2HV7A

Crystal structure of phosphotyrosyl phosphatase activator bound to atpgammas
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
301
structure length
301
Chain Sequence
NFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein phosphatase 2A, regulatory subunit B
publication title Structure and mechanism of the phosphotyrosyl phosphatase activator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 101
structure length 301
sequence length 301
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2hv7A02
2IXOA 2G62A 2IXNA 4NY3A 2HV7A 2IXPA 2IXMA 2HV6A 4LACB
chains in the Genus database with same CATH superfamily
3X1OA 3RYLA 2A6EF 2Y39A 5A6BA 1FR0A 4C3BA 4FAPB 4G0HA 4FX5A 4CX9A 1M57C 2KNHA 1IZMA 2NUPA 2Q9BA 2D4UA 3A11A 4XEVA 1NBBA 2YRFA 5D92A 3EFOB 5D91A 2Q3TA 1G4WR 2QTVA 1VOMA 4C7OA 4XEFA 4JW1A 2G3VA 1LI5A 3I5QA 2HUJA 4XPXA 5BUOA 2CNWD 3C62A 2EINC 1WTYA 3DE9A 2ZPAA 3EJNA 2ASRA 2XLEA 3KYJA 3O39A 4LLCA 3GANA 3RVZA 3K1IA 4MVSA 1A41A 5KYYB 1ZU4A 2P61A 3EFOA 4ANJA 3LNMB 1LIHA 3ATPA 3ABLC 5AC5A 5L0IA 2Y3BA 3EPVA 3J06A 3V7OA 1BR1A 3M15A 1AVOB 4YJWA 1O3UA 2Q4FA 3WG7C 1ZHWA 1M56C 3DMDA 4ONSA 4NCQA 1D0YA 4PFPA 5T3WA 2BL2A 5HV9A 1MMAA 4WGZA 1BDJB 5KYYA 1MMDA 4PJMA 2ETSA 2FGYA 4AX2A 5KYUB 3U8PA 2JPUA 1UG7A 1ORJA 4KBLA 3ZSUA 3V5ZA 3QVZA 4C3EA 1Q0KA 2W9YA 3NKEA 1NLXA 2M64A 2YEVA 2WL8A 3VF0A 1T5OA 2Q9CA 3RQEA 1V54C 3GWLA 2DYRC 4GEHA 1XZPA 1ZHTA 1A0BA 3QW1A 2IBFA 5F5HA 2I8BA 3F46A 4U5CE 2R7RA 2Q7RA 2VCCA 1ZW2A 2R25A 2XS8A 4MW3A 1BZ4A 4PACA 2B0HA 5KYUA 3L1MA 4LERA 4BJ5C 5COGA 2L6HA 2A6HF 4P9TA 1BR2A 3EH1A 3JSEO 4XWJA 5JSLA 4XEKA 3RKOF 3B9QA 5T1DB 2LIGA 3B0VC 1HY5A 4MVUA 4PR9A 4U9EA 3HNLA 3BRJA 2IOQA 2EPLX 1ST6A 4LDRA 3Q6MA 5E3CA 4LLEA 4EBBA 2L81A 1Z6AA 4RBNA 2DB4A 3EG9B 5COFA 3SXYA 2V26A 3K1IC 1BR4A 1OCRC 4N06A 4AK9A 3NYJA 3AG1C 4JJFA 1E86A 3S84A 3U3FA 1GGQA 4AE4B 3SZRA 3LNRA 2AU5A 3EGXB 3EQLF 3LAYA 1T9KA 4DRJB 1V4AA 3NG1A 1M2VB 4NY3A 3IEEA 5BQHA 3EG9A 1QQ3A 4EIYA 2XL8A 5DQTA 2LFFA 4LDQA 3PCVA 1YYJA 2G3KA 1LVKA 2YLGA 4AE4A 2R05A 3W2VA 2MWQA 2Z15A 4MVRA 1NG1A 1ORYA 3EGXA 3FOPA 4JEBA 4IWBA 4DJ9A 1M2VA 4P9FA 5DS5A 3S29A 3VAYA 3I4UA 4O7GA 3SNHA 1Q0GA 1LM3B 4JCHA 2XLOA 3LS1A 1MNEA 3H65A 4CSAA 4JTAB 1JPNA 4EWCA 3AG3C 4YL3A 4CDAA 2NPUA 2V3CC 4NC3A 3US6A 1J8YF 3LEOA 3HJCA 3POVA 1HW2A 1VLSA 2OOCA 3UMIA 5EGYA 5DS4A 2XRHA 3WAQA 2I15A 3TK0A 1ZZPA 3ZTZA 1MMGA 3HLZA 3SP1A 3W4YA 2KYHA 3LJBA 4WABA 4BJ6A 3TQOA 4IAOA 3WHNA 4WGYA 2NUTB 3V5YA 1VTMP 4BEMJ 3DM5A 1YLMA 2J7PA 4O6MA 4OIQF 3I5PA 4ZLDA 2GDCA 1ZHZA 4Z9HA 4KC9A 3EZHA 3W8IA 3C8GB 3N0TA 3RVYA 1C02A 5A6BD 3QZCA 4MTFA 4RDAA 1PD0A 3V5XA 2FAPB 3SYNA 3AQBA 1JRAA 1OQCA 2EILC 3C18A 1YZCA 1EI7A 3FAJA 1APCA 2NUTA 4CS7A 2R7VA 3UGOA 3W2WA 1XZQA 4JCZA 2W45A 2M4EA 1PD1A 2J0WA 2OEVA 2AWYA 1D0XA 3SEOA 2IXMA 4HE8D 3U2LA 3QMKA 3C8GA 3ZIBA 1E84A 3PDMP 1YZAA 3K7DA 4UDVA 1Q0FA 3ABMC 3G4ZA 2P6VA 3LEVA 5A6AA 2EPMX 2OG2A 3IQCA 1FFHA 1H9GA 2JX0A 1FMVA 3KYIA 4MVZA 4O6YA 4U5BE 1QKRA 5E33A 4JKVA 4CSAC 3M1CB 4W8PA 1D1CA 1UFBA 2HSBA 5JT4A 5E2QA 3H2VA 4WJ0A 3W8HA 3ECSA 1AEPA 2PF4E 3RFYA 3L0IA 3TOMA 1AUEA 4XPYA 3S0XA 1LE2A 2QY9A 2L9JA 4FWVA 3JCUQ 5TJ5E 1ZHYA 1D0ZA 4M63A 3MLGA 4I44A 3X2QC 4DXWA 3B29A 3S90A 1TWAA 2EIJC 1U0BB 3KH2A 1TFKB 2GFHA 3AG2C 1I4YA 1CPQA 2CCYA 4R32A 4QI0A 1ORSC 3KMIA 1FFTC 1OKKD 3NYMA 5COMA 4JTDB 3RIPA 4AL1A 4XLPF 4HFFB 1HMDA 2R7WA 3C7JA 1SF8A 2C03A 3FOOA 2OJED 4MVOA 3Q7GA 4PJJA 3RQFA 4YT8A 3ZWIA 1T6IA 2VB6A 1VYKA 1WASA 2A0UA 2HV7A 2KQ9A 3ZDLA 2YLDA 1JR8A 2D5RB 1OCZC 2HKVA 4A2NB 5L0HA 1OXBA 1OW7A 1S7ZA 2L7AA 2Y3DA 3LLKA 4I1OB 4OIRF 5JVEA 4MS2A 3WODF 3U8VA 1WATA 1R4TA 2CDQA 2LCHA 1ZYRF 2R7TA 5L0JA 1D1BA 3GORA 1JPJA 4MNDA 4O6NA 4BEJA 5JS5A 4ZLCA 4YL0A 2HMQA 1K05A 1T01A 2NSGA 1Z5ZA 1I4ZA 4DVYP 2CNWA 2WVNA 2GAQA 1VLTA 3UMHA 4JC7A 4OD5A 2R7UA 1OR2A 2RSEB 3NDBB 4DOZA 2OEXA 3S28A 1OCOC 4YL1A 4U5EE 4IAQA 2L6GA 1TWGA 2MHRA 2R03A 2WZFA 2YL1A 1WWPA 4E17A 4U5DE 1J8MF 5A6JA 1WOLA 3U5SA 1HMOA 1NFOA 2WB7A 2J46A 5KYNA 3SXZA 4E0IA 1DOWA 1G8XA 1PCXA 4HEAJ 3SXKA 3ZQVA 2KW3C 2IYLD 3AOUA 3IQTA 3GM1A 5DLJA 2PX0A 4N6HA 1L3PA 1YYXA 3M79A 1I5NA 4O79A 2W4MA 4Z9IA 3LS0A 3T9OA 3ZG1A 2XLHA 4IJJA 1FTSA 2YL3A 1O87A 2VASA 1ZVZA 1Q0DA 2H8AA 1O5HA 2YLIA 4ULWA 3FVYA 4A4AA 4E18A 4G7OF 3QVYA 5L3QA 2J8WA 4XLNF 1EQ1A 2B0JA 1Z3IX 2A69F 4GQHA 4CS8A 2F22A 3ABKC 3MYIA 3DI5A 1FNTc 3T6JA 2OU6A 2J0XA 3QTHA 4MW8A 4JVSA 2W4BA 4NTBA 4X0RA 3ZQYA 3EHMA 2GWWA 3OEOA 1CGOA 3VYWA 2WZLA 3AG4C 2XLVA 256BA 3NRHA 2R7SA 2R7XA 5BQGA 3NMJA 1QVXA 1LPEA 3LESA 3DWWA 4YWQA 2WVOA 2PNOA 2CYDA 3DJUB 4JRZA 2HSQA 3S9OA 3KL4A 3T4RA 1R5ID 3FDQA 2O9XA 3FAPB 2HJMA 5F5FA 3EH2A 3ASNC 3EGDB 4MQ9F 5L0CA 1A7DA 3DD7A 4L6RA 3RF3A 3EZIA 4J7TA 1A7VA 2JD3A 2ZXOA 3AGUA 1L7CA 1B68A 1BBHA 2ZXWC 4U9DA 3MBGA 1YDIA 3JYYA 1QPUA 3O10A 3T6GB 2H7OA 3EHNA 3UGPA 2OKUA 3NMKA 3N2ZB 1NU7D 1PV3A 2L6FA 5B1AC 4N6CA 3U0CA 4JTCB 3EGDA 5BQIA 1OCCC 2KJGA 2WVQA 2NSFA 5KYWB 4P6IC 1GQAA 1MQVA 2ZXRA 4U5FE 3ZC4A 1K04A 3GWNA 1LS1A 1TQGA 4AL0A 1LE4A 1KNYA 3HKKA 4XTKA 1T6QA 3FXHA 4Q7CA 4KNWA 1G5ZA 1Q0MA 1CGME 5JP7A 1KU2A 4NTFA 2VCBA 4K0DA 1MMNA 4G7ZF 1T6UA 1YA7O 2YWAA 3RW0A 3VM6A 4CS8C 3DE8A 4KNVA 1RJ9B 5KYWA 4J7YA 5B3IA 1M2OA 2FFHA 5B1BC 3HNIA 3OWTA 4NQFA 3O55A 4BJ6C 4CJGA 2XSEA 5AC4A 2XM4A 4IB4A 4J32B 2ICWG 5HSWA 2XXAB 1N1CA 3UMKA 2HZ8A 3U9MA 2R7QA 2Y69C 5K0IA 2RD9A 3MX3A 2EIKC 2IXOA 2YL7A 1VK5A 2QUPA 3NYLA 3IQ6A 3K33A 2DI3A 1RJ9A 2IM8A 2XL4A 1Y4CA 3NKDA 3ASOC 2LK4A 1RKCA 1FMWA 3RH3A 3TULA 1VYIA 1G4US 4KI2A 2ZXPA 5F28E 2XXAA 1CGNA 1OR3A 1SMYF 2YZSA 3FHDA 3GEHA 3RQGA 2EIMC 2A68F 1M6TA 2LSEA 2VCAA 3G50A 3ITFA 3FMSA 3K1HA 2Y3HA 3JRMO 1RMVA 1OW6A 1NFNA 1VMAA 1K40A 1TKNA 3IPMO 4G78A 3GODA 4HFKB 3Q7LA 2J9BA 3L34A 2LP4A 2X0CA 2Q00A 4IGGA 1RKEB 3UNGC 1Z63A 3U9JA 2KSFA 1JAFA 3MFNA 4IRUA 4XPWA 1RCPA 4BJ5A 4K1OA 3U2MA 4MVQA 1LI7A 3G4XA 5T3TA 1GS9A 2AWCA 2LFDA 5A6KA 1QSPA 1RXQA 3QW0A 4NTAA 3GM2A 4CBEA 2CGEA 5FCLA 2AP3A 1Z7Qc 4BG0A 3GEEA 3VRCA 4U5HA 1RKEA 4W8KA 2AVKA 3PMRA 4JEAA 2EPNA 3NMIA 2PX3A 4PJLA 4CS9A 4OINF 4YT4A 2VC9A 3B0PA 5L0FA 4U5GA 3LLIA 3T6BA 4CIHA 3DJNB 4IARA 2YVKA 1H6GA 1U89A 2QNLA 4EHPA 4Q5SF 1XWJA 4CDYA 1YARO 4YN0B 1LKXA 1S05A 3M4BA 5B3SC 4B6IA 4ER9A 4YK5A 1V74B 2HS5A 3K66A 2XS1A 5FZTA 2UUIA 3KKBA 1W2WA 3SXMA 2YKZA 3JTLO 5DS6A 1EA8A 4PK4A 4PJNA 3GM3A 2P0NA 2VH3A 2X51A 2YL0A 4EUKB 2KGOA 3CZ6A 4DVZA 4E7ZA 2Q9AA 1U6HA 3CEXA 5L0DA 3KPHA 5JRAA 4OIOF 1ZU5A 1MNDA 2OCCC 4EKWA 1EKYA 1OKKA 3L8JA 1SR2A 2YHSA 4ULVA 3GEIA 1OW8A 4I3MA 4DBQA 1JMWA 4CDVA 1HW1A 4JJGA 5A69A 1JOGA 2XM0A 2PFDA 1QLEC 4LDKA 4MTGA 4J30B 4MVMA 1VB5A 2A1DD 2OJQA 2YQYA 3JYHA 2LQGA 4OD4A 3F47A 2EPKX 4BJ1A 3DAGA 1WGWA 1NZEA 3JZ0A 4F4BA 1F1MA 2J9VA 1HE9A 3JT1A 1IW7F 4E0HA 4BPMA 1TR2A 5E3AA 4DBRA 3CQZA 2J9WA 4JE9A 2HJ3A 3DXJF 3CAXA 4CS9C 3S27A 1H7IA 3E9VA 3TD7A 4CJOA 1C17M 2BE5F 4Z9JA 3LUTB 5EK0A 2IXNA 3DM9B 3TJ5A 2P7VA 3BEHA 1YAUO 2ZD9A 4CIPA 1YJGA 4EBJA 3M4CA 5L0GA 3A9CA 3DZAA 3C63A 2J9UA 2HMZA 3AQCA 2J7PD 2DYSC 2A0BA 2CW0F 5JUAA 2EPOA 4QI2A 3B0UX 1QZXA 2XLDA 4FESA 2R7OA 1ZW3A 2H7VC 3JRTA 4JZAA 1A7EA 1GM5A 2PP4A 1NU9C 4YT5A 2IXPA 3R2PA 5DVWA 4C3DA 4OIPF 2HV6A 2NG1A 5CI8A 2GA0A 1SZIA 2XL6A 1NSGB 4YT2A 2BC5A 3TJ6A 3UR3C 2TMVP 1KTMA 1WN0A 4N4WA 4GYTA 4G7HF 3CSKA 3R7CA 2PBEA 5IY5C 3L8IA 2KC3A 1TFOB 1ZHXA 3K6BA 2G62A 3N24A 3C8GD 3O6XA 4H54A 5CI9A 3HNJA 5JLIA 5GPGB 5DQZA 1E85A 3DKAA 1D1AA 2Y3GA 2LD6A 1E83A 2OQMA 3PHF2 4Q4ZF 3AJMA 1TWCA 2P1AA 3DAFA 3TOLA 4RD9A 3HTKC 4D4NA 1CPRA 4JIOA 4H4KC 1E2XA 2HFIA 3B71A 3E70C 4JURI 4LACB 5EHHA 5KYXB 3U3BA 1FAPB 1DOVA 1YVIA 3C8ZA 3Q6NA 4I1MA 4D4XA 1Z23A 5CIVA 2MYSA 1OXKA 2UUHA 2XLMA 1Y6DA 3MYFA 4QDLA 4BJTA 5L3VA 2E87A 2KK1A 2J45A 4MTOA 1LS4A 4E7SA 2H7BA 4XQ1A 2R02A 3IHUA 1TWHA 1SYQA 1YA9A 4PFOA 3IQ5A 2QE9A 3JSZA 5KYXA 1H9TA 2C04A 3ZVRA 1C03A 3OA1A 4DRHB 2NUPB 2QLAA 4DRIB 3H2UA 1HE1A 4EBKA 2WZGA 3HNKA 3AGTA 2DGJA 4K7BA 2R9RB 3ZTMA 5AGFA 1V55C 4C7OB 2XLWA
chains in the Genus database with same CATH topology
3X1OA 3RYLA 2A6EF 2Y39A 4C3BA 4G0HA 4FX5A 1M57C 2KNHA 1IZMA 2NUPA 2Q9BA 5D92A 3EFOB 5D91A 2Q3TA 2QTVA 1VOMA 4C7OA 4JW1A 2G3VA 3I5QA 5BUOA 2CNWD 2EINC 2ZPAA 3EJNA 4LLCA 3O39A 3GANA 5KYYB 1ZU4A 4ANJA 3EFOA 3ABLC 2Y3BA 3EPVA 3V7OA 1BR1A 4YJWA 3WG7C 1ZHWA 1M56C 3DMDA 4PFPA 1D0YA 5T3WA 1MMAA 5KYYA 1MMDA 4PJMA 4AX2A 2FGYA 5KYUB 4KBLA 3ZSUA 4C3EA 2W9YA 3NKEA 2YEVA 2WL8A 2Q9CA 1V54C 2DYRC 4GEHA 1ZHTA 5F5HA 2I8BA 3F46A 4U5CE 2R7RA 5KYUA 4BJ5C 4LERA 2A6HF 1BR2A 3EH1A 4XWJA 3RKOF 3B9QA 5T1DB 3B0VC 2IOQA 1ST6A 3Q6MA 5E3CA 4LLEA 4EBBA 2L81A 1Z6AA 4RBNA 3EG9B 2V26A 3K1IC 1BR4A 1OCRC 4N06A 4AK9A 3NYJA 3AG1C 4JJFA 4AE4B 3SZRA 3LNRA 3EGXB 3EQLF 3LAYA 3NG1A 1M2VB 4NY3A 3IEEA 3EG9A 5DQTA 2G3KA 1LVKA 4AE4A 3W2VA 2MWQA 2Z15A 1NG1A 3EGXA 4IWBA 1M2VA 5DS5A 3S29A 3VAYA 3I4UA 4O7GA 3SNHA 4JCHA 3LS1A 1MNEA 3H65A 4CSAA 1JPNA 4EWCA 3AG3C 2V3CC 1J8YF 3HJCA 3POVA 3UMIA 5EGYA 5DS4A 2XRHA 1MMGA 3HLZA 3SP1A 3LJBA 4IAOA 2NUTB 3DM5A 2J7PA 4O6MA 4OIQF 3I5PA 4ZLDA 1ZHZA 4KC9A 3EZHA 3W8IA 3N0TA 3QZCA 4RDAA 1PD0A 3SYNA 3AQBA 2EILC 3FAJA 2NUTA 4CS7A 2R7VA 3UGOA 3W2WA 2W45A 2M4EA 1PD1A 2J0WA 1D0XA 3SEOA 2IXMA 4HE8D 3QMKA 3ZIBA 3K7DA 3ABMC 3LEVA 2P6VA 2OG2A 1FFHA 4U5BE 1FMVA 4O6YA 5E33A 4CSAC 3M1CB 1D1CA 5E2QA 3W8HA 4WJ0A 3ECSA 2PF4E 3RFYA 3L0IA 3S0XA 2QY9A 2L9JA 4FWVA 3JCUQ 1ZHYA 1D0ZA 4M63A 3MLGA 4I44A 3X2QC 1TWAA 2EIJC 3KH2A 2GFHA 3AG2C 4QI0A 3KMIA 1FFTC 1OKKD 3NYMA 3RIPA 4XLPF 4HFFB 2R7WA 1SF8A 2C03A 3Q7GA 4PJJA 4YT8A 2VB6A 1VYKA 2HV7A 2KQ9A 2D5RB 1OCZC 4A2NB 1S7ZA 3LLKA 4OIRF 2Y3DA 4I1OB 3WODF 2CDQA 1ZYRF 2R7TA 1D1BA 4O6NA 1JPJA 4MNDA 4BEJA 4ZLCA 1Z5ZA 4DVYP 2CNWA 2WVNA 3UMHA 4OD5A 2R7UA 3NDBB 4DOZA 3S28A 1OCOC 4U5EE 1TWGA 2WZFA 4U5DE 1J8MF 2WB7A 2J46A 5KYNA 1G8XA 1PCXA 4HEAJ 2KW3C 2IYLD 5DLJA 2PX0A 4O79A 2W4MA 3LS0A 3ZG1A 4IJJA 1FTSA 1O87A 2VASA 4ULWA 1O5HA 3FVYA 4G7OF 5L3QA 4XLNF 2B0JA 1Z3IX 2A69F 4CS8A 3ABKC 3T6JA 4X0RA 2J0XA 4JVSA 2W4BA 4BJ6A 3EHMA 3OEOA 3VYWA 2WZLA 3AG4C 2R7SA 3NRHA 2R7XA 3LESA 4YWQA 2WVOA 3DJUB 3KL4A 3T4RA 3FDQA 2O9XA 5F5FA 3EH2A 3ASNC 3EGDB 4MQ9F 3DD7A 3EZIA 2ZXOA 2JD3A 2ZXWC 3UGPA 2H7OA 3EHNA 3N2ZB 1NU7D 5B1AC 3EGDA 1OCCC 2KJGA 2WVQA 5KYWB 4P6IC 4U5FE 2ZXRA 3ZC4A 1LS1A 4XTKA 4Q7CA 4KNWA 1KU2A 4K0DA 1MMNA 4G7ZF 4CS8C 4KNVA 5KYWA 1RJ9B 1M2OA 2FFHA 5B1BC 4BJ6C 3OWTA 2XSEA 4J32B 5HSWA 2XXAB 1N1CA 3UMKA 2R7QA 2Y69C 3MX3A 2EIKC 2IXOA 1VK5A 3NYLA 3K33A 1RJ9A 2XL4A 3NKDA 3ASOC 1FMWA 3RH3A 1VYIA 4KI2A 2ZXPA 2XXAA 1SMYF 2YZSA 3FHDA 2EIMC 2A68F 2LSEA 3ITFA 3K1HA 2Y3HA 1VMAA 1TKNA 3GODA 4HFKB 3Q7LA 3L34A 3UNGC 1Z63A 4IRUA 4BJ5A 5T3TA 4CBEA 2CGEA 5FCLA 4BG0A 4U5HA 4W8KA 3PMRA 2PX3A 4PJLA 4CS9A 4OINF 4YT4A 3B0PA 4U5GA 3LLIA 3T6BA 4CIHA 3DJNB 4Q5SF 4YN0B 1LKXA 5B3SC 4B6IA 3K66A 3KKBA 1W2WA 5DS6A 4PK4A 4PJNA 2VH3A 2X51A 4E7ZA 2KGOA 3CZ6A 4DVZA 2Q9AA 4OIOF 1ZU5A 1MNDA 2OCCC 1OKKA 2YHSA 4I3MA 4DBQA 4JJGA 2PFDA 1QLEC 4J30B 2A1DD 3JYHA 4OD4A 3F47A 4BJ1A 3DAGA 1WGWA 1NZEA 4F4BA 3JT1A 2J9VA 1IW7F 1TR2A 5E3AA 4DBRA 3CQZA 2J9WA 3DXJF 4CS9C 3S27A 3E9VA 3TD7A 2BE5F 2IXNA 3DM9B 2P7VA 3DZAA 2J9UA 3AQCA 2J7PD 2DYSC 2CW0F 4QI2A 3B0UX 1QZXA 4FESA 2R7OA 2H7VC 3JRTA 4JZAA 2PP4A 1NU9C 4YT5A 2IXPA 4C3DA 5DVWA 4OIPF 2HV6A 2NG1A 5CI8A 1SZIA 4YT2A 3UR3C 4GYTA 4G7HF 3CSKA 5IY5C 3N24A 3K6BA 1ZHXA 2G62A 3O6XA 5CI9A 5DQZA 1D1AA 2Y3GA 3PHF2 4Q4ZF 1TWCA 3DAFA 4RD9A 3HTKC 4H4KC 3E70C 4JURI 4LACB 5EHHA 5KYXB 3Q6NA 4I1MA 1Z23A 2MYSA 4BJTA 4QDLA 5L3VA 2E87A 2J45A 4E7SA 2H7BA 1TWHA 4PFOA 3JSZA 5KYXA 2C04A 3ZVRA 3OA1A 2NUPB 2WZGA 4K7BA 2DGJA 1V55C 4C7OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IXO A;  2G62 A;  2IXN A;  4NY3 A;  2HV7 A;  2IXP A;  2IXM A;  2HV6 A;  4LAC B; 
#chains in the Genus database with same CATH topology
 3X1O A;  3RYL A;  2A6E F;  2Y39 A;  5A6B A;  1FR0 A;  4C3B A;  4FAP B;  4G0H A;  4FX5 A;  4CX9 A;  1M57 C;  2KNH A;  1IZM A;  2NUP A;  2Q9B A;  2D4U A;  3A11 A;  4XEV A;  1NBB A;  2YRF A;  5D92 A;  3EFO B;  5D91 A;  2Q3T A;  1G4W R;  2QTV A;  1VOM A;  4C7O A;  4XEF A;  4JW1 A;  2G3V A;  1LI5 A;  3I5Q A;  2HUJ A;  4XPX A;  5BUO A;  2CNW D;  3C62 A;  2EIN C;  1WTY A;  3DE9 A;  2ZPA A;  3EJN A;  2ASR A;  2XLE A;  3KYJ A;  3O39 A;  4LLC A;  3GAN A;  3RVZ A;  3K1I A;  4MVS A;  1A41 A;  5KYY B;  1ZU4 A;  2P61 A;  3EFO A;  4ANJ A;  3LNM B;  1LIH A;  3ATP A;  3ABL C;  5AC5 A;  5L0I A;  2Y3B A;  3EPV A;  3J06 A;  3V7O A;  1BR1 A;  3M15 A;  1AVO B;  4YJW A;  1O3U A;  2Q4F A;  3WG7 C;  1ZHW A;  1M56 C;  3DMD A;  4ONS A;  4NCQ A;  1D0Y A;  4PFP A;  5T3W A;  2BL2 A;  5HV9 A;  1MMA A;  4WGZ A;  1BDJ B;  5KYY A;  1MMD A;  4PJM A;  2ETS A;  2FGY A;  4AX2 A;  5KYU B;  3U8P A;  2JPU A;  1UG7 A;  1ORJ A;  4KBL A;  3ZSU A;  3V5Z A;  3QVZ A;  4C3E A;  1Q0K A;  2W9Y A;  3NKE A;  1NLX A;  2M64 A;  2YEV A;  2WL8 A;  3VF0 A;  1T5O A;  2Q9C A;  3RQE A;  1V54 C;  3GWL A;  2DYR C;  4GEH A;  1XZP A;  1ZHT A;  1A0B A;  3QW1 A;  2IBF A;  5F5H A;  2I8B A;  3F46 A;  4U5C E;  2R7R A;  2Q7R A;  2VCC A;  1ZW2 A;  2R25 A;  2XS8 A;  4MW3 A;  1BZ4 A;  4PAC A;  2B0H A;  5KYU A;  3L1M A;  4LER A;  4BJ5 C;  5COG A;  2L6H A;  2A6H F;  4P9T A;  1BR2 A;  3EH1 A;  3JSE O;  4XWJ A;  5JSL A;  4XEK A;  3RKO F;  3B9Q A;  5T1D B;  2LIG A;  3B0V C;  1HY5 A;  4MVU A;  4PR9 A;  4U9E A;  3HNL A;  3BRJ A;  2IOQ A;  2EPL X;  1ST6 A;  4LDR A;  3Q6M A;  5E3C A;  4LLE A;  4EBB A;  2L81 A;  1Z6A A;  4RBN A;  2DB4 A;  3EG9 B;  5COF A;  3SXY A;  2V26 A;  3K1I C;  1BR4 A;  1OCR C;  4N06 A;  4AK9 A;  3NYJ A;  3AG1 C;  4JJF A;  1E86 A;  3S84 A;  3U3F A;  1GGQ A;  4AE4 B;  3SZR A;  3LNR A;  2AU5 A;  3EGX B;  3EQL F;  3LAY A;  1T9K A;  4DRJ B;  1V4A A;  3NG1 A;  1M2V B;  4NY3 A;  3IEE A;  5BQH A;  3EG9 A;  1QQ3 A;  4EIY A;  2XL8 A;  5DQT A;  2LFF A;  4LDQ A;  3PCV A;  1YYJ A;  2G3K A;  1LVK A;  2YLG A;  4AE4 A;  2R05 A;  3W2V A;  2MWQ A;  2Z15 A;  4MVR A;  1NG1 A;  1ORY A;  3EGX A;  3FOP A;  4JEB A;  4IWB A;  4DJ9 A;  1M2V A;  4P9F A;  5DS5 A;  3S29 A;  3VAY A;  3I4U A;  4O7G A;  3SNH A;  1Q0G A;  1LM3 B;  4JCH A;  2XLO A;  3LS1 A;  1MNE A;  3H65 A;  4CSA A;  4JTA B;  1JPN A;  4EWC A;  3AG3 C;  4YL3 A;  4CDA A;  2NPU A;  2V3C C;  4NC3 A;  3US6 A;  1J8Y F;  3LEO A;  3HJC A;  3POV A;  1HW2 A;  1VLS A;  2OOC A;  3UMI A;  5EGY A;  5DS4 A;  2XRH A;  3WAQ A;  2I15 A;  3TK0 A;  1ZZP A;  3ZTZ A;  1MMG A;  3HLZ A;  3SP1 A;  3W4Y A;  2KYH A;  3LJB A;  4WAB A;  4BJ6 A;  3TQO A;  4IAO A;  3WHN A;  4WGY A;  2NUT B;  3V5Y A;  1VTM P;  4BEM J;  3DM5 A;  1YLM A;  2J7P A;  4O6M A;  4OIQ F;  3I5P A;  4ZLD A;  2GDC A;  1ZHZ A;  4Z9H A;  4KC9 A;  3EZH A;  3W8I A;  3C8G B;  3N0T A;  3RVY A;  1C02 A;  5A6B D;  3QZC A;  4MTF A;  4RDA A;  1PD0 A;  3V5X A;  2FAP B;  3SYN A;  3AQB A;  1JRA A;  1OQC A;  2EIL C;  3C18 A;  1YZC A;  1EI7 A;  3FAJ A;  1APC A;  2NUT A;  4CS7 A;  2R7V A;  3UGO A;  3W2W A;  1XZQ A;  4JCZ A;  2W45 A;  2M4E A;  1PD1 A;  2J0W A;  2OEV A;  2AWY A;  1D0X A;  3SEO A;  2IXM A;  4HE8 D;  3U2L A;  3QMK A;  3C8G A;  3ZIB A;  1E84 A;  3PDM P;  1YZA A;  3K7D A;  4UDV A;  1Q0F A;  3ABM C;  3G4Z A;  2P6V A;  3LEV A;  5A6A A;  2EPM X;  2OG2 A;  3IQC A;  1FFH A;  1H9G A;  2JX0 A;  1FMV A;  3KYI A;  4MVZ A;  4O6Y A;  4U5B E;  1QKR A;  5E33 A;  4JKV A;  4CSA C;  3M1C B;  4W8P A;  1D1C A;  1UFB A;  2HSB A;  5JT4 A;  5E2Q A;  3H2V A;  4WJ0 A;  3W8H A;  3ECS A;  1AEP A;  2PF4 E;  3RFY A;  3L0I A;  3TOM A;  1AUE A;  4XPY A;  3S0X A;  1LE2 A;  2QY9 A;  2L9J A;  4FWV A;  3JCU Q;  5TJ5 E;  1ZHY A;  1D0Z A;  4M63 A;  3MLG A;  4I44 A;  3X2Q C;  4DXW A;  3B29 A;  3S90 A;  1TWA A;  2EIJ C;  1U0B B;  3KH2 A;  1TFK B;  2GFH A;  3AG2 C;  1I4Y A;  1CPQ A;  2CCY A;  4R32 A;  4QI0 A;  1ORS C;  3KMI A;  1FFT C;  1OKK D;  3NYM A;  5COM A;  4JTD B;  3RIP A;  4AL1 A;  4XLP F;  4HFF B;  1HMD A;  2R7W A;  3C7J A;  1SF8 A;  2C03 A;  3FOO A;  2OJE D;  4MVO A;  3Q7G A;  4PJJ A;  3RQF A;  4YT8 A;  3ZWI A;  1T6I A;  2VB6 A;  1VYK A;  1WAS A;  2A0U A;  2HV7 A;  2KQ9 A;  3ZDL A;  2YLD A;  1JR8 A;  2D5R B;  1OCZ C;  2HKV A;  4A2N B;  5L0H A;  1OXB A;  1OW7 A;  1S7Z A;  2L7A A;  2Y3D A;  3LLK A;  4I1O B;  4OIR F;  5JVE A;  4MS2 A;  3WOD F;  3U8V A;  1WAT A;  1R4T A;  2CDQ A;  2LCH A;  1ZYR F;  2R7T A;  5L0J A;  1D1B A;  3GOR A;  1JPJ A;  4MND A;  4O6N A;  4BEJ A;  5JS5 A;  4ZLC A;  4YL0 A;  2HMQ A;  1K05 A;  1T01 A;  2NSG A;  1Z5Z A;  1I4Z A;  4DVY P;  2CNW A;  2WVN A;  2GAQ A;  1VLT A;  3UMH A;  4JC7 A;  4OD5 A;  2R7U A;  1OR2 A;  2RSE B;  3NDB B;  4DOZ A;  2OEX A;  3S28 A;  1OCO C;  4YL1 A;  4U5E E;  4IAQ A;  2L6G A;  1TWG A;  2MHR A;  2R03 A;  2WZF A;  2YL1 A;  1WWP A;  4E17 A;  4U5D E;  1J8M F;  5A6J A;  1WOL A;  3U5S A;  1HMO A;  1NFO A;  2WB7 A;  2J46 A;  5KYN A;  3SXZ A;  4E0I A;  1DOW A;  1G8X A;  1PCX A;  4HEA J;  3SXK A;  3ZQV A;  2KW3 C;  2IYL D;  3AOU A;  3IQT A;  3GM1 A;  5DLJ A;  2PX0 A;  4N6H A;  1L3P A;  1YYX A;  3M79 A;  1I5N A;  4O79 A;  2W4M A;  4Z9I A;  3LS0 A;  3T9O A;  3ZG1 A;  2XLH A;  4IJJ A;  1FTS A;  2YL3 A;  1O87 A;  2VAS A;  1ZVZ A;  1Q0D A;  2H8A A;  1O5H A;  2YLI A;  4ULW A;  3FVY A;  4A4A A;  4E18 A;  4G7O F;  3QVY A;  5L3Q A;  2J8W A;  4XLN F;  1EQ1 A;  2B0J A;  1Z3I X;  2A69 F;  4GQH A;  4CS8 A;  2F22 A;  3ABK C;  3MYI A;  3DI5 A;  1FNT c;  3T6J A;  2OU6 A;  2J0X A;  3QTH A;  4MW8 A;  4JVS A;  2W4B A;  4NTB A;  4X0R A;  3ZQY A;  3EHM A;  2GWW A;  3OEO A;  1CGO A;  3VYW A;  2WZL A;  3AG4 C;  2XLV A;  256B A;  3NRH A;  2R7S A;  2R7X A;  5BQG A;  3NMJ A;  1QVX A;  1LPE A;  3LES A;  3DWW A;  4YWQ A;  2WVO A;  2PNO A;  2CYD A;  3DJU B;  4JRZ A;  2HSQ A;  3S9O A;  3KL4 A;  3T4R A;  1R5I D;  3FDQ A;  2O9X A;  3FAP B;  2HJM A;  5F5F A;  3EH2 A;  3ASN C;  3EGD B;  4MQ9 F;  5L0C A;  1A7D A;  3DD7 A;  4L6R A;  3RF3 A;  3EZI A;  4J7T A;  1A7V A;  2JD3 A;  2ZXO A;  3AGU A;  1L7C A;  1B68 A;  1BBH A;  2ZXW C;  4U9D A;  3MBG A;  1YDI A;  3JYY A;  1QPU A;  3O10 A;  3T6G B;  2H7O A;  3EHN A;  3UGP A;  2OKU A;  3NMK A;  3N2Z B;  1NU7 D;  1PV3 A;  2L6F A;  5B1A C;  4N6C A;  3U0C A;  4JTC B;  3EGD A;  5BQI A;  1OCC C;  2KJG A;  2WVQ A;  2NSF A;  5KYW B;  4P6I C;  1GQA A;  1MQV A;  2ZXR A;  4U5F E;  3ZC4 A;  1K04 A;  3GWN A;  1LS1 A;  1TQG A;  4AL0 A;  1LE4 A;  1KNY A;  3HKK A;  4XTK A;  1T6Q A;  3FXH A;  4Q7C A;  4KNW A;  1G5Z A;  1Q0M A;  1CGM E;  5JP7 A;  1KU2 A;  4NTF A;  2VCB A;  4K0D A;  1MMN A;  4G7Z F;  1T6U A;  1YA7 O;  2YWA A;  3RW0 A;  3VM6 A;  4CS8 C;  3DE8 A;  4KNV A;  1RJ9 B;  5KYW A;  4J7Y A;  5B3I A;  1M2O A;  2FFH A;  5B1B C;  3HNI A;  3OWT A;  4NQF A;  3O55 A;  4BJ6 C;  4CJG A;  2XSE A;  5AC4 A;  2XM4 A;  4IB4 A;  4J32 B;  2ICW G;  5HSW A;  2XXA B;  1N1C A;  3UMK A;  2HZ8 A;  3U9M A;  2R7Q A;  2Y69 C;  5K0I A;  2RD9 A;  3MX3 A;  2EIK C;  2IXO A;  2YL7 A;  1VK5 A;  2QUP A;  3NYL A;  3IQ6 A;  3K33 A;  2DI3 A;  1RJ9 A;  2IM8 A;  2XL4 A;  1Y4C A;  3NKD A;  3ASO C;  2LK4 A;  1RKC A;  1FMW A;  3RH3 A;  3TUL A;  1VYI A;  1G4U S;  4KI2 A;  2ZXP A;  5F28 E;  2XXA A;  1CGN A;  1OR3 A;  1SMY F;  2YZS A;  3FHD A;  3GEH A;  3RQG A;  2EIM C;  2A68 F;  1M6T A;  2LSE A;  2VCA A;  3G50 A;  3ITF A;  3FMS A;  3K1H A;  2Y3H A;  3JRM O;  1RMV A;  1OW6 A;  1NFN A;  1VMA A;  1K40 A;  1TKN A;  3IPM O;  4G78 A;  3GOD A;  4HFK B;  3Q7L A;  2J9B A;  3L34 A;  2LP4 A;  2X0C A;  2Q00 A;  4IGG A;  1RKE B;  3UNG C;  1Z63 A;  3U9J A;  2KSF A;  1JAF A;  3MFN A;  4IRU A;  4XPW A;  1RCP A;  4BJ5 A;  4K1O A;  3U2M A;  4MVQ A;  1LI7 A;  3G4X A;  5T3T A;  1GS9 A;  2AWC A;  2LFD A;  5A6K A;  1QSP A;  1RXQ A;  3QW0 A;  4NTA A;  3GM2 A;  4CBE A;  2CGE A;  5FCL A;  2AP3 A;  1Z7Q c;  4BG0 A;  3GEE A;  3VRC A;  4U5H A;  1RKE A;  4W8K A;  2AVK A;  3PMR A;  4JEA A;  2EPN A;  3NMI A;  2PX3 A;  4PJL A;  4CS9 A;  4OIN F;  4YT4 A;  2VC9 A;  3B0P A;  5L0F A;  4U5G A;  3LLI A;  3T6B A;  4CIH A;  3DJN B;  4IAR A;  2YVK A;  1H6G A;  1U89 A;  2QNL A;  4EHP A;  4Q5S F;  1XWJ A;  4CDY A;  1YAR O;  4YN0 B;  1LKX A;  1S05 A;  3M4B A;  5B3S C;  4B6I A;  4ER9 A;  4YK5 A;  1V74 B;  2HS5 A;  3K66 A;  2XS1 A;  5FZT A;  2UUI A;  3KKB A;  1W2W A;  3SXM A;  2YKZ A;  3JTL O;  5DS6 A;  1EA8 A;  4PK4 A;  4PJN A;  3GM3 A;  2P0N A;  2VH3 A;  2X51 A;  2YL0 A;  4EUK B;  2KGO A;  3CZ6 A;  4DVZ A;  4E7Z A;  2Q9A A;  1U6H A;  3CEX A;  5L0D A;  3KPH A;  5JRA A;  4OIO F;  1ZU5 A;  1MND A;  2OCC C;  4EKW A;  1EKY A;  1OKK A;  3L8J A;  1SR2 A;  2YHS A;  4ULV A;  3GEI A;  1OW8 A;  4I3M A;  4DBQ A;  1JMW A;  4CDV A;  1HW1 A;  4JJG A;  5A69 A;  1JOG A;  2XM0 A;  2PFD A;  1QLE C;  4LDK A;  4MTG A;  4J30 B;  4MVM A;  1VB5 A;  2A1D D;  2OJQ A;  2YQY A;  3JYH A;  2LQG A;  4OD4 A;  3F47 A;  2EPK X;  4BJ1 A;  3DAG A;  1WGW A;  1NZE A;  3JZ0 A;  4F4B A;  1F1M A;  2J9V A;  1HE9 A;  3JT1 A;  1IW7 F;  4E0H A;  4BPM A;  1TR2 A;  5E3A A;  4DBR A;  3CQZ A;  2J9W A;  4JE9 A;  2HJ3 A;  3DXJ F;  3CAX A;  4CS9 C;  3S27 A;  1H7I A;  3E9V A;  3TD7 A;  4CJO A;  1C17 M;  2BE5 F;  4Z9J A;  3LUT B;  5EK0 A;  2IXN A;  3DM9 B;  3TJ5 A;  2P7V A;  3BEH A;  1YAU O;  2ZD9 A;  4CIP A;  1YJG A;  4EBJ A;  3M4C A;  5L0G A;  3A9C A;  3DZA A;  3C63 A;  2J9U A;  2HMZ A;  3AQC A;  2J7P D;  2DYS C;  2A0B A;  2CW0 F;  5JUA A;  2EPO A;  4QI2 A;  3B0U X;  1QZX A;  2XLD A;  4FES A;  2R7O A;  1ZW3 A;  2H7V C;  3JRT A;  4JZA A;  1A7E A;  1GM5 A;  2PP4 A;  1NU9 C;  4YT5 A;  2IXP A;  3R2P A;  5DVW A;  4C3D A;  4OIP F;  2HV6 A;  2NG1 A;  5CI8 A;  2GA0 A;  1SZI A;  2XL6 A;  1NSG B;  4YT2 A;  2BC5 A;  3TJ6 A;  3UR3 C;  2TMV P;  1KTM A;  1WN0 A;  4N4W A;  4GYT A;  4G7H F;  3CSK A;  3R7C A;  2PBE A;  5IY5 C;  3L8I A;  2KC3 A;  1TFO B;  1ZHX A;  3K6B A;  2G62 A;  3N24 A;  3C8G D;  3O6X A;  4H54 A;  5CI9 A;  3HNJ A;  5JLI A;  5GPG B;  5DQZ A;  1E85 A;  3DKA A;  1D1A A;  2Y3G A;  2LD6 A;  1E83 A;  2OQM A;  3PHF 2;  4Q4Z F;  3AJM A;  1TWC A;  2P1A A;  3DAF A;  3TOL A;  4RD9 A;  3HTK C;  4D4N A;  1CPR A;  4JIO A;  4H4K C;  1E2X A;  2HFI A;  3B71 A;  3E70 C;  4JUR I;  4LAC B;  5EHH A;  5KYX B;  3U3B A;  1FAP B;  1DOV A;  1YVI A;  3C8Z A;  3Q6N A;  4I1M A;  4D4X A;  1Z23 A;  5CIV A;  2MYS A;  1OXK A;  2UUH A;  2XLM A;  1Y6D A;  3MYF A;  4QDL A;  4BJT A;  5L3V A;  2E87 A;  2KK1 A;  2J45 A;  4MTO A;  1LS4 A;  4E7S A;  2H7B A;  4XQ1 A;  2R02 A;  3IHU A;  1TWH A;  1SYQ A;  1YA9 A;  4PFO A;  3IQ5 A;  2QE9 A;  3JSZ A;  5KYX A;  1H9T A;  2C04 A;  3ZVR A;  1C03 A;  3OA1 A;  4DRH B;  2NUP B;  2QLA A;  4DRI B;  3H2U A;  1HE1 A;  4EBK A;  2WZG A;  3HNK A;  3AGT A;  2DGJ A;  4K7B A;  2R9R B;  3ZTM A;  5AGF A;  1V55 C;  4C7O B;  2XLW A; 
#chains in the Genus database with same CATH homology
 3X1O A;  3RYL A;  2A6E F;  2Y39 A;  4C3B A;  4G0H A;  4FX5 A;  1M57 C;  2KNH A;  1IZM A;  2NUP A;  2Q9B A;  5D92 A;  3EFO B;  5D91 A;  2Q3T A;  2QTV A;  1VOM A;  4C7O A;  4JW1 A;  2G3V A;  3I5Q A;  5BUO A;  2CNW D;  2EIN C;  2ZPA A;  3EJN A;  4LLC A;  3O39 A;  3GAN A;  5KYY B;  1ZU4 A;  4ANJ A;  3EFO A;  3ABL C;  2Y3B A;  3EPV A;  3V7O A;  1BR1 A;  4YJW A;  3WG7 C;  1ZHW A;  1M56 C;  3DMD A;  4PFP A;  1D0Y A;  5T3W A;  1MMA A;  5KYY A;  1MMD A;  4PJM A;  4AX2 A;  2FGY A;  5KYU B;  4KBL A;  3ZSU A;  4C3E A;  2W9Y A;  3NKE A;  2YEV A;  2WL8 A;  2Q9C A;  1V54 C;  2DYR C;  4GEH A;  1ZHT A;  5F5H A;  2I8B A;  3F46 A;  4U5C E;  2R7R A;  5KYU A;  4BJ5 C;  4LER A;  2A6H F;  1BR2 A;  3EH1 A;  4XWJ A;  3RKO F;  3B9Q A;  5T1D B;  3B0V C;  2IOQ A;  1ST6 A;  3Q6M A;  5E3C A;  4LLE A;  4EBB A;  2L81 A;  1Z6A A;  4RBN A;  3EG9 B;  2V26 A;  3K1I C;  1BR4 A;  1OCR C;  4N06 A;  4AK9 A;  3NYJ A;  3AG1 C;  4JJF A;  4AE4 B;  3SZR A;  3LNR A;  3EGX B;  3EQL F;  3LAY A;  3NG1 A;  1M2V B;  4NY3 A;  3IEE A;  3EG9 A;  5DQT A;  2G3K A;  1LVK A;  4AE4 A;  3W2V A;  2MWQ A;  2Z15 A;  1NG1 A;  3EGX A;  4IWB A;  1M2V A;  5DS5 A;  3S29 A;  3VAY A;  3I4U A;  4O7G A;  3SNH A;  4JCH A;  3LS1 A;  1MNE A;  3H65 A;  4CSA A;  1JPN A;  4EWC A;  3AG3 C;  2V3C C;  1J8Y F;  3HJC A;  3POV A;  3UMI A;  5EGY A;  5DS4 A;  2XRH A;  1MMG A;  3HLZ A;  3SP1 A;  3LJB A;  4IAO A;  2NUT B;  3DM5 A;  2J7P A;  4O6M A;  4OIQ F;  3I5P A;  4ZLD A;  1ZHZ A;  4KC9 A;  3EZH A;  3W8I A;  3N0T A;  3QZC A;  4RDA A;  1PD0 A;  3SYN A;  3AQB A;  2EIL C;  3FAJ A;  2NUT A;  4CS7 A;  2R7V A;  3UGO A;  3W2W A;  2W45 A;  2M4E A;  1PD1 A;  2J0W A;  1D0X A;  3SEO A;  2IXM A;  4HE8 D;  3QMK A;  3ZIB A;  3K7D A;  3ABM C;  3LEV A;  2P6V A;  2OG2 A;  1FFH A;  4U5B E;  1FMV A;  4O6Y A;  5E33 A;  4CSA C;  3M1C B;  1D1C A;  5E2Q A;  3W8H A;  4WJ0 A;  3ECS A;  2PF4 E;  3RFY A;  3L0I A;  3S0X A;  2QY9 A;  2L9J A;  4FWV A;  3JCU Q;  1ZHY A;  1D0Z A;  4M63 A;  3MLG A;  4I44 A;  3X2Q C;  1TWA A;  2EIJ C;  3KH2 A;  2GFH A;  3AG2 C;  4QI0 A;  3KMI A;  1FFT C;  1OKK D;  3NYM A;  3RIP A;  4XLP F;  4HFF B;  2R7W A;  1SF8 A;  2C03 A;  3Q7G A;  4PJJ A;  4YT8 A;  2VB6 A;  1VYK A;  2HV7 A;  2KQ9 A;  2D5R B;  1OCZ C;  4A2N B;  1S7Z A;  3LLK A;  4OIR F;  2Y3D A;  4I1O B;  3WOD F;  2CDQ A;  1ZYR F;  2R7T A;  1D1B A;  4O6N A;  1JPJ A;  4MND A;  4BEJ A;  4ZLC A;  1Z5Z A;  4DVY P;  2CNW A;  2WVN A;  3UMH A;  4OD5 A;  2R7U A;  3NDB B;  4DOZ A;  3S28 A;  1OCO C;  4U5E E;  1TWG A;  2WZF A;  4U5D E;  1J8M F;  2WB7 A;  2J46 A;  5KYN A;  1G8X A;  1PCX A;  4HEA J;  2KW3 C;  2IYL D;  5DLJ A;  2PX0 A;  4O79 A;  2W4M A;  3LS0 A;  3ZG1 A;  4IJJ A;  1FTS A;  1O87 A;  2VAS A;  4ULW A;  1O5H A;  3FVY A;  4G7O F;  5L3Q A;  4XLN F;  2B0J A;  1Z3I X;  2A69 F;  4CS8 A;  3ABK C;  3T6J A;  4X0R A;  2J0X A;  4JVS A;  2W4B A;  4BJ6 A;  3EHM A;  3OEO A;  3VYW A;  2WZL A;  3AG4 C;  2R7S A;  3NRH A;  2R7X A;  3LES A;  4YWQ A;  2WVO A;  3DJU B;  3KL4 A;  3T4R A;  3FDQ A;  2O9X A;  5F5F A;  3EH2 A;  3ASN C;  3EGD B;  4MQ9 F;  3DD7 A;  3EZI A;  2ZXO A;  2JD3 A;  2ZXW C;  3UGP A;  2H7O A;  3EHN A;  3N2Z B;  1NU7 D;  5B1A C;  3EGD A;  1OCC C;  2KJG A;  2WVQ A;  5KYW B;  4P6I C;  4U5F E;  2ZXR A;  3ZC4 A;  1LS1 A;  4XTK A;  4Q7C A;  4KNW A;  1KU2 A;  4K0D A;  1MMN A;  4G7Z F;  4CS8 C;  4KNV A;  5KYW A;  1RJ9 B;  1M2O A;  2FFH A;  5B1B C;  4BJ6 C;  3OWT A;  2XSE A;  4J32 B;  5HSW A;  2XXA B;  1N1C A;  3UMK A;  2R7Q A;  2Y69 C;  3MX3 A;  2EIK C;  2IXO A;  1VK5 A;  3NYL A;  3K33 A;  1RJ9 A;  2XL4 A;  3NKD A;  3ASO C;  1FMW A;  3RH3 A;  1VYI A;  4KI2 A;  2ZXP A;  2XXA A;  1SMY F;  2YZS A;  3FHD A;  2EIM C;  2A68 F;  2LSE A;  3ITF A;  3K1H A;  2Y3H A;  1VMA A;  1TKN A;  3GOD A;  4HFK B;  3Q7L A;  3L34 A;  3UNG C;  1Z63 A;  4IRU A;  4BJ5 A;  5T3T A;  4CBE A;  2CGE A;  5FCL A;  4BG0 A;  4U5H A;  4W8K A;  3PMR A;  2PX3 A;  4PJL A;  4CS9 A;  4OIN F;  4YT4 A;  3B0P A;  4U5G A;  3LLI A;  3T6B A;  4CIH A;  3DJN B;  4Q5S F;  4YN0 B;  1LKX A;  5B3S C;  4B6I A;  3K66 A;  3KKB A;  1W2W A;  5DS6 A;  4PK4 A;  4PJN A;  2VH3 A;  2X51 A;  4E7Z A;  2KGO A;  3CZ6 A;  4DVZ A;  2Q9A A;  4OIO F;  1ZU5 A;  1MND A;  2OCC C;  1OKK A;  2YHS A;  4I3M A;  4DBQ A;  4JJG A;  2PFD A;  1QLE C;  4J30 B;  2A1D D;  3JYH A;  4OD4 A;  3F47 A;  4BJ1 A;  3DAG A;  1WGW A;  1NZE A;  4F4B A;  3JT1 A;  2J9V A;  1IW7 F;  1TR2 A;  5E3A A;  4DBR A;  3CQZ A;  2J9W A;  3DXJ F;  4CS9 C;  3S27 A;  3E9V A;  3TD7 A;  2BE5 F;  2IXN A;  3DM9 B;  2P7V A;  3DZA A;  2J9U A;  3AQC A;  2J7P D;  2DYS C;  2CW0 F;  4QI2 A;  3B0U X;  1QZX A;  4FES A;  2R7O A;  2H7V C;  3JRT A;  4JZA A;  2PP4 A;  1NU9 C;  4YT5 A;  2IXP A;  4C3D A;  5DVW A;  4OIP F;  2HV6 A;  2NG1 A;  5CI8 A;  1SZI A;  4YT2 A;  3UR3 C;  4GYT A;  4G7H F;  3CSK A;  5IY5 C;  3N24 A;  3K6B A;  1ZHX A;  2G62 A;  3O6X A;  5CI9 A;  5DQZ A;  1D1A A;  2Y3G A;  3PHF 2;  4Q4Z F;  1TWC A;  3DAF A;  4RD9 A;  3HTK C;  4H4K C;  3E70 C;  4JUR I;  4LAC B;  5EHH A;  5KYX B;  3Q6N A;  4I1M A;  1Z23 A;  2MYS A;  4BJT A;  4QDL A;  5L3V A;  2E87 A;  2J45 A;  4E7S A;  2H7B A;  1TWH A;  4PFO A;  3JSZ A;  5KYX A;  2C04 A;  3ZVR A;  3OA1 A;  2NUP B;  2WZG A;  4K7B A;  2DGJ A;  1V55 C;  4C7O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...