3VAYA

Crystal structure of 2-haloacid dehalogenase from pseudomonas syringae pv. tomato dc3000
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
230
structure length
230
Chain Sequence
MIKLVTFDLDDTLWDTAPAIVGAEAALRDWLAEQAPKLGPVPVEHLWEIRSRLLDEDPSFKHRISALRRRVLFHALEDAGYDSDEAQQLADESFEVFLHGRHQVQIFPEVQPTLEILAKTFTLGVITNGNADVRRLGLADYFAFALCAEDLGIGKPDPAPFLEALRRAKVDASAAVHVGDHPSDDIAGAQQAGMRAIWYNPQGKAWDADRLPDAEIHNLSQLPEVLARWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords HAD-superfamily hydrolase
publication title Structure of 2-haloacid dehalogenase from Pseudomonas syringae pv. tomato DC3000
pubmed doi rcsb
source organism Pseudomonas syringae pv. tomato
total genus 80
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1600 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3vayA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3vayA01
4L57A 4EX6A 3OCZA 4IG4A 3UMBA 3L8GA 3OCUA 1YV9A 3HLTA 3ET4A 2FEAA 1L8OA 2FPRA 4G9BA 5IT0A 3NRJA 3ZX4A 2Q5EA 2FPUA 3KZXA 1T9ZA 2RBKA 1RLMA 4F72A 3N1UA 5AM3A 2AUTA 4OD0A 3QYPA 1XP5A 3ZX5A 3WGUA 5AKZA 2IOHA 5AKLA 1Z4LA 1Z88A 3EF0A 5E0OA 2YY6A 2ZOSA 5AW4A 1U2SA 5ALZA 3B9BA 1WR8A 1X42A 4YH1A 1NF2A 2GFHA 1RQLA 4BEVA 4YCMA 1PW5A 2FDRA 2RAVA 4KNVA 4CNQA 5AI6A 3L8HA 3UM9A 3WKDA 5AVXA 2OBBA 3UMCA 1RKVA 5ALNA 3SHQA 1ZS9A 2HO4A 3QU2A 1SU4A 3ZWDA 2W11A 2IOFK 3B8EA 3ZTWA 2G0AA 3CNHA 4Y2UA 1ZD4A 3W5DA 4XQ0A 2DQSA 2BDEA 1FEZA 4EENA 4UM7A 2WF9A 2HF7A 4KX3A 4OFZA 5ALDA 2FPXA 3U26A 5AESA 1TJ3A 4Y2TA 3QUTA 3KBBA 2MU1A 4KNWA 4NABA 3PGVA 4Y2PA 3L0CA 3L0YA 3K1ZA 1RC8A 4HGRA 3AR7A 1J97A 3FPBA 5ALXA 1YDFA 1ZD2P 5AW6A 2BDUA 3WK9A 4Y2VA 3I1YA 1L6RA 4BKMA 2YMLA 2B1RA 3ZTYA 3QLEA 3OCVA 2YBDA 1ZD3A 1S2OA 2FPSA 1RPZA 1QQ5A 1Y8AA 2B82A 1LTQA 3ZVNA 5AI5A 2B8JA 4HGOA 2PR7A 1VJ5A 3QGMA 5AVYA 4Y2YA 1YMQA 1U7OA 4HGNA 3N28A 1YJ5A 3P96A 4UMFA 5AIAA 4RETA 2OYCA 4NWIA 2D2VA 3UMGA 3IJ5A 4XPZA 1Z5GA 2P69A 1EK2A 2B8EA 2CFSA 3QUQA 2AH5A 4YIKA 5AHXA 2AMYA 4YCLA 3OCWA 4C4RA 2I54A 5AM1A 2I55A 4CF4A 3WKBA 5ALRA 4JDPA 2OA0A 3MPOA 1RKQA 4ZEXA 1ZD5A 5ALLA 4CF3A 3FVVA 5T41A 5AVWA 2HCFA 4UU1A 3NANA 5AVZA 3FGOA 4Y2XA 2ZBEA 4CF5A 5AIBA 5FP0A 3WK6A 5AM4A 1NNLA 3NAMA 1YS9A 4I9FA 2Q4RA 1U02A 1Z4QA 3NASA 3E8MA 2C88A 2YJ6A 3MN1A 1WPGA 4UMDA 1SWVA 5A3SA 3TLMA 5AW1A 5AI9A 3IRUA 4DCCA 5AKIA 5ALQA 3PDWA 2W4MA 3ZVLA 2GHQA 4HGPA 3CZ4A 4KX5A 3R4CA 4DFDA 1O03A 5AICA 3ED5A 3N5KA 2FPWA 1L7MA 3SLRA 1RQNA 2EAUA 1YNSA 1Z4PX 3ZVMA 3AR8A 4XOUA 2JAUA 3GYGA 4EX7A 1XPJA 4L6AA 5AK6A 1F5SA 4UW9A 4EELA 3OCYA 3RFUA 3S6JA 4E88A 2FUEA 4FFDA 3E84A 5AW2A 1RLTA 1T5SA 3A1EA 4AS2A 3U7FB 3OTQA 2G09A 3OCXA 1VFPA 2W43A 3N07A 4I9GA 5AKYA 4UAVA 1IWOA 2GMWA 5ALEA 2JAWA 3M9LA 5ALUA 3R9KA 1WVIA 2WF8A 2WHEA 4J03A 2NYVA 3KD3A 2I6XA 3MC1A 1L8LA 1L7PA 1U2TA 4EZEA 2IA5A 4UMEA 2HI0A 3WGVA 4UAUA 1Z5UA 1CQZA 3HYCA 1ZJJA 2YJ3A 1SWWA 4UU0A 2ZBDA 2HDOA 1RKUA 2P11A 3QXGA 3WKAA 3I76A 2CFRA 4AS3A 3ZU6A 2FI1A 5AK3A 5AKXA 4IFTA 1S8OA 2CFTA 4BX3A 2YJ4A 3ESQA 4HAIA 2GHTA 1Q91A 5AVRA 4BX2A 4FE3A 3DAOA 4QQFA 4NFLA 1NRWA 2P9JA 3EPRA 3MMZA 4HGQA 3SKXA 3QUBA 4NAVA 5AVSA 5AW5A 3M1YA 2C8KA 2G07A 3KOOA 3ET5A 5ALPA 3BWVA 3BA6A 2R8XA 3OPXA 4J2TA 5AVVA 1TJ5A 3L8FA 3KDPA 3NALA 5AKGA 1Z4KA 2MSNA 3NIWA 1RDFA 5AM0A 4O8CA 2R8YA 2O9JA 2NO4A 5ALKA 3E58A 1Z4JA 3L8EA 3ZWKA 2JARA 3A1DA 4AP9A 3ONNA 5AW8A 2G08A 3SD7A 3DNPA 5AKEA 5JJBA 5AW9A 4UMVA 5IT4A 4UATA 3A3YA 2HOQA 3WKCA 1L7NA 1KYTA 5AVTA 2X4DA 5ALGA 3AR4A 2FUCA 4BYGA 1MH9A 4KYTA 2VKQA 3I28A 2C8LA 1VJRA 2CN1A 3PGLA 4G63A 1EK1A 2WM8A 4L6CA 2JAOA 3FZQA 4MUMA 4MWOA 2GO7A 5ALOA 4OHFA 4ZEVA 2C9MA 5ALIA 4YIHA 4JB3A 3AR5A 3L7YA 1RMYA 3AR9A 3SMVA 5ALSA 2ZBGA 4C4SA 1LVHA 2EARA 1U7PA 2P27A 1QQ7A 2PQ0A 1RRCA 2R8ZA 3IB6A 2B1QA 4DWOA 3I6BA 1K1EA 5ALFA 3QX7A 3W5CA 2G06A 1RMTA 3VAYA 3EWIA 1N8NA 2PKEA 3KC2A 3SKYA 4BX0A 4Y2RA 4CE6A 3FM9A 2RB5A 2EATA 4HYTA 1XVIA 2WFAA 4FYPA 4UASA 1TA0A 5AK4A 3AR6A 5ALJA 3WK5A 5AW7A 3L5KA 3U7EB 5IS2A 5AVQA 3NUQA 3L1UA 1ZRNA 3U7GA 1QH9A 4B6JA 4BNDB 4DW8A 2IOFA 2I33A 4C4TA 4BBJA 4RESA 5AVUA 5AI8A 3SF0A 2HF2A 5ALYA 2R8EA 1TJ4A 3QU7A 2Q4TA 3E81A 5ALTA 1Z4NA 4Y2JA 2B0CA 3PCTA 2NO5A 2JGAA 3L1VA 1RMQA 5AM2A 3ZI4A 2YFYA 4Y2SA 3DDHA 1RLOA 5AW3A 4GIBA 2YMPA 4H1WA 5ALWA 3D6JA 2ZXEA 5AK5A 5AKHA 2QYHA 4PNHA 2I34A 1J8DA 4GXTA 3WK8A 2YJ5A 2YMMA 5AKKA 5AM5A 2IYEA 5A3RA 3F9RA 3ESRA 2B30A 5AI4A 2YMQA 5ALMA 1QQ6A 1Z4OA 3A1CA 4BEWA 3WKEA 2AGVA 3N8GA 2ZG6A 1ZOLA 3QU4A 4OCZA 3AR2A 3WK4A 2RARA 2HSZA 2WF5A 2WF7A 3QNMA 3U19A 3EF1A 5AI0A 1QYIA 2G1AA 2QLTA 3U13A 1Z4IA 3U7HB 4ZEWA 2ZBFA 3B9RA 3FPSA 2I7DA 3ZUPA 3ZW7A 5AKJA 3R09A 4EEKA 2OM6A 2G80A 2ODAA 3QU9A 4UARA 4BNDA 3L0BA 2WF6A 1CR6A 2YN4A 4YCNA 1T5TA 3QU5A 1N9KA 4YGYA 1O08A 1WZCA 1TE2A 2HX1A 4Y3UA 1Z4MA 5AW0A 3AR3A 3RF6A 1JUDA 4Y2QA 4NV0A 1ZRMA 5A3QA 2O2XA 1L7OA 3W5BA 4KN8A 5ALVA 3J7TA 3WK7A 2BY4A 5ALHA 2C4NA 2HHLA 4F71A 1AQ6A 4QJBA 3W5AA 3QUCA 4UM5A 2HEGA 1Q92A 4XE5A 3DV9A
chains in the Genus database with same CATH superfamily
4CMAA 4GMGA 1N4DA 5BNTA 4RHXA 1RNLA 5LOVA 2A1UB 5BY2A 1IPFA 1TW2A 4XW2A 2VSXA 3DAYA 1Z88A 4ARAA 4B75A 4OG2A 1U2SA 1HE4A 1S6YA 1SXIA 5I6DA 1AKVA 2YVQA 2B1JA 4J76A 1A50B 2RAVA 2X3FA 4RTSA 4MP8A 3AVUA 2ZYUX 4YQZA 1DI0A 4M22A 1YZKA 3V6MA 4F4DA 3EFOA 1YCDA 3D7SA 3UPDA 3NVDA 3QRWA 4LBVA 4V03A 1RZRA 4Z9JA 1FXWA 2VQ3A 4WUTA 1QH0A 2G3KA 1S2OA 3FZEA 4FFMA 3E1SA 4TUYF 1Y5IA 3NC4A 4MPRA 5BRAA 1NBMA 5FBLB 1JJBA 1P1HA 3EK2A 4HDRB 2XAAA 3UJDA 1WA5A 1HLFA 1BXKA 4OQEA 1NOIA 4KXYA 3ETLA 1NXXA 1DIHA 2J3JA 4GM0A 3P9XA 3SPXA 2DWPA 2CUNA 1MA0A 3TAHA 2YQZA 3D4LA 1I9CA 5HMLA 5AKIA 1XCJA 2YNMA 1FUIA 4BB0A 1RYDA 4KRFA 1DGQA 1J23A 2P67A 4O2RA 1QO7A 4KW7A 5IXSA 1YFLA 3A6KA 2KBEA 2RSEB 3M9LA 3I83A 1TWGA 2YRWA 5JXGA 1SEPA 1VTKA 1Z82A 4MUAA 1H93A 4C88A 3FYCA 1HW1A 2NO0A 2O54A 1E2KA 1XZAA 1I4LD 1VHQA 4G4JA 4N7BA 3VMFA 3ZI7A 1N1MA 4J4HA 1XXLA 4MVZA 2UAGA 3G6WA 3CEAA 4NY3A 1DC8A 3I9FA 2QTNA 4GXQA 3VZSA 3DJUB 4KGVA 4JVLA 2RGAA 4NCQA 1T3HA 4R8LA 2X9VA 1AV7A 4J94A 1ZL0A 4I1IA 1DBSA 4AP6A 2W2LA 4K7JA 1TQ8A 2MT9A 4PG5A 4KQXA 2IZ7A 5J23A 4NAUA 5BNIA 1K8QA 3NBXX 1VIAA 2FPIB 4EPXA 3TQFA 3LLSA 2GEBA 4RX1A 4HAOA 3C2QA 2R7KA 1GQRA 3SM3A 4ZT6A 1V1RA 2QY9A 1KBZA 4C4ZA 1DOWA 5F35A 3Q9LA 3R0JA 4Q4HB 2A0FA 2ZUBA 4L27A 1YE8A 1KMIY 3R5XA 1U94A 1GT6A 3PUXA 3KSBC 3DQZA 4E5UA 5L0FA 3F6BX 4WOBA 1AUXA 1U1CA 2RHLA 4WCFB 2J6CA 1GUFA 4H6WA 4Y6GB 5ALYA 2R8EA 2JJYA 1QWSA 2ZIUB 1LK7A 4HZUB 3CH7A 2CLDX 5EJ8A 2VN8A 4F6RB 3QNWA 4YO7A 3QWIA 1M6NA 1U1DA 4DQXA 3NIDB 4AMYA 3UWDA 1Z6QA 2NAFA 1EBFA 3LCVB 4PAMA 4YUXA 4J29A 1SBQA 5BOSB 1X70A 4MB2A 2PNOA 2FLKA 1UCFA 2DCUA 2R5FA 2IUFA 4AJ1A 2C2YA 1E1QD 4MGIR 5DQZA 3ZHUA 4Y67A 2H1VA 2F8TA 3FOEC 3IV7A 3R5KA 2EGUA 3EE6A 1BW9A 4AY4A 1D9ZA 4HZIA 2HX1A 1O89A 4BQIA 2DFVA 4BNUA 1ZVJA 4XVCA 1KXZA 4M0FA 5TJ9A 1E58A 4EYGA 2OCCC 2OFOA 1XN4A 3DH0A 2VC2B 1P1BA 5BQ3A 1V1MA 1Q92A 4D02A 2VOEA 3ACBA 5DHFA 3AO0B 1V7CA 4FIDA 2JDID 1USVA 2JCBA 3GEGA 3RYTC 2JI7A 3UMVA 1L8OA 5ITVA 3D7LA 2PWZA 1MHTA 1K5DA 5DNWA 1N2JA 2NSFA 5T4FA 4GOOD 3NWEA 2CF6A 4DGQA 2WM9B 2V3WA 4L8LA 4M0UA 4ZOAA 1ANKA 1SVKA 3LS0A 3AFMA 4DEXA 3LC0A 3M79A 2PRSA 4UUBA 3O4IA 2HADA 2CHQA 2IYYA 5DQTA 4MIEA 1ZMOA 2A5DA 2EFEB 2KWIA 3GHYA 2APJA 3CH4B 4G23A 4FYYA 3TUJC 4KPUB 4EI8A 2WP0A 4XCVA 2Q3HA 2WNHA 2PFGA 2GM4A 4Z86A 4IHJB 1V4BA 2JFZA 1ABBA 1IXYA 4ZAFA 4JC8A 1RXCA 3KTOA 2VAWA 3VV2A 3EXAA 1N3IA 4KB5A 2POQX 5DP1A 5DN6A 1Y5RA 1EX7A 4U6QA 2ZITA 4IJUA 3FNGA 5FB3A 1W4AA 3T41A 3M6XA 4MUIA 2GZHA 1DAPA 1JWLA 5C31A 4YT5A 2R86A 3ZEIA 4UW9A 4HFKB 2EU8A 3OCYA 3VR5D 3D3WB 3ZD7A 2LQGA 5CR9A 2CYCA 1O94A 3KD3A 2ILVA 1BA2A 3LQRA 4MEBA 1KPHA 1PNQA 1T1GA 5DTRA 4A03A 4B87A 5TXGA 2I80A 1GEEA 1GYPA 4FEYA 1X86B 3RSQA 2GZ1A 4WV3A 4X41A 4R1UA 2B2CA 2JKZA 1ZJZA 4F4UA 5FOXA 1DOZA 4AMBA 1A2QA 3B48A 2IOQA 1P1IA 2N9UA 2MSNA 4JLJA 2HN9A 1YRLA 1NW8A 4TMKA 3NPAA 3KUDA 1YLMA 1CBUA 1IZZA 4HS9A 4WZ6A 2VFAA 5AW8A 3PNPA 4LWZA 1MRSA 3FETA 3C8GA 3T99A 2FSUA 4Q12A 4G4SP 3CEHA 7ADHA 4LHYA 1DLIA 5BSGA 3NKLA 5CIYA 1BGWA 1XO1A 2CLMB 2OO7A 3G1UA 3V4RA 4G63A 4RZSA 1WLSA 4DM3A 4L8FA 1PFKA 3OWXA 4OHYA 4BCBA 3TTWA 1R6XA 2OCPA 2VSQA 1OZ0A 3H3JA 2UU9B 4TYPA 3PMRA 3E9EA 3MJRA 4YV1A 4U7HA 1GTJ1 3AUJB 2IS2A 2QRJA 4FZJA 2QY6A 2NVOA 4M60A 1FK8A 4FOTA 1SG0A 1TKNA 5L7YA 3PDCA 4NY1A 1UJMA 2ZLBA 5DHAA 3A6EA 3ADOA 4JI0B 1DZ3A 1RJGA 3TL2A 4HYYA 4C4AA 4AJNA 2YLGA 1DAKA 2O1SA 3Q7GA 5MFPA 2O8FB 4QSHA 3RI3A 2QA5A 4XCQA 5AM5A 4IMRA 4LJLA 1C30A 5CNMA 4CIVA 3VHXA 2PMBA 3D4BA 1NNSA 1SVWA 4XQ1A 4XEKA 4FYHA 1W7AA 5E4YA 5F1PA 4YWHA 1TEVA 3K6JA 3COVA 3LPMA 3FPSA 2H11A 1U3VA 3VKFA 3CEMA 3TAXA 3EQ2A 4KKVA 2M6LA 3S90A 2C4HA 5KDDA 1TVEA 3TNFA 3K70C 2C2WA 4O2BB 4CG0A 3WFZA 3STTA 1TF5A 2IQ5A 4HPJB 5BXYA 4O25A 2NTNA 2ZU6A 2I8AA 3KR9A 1ISIA 1VBKA 5BQ5A 5BP7A 2GD0A 3WMXA 2I2XB 4KXQA 2VNKA 1UWCA 3D6MA 2W6PA 3TPZA 2H2FA 4YH1A 1TZBA 3LRTA 1ETHA 3E1GA 2PX5A 2GSWA 3RKUA 3ZGNA 4H7EA 3T4XA 3VU0A 1ZH0A 4ZI5A 3O8LA 4OHVA 2PGXA 2RAUA 3OQJA 2WAAA 4NXNB 1FUEA 5F51A 5LDGA 3AZQA 1GAJA 4BO1A 3GM2A 3VR0A 3PT9A 2FA9A 1WB6A 5ELLA 1J97A 1DRKA 3R2JA 1I01A 4FB4A 4KR7A 3ZJ5A 4J49A 5IAGA 4JU8A 4YRCA 1HYEA 3KPYA 1IBMB 3GGOA 4TZKA 5HJEA 3ITNA 4UHJA 1YQ9A 1J2UA 2GBFA 4OQXA 2JLAA 1S4MA 3I09A 2HXSA 3LWZA 1D8TA 2NVUA 2CDNA 3VR6A 3ESYA 4QUEA 1M0SA 4ND8B 1E1DA 1YR7A 2AVNA 5LU9A 2DUJA 1M5UA 3FUCA 4RZHA 2WP8J 3ISVA 1F7UA 2BT4A 2HQBA 1YS9A 3N53A 3KSMA 2R96A 4UEKA 1Q83A 4XQCA 3RROA 4ML3A 3O3CA 1DEAA 1NXTA 4HQKA 4ZOEA 3CZ4A 3R4CA 1X6VA 1JEJA 4EPTA 3ZVMA 1ZO8A 2WMNB 2A88A 2RHBA 3H11A 5DLEA 2XE4A 4DR7B 4F5EA 4XA8A 4J16A 5C7LO 5B30A 2B94A 4J03A 4J8PA 4MUHA 3X1KA 3OUTA 5F1KA 3A9RA 1ZJJA 2H08A 2IHYA 4ZYWA 1RKUA 4OF4A 3M6IA 3WKAA 4XX0A 3VX4A 2QTCA 2QRKA 4JAVC 2PGLA 2VYNA 4WN3A 4ER9A 1EUCB 2LIPA 4LQDA 3TJMA 4FLEA 5CH5A 2PRIA 4LXHA 2JAHA 3QPWA 2FMUA 5DPMA 4GMHA 5D7BA 2EHDA 1T10A 2WJYA 1T1IA 2PGDA 5F1YA 1HDYA 5L0GA 1U28C 1J99A 1NN5A 4YDRA 5G4KB 4BE7B 2XYVA 2VOJA 4DBLE 4JODA 1U5AA 1VDZA 4R1SA 5A4JA 2AZTA 5JFOA 4CV2A 3OWHA 4INZA 3E05A 1HWYA 4C7OA 2HSQA 2HSGA 1ZUD1 3UHJA 2QK4A 1BN7A 4OHFA 3OP4A 3HSKA 2A9VA 5DEOA 4KWHA 3RT9A 1SUPA 2UXBB 1H8HA 4PHCA 3CMCO 1GPKA 1S3GA 2H57A 3EGCA 2LV8A 1T8WA 1U11A 1L4YA 2QYOA 5TNXA 2BD0A 5KC9A 3L1UA 1XMXA 5G1PA 4YT2A 5EMNA 5IVPA 5AVUA 4UBMA 2OFWA 1UM8A 2H63A 3J06A 2HWXA 4C0HA 1FYXA 2KS6A 1A9PA 1SHZA 3KTAA 5F5FA 4V0KA 4RVCA 1XHLA 1E2QA 4HXGA 3F5QA 3FVRA 1VYTA 2YFYA 3KUUA 3KUKA 1CUZA 4Y30A 4XGKA 4IM7A 3B3AA 4PXSA 2GF2A 1RAGA 3TTTA 3AJEA 3WC4A 1GAEO 3KUCA 4B3BA 2FZVA 2LFFA 4K9QA 2DFKB 2PV7A 1E2DA 3IMEA 1K3TA 2YOHA 3U19A 3FD8A 2J0XA 1Z0KA 4KOAA 4UZSA 5BSTA 2ZUTA 2LR0A 4ZO6A 3Q7EA 3QU5A 4Z0PA 4D80A 4CODB 5I4BA 1UQTA 2GJKA 3Q9UA 1E9CA 3OQIB 1Z25A 4BGUA 1PCXA 3GN2A 4GSYA 4S1TA 2A9KA 5SY4A 4DR1B 3HNKA 1O96A 3C43A 4GKVA 1Z0IA 2CJXA 4KG7A 2ZJAA 4D5EA 4AKTA 4GLLA 5LP6A 4WZAE 4PR9A 3UB4A 4X1YA 4II7A 2NUBA 1JQLB 3U9SA 3RKSA 3TD2A 3R74A 4A8HA 5ALZA 3O4HA 4AROA 1PJSA 1NW9B 3N76A 2BFAA 1NPYA 1HMPA 4CVNA 1KYYA 4TTPA 3PXCX 3QU2A 2QVZX 2GXSA 2FP4B 1PFQA 2IPAB 1XLWA 2HGSA 2VJCA 1D2HA 1ZZPA 4XAQA 1VMDA 1T2CA 2O19A 3G4ZA 3EPKA 1OXTA 3G6KA 1E5VA 2YJTD 2IZZA 4F04A 3ZBTA 1ZFNA 4C0BA 1C3OB 3VR6H 1I2MA 4FWIB 1LRLA 1G1MA 4H7JA 1CD5A 1JPUA 1KVTA 5FD8A 4H18A 3SF8B 3X1WA 3F74A 4QQKA 1BCRB 1XR3A 1X39A 4R6WA 3MCAA 2BBTA 4DKXA 5HBRA 3I30X 1UDRA 1SZPA 3KEMA 4C22A 3LVRE 2QW0X 1WBJB 2HD4A 1FSZA 3FKQA 1MNDA 4LJ9A 4X64B 2W93A 5HQTA 1XNHA 3QVVA 4U1RA 5FO1A 3F6PA 3OTWA 2Z3VA 2GJ8A 4BKQA 4JC0A 2XOKA 3FHTA 1C7QA 2OP0A 3CUTA 2W6JD 3COWA 1U65A 5K0JA 2XLEA 1WY7A 2C98A 1CZUA 3LOQA 5ER9A 1JA0A 4DWVA 3WQQA 4DJTA 3W8NA 3TKYA 1S3IA 3O94A 3UOWA 3TFOA 1FFSA 2CB0A 4QYTA 1LS6A 1Z68A 4KAAA 3PA8A 1GQAA 2Q6LA 4IZ6A 3V8EA 2P6UA 4B3FX 2WD7A 4PSUA 5TQ2A 4WBNA 4TV9A 4AMVA 4LJRA 5I7UA 1L8LA 5K8UA 1NQWA 3CBGA 3B6ZA 1NPTO 3BD6A 4AO7A 3I8XA 1OXSC 1K6MA 1VLHA 4L50A 5HOQA 4PZEA 4OATA 1SQFA 2FPPB 4QQRA 1R5ID 2PQMA 4HAIA 1LV7A 1K4YA 3ANYB 3VZPA 1Q0UA 1RI3A 3KS9A 4M0CA 3QVLA 1XD9A 2GCOA 2B7LA 3PC8A 3KWLA 1RWVA 2HCJB 2ACVA 2WIBA 3V46A 2X40A 2G4LA 1GN8A 5CDFE 4N06A 3ZHZA 2VG8A 4Q6BA 5BO5A 1AKYA 5DW3A 3SNHA 2HPZA 3R6LA 1IN4A 1EJBA 1KMHA 4YS6A 3WMGA 1XQ9A 3FPKA 2R7NA 2VQ6A 1Q20A 3I3SR 5EGYA 4DLZA 4C6RA 1H5UA 4RIGA 3DOFA 3SYTA 3EVZA 3UQZA 3DDOA 1EA7A 3IX7A 1MENA 2HRRA 2BGGA 1SB8A 2C2HA 1MFPA 2DVMA 3SXKA 3GI1A 2HCRA 3VPDA 3KKLA 2YV5A 2QBYB 4DOZA 2VK8A 4IF4A 3UJ6A 3BB1A 3PXEA 2J7PA 4ND3A 1XCOA 3BXHA 5BPHA 1XP8A 3UWMA 3P2JA 1NP3A 5BYKA 3A3NA 5FUBA 1RBQA 4DG9A 2XYRA 2VDLB 1HLPA 5AVOA 2ZAIA 5JHHB 3U5SA 3OY2A 1C29B 3FNEA 2EIJC 2R5WA 4HTAA 1OW6A 5I9SA 2OFFA 1W35A 5ADVA 1FTSA 1XT6A 3A1FA 1GNPA 3AKZA 1XHEA 3Q8XB 1NBHA 1AGXA 3P9CA 1IAQA 4H16A 2MSLA 1Z5WA 2D1YA 1B00A 4IXTA 3VR1A 2PE5A 5I7RA 4EYSA 2DTEA 4L15A 1A82A 1ZSNA 4JCCA 1M8JA 4HVAA 2GM9A 4MGZR 2Y0DA 1CCWA 3ECAA 3EDOA 4KVGA 1YBVA 2QD3A 3H4VA 4UTZA 1U3UA 1DO0A 1PRYA 2VK2A 5ALHA 4U7TB 3MQ2A 2OD9A 4OO3A 2NZ8A 2DFLA 3GOQA 3H4TA 3MXOA 4IV5A 3DXZA 3Q4GA 1L7BA 4LFAB 1N2CA 4AN0A 3QIVA 3D0KA 1INLA 5IBCA 3HP7A 4RF4A 1BNCA 5E3CA 1WKCA 4PXYA 2ADOA 3L8HA 1M33A 3P9SA 5E1MA 2AB0A 4HAUA 2QAIA 1VGRA 1OQCA 4AJPA 3ZGVA 4Y2UA 1FE8A 2MYPA 3OESA 4P4SA 2OXTA 4LF4B 1JFRA 5K3AA 2MU1A 1Z62A 3CVUA 2CNKA 4QVGA 3TE7A 3CRVA 2CE2X 3QVGB 2IYZA 1DZIA 5FJJA 1Q0DA 3ORRA 5JSZA 5JC8A 3M7IA 1C8LA 1JLLB 4GR9A 5J63A 4O4IA 1CPYA 5BUQA 4ECEA 2O7VA 2HPAA 5CD9A 2X51A 2HU5A 1HE5A 4QNRA 1UOOA 3CNOA 4O33A 1CB0A 1YS4A 2D62A 1P44A 3DAFA 2V4UA 4UQLA 5ALRA 4LWOA 1KJIA 5FTJA 1XZQA 3RQSA 2LDBA 3O2SB 1YCFA 5D3MA 5KVAA 3I8OA 1TU0A 3VVMA 2XGOA 4G0HA 4BMSA 2HV7A 5EE5B 4DA9A 1E1KA 3U7IA 3LWBA 4Q5SF 2IYPA 1E3IA 2FX2A 2AWOA 1KZ1A 1ZJ5A 2HA6A 3OTGA 1XB2A 2D5LA 1C3LA 3UFBA 1OXKA 3RFUA 2MCFA 4ARVA 2GASA 2HK8A 1FQOA 3QVXA 3UK6A 2RJ3A 1YC2A 1U2TA 1PJ8A 3TW8A 1IJBA 4FQ8A 1NW7A 1TFOB 3ZY2A 3I53A 1W93A 2P79A 3N2KA 3LY8A 4H7DA 3FYUB 4X8HA 6CHYA 1PGPA 2RHJA 2CXRA 4L7QA 1AO3A 4YL0A 3A2LA 1R4TA 1KEKA 3P2EA 2IF2A 4ETIA 3T6JA 2PSDA 4XJSA 3VO2A 3DHNA 2J6IA 2AZ4A 4EDHA 1Z0ZA 3L0DA 2A35A 1VXRA 1O97D 3OLZA 1W48A 3ESXA 2O5EA 4CKWB 4QU8A 3PRKE 2PP4A 1C4OA 1XLTC 3SHVA 1AKQA 4AF6A 1I5NA 2DBQA 5FTLA 1E1RD 5DXAA 1L5YA 1QOQB 3DBRA 3W2FA 3QPAA 2O6LA 4UUPA 5DYYA 5CBKA 1E98A 5B3IA 3ETJA 2Z1MA 3AV3A 1IN6A 4ERXA 4MDYA 2E5WA 1KQOA 2PJUA 1JU9A 3GRUA 4E2ZA 4Z1MD 2YZ2A 3AESA 4XSHA 5K4HA 2JJ1A 5ES3A 4FYMA 2YIDA 2E87A 3WK5A 1QUFA 1TCAA 3IE2A 2VQEB 1VKZA 1EVLA 1WV0A 3OOWA 3VXKA 1PVOA 5KVQA 1W0JA 4XVUA 1WKVA 1MG5A 1TZMA 3QVUA 5LBIA 1G55A 3SC2B 1K3FA 4RHTA 1NQVA 1L3BA 1U90A 2BP7B 3STYA 4WZAB 2LD4A 5F5HA 3JQAB 4UHDA 2OC4A 1J8DA 4ZYXA 2YJ5A 2B5VA 2BMAA 3F9RA 1Q7EA 3G23A 4DT1A 4CYMA 4GVLA 1Y4ZA 1QQ6A 4M0LA 3JY6A 3UUGA 4QAJA 3DL0A 4C5BA 4LRWA 4MW8A 5JBNA 2BUBA 1CW2B 4BQEA 4A3SA 5BSMA 1MMFB 2GHIA 1DC5A 4AY2A 1DJOA 4KOEC 2ID4A 5CA0B 2X86A 3GLVA 3DWIA 1XZIA 1PO7A 3NDRA 5ESDA 2PRKA 2VF2A 4QUIA 5BR1A 3QELA 1TKAA 2OCDA 3L6BA 1S7GA 4LGCA 5TQVA 3THWA 4F38A 1VRWA 2YICA 1K04A 4CLEA 3ASOC 4R2HA 4P9NA 2X0DA 4BN4A 2CLFB 3D1VA 4Y98A 4CWAA 4KR9A 2VYVD 2IOYA 1Z08A 3HXKA 3PRJA 5CYOA 5DIZA 5GV7A 2K7FA 4R05A 4ZYYA 1OX4A 4EYQA 3NVMB 3TX2A 5IMSA 1CJSA 6NULA 2F17A 5EGSA 4YRNA 2OBBA 4EFLA 3H5IA 4QDZA 1Z16A 4QLBA 1Q7CA 2IOFK 4ZOQI 5FNVF 1TYEB 2ZI7A 3IHKA 4H3VA 5MGNA 13PKA 2PBRA 5NLLA 4NU6A 1NSYA 3GFVA 1X8XA 4X6UA 1ZHFA 1ZEJA 3C5HA 3L8YA 5M04A 5ED0A 2VO1A 3AHGA 4P81A 4JVOA 4XIGS 2OG2A 3QGMA 4WY8A 4IDOA 4P5EA 4BNYA 3SQWA 1AM4D 2FEPA 3NETA 3N28A 4HC4A 1VSQA 1T6IA 1H2XA 4OP1A 1PT5A 4G4SO 5KYWA 1YJGA 1FYVA 4MRMB 2Q0XA 3LBNA 1ECCA 4QOEA 4HN9A 3CFYA 3MIIA 2PMFA 2FK8A 3PGXA 2O2HA 3I72A 1ZUNA 3GK3A 1QK4A 1F8FA 1DBIA 2AQHA 4RSMA 1JIKA 1TCBA 3B38A 3E22A 3QVYA 4BFVA 1L4UA 4NVRA 4EIWA 1LNSA 1ZX1A 1IJEA 4YJHA 4G1VA 1V11A 2FF5A 4G0NA 4G9EA 1B0AA 2ATVA 3NP7A 1GRQA 3S6JA 4OM7A 4BVFA 1NN0A 1LLCA 3NYQA 2ZKLA 5IXJA 4TQGA 5IK2D 3FY4A 3WSVA 5H3HA 4KVAA 1KU6A 5JRZA 3MT8A 4C4YA 1UIRA 2F3PA 1TRHA 1STOA 5FPHA 5COQA 3WYEA 2YDXA 2VXBA 3AIIA 1ESNA 5EOVA 3U44A 1JAZA 1UBSB 3ET5A 4PN3A 3NHAA 4ZHQA 1G3IA 3B7WA 3LAWA 2UZ4A 1X0XA 2PCLA 3LJBA 2B9EA 1LPSA 4M9SA 1T4BA 4HVCA 4JWKA 1WZIA 2ZI5A 1RLUA 3PSHA 5F3DA 3LEVA 3RVQA 3K09A 4CS8A 2IP2A 1SHTX 3OT5A 4OKIA 1MO2A 5KI6A 3LTEA 3D02A 4P32A 4FWVA 2QUBA 5F21A 2QRMA 1L3PA 3RVNA 2W70A 2PSJA 1W9MA 1LFDB 3M1IA 4BG0A 2VCCA 3T5TA 3KQNA 2GWHA 4B71A 3AOEC 4G36A 1QOPB 5A02A 3CVOA 4PX9A 3WOHA 3DLAA 4DVGA 3SNKA 1EINA 3BHNA 1V35A 2B4TO 5LFAA 2X0RA 2OOKA 2TMGA 4BGVA 1JVNA 1D4OA 1X80A 2V8OA 1VECA 1C4WA 3AG5A 3V42A 3VJLA 4UXIA 3S99A 4BZWA 4EB0A 5JAOA 4M1OA 1RLOA 2ZRBA 3F97A 4EB3A 1VP3A 4IDDA 4FZ3A 3BXFA 4I1UA 4GQIA 2NZYA 3DJNB 5B1BC 3OAAA 4Q7CA 4EMBA 4I4LA 3BG5A 4DQKA 4PAGA 1YOBA 1WCIB 5FL7A 3DTYA 4U7GA 5KS2A 4NBUA 3R9IA 5IG2A 2PKXA 2G77B 1JF8A 2H1FA 4Y1GA 3FPEA 1N6RA 2H06A 1YZHA 4C0XA 5LKAA 1N9ZA 2WWHA 5ENVA 1FSGA 4RMGA 3POVA 4PYKA 2IEGA 4BMZA 5HG0A 3UW3A 2Z0MA 5G4LA 4RCZA 3EEQA 1OA1A 1KQNA 4DLXA 5LQRA 1K0UA 1YL7A 4M8IA 1WDLA 4Q3BA 4I3GA 1WY5A 1CXZA 4F72A 4BO7A 1W2HA 4I55A 1M2KA 5TQ0A 4DV1B 1TQHA 1N7IA 3STUA 2R44A 3S44A 1LVUA 4R9RA 5HQJA 5EHGA 2H18A 2EJCA 4EQ6A 1T6QA 4C5AA 3U17A 3UK7A 4LCBA 1H1LA 1XDSA 4NFSA 2WJAA 3W6ZA 1QNFA 3IEKA 1USUA 4RMHA 1HKUA 2V26A 3ZSUA 5JYBA 2BDUA 1R00A 5JDCC 3S3TA 1MABB 4QTUB 2QN8A 1RFLA 1MVOA 4JEUA 1XYVA 3EXG2 3GXOA 5GONA 2XQJA 4AZTA 2B8JA 2ZWIA 2RJOA 3RSCA 2H4HA 1XTRA 2XDQB 3FGNA 1N9GB 5JJIA 2BFBB 1OXXK 4WFIA 4AZ3B 2FZCA 5B5SA 5FLXA 3SM9A 3IA7A 4TVBA 1KI7A 1G98A 4JB8A 1SU6A 2EIHA 1ONPA 3L40A 4CF3A 5CM8B 3SIXA 4KZKA 4ESEA 5B2FA 4FBLA 5JYEA 4EHNA 4M6WA 2AW5A 1W96A 5T6BA 2C7PA 2AK2A 1GPAA 4I50F 1LI7A 3O0DA 4EI9A 4B4WA 3PUJA 1SH7A 1Y5LA 4MUFA 3GLGA 2OD7A 1EXDA 1IRIA 4OIQF 2NIPA 1KEEA 5EZYF 1WDTA 1FQWA 1NR7A 3AXTA 1JR3A 2WIJA 4OUDB 3B6EA 1PG0A 3CIOA 2OE2A 4K9NA 3BT7A 5I9MA 3Q5EA 1Y3FE 2IUUA 3D1JA 1P29A 1R3DA 1SNYA 5I9IA 1CJCA 5PGMA 821PA 1PNOA 3OWTA 4EKNB 3MTJA 1Q91A 3CLTD 4QUDA 1Z29A 1T2AA 3AUUA 2Z9CA 2ZRMA 3C7CB 5ALPA 2QVYX 1II8B 3RIEA 4BJ5C 5IZCC 1RI4A 1SHLA 2WU4A 1NY5A 4J7TA 1K8YB 2IYUA 1LTKA 4MVJF 3TBKA 3PNVA 4EZIA 1JR2A 2X6QA 4OMDA 3RVYA 2CUZA 1PJZA 3MMSA 1DTWB 2OHVA 2PXHA 3E3LA 4E08A 3OETA 3BH6A 2GKOA 3SOZA 3C6BA 3FPAA 3PE3A 5L3ZA 1JAIA 3FF4A 2QORA 2G3VA 1L4FA 5CB8A 1RCTE 2VH2A 3EVNA 1FP1D 5ELMA 3RKRA 4RJKA 4P7JA 4AQDA 1QPGA 4G7OF 2XBUA 1JFLA 3VKWA 2ZZKA 1BEUB 1ZH4A 1YWGO 4JI6B 1CE8A 2GYWA 2EEZA 3DD1A 3L43A 2WDPA 4ZOCA 1TU4A 5HKLA 2FN7A 1OI7A 2UUBB 3RODA 4W8GA 2ENUA 3NIGB 4QTXA 3UWPA 3FOWA 3GP3A 5E2BA 3BMOB 3TOMA 5BRNA 1U9JA 2OSVA 5BQFA 2Y2VA 4EB6A 1FDRA 2FE1A 1YACA 2O0HA 3CWQA 4E5PA 3TSYA 2UVDA 2HU2A 3DW3X 4H08A 4DARA 5CFQA 4AJJA 4IQFA 2O8CA 2VL7A 3OA0A 3SY8A 4KGDA 1FX0A 4DNFA 4ZDKA 2FWJA 1ZAYA 1ZGCA 4ARZB 5F9MA 3GRFA 2WNSA 2GHRA 2GJSA 1Y81A 3U7HB 1PQUA 2DLNA 4D57A 5J4VA 3KJZA 2V74B 2XMPA 4J3FA 3T5PA 4OU5A 3KAPA 1WU7A 4AO6A 5JISA 1DXQA 3KDAA 4MLDA 3CVXA 3VDRA 1HM5A 1LPPA 3L8DA 3B7PA 4EFKA 5KTTA 3EWSA 4AXXA 2XE8A 4JQZA 3CQ9A 2CVZA 5TEWA 1LI4A 3F1KA 4P7BA 2BBWA 5E0KB 3JZ0A 4NZMA 1JPVA 3ACDA 4OIRF 4BO9A 1V9LA 3ZDFA 4IARA 1B0UA 1VPDA 2XT9A 1EKYA 2PMCA 5E0OA 4FAPB 4BRUA 3FR7A 4U2BA 3FHLA 2L0XA 1UMBA 1RWBA 2A78A 2ET6A 4YJFA 3MGBA 4RK7A 1FBNA 4XEFA 3UWSA 3DO5A 2AXPA 4IG9A 1K89A 4C0KA 2JCYA 4EPYA 4TWZA 3RVBA 2EPOA 2IHKA 4OFZA 1V7ZA 1A1VA 3RIXA 4DIOA 4U2GA 4UTXA 1UP6A 4CHGA 2PD4A 4CIPA 3TTXA 1XKXA 4BKMA 4GMXA 2F3TA 4V3CA 5EQDA 1Y8QA 5EIBC 3UFXB 3TJRA 4O6VA 5G0TA 3T3PB 2IXNA 1KVQA 5DP2A 4MAAA 3IEPA 1T34A 4IIEA 4HXYA 3OEYA 4XPZA 3T15A 3V7UA 3TGPA 1D2MA 4PLVA 3LPDA 3M3HA 4R3UC 3E3AA 1KI1A 2NO9A 3H1AA 2RHMA 4FHZA 3U3DA 1U98A 2HRBA 1HK7A 2XD9A 1QGYA 1V8ZA 3RC7A 3IMGA 4D99A 4TKMA 2XV1A 2GUWA 2GT1A 2W22A 1SWVA 1SBNE 3ZWIA 3FJYA 4B8ZA 2A6EF 4YDQA 2GWRA 2ODQA 3D2LA 3ZU5A 2JBHA 1R7RA 1GSAA 1OREA 4AJHA 3SR4A 4B35A 5F64A 2VWGA 4ZN6A 4XOUA 2XLCA 1WSDA 3TBHA 3OFNA 5JZMA 2AE2A 3FDJA 1T2NA 4AL0A 2W2VA 1T5LA 4AS2A 3EGXB 3RASA 1FAPB 4EG3A 4U0JA 2R68A 3I6MA 3EIQA 1QHGA 5CGQB 2OWEA 4LSMA 4MUKA 1EFAA 1N2SA 1QV9A 1KGSA 4EMTA 4LFCB 3DHVA 2XE7A 2B7CA 4X3OA 2AJDA 5BT9A 1PG2A 3E7FA 1CC1S 2BFEA 2PX4A 4K9LA 1FMVA 2IS6A 3K1JA 4UBJA 1AT1A 2FSVC 2NU6B 4M36A 1RVV1 3KFLA 1OLXA 1QKJA 3CZ5A 3UJHA 4X24A 1CZNA 4DKJA 1JA1A 3PJRA 2R8YA 4GU5A 2KPOA 2XCQA 3L6OO 4HG2A 4KC9A 4MS3B 3TTYA 3GZNA 4N7JA 4B44A 1Z2EA 4ZQEA 2Y1EA 1COWA 4TMWA 3LKVA 1UBGA 3U0CA 1MX3A 4WVFA 2BOVA 2Y99A 2UUOA 2Q7RA 3I4LA 4CEJB 2NO1A 1YB6A 2XL4A 5DVWA 1N25A 3NYRA 1JHPA 1P45A 2FW8A 3I6BA 1MTZA 4E14A 4Y2RA 1JHRA 4BB5A 2O07A 5K0CA 4Z3KA 1F9EA 1Q1GA 2G83A 4CIYA 1K66A 4KI7A 1EI7A 3P2KA 2BKLA 1FFGA 3Q1LA 2D3TA 1W4ZA 3GGPA 4XM0A 2FETA 2FR1A 5ICFA 4RULA 3E81A 1PX2A 2WU1A 1F2UB 2FB9A 2OAQ1 1HTTA 3M4NA 3C5EA 1W5FA 3AWDA 5JAHA 4HLUC 4GXTA 3WK8A 5A9SA 2ICWG 4IIJF 4C3VA 1ND5A 2AL7A 4Y9TA 3OJFA 2VJMA 1L7VC 5JFGA 1IBKB 2WFLA 1M0TA 1G7RA 1KERA 2C4WA 1WMEA 4UBKA 1YRYE 3ZE0B 3OEHD 4DJAA 1N8KA 2FPGB 2QS9A 1GRNA 3HBFA 4PZCA 4IUBS 3W9YA 3A1UA 4QJ5A 4EY3A 1JYFA 1JKFA 2R84A 4CT4B 4DHEA 1O5IA 5T4EA 4J6EA 2ZSDA 4EYKA 5C34B 1BU5A 4LMBA 3ZK8A 3IP7A 3PE4A 2XRMA 2H7VC 5BNFA 2IX9A 1VJTA 2ZRIA 2W00A 1ACJA 3WAKA 4KQKA 3IR7A 2PPLA 1NVDA 3THXB 2G9NA 1A9XA 3VPBA 1SPXA 1ACLA 4TWIA 4AJ2A 2RG7A 4MCJA 4RTMA 5K20A 3IOCA 3DFZA 4LC1A 2X77A 2ZJYA 5LMUB 3B78A 2Q5HA 3R23A 2PFDA 4OQZA 4MXDA 1KRWA 1ZH2A 2AVKA 3VFDA 4NCBA 4OPMA 1GZDA 2NUPB 1KI6A 1TNDA 3GCZA 4LUCA 4GP6A 4QDTA 3AUKA 1QWOA 4GLBA 2NM0A 1JQKA 3A2NA 3PFNA 2EQBA 2J46A 4ZI3A 2NV0A 2C2ZA 4UXHA 1X0VA 2ISSD 3BE4A 4G78A 4YR7A 3U3OA 1POXA 3QQPA 4LTNA 1RRKA 1LPNA 2DPMA 2NXNA 5EKSA 2ETXA 4CF4A 4NV3A 5BN5A 1Y1TA 4BX8A 3IKVA 3AV0B 4FEAA 2XSZA 4LIPD 1NFOA 3ZCTA 4JJIA 2Z2KA 3FVVA 1P0CA 3IUSA 1DKQA 3NBKA 3KEGA 1JKJA 2EZ9A 2ASEA 1JXOA 2ZBPA 2ZYVX 4DV0B 4LTMA 1DCFA 1SXGA 3FMFA 5F52A 4BE9A 1Q0LA 3LIIA 1ZVMA 4QXPA 1NYRA 5AT1A 2R62A 5DO9A 2GA8A 4XM2A 4R81A 1HEYA 4YLEA 2FN9A 3ABRB 1RFGE 2C0PA 3NGXA 5G3YA 3OUUA 4B79A 4GZ6A 2WAOA 5FRDA 5KTSA 4MP3A 2ZTMA 4CQNA 2XUPA 3SQXA 1LA2A 4L2IA 2AFRA 1W88A 4A10A 1P9RA 3P0IA 3EHDA 2QTFA 3I76A 2YIJA 4P2GA 3UMFA 1II0A 4QNNA 4JSRA 3O8OB 1SBZA 2Q8PA 1NYTA 2K5UA 2XITA 3DE6X 4QQFA 4ENSA 1J90A 3MMZA 4ZZ1A 1W30A 1G5PA 3O2JA 3F9IA 3EGDB 3RNLA 2VNAA 2NADA 1V5GA 1P31A 1K08A 4Y2HA 1KK3A 1ZN8A 1BJKA 4PANA 5JJKA 2H1HA 6GPBA 4DA8A 3EZ6A 1R6UA 1PDWA 1MZVA 2QD1A 4LJ4A 2IHNA 3HNRA 3JAWB 1XZMA 4U8HA 3B60A 3A9CA 1II9A 2VP3A 1W9HA 1EVIA 1SKMA 2VBFA 3OECA 4WXEA 1DDOA 1BYIA 3FBWA 5A0FA 2XNCA 3OZVA 2AC4A 1U80A 4D9JA 2N3ZA 1EP9A 1GFWA 5B36A 5BQIA 2CW5A 4G1FA 2JD3A 5EJGA 2Y4NA 1QVXA 1N6NA 2YQ5A 3IIJA 3NUQA 4Q1CA 4KACA 2JHGA 1G8KA 1HUQA 3DI5A 3C85A 3M1LA 3G85A 1PYGA 5AOCA 4KO3S 1DARA 1PT6A 2P68A 3B9PA 5SV2A 1R4MB 4DDUA 3OEEA 1QV6A 5DWDA 3L7CA 3TUZC 2AG5A 1Y4CA 2QM3A 1ZOPA 3LZDA 2ZTHA 2G1JA 4RF5A 4R8KA 5FOWA 2VHXA 3AVWA 3OA2A 4NPCA 2ZRNA 4C07A 1BR1A 4TV8B 3H2JA 3IHUA 5HFJA 3LUTB 1N77A 3ZIBA 4Y6RA 2H2AA 3QVOA 3IQTA 4NJEA 4ZDWA 3RJ9A 4J90A 4FJ0A 1ZCJA 2B4AA 5DLQC 1U89A 3T7JA 4AW9A 4JI3B 4KQFA 4LYEA 3HEMA 4AX8A 4X9XA 3T0GA 4ND4A 4OSEA 1ZUHA 1VOTA 3V1KA 1G4AE 1JUDA 2EX1A 1DKRA 5EGNA 2CBXA 3BXEA 1VE9A 2VI5A 2XLHA 1E2NA 5BVHA 3MGAA 4G7HF 4D0SA 3KVYA 3U37A 4X7MA 3C62A 2FUG1 1P18A 1EAMA 3K94A 5A9TA 5JJLA 1E7YA 3IHTA 4KDEA 2RD2A 2O3UA 3V48A 3LPLA 4P4LA 1GKUB 4BZZA 1NQOA 521PA 1GRVA 3BERA 2XTAA 2HT6A 1B8OA 3AY3A 1GTVA 2Z2ZA 4Y6PA 4NV1A 4B2YA 2IXAA 2W8BB 5KYXB 4GVPA 3GA0A 4A92A 4TRNA 2QE7A 3LO5A 4ZAYA 3IP8A 2WHQA 1AGYA 4NMLA 4YFYA 1GPNA 1G8YA 4OHZA 2SKEA 1LDGA 5JS2A 4F21A 3H05A 4L9SA 5D5PA 2PL9A 2YV4A 3MHTA 3BAZA 3J7AC 2ZQZA 1KARA 1BGVA 1W19A 5M5BA 1C9DB 2B2XA 2YX1A 2P78A 2XR1A 1BE1A 4OXRA 5HE9A 3QHQA 5FUVA 4FB5A 2CFSA 3HH8A 3HRIA 3TYXA 3KQKA 3V97A 5CDSA 5BT8A 3JQAD 1ICIA 2IXEA 1TM4E 3PQ3A 2BGIA 2CLEB 4I1SA 3ZNNA 5K3OA 1VE5A 1XRNA 4I9FA 1B2RA 1U0LA 1OZHA 4JV5B 3HYNA 2UUCB 3CWZA 3TSWA 3PSAA 3WA7A 4E6PA 2HUNA 3RSZA 3VYTB 4JH0A 5K99A 1F5SA 4L6IA 1JHMA 4GPD1 3M6VA 2G1KA 1MEEA 5ECWA 5CJ2A 2E55A 4B3XA 3FCYA 3TVDA 2WF8A 3BMXA 3FFWA 1E9EA 4OFXA 1F17A 5FI1B 3IHLA 2GDJA 2ZBDA 2P11A 3C6QA 2OQ2A 1VXOA 2HRDA 2FI1A 2RB4A 4KR0A 1H4QA 4C6TB 4QYWA 1XTUA 3REFA 4D81A 3I8SA 2Y39A 4BX2A 2Q1TA 1E3MA 4NFLA 2C77A 1K7SN 3WTBA 4OJYA 4B9EA 5A03A 1KZGB 1E7QA 2JLUA 4DSUA 1F9AA 4JBYA 1KDOA 5D86A 2RBEA 3TLJA 1P7CA 4HNGA 3LFHA 4MITA 1I3CA 2FGKA 3U6KA 2AFHA 4LY9A 1AN9A 4JEHA 1I4EB 2AG0A 4OIPF 5EHIA 3DYBA 3IV9A 5DBIA 3TSOA 4KE7A 4AMGA 2HLDD 4GG1A 1NM5C 5CB4B 2OXCA 5C32A 2Q21A 2R8OA 3FDQA 3QK7A 3UK0A 4CKCB 4HWTA 5JTUA 4Q9AA 2XKKA 4BLSA 3E5HA 5LQCA 1QDUA 1NUAA 1EM8A 1OTYA 3BFJA 1G5QA 5EEGA 3AJ8A 1WD7A 3FJOA 3JQFC 2BONA 5E8JA 1QH9A 3NKVA 5MN4A 3AXSA 4IB4A 5A5DA 2PYIA 2ZE5A 3ELDA 2WZLA 1NXOA 3LWNA 4DYHA 1L7AA 1E6LA 1QRRA 3A25A 3AF6A 5DI3A 1P0FA 4TMVA 4M0PA 2AJ8A 1NV8A 3LD9A 2DBRA 2FFRA 3N2IA 1NASA 2XXJA 4OU4A 1OXMA 4XSVA 3C3EA 3EOBI 2DJ5A 1IOWA 1MDBA 1JLKA 3WGMA 4LYFA 2I7DA 5B4TA 2KNHA 2BJVA 1KIAA 2XEXA 2NN3C 2WHRA 1JAFA 5KPJA 3T9EA 4OBWA 4AP5A 2R7XA 3IUNA 1PJLA 4UC0A 3SHFA 1PFGA 5DGDA 5ALVA 5KNBA 1XPRA 4PVCA 4A6DA 4WWHA 1D0YA 1YULA 3MW8A 2EX0A 4KDCA 4AULA 2YWGA 4TSKA 2G72A 4N3BA 1LSSA 3IO5A 1MDFA 3FIJA 2R6FA 4J1QA 1SK9A 1U9IC 4BO5A 3HRHA 1DL5A 1H2AS 1EGVB 3IE0A 2JFBA 1JDBC 3DZIA 4QXRA 2PUGA 1RQLA 1UR5A 5EJ2A 1BE0A 1ULHA 2KQUA 1GCIA 1XJ5A 4RZ3A 4M8KA 2LSEA 5LQNA 4Q47A 4I19A 3CEJA 1Y6JA 4GKAA 3QVKA 4MRRA 1TEXA 4U9HS 2JIRA 3VHQA 1GTMA 2XBLA 4MK4A 4RZIA 4HFFB 1VCNA 3WMRA 3FPBA 2GM3A 2FK7A 1SOWA 3WK9A 3IDFA 2JKYA 2DUUA 2BGNA 1QFMA 5LNK6 4FFBB 5EERA 1XJWA 2JL1A 1PR4A 1K6JA 1RTTA 2OV1A 2VDWB 2HF9A 1H9BA 1QONA 4WESB 3VHRA 1T4MA 1BBHA 3AZPA 3M6FA 3WWCA 2CMGA 3HXMA 3U1VA 4UOQA 5IJZA 3N2NA 4QI0A 4P54A 2ZVDA 3HFGA 1M6HA 2G4VA 1AKNA 5FWYA 1A72A 4HEAJ 4ZMRA 3JWGA 3GEPA 2WE7A 3MK31 1CIPA 1LNQA 3G8AA 4N82A 4DAEA 2WB2A 2O2YA 3DE1X 2YFQA 1QZUA 5JCXA 1SA0A 3EODA 3HHPA 3BJRA 1T4DA 3B1ZA 4JFAA 4MIOA 4F1JA 1MQAA 2GN9A 3PWZA 3BHJA 2PA3A 5E9QA 1KJZA 3VPHA 2CFOA 3PEFA 4P38A 3A70A 3WMWA 4TYQA 1ZWKA 4N48A 4QDUA 2VH3A 3O0TA 2G82A 2V7UA 4ZOLB 3KLNA 1SCNE 5DMXA 3FNQA 3BFVA 3CLHA 2CZCA 1WCYA 1RR6A 2G17A 3SXYA 1UZUA 4YHHB 1U6JA 3MGKA 3SX2A 1P19A 2C7QA 4F12A 4CU2A 5JH7F 4LF7B 3URKA 2I3ZA 5HV9A 4NJMA 4Z3OA 3IP5A 1D09A 3LEOA 3SXZA 3CN7A 1MQSA 2ICAA 1K7YA 5JWHA 1IBLB 2VF8A 3V4VB 4AYTA 4DHWA 4HVLA 2NNLD 2BIFA 2I4IA 4RDAA 4DE5A 3TRHA 4GP9A 3S9OA 3HKCB 3WLHA 2PAFA 3QMWA 1V3QE 3AJDA 3P9KA 2HFKA 1YFZA 16PKA 2FSIA 1SN7A 4Q7QA 3PDIA 3FUTA 1T91A 4KC0A 4MUMA 4MCAA 3QMMA 1VPTA 3B6IA 2EKBA 3BF7A 1QP4A 2QT9A 4X65B 3PZBA 4NEQA 5LBUA 1XTBA 4W5HA 5KREA 1Y7PA 2FOXA 1VYVA 2P0EA 2P9GA 4NZ9A 3NX4A 2EATA 3VV3A 1U28A 5KVSA 2W6QA 3SJAA 4ZTZB 3JR3A 3DL4A 1I2DA 4DCTA 4FYIA 4HB3A 1QPUA 2ZBQA 5DOZA 2HF8A 4MV0A 3JZAA 3B13B 3L8MA 1CNMA 1CQPA 3WISA 2WKRA 3KTDA 2Y6VA 3H2VA 3HKEB 2XECA 3TMYA 2DQZA 4UKDA 5BSEA 2HB6A 1Q0HA 5EP1A 2ATEA 1VL8A 2PEZA 4JXJA 3KZKA 3IPMO 3V3TA 1CK4A 4P80A 1FNBA 4FTWA 4RHYA 2ID9A 3UC9A 3M2PA 1CR1A 4REMA 1VRVA 2VJQA 2ZIWB 1IM2A 4DIBA 2XXBA 1O9HA 2EEPA 2F4VB 5KNBH 1FQJA 1XTZA 4F9TA 2D7CA 2ZGVA 5JW6A 2ODAA 3KAQA 4AQYB 3GY0A 1TE2A 3RC1A 2IFTA 3RQIA 1K4KA 5BUZA 2UUHA 3EVEA 3OOEA 2WT8A 4K6GA 1HE8B 2QN2A 2A4MA 4DS3A 2O2JA 4JXZA 4WFKA 4W8OA 1Q16A 5J5VA 3EZYA 1ZK1A 2DWOA 2OCXA 4HUQA 1W2WA 1NJSA 5LNK1 1NBOA 2W98A 4PPNA 3UO8B 1U0BB 5FTKA 1WV1A 3QX8A 1LE2A 1JEAA 4TVKA 5JECA 4HE8D 4PZPA 1TX4B 4JP1A 3VOAA 4TXHA 1JH8A 5K03A 2X14A 1PNRA 2P7VA 1M1UA 3DF7A 3LBAA 5L45A 1DDIA 4YUZA 3D6AA 3CR7A 4FDUA 2L17A 1U2GC 4CM9D 4MWDA 2YUIA 4ZAWA 1PL7A 4L76A 3UCXA 1PLLA 1G8HA 4MQ6A 1E9AA 1OA0A 4YPVA 3NYJA 4MVJP 3HZHA 3FPGA 1H4SA 1SD5A 1CZLA 5DVZA 2PMWB 1ML3A 1RJEA 5EIFA 3JWPA 3IEMA 3ILVA 1DHTA 3UHPA 2V0NA 1H2ZA 2PX6A 2AZXA 1V4AA 3V5NA 3DQQA 3SK0A 3IH5A 3ADDA 1N5KA 3VU8A 1H6DA 3HADA 3IPLA 3E18A 4JHXA 1R15A 3OJLA 1OYOA 5E7JA 4WK2B 4UHBA 1NATA 4D1YA 2QMEA 1JFTA 4D9FA 5JR3A 2XPCA 4EP1A 1JZSA 1P5RA 1UWVA 2IU4A 2OJED 1JT2A 1M6TA 1AUEA 4FMBB 3PFFA 3KELA 2ZBEA 2BL2A 2W90A 3A05A 4K05A 4ZVUA 3DXFA 3HO6A 4Q7MB 1WAMA 1V41E 1WX1A 1EFLA 3O21A 4PRZA 1T36A 4WEOA 4NH4A 2QZZA 1R9NA 2JHAA 2PKWA 1T0PA 1HYBA 3RS2A 1HH4A 1LLDA 4ZC1A 1ZNZA 1WCXA 3T7RA 4R7ZA 2EL7A 1GZHB 2D1QA 5IHXA 1WSAA 1NRIA 2HJRA 2I6XA 2P3SA 3WL7A 1VJDA 1EVKA 4DXAA 4XIYA 5LYJA 5HVNA 1YH3A 3NHWA 1U3TA 5DMHA 2FKNA 1I3MA 4MI9A 4JL8A 3NR2A 4JKVA 3OPVA 1S8OA 4IQGA 4YJ3B 3DEIA 2O48X 1H7IA 3DAOA 5AHOA 3LT1A 3H2ZA 1YR8A 5AVVA 1KVSA 3HWWA 3IXMA 3FWPA 3WYNA 3R3WA 4B6QA 2ZAMA 1TQ6A 1QG2A 3B6MA 4DY6A 2PKRA 3L77A 5EWJB 1NKVA 4KYUA 3W8EA 4EIYA 2UUAB 3LDGA 1H2HA 5IKOA 4O4HF 4B4DA 2PBZA 4DXHA 4LF8B 1UQRA 2CL6X 2HCTA 3CJQA 3KJQA 4HNRA 2FHSA 1GDTA 4E5YA 2QTZA 3GVHA 4MQBA 1YASA 3EZIA 4F60A 3OEWA 4BAZA 4BMVA 4X1IB 1RTKA 3CNLA 1IY8A 3I23A 3UENA 4Z4FA 2V58A 4A6PA 4ZO9A 3N0WA 1QS0A 3LJKA 4EYOA 4NP6A 5TPZD 1S7CA 4ZVKA 5BWCA 1L5SA 2XRHA 1Q6YA 1UBRS 5CX1A 4QATA 1MC4A 2R9VA 5L8VA 4Q82A 5BYJA 3V8QA 2JLZA 4IIUA 4TUYA 2ZRPA 4E15A 1G17A 1IM8A 3L18A 3P4UA 3R1IA 5GVSA 3FMGA 4TROA 3T5CA 9ABPA 4AZVA 1D6JA 1WMSA 2QXYA 5E9WA 4LF5B 4LSWA 4OGLA 1LCIA 1Y1PA 4YREA 1AXEA 3V1TC 1XCGB 2IYWA 3U9TA 2QQEA 1C2TA 3HJRA 4F2DA 4FLFA 1SZCA 2QR2A 2NU9A 1P0PA 2HBZA 2O8NA 5BV0A 4MR8B 3WE7A 3FFAA 2A5YB 3W8DA 3FVYA 2GERA 2JFQA 3S0JA 3ZN2A 3CA8A 3OU2A 4H1TA 2VUHB 3LGSA 3I04A 2EJWA 1FFXB 4JYBA 3BXPA 2XOEA 3MPUA 1JPJA 3C3YA 1Y8CA 4PYOA 1L3CA 3VPSA 4L5BA 3EGIA 1LV8A 3QF4A 5KX5B 3QYPA 3GUVA 4LVCA 1ORVA 1PZFA 4RLHA 3GLFA 2R47A 3GX1A 4OQYA 3CX8A 3CSSA 4I1MA 4ALJA 4BV3A 4ZYUA 4BXOA 3IFSA 5A5FA 3EZ7A 2Y9MB 1GZ5A 2W2KB 2BDEA 3RVZA 1OW7A 4NXMB 3KYIA 3QLJA 1KFEB 1U4SA 3RS9A 1AJEA 2HWYA 2Z8YM 1NLYA 4WLVA 3FBGA 2UVPB 1LPBB 2XA2A 4AFNA 1QQ5A 2EFYA 1SURA 1BOOA 3VI4B 4NOKA 2JKVA 1QGUA 3OI7A 3KR0A 4LZJA 5GJBA 1R8YA 3OLVA 3LQ4A 2BMEA 1PFUA 3IPRA 3H8SA 1H8ED 4B2LA 4F9FA 2WWXA 5KU7A 3E3OA 1C1YA 4L8WB 2BR5A 4J07A 3GJ8A 4CMKA 3T4RA 2W6IA 4Q0MA 4CM7A 2CNWD 1M8GA 2GEDA 3OMLA 2AHOA 5DRTA 4IUDS 1OYWA 5JXHA 1VL1A 4LE2A 1OBVA 5C7OO 4CXMA 1X38A 3C5WP 4GDMA 5A3SA 3MLEA 2QJTA 2V1XA 2WG2A 3ENWA 2Q3CA 4ZIRB 3A2MA 4RIEA 1Z4PX 2OHFA 1H9CA 1D8AA 3IAHA 3M6AA 2OILA 1E96A 3RO7A 2YS7A 3OY7A 5DLPA 3I12A 1BN6A 2VP6A 3IPCA 2AI1A 3O38A 1NULA 2CXSA 4Y9UA 1NRXA 4IGEA 4AL1A 4GXNA 1UFOA 3LUGA 2A4KA 1YQEA 1XAHA 2ZUFA 3JQDA 2QRLA 4RD3A 1QB8A 5A05A 2X7HA 5FF9A 1NF8A 4UVGA 4AX4A 3ZUGA 3I1IA 4AD8A 1QCZA 2JIPA 4RV4A 2AVDA 3FLAA 1E1LA 4LI3X 1HE1C 3DNPA 5AKEA 3RTGA 4LV5B 1JX6A 4B3MB 4WXHA 4KIGA 3L06A 4ZCQA 3QTBA 3BZUA 1I30A 1ZNXA 4D3XA 3WBJA 3GNSA 3K7EA 4JW1A 4EMUA 1K98A 5F7OA 3IPYA 2UZIR 4P33A 4RSRA 2Q27A 1XMJA 2C29D 3ZJUA 4HWKA 4BASA 4W1RA 2PKQP 1Y82A 2I6QA 5CDUA 1PJCA 2DSNA 3Q3CA 2BM9A 3HNPA 3JU3A 4ZPJA 1P1FA 5GMOA 4WLEA 3DEHA 2A0YA 4NBWA 4DMCA 4Q05A 1ZU5A 1XLTA 1S7ZA 2X15A 3VHLB 2QN6A 2ZE8A 2VUTA 3DLBA 2IF0A 4TYYA 3U7GA 2OBXA 3WLJA 1JIQA 3LMKA 2VTBA 2Z5LA 1IK6A 3ETDA 1XIVA 3L41A 1W76A 1BC5A 2PUAA 3U4HA 4ANFA 2H1IA 5KAMA 2XW6A 1CKEA 2H1SA 3N0XA 5BMVF 5BN3B 5I3ZA 2QIPA 1FW6A 3AILA 4FFRA 1BFUA 4K8RB 3A6LA 2AMVA 1EFRA 1HETA 2QM0A 1O95C 2EZTA 3DD7A 2BCEA 3MBKA 1RVDA 5G41A 1YZNA 2IIVA 1DKLA 2R2GA 1L5KA 3ZUPA 5BSWA 3IQDB 5AKJA 4EEKA 3ZYCA 1IHYA 2JGDB 1DIGA 3T3GA 3V7OA 4FONA 3U9LA 5LC1A 2OLKA 2X6TA 1GITA 3NUZA 3LH5A 2VRWA 3I1JA 1CVRA 5IUKC 5KCZA 3A9VA 4M1SA 1WSWA 1T9GS 4EI2A 1Z7YA 4XSGA 4AG6A 3S2IA 3GMDA 4UBNA 1ZK4A 1ARZA 1ZNQO 1GGVA 1YTLA 3N2GB 3Q6NA 4EGJA 3IUQA 2G4CA 2ZB7A 5HBGA 1J1UA 1D1AA 1PZMA 3E9MA 2J4CA 3AYZB 4TQUS 3QY0A 1DDGA 2OGSA 2ORIA 2YW2A 1VBNA 2CY0A 3BXOA 1YRQA 1ECPA 3ZIDA 1SCJA 3PIDA 4F8YA 5JLIA 1GQ2A 3L0YA 3K1ZA 4KR3A 1IXKA 1N1GA 5TARA 4DPMA 4BJHB 1ST2A 2GJ9A 4J91A 1E0DA 4FU0A 3G2MA 4OQFA 3WLQA 2XCOA 3D3NA 3GUYA 1RXEA 1WHSA 2GN0A 1JR8A 3NAQA 2C5FA 3SE0A 4G0UA 5DH9A 3FUVA 3H1GA 2GEKA 1T0HB 1YZLA 3NBFA 4TS3A 2X0KA 4QLOA 5I8PA 4O4JB 4AYXA 2G9QA 1UMKA 3EMVA 4MQMA 5LQKA 4A0QA 3R7WB 4LRXA 3TCXB 2EDCA 3FRHA 3HM2A 1H0HA 5BMOA 1P2FA 1XRSB 4DNXA 3ZW9A 2BCGY 4AY5A 1Z7BA 3VF0A 3GAAA 3IXQA 4KCGA 3NVAA 5ITZA 4L4RA 5KJFA 1P60A 1AX9A 4AM8A 3OMXA 1DBVO 5IJAA 3WIEA 4ZCMA 1TWCA 3WV4A 2J9RA 3UAZA 4MPTA 1A8SA 2K4MA 4HK4A 4HFMA 2G09A 2A14A 4R8RA 5CLJA 4JZAA 3HJUA 1DOAA 3BD7A 1A9ZA 2PG3A 4PIMA 4JUIA 3ZPXA 4Q93A 3OQNA 3M6LA 4D96A 1J9GA 1OKKA 2RMKA 1R8SA 4LDZA 2HNBA 3I64A 4TKUB 3M33A 2YOFA 1QANA 4FFLA 4FZ5A 2WJZB 1TYBE 4CM3A 5KJ6A 2IIBA 4M49A 2GRJA 1IVYA 1OX5A 2K6GA 5GGYA 4N8DA 3KDPA 2YVKA 3D4PA 3GNQA 2IZ1A 2GXUA 1XCBA 3GEMA 4HF7A 1EP3B 3AI1A 1PZXA 2BZ1A 3N59A 1FSSA 4OKNA 4JB0A 3ZLJA 4DIMA 2AA3A 2RGGA 1UC9A 3K1HA 2XMRA 4CTKA 5HIAA 4EY6A 2VDKB 4MUYA 2RHTA 4Q24A 4X66B 2P6VA 4R7GA 4GZ3A 1DCTA 1UMCB 5F2NA 3KWJA 1QB7A 1K1EA 1RABA 3TRDA 2JIOA 1OZAA 3BRSA 5DOVA 4PZZA 3JCZA 4OLJA 1U7WA 3OQ6A 4V38A 2VHVA 1QE5A 3RHSA 4IDPA 4A2CA 3SZLA 1EKXA 3RUDA 3TLGA 4M89A 3UG7A 1ZVZA 5AOBA 4IDFA 3BDAA 2XCSB 2M6SA 4MRSA 4F85A 1XNJA 3KPUA 3OC6A 1E9DA 3E7XA 5J4LA 2CSXA 2X8JB 2DT5A 4N6HA 3PI7A 3Q7QA 5EE0A 1Z12A 1JP7A 4PGFA 1L8XA 3TDKA 5AH0A 3AOEA 4IY1A 1GPDG 4HTFA 1HO3A 3RYHA 3GODA 2OB1A 1XTVA 2QEQA 4PSAA 1ADFA 1M6WA 3Q1KA 4Q1FA 4MH0R 3ZZ0A 3FNFA 1QPZA 2IC5A 3T0IA 4F97A 2ZJ2A 4MVWA 1BH2A 3H1BA 4ND2A 2ORYA 3ACCA 4HH0A 1SKUA 3FNHA 4KUHA 4CQJA 2ZWVA 3ZE7A 4E4RA 4EVSA 2ZUEA 4YR9A 5EK0A 3H97A 2PH1A 1Y1QA 3HU1A 5JU6A 3TD9A 2FVXA 2V97A 3TZEA 3D6NB 3RD5A 2ECKA 2VF5X 4P31A 4G8CA 2ASVA 1NVFA 3LX6A 4P35A 1PK8A 2QZ4A 2KK1A 2XCIA 1KO8A 1MKYA 2EFDB 3EXIA 2WLTA 4WOPA 3DGEC 1J9EA 4GF5A 2C83A 2AXEA 5DBFA 1YOVB 3HHEA 1PL0A 3I2IA 1ZIPA 1U8UA 5CLHA 3B71A 3HJAA 1Q3KA 4Q1BA 3ZE6A 1K06A 2YTZA 4B6FA 5FWDA 2EWMA 1CLEA 3UJ8A 2G40A 1A7VA 2OP1A 5IT5A 3MTAA 3GBSA 1NF3A 4RA9A 3KD2A 3OT1B 8ABPA 3I5XA 3SQDA 4UVIA 2QX8A 3AKDA 4QEKA 1IAVA 5AJUA 1QFZA 3EVFA 2P2YA 1TUIA 5CPBA 4ZCSA 3OQ1A 3ORYA 2H1OA 3X2SA 4N8SA 5E6UA 4TTVA 2EJBA 5C8YF 5J5AA 4L8YA 1LE4A 3OQHA 1OFTA 1TFKB 4ID3A 1GVNB 4X7PA 2ZXPA 5JDCA 4H7IA 2DXIA 5AI9A 4JS0A 2CNDA 1HE2A 4JFRA 1E7RA 5DISB 4Q4JA 4YASA 1NBAA 2G6TA 5H5JA 2J0UB 2ZM6B 1SELA 3NAZA 3NHZA 5HSGA 4HP8A 2OV4A 4RIHA 1ZN2A 3WZMA 3OPYB 1R18A 4L8VA 3GGJA 5DYWA 2J9YB 5CT6A 2GRUA 5DBEX 4E30A 3O8QB 1IZ9A 5CT5A 2JFFA 4LNHA 1XRJA 3Q10A 2NT3A 1MVNA 3M5DA 1R0RE 3PPVA 2MMCA 5A4KA 3R76A 2CHEA 3R41A 4AT1A 2XY4A 4HEHA 1PD1A 1ULAA 3SS8A 4E18A 4D92A 3ON5A 2R8XA 4LQ4A 2FHPA 4J0DA 2ZXWC 4AP9A 4LACB 5JJBA 3QE0A 2ZCUA 2Y3DA 1CDZA 2O8EB 1ESEA 3L0SA 4MW7A 2WC1A 3NBQA 1KVUA 2YXLA 4WK0B 3U4CA 4TT8A 1AQJA 2Y69C 1M2VB 4E1AA 4IIGA 2D4AA 3JD0A 5EPEA 2VHTA 7YASA 1UBMS 4ZEVA 4YIHA 4WKNA 4MVXA 1LI5A 5COGA 3PV0A 1KR5A 1ZONA 3IB6A 2W9XA 5HPYB 3QEAZ 4BJ5A 3VZRA 5IZCA 3WLKX 4ZRNA 1NSFA 1DQPA 4AJ4A 4N5IX 1FCJA 2GXAA 1Z74A 1V0JA 1E77A 5C8VA 3ZWXA 5IW8A 4ZLCA 1GSHA 3SF0A 1QIKA 2PGNA 1OFUA 4BEJA 3U4DA 1BXGB 3PWKA 4DEVA 1UBNA 2IDJA 3T6GB 3QWAA 1W2GA 1O6CA 3IBGA 5IKXA 2B3DA 3C14C 4DMMA 3D2CA 3UB2A 1PR2A 2XQGA 2FUG6 1VBMA 3EZGA 3SFZA 3EZNA 1BQEA 1FRNA 1A96A 2QXTA 3CIFA 3LLMA 1JIJA 3GJRA 5JLAA 2H2GA 2GARA 2QB5A 4WOJA 2G80A 2DMRA 5IY5C 1Z37A 2I65A 3U8VA 3DOUA 3EEFA 4RNDB 4EBBA 1FW8A 5U1PA 3J7TA 4W8HA 2JJQA 3TE6A 2EP7A 4O1HA 3UNXA 4C0QC 2ZAOA 5FPKA 1JDVA 2PSHA 2M4EA 2GTPA 1KI9A 1YV9A 1E1CA 5EWMB 3CISA 2WK1A 2X4LA 3L0OA 2GCNA 2RG1A 2NYUA 5DXJA 1XEFA 1D6NA 4RQUA 2ZRLA 4DV5B 1LTHR 1QGZA 5P21A 1G4HA 4JJ7A 4TM8A 4HX5A 3S8YA 4QE3A 3C5VA 1V16A 1XTIA 1X19A 2VK4A 2Z5GA 3C4JA 4FYXA 2QWXA 1U3DA 2I2DA 3KJNA 3ZHBA 2O6HA 4UHHA 3DMPA 1PT8A 2YJNA 4FT2A 3U0BA 4WKOA 2DQSA 5LD2B 2WKSA 4IHAA 2C3UA 4U5CE 1MC8A 5TVGA 1VG8A 3G2NA 4G6ZA 3OM0A 1ZOIA 4KMSA 1I94B 1P5ZB 1W1WA 3L6RA 3U80A 3G9QA 4GXRA 2D4UA 3EZLA 1MAHA 1KIMA 2GCGA 3BSFA 2VNIA 3Q7SA 2HGZA 4EVIA 1SQ0A 1RPZA 1VA4A 4K9OA 2NU8B 3FVWA 3BRJA 1TUGA 3K9QO 2B78A 2C31A 2IH2A 1OCCC 4NENB 1YJ5A 4E31A 2Q3TA 2JLBA 4HO1X 1QTIA 3BMNA 4XRRA 4QOIA 4F2WA 3AU8A 2YL7A 2O1XA 3RWOA 2ZPTX 4H7KA 1IZYA 2P4QA 4H2DA 1QZZA 1KA9H 4H3HB 1LVGA 1ID1A 1NVMB 3DW1X 3NAMA 1OR3A 3DE7X 4N0MA 3PD0A 1WF3A 3VOSA 3QLUC 1SG6A 1JDZA 2F43B 4NHOA 4FMCF 2Q1WA 1A9TA 4OOFA 2IBSA 1ZLXA 3PYLA 3TRFA 5LJIA 4C2AA 1C7IA 2PWAA 1AMUA 1XTPA 3BWCA 1JSZA 3QSGA 4HX9A 1PZNA 2ZP1A 1KJQA 2CXXA 2IV7A 3V4FA 4B6IA 3N8KA 3EXG1 1CY8A 3FROA 5CLLA 2FMHA 4WY5A 5ERXA 4ALMA 4Q3LA 1KI4A 5EQTA 5I01A 1RPJA 2QX9A 3JQ7B 4W5TA 4FYVA 5K8LA 3NDIA 3IIKA 1NRWA 1X1QA 3EPRA 1IXSB 4NESA 5E3JA 1VG9B 3RK4A 2QL5A 3NEPX 3H5TA 2OPBA 4ZJZA 3SEQA 4TM7A 1Z8NA 1FXUA 4HEA1 2V55B 2FMIA 5C3MA 1GYRA 3DT6A 2V9PA 4G37A 2C99A 3L6DA 4RF2A 4C2UA 1YR6A 2P41A 1RQXA 1Z33A 3TKAA 3H17A 2BGRA 3PZRA 1V5WA 1GL3A 3UEOA 3GLRA 3FSEA 1VQ1A 2BEVA 2QKYA 5TPWB 3GWLA 1NQUA 1Q19A 3CZ6A 2XGMA 5L3VA 1T5DX 1RXYA 2ZVQX 4C4SA 1TT5B 2FSVA 1U9YA 2BFDB 2KQ9A 3OM8A 2VT2A 4ER5A 3GEDA 2PBEA 3HBNA 5K8IA 1LBTA 3UJ7A 3WYGA 2VZ8A 5AVQA 4CI9A 2WSLA 3SX0A 5E6RB 4U5GA 1CTQA 1RXWA 4FR2A 4A0RA 1MIHA 1CLUA 1XZNA 1B0PA 4YP5A 4PBRA 2Z6VA 3L7NA 5IYZB 4ME6A 3WA6A 2KJQA 2IY8A 1OWMA 2PQ6A 4BVKA 1GGMA 5LQDA 4EUEA 4ZKDA 1QO0D 4DCJA 1M74A 3CW8X 2WMOB 1V9CA 2OHIA 1ECLA 1PV3A 2C4KA 5FR2A 1YFJA 1RADA 3LY7A 1QUEA 1U9CA 5C1DA 2PGAA 4QSMA 4RA6B 4QFDA 3QHPA 4CM4B 1B74A 5EJ4A 3E6AA 5LA6B 2JCGA 1PV1A 5EZQA 2WT4A 2GJAA 3AVYA 3HGMA 1XG5A 3L07A 4OI4A 5F2OA 3CVYA 4JT2A 5GZ6A 1M0WA 1GDHA 5F98A 3PF8A 3DFIA 3GIWA 2LP4Y 3X0DA 1ZP6A 3R3UA 1E0AA 2B25A 4BQSA 1D1SA 1ZHYA 1K2VN 4HLUA 4UE2A 4KQHA 1QLJA 4PIVA 5H7XA 4G9BA 3C7TA 2QAGC 1KC3A 1YJ8A 4GP7A 4Q4LA 2IOHA 1M10A 2OG1A 1ZN7A 3IEEA 3EXHC 1H9GA 2GFHA 1TVCA 3O92A 3TEFA 2H51A 3M81A 5CT4A 2NSHA 4J6FA 4OXNA 3MUEA 1FR0A 4JBIA 1F0KA 4ODIA 2C3PA 1O9BA 2C3MA 1J49A 3TX6A 5K0FA 1E92A 1DRUA 4OREX 5KYGA 3REGA 3IB3A 1P0QA 1NIPA 2H7VA 1AHNA 9ATCA 1N2ZA 3MA0A 4YRDA 3FMOB 3X1MA 3MYYA 3K8ZA 4PF1A 1IVNA 2EIXA 1VFNA 1LTQA 1HE9A 5ECDA 2F8LA 3F5MA 3BRQA 4S04A 2QTAA 4N6OA 3A10A 3ROGA 2FWBA 2FQ1A 3CLRD 4AUEA 2G04A 3ZG6A 4AURA 3K5IA 1SHKA 3AEQB 2WZCA 1W85A 4MJLA 5JZ9A 1E4OA 3GW8A 4LLCA 2PKQO 1JHDA 2EWVA 3IQZA 1XF9A 2EZ4A 1A9YA 1V26A 3QXXA 1MOSA 1PU2A 5L53A 4RS4A 4KTVE 4RTLA 1PQYA 2BHRA 1M6VA 4IHKA 3F3KA 1C14A 5HJ7A 1TQ2A 1ZD1A 2IY7A 3AR8A 2C5EA 2B21A 2PQ2A 4N9QA 3IDOA 4RABA 2YHSA 1JFFB 3NT2A 4ZO4A 5KOIA 3D8TA 3BYZA 4MI1A 2X3UA 1MRNA 3HFSA 1YS6A 2PJRA 1AO0A 3RQGA 3ZS8A 2C3OA 3PXXA 3Q5DA 2AOUB 5HF6A 5TMPA 4KSYA 3A4IA 2ZUSA 1T26A 2NQ2C 2QIOA 1SKBA 1EWKA 3N74A 3RH0A 1VCIA 5A6KA 2V7PA 3BWBA 3MWEA 4E4TA 3DDSA 5B6JA 4O02B 2NSLA 3O7MA 4L78A 2BM1A 2GAAA 3WDMA 1ATIA 3HV0A 3ILYA 5CBPA 1XZEA 4RHEA 5H68A 3M9XA 2ZSEA 1FQKA 1YZAA 5KTKA 3WAJA 1N36B 2Y27A 1JXQA 1IHUA 2C95A 1BCSA 3H9JA 1EP2B 2YIMA 1PKEA 1L8AA 3S55A 1DKMA 1JIVA 4IH9A 2G0TA 1ZIXA 1NXQA 4YL1A 4GLOA 5A5VA 3FZYA 5HOEA 1E18A 5GY7A 3WWEA 3ITEA 4B84A 4BN0A 2WYUA 2B8NA 1HC7A 2I6GA 3ADBA 5FNVA 3GCDA 5HKAA 3D8BA 2EGGA 1ZM9A 2QI9F 1RRPA 2I1VB 5ALJA 1SR2A 1VLSA 3OLWA 3KSZO 3G02A 1NU6A 1PFVA 3Q5GA 5E6SA 3PC7A 2DLDA 2ZBUA 1DNPA 1L1RA 2HF2A 1LDEA 4ENRA 1G16A 4Z8YA 2CKMA 4I2NA 3ZI4A 3C1OA 3DDHA 3TQCA 2AKYA 4E5DA 1YMUA 2QYHA 3Q88A 2V98A 3DEAA 3HLZA 3TPCA 1P91A 1OOEA 3ZDAA 3T9FA 1NY6A 4J9VA 4EJSB 2WU0A 3SVZA 5IVKA 1NT2A 5FPPA 5FEMA 1J8MF 3KQOA 3CN9A 3HB0A 2B5OA 1WUYA 1EGQA 1QIMA 3BQNB 4PS1A 2P3QA 1MX5A 4HH3C 3QU9A 3O4RA 1G8JA 4KN9S 4LERA 3G5MA 4DRZA 1L7OA 3HP1A 3WK7A 4ZYTA 1R9MA 3USCS 5G40A 2WIDA 4DILA 1Q44A 5CYGA 3KVVA 4A73A 3Q7IA 4BQNA 1T9AA 4KK4A 4Q9HA 1J39A 4IICA 4MKRA 2NTJA 4K0RA 4ZV9A 1DOHA 3EYWA 3OZSA 4A15A 1WMFA 3TQOA 3IOEA 5K7SA 3E0QA 1P2VA 5ALNA 2GESA 2YZGA 2CNOA 5A6SA 1UBOS 4K1XA 4M9CA 2JJ2D 4E4YA 4QUJA 2ZIXB 3MLBA 2HF7A 4JLUA 4QXMA 2JGIA 4ZVLA 3QKWA 3ONFA 1M1NB 3A6DA 4DSNA 3T52A 3ZEAA 1VPWA 4YUVA 3ZIUA 1FNDA 1OW3B 1ILEA 1GCUA 2YHIB 1DOVA 3DHWC 1FYWA 2BM0A 1GUBA 2E3JA 2NYRA 1PS8A 2ZWPA 3G9XA 4G5FA 4G0ZA 3T94A 2EV9A 1V55C 1N5JA 3WVNA 5ECGC 3JASA 1CU1A 2H2DA 4QYSA 3ZOZA 2H00A 2IPLA 1VL0A 3FW1A 1RKQA 3OH8A 2H0RA 5FH9A 5ALLA 4EA7A 2OZLA 2P1DA 4EECA 2WILA 2ZJ3A 3HZRA 1FDIA 3R2PA 2FFJA 1CS0B 2M64A 3OX3A 4IHQA 5B1YA 3A7DA 4UUOA 3G89A 1L5GB 2GK4A 4WA7A 3JYQA 1Q1ZA 3WWPA 1C1DB 2SCUA 2C2XA 3QA9A 6ABPA 1HURA 4GOND 1O7JA 5JSFA 4LJ6A 1Q0TA 1DV1A 1J4AA 3FTEA 1EFVA 2JCVA 8AT1A 1RQPA 3HTKC 4YBZA 2ZJ7A 3MINB 2EWWA 1THTA 4K46A 4D9CA 5MGBA 1HNWB 3AK4A 4BNJA 2QSJA 3MRTA 5LCXA 2CFRA 4I1YA 5AK3A 3GP5A 4MEJA 2BFCB 4K9SA 1W1UA 3ONVA 1I7QB 5CEJA 1HL7A 1YBFA 5HKKD 1V47A 1LBHA 1X3LA 1QZXA 4C89A 2PO5A 4B46A 2ZJBA 3ORQA 4S1WA 5TEVA 2WA2A 5F9FA 1P9OA 3H5AA 2CL5A 5LIPA 4WINA 1NMXA 1EUDB 1L0BA 1Y5MA 4PC3A 3LHFA 2L82A 4DRJB 2GEJA 5C81A 2PZBA 3OSZA 4X1KB 4XASA 2IBMA 2D8AA 3D5QA 3LC2O 4A4AA 4YT4A 4OI2A 4G8DA 4IJVA 1VMIA 3FZQA 4IX9A 1OHHA 4WNAB 2BZSA 5B1HA 2WZFA 2VATA 4K8OA 4CPDA 4RJJA 1U7PA 1VYUA 2KLBA 3I9OA 5JS5A 1IG3A 3EWNA 1RP7A 4KXNA 3K15A 3AG2C 2PT9A 1E63A 2AQ8A 4NPAA 2R1TA 5BN1A 5FAKA 3LP6A 2CLCX 5AJZA 5DTMA 1E3WA 4IVQA 5LU8A 1DO8A 4OIMA 1BDJA 3L1VA 1NM5A 4M0MA 1ZESA 4YJDA 3EPVA 3NOXA 1W0KD 3Q8LA 1TYZA 1SZIA 4RPLA 3WLRA 2W42A 2OCIA 3PQDA 1Q11A 3K8YA 2OO5C 1A27A 1LPMA 2YBEA 3CUVA 3BGWA 4HB0A 1ST3A 1YDMA 4NC9A 3JQFA 3O4FA 1EVYA 3SE7A 5EHQA 4L1KA 1RIFA 3LUFA 5DNVA 3RS5A 4XD7D 3UT5A 2O3TA 4D9KA 4F3CA 2I22A 1BMQA 4KMRA 4IYJA 2CWDA 2O2CA 5SYAA 1W94A 2R03A 3C8MA 1NBIA 2PUWA 4CQMB 4B34A 4BMCA 1FZTA 1M1XB 4I50A 3QEMB 3RSHA 2JFYA 3FOCA 5GM2A 4AG5A 4Q4AA 5CA1B 2OEPA 5DBGA 3W0LB 1NVWQ 5EZYA 1ODTC 4V2UA 4TYNA 3KZCA 4RKEA 3PT5A 1QRUA 3OZFA 1P9NA 2GPYA 4X63A 4ZVMA 1SCUB 1HYQA 5AI6A 2R7VA 1TK3A 3VJRA 1GTL1 2QTHA 1BGXT 5JT1A 5BW6B 2GETA 4X20B 1JE0A 4HDQB 5F77A 3WB2A 3OCJA 1JU3A 3SMQA 2L81A 4F1WA 1QF7A 2Y1KA 1X9IA 3L4KA 4NQFA 4D0NA 1U9IA 4BNVA