3VAYA

Crystal structure of 2-haloacid dehalogenase from pseudomonas syringae pv. tomato dc3000
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
230
structure length
230
Chain Sequence
MIKLVTFDLDDTLWDTAPAIVGAEAALRDWLAEQAPKLGPVPVEHLWEIRSRLLDEDPSFKHRISALRRRVLFHALEDAGYDSDEAQQLADESFEVFLHGRHQVQIFPEVQPTLEILAKTFTLGVITNGNADVRRLGLADYFAFALCAEDLGIGKPDPAPFLEALRRAKVDASAAVHVGDHPSDDIAGAQQAGMRAIWYNPQGKAWDADRLPDAEIHNLSQLPEVLARWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAD-superfamily hydrolase
publication title Structure of 2-haloacid dehalogenase from Pseudomonas syringae pv. tomato DC3000
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Hydrolase
total genus 80
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1600 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3vayA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3vayA01
5ALZA 2G80A 2FEAA 3RFUA 1ZS9A 4UM7A 5AKEA 1EK2A 2R8XA 4NWIA 1YDFA 3QLEA 3DV9A 2IA5A 2G09A 2HO4A 3R09A 1RMYA 4BX2A 1WR8A 3L8GA 4MUMA 3RF6A 3QU4A 4C4TA 2HI0A 5AI9A 3B8EA 4UAUA 3FPBA 2FPUA 3ZWKA 1Z4OA 5AM4A 3UMGA 4YIKA 3EWIA 3QUQA 2WHEA 4OFZA 1TJ5A 4UATA 1SWVA 4UMDA 1LTQA 5AW4A 3R4CA 4BX3A 4G63A 4O8CA 4H1WA 1RKVA 2W4MA 4OCZA 3ZVMA 3PGVA 1QH9A 4YH1A 3ESRA 4UU0A 3ZVNA 1YJ5A 3FM9A 3FVVA 1U7PA 3WKDA 3E81A 4IFTA 5AI0A 4BYGA 5AI6A 4Y2SA 3OCWA 2B1QA 5AKZA 2YMLA 3EPRA 1RC8A 3L7YA 3QU5A 3U7GA 2ZBDA 2G08A 1S8OA 2G0AA 4CF3A 1ZRNA 3NRJA 1ZD5A 4HGPA 1RQLA 3L8EA 3OCUA 1XVIA 2ZG6A 3D6JA 1U2TA 4UMVA 1RLOA 4HGRA 4QJBA 1LVHA 5AM1A 5AM5A 4BKMA 1Z88A 3W5AA 4BNDA 3ET4A 4XQ0A 4L6AA 1NF2A 5AVQA 4Y2JA 1VJ5A 4FYPA 4Y2VA 5ALQA 4HAIA 3WGUA 1Z4QA 2OA0A 3SKXA 2JAWA 4UU1A 2DQSA 3L0CA 3KZXA 4CF4A 2VKQA 2G07A 1T9ZA 5AW8A 2YY6A 3N5KA 2ODAA 4J2TA 5A3RA 2C88A 2AMYA 4AS2A 5ALMA 1ZD2P 5AIAA 5AK5A 1U2SA 3KC2A 2ZBGA 3MN1A 3ZTWA 3BWVA 5AI5A 1RKUA 5ALJA 5AESA 4OD0A 1WZCA 3L8FA 3A1EA 5ALPA 4BBJA 4YCMA 3L1UA 2MSNA 5AKGA 2MU1A 2NO4A 2HX1A 1NRWA 3N28A 1J97A 2YMQA 3ZX4A 5AW0A 3KOOA 1FEZA 1RMQA 2GO7A 4BX0A 3NAMA 4EENA 1U02A 2JAUA 5ALFA 3TLMA 2FDRA 1N8NA 2ZXEA 1T5SA 2IOFA 3NASA 3SLRA 3QUCA 5ALTA 1IWOA 3L5KA 2ZBEA 1S2OA 3HLTA 2YJ6A 1U7OA 1Z4JA 2FUEA 4XPZA 4E88A 1L7PA 3AR2A 5AKKA 2RB5A 5ALKA 5T41A 1Z5UA 2CFTA 2D2VA 1Z4KA 4KNWA 1J8DA 4UW9A 4UM5A 2JARA 2NO5A 3NALA 2I55A 5ALDA 5E0OA 5FP0A 1QQ6A 2Q4TA 2WF9A 4IG4A 2B82A 1MH9A 5AIBA 3AR9A 5ALIA 3BA6A 3IJ5A 2IYEA 1YV9A 3AR7A 1Z4MA 3SMVA 2RARA 5ALHA 3PCTA 5AI4A 4MWOA 5AW3A 1X42A 1Z4NA 2OM6A 3E84A 3OCYA 1T5TA 1RDFA 3ZI4A 2B0CA 3EF0A 2ZOSA 3FGOA 2HF2A 1ZRMA 1ZD4A 3U7FB 5ALWA 3WKBA 3I6BA 1RLMA 5AKLA 1YMQA 1O08A 3WK9A 1RLTA 2JGAA 2GHQA 4YCLA 2G06A 3SD7A 3ZTYA 2YMMA 3N8GA 3SF0A 3IRUA 4XE5A 2BDEA 4I9GA 3L1VA 3OCXA 1TJ3A 2Q5EA 3WK4A 3U7HB 3ET5A 2I54A 3I1YA 1TJ4A 2HSZA 3ZVLA 1RMTA 5AKHA 3WKCA 4CE6A 2WM8A 3ED5A 3DDHA 4NFLA 2G1AA 3NIWA 4DW8A 2FPSA 4AS3A 4OHFA 3L0BA 3PDWA 3IB6A 3K1ZA 2IOHA 1CQZA 4KX3A 5AW9A 3FPSA 1RQNA 2WF6A 3U13A 5ALLA 2ZBFA 3HYCA 5AW5A 2O9JA 4NV0A 1Z5GA 2HOQA 2YJ3A 2OYCA 2AH5A 5AM3A 1ZOLA 3W5BA 4UMFA 2B8EA 3DAOA 3ZX5A 5ALSA 5AVSA 3QUBA 3QU7A 1YNSA 3S6JA 3ZU6A 2GMWA 4EX7A 3QU9A 3CZ4A 3DNPA 5AK4A 5ALGA 2EAUA 2JAOA 4FFDA 2YFYA 4C4RA 2W43A 2AGVA 2YN4A 3QNMA 3VAYA 2Q4RA 2YJ5A 3WKAA 2QYHA 3ESQA 2CFSA 1ZD3A 2RAVA 1L7OA 2YMPA 2R8ZA 2IOFK 3PGLA 4L57A 2EARA 4ZEXA 4KN8A 3P96A 1QQ5A 3QGMA 5AKYA 2C8KA 3GYGA 2P27A 5ALUA 3AR5A 2FPRA 5AM0A 1CR6A 3NUQA 4HGOA 1L7NA 1O03A 5ALEA 3MC1A 3SKYA 5AVXA 2WF7A 4JDPA 5AKXA 4EX6A 2P9JA 5A3QA 4PNHA 3ONNA 3AR6A 3OTQA 3KBBA 1K1EA 1L7MA 4UARA 5AW2A 1RRCA 4UAVA 4C4SA 1XPJA 4GIBA 5AVWA 5AVRA 4DCCA 2I7DA 2B8JA 1KYTA 1NNLA 3QUTA 2FPXA 2I34A 3QX7A 3R9KA 1XP5A 2C4NA 3MMZA 3WK6A 1AQ6A 2WF5A 2WF8A 3B9RA 2YBDA 3FZQA 3J7TA 4AP9A 4BEWA 4DFDA 3M9LA 5AVZA 1QQ7A 4F71A 4Y2QA 3QU2A 3WGVA 5AICA 2HHLA 4RESA 3W5CA 3EF1A 4BNDB 1VFPA 3F9RA 4JB3A 1L8OA 2C9MA 2X4DA 2AUTA 2B30A 4UASA 4ZEWA 4CNQA 3WKEA 3A1CA 4HYTA 5AK6A 3ZW7A 2C8LA 2W11A 4DWOA 4J03A 5ALVA 2CFRA 2OBBA 1WPGA 1Y8AA 4EELA 5AW1A 1SWWA 3NANA 4HGQA 5AHXA 3N07A 2I33A 4QQFA 5AVVA 4BEVA 3E8MA 2NYVA 4YIHA 2FPWA 2CN1A 3AR4A 1L8LA 1TA0A 3OPXA 5JJBA 5IT4A 3UM9A 2P11A 1Z4LA 4G9BA 5IT0A 1JUDA 3UMCA 5AI8A 4Y2PA 1PW5A 4L6CA 1F5SA 3QYPA 3WK7A 3ZUPA 5AW6A 4Y2XA 5IS2A 3U7EB 4NAVA 2QLTA 4Y2RA 3CNHA 4I9FA 2R8EA 4Y2UA 3AR3A 4EZEA 5AM2A 5AVYA 3ZWDA 3OCZA 4UMEA 3UMBA 1Q92A 5ALRA 1ZJJA 5AW7A 3AR8A 4Y3UA 2BY4A 2EATA 2PKEA 3A1DA 3B9BA 4B6JA 3W5DA 1SU4A 1RPZA 2HEGA 5A3SA 3WK5A 4GXTA 1EK1A 1WVIA 5AKJA 1Z4PX 2P69A 2GFHA 3KD3A 3QXGA 3L0YA 1Z4IA 2O2XA 2HDOA 3I28A 4RETA 2YJ4A 2FUCA 2GHTA 3U26A 1L6RA 3E58A 3U19A 1VJRA 5ALYA 3SHQA 2I6XA 4KX5A 1QYIA 2B1RA 5AVUA 3MPOA 2R8YA 2RBKA 4CF5A 3OCVA 1Q91A 3M1YA 3N1UA 5AVTA 2PR7A 4HGNA 4KYTA 4YGYA 2HCFA 1YS9A 2FI1A 3L8HA 5AK3A 4ZEVA 3A3YA 4FE3A 4YCNA 5AKIA 1N9KA 4NABA 5ALOA 4KNVA 3WK8A 4Y2TA 5ALXA 3KDPA 4Y2YA 2HF7A 5ALNA 1RKQA 2BDUA 1TE2A 4XOUA 2PQ0A 4EEKA 2WFAA 4F72A 3I76A
chains in the Genus database with same CATH superfamily
1TAUA 3UB4A 4HOYA 1VJGA 4OSOA 3TI9A 5ICSA 5LOVA 4CKYA 4I1RA 4JC8A 2D8AA 3JALA 5F77A 1H4VB 2R1VB 4EY3A 4KFCA 4UBLA 1E58A 3TKYA 1OTYA 3RWMB 2AR9A 3WO1A 4GLFA 1GFIA 1G21B 3RR2A 1SU8A 1RYYA 1YQQA 4GPEA 2H1FA 4C0JA 4DNOA 2WTMA 4QLAA 1YS2X 4NMHA 3ZEIA 3VX4A 2VPQA 4Z0HO 2Q27A 3TNYA 1FCJA 3WLFA 3R5HA 1F7VA 4MPDA 5AVQA 2DOKA 2YWDA 5CVJA 1K7FB 4G9GA 3VU8A 1W52X 3RB8A 1GTVA 4LHWA 4QI2A 1PUXA 4Q9KA 3VJKA 3QLVC 4G5SA 4W63A 3NBMA 2AG1A 3K1IC 1GADO 1Y63A 3CLTC 1VIYA 3KJZA 4PG4A 2QU7A 2I3DA 4YRCA 2P5YA 4KBLA 2V7TA 1UMKA 4M54A 4AE4B 5JZMA 2BI8A 4PC6A 4OV6B 3PPXA 4LJLA 2EFCB 1QCYA 1GDTA 1MCZA 5SYAA 3WSTA 4JDUA 2YN2A 3UT0A 4KQEA 1KA9H 3VR4H 1I3LA 3WV5A 2R8BA 3A11A 3GLIA 4RTNA 4D74A 1MU0A 4Y18A 1W49A 1XR3A 3ZBUA 5J43A 3TSWA 2H9AA 5DHAA 2RC5A 5B7NA 2DHRA 1TFKB 4X7RA 3LCRA 3MYFA 2X3YA 4TYPA 4MAMA 5CXQA 3MQ2A 4YVFA 2VJAA 1C3OB 2HGZA 2OB2A 3BXGA 4YYZA 1Y7LA 1GPAA 1TM1E 2AF4C 4NV0A 3G2JA 4NCKA 2MHCA 4R1MA 1ZOSA 1Y6DA 4KV7A 5HM8A 2ABWA 3FPKA 2OP1A 2H08A 3V1UA 5IFKA 3ABMC 4YRMA 3Q7SA 1ZYRF 4V0LA 1DELA 2PLFA 1DIRA 4GUDA 2ZM5A 1VB5A 5I7FA 2FLVA 3N6VA 1OKKA 2FK8A 1WO8A 4E2XA 2X40A 3H6KA 2VCAA 5CFOA 1EKYA 3VSDA 5EJ7A 3MGKA 5H3HA 4HC4A 1ZCAA 4LHXA 3GHYA 1RRGA 3ETJA 4ND2A 4F21A 2XRFA 4NKRA 2I4MA 3N87A 5AVWA 4NONA 1P4RA 4UTZA 5TQJA 4IDEA 5BN1A 1BRTA 4JC5A 2AL7A 1JR8A 3MAGA 2WF8A 4F5YA 4DEXA 3R0ZA 3HI6A 3WHIA 4RK7A 3EPKA 3SI7A 3SPXA 4P4UA 1A8PA 2AZXA 5ICCA 5AFSA 5EIXA 3UC5A 1UH5A 3VQTA 3ROTA 2RHDA 1O95A 4N6CA 4FBGA 3DWFA 3ENQA 2OO5C 1T9GR 1ZH4A 1FFBA 4QBIA 3MQFA 5GADl 4PHCA 3UJ7A 4EW2A 1L7DA 4R84A 3QVYA 4H6WA 4XW2A 2RCYA 1U7WA 4BNKA 4GE3A 4GT1A 1P4AA 5JO0A 3LPNA 4G0XA 4JOCA 1E5LA 3RVNA 2E9SA 2QMHA 4Y6GB 4FYMA 1CE8A 2X8AA 2MWMA 5C8XA 3KL4A 1Y89A 3H13A 3H3FA 1ZP6A 5TR9A 4CGZA 1OR8A 1UINA 1KZ6A 2WV9A 3A04A 2DQKA 5C81A 4URWR 3FPEA 1ABEA 4PK4A 3RASA 1KH2A 2VA8A 4FDVA 2ZULA 1G8YA 2GPWA 3MWYW 2ZVDA 3FF1A 2B2XA 4DQXA 3WRYC 4WE3A 2AR0A 4P33A 3MT9A 1M34A 3ICCA 3JARA 5IHXA 3ZCQA 5FORA 2AEFA 4H6VA 3J06A 1VG8A 2VHTA 3T3OA 3DPIA 3IP6A 3OFVA 2W2LA 1BDJA 3ZCUA 3CBGA 1SUCA 4MW7A 1MIHA 5G40A 4IFTA 5K09A 3VNVA 1C4XA 3D6MA 3CF0A 2MINA 5CPFA 5T67A 3OA0A 1JG1A 1QAMA 1WLSA 4JJAA 4EL5A 2ZG6A 1R4ZA 1PQYA 1RLIA 4GMXA 3RLIA 4HWPA 1O5TA 5DX8A 5B55A 3K4PA 4CTOA 4PO1A 4OK3A 4ENPA 1Z83A 3G59A 3E3LA 1XQ6A 2VA9A 3O1HB 2FG6C 4TXMA 1MH1A 1F6DA 1ZI9A 1XTTA 3DO5A 5ADVA 2J7PA 2FMFA 3B12A 4UFNA 3LXRA 2P61A 5K6RA 4HEJA 4DJFC 4WKBA 4IIYA 1QRTA 2F62A 4US1R 3NAMA 1O6GA 5EIFA 3RW9A 4BWYA 1TMOA 2H1HA 2B83A 4Q12A 3L8IA 2FDCA 2ZXFA 2J3JA 1Q1GA 3KKZA 3VKVA 4N3AA 3EFHA 1PVOA 4E94A 1PV1A 1GKUB 1NW4A 1P77A 1AKEA 1NTOA 2IYEA 5ANRB 4DB2A 1HFJA 3I2JA 1NY5A 2H51A 2O23A 4HXYA 3BGVA 1LLCA 1JTEA 1R5JA 2ATXA 5DXFA 1DOVA 1MC8A 4CFSA 5JE8A 1J2UA 4MVMA 1N6HA 2VP3A 3OTIA 5EMNA 3L02A 1W2WA 3AL0C 3FDJA 5LDGA 3SYRA 1KP9A 2QTLA 1PFKA 2W2NA 1L8QA 5CLGA 1MRNA 5ALLA 5TJHA 3EGOA 3U3RA 4DPKA 4MKGA 3ZY6A 4QU9A 4DBLC 5B36A 3THWA 5CDTA 2QJWA 4PS1A 1P1CA 2VZ8A 3NOVA 3AM3A 4ZTUB 4Z9IA 2EEPA 3KXPA 3KBOA 5JFTA 1Q77A 5CVEA 2RJOA 4LDAA 1QS0A 3UHFA 3LGXA 3R7WA 2I76A 4O1MA 3D02A 2LKDA 2HK8A 4DUGA 3QNUA 4PAQA 1F0YA 2HT1A 4X97A 3ENWA 3T7SA 3ZK8A 3MWJA 2DGJA 3EEYA 3VH2A 2YASA 4WGGA 3U7QA 3SKYA 3VA7A 2I22A 3ND9A 3X2FA 1P1HA 2N75A 4QX6A 2A6HF 5MGBA 2EBHX 4E4YA 1FRFS 3BDAA 1DBSA 4XWYA 3L18A 1ENPA 2JCVA 3GRVA 4J2OA 2O8DB 2X42A 3CUTA 3EYWA 4M6WB 1JU9A 3RYFB 5D5HA 3URMA 5CB8A 3ZYZA 1YVEI 5JU6A 4RJLA 5CT4A 5KNDD 4MIKA 4TXNA 1RPNA 3QELA 3LWDA 4XVRA 4YQZA 2YJGA 2XCTB 4HEHA 4U9DA 4KGXA 1TI7A 3P45A 5ULLA 3K2EA 1I3OA 2AQKA 2O06A 5IT0A 1CD5A 4ONEA 3EA4A 1T5IA 3B6EA 5IS2A 4Q6BA 2AOXA 4ZOEA 2P9ZA 1H0KA 1LC3A 2Z6VA 4FT4A 4KO2S 3BXFA 2C0PA 3KXKA 1P60A 3B5EA 2JFFA 1YBAA 3UXMA 2OSBA 4AL0A 3NG1A 3DL7A 3STHA 1KNYA 2GHTA 3MJSA 4B2LA 3WDSA 3LYAA 1VRCA 3NIBA 3NWEA 3CRRA 1MUUA 1SXJA 4JE9A 5L7TA 1RTTA 4UCQA 4RTLA 4YGYA 3SGLA 3SIPA 3MAJA 4CIYA 1Q57A 1CZLA 3KVYA 1WB5A 1HDGO 3AF4A 1GP2A 3NGMA 5BUZA 4JJ6A 4UAGA 3QX8A 4TXHA 4JLVA 4MINA 4WRRA 4DHWA 2IDMA 1R18A 2C00A 2WD7A 4JK3A 4RZUA 2ERXA 2H17A 4OIMA 2VEOA 3VR1A 4XD2A 4CKZA 2QNBA 3RVRA 1OXKB 3GV0A 1B0AA 3FFTA 3EDCA 1K0UA 1OREA 2J46A 3RO7A 2PXCA 3UC9A 2IYFA 4AJ9A 3KYCB 1XVIA 3UENA 2Q5HA 4J1SA 3AG6A 2CVHA 3AM4A 5CIVA 4AUNA 4ARIA 2UYYA 2OA0A 2AZMA 3MLEA 4ZHQF 1W94A 4PZDA 4QD3A 3VSAA 1Y7HA 3NMJA 1UL1X 4OJMX 5KDDA 2TMYA 4D99A 4I2NA 3QE2A 5TJ5E 2JA1A 2V6IA 1M7BA 3NJ4A 4JSTA 1AH2A 3IO3A 4QLBA 2GSDA 1QGZA 3TLEA 2A9FA 3O8RA 2NUAB 1X8LA 4FN5A 2HBYA 4CIVA 1MT0A 4G1EB 1BYUA 3IKLA 3QMVA 4TLAA 5F35A 3SLRA 3ELYA 4IDFA 4NESA 621PA 2BGKA 3IUBA 1BIFA 1GZVA 5ALDA 2ECQA 5FP0A 2BR3A 4JYBA 3E15A 3O0DA 4F84A 2ZI5A 5EKDA 3M4NA 4DV2B 1GQOA 4RTMA 2H9YA 3X1YA 2OM6A 1T5TA 3WJ2A 4GSLA 2FX5A 1UBNA 4E3ZA 5BQOA 2GKOA 5CAEA 2CNOA 5C3MA 1YFJA 1ANKA 2JH3A 1XRSB 4A92A 3G2PA 3FMIA 1YGYA 5KHOC 2ANCA 1UDWA 2IIVA 2WWHA 4JC4A 1AV7A 2CW5A 4R7ZA 1XGKA 3RS0A 3KQSA 3O4GA 3ZWQA 2IE0A 1E3SA 2VK1A 3KKNA 4WA8A 3IUJA 3NYWA 4JEIA 2ZB2A 3WFIA 3H84A 3M5CA 3KRTA 3UZUA 1KFJB 4JBYA 3SS9X 1OZGA 2X7HA 3D5TA 1GYPA 3HDJA 2A33A 4R6WA 3EXFA 4EPVA 3TTUA 3IKMB 2DHDA 5DEIA 4DJTA 1OW7A 4RZXA 2IPNA 4PN7A 1J49A 1YAJA 5TEVA 2BGNA 1RHUA 2G70A 3HVJA 1V6SA 1JWAB 1L1EA 4KN8A 3K3PA 1V71A 2XCLA 2WQ6A 5BWLA 1R7RA 4GYTA 2Z1DA 4YAIA 1OIXA 3CCBA 3W5HA 4R8VA 2ZJ3A 1KKMA 2Z8YM 5EE9A 4XQ9A 4E7ZA 3PX2A 1CQIA 1R4MB 4YFVA 2W6JD 4R8SA 3PUIA 2IV3A 1N6KA 1XP5A 2R7KA 4QAQA 4I81A 4GKBA 1OMOA 2C84A 3C3CA 1FUEA 2WVAA 2YBDA 3NBAA 3OEHA 4B79A 4WI1A 3AGTA 5AICA 3H7IA 2CUTA 1COWA 3U9SA 2QYOA 3CAXA 1PL6A 2NZWA 3B6ZA 4V1CB 1HDZA 3ZW7A 2WVJA 2WTXA 1E0KA 4J03A 5EUQB 4KSCA 1SWWA 4HUQA 4JY7A 5A9RA 3QPWA 3KAPA 2ZRFA 4E7SA 3NHPA 3TPCA 2PT7A 2DY0A 3G17A 3KZMA 2F8MA 1JE0A 1UPXA 3EIQA 2B3TA 3UUWA 2AJ8A 1OPXA 3CCCA 4RMNA 4IHAA 3PUHA 1L4YA 3ECCA 3ZHVA 1SG6A 2G9QA 2PAFA 2PWZA 4OKIA 4J3JA 1LXCA 2FW7A 2A9PA 5K6TA 4EP1A 4DMGA 1I0IA 5F1OA 3QKWA 5L0CA 3HCFA 5LB4A 1QYIA 5LP6C 3TTTA 4BFSA 3E9RA 1JQKA 4J4HA 2QRNA 2J45A 3V2HA 3KAJA 4K6OA 1E98A 3ZEAA 2VPPA 4XWOA 1EUDB 4RXUA 1ADYA 4G5GA 2NO6A 1H0SA 2QA5A 1OXMA 2RH9B 1R64A 2W9YA 4NY1A 3QLEA 4PO3X 4FMPA 3HJNA 4QODA 4PXAA 2Z15A 1PJ4A 3G7NA 1JNYA 4PJNA 5F52A 2BUCA 2RGRA 4ZOLB 3FVTA 2ODPA 1Z0AA 3AY3A 2WHEA 2B94A 5KYKA 2FRVA 2O57A 4C2AA 2Z57A 2Y0PA 3AETB 2JGJA 1P9RA 3U3XA 4EK9A 4EI7A 3T35A 4QYIB 2QUJA 1X14A 5EC8A 4R83A 2J0UA 4O2BB 5TQ0B 1PR0A 4HYYA 2DHCA 2WWVD 1OCRC 3IILA 1K7YA 5DIZA 3TQQA 1AKYA 4ARAA 1TJYA 5C1DA 4MSUA 4RFSA 4R1OA 2GI4A 3JVUA 4RPJA 1T34A 1XNQB 2OCPA 1MW8X 2OCDA 1TYZA 1BAPA 3Q72A 4RIGA 5F51A 1OTXA 4AP6A 3P9ZA 1JEYB 3HBMA 4QKQA 5AKGA 4QDKA 5JEDA 1J97A 3B53X 4MYRA 3ZE2B 1GKYA 5F9MA 3BRWA 2ZRMA 3IIJA 5BW6B 1BO6A 1PX2A 2C2ZA 1QH8B 4IP0A 1A76A 1UKZA 2DH6A 5LIPA 3B48A 3L7OA 1GLNA 3TDMA 5T4FA 4XDYA 5EP4A 3VU9A 4CLRA 3ATPA 3FOPA 3H9UA 1OH8A 3RE1A 1QF6A 1XXHE 5HOQA 3IAXA 4O4HF 1SXQA 4HK4A 3KPHA 2D7DA 3DKAA 3SU8A 3LCMA 4P0QB 4G85A 3I6IA 1R6VA 3OFNA 3ZDYB 3N8GA 2AN9A 2PLAA 4QVIA 4GRIA 1X0VA 3AK4A 4K0KB 1KWGA 1FMCA 4WBXC 3FVWA 5K3EA 3R76A 2GRJA 3H8SA 3PBKA 4FU0A 1UIMA 5DQTA 1U6IA 3WSVA 3HCPA 4G8JA 1XKXA 4B8ZA 2JLZA 1BJRE 1IY2A 2Y1GA 3L7LA 1SM4A 3DF7A 1JV2B 1ZNYA 3HR8A 4MUFA 5G4LA 1N8KA 5GGXA 1KYYA 4L7QA 3O8OA 3B1VA 2EP8A 4C4XA 2AEMA 4OY3A 1IJKA 1O0BA 3C48A 5HOEA 1B15A 3H2IA 5LQSA 1ISFA 3UGOA 3A32A 2EGHA 3W2HA 4C6TA 1GTMA 3INGA 2DPMA 2C5GA 2Z2YA 1PNVA 2QJOA 4KQJA 4HEA6 2P9EA 4U2CA 2ADOA 3OJLA 2QLFA 4B1FA 1DUIA 5DHPA 3VU3A 2IYNA 4DM3A 5AJTA 1NI3A 5FPSA 1SBHA 4DSZA 4JL5A 5JS2A 4QNNA 3CLKA 5D84A 3ASNC 4OF4A 1E9AA 3AHDA 1K8XB 7YASA 2CFRA 2PWYA 3VR4A 1JAXA 3VPDA 5KYYB 3AW9A 3R9XB 3OPXA 4EB0A 4OOFA 4UCWA 3FUTA 1PW5A 4BO4A 3GJ5A 8MHTA 4C22A 3BGWA 1PE0A 3CNHA 3CRMA 1L5MA 4UMEA 3L34A 3G8YA 2XQVA 4NCHA 1DNPA 2BJHA 2C83A 4NQZA 2Z4SA 4XLPF 4QPJC 2P65A 1L5WA 1FMWA 4LOIA 4Q3NA 1L9XA 2Y93A 4RY2A 2UXDB 3CEPB 1XK6A 1NQUA 3H4VA 2LTAA 5FHRA 5FOVA 3MRTA 3H0KA 1CNFA 5DHUA 3OD5A 2Y1WA 2BFEA 4CR7A 4CR6A 5DGTA 5LKAA 3NHFA 3STTA 1TZKA 2P4SA 3QKSB 1DXQA 2GXAA 3ONFA 1U7UA 3TWOA 3KTOA 4C1BA 3KT0A 5KU7A 4EKGA 1OA0A 4YBRA 4O63O 2OD9A 2SHKA 4OI0A 1DQRA 4FHFA 3GOHA 4LBZA 3DFKA 2TS1A 4LJ4A 2B5VA 3PG5A 4NK5A 1I24A 3VR6A 1PLKA 1KMQA 4JR1A 7MDHA 3B8HA 4H4KC 1L3IA 3JWEA 1UPUA 5IW8A 1AUXA 2QZ4A 3NOQA 4L0DA 3MWKA 5DM2A 2GAQA 2R5FA 2WJAA 5C1BA 2PQ2A 1HE4A 3CLHA 1P0IA 4FUQA 2D1TA 2W6ZA 1O6ZA 4B4VA 4XEFA 3HLZA 3WQBA 3R3UA 3MIIA 3ILVA 3NBYC 4R16A 1J22A 3MUOA 3PTAA 4OYYA 2O8EB 5BT9A 5CK5A 4K03A 1NVAA 1GPJA 1KTIA 2OQMA 2YZSA 3OUTA 3MWLA 4DVYP 1WZ2A 2F3RA 2HBQA 4TTSA 4CQMA 4AB1A 1Q83A 1NU8A 2QJFA 4OD4A 3K9NA 1U0RA 3ISVA 1SKYE 2RGWA 2R25B 4MW8A 3L1UA 3D3KA 5EUMA 2PX5A 3AQIA 2EKLA 3G50A 1OXBA 3AI7A 5LZ7A 2AUNA 5CFZA 1QHEA 3CNOA 4MROA 1GCIA 1QV9A 3IV7A 4WY8A 4AJHA 5BOSB 3WL4A 1Y3HA 3O8DA 3RFFA 3W2EA 4DMCA 4NBKA 3IXLA 1QYRA 4FNMA 2IXNA 1I0LA 3WMGA 4QVKA 3K0BA 1NVTA 3QI7A 1CJBA 3V5ZA 4CMAA 2ZPTX 4EY6A 5I7WA 3OTWA 4YP0A 3TLBA 4R68A 4FGWA 4GECA 2DHEA 3AERA 3ACCA 4ZU6X 1FOEB 3GLGA 1DFHA 3SHVA 4DN6A 3B7WA 4REMA 4YNBA 4I19A 3Q1KA 4IGGA 3M5WA 3GEIA 3SZ3A 1EKXA 2V7GA 3NTUA 5CP8A 4IIGA 4FMBB 1RQNA 1PT8A 3IQFA 3F4BA 3N59A 1RLJA 2CDRA 1ZGAA 2QTBA 4L9SA 3N8NA 2CMHA 3RVQA 3TZHA 1F2VA 2NTYC 4GLOA 2WWFA 1J07A 3AEUA 2WUVA 3D1LA 4IIHA 3M2TA 5IDWA 3OX3A 2OO7A 4ZK6A 3OKFA 2J6CA 3UAWA 2ZI6A 3PKJA 3GDHA 3SHWA 2OK7A 2DX7A 1M83A 2VRNA 1T2EA 3GROA 1JA1A 1EXVA 2PUJA 1LE4A 4O4IA 1XCBA 2FFRA 5DYTA 2QX7A 1YZAA 4U5FE 2DULA 5LP6F 2QD4A 1N9GB 2P2ZA 1T9CA 3PNQA 2BMAA 2WF5A 1GUZA 1YA6A 1TEXA 4MAAA 5L9AA 2PX0A 4MRMA 1CB0A 2GCIA 1Q17A 4XPWA 4AL4A 5JARA 3K0CA 2Q6OA 2GPYA 3N5CA 5HUJA 3W3AA 4YAEA 1SU6A 3N07A 4B6IA 5F7JA 3R0VA 4ETMA 4M0PA 1B2RA 1QMGA 1MKYA 2PUTA 5LC1A 2ZJOA 1RI5A 4NBUA 4E7PA 4MA4A 1FB5A 1RVV1 2KYHA 1N6PA 3W5DA 4P9NA 3LMKA 5FB3A 2SICE 1OZFA 4MVJD 1YBVA 2WC1A 3L0YA 2OORA 1YBMA 1K06A 2LZ0A 5D5QA 2C1EA 5DS4A 3MTIA 2XYPA 4ZI3A 5CX1B 5TV2A 3O8QB 4X63A 3NGXA 4QU8A 3K8QA 1JBEA 3Q12A 4GX2A 1EA8A 2W6MA 3KQQA 5KQMA 3S1AB 3I2FA 3HB9A 2LDXA 1OAKA 1W75A 2G80A 1Z7BA 3M49A 1CDDA 5AKEA 4WACA 1Z0DA 5F5LA 4B83A 2Q9CA 2LV8A 1QHIA 2PWPA 4ID9A 1E92A 3F98A 1IZMA 2V4UA 3CG0A 1YC5A 3BTOA 4LFBB 3LCJA 4B35A 5SZKB 4JVSB 2IV7A 4HDMA 3WG9A 3WHLA 2CNLA 4NV1A 3WRXC 4YXWD 2OZLB 2PEYA 4KPUB 4TRNA 3ET4A 3KCQA 2M6KA 2GVNA 3ZV5A 1JG3A 3W0LB 5CITA 3M83A 2PUFA 2QRUA 2VJNA 1TQ4A 2VC9A 1MA3A 3PFHA 2VCYA 3I23A 4A0QA 1Q3HA 4X8HA 5LZ9A 2VBIA 3OLCX 3OQJA 2WYOA 2PR2A 5ALPA 5E8RA 1T1EA 1XQYA 3SXYA 2PGIA 4BX0A 2XBUA 3A6ZA 3TQOA 5LLDA 5LOVB 4D9FA 5BR7A 4JLBA 1OI3A 5M29A 1Y7TA 3JALB 3HCDA 2IUTA 2IOFA 4P32A 1QIEA 4H17A 1TYEB 1KYZA 3ZWWA 2BF4A 2MYUA 4BCDA 2JGLA 4KNWA 2YIDA 1M2FA 2R03A 4M0EA 4C88A 2VYNA 3OE7A 1YZHA 2Y9MB 3CLRD 5ALIA 1ST2A 1PEDA 1AKVA 5KNCH 1E62A 3NH9A 5NLLA 4PW0A 2BMJA 1BN7A 2Y0BA 5BWBA 2BFBA 3QW4B 1DC5A 5AP9A 3DD7A 1BXRA 1WXWA 4PLYA 3G7UA 1CR4A 3M34A 3WV4A 1LS1A 4LMBA 2GCOA 3CLUD 4C3DA 1BS1A 1C29B 4I2VA 1NFOA 3GMIA 1RVDA 4XEUA 2CE2X 2ZBFA 4ECEA 3IE0A 2HA3A 1T0BA 2EDCA 2BDTA 5C8DA 3IMCA 2Q5QA 3ROKA 1X94A 7ADHA 1K0FA 2R751 3HU5A 4KMOA 1FUUA 1HZZC 3CR7A 2BCGY 2BRUC 1ULSA 1ZITA 2RI6A 4WXYB 3UA4A 4W1SA 2P62A 4EYQA 3BPSA 2I6TA 1GYQA 3ANLA 2ECKA 3ABRB 3QA9A 2BBTA 4IOJA 1UFBA 5GMOA 4YXFA 2FLKA 4IAQA 1N2SA 4KK4A 4IKPA 1E2BA 4CTJA 3ZDRA 3GLIB 5DU2A 1B3BA 2BGRA 3OTQA 1IHPA 1K8ZB 5HUHA 2IU6A 2HHHB 5AQ1A 1D4OA 1GAWA 4CEJA 3BWEA 3ELBA 1ADJA 3AP1A 2GR9A 2XMBA 2DP4E 3T7IA 1A9SA 3X1DA 4F11A 3N8IA 1SC4A 3OVMA 5IYZA 5EAIA 2Y1FA 2NSJA 4EELA 1EFUA 5AVVA 3FZNA 4INAA 5JRAA 1GZ6A 2LIGA 4Q1EA 1K2WA 2XITA 3EPVA 3ZTZA 1E9VA 1PGNA 5C5EA 5HZGA 5K1ZA 4Y2UA 4WA7A 5HKAA 4ZVSA 4WXRA 4NU5A 1CZKA 2QI9C 3WLLA 1EEXB 3K72B 3ZWVA 4PLWA 4EECA 4OBBA 4PO8A 5CDYA 2EG9A 2GYVA 5A05A 4GOXA 4I55F 4M55A 1OLUA 5A4MS 2X23A 2AJTA 5JOQA 1RYFA 1SGWA 1YR3A 1YQXA 4HGNA 4MWZA 5CA0F 1QU3A 2I62A 2R9VA 1U2ZA 4W9RA 4CMIA 4EG4A 2PKWA 3CSSA 2WAMA 1C5KA 1WAMA 2Q7DA 4JURI 3NC0C 3LK7A 4WK6A 3KX2A 2DH5A 2H6EA 3V7FA 1I6LA 3CGGA 2J5BA 4G01B 4BMZA 3AGPA 3ROMA 2OZPA 2XY4A 3GBPA 5EN4A 4ZI7A 5I7VA 5B1HA 1E1QA 4ZHSA 2Y66A 1XEWY 1EGHA 4H7DA 2I4TA 5A04A 5CFMA 3ZV6A 3A06A 2VQFB 2I71A 3FTFA 2YVKA 1CE8B 2G0AA 2JIPA 1DEAA 2YICA 1ATIA 2WT4A 2JATA 1D9XA 3FWHA 1X1SA 3HBLA 3W4YA 3NHKA 3OIUA 3ZZTA 1E1MA 4DXAA 3WIEA 4LF4B 3CURA 3KJFA 1RAHA 2DI3A 3KC2A 1LQ2A 1RWVA 3LU1A 2FRDC 1VFNA 3ASVA 3UA3A 3AFGA 3VZCA 1M34B 4EVSA 3JARB 1D1PA 3CPHA 3R6LA 4IRXA 2C4KA 5FI5A 5TIIA 4JUDX 2IDJA 3KR9A 5HE9A 4DQDA 4L4XA 1A8IA 3Q9NA 3OQ1A 1BDJB 1MMGA 1SCQA 2O7SA 3QY0A 2OZKA 3EXAA 5DS5A 3WRVA 1I7NA 1I4EB 3UTCA 2C2XA 4X41A 2WK1A 3FETA 1UKYA 5FPKA 3C14C 3L8YA 1IHOA 3BBPA 4K86A 5JDCC 5KQLA 2MINB 2XLCA 1Q74A 1UBLS 2QM0A 4DM4A 4XPXA 4MP6A 1MX5A 5JNLA 3H65A 4HQOA 4ZZ1A 1K7SN 3K0EA 4I9GA 5F7ZA 5JLIA 1FMLA 2LP4Y 3IA2A 3RRBA 3ONEA 2ATCA 1BGVA 4HF7A 3ZWNA 1WMFA 1S4MA 4RJTA 2VJDA 2ZTVA 2D4HA 1YC2A 1PS0A 2O8BA 2YJ3A 1QUFA 2QYTA 3O6XA 4O0MA 1P73A 3O2NA 3B38A 1Z34A 1GN8A 5JYBA 1PDVA 2DSNA 4ADSG 1Z0ZA 3F46A 4H7EA 3K9FC 1O6CA 1CQJA 4JU8A 2IEYA 5DBEX 1XMSA 2EG5A 5HKBA 3Q3IA 3JW8A 2WWTA 3KEMA 4KLAA 4NOKA 1F06A 3QP9A 3OFSA 4LHVA 3RBAA 5H0IA 1DHRA 3IPRA 4C0XA 1BXGA 4B8YA 3TUZC 5IWAB 3UNGC 5EEHA 3P0EA 2J7PD 1ORYA 2OCIA 5A0TA 1HE5A 1SD2A 1W2WB 2UVPA 3EK2A 3FRIA 5UKDA 4NHEA 1ABBA 3A1CA 4TL8A 5FPQA 3OZBA 4J0GA 1NUQA 1IJFA 1BCRA 3H6GA 4EW6A 3EVEA 3E8MA 1T0HB 3WHPA 3A1UA 3A6GA 3KQNA 3THWB 4W7SA 5JI3E 1KI3A 4TKZA 1QQAA 1GNQA 4S35A 4HDRA 4P98A 3AB8A 4EZEA 1SUBA 2ZFUA 3H1EA 3OICA 3G4ZA 1QS0B 3TLJA 3R7WB 4HN9A 3AR8A 1Y48E 4BQOA 4CDGA 4J6FA 1E3TA 1IATA 3INRA 3IAAA 4DRJB 1W25A 2ZUWA 2V0NA 1TPYA 3HO6A 1VXOA 3DG9A 2JZOA 3EHDA 3U7QB 5AJZA 5LA6A 3WSWA 2FQQA 4GO1A 3T3NA 3BFVA 1VIDA 5AVUA 3QLUC 1VL5A 3WA6A 1A82A 1XYYA 4XGIA 1K7EB 2X41A 4WAUA 3RU2A 1F14A 3ITFA 3VDMA 4KIJA 1NUPA 1SELA 5JZVA 3PNBA 5A69A 3Q7LA 2Q3BA 3F8SA 2FPGA 4CV0A 5I8PA 3FIUA 4XX0A 2YHAA 3QELB 5T5QA 5EY5B 2PWAA 3CRVA 4UATA 2AZ4A 2Y8EA 4DCOA 4KVAA 5JS7A 3FBWA 4PBSA 4DUGD 4LJYA 1Y9EA 3UJCA 3OURA 4MGIR 3KYJA 3QE0A 2JHAA 2L17A 5CB6A 4XYMA 5CRIA 2ARKA 3TDKA 4LACB 2VG8A 1ECLA 1UG7A 3VVCA 1RAAA 4GX1A 1Z45A 2B8NA 5IAKA 3H2HA 3C16C 3Q4GA 3SYLA 4PLTA 3G1WA 1NF2A 1ZRSA 1ZXBA 1IZ8A 2PUEA 4DC0A 3BK2A 3VSBA 3LPLA 4ER3A 1CY6A 5TPZA 1SXJB 2JIZD 5LUAA 1KMHA 2GLTA 3OBBA 2FN8A 4JBNA 1XDSA 2KYRA 4DDTA 2YL3A 4YRTA 1TMYA 3EUAA 1OSNA 1GPMA 4RKEA 4QJ3A 2PUCA 3C5EA 4LISA 4R8KA 5K0BA 3ZOKA 4QBGB 3IVXA 1N2CE 1OAOA 2QRVB 1SCKA 2WD7B 5DPMA 1YQ9A 4PPFA 3EVAA 4JQOA 5JUAA 4DZRA 2GXQA 1EFHA 3AG5A 2CCGA 4RKQA 1CF4A 1XZLA 4W7HA 4YMHA 3Q5EA 3NV7A 3H18A 2IW3A 3DDUA 4E5UA 1KS2A 4IGAA 1SXJD 5FWDA 3ZCXA 3EFOA 1AQIA 1VECA 3PPVA 1MOQA 4L07A 3LCCA 3O91A 3GGGA 5CU7A 3N0WA 5I7HA 1PZHA 1W73A 3CNEA 1V74B 3LG2A 3S7ZA 1UFOA 2HSZA 1A72A 1FXUA 3MTJA 2HJ9A 5M7EA 1D07A 1K05A 1KC1A 5DASA 1FFTC 4RIEA 4KSYA 2AYXA 4KRYA 4U0JA 2GPTA 3NR2A 1T3TA 2EFEB 3L04A 4GOOD 3HYCA 1FMVA 3PWZA 3PHGA 2X3FA 3AONB 1EGQA 4PJJA 2CZQA 3GZTB 1HYHA 1UFKA 3S5JA 2HPAA 2R6JA 3A6LA 3W4IA 2Q5FA 4HWOA 1AKMA 3PHJA 5ITSA 2OMEA 1LRLA 1TCAA 1OBCA 1PZGA 3NUQA 3QITA 3GN1A 4GAEA 1EWQA 3VPXA 2Q00A 2GVZC 1UJMA 3F90A 1QKIA 1ULHA 5JQGF 4XFJA 5CAEB 4JZKA 4KKXB 4W5RA 1O1YA 1KU6A 1KY3A 4B6FA 3UJ6A 1ZHOA 3L4SO 2OOKA 5DULA 3GDGA 5K3OA 4LY0A 4BNDB 3E3NA 3ETLA 4EITA 1PLJA 2VDWB 2ZXOA 4FLMA 1Q7CA 4EARA 1Z7Qc 2CDBA 3W4JA 4Z9BA 1Y0BA 4UNSA 5L0DA 3CH6A 3HUDA 2ODTX 2E37A 3EXFB 2I5PO 3KG2A 4LDQA 4YJ2A 1JX6A 4ER5A 1MZPA 2H1OA 3FLAA 4Q82A 2WLTA 2HV8A 4W8OA 2PBLA 5CJPA 3BWYA 4MS4A 4R0VA 1UAYA 4FJ1A 4QVGA 3OH8A 3OI7A 5B1BC 2YUTA 3CKYA 3QVTA 1AUPA 3LKDA 2GN6A 3IMEA 4AROA 4WZAA 4NBNA 2FW1A 3BRSA 5COAA 4JI7B 2VP0A 1CQIB 4FE7A 1I6KA 1F1JA 3L6OO 1QP4A 4RZ2A 1CPYA 1TCUA 3GORA 3BCHA 3G5AA 3PF8A 4MMZB 3FNGA 2ZRAA 4N8EA 2QX6A 3V4VB 1L1RA 1T5OA 1PZFA 2PZEA 2YX1A 3R0IA 1JXOA 5FAKA 5J3JA 2O5RA 1GGHA 5FADA 5BVHA 1N57A 2IU3A 1E9DA 1ZMOA 3U4MA 1U5AA 2Q29A 3ZWIA 1M6VA 3WDMA 4D0RA 5KTNA 16PKA 4HUQB 2FXIA 1WGWA 2PTHA 4QWWA 2JJMA 4G0UA 3I01A 3K5WA 3ZH9B 2ZT6A 3GIDA 1VLVA 5K20A 1THGA 4BNHA 5DNUA 3AKDA 2H7CA 1XI2A 3E1SA 4NFHA 4TZ0A 1BVHA 4J1TA 1MO2A 2D5CA 3UMJA 5BQPA 2NMVA 4JL6A 4DAOA 6GPBA 5CVUA 3NYJA 3GUYA 5KZMB 4D41A 2EVWX 4Y2VA 1V9LA 2XL4A 4UNQA 4JMLA 2QSUA 3TW0A 3OEHD 3KZXA 4BB5A 3RVZA 4YR9A 3K0AA 4IDDA 3HEMA 4EUHA 3F6CA 4R4JA 1XCOA 3IQ5A 4WX2B 1WXXA 1E84A 1ZWKA 2HSEA 3GPCA 3L7IA 2ZATA 2EBUA 3A1EA 2W4BA 3AU8A 3OQVA 2Y0DA 2O05A 1Z0SA 1DJNA 1LCIA 3UPUA 3SX2A 2EL7A 3PHLA 4YN0B 3CT4A 2F17A 3LBAA 5DTRA 1M73E 3OJEA 1RCUA 3ORHA 1SKBA 4J4BA 1J0AA 3I9JA 3FOFC 1G3QA 2Q4TA 2CLSA 2WIFA 2F55A 1FLAA 1MH9A 2NVBA 4PSUA 4COOA 3MYYA 2J0UB 1IYZA 1Y6RA 1F51E 4BO3A 3VDQA 5AW3A 4LDNA 5T57A 4C6HA 2B0CA 4LI3X 1UODA 3E35A 3JAWA 1ZA2A 1YUBA 4WW0A 1WF3A 5FOUA 3TL3A 3D8HA 1QFYA 2H7BA 4H15A 4DDKA 4RFSB 1Z5VA 1XZHA 1G5PA 3MBIA 2R6HA 2CB9A 1KI2A 4EPTA 1EZ4A 3EOBI 3IE1A 2Q21A 2VHZA 2Q8PA 5ADUS 3A2MA 4LJSA 1DRWA 5CIWA 1D0ZA 4G37A 3GFGA 1E7YA 4XQ1A 4D5GA 4MWBA 3QU9A 4DXHA 5T3YA 3PFKA 1Z13A 4PAWA 1CX9B 1YHZA 2GD2A 2GH1A 4N4AA 5H59A 1U7ZA 1QK3A 4Q19A 5BSGA 1JTVA 4WK2B 1SC3A 3VU9B 4CLRB 4R2LA 3A28A 1G20E 3N76A 1ZN7A 1E2JA 1SKUA 2BH2A 2B4TO 2X2EA 1FNCA 2AJCA 4CBEA 4X1OA 2H59A 4LC0A 1S89A 4HI0E 1CP3A 4JKVA 4ZGGA 3FY4A 2H29A 4CMGA 4NV3A 2BVNA 1KEEA 3KLMX 4J9UE 3N86A 2QRVA 2GN4A 4UVDA 1G7RA 1Z6YA 3LIPA 5EJAA 3IQEA 1KZ7B 3U1TA 4ZQCB 5KNCA 1BU8A 4WKOA 4CI9A 3LP5A 3EC7A 2WWXA 5BN3A 5GV7A 3RD5A 5IEBA 1KOLA 3G0CA 2IEDA 5AI8A 4ZKDA 1FSGA 1ZGHA 1VP3A 3R5TA 1VTMP 3QF4A 1C1XA 4E08A 4PHFA 2MSWA 5F5FA 3LBNA 3V00A 5GZ3A 4YX9A 3DMGA 3O8OB 2GFIA 4AECA 5GONF 2N1MA 2GFHA 3PJEA 1PR2A 3LL4A 3N0VA 1RXIA 2DCUA 4RLHA 4FX5A 3T6BA 2N3ZA 1T1JA 4C6TB 4P35A 4FR0A 4KIGA 3A3YA 1ICIA 4K1LA 4GOLD 4R2KA 1JQEA 1KDYA 1FPQA 1RAFA 1GARA 1JZQA 4NIMA 1PQPA 3CZPA 2XLWA 1D0SA 4LW8A 1F12A 3RU9A 5M5BA 2DR0A 2QMEA 3ND7A 4JIOA 3OECA 1ZIPA 4B9EA 5AHWA 1MJHA 5GGYA 3L1MA 2WHXA 5AXDA 4NMXB 1JHYA 1X7DA 4X93A 3R7NA 4HNAA 4ZJPA 4RX1A 1FRNA 3TAHA 4Z7QB 5A3VA 1P1JA 4D9MA 1MLDA 5FI3A 2YJTD 3ESRA 1XTBA 3LHIA 1W85A 2QUIA 2Z04A 3BWBA 2I66A 3GL9A 4FOTA 4RFLA 5A2GA 4HGPA 1DBVO 2ZTMA 1JEQA 1FJGB 4G86A 1J7KA 4U7HA 4BNDA 2PPVA 1ODFA 1HDOA 2VDWA 5BRNA 4BCCA 4HWTA 3FLEA 5IVPA 1DAIA 4YJDA 3GDWA 2BFEB 1NX9A 3L7AA 3NKDA 2VDPB 3K0HA 4ECAA 3PK0A 3TQHA 2PEZA 4DA7A 3QV1A 5JNWA 1P7ZA 3HH8A 3X43A 4Z4EA 3NTXA 4OINF 3FNFA 2PHZA 2QTWB 4BNWA 1PN3A 3ZX4A 1S9HA 2DGDA 5BYAA 2EIMC 4OAPA 3FOBA 2X6RA 2DKOA 3NU1A 1UM8A 1KJIA 4JCCA 2FFHA 1PYOA 2YNMA 2E48A 2O0KA 1YZ3A 2ZRQA 1KSGA 1XVTA 4XARA 3UJNA 4EUSA 1C2YA 5CLFA 1F38A 1SBYA 3I3SR 1JMWA 1WSDA 2GK4A 1P44A 1KJNA 3UGKA 1E2DA 1CW2B 1TD1A 1G2QA 2OR3A 4AI6A 3UBTA 3OEYA 3SP1A 3P0RA 3RF7A 4B3BA 2IYYA 4DY6A 1U8ZA 1WZNA 2ZUCA 1U6JA 1JSRA 1GSHA 1V8BA 4Z4CA 4QOHA 3GAFA 4CQMB 5CFLA 4M63A 1FY2A 1RAEA 2JHFA 3GQVA 4E5PA 1ULZA 5ERGB 3VPHA 2H8KA 3VR6D 1OXBB 2D2FA 4X62B 3LT1A 9GPBA 1NU7D 5AVSA 1Z35A 4JELA 2WP0A 3L0IA 2P1DA 2VUHB 4A6DA 3KOUA 1R5BA 3RSGA 3D81A 4B6RA 3KUUA 1WCIA 4ZDJA 4RD9A 1WEHA 1GQSA 1VK5A 3UWPA 1AOXA 3OE1A 2FMXA 2V7WA 1X7XA 1GUFA 1IB0A 1O0CA 4OLJA 4BU0A 5P8WA 3CQ9A 3LZDA 2CE7A 5J5AA 3ONNA 3BD9A 3RG8A 4H6PA 2MOKA 4UTRA 2ZSDA 3M6FA 4MXDA 4MJXA 4RW0A 4L51A 1IBKB 1F1MA 2JI4A 4F5ZA 3AERB 3K4QA 1PSZA 4IDCA 1VIVA 3HUTA 4LWQA 1I51A 1KJYA 4KVFA 3QEOA 4MV3A 3GLGB 4IDAA 4G7ZF 4GYWA 4B44A 4YWQA 1L0BA 4EYKA 4MMYB 1SVLA 3ZSUA 4Z9XA 1BKSB 4GBJA 4M9ZA 4BEVA 2YS6A 4RS3A 1Z0JA 3TTWA 1G5QA 3DMYA 1HEIA 1MB2A 2QRMA 3OLVA 1EINA 4IQ8A 4K9LA 4PVDA 3GRPA 3U1BA 2G36A 3CWZA 3W8FA 4HNSA 3C4JA 5FX2A 3AEUB 4B75A 3EVNA 3A1DA 2NP6A 4B6JA 3LRXA 4YDHB 1D4AA 2W70A 5B37A 1EJ0A 2ECOA 4HS4A 3GCDA 2RBKA 4QRHA 4O4IB 1I4ZA 3NCTA 4PX2A 1RQ2A 1V41E 2O1WA 2VHYA 3OZEA 5LL6P 5K01A 1VCIA 5HQ3A 2I80A 3CNQS 4MRMB 2FEAA 2VHXA 4XLLA 1GNSA 2R8XA 3FCUB 3DE9A 1TYAE 1M1UA 3TNDA 4U63A 4BLQA 1FYFA 2QPOA 4C4TA 2RDMA 4TWBA 2CJWA 4OLAA 1KKUA 4CKCA 1H9GA 2B2NA 2GN9A 3DZJA 4BFWA 1LNQA 4MKFA 1JA9A 4QXQA 2VT2A 4FGSA 1JR3E 2D1FA 1FW6A 2I8AA 5H68A 2D3WA 4TMXA 5I9MA 3L84A 2XVXA 4WLUA 1KOFA 4O4JA 1WZIA 2E4XA 4LRTB 1IVNA 4LVNA 4FZ5A 1J00A 2E18A 6NULA 1GHTA 3ON5A 1L4GA 4CTKA 2QNIA 4A26A 1TA4A 1YR1A 1X1EA 1C7ZA 2IHJA 4G07A 1KEZA 3A2LA 4LQCA 2DTEA 4F2PA 3L7CA 3ZE1B 1SIOA 1JLMA 2YHIA 4NOLA 4ERNA 2PX6A 4IB4A 4LHEA 1F2UA 5FJJA 4U2BA 3W3AD 1II9A 2HC9A 4PSDA 3GRRA 3W1WA 5B4UA 2FUNB 2QM8A 1ZJ4A 1A4RA 2BEJA 2I4LA 4HG2A 4IX1A 1SN7A 2F48A 3DLBA 4MZXA 5IJ0A 2QTHA 3UQZA 4UREA 4YRQA 2JIDA 4DL9A 1FTGA 1YJBA 3IJEB 1HSOA 2BE5F 1NLZA 5LP1A 4FMCF 2HQSA 3PI7A 2XEDA 4YJKA 1DAHA 1KIMA 4YP6A 5FFNA 3IX7A 4HDMB 1HMOA 1TVEA 4MWTA 4TZ6A 4BQNA 1N36B 1RU3A 2X1HA 4MUKA 3V5YA 3M3DA 3V2UA 2JFQA 2Z4RA 3ABIA 5AKLA 3QJYA 5EIBC 3RQFA 3CZ6A 1G4WR 2I2DA 4ZAWA 2HWXA 1PG5A 1AG9A 3VVMA 1T9DA 4L5CA 2APJA 3N6XA 1AGPA 2CLLB 4DXWA 4YRZA 4D0LB 4CQNA 3EMDA 2BGJA 4N3GA 3TNFA 3Q8KA 1JAHA 2X9GA 3L4BC 2HTFA 2AJBA 2DPLA 1GL9B 4X92A 3GARA 5TRTA 1R37A 1T6XA 4OGWA 5F2EA 2OHHA 1LDGA 4LJ9A 5DX0A 2YINC 2JGKA 2YFYA 2HV7A 4YRBA 3CF6R 2YEVA 4I3MA 2XYRA 3MX3A 4ZEXA 1CC1S 5AJYA 1ZH8A 2HDWA 5E3JA 4I44A 1JSXA 3CXRA 5IKPA 5D92A 5GZ1A 3SF8A 3LUCA 1UK9A 3HDGA 1X7ZA 2BFBB 2UKDA 4KO1S 4PFJA 1U1FA 4GOJA 2NZ8A 1E1CA 5DNVA 4OQLA 3QX7A 1BXRB 4CEIA 4LF8B 1D9ZA 3O82A 4GQIA 4XDZA 2HL6A 1UC5B 1N2EA 2GCOB 3SIWA 1H1TA 2IQ5A 1XALA 2WU4A 4HWKA 1Z7GA 2WB7A 1WDMA 1GTSA 2XNDD 3AQCA 1FC0A 2FW0A 3G2IA 2VUSA 2ZIUB 1JFTA 3ICVA 2X9NA 2PD4A 4Y9TA 1PJLA 2ECPA 4KQ6A 3M2PA 5E4JA 1T24A 4G0OA 5IC6A 3HNJA 2W2KA 4NECA 1KTVA 3CE6A 4E5KA 3JQBA 4ZMSA 1PDOA 4Y2RA 2ZROA 1GZSA 5GJVC 1FBNA 1ZHZA 3MIZA 3PHBE 3L43A 1CJUC 1BE0A 1EYZA 3RJTA 1NNI1 4R8LA 2O20A 3RFVA 1RPZA 1NJ1A 3WK5A 5ABPA 1Q2XA 4DPMA 5KAPA 4CS9C 3RUCA 4CV1A 4P5PA 1Z63A 3LZ6A 5IXSA 1OOEA 1PP4A 2I65A 1V3UA 5EZQA 3UV3A 5DMHA 3KQMA 2KS6A 1GL6A 4GBMA 4CEJB 4KNVA 1J56A 3WBFA 3M6WA 1SUEA 4O02B 3HCWA 2PRIA 3DT9A 4LZLA 3M4XA 3QI2A 4GP6A 1KKLA 3RVPA 1UPCA 2FW6A 1SKQA 5IYZB 4EUEA 5HMMA 1TQHA 4IS3A 2FSVC 4RPGA 1N7JA 1TJ5A 2WILA 4KDCA 3BSSA 4YUVA 1XRJA 1HGXA 4UZSA 4OGGA 2VQSA 1XZCA 1F9EA 2XKBA 3EHEA 1E2NA 3MGGA 4DSNA 1L4MA 2R1UA 5TT0A 1TKNA 5DV9A 4OQEA 4A3SA 2IZ0A 2YFQA 4OU5A 1OLUB 1PAUA 1V7PC 4L4YA 2HSDA 3SJUA 3J80A 4OX9Y 4F4IA 1O58A 3FKSA 5JJ5A 3AJ9A 3ZTWA 2Y68A 3SJBA 1PS8A 4BMVA 3SYMA 4MVJI 4CMIB 2O1EA 4HXGA 2NO4A 2HX1A 1ONOA 1ELOA 2M64A 2XGSA 4RSGA 3HNRA 3M6VA 1U02A 3RS2A 4Q7MB 2IYWA 4OHWA 1WABA 2BFMA 1OE0A 2FZCA 1UBEA 4AZWA 1Z4JA 3HRKA 2V5VA 4ZI7B 3BVPA 1FFDA 3L7MA 1XZNA 3RC1A 2I55A 4D6YA 3ZWCA 3TB4A 1DMRA 3LZCA 2ZIEA 5GPGB 3JSEO 2Y0EA 4KU4A 4LXIA 3TQRA 5KBYA 2ZRDA 2GM3A 3U62A 3MTBA 2V59A 1JA0A 3NM4A 1IC6A 2YL0A 4D4LA 1ZRMA 2GYUA 2QUAA 4JCOA 3H8WA 3CIOA 1CERA 2PYZA 1T0PA 3QFRA 4MCJA 2C7GA 1YKFA 5I4CA 3I9OA 1IN7A 5LQAA 1QE5A 4X6XA 3AVQA 3KWFA 2FN4A 1N2IA 1TFOB 4GC9A 1DP4A 2A0KA 3VJLA 5H4GA 1E89A 2IF0A 4PLVA 1SULA 2OCCC 1D09A 1JHMA 2IKQA 4BWFB 3ZZ1A 1QFSA 4CTMA 4CDVA 1N1MA 5L0JA 2DPYA 1CUCA 5IN5A 5LNK6 5A62A 2XGJA 3O84A 1DGQA 3RRZA 4OB8A 1E1QD 4Q3BA 1XEFA 3EF3A 3O92A 3UK2A 2IZZA 4NBSA 4F1KA 2WRZA 2JAOA 2D06A 1Q44A 4BB6A 3CH7A 3FWKA 3PXXA 4DA8A 3T5CA 2LUOA 5CCXA 5I9IA 3TRHA 4ZV9A 2RHWA 2ZU6A 3T54A 3B6IA 1PNRA 3ABQB 6ABPA 2WIKA 4FI3C 3GGPA 1L3CA 5AM0A 1CFZA 4D4JA 1VHTA 5K3SA 4RTSA 3T6KA 3NVAA 5EVJA 3NBKA 4OXXA 4GW3A 2GYWA 1S3IA 1L5LA 2KWIA 1J2TA 1ST6A 4RD2A 2PSJA 2X77A 3QVXA 1RS0A 1W0KD 5TARA 1ORSC 1ODIA 4RPKA 2QROA 3AF2A 1B2LA 1QU2A 5IJXA 4M49A 2R11A 2H48A 2QWXA 4RWEA 4EGFA 1YB6A 2K4MA 3TINA 4H60A 3HSSA 1E77A 5G0WA 3L4JA 1QVVA 1ZW1A 3UHJA 1YB7A 5LR6A 1N6OA 1TFUA 1GSIA 2O8BB 3U6KA 4TS9A 1FDUA 4N47A 2HLNA 4BX9A 1I2AA 1CQPA 1BHJA 4ASUA 2R8EA 4C0WA 2PD6A 3TX2A 2JKYA 5HR5A 3EAQA 1JDSA 1CQJB 3U49A 2B7CA 3VSEA 1KBZA 3OQBA 2J85A 2VJOA 4IL5A 3I5QA 4BAUA 5BNZA 4W5OA 1IHDA 4QDOA 5JZSA 3D3JA 3NVMB 5FWAA 4RF5A 4WKCA 1Y98A 1C1YA 1HL3A 5LIRA 1U11A 4MA0A 3B1KA 1B23P 2NZVG 1YACA 3U9LA 1ZJYA 1BXGB 2IVZA 1R5OA 4PS0A 4FIZA 3PRJA 4YAGA 2X4LA 1IH8A 4WCFC 4WBNF 2UVPB 3DZAA 1GVHA 4PTZA 2HYDA 4EMUA 4CCYA 1X8XA 5EPUA 3UJHA 4FM9A 2VOJA 1UZUA 3K9HA 2WNIA 1BCRB 3GJ8A 1K97A 1KEUA 3QUQA 1YU6A 3T06B 4JGGA 4KI7A 2IHYA 2ZU0C 5A4FS 2JHGA 5EE5B 3X1MA 3FOWA 4FFSA 2DMRA 2O2CA 3ZCSA 4HDRB 1R4AA 1WVGA 4BVFA 3SG0A 4LMPA 3KT8A 3JY6A 4HWRA 2P5TB 3G6KA 1RQLA 1VJ1A 3PEEA 3NT2A 4R1LA 5KOJA 1LW6E 4EGQA 3C3BA 3WTBA 1EWTA 1XAIA 1NWHA 5LA6B 4I1SA 4C5CA 1QK4A 1U4OA 3CPSA 2PS1A 1ULUA 1ID1A 4LJ7A 4CCAA 3EDOA 2R44A 3ZBQA 5ALMA 1WOLA 1P5FA 1O94C 4DLAA 4KUGA 3QVJA 3OLYA 1XZIA 5TF4A 5C5DA 4NULA 4BLVA 1L7VC 4JP1A 4KC0A 2R2GA 1QH0A 1X70A 2FPGB 2WLSA 1HYQA 4UUMA 3HYLA 3PNSA 4KH1A 1VE5A 4XX0B 1S2OA 2OKCA 2ZJ2A 3L1HA 1F3LA 3ABZA 3OIWA 1G19A 1A4IA 2WFMA 2ZYAA 3GGCA 3QYAA 4JI3B 4FMDB 1GZHB 1M5TA 3QKUA 5IANA 2ZZKA 5CH8A 3KYJB 4X1YA 2OXIA 3PLAE 2VHUA 1R00A 5NULA 1RLUA 5DHSA 3QPAA 1PF7E 4N6HA 2HF2A 1F6WA 2BIFA 4ZO4A 1E1KA 4BAZA 2QTMA 1L4LA 3W90A 2QX9A 4YP1A 2GZAA 5L0IA 1VYUA 4TTJA 3U7HB 3TR6A 5B4TA 1EU1A 2Y2VA 4JVOA 1KMHB 1R0YA 2CKMA 4BU1A 3AG2C 1CG6A 3R7FA 3ZLJA 3IB6A 5LMZA 5B58C 2ZUVA 2B37A 3VO2A 1UFVA 1QFMA 3FOEC 2P2YA 1T2AA 1GNRA 1X7YA 3SFVA 4JJ4A 3BKWA 4D6PA 2PVSA 1UBMS 1A1SA 3EVTA 4PSVA 5FXMA 1OLXA 1Y37A 3AJEA 3GZNA 4R05A 2CYDA 1ZLXA 1Y33E 1KWKA 2R8ZA 2CVQA 3H8JA 1E1YA 3P96A 2QB5A 1WUYA 2WSSA 1VMDA 1Y4DE 1FVHA 2NV6A 1M7GA 3OOYA 3MJVA 4Y0VA 5TPZD 3PEYA 2KBEA 4U39A 3EFOB 1LDEA 2WJJA 3HV0A 1DADA 2RAFA 4WMLA 1K6XA 4TUYA 4NH4A 4MVXA 1UMBA 4RLQA 4KR7A 1M6EX 1U8EA 2PBEA 5KSPA 1Q21A 4L74A 5JS6A 3O03A 4EFKA 1OKKD 5A5FA 2AKAB 2QAGA 4TTIA 3OZIA 3VYUB 4MWCA 4RY9A 3M4CA 5FEUA 4Q7LA 5JUWA 3ZU2A 5IUNC 2BFWA 2P11A 3T0FA 4XI9A 2FY8A 2AD1A 2KI5A 1N5LA 1TUIA 5TEWA 2ORWA 3CN9A 1PJ8A 4M4SA 4TLLB 5EMKA 1NT2A 4OB7A 3HDYA 1U9IC 2JLRA 3ZY2A 4RF3A 4UHCA 2LKCA 5KVQA 3MPUA 2CJXA 3MLAA 1O95D 2IPOA 4I5EA 5K3CA 1XKQA 4C7JA 3K2IA 1ZCFA 4BBZA 3B0PA 3OESA 3QA3E 2GVDC 3FOOA 1OWLA 2HFKA 3EC1A 4ZPXA 3T7TA 1FYVA 4NMWA 1G9SA 3LY5A 2HF7A 3SIRA 3PGKA 1CGOA 1M67A 1RCTE 2WFAA 4QDUA 1Q0SA 1XVUA 2OFWA 4QTTB 3A27A 4KPEC 3MLBA 3LS1A 1ZNQO 4LV5B 2DPGA 5AI9A 3M79A 2VXCA 2QGNA 2OHOA 1P17A 3N2NA 5KCZA 4KMRA 1K89A 1MAHA 4D8XA 2O1XA 3ZNOA 3T9OA 3EXIA 1M2VA 2FVYA 3F5QA 2DYKA 2GJ4A 1E0AA 4Q3OA 4YJ2B 2XUOA 4UXHA 3M82A 4DLPA 1AC5A 2GM5A 3NAGA 1ZRNA 4HFRA 5FBHA 1JMVA 4MS4B 3KZKA 1DKOA 3A10A 4L8VA 3EOAI 3RNOA 4AWAA 1RJDA 4LOHA 4WZAB 1L5ZA 1YL5A 3HYSA 2N46A 2W2LD 1NKVA 1YVRA 3TSZA 3QWAA 1SUIA 1UBCA 3T61A 4AS2A 1FR0A 1RWQA 1E6UA 5H70A 3GWNA 1JHDA 2WQ7A 1KK1A 1MRSA 4B80A 4YCMA 4Y2HA 2AXEA 5AW0A 2Q2QA 4EJ6A 2JHCA 3P2YA 3OQPA 1NLUA 3VU1A 3VNBA 5G53C 2IYAA 5DT9A 3VR2A 5EHHA 5BVHB 1QOPB 2BT4A 1HQYE 1B43A 1M6VB 1I01A 4ED9A 2LGJA 4HEAJ 3ILYA 1KR2A 2QTZA 1Y7PA 1Z4KA 2XF2A 1JLKA 1H3NA 4US0R 2JFYA 4ZOAA 2DBZA 2B8WA 1Z5NA 4HDOB 4JT8A 1JH8A 3Q7GA 4FI3F 3FN4A 3NAZA 4G36A 5KKCA 2I67A 3JAKA 3PYLA 1C41A 1JBQA 2R6DA 1P6XA 4LXHA 4BG0A 4P83A 2FQYA 4DR2B 4K6GA 4BPBA 1Y82A 3MT0A 2ZBRA 3FMGA 4IIEA 3I72A 1LSOA 1E3IA 5EMLA 2JLUA 4P86A 3K0AB 4BRUA 4LG1A 5A5GA 1PFVA 4M7OA 3ZDZB 2Z43A 4BMPB 1Z0FA 3QPUA 2WAYA 3TTXA 2PH7A 3V1KA 4U5HA 4V0NA 3N3BC 2DWPA 3UH1A 3HDTA 4P4LA 2HUPA 4BS9A 4PZYA 3WNQA 1WU7A 1O54A 3S28A 1NMEA 1UBGA 3PDJA 3H8VA 3NT5A 1ZO8A 4B4WA 5IG2A 2IOFK 4R31A 3RQGA 1K9VF 3HTKC 2NVOA 3E8XA 1EJBA 1L7NA 4HN4B 3R3JA 4LDPA 4KVGA 4KUHA 4PACA 1ZNXA 1OT3A 4ZIRA 1I2ZA 2DFNA 1X80A 1XZPA 3JAWB 1G55A 4BEBA 4AF7A 3GELA 4K40A 2VDLB 3R9KA 3G9TA 1DB3A 3GVIA 3MXTA 3F96A 3LA6A 3U3DA 3B3JA 3QU2A 3RYCA 1H5QA 2JLQA 5AO9A 4I4IA 2M2IA 5DYYA 1M6HA 3L4EA 2P78A 1IZ9A 4PX9A 4TL9A 2XLHA 2X9VA 5AGFA 3LUBA 2EYQA 3WLMA 2NZYA 4C04A 1FNNA 4F4CA 4IGIA 4UFOA 3LRTA 3LC0A 2M6SA 3Q88A 4Z6KA 1XQVA 3GA0A 1W1WA 4ABTA 1K7XB 2VF7A 3ZLBA 1N4DA 2HEIA 1IVSA 3LDHA 4RDXA 1AKRA 3RWBA 2HRDA 4RULA 3QOYA 1MD9A 2NUTA 3FRJA 3RPEA 2I4NA 5IT5A 4GU5A 2UYGA 2IYPA 1T4MA 3NXSA 2HJ3A 3DD5A 2XCRB 3UH0A 3WK8A 2DR3A 1TVCA 4JGIA 1KEEB 1T5DX 2QE6A 3F73A 2AYZA 4L8YA 1GSOA 1UOEA 1NUHA 3PNOA 5HZKA 1KE2A 2EF0A 2VHJA 2FG7C 4YK7A 1U2RA 3COVA 4DCJA 4ZARA 2CXSA 2TSYB 4MO9A 5CJ2A 3UCFA 5BN3B 4FQ8A 4XWGA 2PU7A 4B71A 1NXQA 5KTOA 1XRMA 4Q1AA 2NG1A 5JAIA 4N82A 4UHFA 5CLHA 5CGZA 3KUXA 3QF4B 1XNRB 1C1XB 3B36A 3DBOB 1Q0QA 1BMFA 1ZD5A 1AE1A 3ZHYA 3D6JA 1MORA 5FCDA 4S0ZA 3IODA 3BE5A 1UMDA 3VGPA 3K16A 2BHSA 3ZDLA 4LVCA 4HT3B 3NDRA 4GR5A 5IABA 4BO5A 4UE6A 1LLQA 1WULS 5C52B 2AMYA 1RPTA 2YY5A 3VDRA 1CRPA 1U6HA 3TF5A 4Y1FA 1MVLA 1RKUA 2JCGA 2CLIB 5T3WA 1VE9A 1GTZA 2Z2JA 2LFFA 3KOOA 3LXMA 1XDDA 3CCFA 3GFOA 1AHPA 4C9BA 3VYWA 1D6SA 3JYHA 3A7DA 3KOMA 1WMSA 2QI9F 3PUXA 4HJXA 5SYNA 1VPDA 4IVRA 1U7OA 4UTPA 4HNAB 1QGED 3AVPA 1A41A 5L3ZA 2AQ8A 4NSNA 5IMSA 2WAAA 3GNTA 2YWCA 4X44A 2OQ2A 2XR1A 4YPVA 3GLRA 2A5DA 2J8ZA 4BZWA 1W85B 3HHPA 4ZQEA 1YV9A 5E7QA 1T6YA 2VP5A 1NSGB 2HIHA 1W36C 1ND5A 1N78A 1KU2A 4KODA 2H1RA 4P93A 3NUZA 2GK3A 4HWSA 1P5RA 2ZETA 1VMAA 1JEQB 3NHJA 5DBGA 2PMFA 2XUHA 1Y1RA 4N0QA 4GYJA 4NCQA 4MP8A 4XVUA 1VQ1A 2FNAA 1NKTA 3B71A 3DGEC 8AT1A 1J21A 1BNCA 4QEZA 2IOHA 3FCYA 4AJPA 3FOCA 5A0VA 1ESDA 4WJKB 2WL8A 1GAJA 2XAAA 1NM5C 5FUQA 2I1LA 2DBYA 1ZQ1A 1XLTA 4INPA 4H3HB 3W2TA 2XECA 4A8JA 3SZGA 2ZIAA 4NARA 4DLBA 3TZQA 3LIIA 1N0VC 4B5KA 1CUGA 1QP7A 5HV9A 3UJPA 4FZVA 3Q6MA 4BMYA 2OP0A 4QQRA 2VF8A 1LLDA 1ZINA 1OW3B 1WUTA 3B6KA 4N03A 1KPHA 4K9DA 5HKLA 4M9CA 1YJCA 2FOLA 4ACAA 4JUFA 1QBKC 5CX4A 1NNLA 2BFCA 3USCS 3KT3A 4MKIA 1YQUA 1TB4A 2YL2A 2C98A 1UT5A 2W45A 4EHBA 1Y3DE 1U90A 3OCCA 1Z9BA 3RTGA 3VC1A 5FTLA 1JJBA 2A14A 5ALVA 4ALIA 2YNMD 1V3TA 1Y3FE 3HB5X 3G2QA 3AOGA 4AO7A 3LQKA 5DP1A 4Q24A 5HK9A 4OBWA 4N0PA 4M1YA 3G0IA 3RUDA 3L0IB 1SBQA 1ZMRA 3AX6A 4EB3A 4HFNA 1IDOA 5LXTF 4ZXFA 4HH4A 3PVCA 4FZJA 4HZIA 1WCIB 2BY4A 4OIQF 3VXKA 4DIFA 2FQWA 1VYKA 1WNFA 8ADHA 1V39A 1SU4A 1TC1A 1JIXA 3PR2B 1DO8A 2ZYUX 4KIFA 1X7XB 1COWD 2F9MA 1BZYA 1CRQA 3CX8A 3T9FA 4CCSA 2Q9UA 1A5BB 1NP6A 2B92A 2MWQA 5EZSA 1Q91A 1U98A 4PSAA 1Z6AA 2CHUA 1NN0A 4KYVA 1QFXA 4PZAA 4ZEVA 3CZ5A 4NJEA 1ISMA 4URUR 3NKVA 2H1SA 1HO3A 3IOYA 2RK6A 3ESAA 3MHPA 3IT0A 2QW1A 2PG3A 4JSYA 2XWQA 3T7EA 1E18A 5KYNA 4MUNA 3FH0A 5GM2A 2HV6A 5A6JA 4Y8VA 4MUYA 1B93A 3ER6A 3OQHA 5KINB 2RHJA 2ALJA 4GLBA 3KXLA 1SWVA 4YH1A 4KE7A 2EPLX 2BF7A 3MTDA 3IAEA 1AXRA 4YJHA 4YPOA 4MTFA 4R9UC 3C3AA 4IHJF 1A2QA 1OYYA 1YIDA 3ZWOA 1YD7A 2PE5A 3IOCA 3PGMA 5SZJA 1GZ4A 3ZJUA 4UEKA 1NIJA 3JD2A 4L3OA 3GUZA 3IE2A 2KMLA 5C8YF 1QV6A 5L3RA 1GITA 2CW0F 2ONKA 4DG8A 2YFKA 3WX0A 2X4IA 2P9YA 4PCUA 3Q40A 2X8BA 5HQ3B 1C7RA 3CRZA 4RAOA 3ME5A 1K08A 1I10A 4L8LA 3S27A 4PYQA 4I50F 2OC9A 4C2TA 1KI4A 2CJWB 3ZCPA 4GWGA 4CKCB 5E9JA 2PZAA 1GEEA 1I4OA 3VV3A 3H05A 2C95A 4QGSA 3MWEA 2CK3A 5HQJA 3JVEA 1S9DA 1I5EA 2XE8A 3AKZA 4O4JB 2I2CA 2WFLA 1E0DA 3U1VA 3HWWA 1DC6A 4ARUA 3CH4B 3CX6A 1HG1A 2Q5LA 4MKHA 1RLTA 1HETA 1YVUA 3BRWD 3ITDA 4JXKA 5DF1A 4ZCSA 4IIJA 1GLGA 1ILWA 1I3MA 5L7WA 3ED5A 3DDHA 3LNCA 3WFZA 3FE2A 2OBFA 3TFOA 3NIWA 4UCXA 1WETA 2P7IA 2YHIB 3T7AA 4HV4A 1F2UB 5F73A 1T3GA 1U9CA 2FJUA 3STVA 2CF6A 1IK6A 4BP3A 3AJRA 1NW7A 3HCCA 3U9JA 2F2TA 2OUIA 3BH7A 2P6RA 1J70A 2OBXA 1XAHA 5IJ0B 1N5RA 2YZMA 3H4IA 3CZAA 3X2EA 3OFND 1QLJA 3E9NA 4A6EA 5CB0A 3ABLC 2MSKA 4DYVA 1T13A 5DS6A 2C4WA 1E1LA 3U4CA 4CG1A 3UW3A 2L82A 2G72A 4YJGA 1NRIA 4UARA 1Y5LA 3BEDA 4JBLA 2FPXA 5GOZA 3D7NA 3KLPX 4Q47A 2ORED 2DETA 1WZUA 2L18A 3FCOA 1MABA 2ZWIA 1FIUA 4ESHA 2X0NA 2FPOA 5LLSA 4Q6WA 5JNTA 1KO1A 3T1YB 2PMDA 3SVLA 1MQVA 1VTKA 1EVLA 3GA7A 1H66A 1PL0A 3I4FA 2IWHA 4JR0A 2HA5A 2RK3A 2VH5R 1KP3A 1LF5A 2Q5JA 3ZQJA 4FEEA 1LPBB 2AWCA 3U4GA 2BCJQ 2DU8A 2DECA 5AW7A 4C7XA 1GDDA 3LVQE 3WYNA 3N0RA 1BMTA 1LEHA 3U2MA 1FMJA 4QYWA 4KGDA 1EK1A 3KEOA 4KR2A 1C81A 5D85A 2I4OA 1IQRA 3SF8B 1VCNA 1ZNWA 1X7ZB 4O79A 4JEUA 3MPOA 2EPKX 3VR4D 2Q8QA 1XEAA 1WKCA 4X66B 1E1CB 3L0ZA 3PIDA 1WWKA 5EP2A 4CEIB 1M72A 3H5NA 5SY4A 3WJ1A 3QFHA 5E8JA 4O7GA 1OXUA 3STYA 3BTVA 1MC1A 1VZ2A 3S40A 1GG2A 2NACA 1OI7A 1JQJC 4H1VA 4V1CI 1SPXA 2FZWA 2AQIA 3W8EA 4BRSA 5DK4A 3ABKC 4FPXA 2PRSA 4ZV7A 5BQIA 4FEGA 5LZ2A 2H4WA 3BFJA 2W2KB 4N5MA 4ALLA 1CGNA 2H0RA 3EIWA 1V55C 2QPTA 3ROXA 4C7MA 4HHEA 1BWPA 4XPYA 1MMDA 5BV7A 5T64A 2H7VC 4CU2A 4PQFA 4OPMA 4CS8C 1HDIA 3I5UA 2XZLA 3RLFA 1Y6JA 1TFRA 4IMIB 1V3QE 3JWJA 1WX1A 5C7OO 1SVMA 2IEBA 4ZFNA 1V2HE 3G7SA 3QG5A 2DLCX 4MVZA 3K1HA 3CINA 3GDFA 4TL7A 4HL6A 4IJMA 3OT4A 1V5WA 2NSGA 1Q6YA 2Y39A 3QXHA 1Q11A 3AW8A 4UHBA 1SOMA 4YDRA 4URYR 2IVFA 3O73A 4BLSA 4K3VA 1OFTA 3ICWA 4DOMA 1CT9A 2Q62A 4R1TA 4L76A 3OZGA 2F3PA 1Z5UA 3FYHA 2WNSA 1THZA 3INYA 2ETSA 3V4SA 5AC4A 1E32A 4J9VA 2IE8A 1A5AB 4DMRA 4CQMD 4ZC1A 1YDHA 1ABFA 3E7FA 3FWNA 3IDZA 3DMFA 3ZE7A 1TCVA 1H2EA 3FB4A 3THOA 3DAGA 1MF7A 2WVOA 1G3MA 3V8MA 3K7DA 1KAOA 2R7VA 3PQ4A 8GPBA 4OQFA 2PH3A 4H7PA 4C06A 1WB4A 2A7QA 2Y1KA 3C97A 3R2PA 1NPYA 4QYSA 3IVGA 2VP2A 3O31A 3NTLA 2ZCJA 3IL2A 2C9OA 4YC7A 4GWLA 2QN8A 3DAOA 1V8OA 5HGJA 3HL4A 1OIWA 3AY6A 1YAUO 4F85A 2KK1A 2ZI9A 3CN7A 1GTL1 3Q3GE 2PLNA 4GNKA 2MSEB 3EAGA 4JTDB 3ZHCA 2BE9A 3UMFA 1EK5A 3P4UA 4E30A 2Z83A 4Y9SA 4D3ZA 2BV3A 2ZM6B 4MCIA 5TJ9A 1L2TA 1W2GA 3DL2A 4WFKA 2C77A 4Q00A 2DFKB 5EZYA 2CD9A 1VB3A 3ZGVA 2BPOA 3K1JA 1XMVA 1LJ8A 4HVCA 3PD7A 5AVRA 5FFFA 3QH4A 3QMKA 4ARSA 4X6YA 3KUCA 4LGVA 3VH4A 2R2AA 3M0EA 5F5NA 5B58T 2A6PA 7GPBA 1GUYA 4HWGA 3OIDA 4NHOA 4PLPA 4RLSA 3OBIA 4NBVA 3ER8A 1IIBA 5B6IA 3NEPX 2J09A 3WLRA 1ECBA 2CNNA 2W22A 2X7XA 3R8XA 4LIPD 1XMOB 3C24A 1MFZA 4EG0A 1FDOA 1VKOA 1BROA 4RANA 3DJNB 1RXVA 2GEVA 2G5TA 3FAZA 5B7GA 1SIWA 2EKPA 4TGLA 4NYMQ 1Y4AE 2YHUA 2HEGA 5E3CA 1RBQA 1T6UA 4R0NA 3ESYA 3AJAA 5BRJA 4PHHA 1E8MA 3LHFA 3DA8A 2FSIA 1UBHS 4F4HA 5I7RA 2B7LA 3H5TA 4ZCQA 5GINE 1KZHA 3AP2A 4KYTA 3W78A 2H1IA 1N9KA 1W0CA 1P7YA 3OM8A 3FHCB 4M22A 4GNRA 4WZBA 4IOMA 4YJ3A 3Q85A 4LYEA 4GKAA 4F3KA 1QYXA 1JPJA 1MA0A 1LD3A 3OZTA 2YL1A 4Q3KA 5SYMA 1MO5A 1X9HA 1IXZA 1J0BA 3NBQA 1WDTA 2XEXA 1VBMA 4YIKA 4I9HA 4D4HA 5IARA 5COGA 2WY2D 3H75A 1XT6A 1IIRA 2XJ9A 4YUYA 3DE3X 4BMXA 1ZVJA 4UUQA 2P9FA 5DNYB 3LY7A 2E21A 4XWKA 4EG7A 1GGQA 2HSQA 1ZN9A 3HACA 3OEOA 1KMMA 3O3NB 2WEKA 2CHVA 1G21E 2Q1TA 3FDXA 3P2JA 5JNUA 2G3VA 4KAFA 2Q6KA 2XDAA 3RQEA 5JFOA 1WV1A 2QQ0A 4BLUA 2OCXA 4PC3A 4V0QA 3TD7A 2OV8A 2Z5FA 2H2IA 4TS1A 3P1JA 1PTJC 3SYKA 1XMPA 4BFLA 4NYMR 1NZDA 2YY6A 4IARA 1G8SA 2QJTA 5B30A 1M1ZA 4A10A 1M74A 2OVFA 3T1QA 3AFIA 4FNGA 1KEWA 3GOQA 2AV6A 2JCBA 4BN4A 5AESA 4B34A 1QZ3A 2GCEA 4G56A 4IIUA 4LZPA 3ZW8A 1JHQA 4CCYB 2HMZA 3LSTA 4DV3B 4CDAA 4CSAA 1W5AA 4TL6A 3BCSA 1K4YA 3BGDA 3OZUA 3CM0A 1SA0B 4IVPA 3QZUA 5I7UA 3NKEA 4ANJA 4EUNA 3NALA 1FVOA 2IF2A 1KERA 5KTYA 1NJGA 3VJRA 1QZZA 1WBDA 1KXZA 5KTPA 3I1FA 1U2QA 3IBGA 4ISCA 4DR3B 1C4OA 3GBVA 2XQKA 3DE5X 4L5JA 3HM9A 2FV8A 4B43A 2WJGA 4MV5A 1E9EA 4IZIA 3Q6IA 4ZYZA 5F9HA 1ZSNA 221PA 4MKRA 3ED1A 2PKQP 2PPLA 3FTEA 3KSAC 4TYMA 5KOJB 4PE5B 3SOPA 3VZQA 3F2VA 4EM6A 1F60A 3S81A 3T5MA 4DQKA 4FFRA 4ZRDA 2G04A 1Q0TA 3HY4A 3LBIA 2BUBA 3KPJA 4E0HA 4UNPA 5CTJA 3CUKA 3DPUA 4AKSA 1PJSA 2VYND 3OE7D 1B8OA 5JBQA 4IEIA 1EFPA 1ECPA 4EHJA 2H5EA 4GMFA 2VH3A 3NHMA 5PGMA 5CW2A 5I3ZA 4WOCA 4I1UA 4L9AA 1NW5A 1YCFA 2Y6UA 3AUUA 3ODGA 2H1VA 5CG2A 1BU5A 4TS4A 1XTZA 2WDZA 3VAYA 4HZUA 3DZ8A 3ZTTA 4CN8A 3CUVA 2E1RA 3UN1A 2H85A 2FWIA 4U9EA 1BWRA 1LKZA 1YB5A 4LUCA 4X1YB 3RH0A 1SUAA 4XH9B 2XMPA 3MCTA 2J4FA 3OIGA 2P9JA 1ZNZA 3MFNA 4DIEA 2YV4A 3ZHSA 4R7TA 3VKGA 4LTDA 1CUXA 2G40A 1XF9A 4Z4IA 2FUKA 1WQ4A 3RTDA 2NSDA 4KZPA 1Q12A 2WKRA 4IY1A 1DQNA 2O2IA 3FBGA 3KR2A 3M9LA 5JNSA 2BMDA 4RESA 3P9KA 4DVZA 3F9RA 3QJGA 1BHSA 4Q21A 4GPBA 4KOEC 3C8UA 2IZ5A 2HU7A 2ZYHA 3LYHA 4ZAGA 4IUYA 1OWPA 2H0AA 3PTLA 3MGBA 2CB0A 3DHNA 1E0JA 4GMHA 4EFDA 4IOKA 2YZ2A 2VRCA 4IZ6A 4D82A 3A58B 1X7YB 3OJOA 3ICQB 1JUDA 3VNRA 2ATEA 5T4EA 3A37A 1WBBA 3QYPA 4Z9HA 4IZHA 3UMSA 4RDHA 5M2QA 5I45A 1YULA 5ITZA 3MVEA 4ZO6A 1OLXB 1WW2A 3GZNB 2WTAA 1T3HA 3B9BA 2UUIA 1V48A 5FH9A 2YIVX 3IT2A 3H42B 4ERXA 5TGZA 1WXEA 4FGLA 5KHAA 2BD0A 3OPYA 4LOJA 3ND8A 2QU8A 2YZ7A 4D8TA 5J23A 2PY6A 2KB0A 2YZKA 2Y99A 2M4EA 2X5JO 2BR4A 3DBRA 4LYDA 3O38A 5ICGA 3TRKA 4TUYB 5C7IO 3QFSA 1UMBB 5DNWA 3B3FA 2XB6A 1KJZA 1XU7A 4FFNA 4BQPA 1FMTA 2P4HX 1GQRA 2QAGB 4FAPB 4MGKR 4MUMA 3EWNA 2Z0MA 1ZM9A 3T6JA 1T0IA 3A26A 1QQ3A 4IIFA 2AWOA 1Y1SA 3ZQ6A 4BNMA 5FOQA 1KAEA 2WSSD 1U7PA 1EWYA 3HWRA 3ESDA 2B1QA 2VUTA 1VBKA 4II3A 1PR5A 4CL8A 5F3DA 1CSEE 1AXGA 5EP1A 2PBZA 1EESA 1WRBA 3TX6A 3GRYA 1EB9A 4HUJA 3F1KA 2JGFA 4I66A 3F7NA 1D1CA 1V37A 4UVGA 3DXJF 3M4YA 2V3WA 4F7WA 2QY6A 2G9NA 3IOMA 2QMOA 4CDRA 4GM4A 1ZR2A 3M8KA 2H16A 4PIVA 3GFSA 1QR6A 1KZGB 4FDLA <