase from pseudomonas syringae pv. tomato dc3000
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
230
structure length
230
Chain Sequence
b'MIKLVTFDLDDTLWDTAPAIVGAEAALRDWLAEQAPKLGPVPVEHLWEIRSRLLDEDPSFKHRISALRRRVLFHALEDAGYDSDEAQQLADESFEVFLHGRHQVQIFPEVQPTLEILAKTFTLGVITNGNADVRRLGLADYFAFALCAEDLGIGKPDPAPFLEALRRAKVDASAAVHVGDHPSDDIAGAQQAGMRAIWYNPQGKAWDADRLPDAEIHNLSQLPEVLARWA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAD-superfamily hydrolase
publication title Structure of 2-haloacid dehalogenase from Pseudomonas syringae pv. tomato DC3000
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Hydrolase
total genus 80
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1600 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3vayA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3vayA01
4HYTA 3L0BA 1RLOA 3B8EA 5AKZA 1L6RA 1ZD2P 1LTQA 2CFTA 3SKYA 1RRCA 4YCNA 2I55A 3QUQA 4HGOA 4Y2JA 2HI0A 2P11A 1L7NA 4C4TA 2W43A 2FDRA 1LVHA 4KYTA 3BWVA 5AW4A 1U7OA 5AI5A 5A3RA 5T41A 1Z4JA 2G1AA 5AI6A 3W5BA 2MU1A 2OM6A 5AI9A 4ZEXA 4KNWA 5ALQA 2JAOA 1EK2A 2WF9A 5AIAA 5AK5A 1CR6A 4B6JA 2YJ6A 3NUQA 4MWOA 4YGYA 3AR2A 5AKEA 2I7DA 2WF5A 2B1RA 1YJ5A 2VKQA 2IYEA 1RDFA 3L1UA 1MH9A 5ALIA 4NAVA 3ZVNA 1L8LA 3FM9A 1XPJA 1L7PA 3D6JA 5AK3A 1EK1A 4BNDA 2BY4A 1RMYA 4Y2UA 3OCUA 4NWIA 1QQ6A 1YMQA 4EEKA 4OHFA 2ZG6A 4OD0A 5ALLA 3L0CA 5AKGA 1K1EA 4UW9A 2ZBDA 4KX5A 4HGRA 2G09A 5AI8A 4Y3UA 5IS2A 1N9KA 3DNPA 3EF0A 4KX3A 1U2TA 1U7PA 3R4CA 3ZWDA 4UM7A 3MMZA 3A1CA 4FYPA 5AM2A 5AM1A 5AICA 4YH1A 1J8DA 1QQ7A 3SKXA 5FP0A 4ZEVA 3MC1A 2I33A 2I34A 5AKJA 4L6AA 2X4DA 2FPRA 2HO4A 3MPOA 3N28A 3U19A 1L8OA 5ALYA 2B1QA 3QU2A 3U7EB 5AKYA 2B0CA 3ZVMA 1S8OA 3KOOA 4DWOA 2MSNA 2GO7A 3F9RA 5AI4A 1ZRMA 3NALA 3QUBA 3ED5A 5ALGA 3SMVA 1RC8A 3ET4A 4Y2YA 3WGVA 2R8YA 5AW5A 4DFDA 5ALTA 1N8NA 4QQFA 4CF5A 2YBDA 2EAUA 4OFZA 2G06A 1QH9A 1Z5GA 2C4NA 3WKAA 2RBKA 3AR4A 3W5DA 3HLTA 3WKCA 5ALFA 3N07A 5ALZA 2P27A 3WKBA 3AR8A 5ALWA 2RAVA 3NIWA 2GMWA 4MUMA 3UMCA 3KC2A 5AW7A 1L7OA 3OCYA 5IT0A 3L8FA 5AVZA 2WF6A 4UMDA 5AW9A 2HF2A 1NF2A 4CF4A 2FPWA 4JB3A 1RKUA 2FUEA 4L6CA 4NABA 1U02A 3IRUA 3B9RA 1SWWA 1YS9A 5AM3A 3E81A 4GIBA 2ZBGA 4UARA 3L8HA 3PDWA 4Y2XA 3W5AA 3FVVA 1RQLA 1RQNA 2HDOA 2P69A 3CZ4A 2Q5EA 3SLRA 2IA5A 3WK8A 2I54A 4BYGA 1Z4IA 2PR7A 4UASA 4UMFA 2O9JA 2AUTA 2B82A 4EZEA 2CFRA 4L57A 3OPXA 4AS2A 2YJ4A 3GYGA 3QU5A 5AK4A 3QU4A 3WK7A 4AP9A 4F71A 3WKDA 4BEVA 3OCWA 1WPGA 3PGLA 2WF8A 1QQ5A 4UAVA 4FE3A 4Y2VA 2IOFA 3UM9A 1Q92A 3QGMA 2ZOSA 1Q91A 5AK6A 3R9KA 3ZWKA 3I28A 2I6XA 4G9BA 1XVIA 3I6BA 3ZW7A 5AKXA 3QNMA 4YIHA 1VJ5A 4UMVA 1J97A 4RESA 2EARA 4JDPA 3VAYA 5ALVA 3OCVA 4HAIA 5AW0A 3FPSA 4I9FA 1RLTA 1XP5A 3L1VA 2C8KA 5AESA 4RETA 5AHXA 3E84A 4EELA 4F72A 3KDPA 2NO4A 3A1DA 5AW8A 3BA6A 1S2OA 3U13A 3QYPA 4DW8A 3E58A 5AI0A 3AR5A 2Q4TA 4UM5A 1T5SA 3A1EA 2GFHA 3KBBA 3QUCA 1AQ6A 4J03A 2JARA 5ALNA 2AH5A 1VJRA 3IJ5A 2PKEA 3EWIA 3DDHA 5IT4A 1O03A 2YN4A 5ALOA 3SF0A 4XE5A 1ZD5A 2CN1A 3B9BA 3K1ZA 3L5KA 4BNDB 1YDFA 3CNHA 1WZCA 1Y8AA 3P96A 2QYHA 3ET5A 2YY6A 1ZD4A 2FUCA 2FPUA 2YMMA 1RPZA 2GHTA 1Z4LA 4OCZA 1WVIA 2B8EA 5AVQA 1Z5UA 4Y2TA 2IOFK 5A3SA 4IG4A 1YNSA 2HF7A 1Z4MA 1IWOA 1RKVA 4BEWA 4Y2QA 1ZRNA 4I9GA 4Y2PA 1X42A 1NNLA 2WF7A 2AGVA 3L0YA 2YFYA 3NASA 3U26A 4BX3A 5ALJA 2B30A 2C9MA 3AR7A 4DCCA 4IFTA 3IB6A 4UATA 2YJ5A 3NANA 2WFAA 1RLMA 3L7YA 4EENA 3SHQA 2YMQA 4AS3A 1ZOLA 2ZBEA 3EF1A 3UMGA 1Z4OA 3WK4A 1WR8A 2DQSA 2OA0A 5ALPA 3ZTYA 2HHLA 1F5SA 5AVYA 3RFUA 3ZX4A 3S6JA 3ESRA 3AR3A 4UU0A 3OTQA 2B8JA 1PW5A 3AR9A 4G63A 2ODAA 2YMPA 2NYVA 2YJ3A 4ZEWA 4CF3A 2BDUA 3HYCA 1VFPA 2ZBFA 1Z4NA 2EATA 2PQ0A 1SU4A 5AVRA 1TA0A 4YIKA 3UMBA 5ALKA 2AMYA 4Y2RA 1ZD3A 1TJ4A 2WHEA 4UMEA 3PCTA 5AVTA 1SWVA 2RARA 3A3YA 1U2SA 4XOUA 4NFLA 1YV9A 2OYCA 3NAMA 2C88A 1CQZA 3FGOA 4EX6A 4QJBA 3NRJA 3WK6A 2BDEA 5ALHA 3U7HB 3QLEA 4CE6A 5AKKA 2HSZA 3OCZA 5ALEA 5AVWA 3RF6A 2CFSA 3M1YA 1JUDA 4EX7A 3U7GA 3KD3A 4HGNA 5ALDA 3ZVLA 4BX0A 4C4RA 4XPZA 5JJBA 2D2VA 3R09A 3KZXA 2JAUA 1Z4QA 2IOHA 3PGVA 3N1UA 4Y2SA 2W11A 5AKLA 3ZU6A 3ZUPA 5ALUA 3QUTA 2WM8A 3ZX5A 4BX2A 4BKMA 1NRWA 2FPSA 4XQ0A 2C8LA 5AM0A 1O08A 3J7TA 4KNVA 4UAUA 1T5TA 1Z88A 4HGPA 4HGQA 2O2XA 4PNHA 2Q4RA 3U7FB 1L7MA 5AVSA 4C4SA 3I1YA 3MN1A 3WGUA 4KN8A 3SD7A 2G08A 1TJ5A 3DV9A 2ZXEA 2FI1A 1RKQA 1ZS9A 5ALSA 2HCFA 5ALXA 3L8GA 5AKIA 4UU1A 4J2TA 5A3QA 3N5KA 2HOQA 3L8EA 3ZI4A 3W5CA 2HEGA 3QXGA 5ALRA 3TLMA 2NO5A 3WK9A 2OBBA 3ZTWA 4BBJA 4E88A 5AIBA 1QYIA 2JGAA 3FPBA 2G0AA 2FEAA 5AW3A 4GXTA 3M9LA 2P9JA 3DAOA 1TE2A 3OCXA 1Z4KA 1ZJJA 5AW1A 3EPRA 1TJ3A 1RMTA 1RMQA 3QU7A 5AM4A 4YCMA 1FEZA 4CNQA 5ALMA 2YMLA 3I76A 3N8GA 2R8ZA 4O8CA 2G07A 3WKEA 1Z4PX 2JAWA 3ONNA 2R8EA 2W4MA 5AVVA 1KYTA 2G80A 5AVUA 4YCLA 4H1WA 5AW2A 4FFDA 5AW6A 2FPXA 2R8XA 3QX7A 2RB5A 5E0OA 2QLTA 5AKHA 2HX1A 5AM5A 2GHQA 4NV0A 3FZQA 3E8MA 5AVXA 1T9ZA 3AR6A 3WK5A 3QU9A 3ESQA
chains in the Genus database with same CATH superfamily
1U8CB 4DWJA 1A82A 1YVUA 3STUA 2J85A 5JXHA 3DO8A 1DWOA 3TI7A 2C00A 2PBRA 3MSCA 2GTIA 2HJSA 1V8PA 2E85A 4NU0A 2MU1A 1KZ4A 2HPZA 4DNOA 4PGMA 3K6KA 1JX6A 2DKFA 3BE8A 5ALIA 3A1VA 3MRTA 2G83A 2ATVA 2B6HA 1DI0A 4IUCS 3FCYA 4UHKA 1LTKA 1XD2B 4A1OA 4IHAA 1DQNA 5FJIA 4RK0A 4Y3UA 3SR4A 3NPAA 5EXXA 3ZGNA 4FBGA 1YXMA 5EJFA 3HBMA 3I5AA 1I13A 1JYSA 3M6IA 1TLFA 1ITZA 3RHZA 5BUQA 3TKYA 1PRYA 3IIJA 1LLCA 4L72A 3TSYA 5C5EA 1SCUB 2YHIA 2WUVA 1BS1A 2A14A 2FKNA 3DH0A 4JEHA 3FHLA 2IYZA 1FVXA 2H1HA 3N70A 2EAUA 1GPAA 2A1TS 5IAGA 4PVCA 4HRYA 4P4UA 3W5DA 3VOBA 3K6BA 1RIFA 2CZQA 4DT1A 1U6IA 1SXIA 1Z75A 3B3AA 4GVXA 5CDYA 4MKIA 1D4OA 3ADPA 2XY4A 3AEQB 3IRUA 3OMWA 4L8FA 5ICGA 2AEFA 2JKZA 1YR3A 4DG5A 4XEFA 3G3EA 2QX6A 4GLJA 1VZ3A 3VPSA 4YWJA 2ODNA 2PFDA 5BN3B 1CUBA 1QYXA 5DX1A 5A3VA 3R5FA 1P4AA 1ZZPA 3DE3X 3UMIA 4MTGA 2OCPA 3CAXA 3ZBQA 4PY2A 4URYR 4M3NA 5LMUB 3HUFA 3QZCA 1CUSA 2JD1A 3F97A 4XX0A 3B60A 3K4HA 1V8BA 4MQEA 1HV8A 3VRHA 3F96A 2CCGA 5CIYA 4D8YA 2AE2A 2GASA 2WP8J 2CJWB 2VQEB 2CMFA 3CW9A 2GJSA 4G0QA 3UBMA 5IVDA 4DIOA 4RMGA 4ZQHA 2FMTA 1TCVA 2VJNA 1C0IA 1FE8A 3WFJA 2DGJA 5T64A 1I4LD 3R41A 3R8CA 2PIDA 1H1LB 3CUEF 1TO1E 2B7CA 3TZBA 3KQMA 3SX0A 1YNSA 5L0FA 4IGEA 5E0KB 2VSXA 4RLHA 2QMQA 4QT0A 4Y1RA 1VA4A 3ML1A 4MWDA 2XQVA 4XVCA 2PX4A 1JEQB 3TTTA 3E2IA 4CTJA 1Y3DE 4D7AA 1QIEA 3LPDA 4C76A 4FZVA 1LDNA 1Y1TA 5ABPA 1PEKE 1ZGJA 4YUXA 2WJPA 4U7HA 1QDUA 4C0AC 4IUYA 4U5HA 4NOLA 3A3NA 3RJMA 3K66A 4NFSA 2TS1A 2C29D 3N7TA 3RLFA 4ITUA 2B8WA 4Q1CA 3GJ6A 2ADMA 3OJWA 4O6VA 2GEDA 4TROA 4X66B 2L9JA 4QJBA 1VKHA 4TV8B 3FWZA 3TIXB 5FWAA 1OB5A 4E7PA 1HDCA 1UMCB 4A0HA 1WO8A 2LE0A 2BGLA 2D74A 2HMVA 2IDKA 4G0YA 1D1SA 256BA 3D3KA 4IDBA 1N92A 3K9NA 2WG2A 1I6WA 5FD8A 4TLMB 1QFZA 1C3JA 1OZ0A 4ALMA 2CHUA 3I9KA 3EGOA 5K6AA 2H4WA 4GGMX 3RG8A 1LE2A 1AQUA 1DOHA 3LX5A 4H3KB 3GFVA 2WNIA 1DVRA 1PV2A 4MRAA 5JJKA 4HNGA 4FGUA 2UZ1B 3NBFA 2LKDA 1S8AA 3K20A 4XEUA 5U9CA 3IO5A 2QUKA 2R7XA 4D4MA 1MEOA 1KJWA 4U3JB 4BE4A 1USWA 3TE6A 5AVVA 4MR9B 4J90A 2XQJA 1SBIA 1VPWA 2EPNA 2CY0A 3WDSA 5AP9A 1ABEA 2J9FB 3T4XA 5ICMA 1V3TA 2Y39A 1DKLA 3ESQA 2NQ2C 1BG6A 5J5VA 2WVAA 1KPIA 4ZYZA 2XL6A 1L6RA 4IDAA 2G62A 4NY1A 2UUBB 1FUEA 1UWLA 3A9WA 3U9MA 3IPAA 1VHDA 3AFNA 3TLEA 4NBLA 4F9TA 4QEZA 3FDJA 3L40A 1QKIA 2XVZA 3HHEA 1XTVA 4Q6BA 1JJVA 1C0LA 2RC5A 1C30A 1H2YA 5FI1B 1MRSA 1QANA 1MC8A 3RANA 3WI7A 4PGGA 2PO5A 3H4VA 4N5HX 2Q1UA 4BFSA 4MROA 5JSHA 3J7AC 3ORRA 4HVCA 2D2FA 2VHTA 4KKXB 4D74A 3P27A 1KTIA 4RW0A 1XX6A 2HQBA 2P5TB 1XQYA 2WIFA 3C2QA 3GEIA 2ZIGA 1PD1A 2XMZA 1O95C 4E5YA 2ZJFA 1CZOA 1Y5IA 3CKYA 3UFXA 2Q3LA 2P90A 4U5XA 3EF3A 2GKOA 4ZV4A 1QG0A 4ZAXA 3OY2A 1LNSA 4RF4A 5B58C 3G9QA 2EZTA 4BMYA 4GMFA 2VDKB 4EA8A 3CLTC 2P5SA 1MTOA 5TJ9A 1O8CA 2FPWA 1Z07A 4NABA 4WASA 1I2CA 1FNSA 5K0TA 2AFHB 1UOPA 2H2AA 3C7JA 1B4DA 4R40A 2XDAA 1ONSA 5A2QA 5TPWA 5ERXA 3FWHA 1QU3A 1T4CB 1JLRA 1HYGA 3AFGA 3NAGA 3MPUA 5DLEA 2FG5A 4LY3A 1DB3A 1F1JA 3GROA 4LJ6A 3SNHA 4OLFA 2O6HA 4ZCIA 4XIGS 4NX2A 2W6NA 5DNCA 1HQYE 5KVSA 2EKQA 1Y8RB 2FUKA 4C4YA 3UXYA 4CLXA 4ZAFA 4JCHA 3E0XA 3L2OB 2QX7A 3FWYA 8ADHA 5CVCA 1Z9BA 3HCDA 3WFZA 3EWIA 3DNFA 1AKVA 2IEBA 2M2IA 3PGMA 4WRRA 1FLDA 3F6CA 5LXTF 4CL3A 3RHTA 4CMJA 4QWWA 4NPCA 1ECJA 4Q3KA 1N33B 2DWPA 1U0BB 2XTZA 4V38A 5HPYB 2HBRA 1DP4A 4UEQA 1Z4MA 4FGJA 1DX9A 4Z8YA 1NI5A 5TJ5E 3NVDA 5DGXA 1HX7A 3UGJA 1E63A 4AJJA 3PDIA 4IOMA 4F4HA 1MUUA 2J9RA 3R7BA 3FFAA 5EERA 3KJHA 3SZRA 1WKVA 2JIQA 5GM1A 1YB6A 5BORA 2QIPA 2ZSUA 3OY7A 4EG5A 2Q6LA 4XSHA 4C4PA 3U4QB 3M4JA 1SU4A 3ZHBA 2OQ2A 4LIPD 5EP4A 4NVRA 1N32B 4EBJA 2BAGA 3ZDQA 1JHAA 1K7CA 4FZ3A 2F2TA 3ZWOA 5F4BA 4X6XA 3OD1A 2XT6A 3PD1A 1L4FA 3GFTA 1H6DA 4RZIA 1A5TA 1CUYA 2OO5C 1M6HA 3MT0A 2BISA 5BSEA 2VR1A 4JZKA 4Q7QA 4ZCRA 3M6VA 5GOTA 5BR7A 5TT0A 2V7PA 1N6HA 1P9OA 2IXGA 2BRUA 2FPSA 2CV2A 3BL6A 4YRJA 2YVQA 4ZPXA 1LBTA 2J08A 2WSSA 4C43A 1R9MA 2IOYA 2YIMA 1EJ6A 3SC2A 1FIUA 4IF4A 4DY6A 4MI3A 1Q50A 4LC9A 1X6VA 3JD3A 2A9JA 4FXOA 2L19A 4CVNA 4LMPA 4XFKA 1NXWA 4MGHA 2PBEA 2J0EA 4ODIA 1G8KA 3T7DA 2DFPA 2VPQA 1C50A 2JAWA 2BF4A 5KCMA 2C7VA 2WRZA 1T34A 2ZVPX 3F8WA 2IXOA 1XSEA 1S5PA 5DHFA 3N76A 3UN1A 2BJWA 2XRYA 2HX1A 3K9LA 3ZHYA 3A25A 2ZSHA 4OL0A 3IMGA 3G4ZA 3HKCA 4GMDA 1PQ4A 3P0IA 1RRCA 3QVGA 4OIOF 3CTMA 4M9SA 2H92A 3RARA 3OZXA 1VPTA 1PZGA 1NUUA 1BVRA 3DL4A 5TQ2B 3LVBA 1MO3A 5AK5A 1I7DA 5CW1A 5LJLA 4PANA 2VSOA 3GG2A 3DEJA 4Y2GA 1I2BA 2P7HA 1XPJA 4BNDA 4LJ8A 4A03A 2BFNA 2Q5QA 5LOVA 4C4XA 2G9NA 1W88A 4J4TA 3D8SA 3ZCVA 1YTLA 2B21A 4KQ2A 2CZGA 2GCNA 3GJZA 3JD0A 4HQKA 4YR9A 4XGNA 4Q9HA 2FHSA 3FA2A 4UNSA 3TOZA 3IX7A 5CG1A 1TLTA 4RTQA 2WSYB 3WYAA 4X93A 3PRKE 1UXHA 1YR7A 3TL6A 1Z2AA 3OO1A 5FBQB 2Q5FA 2P1RA 4RQUA 2QTGA 5KKCA 1QP0A 2ATEA 1FYFA 4E7SA 2YV4A 2XM4A 1LNZA 3ZJVA 2X15A 3SFTA 4BV2A 2RCYA 4K9NA 1XLUA 1TKCA 3UW3A 4MCAA 1KY2A 4CGYA 2Z9DA 2OY0A 5IM4F 4ULVA 3CT6A 3CW8X 3VH2A 4YQEA 4BEMJ 1XVAA 3ERCA 5BVHA 1EFPB 2QQ5A 4P93A 3ROFA 2ZATA 4TKVB 5K01A 4WLVA 1OX4A 2QSYA 1MZVA 4REQA 4HADA 3SBDA 3DE5X 4NEHB 3JWIA 3LDGA 1GGQA 1H9CA 2CDAA 4PLHA 3OIVA 3FPLA 1VLVA 3EDMA 3NDBB 3GEDA 3TOMA 1U7DA 5IBCA 2FE4A 1JWLA 2E0IA 5IC6A 3PCXA 2CDBA 2EZ8A 4HUQA 2C5GA 3T06B 7MDHA 4BCBA 3NDJA 1OIVA 3SI7A 3PFKA 4JQOA 2HPAA 1W75A 3IFSA 2IXDA 3IODA 1DTWB 2PMBA 3L4JA 3G50A 3BZUA 3ISTA 1G6OA 2DPYA 1XPUA 1TWHA 4BPRA 2C5BA 3PNLA 2GXQA 2P62A 2JEYA 1AKMA 4OPMA 3O38A 2J48A 1G8PA 3GLGA 1YB5A 5ITVA 2X1MA 3TMKA 4G0XA 2C98A 4U7GA 2CLLB 1OCRC 4KJXA 1XQWA 2ZP1A 5LBIA 2Y9PB 3KQHA 4B35A 5CA0B 3S8YA 2IHUA 3BXHA 2AN1A 1XTQA 4PFJA 4JT9A 5IZCC 1P7CA 4M7PA 2QNRA 2VUSA 4ER0A 3P0HA 1LNQA 4MULA 2ZJ8A 3S1SA 3KG2A 5TRTA 1E59A 1YBAA 2HMSA 5LU8A 2VTDA 5E9QA 3TS1A 1OXSC 2QK4A 4JJIA 1I2MA 1LV8A 4XVUA 1NRXA 2QRHA 2HK7A 1M6VA 3SHTA 3MYIA 2O1WA 1C7RA 1I1OA 1OIXA 4KIFA 3WX0A 4DJEC 3PRJA 4CM6A 1XYGA 1TGVA 4FMCB 1FSSA 1FQWA 1FLAA 2IH4A 2VT6A 1VLJA 1Y80A 4F6LA 2GZRA 1OX6A 3QUTA 2DE0X 3BTOA 3O26A 2Z09A 4X1KB 3L6DA 3FFXA 4G4IA 1ZHTA 5T3TA 1X0XA 2A9VA 3ROMA 2KQ9A 2FN4A 3AYXB 3N5KA 2ZIXB 1Z39A 3QZUA 2PUVA 2GBCA 2Y1CA 4RACA 4Y0NA 2ORWA 4FGLA 3HFGA 1KNXA 3G9TA 4RHCA 1EX9A 4RY8A 2G3VA 1E9VA 4KH1A 3NBKA 2BEUB 3JU3A 3QY0A 1IMOA 5KREA 3L49A 3QJ5A 4WZBA 2Q6VA 2QRVB 3HLYA 2HSDA 2VA8A 4JI6B 2HK6A 4I4IA 5JPCA 4EHFA 1ZJ4A 2J3MA 1T9ZA 3OETA 1EGAA 5JCJD 1XDGA 1J1IA 1AVTA 3O55A 3OJFA 1NF8A 4CEHA 3U1BA 3OA0A 4OHUA 1NBWB 3A9CA 1GQOA 3IQTA 4JASB 1V96A 4IYJA 1XZIA 4U63A 2E9SA 4CZ2A 4J6EA 3CRRA 1G8FA 2WF5A 2FW1A 1C9MA 1S7CA 5L53A 4N9WA 2W83A 2MT9A 4Z7JA 1BXGB 3KAKA 1QBGA 1TWAA 3EE6A 3IQIX 3WGKA 5HKKD 3X1ZA 5IHXA 3SDZA 1GZUA 4R1NA 1XMOB 2RGGA 4U6QA 3BT7A 4D4HA 4XWGA 4OQDA 3UJCA 1EE2A 3I1IA 3SSOA 5IEBA 3ASNC 3CNLA 2QVLA 1TIPA 2CUKA 3ZD9A 1OWOA 1JMVA 2FSFA 2BGWA 3LFTA 1X1BA 1E61A 2MSNA 1HXHA 4EPVA 4JROA 3EXHC 2GBGA 4WGFA 3EZ6A 1Y4SA 2O0KA 3ACBA 3NIDB 1TL7C 3AR4A 1UQUA 5FBRB 521PA 1KS2A 1VDZA 4ZOEA 2MSDB 2L6FA 5E3HA 4DGSA 3V8PA 2AE1A 2NT3A 1DQSA 1ML4A 3A31A 4P1ZA 3JV7A 3JPWA 5G0WA 1XZLA 2PQMA 5IJXA 3ZJYA 2C5LA 2Q6TA 3M3HA 3RU3A 4BVHA 1ULHA 5HBRA 1NE7A 5EPUA 1R4TA 4GYJA 2FGJA 2YS6A 1G5ZA 4JYBA 1Q0QA 2CL6X 5LUBA 2E4YA 3LIIA 3PGLA 1CF2O 3VSCA 3GJRA 5F51A 4DLAA 1O0CA 3LLMA 5J2TA 1FFSA 2FSSA 3G5MA 1I4WA 1P4SA 4QASA 2VZEA 2HJ9A 1O6FA 3LVFO 3DC2A 3FBWA 3T15A 2R1VA 4QYMA 3U3OA 3UF0A 3MTJA 4RCVA 4E1BA 5LZ7A 4A0GA 1MOZA 3RTDA 1YE3A 4X7PA 3HU2A 1T5SA 3TSAA 4F2GA 1CIPA 3MMXA 4CJGA 3IJ5A 1A7VA 3TNJA 1A04A 4P7KA 1ADGA 3UFBA 5D86A 2A1UA 4EUHA 3HUUA 1IZ7A 3Q15C 5KYXA 2WB7A 3ZGVA 5BV2P 3OZBA 4D9KA 1SHJA 1AKYA 5EHIA 2EFGA 1XLTC 2WT4A 4BLPA 4D99A 5B1YA 3DZ8A 2W6QA 3BG5A 4FCVA 2RKBA 3K53A 2C84A 2BP7B 2AZDA 3L7YA 2QUAA 5DMXA 5BSHA 1MCZA 3NUZA 1AA9A 4FSDA 1C81A 1NSYA 3MNFA 3PHHA 4YJGA 5ADUS 1ST3A 3JQ7A 2UZAA 1LRJA 3A2LA 4B31A 1QO0D 4RNCA 2PUCA 1UT8A 4O6YA 3T8YA 4UTPA 4LWQA 3Q9NA 4PG8A 3V2UA 3BRJA 3F3MA 4BNZA 2C95A 2VDRB 4GOXA 3F2VA 4AY6A 2LGJA 1XZDA 2W8BA 3M9XA 1N0UA 2XLBA 3QVOA 4A82A 1ZI6A 3H83A 2D1RA 4UHJA 1UODA 2Y1EA 3QNUA 1ZJ6A 1MHPA 4E21A 2OOSA 4QNMA 3VNSA 1DAPA 5H4GA 4RQAA 5LMNB 2QF7A 1EFCA 2JGRA 1CHNA 4DMFA 4WIAA 1O08A 1FDUA 4LXGA 4AO7A 3ZOZA 3TOCA 4PBSA 2OL4A 5G40A 3IIEA 2W2PA 1YJAA 2G0NA 1KSJA 3CRVA 3FOBA 3CZCA 4IHJB 1RMQA 4DA0A 1XU7A 4N03A 1T1JA 3OP1A 3OWHA 2H9YA 1EINA 1BWRA 2WK1A 1SYQA 4IGAA 2W22A 3TTYA 4U7PB 4U7JA 5GVSA 1LQUA 2R3SA 3V48A 1CUDA 2QYOA 4H15A 4WD3A 4C6TA 2ZE8A 1YFJA 2YY5A 1ZH4A 3H5AA 1U7OA 1QAMA 3CEPB 3SJBA 1WOLA 3W5BA 2ECFA 4ZEXA 4LXXA 3EDRA 3HJNA 2XOKA 2X0RA 1SQ5A 3T3PB 1ACMA 4M0PA 1EK1A 621PA 3H2HA 1FTSA 5L0JA 4ISCA 3CEXA 4ZV7A 1Q5PA 3GIDA 5EVJA 5KOJB 1G66A 1ORTA 2WSIA 5JUAA 2CHGA 1NF9A 3SSNA 4GH5A 5A6SB 4TZ6A 2DECA 4RULA 4MGYR 4D3FA 5DCWA 4CIDA 3NTRA 4YMVA 2QD1A 2AFVA 1RFGE 3DFIA 3ELYA 4GZ3A 1NMEA 2QG9A 4IDGA 3EMDA 2QRZA 4KC0A 3DCJA 2C2GA 2B8TA 2BCJQ 2I3AA 1LPSA 1TCCA 3N0WA 4L8GA 4JNKA 3LHIA 4WH0A 1R16A 4CKEB 5L4SA 2B92A 3FTCA 1Y6RA 1IATA 2BC9A 4H7PA 4NYJQ 1WXWA 3MBKA 1XRNA 5CCXA 1KA9H 4O63O 3IKVA 2JFWA 1RXQA 3JQFC 3LQRA 2A9OA 3MD0A 1YBHA 2Q3HA 1QDLB 1WLSA 2X76A 2RHLA 4F71A 5FWDA 1M54A 1NW8A 2WZDA 4NYIQ 3DBRA 4ZAZA 1NW7A 1U28A 5JW6A 1CC1S 1G8GA 1VLZA 1XA3A 1T0IA 2A5JA 1R1DA 1QIGA 3M79A 4AYWA 3FPSA 1OF1A 1ATZA 4QYWA 3NPMA 3A6JA 4A16A 2WJZB 4MITA 3JQ9A 2UU9B 1Q7BA 2FF7A 5IC5A 5DNYB 2PRIA 4M9RA 2NVUB 1VTKA 4MKHA 3KB1A 4M99A 4R31A 3WR5A 1BE6A 4C0KA 2JX0A 1OIWA 3E70C 1FK8A 4NI5A 1MHTA 4MI6A 4U2DA 1E1QD 4ZGGA 1NM5C 2NPIA 2E6UX 1SM4A 4Y6OA 4MUGA 4LNHA 1R0ZA 5ECWA 1I2AA 2VTEA 3WOHA 4HE8D 5KTPA 4BO6A 4QNNA 5DISB 3S7TA 4HQ6A 5IRCD 4JUBA 5B57C 1T5IA 2Z6UA 4C21A 4JD5A 4OI1A 1SH7A 2VDNB 2GPTA 2QAGA 4GRAA 3IA2A 3NRCA 1HDYA 3VH4A 2XNDA 1W2HA 5E3IA 1SQ0A 3FX2A 3CISA 4HNUA 3HMQA 3D8RA 4JLKA 2JFXA 2Q8QA 4Q3OA 4TLDA 2NGRA 3GJ0A 3CX4A 5JAOA 5BR1A 4JBYA 2PLRA 4YLGA 1L5GB 1GVNB 2F4NA 2MSEB 4Y6RA 5A5EA 1WXHA 1OU0A 3E7FA 3IBYA 9LDBA 4CV2A 1Y5NA 3NGMA 4B4KA 2L18A 4XPZA 1C41A 1H69A 2AS0A 3CT4A 3N2IA 4MQFB 1R5JA 4KE9A 3EBLA 2DBZA 3I2JA 3U3RA 4OHXA 4KDRA 2A9PA 1Z88A 4BZXA 4N39A 4L08A 4EKIA 1UKVY 1M34E 1STOA 1SIBE 4XH9B 1H3FA 3KXDA 4LFAB 3ZLTA 3L8EA 2IXFA 2A5LA 4LE2A 8MHTA 3QI7A 3ZHTA 1Q3HA 4JBWA 1EX1A 4MUHA 4RVCA 4E0BA 3DAOA 1TE2A 3A1FA 4AMGA 3DM5A 4HN2A 4EJSA 1U98A 3PLAE 2FFHA 2OORA 2J4CA 2G80A 3THWA 2EYUA 4ZI7A 2NSGA 2RHRA 3SHWA 1X7XA 3EFOA 4D3XA 1E5XA 1QGZA 1PVVA 2XQGA 2AL7A 4QWMA 4RMHA 1WDTA 5KYTA 1ISRA 4ER3A 3PP8A 5FTNA 2Z1NA 3HCBA 4MUFA 1IBLB 3JWPA 1G5PA 5IAOA 4CKBA 4P8RA 4RUKA 2ASVA 2VK4A 4IXWA 2VC9A 4UHEA 1ZVMA 3DOUA 2GFIA 3OBIA 3PDHA 4NBVA 1KYQA 2OSBA 4IGGA 1ZM9A 4LCBA 2GK3A 2WLTA 5A04A 2HV6A 4X45A 3IBGA 3PRYA 1ECPA 4CKCA 2ZUBA 4NQRA 3EASA 3W1VA 1PG5A 3WV5A 4EY4A 2ZYSA 3GAMA 3IBSA 3MTGA 1QAOA 1QP4A 1QOZA 4UBIA 3RT7A 2R68A 1LSSA 5B64A 4IZ6A 5AW5A 2GZAA 5FUYA 5K0EA 5GMOA 4KO8A 5G4KB 2G06A 3DZGA 1OH7A 2YFQA 3AJRA 3I6MA 2R1TB 1GFZA 4JURI 3KC2A 1F0PA 2DMRA 3L4BA 3Q3CA 4TM7A 1CIVA 2IEGA 1P6UA 4AKGA 3OIYA 1OLXB 1VG0B 1RI2A 3TPCA 1PVOA 1P7WA 2Y05A 4QG7A 3WNZA 4YT8A 2F67A 1W35A 1T3ZA 1ZO8A 1DIGA 2PMWB 1UBNA 3HPQA 1Z4IA 2H17A 1OSNA 3D6AA 1L4EA 4L5JA 1YR2A 2COKA 9MHTA 4HPWA 5KVCA 2PSHA 2TMKA 2WZBA 2ZOSA 2IBMA 4CM9A 2FPIB 4BZZA 3GT4A 1UMBA 3AVXA 5C1DA 3DMPA 4N01A 3NEJA 2FUNB 4BQEA 2ZJAA 3AQCA 3FCEA 5JT4A 2GCPA 3BD8A 3KX2A 3RFYA 3VSAA 2GJ8A 2F8SA 5I9IA 2H59A 2BGTA 3AR5A 5JD6A 2YWDA 4OG2A 4WNAB 3VKWA 4RQTA 1NVGA 3QFSA 5LKAA 4YTEA 2B1JA 4LOAA 3UWDA 3E3OA 4CV3A 1UBKS 3MS7A 1GZSA 4UPDA 3U1VA 3FD8A 4P3OA 4AIIA 2BGMA 2YW9A 2J9ZB 4HMPA 2J0UA 2O0JA 3K8OE 3N2KB 5DTMA 1R6BX 2ETXA 4KITB 4HOYA 2WJWA 3T54A 3NS7A 4AS3A 1DQRA 5F7OA 2WWYA 1O6GA 2AA3A 2JJ2D 1PZXA 4JYCA 1HQCA 2HRZA 3FRJA 2R6FA 3PK0A 1KO7A 4EHKA 2ZK7A 5EFZA 2MJLA 2H7BA 2OLJA 4CF3A 1X1CA 3PZRA 2C5SA 4UPEA 1N5RA 1TEZA 4DDUA 4FHCA 3L4SO 2HK8A 2JCVA 5JHHB 3GLTA 4GX5A 4HO1X 3SOZA 1E2EA 4JZYA 4G97A 3L6OO 3A9RA 1V47A 4MHOA 3EGWA 2B4KA 5AVWA 3HWWA 3PU6A 3ELWA 1P5HA 4D8WA 1V5FA 3CO0S 3MTDA 4PZDA 1VJTA 3OFJA 5CCDA 4ND4A 1SG9A 1MOPA 1QORA 3IOCA 4D8VA 1TMKA 2OCIA 1VMKA 1Z74A 1UJ2A 3K0FB 3DS8A 4PPGA 4NOMA 3PBKA 3ODGA 2AOTA 3H1TA 3LXXA 3DW3X 2UZ0A 1Z5OA 1ZXLA 4EGCB 1A9RA 5D87A 1MGOA 1RQRA 1MV5A 2ACKA 1IOWA 1UBMS 5ALMA 3DLHA 3SJAA 1KIMA 4I5EA 3BWBA 1H3NA 3H4MA 1R5ID 1VBNA 5EL0A 2Q3EA 4J6FA 3IPYA 3S68A 1ACLA 2BH2A 3LWDA 4M38A 1HYEA 1AO0A 2QRPA 3AGUA 2IUYA 4HYTA 5E1DA 4C01A 3OTOB 4X71A 5EY5B 2LRHA 2JLQA 4KYTA 2YOGA 3G49A 3ICCA 1ZDMA 3N0VA 5TIIA 4OIPF 1KC3A 4BNIA 4YAIA 5DOVA 1GG8A 2J7PA 3QBJA 3AOEA 3HNKA 4WERA 3LDFA 2CNDA 3GP8A 2FU5C 3L92A 3TL3A 1SBQA 2PJRA 4DUZB 4ACBA 1M2KA 3KTDA 3FUCA 4HMQA 1U7PA 2BGJA 1SVKA 3HXTA 1G7TA 5F4ZA 4RZ2A 4UCFA 1DL5A 1PWZA 2B1QA 3GRYA 3RFVA 3GLIE 4JCZA 1N25A 2E4WA 3LLVA 4BC1A 2J87A 2AG5A 5ALWA 2QI9C 4O2BB 2L82A 3SNKA 2DHQA 4IWXA 1Y34E 3GD5A 4CDNA 4UBLA 1WATA 2YKZA 4LA4A 2CK3A 4PGHA 4BCCA 2EPMX 2REBA 4D9EA 3D4IA 2I76A 3K6JA 3AU9A 3GPIA 3WKDA 1WDKA 1YQDA 3EXEA 4WW0A 2V7QD 1E5VA 2QW1A 1P7ZA 1EJ2A 2II6A 3O8BA 3JARB 3ZW7A 3PNSA 4NRDA 3L93A 5LFAA 4M4SA 1CUCA 1TRHA 2X86A 4AB1A 4N8EA 1W48A 2WFLA 4L5IA 2X0CA 3TFQA 1CS0B 2EVWX 1RJ9A 4RTKA 3P4UA 1TZCA 2I8LA 2NO4A 2I1LA 4KLZA 3MBIA 4GX1A 2YN0A 1GU7A 4FCCA 3JASB 2DSTA 3QSYA 2AKEA 5JMOA 2HKIA 3LECA 3SYNA 4ZI5A 2UVDA 1GUDA 4YMSA 2GHTA 3ZXXA 2O54A 4RPLA 3JD4A 1W2GA 3SFVA 4N7JA 4B9AA 4LWPA 1RAFA 1JVSA 1NDQA 4IJQA 1TM1E 1CJUC 5CLIA 2BBTA 4MAMA 4YC7A 2A0UA 1J00A 3WLMA 1O8BA 4YJHB 4J9VA 3KEFA 4JVNA 1SOVA 4IDCA 4YUZA 5L6LB 1V43A 3NVAA 2EKDA 2VF8A 3NKEA 1IG3A 4YPFA 4QARA 5JUWA 4ZVQA 4L75A 4ZTBA 4QBKA 4DRHB 3QE9Y 2Y9MB 1GTJ1 3P9SA 4U9HS 4YAGA 3OMXA 4X3OA 2JPDA 5JEEA 4F85A 1DIAA 4ZGBA 3PCVA 4EX7A 3Q8MA 3DEZA 3N2GA 1JR6A 1ZWLA 2VH3A 2GLUA 1RZ3A 1Q0DA 3BULA 3PEFA 1S7ZA 1WDLA 3ZXYA 2YQ5A 2H1FA 4MPRA 4F3RA 1U8AA 3RKUA 4IO1A 3MMSA 4AYTA 3CNQS 3VQTA 2Z8YA 1BROA 6NULA 1NULA 2OHJA 1W76A 2P2NA 3EW7A 1BQ3A 3KAQA 1OT3A 3ESDA 3K4PA 4HF7A 3AHJA 3ER6A 2J09A 4Z0PA 2XYRA 2PIAA 2VL7A 4DA4A 1W1WA 1WETA 1TVEA 3WGMA 5KU1A 1CVRA 4Q9JA 4CMIA 4PO8A 4Q3AA 1JTEA 4KQIA 3TBFA 3ZKWA 3BHMA 2QT1A 4ND3A 1ADFA 3KSAC 1BMTA 3LCRA 2A35A 4YYZA 3TLBA 4ZQFA 3MJDA 2XNKA 1WB4A 5ECYA 2CE2X 4BS9A 5B6IA 2W0MA 3STWA 1C1HA 3ETLA 3QX7A 1FP7A 2OZLB 3QPVA 3N8DA 3FZQA 3G2IA 3E8MA 3NT5A 1DHRA 2EX1A 3ABLC 4JMLA 2O2SA 2HMZA 4WFIA 3RUCA 1PCXA 2IHBA 4M22A 2GA0A 4MHSA 4WLOA 4KL8S 5KDOA 4TTQA 3LNMB 4DLSA 2Z8XA 1DG9A 4DXDA 1EQ2A 4RVGA 2HQRA 3N3BC 1XJWA 1DDOA 5DBFA 4DSNA 2FPPA 1NVBA 2VCBA 4BRZA 1HEUA 3NRHA 3KUXA 5LN1A 1ZCBA 3PUYA 4IZIA 4MWZA 3SIPA 5EYPB 5IDWA 4D4XA 1CB7A 2ABWA 1NVDA 3GMSA 2BTOA 1Z2CA 1D0VA 5L3VA 4W8OA 1N5OX 2QLFA 5AFSA 3X2FA 2BMDA 3AMVA 4AVYA 1Y9JA 4RYLA 1VZ2A 4DEYA 3WZ2A 3ED5A 1P0PA 3LHSA 2GEFA 2OUIA 4QQFA 2IX3A 3N8KA 1LLUA 5EE9A 2YLDA 4B7CA 3NWPA 1PWXA 3T9BA 3VJRA 4HEHA 2J4DA 1OHHD 3COZA 4R2KA 4MUMA 1L7OA 2PWPA 5JE8A 2PYDA 2VNIA 2DQ4A 2A94A 3H19A 3KYBA 1E3WB 1NVXQ 3BWXA 4UNIA 1D2HA 2XRFA 4U5BE 4V3BA 3HCRA 2VRWA 4UBMA 3TUJC 3AIIA 4L57A 2ZE6A 5EJEA 2IODA 3ZWMA 4U5QA 2WOOA 2NO7A 4HYYA 3AL3A 4H6VA 2JFGA 1TEHA 3N24A 3AIOA 1TYEB 4YIHA 1LA2A 4Q18A 2QSZA 3PL5A 3SWWA 3SQNA 2YQ4A 2RK4A 4DF3A 1J90A 5CLGA 1GS9A 5C8YB 5JALA 2IUEA 2AXNA 1BFDA 1RACA 2J0VA 1NNUA 1Z28A 1GXSB 2VTBB 2H18A 3B52X 5JSZA 3GLHE 4YAUA 5HF8A 6CHYA 5A4JA 1L8XA 1VHJA 3MJCA 4A2WA 2QVBA 1G5HA 1AS0A 4FSHA 2VP6A 1WZNA 2QE7D 2CNBA 1B0AA 4XCQA 3FAZA 1JG6A 2PUWA 4I55A 2AHRA 4JWKA 3IEVA 3T9OA 1Q1BA 4DCCA 1P1HA 2ETSA 2H4YA 4L0QA 2OA0A 2DBYA 1OX5A 4F3CA 1DNPA 4RDXA 3LPNA 1YCFA 2PUGA 2ID9A 4C0BA 4D5GA 4EFDA 4IIVA 1WCXA 3NYRA 2OB2A 2H4JA 4G0UA 3NOOA 2O9XA 1RWVA 1U81A 2AOUA 4ZRDA 5FO1A 3CNOA 4I1OB 3A1TA 4AF8A 4ZI2A 1ORVA 1GU0A 4R1QA 1XWIA 4G86A 3AUKA 2IPXA 4UFOA 1Z34A 5B1BC 2N0SA 3KD3A 1NBBA 5E6RA 2IYPA 1WXFA 4KBGA 2F43B 4NC3A 1UZAA 4A4DA 3OOHA 3RYHA 1Y8QA 3RS9A 3CZPA 3O75A 2A0BA 4IIJF 3N1UA 3OLXA 2C4KA 4JJ4A 1V95A 5DBEX 1OFUX 3VJLA 2DRIA 4PZPA 3ZX5A 1Z2OX 2RHWA 5K0BA 3BCHA 3JYNA 3N5CA 3OM8A 4TKUA 5M3BA 1SJ9A 2VN8A 2Y2UA 3L01A 1R6XA 5CVEA 1B2LA 2N3ZA 3FPCA 4HDOB 1G9TA 2BVNA 2ONZA 5EQFA 4J43A 2FJ0A 5DF1A 3BCSA 2BPOA 4FQ5A 1LI5A 1Y7HA 3JALA 4FYXA 1HR0B 2BC5A 4XRGA 1FEZA 2XMQA 4MIOA 3CUTA 3UGTA 3NO4A 3JQGB 4L3OA 3QPWA 3TLAA 1VLQA 3D5EA 2CLFB 2VH5R 2NUAB 1YFLA 1IY2A 4G37A 2AXEA 4KSCA 4ADSG 5BURA 4CRWB 2QM8A 2XTAA 4OHOA 4TLBA 4BLSA 1V6SA 2DR3A 3BAFA 3K8YA 3PQ4A 4BO7A 4E7OA 1O3YA 3ZN2A 4BAGA 2HJMA 4HV4A 2QL6A 1IOZA 5CNIA 2OC4A 1VL8A 1FTYA 1SXHA 4QUHA 3K0EA 1AZWA 5F1OA 4DNPA 5TQ0B 2VKQA 3E9RA 3EGDB 1MH9A 4WESB 1QCDA 2JFZA 4QJ4A 4X1IA 3GMDA 2OT3B 4UULA 4IV8A 1XJ0A 2BN4A 3DLCA 4PM4A 3SZ3A 4BCDA 4AL4A 3MGAA 2ADFA 3H8SA 4XGIA 4YT5A 3AZQA 2JVKA 1U2RA 3Q72A 4MTOA 1V3QE 3RK1A 3SE7A 4B3XA 4E5NA 4F6CA 1KEZA 1FTGA 1FTWA 1NL3A 1YTUA 4MW3A 3LC2O 1FB5A 1EFVB 4EYKA 2GO7A 3FLMA 3OT1A 4UEOA 3FOAA 1L5VA 4DYDA 1QFJA 2EJWA 5L7WA 3GPDG 2IY8A 4XPYA 2BZ1A 4BFUA 2C4NA 1FP4B 2ZAMA 3HLZA 1DJPA 1CPRA 1TFUA 2V5VA 3WB2A 2XWBF 3Q3IA 1ZMOA 5A4AA 5CYPA 3I4CA 4X44A 4K9PA 5DU2A 1SWWA 1KAMA 1AS3A 5IKOA 3A6HA 2ZJZA 3M82A 1TCAA 2PR7A 3OQVA 4PHFA 4LJ9A 1VG9B 5IW8A 4D0RA 3BXEA 2BR4A 1KP9A 4MS3B 4CDGA 1YSCA 4HX9A 1G3QA 4ED9A 2C99A 3QFFA 4HZUA 2EEPA 2I2AA 3PXXA 3WC4A 1TPZA 1A41A 3I5YA 1SC6A 1QS0B 3TZEA 3MCVA 4YRNA 4BP1A 3RT1A 4D43A 1MMDA 1XU4A 3FMFA 1QIFA 2BL4A 1I7PA 4HDKA 4LK2A 2XS8A 2QRLA 2IIPA 4BB9A 4WMLA 2ZRKA 1E84A 3QUCA 3C62A 3DDHA 5JECA 3RJ5A 4HFJA 1SVMA 4LSZA 2GF2A 2FR8C 2Q4OA 2V6FA 3JQDA 2YW2A 2VCAA 1QNFA 2MYUA 4NZOA 1I36A 2B94A 4YJKA 3ILVA 1QLEC 2DTEA 1XUOA 4NZNA 1RKVA 1U9IA 1AKUA 3KSMA 2A58A 1MT0A 2WBLC 4LHEA 5JTTA 3FNBA 3RGWS 4G5YA 4L4XA 1XZHA 5AH0A 3IUSA 3WLHA 5HKAA 2XZOA 4TV9A 3KR9A 4GPEA 3K6RA 5EIBD 1K4KA 3PVCA 3ZHCA 1SKYE 1GL6A 2PL3A 2DSNA 2YC2C 2DQYA 2H7CA 4I5FA 4CT5A 3GG9A 4O02B 3B7WA 2H2FA 1U3TA 4ESEA 4DCJA 3C1AA 1OROA 1ZVQA 1PR5A 1J56A 3DKPA 2GJKA 1T36A 2IELA 5BQ3A 4P4SB 5FA8A 4MA5A 3ZOKA 1A5BB 3KYDA 3UGQA 2FSPA 1B8VA 5T6BA 5E3AA 4F38A 4OJNA 2O3TA 1C3EA 3VGPA 3N6XA 2O8CA 4WWHA 2K4MA 4F97A 1PW7A 4DR2B 1E1YA 2A88A 1ADCA 4LJSA 3PWTA 3ND8A 4CKXA 2R7LA 3H0CA 4IVNA 3FG9A 4R9UC 4C3OB 5MGBA 4HGQA 3AW8A 4Z2AA 3TL2A 4BQOA 2FG7C 1XPOA 3P2IA 2GD2A 1BHQ1 2VBFA 4G0MA 1VPLA 1H2HA 1JFLA 2PU7A 2NO5A 3CB4A 2PRYA 4ZODA 2ZQZA 2GYVA 5CT4A 4L4UA 2UYHA 2H2HA 3MWEB 3BSSA 2OBLA 2ZQ5A 4F4JA 3JVIA 5BRJA 1M2OA 1G41A 4FFBB 1I6LA 2I7XA 4N3AA 1K63A 1JDJA 4KWEA 2YYZA 3HVHA 3MYRA 3AK4A 3QMMA 3DDOA 4ZVMA 1RLOA 4G4GA 4FFOA 1TWCA 1BCSA 4FI3C 421PA 4OAOA 4RTMA 4YJ3B 1GRNA 3RR2A 2IZ0A 4JC8A 5BSUA 3DDWA 4UVGA 3ZWQA 4LACB 1TFKB 2EL9A 3KLNA 1V5WA 2MSKA 5F76A 1OYOA 5KYWA 2D59A 1OW3B 2EKPA 4Q4AB 4DXAA 5I7EA 5BT8A 2VJQA 1B15A 3P0RA 3SOPA 3QIAA 1L0BA 4UM7A 4MJXA 4D9FA 3DOCA 5HZMA 2G1UA 4KREA 1BS9A 1AT1A 1TJPB 3MTIA 4X64B 1OI4A 2YRWA 2CB0A 2D4UA 1IPHA 3O3MB 3KOOA 4CQJA 5IDYA 4OQPA 3KR2A 1AG9A 3ET4A 1UL1X 1VBFA 3UB2A 3OUTA 3HR8A 4OYRA 3PFFA 1K7XB 3SIXA 1KO8A 3S28A 4CQMD 2C04A 1F6DA 1YJCA 3EA0A 3HNRA 1BA2A 2JAXA 2AFRA 2IW3A 5FA5A 4YJDA 4B6IA 4KR3A 2C3MA 4OQYA 2AFIB 3KZCA 1JAZA 1RKUA 4L6CA 2VDVE 4Y67A 2X2PA 2Y1DA 2X5NA 2C9YA 3RE1A 3SF8A 1M2HA 3BMOB 4MQLA 1KI3A 3I9LA 5KNCH 3IOEA 4LTMA 3PFWO 3HA2A 1D2EA 5JD3A 4HDAA 4IQ0A 5LU9A 4PZAA 4M1QA 1ZYRF 4KU4A 2A6PA 4AZ3A 3QV1A 3HTKC 3ZV3A 4DMRA 4OU4A 2VYVD 1II8B 4CQLA 1BQ4A 4X95A 2XS1A 2Q8NA 3KAPA 5EWLB 3KUCA 3TUZC 1CZLA 3C0KA 1Y7LA 1ZD9A 4K9QA 1A3CA 4GS5A 4ML3A 1YC2A 4GKAA 1LS6A 2HZBA 4N3NA 3M49A 4RETA 4X85A 2GYUA 1RE0A 3V4SA 4R2IA 3DLTA 3RKSA 4S2EA 1UFBA 5EMNA 1NOIA 5JCJA 3R2PA 2Q62A 2OHGA 2W6MA 3K0CC 4EFKA 2C9DA 3C1TA 1F3LA 1A8SA 1YE8A 3MOIA 4D4KA 3SYTA 4EG4A 3R3VA 1RCFA 1YS6A 3D54D 4N41A 1DXQA 1HE2A 5JASA 1RVDA 1XLVA 2GCOB 2G6BA 3KP1A 4NYJR 1BNCA 1D07A 1QRTA 2ZU6A 5HKKA 3AKCA 3DXXA 3LBFA 1Z6GA 3CC8A 1HFEL 2Q7OE 1MJHA 4P80A 4YLEA 2WHEA 3UH1A 2E4XA 4NYIR 4Q3LA 1CQIB 1Y33E 4MCIA 3OA1A 3TZ6A 2WDPA 1U8FO 3IQCA 5TMDA 4BLVA 2M32A 1U2ZA 2LK4A 3TW0A 5CBKA 1KO1A 2IYQA 2BFPA 1RXUA 4MUXA 4LOIA 4BB5A 1M2NA 1G1MA 1HH4A 1ZK0A 4LVNA 3CLSC 4CMKA 2W4IA 2XJ9A 1L3PA 1LSJA 2I8CA 2YZSA 1F8FA 2V3WA 3GAZA 3ZHUA 4EJFA 3RVNA 1GZ3A 3SD7A 3I37X 3AERA 5JP7A 5BSRA 5CM8B 2DTDA 3EXG1 4M37A 1TVKB 5BVGB 4FJ0A 3HACA 4WCFA 4LRXA 5DBHX 3NLLA 3CS3A 1LK0A 1V9SA 4KVGA 2ZYUX 5DV9A 3TF5A 4HI0E 3IELA 2Q7XA 2X9LA 3R77A 4PLTA 3WB0A 4NS1A 3AVPA 2CT8A 4X9XA 3VV2A 3O8CA 1MU0A 3S55A 3CKLA 2XE7A 4PLVA 3OPNA 3WYFA 3IDFA 1GILA 5JI2E 4ALNA 4M1KA 4R1SA 1DT3A 4C20A 3BE5A 4KIWA 3N0RA 4YRAA 2CHFA 1CBUA 4UEWA 4BLRA 5I3ZA 5FWXB 3EG5A 5DW0A 2PT6A 1Y81A 4OIQF 1KORA 2GAIA 1WUHS 2EFDB 2EPLX 3OC0A 1CY6A 2XR1A 1ISGA 3UK6A 2W2QA 4J4BA 2OZEA 3H11A 1VI6A 3KSRA 3ETJA 3EXG2 1ONPA 4OMFG 2FWRA 1MJGM 1JKJB 1WD5A 3MBGA 3IAXA 2Z0MA 4FIZA 3IXQA 3MTBA 4WE3A 1UPTA 1WP9A 4UUAA 4U5GA 5H83A 3ZE9A 1QO0A 3FJYA 3JSEO 1EP2B 1C9DB 4H1UA 3NALA 4BJ5A 5GOZA 3C3BA 1F2DA 2VHZA 1RYMA 4ND1A 5A05A 4GNRA 1K3UB 4LISA 2EHJA 3KJEA 1HZZA 2PTHA 2VZLA 1XTIA 2FOIA 3RNOA 3JVEA 2QA5A 1DUSA 5C35A 5AVZA 1EXVA 1S89A 4KHPB 4FESA 3KHSA 1JIUA 3IULA 1TT7A 3QWAA 2ZBGA 3KB2A 2LW7A 3W5AA 4CKWB 1QCZA 4BQRA 5M34A 3I2FA 1R0BA 3ESBA 4JIMA 5BT9A 1RQ2A 3UNGC 1NXXA 1HY5A 2QUJA 5BRAA 4E07A 3H2VA 2YJGA 2C42A 4HLDA 4TMZA 3DEAA 4F5YA 4G41A 3I61A 2VPXA 3T1NA 2WE8A 2EZUA 2AG1A 3EQ9A 2DETA 3RH3A 4LV6A 4NECA 4CLOA 4F2PA 2G71A 3B3FA 4TWAA 2A0KA 1J0AA 1D0ZA 2R7WA 3RUFA 2IU0A 5CDGA 3BXXA 3B2EA 4PONA 2PKEA 3PIDA 2OCBA 4BGIA 3FVTA 4K87A 2R02A 1OZFA 1PU2A 2P9BA 2MYNA 3GRFA 4JSYA 3AF3A 2HCRA 1E4VA 3FPJA 3AFMA 1UFVA 4IS2A 3SIWA 1N2GA 3CWCA 3OQHA 1BEZA 4HFFB 3AM5A 1UM8A 4I6JA 3I2KA 2XV1A 2BKUA 3AR7A 4RY9A 1F38A 1SA0B 2XDYA 3L18A 3SHQA 1OCOC 6PFKA 3MB5A 1PYOA 1X86B 4IDPA 2OO7A 3V97A 4CTOA 3R5JA 1K5DA 5COMA 3FYHA 2OYSA 1Z0ZA 2ZE5A 1CUJA 2D4HA 3I52A 5T8KA 1VE3A 3DV0B 1XZKA 4EHBA 2EZ4A 3NAMA 1C4WA 2I6FA 5LNK6 4XI9A 4GPIB 1I3KA 2QVYX 1W0CA 1V1JA 3M1YA 3H9GA 3DZBA 1J70A 3ESAA 1O6BA 1KMIY 5C7LO 4E03A 2FCRA 4JQSA 1GZHB 3AZOA 3WHPA 1KK2A 1UBOS 1Q1ZA 1O97D 1SHUX 4PYMA 3U4AA 1OB2A 3ONWA 1AZSC 5HTKA 2EF0A 5KDLA 5IMBA 2B5VA 1YA4A 4MLDA 2C20A 4XIIA 4WVLA 2CF5A 5KTTA 1M2EA 2C2WA 4N18A 3LL4A 1JR2A 1QKRA 1KZ7B 2ISQA 2C1XA 3ECCA 2RGDA 4U5FE 3LPAA 2QSUA 2PH3A 4X8LA 1VE5A 1BH6A 1KFCB 4HATA 3QEBZ 2ZPUA 1A71A 1SZJG 1PKEA 5I5GA 2BFAA 1QZUA 1FRNA 4FOLA 1P2UA 3I4LA 2W2NA 2AQHA 4KXWA 1VE9A 5JS5A 4MWEA 4F56A 5L8VA 4EGJA 2ODEA 4UD2A 4ENWA 4LVOA 3U2LA 4U02A 3BWCA 1F06A 4TWZA 1WKCA 4CR7A 1JHXA 4QGBA 3EZFA 5FPKA 1EHCA 4KK3A 3SKYA 3WISA 4ZU3A 2CD7A 1Y1SA 3A4LA 5C81A 3EAFA 4PQEA 5A4KA 3IOBA 1X0VA 5AXDA 3VPDA 1E1QA 1UOQA 3V4RA 3BUSA 2G9VA 4FQ8A 1E8MA 3I2GA 4KXQA 5CJPA 4AMBA 1G98A 2R5NA 4EHAA 3F47A 2OCCC 4ZAGA 3I1FA 1G5FA 2CW5A 3FTFA 4XPIA 4ZHQB 5T4BA 2PKCA 3TQOA 1VYIA 1SBCA 2H63A 3RBXA 2HV9A 5E2QA 2Y6UA 1SK8A 1VKNA 3M7IA 2EG9A 3LF2A 1E0DA 5L0CA 4WXRA 1JQLB 4F4BA 1J2RA 1ODKA 3UWOA 3WGVA 4TLCA 3EW9A 3DDSA 4CF5A 3FTPA 2O05A 2UZ4A 2WD9A 1J0EA 3EXIB 4J2OA 3ICOA 4OSOA 5LM3A 1GNRA 4TV9F 4BDTA 5H68A 2X6QA 1DRUA 4L5AA 3GT0A 4X97A 2C3YA 1KERA 3T5DA 1EPUA 1GR1A 2GZMA 4GR4A 4MW7A 5HBGA 3FDFA 2YJ4A 2NUPA 2HWWA 3HQ4O 4PYRA 2XQIA 1W8DA 1D2NA 5HHTA 1TYZA 1NBOA 3FPGA 4YR7A 2VZ8A 4LZJA 1EFAA 4DRXA 1CE8B 1WCIA 5B4VA 2VHEA 1VRWA 4ZARA 3HP1A 3UUGA 2IY9A 1QQBA 5HK8A 1PJBA 4QG3A 2FWPA 2VT2A 5LOVF 4KO1S 1GARA 1XJ5A 2VTKA 4I9UA 2P65A 3A1EA 3G02A 3DV2A 3H16A 2LQGA 5JNUA 1UT6A 4KRFA 3EEYA 4QQRA 3LWBA 1J21A 1I1HA 1W49A 4FR2A 1WGWA 1YT5A 1KBOA 4IGKA 4KQXA 1FS4A 4Z0HO 3PGKA 3VYUB 4RCZA 1RQXA 1AQYA 1LWNA 2UYQA 3S3TA 3A36A 2XD9A 3DBLB 4M83A 2PWBA 1P18A 2CV1A 3K71B 1IZYA 2FUG1 1WW8A 4X6UA 4CMAA 1LF0A 2NIPA 1G8HA 1JIXA 1RYFA 2XKBA 4N40A 2AV6A 1E0AA 3FAJA 4Z4FA 1NRJB 1CFJA 3E3NA 3ZY5A 3ZWXA 1CJBA 1HKHA 5FDFA 4B47A 2JIDA 1IU9A 2Q99A 1GL3A 4HNHA 1E92A 4L7VA 1A9SA 1GFWA 3OLYA 3KT3A 4NFLA 1OASA 2R7TA 2WUGA 1X39A 1FPMA 4YK7A 4JLPA 4RCYA 1OH6A 2MYSA 5CVJA 1D1PA 3BFXA 1XDWA 5ALEA 1IB6A 4ZYYA 1I1NA 2REOA 2E4ZA 5F12A 2IU3A 1ZHYA 4CLEA 5JEDA 4KUEA 1PFQA 2J0QA 1WB5A 5TX7A 4Q7MB 3V8EA 5ARCA 4N6GA 2Z57A 3U9LA 1XROA 4ZYUA 2FI1A 4V0OA 4TMXA 3THYB 3BB3A 2A84A 5HIAA 1JMYA 2ATCA 2M64A 1QYIA 4JN6B 4RIGA 3DB1A 3FHTA 4J2HA 4QU5A 2O7RA 2O2ZA 1EM6A 3M2PA 2CVPA 3ZDEA 3FIUA 2O14A 3W2FA 2PJDA 4NENA 3KPYA 5CI8A 1U7ZA 1N6RA 2A4KA 2JFUA 3F8TA 1PWYE 4RPGA 4CPDA 3OECA 1ANKA 4CT0A 5KOIA 3PJRA 5F98A 3AF1A 1N5MA 1FL9A 3CVUA 3IB3A 4Y2JA 1Z29A 4LQDA 5EHGA 5FOVA 2IDMA 1MF7A 4CN9A 4ZCTA 5EGYA 4HB2A 5CDFA 1M7GA 4N5MA 3GLIA 5LQJA 2R25B 4US0R 1N7GA 3AGQA 1YCHA 1T0BA 1VSTA 1JEOA 3X1KA 3SZLA 4JYZA 4X63A 3C7KA 2IV2X 3NYMA 3I5UA 2C4HA 1HUQA 4V03A 3PQ8A 5AI8A 1CTQA 1S05A 5T6MA 1U2TA 1GG9A 4DN6A 2MR5A 1U5BB 5IP5A 3NNDA 3DZAA 3RB8A 5BQXA 2XUQA 3EZ7A 3SC4A 2EILC 1WOYA 4DCTA 3BHNA 2QAIA 4O4JB 2FP4A 3E8XA 4N7BA 2VDWA 4PZCA 1R37A 5JRZA 2RMKA 1I2ZA 4LJ4A 1AXRA 2NZ8A 3BJMA 1Z5GA 3ZE7A 4MTLA 1HQKA 4ETWA 4FLMA 4OK5A 3AHGA 4NV1A 4UAJA 4YVFA 1TT5B 5ER6A 4EAAA 4UE3S 3SXJA 4EI8A 2Q9AA 5CYGA 5B4TA 1M7HA 3H18A 4O6NA 4KMMA 5C8DA 3RYFA 3ZG1A 3P2KA 4U6NA 1G16A 3MINB 3L7NA 4CF6A 4PZUA 2D2XA 1NVWQ 4TMWA 1P77A 4AP6A 5C8XA 2PX0A 3KR1A 4KN9S 3IO3A 2R66A 3O5AA 1G4AE 1M1UA 3DZHA 3FHDA 2B5OA 2I6XA 4BMOB 4H31A 1S2GA 1CQJB 4BWFB 1ILEA 1E3IA 4LNUA 5DI3A 2LFFA 4CI0B 4UVEA 1QK4A 1E2UA 4ZT7A 2H0QA 2YV5A 4EELA 4KXLA 2N75A 5DNWA 5BN5A 2ZSAA 3GM3A 1N9GA 3VYRB 2LPMA 4J32B 4RD0A 3N6RA 5EE3A 5CVVA 1UAGA 4BB6A 4IJVA 3Q85A 3DO6A 4B3FX 4L2IA 1ZK2A 4PK4A 4LQLA 3N2ZB 5JARA 5H7XA 1UKZA 4JSTA 4W5RA 2YCLA 4IBOA 3ETEA 2H16A 3QWBA 3VKFA 4WJ0A 1QYCA 2YZMA 3N2LA 3R0QA 1CK4A 3HNPA 2WY2D 2RHTA 1EP9A 1QCYA 4JYPA 5EGSA 4PO1A 3UY4A 4PPNA 1H2ZA 4EGFA 1L5HB 1XI2A 5ALKA 3IKLA 4ZZ2A 1SWVA 3D3WB 5LJIA 3C8DA 5CA1B 3QKUA 4GUDA 1COWD 4BFWA 1Q95A 4BKOA 2VHJA 4BNYA 1SR8A 1DOWA 3OZRA 2RD9A 5EI5A 5J2TF 3G88A 3ZDZB 1ZJWA 3HFSA 3H0KA 2EFJA 1CU1A 2H4FA 5DULA 3R6LA 4I4NA 1I5OA 3WBKA 3E9ZA 1WASA 4DSZA 1F60A 3ZD8A 1B42A 4TWRA 2HBZA 5KC9A 1ZEJA 4RK4A 2G4VA 1MZPA 2ZJOA 5L9AA 4QAQA 4AKIA 4UFPA 4YYEA 5DGCA 3DPSA 2GESA 1TLLA 1FNTc 1R2QA 2FXVA 4ENTA 3AJ8A 1YHNA 5L4NA 2YRFA 4HEA6 5EUQB 3DEIA 4L85A 1WXQA 1P6XA 1OC4A 3DDCA 3Q6MA 1TC1A 3I5PA 2ZI4A 4FFDA 1EX6A 4DLUA 3H8JA 3CNBA 2PZBA 1D09A 1PNQA 2JDID 1M5UA 1T8WA 1VHWA 5B7PA 1T5LA 2OZVA 1KMHA 3KWJA 4AF7A 2MWQA 1ZK4A 4RKQA 3EA5A 4NL4H 4DCNA 1G4UR 2JD0A 4JYMA 5K45A 2EWVA 1EK5A 1DZ3A 5B3JA 3G89A 3RVMA 2CZCA 4U1RA 3COPA 4J1SA 4V0QA 2G5CA 3SK0A 1W0JD 2X8AA 4E2YA 4EKEA 5HE8A 3I9V6 2QTMA 1O87A 1OGIA 1XRJA 4Y2UA 1NW4A 3I9NA 2NQTA 2ZG6A 2XYPA 1K9VF 4FB5A 3IP1A 2ZUEA 3CUSA 2W9XA 1YAHA 5AM2A 3STVA 4ESVA 1YQ9A 2YDYA 2FWIA 5JYDA 3EARA 5B3LA 1QIHA 1D3AA 2JAQA 5AI4A 5ALGA 5IYZB 5CLHA 5HM8A 5CP8A 1VRVA 1ZGBA 2R8PA 1QHSA 3V6MA 4NP6A 3KAJA 1M8FA 2SICE 3HLTA 5CLQA 3BFKA 3RYLA 1ZJZA 2R7SA 2QAJA 2EDCA 4OQMA 2ICWG 2C5FA 1ICEA 3WO0A 3OJLA 2AG0A 2ORED 1GYRA 4Z3OA 1LPBB 1MDFA 3KJXA 5IKXA 4FZJA 2O07A 4G8BA 3K09A 3U4DA 2NTNA 4ABYA 2A9QA 4FQ7A 1YQUA 2A30A 2P9ZA 2H7OA 4J1TA 2Z2IA 3L0PA 1COZA 5LMCA 1QQ5A 3G7SA 3ZCQA 3QA9A 1NKVA 4F7WA 2JFFA 4UXIA 4BZQA 1W6RA 4JOBA 4Q1AA 1OA1A 2PH1A 4OGWA 1I3MA 4I6GA 2WP0A 4G9BA 4IJKA 1J0DA 4E94A 4UDVA 3GI1A 4H7EA 3OIUA 2GT1A 5KBYA 3CVVA 4CFZA 3R3ZA 3I72A 1MB4A 2WAOA 2DH6A 2BHSA 1Y5LA 1FXUA 3QX3A 4P5PA 3C41J 3KFXA 2D4AA 1PBNA 1V55C 3CKMA 1CUZA 1KAQA 5J2UB 3D4PA 4ZYWA 3FYSA 2F1KA 2FX2A 3OJCA 4CM1A 4MP6A 1KVUA 3LUPA 4AO6A 1U0EA 3KT0A 4UNRA 1DGQA 4S1VA 3KQWA 5K99A 5FYQA 3ET5A 3E18A 4XTCS 5AVQA 4EKYA 1IULA 2ODTX 4CM4B 5FUMA 1XAGA 3BXPA 2O5VA 3RREA 4CTKA 4A0FA 2AK2A 2JPUA 5GY7A 2WJ6A 3GRRA 4K6OA 4F84A 2PWAA 1NXSA 4TT8A 1S9HA 2WI8A 5HOEA 3CSDA 2APJA 2NSLA 4QATA 1U0RA 4FHFA 5I7AA 5LA6B 2I3DA 3WJAA 2OOKA 3ROQA 3F6SA 1DKNA 4HDQB 1TQ6A 3ANTA 2P67A 2Z1DA 4Q3BA 3ZGLA 2WUDA 3PC8C 3EZLA 4W8KA 2O2GA 5AVOA 4WZAB 3WJ2A 1OV4A 1ZSVA 1ZGZA 3GK3A 4KTTE 1JLLB 4W9RA 5BN4B 3KU1A 3VC2A 3VR4H 4YJ2A 2EF1A 1FFHA 3HFRA 2BTQB 2A5GA 4LSGA 2ONJA 1N5KA 1Q3KA 3QKTA 3C24A 3ZWBA 1W2WA 2BHTA 4JITA 1JFFB 4WACA 4HBZA 1OHHA 4QU0A 4JB2A 4M0MA 2X1HA 2IPMA 4C0XA 2BMWA 2ONYA 1SG0A 4IKEA 1F48A 1ZIDA 3DFZA 4UDNA 4O2AB 4KFRA 4N48A 4WKBA 3I23A 3INRA 3WL3A 4N76A 2JGAA 2OAQ1 3A6EA 3OE5A 5EESA 4HH0A 4ES6A 1SD2A 1MX1A 3OD5A 4RPKA 2UVPB 4HQFA 5FFMA 2VATA 2ID8A 4IARA 2GGSA 3SXUA 4WBNB 3TOLA 3RC3A 3BBLA 1R7RA 1LLFA 3N8IA 4BUJA 4P82A 4WKOA 4AUEA 3E61A 4GSYA 3L9WA 5REQA 2K5UA 3EODA 2GD6A 2H5LA 3QU9A 1MB9A 3ZJUA 2ACEA 3GOHA 4DWWA 4CFSA 2X1VA 2K6GA 4HLCA 3TAHA 1A4RA 2I6SA 1YLMA 1EXMA 2JGFA 2C2MA 5TGTA 4ZV9A 4PR0A 5J9FA 2QU7A 3I62A 2I7DA 4CL8A 4ER5A 2ROQA 4H17A 2A7QA 5CNKA 3FM9A 2QE7A 4R1PA 4HAUA 1TYBE 2RHJA 1FPQA 5EIOA 4JWTA 1DAGA 2HPVA 2H1IA 2I80A 1I30A 4JL8A 1A7DA 4GC9A 3VVLA 3ZWDA 4D82A 3EJWA 4CSAA 3IHKA 4DQ0A 2XODA 4C04A 3AXTA 2ECPA 4ITRC 4E2WA 1I5RA 1S1MA 3PA6A 4D4JA 2V6MA 3SJ7A 2XW6A 1HEIA 1CG6A 1W7AA 4BTEA 5SYAA 4YRKA 1W0KD 2D06A 4M1MA 4F3TA 3EG9B 3CUYA 4G09A 1EZ1A 5KNCD 2L17A 1KEPA 1XZ8A 2BE7A 2V4MA 3CY6A 4IHKA 3W8HA 4OATA 4CIHA 4KXNA 4NFYA 2O2EA 1MV8A 2NNLD 1ONNA 3IT1A 4ZI7F 3FWNA 1C9EA 1JJBA 2FEMA 3RH0A 2KK1A 1RXCA 4URVR 5KVQA 1OFIA 1EG7A 2B37A 1YASA 3ADCA 4V02A 2PZAA 2HMTA 4KYIB 5B6PA 4U2FA 3JPYA 1Z7Qc 4HFKB 1OR3A 1DRWA 3UA3A 5LQAA 1XN4A 3C85A 3MCTA 4WECA 4NYMQ 2IZZA 3AG3C 1FXSA 3Q3VA 3GGPA 1KE1A 4AFNA 3T5TA 2D2EA 1JEEA 3CX8A 3RK0A 1T8PA 3GPLA 1H9GA 3KDSE 4DW8A 5SYNA 1B0PA 1Y82A 1RW4A 5IPFA 4I3GA 1UIMA 5IT5A 1YBFA 2HHAA 1Y8AA 3B5IA 2NAPA 5DO9A 4WEQA 4A26A 1DIRA 4MVCA 3VR0A 1UIRA 2KI5A 3C97A 3WLTA 3QNWA 1EBFA 5JPIA 2GZSA 2VJOA 4CLDA 3FWPA 1UG7A 3GX1A 4YRRA 5F9MA 2A9KA 3J80A 3LF1A 1R18A 3G23A 2PXHA 5EWMB 3X1OA 3RADC 1N4DA 3QTHA 1BKSB 3ITNA 2H7YA 4FFRA 4EHIA 3ABKC 1MFPA 2RIRA 4V0LA 3SHVA 4JR2A 2X0FA 2SKEA 3R75A 2DVMA 4PXSA 1YKGA 3C3MA 2Q9CA 5B7QA 2QT9A 3CLUD 3HGTA 3AVQA 1WW3A 1ISSA 4WNIA 1JG1A 4BU1A 2C4TA 1I3OA 3F98A 7YASA 3PPYA 4AX4A 1DBWA 2ZFUA 3KTAB 1GAXA 3SS8A 1P0IA 2W2LD 1CY2A 3TBKA 1J20A 5FLYA 4MVJH 2QVCA 1CR1A 1QONA 3AFHA 1ZNXA 2ZRGA 1GQ2A 3MSXA 3IDZA 1P2TA 5KU7A 2IFTA 5KQRA 2ZI9A 5THQA 3DHVA 1RS0A 1TW3A 2POCA 2ZW9A 1W52X 3NBZC 2NN3C 2JEZA 1MG0A 3OQNA 2HC9A 3ND5A 2XLMA 4FNGA 3L8GA 3U5SA 1MR3F 3WP0A 5AOBA 1FFXB 3BL8A 3DL7A 5IVIA 1VFNA 5MHTA 3V2GA 4R4JA 4BFCA 1NAHA 5G53C 1GCOA 2CWDA 4I1PA 1IVSA 3M33A 1LSOA 3CO5A 2OFOA 2IT1A 1GUFA 1EKXA 4FD3A 2WHXA 2VZ0A 3OZFA 4EDHA 5AVUA 3AJMA 5AD1A 2J6CA 1QGUA 2P1AA 2WKRA 1AH2A 1ZL0A 2J0XA 2VDQB 5EJ5A 1V39A 1PK7A 4NNPA 4LC0A 1BRMA 4CODB 5HQ3A 2FDRA 3CVXA 3EEIA 4YJFA 4B74A 1QZZA 4UUBA 3ZY3A 4EO4A 1MRNA 5J5AA 4QYSA 1PFWA 1NF3A 4DNFA 3IV7A 3LCUA 1T2CA 3MYYA 2CMGA 3SY8A 3W6OA 3RSCA 4Z7NB 4ZCSA 5HVNA 1HE5A 4B4UA 3D6MA 2IZ5A 5B6JA 4MA4A 2YOFA 1C14A 1UBSB 5KYUA 2CBXA 3WRYA 3TXXA 3FNFA 4O08A 4JUAA 3W8NA 2XCTB 1V0JA 2JCYA 3IEMA 1ZBDA 2X1LA 2Y68A 3PA8A 3K9WA 4UQPA 3VZSA 4XFDA 1Q1GA 4L73A 1GPJA 4BXOB 1H0SA 2F8LA 1E62A 3CUKA 3PHF2 1ESMA 3G4XA 4LXUA 1WXIA 4HWGA 4A0SA 1OCCC 3DT8A 1X77A 2RGEA 1UXKA 1JVBA 1GGJA 1UBTS 4LJ7A 2YLGA 4MVJM 2P79A 2Q5EA 3PVZA 3E1GA 3ZWYA 2EV9A 2B82A 3UJ3X 2F3RA 3CZ5A 3LPMA 2YLIA 1JR8A 3TG8A 1VKJA 2R9RB 4QBGB 2CNLA 2QMYA 2PX3A 3WLJA 4JQZA 4LFBB 5G0VA 1IN1A 5KNBH 3TNLA 1CT9A 4KXFB 5K2OA 5DIFA 2JCSA 5AJHA 3HU1A 1UOEA 2QP4A 3EIEA 1M67A 4XOIA 2R47A 3K2IA 3WHKA 2IIBA 4ZLDA 5K8LA 4A8JA 1UT5A 3O9VA 1IHDA 3QPAA 3UTCA 2AD1A 2D6FA 4MKFA 4RBNA 1S2OA 2Q0QA 3VYWA 3T0FA 2VJMB 2BFDA 3T9DA 2JIZD 2XBMA 5KWIA 2NYRA 1C1DA 1X3LA 3AUUA 5E3CA 4W7HA 1JEYA 2MSLA 4MWGA 5AJZA 3H3XA 4XZ3A 2V58A 5DWVA 4I0WB 3NG1A 2NSJA 3QEOA 1M8JA 4MEBA 4KH0A 1ZUNA 4Q5IA 1WPQA 4D6PA 3M1IA 2WFAA 2J6BA 4UHHA 4PR3A 5KSZA 2JG3A 2FSVC 3FH0A 1RWNA 3KTFA 3BD7A 1AA6A 2NYVA 1N6LA 4CHTA 4R9NA 4EY6A 5B3IA 3UMBA 4JHLA 5G1NA 1UPBA 3JXEA 1CZRA 4M7OA 3I3SR 3ELDA 3IAEA 1AHPA 1ZIYA 1GSIA 1Z22A 1QZ3A 3DXYA 5HCNA 2FZ4A 1DDIA 3TVYA 2LFDA 4UFNA 3UT5B 5LLDA 4GOOD 1Z68A 1F7VA 5FZTA 3RBAA 2A1TR 2PMKA 2QG4A 2BMAA 3OZDA 4ARBA 5LQRA 3CN9A 1TU4A 4TRJA 3ZVLA 4CQMA 4I8XA 2BCEA 1P1RA 3KYJA 4K0RA 1Y4UA 2YH2A 2QT0A 3FYCA 4QPZA 1NPTO 2GD1O 4HHEA 3WLLA 3Q5DA 5DBIA 4M6WA 4DJDC 1TTQB 1O89A 4YRLA 2RC6A 3DHNA 4L6IA 3UUFA 2CXRA 3MB8A 2RHDA 4NAHA 3DSRA 1PJAA 1L5OA 4OSEA 4UHFA 2WVQA 4OX9Y 4M86A 3UK0A 3B0UX 1VYHA 5CFRA 3PWKA 3AJEA 5AJXA 2HO5A 2HR1A 2TYSB 1GAWA 4MRMB 4DLNA 1P4JA 2VYVA 1Z4KA 1M1NB 2Y0DA 5F73A 3GQBB 4BMPB 4TUYA 2V5UA 3OAAD 1RPTA 4HXFB 4EY3A 3ZHRA 3EHDA 4J94A 1RI1A 1G3RA 3H9QA 3U3JA 3GDGA 2X42A 1WCYA 3LZDA 3GRCA 3GJTA 3K8QA 1DWQA 2RONA 1BE8A 2O8NA 3L0IA 2Y66A 3QF4B 5A06A 1KMMA 1A77A 3K1IC 3UXMA 3KKEA 4KYUA 3LYLA 3SU8A 2F3TA 2L7AA 1H4VB 4QTZA 3CINA 3UUEA 3NM4A 1VJ0A 2W4BA 2KC3A 5BNIA 3QBEA 3QQ5A 2XRHA 1LK5A 5A5VA 5JXIA 1QQ6A 4OFXA 1AU9A 4BNHA 4HKTA 1T9BA 3D64A 3VHXA 2HF9A 1DLIA 3QYJA 2JANA 2ZVQX 4UTNA 4GQAA 1CVIA 2C3OA 1JLKA 1NWCA 2PP4A 3E22A 4EPTA 2RGNA 2VK2A 3Q0IA 4OQEA 1NFQA 3CH7A 2CFCA 4XWOA 1JQEA 5KOYA 4BFXA 4HDMB 1IY0A 1C4XA 5HGJA 3V3TA 3CUUA 4KBLA 3D6HA 4CXMA 5KSOA 4H7HA 3O8QB 4HDRA 1ORHA 4OHPA 2BZ0A 2D5BA 4FW8A 4E08A 3T5AA 1CY1A 2GETA 3L3BA 1NBIA 4UQLA 1JAFA 4OB6A 2Q27A 5JZMA 2GJ9A 4YJ2F 5KQGA 3HBFA 5CB4B 3Q1LA 2PSEA 5ALVA 1EHIA 3T95A 3BZWA 1QJ4A 1KJNA 1QHEA 5CJJA 1KI1A 3BMXA 1XQXA 4AJ2A 1DV2A 3A7DA 2DT5A 1WV1A 4D4LA 3DF9A 5AI0A 3HRIA 3JQAB 1EESA 3I04M 3QIVA 1E1CA 2FRDC 2A69F 3LA6A 2JGMA 2CNKA 2QL5A 3U44B 2WA1A 3U8VA 3BXZA 4M1TA 3C6MA 4R5HA 4FLEA 1LDEA 5KNLA 4DBLE 2ECQA 4C4AA 3CX6A 1MEEA 2HXGA 2BM8A 4OB8A 3AT1A 2WTEA 4B7UA 4J0QA 3DWFA 4E09A 5EIWA 3W34A 2VF7A 1VK5A 3V7WA 3ESRA 4MUJA 3GA7A 4W8HA 2DULA 2W42A 1GPH1 1NTOA 2VT3A 3IR5A 4G0HA 3FAKA 1N9ZA 4EUEA 2GXSA 5K3FA 3KVVA 1TA0A 3NHFA 2EW2A 5E7IA 2B20A 5TC4A 1NJ5A 1V9LA 3V9PA 3FFBA 4OIRF 1QFSA 5G02A 3ENWA 5FI3A 2JAHA 1FDSA 3RVRA 4OVKA 4UEJA 4XDYA 4EPWA 4ARZB 3ZC4A 4OFWA 2GM5A 4PYOA 3PDCA 4QULA 3ISVA 1BFUA 1YZAA 4HNAB 1D04A 2NU9B 4Y98A 4WPGA 1NXTA 1ZRSA 4FS8A 4ZOLB 1XVTA 4BQPA 2I5PO 4NQZA 2VHYA 3OQBA 4R1MA 3AVOA 5MFPA 3U0CA 2E5FA 3GUUA 1MX9A 3U39A 3FROA 1N75A 2WZLA 2OAEA 2PRJA 4KIGA 4IIXA 1DRKA 3TDNA 4JGIA 1QE0A 4GQBA 1S2IA 2G0AA 2OHFA 3MGKA 5K3SA 4HAOA 4I55F 3HCAA 2Y0PA 2DR2A 4B46A 4F21A 4NZ9A 3V8BA 5AW6A 3D6NB 2OOCA 2EJCA 4JKOA 2REQA 2ZRJA 5GPBA 1NYTA 4K81B 2DB4A 3N3AC 3MWFA 5FADA 2AFHE 4DKJA 1E6LA 1F1BA 4NXMB 1HLPA 4QM6A 3MUOA 2ZKIA 4PJJA 3O4HA 2G72A 1TIBA 3PQ6A 4KNWA 3EBOA 2DQZA 2ICAA 3EYAA 2ZT8A 5HZHA 2JD2A 1ZCZA 1A4IA 5KJ1A 1TQGA 4MVRA 1DDGA 1E6UA 2ADOA 3QELA 4Y9RA 5IABA 4BX9A 2XGGA 4JX8A 2ZBDA 2RAFA 5JO9A 3VDQA 3HY6A 1HFJA 4NICA 2Q2QA 1QJCA 1IL0A 4U39A 4HWOA 5AQEA 2BBSA 2AZMA 1B00A 2R6CA 4LF5B 2BM9A 3L6UA 2FE1A 4Z9FA 1E9DA 3H1BA 1Q74A 1M2WA 2ANCA 5CR9A 1YA8A 3TM4A 3ROGA 3PVSA 1N8NA 1V4NA 2GRJA 2FY8A 1T2VA 1QMGA 2I4LA 5FOQA 4Z1OA 1K8QA 4ZXPA 4FMPA 2QLAA 3VTKA 5K0FA 2TSYB 2R2GA 3PYMA 2ODWA 1V3VA 1PG0A 3GANA 5JDIA 1V25A 1PEDA 1Y9ZA 4QQ8A 3RRYA 4MV9A 3EH2A 3R7CA 1X9GA 4W5HA 2XLDA 5DI9A 3RGGA 1KP2A 1CDEA 1U3UA 4E2XA 1NY5A 3MQ4A 1KU2A 2C3PA 1K75A 4YDRA 2XCUA 4JP3A 4B2PA 2GLXA 1NBMD 1OV6A 3MRSA 2PGOA 5EUCA 1M34A 3AVUA 3AETA 1OFVA 1X1QA 1WNTA 1GQRA 2FEPA 4BPMA 5AHRA 1FBNA 4O2RA 4L76A 4DAOA 3D8BA 1XKQA 3R3WA 2F17A 2WIGA 1QHHA 2PSSA 2VP4A 2I1WA 4RVUA 1U3WA 1OQCA 3RIGA 2QTAA 3DUFB 2C2HA 2JVIA 2QYHA 4NPHA 1W36C 2C7OA 4ZIRA 3UMVA 4BECA 2JI8A 1NAIA 3UG7A 1ZA1A 4MI1A 1L5ZA 1XTTA 1JDSA 2YMQA 3KPJA 1E6WA 3T6KA 3UATA 2HCJB 5CDUA 1SC3A 3IIKA 2GBIA 1Z08A 1NVAA 3Q3JB 4LJKA 2DYKA 4TN5A 4UC0A 3TCKA 5JAZA 2I2DA 5T4HA 2P35A 3RK4A 4RX1A 1ZOPA 5I7WA 1USGA 3WQRA 3OCZA 4HFMA 3GUVA 1BVYF 1VSVA 1G6HA 5CK4A 4K7BA 3N7UA 4BX0A 2R6GA 5B3SC 1MC4A 5KTKA 2ZUFA 3VX3A 4A36A 8GPBA 4ZVLA 5IWCA 1JYFA 8ABPA 5FPYA 2AQIA 4PAOA 2Y67A 4FMDF 2Q0HA 1ZJ5A 221PA 2YTZA 3HDYA 4FGWA 3ZZ1A 4AK9A 5JG7A 1HNZB 2Q4RA 1QRAA 4C4SA 3ECAA 5EEHA 3V4VB 2I1QA 4DLTA 1KYXA 3VPCA 2CFOA 3C7CB 4J1NA 3BBPA 3QYFA 3ZI4A 4QAJA 1JE1A 5H3CA 4E88A 5E9JA 4ZO6A 4P33A 1HF3A 2I6TA 3BD6A 1LPNA 1NRIA 1JRLA 5F5NA 5K9ZA 4ENVA 3OX3A 1M1YB 1QH1B 1QSPA 1KSHA 4H7IA 4W1RA 4YWQA 5EA2A 4D25A 1BEUB 2RB5A 4C3UA 5CYFA 2M6LA 1XP8A 4BMNA 2C59A 3RFFA 1FFWA 1O0SA 4LJAA 1XK7A 3DMYA 1MORA 4JXKA 3WLKX 3OPYI 1D2AA 3AVTA 1P5JA 3TYXA 1ADYA 2Q3MA 5K8JB 4ZN6A 1DZIA 2P3QA 4KFCA 3EH1A 1NBME 1XEXB 1ZIPA 1E58A 3O4RA 1KWGA 1VMIA 4P0PB 4UJ5A 4NJEB 3F5MA 4NAVA 3ACCA 1PUJA 3LBIA 3LCCA 1D9XA 1C8BA 1GR0A 4X61A 4GLOA 1MVOA 4V1CI 1Y3BE 2KPOA 3KLBA 2JI4A 4LHZA 3HXPA 2XLCA 3L82B 4HQOA 4XAQA 4HX2A 3VTZA 4V0NA 2YIVX 4QYIA 4ZEVA 4R2LA 4MNDA 3DHWC 2O0HA 4TS3A 2X2FA 3SM3A 3C63A 5E2AA 3M6WA 5DHRA 3UJ6A 4JB8A 4PU0A 1EGMB 4FX2A 3IUEA 3PF8A 3H8VA 4ZJZA 4EMTA 3VSBA 4Y9UA 5BW6B 1XV5A 1JT2A 3RW9A 4CQNA 1KTVA