2HV7A

Crystal structure of phosphotyrosyl phosphatase activator bound to atpgammas
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
301
structure length
301
Chain Sequence
b'NFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein phosphatase 2A, regulatory subunit B
publication title Structure and mechanism of the phosphotyrosyl phosphatase activator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 101
structure length 301
sequence length 301
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2hv7A02
2IXPA 2IXMA 2G62A 2IXOA 2IXNA 4LACB 2HV6A 2HV7A 4NY3A
chains in the Genus database with same CATH superfamily
5BQHA 3ABMC 2PX0A 2GFHA 2XS1A 4D4XA 2Q3TA 4HE8D 1NFNA 3Q7LA 4I3MA 4MVUA 2V3CC 4AE4B 1KU2A 3CZ6A 4JE9A 1CPRA 2G3KA 2AP3A 3K33A 5K0IA 3DXJF 1AVOB 3QTHA 3S0XA 1K05A 2WZFA 3VM6A 5KYUA 1HW2A 1D1AA 2GA0A 1E86A 4I1OB 1Y4CA 1JR8A 4LLEA 4JIOA 1LE4A 2J45A 3N0TA 5FZTA 2XL6A 2DYSC 2L7AA 2NPUA 4XLNF 2DI3A 5T1DB 1DOWA 3LUTB 2UUHA 5BQGA 2D4UA 2J0WA 2P1AA 4IRUA 4CJOA 5AC4A 1YA9A 3MBGA 1APCA 2D5RB 2R05A 1XZPA 3U9MA 5KYXA 2WB7A 3ECSA 4J7YA 4OD5A 2Y69C 2XLHA 3X1OA 1L3PA 2I8BA 1RKEA 1OCZC 3F46A 3GORA 1BR4A 3T6GB 4P9FA 4DVYP 2L6GA 2W4BA 2R7OA 3GM2A 5DQTA 3DE8A 4NQFA 4H54A 2G62A 4DBRA 3POVA 3RF3A 1LS4A 3GEHA 4BPMA 4EBBA 2LP4A 3O55A 2NUPA 1U0BB 2EIMC 2B0HA 1WOLA 4CDYA 4YK5A 3RQEA 3EG9B 2OKUA 3WG7C 3QVYA 4KNWA 3EGDA 4AK9A 1NSGB 2EPMX 3U5SA 1YDIA 1Q0GA 3QMKA 1RJ9B 1Q0KA 1ZHYA 2PP4A 2WZLA 5HSWA 3L8IA 1G8XA 2I15A 4LDRA 1J8YF 5DLJA 3U2MA 3C8GA 4U5BE 2YLIA 3C63A 3LNMB 3KYJA 4FESA 3AOUA 5L0HA 4JCZA 2EINC 2PNOA 5DS6A 3EFOB 3HTKC 1FTSA 4N06A 3SXMA 4HFKB 3L0IA 2EPOA 2AWCA 3EHNA 5KYWB 4CSAC 3DJUB 1PV3A 2KW3C 2ZXPA 1D1CA 4JW1A 4E17A 1TFOB 4CSAA 5A6AA 1T6UA 1EKYA 4XPYA 3I5PA 5B3IA 2XLEA 2YL7A 3FHDA 5DQZA 2LFDA 5A6BA 4G7HF 4OIQF 4KBLA 3LLIA 4WJ0A 4C3DA 2RSEB 4QI0A 1V54C 2HMQA 3M1CB 2JPUA 3TQOA 5F5FA 3HNJA 1A7VA 4U5CE 3WODF 2Y39A 3E70C 3PHF2 3JYHA 3JRMO 3W8HA 2Q9BA 1A7DA 1NFOA 3MX3A 4RDAA 4UDVA 2R7TA 1H9GA 2Q7RA 3U0CA 3U2LA 2VCCA 1Z7Qc 1YVIA 4AX2A 4E18A 4O6YA 5BQIA 4ONSA 3TJ5A 4CS7A 1E84A 3M4CA 1LE2A 1I4YA 4PJLA 1D1BA 1YARO 1YYJA 1YA7O 2J46A 3EG9A 4ULWA 1C02A 3OWTA 4PFOA 1VLSA 1TWAA 2YL1A 4YT5A 4C7OB 3GWNA 1JPNA 2XM0A 1B68A 1FNTc 5A6BD 1TWGA 2E87A 3J06A 3LESA 3K6BA 5COGA 4OIRF 4YJWA 1LS1A 3S9OA 4F4BA 3NMKA 1BBHA 4IWBA 2WZGA 4FWVA 3N2ZB 3F47A 1PD1A 2BE5F 2KJGA 3T6BA 4R32A 3EZHA 3AGTA 3Q7GA 1ZHTA 1M2VA 4YWQA 2O9XA 3O39A 2YQYA 1VYIA 5KYWA 1EQ1A 2IXOA 1CGNA 1ZHZA 3PMRA 4C3EA 1CPQA 3ITFA 3V5XA 1BZ4A 1JOGA 1ZHWA 1BR2A 1OQCA 2A6HF 2CDQA 3MFNA 4DJ9A 2IYLD 3AG1C 1T5OA 2ZPAA 3BRJA 3VYWA 2TMVP 2YLGA 4YL3A 3T9OA 1WATA 1K40A 4PJMA 1R5ID 1IW7F 1VLTA 3ASOC 4U5HA 2YRFA 5CI9A 4JJGA 1ZHXA 2H8AA 1UFBA 3CQZA 1QQ3A 4O6MA 2LFFA 4XPXA 4FAPB 3IEEA 3ZG1A 4DRIB 5JLIA 3TD7A 2WL8A 3TK0A 4BEJA 2AU5A 4MTFA 1Z6AA 3JSZA 1OW7A 4GEHA 1ZZPA 3KMIA 3G4XA 2KGOA 4L6RA 2P0NA 4EIYA 2L9JA 2YL3A 1WGWA 1LVKA 1ORYA 5A69A 3ZVRA 2A69F 3JCUQ 1JAFA 2NUTB 2WVOA 3JT1A 3SXZA 4BEMJ 4E0IA 4N4WA 3FXHA 1G5ZA 3GM1A 2KQ9A 4OIOF 4JZAA 4EHPA 2NSGA 2EPKX 1C17M 3AQBA 2MHRA 4XQ1A 5EGYA 4YL0A 1OW8A 3CAXA 4OINF 1YLMA 4B6IA 2JD3A 3GM3A 4O7GA 5E33A 3GWLA 1TFKB 3K1HA 4OIPF 2IXNA 3IQ6A 4DRJB 4QI2A 3T6JA 2OOCA 5L0IA 2P6VA 3NDBB 3HNLA 3KYIA 3B0PA 3E9VA 4CIHA 3MLGA 2R7RA 5JS5A 3FDQA 3ZC4A 3FAJA 4E7SA 1K04A 1S05A 1ST6A 2HKVA 2J9UA 2YVKA 2C04A 3O10A 2XLWA 4MNDA 4MVMA 3RW0A 3RVZA 3ZDLA 1U89A 5JRAA 4EWCA 3A11A 3EHMA 1NZEA 1WTYA 4WGYA 1OW6A 3CEXA 1ZW3A 4XEFA 1EI7A 1CGME 2YHSA 2YKZA 2XXAB 3JRTA 3H2UA 1V74B 4JKVA 5E2QA 1TKNA 4CJGA 2CYDA 4EUKB 2R02A 2R25A 1T9KA 1TWCA 2OJED 4BJ1A 3K66A 2XLOA 1M2OA 4P9TA 2OEXA 3ZIBA 4CBEA 1OCRC 1ORSC 2CW0F 5JT4A 2LK4A 5KYYB 3UMHA 1N1CA 1AEPA 2J9WA 3R7CA 3W2WA 2EPNA 2Q9AA 2KNHA 2VB6A 4NY3A 4PFPA 4CIPA 1YJGA 1V55C 4W8KA 3DMDA 4U5GA 3DAGA 4NCQA 1JPJA 2VCBA 3U8VA 3UMKA 2A68F 3S27A 3S84A 4PJNA 4DRHB 4AE4A 1G4WR 5JUAA 2WVQA 4XWJA 1R4TA 1MMAA 3KL4A 3OEOA 3ABKC 2HSQA 3RQFA 1BR1A 2J9VA 3FAPB 1UG7A 4MW3A 2ZD9A 4MTGA 2L6HA 1QZXA 2ICWG 3RH3A 4ZLCA 2MWQA 1MMNA 2JX0A 3JTLO 2DB4A 3NYJA 1LKXA 5L0FA 5JVEA 3NMIA 1J8MF 3WAQA 2DYRC 3SP1A 2ETSA 2R7XA 1AUEA 3ZWIA 1OXBA 3GEIA 3IQCA 1ZW2A 3C18A 3FMSA 1GQAA 1W2WA 2HJ3A 4JURI 3UMIA 2H7OA 3DE9A 3GEEA 4XEVA 5TJ5E 4KI2A 4GYTA 4JCHA 4I1MA 3L1MA 2KSFA 3IQ5A 2OG2A 4LERA 2EIJC 2FFHA 4GQHA 5A6KA 3W8IA 4LLCA 3AG2C 3SZRA 2LD6A 1GM5A 1HMOA 2MYSA 3LLKA 3H65A 3HNIA 5L3VA 5B1AC 4ZLDA 4A2NB 3NG1A 2R7VA 5CIVA 3B29A 2IM8A 3LNRA 5DS5A 5E3AA 1H9TA 1YZCA 2L6FA 1HY5A 2A1DD 3UR3C 1QLEC 1LI7A 3I4UA 1TR2A 4W8PA 3M15A 4N6CA 1NU9C 3CSKA 5CI8A 3U9JA 3A9CA 2HJMA 3K1IC 4PK4A 2X51A 3HJCA 5BUOA 4MVOA 5F28E 4DVZA 1FMVA 3KKBA 1RJ9A 3S90A 2XRHA 3K1IA 2VASA 1OCCC 1EA8A 3G50A 1V4AA 2OU6A 3RQGA 4CDVA 1SF8A 1MMDA 3EGXB 4G7ZF 2R03A 1LM3B 3HLZA 2A0UA 3W2VA 4X0RA 4Z9IA 3OA1A 3BEHA 4MVRA 3EFOA 3WHNA 3B0VC 1OCOC 2DGJA 2J0XA 3GANA 3IPMO 3FVYA 2BL2A 2EIKC 3RFYA 1JRAA 5GPGB 3S28A 2UUIA 1VOMA 4IGGA 5JP7A 4XPWA 4K0DA 4U5EE 2X0CA 2KK1A 2W45A 3DZAA 4OD4A 4YN0B 1H6GA 3L8JA 4BG0A 3QZCA 4U5DE 1YAUO 2XS8A 2ZXWC 1HE9A 3JZ0A 3FOPA 3H2VA 3R2PA 1BDJB 1HE1A 1NG1A 1RXQA 3JYYA 1KTMA 3AJMA 3LJBA 5E3CA 4Z9JA 4JVSA 4Q5SF 2HUJA 1T01A 3C62A 5KYUB 2YWAA 3JSEO 1VB5A 1VMAA 3Q6MA 1NLXA 5DS4A 4E0HA 4K7BA 1YZAA 1LI5A 2NG1A 4IAOA 3DM5A 2NSFA 2OCCC 5D92A 3RYLA 1MNEA 2VCAA 4CS8C 1I4ZA 1E83A 1KNYA 3ZTMA 4O79A 4RBNA 2R7QA 5KYXB 4BJTA 2GWWA 2XLDA 3G4ZA 4YT8A 2H7BA 4C7OA 2HSBA 1XZQA 1GS9A 1TWHA 1RKEB 1SYQA 2CGEA 2Y3HA 3NYMA 3PCVA 4HEAJ 4MS2A 4Q7CA 4EKWA 2IOQA 1QVXA 2LSEA 4PR9A 3ZSUA 1M56C 4MVZA 2XL8A 5JSLA 4BJ5C 3NKEA 3V7OA 2PBEA 2V26A 3MYIA 1T6QA 5T3WA 3M79A 2BC5A 2NUPB 3ZQYA 1QPUA 4YT4A 2KC3A 1O5HA 4JTAB 3X2QC 4U5FE 1D0YA 4MVQA 3L34A 4BJ5A 4EBKA 1SMYF 2W4MA 3EGDB 3U3FA 2VH3A 2HV7A 1G4US 4G0HA 4ER9A 1M57C 3ABLC 4J30B 2AWYA 1E2XA 5L0JA 5B1BC 1LPEA 4DOZA 4FX5A 4KNVA 5L0DA 3TULA 3C8GB 5A6JA 3B71A 4NTFA 3O6XA 3DJNB 2J7PA 2LIGA 4JRZA 3UGOA 1MMGA 3HKKA 3SXKA 4AL1A 3IQTA 3DKAA 1S7ZA 1T6IA 1WN0A 3QW0A 4JTDB 5T3TA 3LEOA 3TOMA 1FFTC 2QUPA 5DVWA 2AVKA 2H7VC 2LCHA 4DBQA 4WGZA 1ZYRF 1L7CA 3HNKA 2Y3DA 2HMZA 3SNHA 5L3QA 4J32B 3B0UX 3EQLF 2P61A 2Y3GA 3DD7A 1RCPA 4JC7A 3C8ZA 1FFHA 2NUTA 1Z23A 3SXYA 2W9YA 2A6EF 1O87A 2PX3A 5AC5A 4LDQA 3B9QA 3MYFA 5AGFA 1LIHA 5IY5C 1E85A 3C7JA 4MW8A 2ZXOA 3DI5A 4CS8A 3IHUA 3EPVA 4EBJA 1FAPB 1ZU5A 3VF0A 1Q0DA 1F1MA 2Q9CA 3EJNA 2J7PD 3N24A 4LACB 1HW1A 2Y3BA 1A7EA 3ASNC 4PJJA 3US6A 5FCLA 2KYHA 2M4EA 3VRCA 2QTVA 4NC3A 1WWPA 3KH2A 4CDAA 4IAQA 1I5NA 3ATPA 2QLAA 3KPHA 3LAYA 3AGUA 4XTKA 3LS1A 2GAQA 1FR0A 2PF4E 3U3BA 3M4BA 4O6NA 3FOOA 1JMWA 2B0JA 1H7IA 5HV9A 2XXAA 4Z9HA 3ZTZA 1VK5A 1U6HA 1XWJA 4IB4A 1YYXA 2IXMA 2HS5A 3AG3C 3DWWA 4JEBA 3SEOA 1VYKA 2FGYA 4MVSA 4CX9A 4IJJA 5COMA 4BJ6C 1D0XA 1M2VB 2QE9A 4ANJA 3UNGC 2XSEA 5D91A 4LDKA 2ASRA 4H4KC 4XEKA 4D4NA 4M63A 4HFFB 2G3VA 3GODA 4JJFA 3TOLA 4BJ6A 5KYYA 4N6HA 5B3SC 4XLPF 3S29A 3LS0A 4Q4ZF 2YL0A 3UGPA 2FAPB 3VAYA 3NKDA 1Z63A 2IXPA 2HFIA 3I5QA 1Z3IX 3NRHA 1NU7D 1DOVA 3DM9B 4YL1A 1GGQA 1Q0FA 2R9RB 2CNWA 3Q6NA 4QDLA 1RMVA 3LEVA 3PDMP 3DAFA 2A0BA 1RKCA 5L0GA 3EH1A 3C8GD 1FMWA 2Q4FA 5F5HA 2R7WA 2J8WA 3EH2A 4YT2A 4IARA 1QSPA 2XLVA 1OXKA 4WABA 1Q0MA 4RD9A 2QNLA 2YEVA 4G78A 3AG4C 1NBBA 1SZIA 5COFA 1A41A 3TJ6A 1OKKA 256BA 1CGOA 1WASA 1OR2A 4U9DA 3T4RA 2YLDA 2XLMA 2HV6A 3V5YA 4U9EA 1MNDA 3RIPA 1M6TA 4DXWA 1IZMA 1C03A 2F22A 2EPLX 2HZ8A 2M64A 2VC9A 1SR2A 1Z5ZA 3ZQVA 1D0ZA 4PACA 2WVNA 2CNWD 2J9BA 2CCYA 3QVZA 3EZIA 4MQ9F 5EK0A 4P6IC 4E7ZA 2EILC 3W4YA 3K7DA 2XL4A 1Y6DA 1PD0A 4KC9A 2ZXRA 4JTCB 4C3BA 3U8PA 2PFDA 1VTMP 3V5ZA 4K1OA 5EHHA 3RKOF 1A0BA 1HMDA 1OKKD 3AQCA 4J7TA 1OR3A 4ULVA 4I44A 2GDCA 2OJQA 3SYNA 2IBFA 1ORJA 2QY9A 2LQGA 2C03A 2R7UA 2YZSA 1TQGA 1ZVZA 2XM4A 4G7OF 3QW1A 4CS9C 3RVYA 1O3UA 1MQVA 2OEVA 3EGXA 1PCXA 4MTOA 4NTAA 4AL0A 5KYNA 2P7VA 2L81A 2RD9A 2Q00A 4A4AA 3NYLA 3NMJA 4CS9A 5L0CA 2OQMA 2Z15A 1QKRA 4JEAA 2R7SA 4NTBA 1ZU4A
chains in the Genus database with same CATH topology
3ABMC 2PX0A 2GFHA 2Q3TA 4HE8D 3Q7LA 4I3MA 2V3CC 4AE4B 1KU2A 3CZ6A 2G3KA 3K33A 3DXJF 3S0XA 2WZFA 5KYUA 1D1AA 4I1OB 4LLEA 2J45A 3N0TA 2DYSC 4XLNF 5T1DB 2J0WA 4IRUA 2D5RB 5KYXA 2WB7A 3ECSA 4OD5A 3X1OA 2Y69C 2I8BA 3F46A 1OCZC 4DVYP 1BR4A 2W4BA 2R7OA 5DQTA 4DBRA 2G62A 3POVA 4EBBA 2NUPA 2EIMC 3EG9B 3WG7C 4KNWA 3EGDA 4AK9A 3QMKA 1RJ9B 1ZHYA 2PP4A 2WZLA 5HSWA 1G8XA 1J8YF 5DLJA 4U5BE 4FESA 2EINC 5DS6A 3EFOB 3HTKC 1FTSA 4N06A 4CSAC 4HFKB 3L0IA 3EHNA 5KYWB 3DJUB 2KW3C 2ZXPA 1D1CA 4JW1A 4CSAA 3I5PA 3FHDA 4G7HF 4OIQF 5DQZA 4KBLA 3LLIA 4WJ0A 4C3DA 4QI0A 1V54C 3M1CB 5F5FA 4U5CE 3WODF 2Y39A 3E70C 3PHF2 3JYHA 3W8HA 2R7TA 2Q9BA 4RDAA 3MX3A 4AX2A 4O6YA 4CS7A 4PJLA 1D1BA 3EG9A 2J46A 4ULWA 3OWTA 4PFOA 1TWAA 4YT5A 4C7OB 1JPNA 1TWGA 2E87A 3LESA 3K6BA 4OIRF 4YJWA 1LS1A 4F4BA 4IWBA 2WZGA 4FWVA 3N2ZB 3F47A 1PD1A 2BE5F 2KJGA 3T6BA 3EZHA 3Q7GA 4YWQA 1ZHTA 1M2VA 2O9XA 3O39A 5KYWA 1VYIA 2IXOA 1ZHZA 3PMRA 4C3EA 3ITFA 1ZHWA 2CDQA 1BR2A 2A6HF 2IYLD 3AG1C 3VYWA 2ZPAA 4PJMA 3ASOC 1IW7F 4U5HA 5CI9A 4JJGA 1ZHXA 3CQZA 4O6MA 3IEEA 3ZG1A 3TD7A 2WL8A 4BEJA 1Z6AA 3JSZA 4GEHA 3KMIA 2KGOA 2L9JA 1WGWA 1LVKA 3ZVRA 2A69F 3JCUQ 2NUTB 2WVOA 3JT1A 4OIOF 2KQ9A 4JZAA 3AQBA 5EGYA 4OINF 4B6IA 2JD3A 4O7GA 5E33A 3K1HA 4OIPF 2IXNA 4QI2A 3T6JA 3NDBB 2P6VA 3B0PA 3E9VA 4CIHA 3MLGA 2R7RA 3FDQA 3ZC4A 3FAJA 4E7SA 4MNDA 1ST6A 2J9UA 2C04A 4EWCA 3EHMA 1NZEA 2XXAB 2R7UA 2YHSA 3JRTA 5E2QA 1TKNA 1TWCA 4BJ1A 3K66A 1M2OA 3ZIBA 4CBEA 1OCRC 2CW0F 5KYYB 3UMHA 1N1CA 2J9WA 3W2WA 2Q9AA 2KNHA 2VB6A 4NY3A 4PFPA 1V55C 4W8KA 3DMDA 4U5GA 3DAGA 1JPJA 3UMKA 2A68F 3S27A 4PJNA 4AE4A 2WVQA 4XWJA 1MMAA 3KL4A 3OEOA 3ABKC 1BR1A 2J9VA 4ZLCA 3RH3A 1QZXA 2MWQA 1MMNA 3NYJA 1LKXA 2R7XA 1J8MF 2DYRC 3SP1A 3UMIA 1W2WA 4JURI 2H7OA 4KI2A 4GYTA 4JCHA 4I1MA 5B3SC 2OG2A 4LERA 2EIJC 2FFHA 3W8IA 4LLCA 3AG2C 3SZRA 2MYSA 3LLKA 3H65A 5L3VA 5B1AC 4ZLDA 4A2NB 3NG1A 2R7VA 3LNRA 5DS5A 5E3AA 2A1DD 3UR3C 1QLEC 3I4UA 1TR2A 1NU9C 3CSKA 5CI8A 3K1IC 4PK4A 2X51A 3HJCA 5BUOA 4DVZA 1FMVA 3KKBA 1RJ9A 2XRHA 2VASA 1OCCC 4G7ZF 1SF8A 1MMDA 3EGXB 3HLZA 3W2VA 4X0RA 3OA1A 3B0VC 3EFOA 1OCOC 2DGJA 2J0XA 3GANA 3FVYA 2EIKC 3RFYA 3S28A 1VOMA 4K0DA 4U5EE 2W45A 3DZAA 4OD4A 4YN0B 4BG0A 3QZCA 4U5DE 2ZXWC 1NG1A 3LJBA 5E3CA 4JVSA 4Q5SF 5KYUB 1VMAA 3Q6MA 5DS4A 4K7BA 2NG1A 4IAOA 3DM5A 2OCCC 5D92A 3RYLA 1MNEA 4O79A 4RBNA 2R7QA 5KYXB 4BJTA 4YT8A 4C7OA 2H7BA 4G7OF 1TWHA 2Y3HA 2CGEA 3NYMA 4HEAJ 4Q7CA 2IOQA 2LSEA 3ZSUA 1M56C 4BJ5C 3NKEA 3V7OA 5T3WA 2V26A 4YT4A 2NUPB 1O5HA 3X2QC 4U5FE 1D0YA 4BJ5A 3L34A 1SMYF 2W4MA 3EGDB 2VH3A 2HV7A 4G0HA 1M57C 3ABLC 4J30B 5B1BC 4DOZA 4FX5A 4KNVA 3O6XA 3DJNB 2J7PA 3UGOA 1MMGA 1S7ZA 5T3TA 1FFTC 5DVWA 2H7VC 4DBQA 1ZYRF 2Y3DA 3SNHA 5L3QA 4J32B 3B0UX 3EQLF 4CS8C 2Y3GA 3DD7A 2NUTA 1FFHA 1Z23A 2W9YA 2A6EF 1O87A 2PX3A 3B9QA 5IY5C 2ZXOA 4CS8A 3EPVA 1ZU5A 2Q9CA 3EJNA 2J7PD 3N24A 4LACB 2Y3BA 3ASNC 4PJJA 5FCLA 2M4EA 2QTVA 3KH2A 3LAYA 4XTKA 3LS1A 2PF4E 4O6NA 2B0JA 2XXAA 1VK5A 3SEOA 3AG3C 2IXMA 1VYKA 2FGYA 4IJJA 4BJ6C 1D0XA 1M2VB 4ANJA 3UNGC 2XSEA 5D91A 4H4KC 4M63A 4HFFB 2G3VA 3GODA 4JJFA 4BJ6A 5KYYA 4XLPF 4Q4ZF 3S29A 3LS0A 3UGPA 3VAYA 3NKDA 1Z63A 2IXPA 3I5QA 1Z3IX 3NRHA 1NU7D 3DM9B 2CNWA 3Q6NA 4QDLA 3LEVA 3DAFA 3EH1A 1FMWA 5F5HA 2R7WA 4YT2A 3EH2A 4RD9A 2YEVA 3AG4C 1SZIA 1OKKA 3T4RA 2HV6A 1MNDA 3RIPA 1IZMA 1Z5ZA 1D0ZA 2WVNA 2CNWD 3EZIA 4MQ9F 4P6IC 4E7ZA 2EILC 3K7DA 2XL4A 1PD0A 4KC9A 2ZXRA 4C3BA 2PFDA 5EHHA 3RKOF 1OKKD 3AQCA 4I44A 3SYNA 2QY9A 2C03A 2YZSA 4CS9C 3EGXA 1PCXA 5KYNA 2P7VA 2L81A 3NYLA 4CS9A 2Z15A 2R7SA 1ZU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IXP A;  2IXM A;  2G62 A;  2IXO A;  2IXN A;  4LAC B;  2HV6 A;  2HV7 A;  4NY3 A; 
#chains in the Genus database with same CATH topology
 5BQH A;  3ABM C;  2PX0 A;  2GFH A;  2XS1 A;  4D4X A;  2Q3T A;  4HE8 D;  1NFN A;  3Q7L A;  4I3M A;  4MVU A;  2V3C C;  4AE4 B;  1KU2 A;  3CZ6 A;  4JE9 A;  1CPR A;  2G3K A;  2AP3 A;  3K33 A;  5K0I A;  3DXJ F;  1AVO B;  3QTH A;  3S0X A;  1K05 A;  2WZF A;  3VM6 A;  5KYU A;  1HW2 A;  1D1A A;  2GA0 A;  1E86 A;  4I1O B;  1Y4C A;  1JR8 A;  4LLE A;  4JIO A;  1LE4 A;  2J45 A;  3N0T A;  5FZT A;  2XL6 A;  2DYS C;  2L7A A;  2NPU A;  4XLN F;  2DI3 A;  5T1D B;  1DOW A;  3LUT B;  2UUH A;  5BQG A;  2D4U A;  2J0W A;  2P1A A;  4IRU A;  4CJO A;  5AC4 A;  1YA9 A;  3MBG A;  1APC A;  2D5R B;  2R05 A;  1XZP A;  3U9M A;  5KYX A;  2WB7 A;  3ECS A;  4J7Y A;  4OD5 A;  2Y69 C;  2XLH A;  3X1O A;  1L3P A;  2I8B A;  1RKE A;  1OCZ C;  3F46 A;  3GOR A;  1BR4 A;  3T6G B;  4P9F A;  4DVY P;  2L6G A;  2W4B A;  2R7O A;  3GM2 A;  5DQT A;  3DE8 A;  4NQF A;  4H54 A;  2G62 A;  4DBR A;  3POV A;  3RF3 A;  1LS4 A;  3GEH A;  4BPM A;  4EBB A;  2LP4 A;  3O55 A;  2NUP A;  1U0B B;  2EIM C;  2B0H A;  1WOL A;  4CDY A;  4YK5 A;  3RQE A;  3EG9 B;  2OKU A;  3WG7 C;  3QVY A;  4KNW A;  3EGD A;  4AK9 A;  1NSG B;  2EPM X;  3U5S A;  1YDI A;  1Q0G A;  3QMK A;  1RJ9 B;  1Q0K A;  1ZHY A;  2PP4 A;  2WZL A;  5HSW A;  3L8I A;  1G8X A;  2I15 A;  4LDR A;  1J8Y F;  5DLJ A;  3U2M A;  3C8G A;  4U5B E;  2YLI A;  3C63 A;  3LNM B;  3KYJ A;  4FES A;  3AOU A;  5L0H A;  4JCZ A;  2EIN C;  2PNO A;  5DS6 A;  3EFO B;  3HTK C;  1FTS A;  4N06 A;  3SXM A;  4HFK B;  3L0I A;  2EPO A;  2AWC A;  3EHN A;  5KYW B;  4CSA C;  3DJU B;  1PV3 A;  2KW3 C;  2ZXP A;  1D1C A;  4JW1 A;  4E17 A;  1TFO B;  4CSA A;  5A6A A;  1T6U A;  1EKY A;  4XPY A;  3I5P A;  5B3I A;  2XLE A;  2YL7 A;  3FHD A;  5DQZ A;  2LFD A;  5A6B A;  4G7H F;  4OIQ F;  4KBL A;  3LLI A;  4WJ0 A;  4C3D A;  2RSE B;  4QI0 A;  1V54 C;  2HMQ A;  3M1C B;  2JPU A;  3TQO A;  5F5F A;  3HNJ A;  1A7V A;  4U5C E;  3WOD F;  2Y39 A;  3E70 C;  3PHF 2;  3JYH A;  3JRM O;  3W8H A;  2Q9B A;  1A7D A;  1NFO A;  3MX3 A;  4RDA A;  4UDV A;  2R7T A;  1H9G A;  2Q7R A;  3U0C A;  3U2L A;  2VCC A;  1Z7Q c;  1YVI A;  4AX2 A;  4E18 A;  4O6Y A;  5BQI A;  4ONS A;  3TJ5 A;  4CS7 A;  1E84 A;  3M4C A;  1LE2 A;  1I4Y A;  4PJL A;  1D1B A;  1YAR O;  1YYJ A;  1YA7 O;  2J46 A;  3EG9 A;  4ULW A;  1C02 A;  3OWT A;  4PFO A;  1VLS A;  1TWA A;  2YL1 A;  4YT5 A;  4C7O B;  3GWN A;  1JPN A;  2XM0 A;  1B68 A;  1FNT c;  5A6B D;  1TWG A;  2E87 A;  3J06 A;  3LES A;  3K6B A;  5COG A;  4OIR F;  4YJW A;  1LS1 A;  3S9O A;  4F4B A;  3NMK A;  1BBH A;  4IWB A;  2WZG A;  4FWV A;  3N2Z B;  3F47 A;  1PD1 A;  2BE5 F;  2KJG A;  3T6B A;  4R32 A;  3EZH A;  3AGT A;  3Q7G A;  1ZHT A;  1M2V A;  4YWQ A;  2O9X A;  3O39 A;  2YQY A;  1VYI A;  5KYW A;  1EQ1 A;  2IXO A;  1CGN A;  1ZHZ A;  3PMR A;  4C3E A;  1CPQ A;  3ITF A;  3V5X A;  1BZ4 A;  1JOG A;  1ZHW A;  1BR2 A;  1OQC A;  2A6H F;  2CDQ A;  3MFN A;  4DJ9 A;  2IYL D;  3AG1 C;  1T5O A;  2ZPA A;  3BRJ A;  3VYW A;  2TMV P;  2YLG A;  4YL3 A;  3T9O A;  1WAT A;  1K40 A;  4PJM A;  1R5I D;  1IW7 F;  1VLT A;  3ASO C;  4U5H A;  2YRF A;  5CI9 A;  4JJG A;  1ZHX A;  2H8A A;  1UFB A;  3CQZ A;  1QQ3 A;  4O6M A;  2LFF A;  4XPX A;  4FAP B;  3IEE A;  3ZG1 A;  4DRI B;  5JLI A;  3TD7 A;  2WL8 A;  3TK0 A;  4BEJ A;  2AU5 A;  4MTF A;  1Z6A A;  3JSZ A;  1OW7 A;  4GEH A;  1ZZP A;  3KMI A;  3G4X A;  2KGO A;  4L6R A;  2P0N A;  4EIY A;  2L9J A;  2YL3 A;  1WGW A;  1LVK A;  1ORY A;  5A69 A;  3ZVR A;  2A69 F;  3JCU Q;  1JAF A;  2NUT B;  2WVO A;  3JT1 A;  3SXZ A;  4BEM J;  4E0I A;  4N4W A;  3FXH A;  1G5Z A;  3GM1 A;  2KQ9 A;  4OIO F;  4JZA A;  4EHP A;  2NSG A;  2EPK X;  1C17 M;  3AQB A;  2MHR A;  4XQ1 A;  5EGY A;  4YL0 A;  1OW8 A;  3CAX A;  4OIN F;  1YLM A;  4B6I A;  2JD3 A;  3GM3 A;  4O7G A;  5E33 A;  3GWL A;  1TFK B;  3K1H A;  4OIP F;  2IXN A;  3IQ6 A;  4DRJ B;  4QI2 A;  3T6J A;  2OOC A;  5L0I A;  2P6V A;  3NDB B;  3HNL A;  3KYI A;  3B0P A;  3E9V A;  4CIH A;  3MLG A;  2R7R A;  5JS5 A;  3FDQ A;  3ZC4 A;  3FAJ A;  4E7S A;  1K04 A;  1S05 A;  1ST6 A;  2HKV A;  2J9U A;  2YVK A;  2C04 A;  3O10 A;  2XLW A;  4MND A;  4MVM A;  3RW0 A;  3RVZ A;  3ZDL A;  1U89 A;  5JRA A;  4EWC A;  3A11 A;  3EHM A;  1NZE A;  1WTY A;  4WGY A;  1OW6 A;  3CEX A;  1ZW3 A;  4XEF A;  1EI7 A;  1CGM E;  2YHS A;  2YKZ A;  2XXA B;  3JRT A;  3H2U A;  1V74 B;  4JKV A;  5E2Q A;  1TKN A;  4CJG A;  2CYD A;  4EUK B;  2R02 A;  2R25 A;  1T9K A;  1TWC A;  2OJE D;  4BJ1 A;  3K66 A;  2XLO A;  1M2O A;  4P9T A;  2OEX A;  3ZIB A;  4CBE A;  1OCR C;  1ORS C;  2CW0 F;  5JT4 A;  2LK4 A;  5KYY B;  3UMH A;  1N1C A;  1AEP A;  2J9W A;  3R7C A;  3W2W A;  2EPN A;  2Q9A A;  2KNH A;  2VB6 A;  4NY3 A;  4PFP A;  4CIP A;  1YJG A;  1V55 C;  4W8K A;  3DMD A;  4U5G A;  3DAG A;  4NCQ A;  1JPJ A;  2VCB A;  3U8V A;  3UMK A;  2A68 F;  3S27 A;  3S84 A;  4PJN A;  4DRH B;  4AE4 A;  1G4W R;  5JUA A;  2WVQ A;  4XWJ A;  1R4T A;  1MMA A;  3KL4 A;  3OEO A;  3ABK C;  2HSQ A;  3RQF A;  1BR1 A;  2J9V A;  3FAP B;  1UG7 A;  4MW3 A;  2ZD9 A;  4MTG A;  2L6H A;  1QZX A;  2ICW G;  3RH3 A;  4ZLC A;  2MWQ A;  1MMN A;  2JX0 A;  3JTL O;  2DB4 A;  3NYJ A;  1LKX A;  5L0F A;  5JVE A;  3NMI A;  1J8M F;  3WAQ A;  2DYR C;  3SP1 A;  2ETS A;  2R7X A;  1AUE A;  3ZWI A;  1OXB A;  3GEI A;  3IQC A;  1ZW2 A;  3C18 A;  3FMS A;  1GQA A;  1W2W A;  2HJ3 A;  4JUR I;  3UMI A;  2H7O A;  3DE9 A;  3GEE A;  4XEV A;  5TJ5 E;  4KI2 A;  4GYT A;  4JCH A;  4I1M A;  3L1M A;  2KSF A;  3IQ5 A;  2OG2 A;  4LER A;  2EIJ C;  2FFH A;  4GQH A;  5A6K A;  3W8I A;  4LLC A;  3AG2 C;  3SZR A;  2LD6 A;  1GM5 A;  1HMO A;  2MYS A;  3LLK A;  3H65 A;  3HNI A;  5L3V A;  5B1A C;  4ZLD A;  4A2N B;  3NG1 A;  2R7V A;  5CIV A;  3B29 A;  2IM8 A;  3LNR A;  5DS5 A;  5E3A A;  1H9T A;  1YZC A;  2L6F A;  1HY5 A;  2A1D D;  3UR3 C;  1QLE C;  1LI7 A;  3I4U A;  1TR2 A;  4W8P A;  3M15 A;  4N6C A;  1NU9 C;  3CSK A;  5CI8 A;  3U9J A;  3A9C A;  2HJM A;  3K1I C;  4PK4 A;  2X51 A;  3HJC A;  5BUO A;  4MVO A;  5F28 E;  4DVZ A;  1FMV A;  3KKB A;  1RJ9 A;  3S90 A;  2XRH A;  3K1I A;  2VAS A;  1OCC C;  1EA8 A;  3G50 A;  1V4A A;  2OU6 A;  3RQG A;  4CDV A;  1SF8 A;  1MMD A;  3EGX B;  4G7Z F;  2R03 A;  1LM3 B;  3HLZ A;  2A0U A;  3W2V A;  4X0R A;  4Z9I A;  3OA1 A;  3BEH A;  4MVR A;  3EFO A;  3WHN A;  3B0V C;  1OCO C;  2DGJ A;  2J0X A;  3GAN A;  3IPM O;  3FVY A;  2BL2 A;  2EIK C;  3RFY A;  1JRA A;  5GPG B;  3S28 A;  2UUI A;  1VOM A;  4IGG A;  5JP7 A;  4XPW A;  4K0D A;  4U5E E;  2X0C A;  2KK1 A;  2W45 A;  3DZA A;  4OD4 A;  4YN0 B;  1H6G A;  3L8J A;  4BG0 A;  3QZC A;  4U5D E;  1YAU O;  2XS8 A;  2ZXW C;  1HE9 A;  3JZ0 A;  3FOP A;  3H2V A;  3R2P A;  1BDJ B;  1HE1 A;  1NG1 A;  1RXQ A;  3JYY A;  1KTM A;  3AJM A;  3LJB A;  5E3C A;  4Z9J A;  4JVS A;  4Q5S F;  2HUJ A;  1T01 A;  3C62 A;  5KYU B;  2YWA A;  3JSE O;  1VB5 A;  1VMA A;  3Q6M A;  1NLX A;  5DS4 A;  4E0H A;  4K7B A;  1YZA A;  1LI5 A;  2NG1 A;  4IAO A;  3DM5 A;  2NSF A;  2OCC C;  5D92 A;  3RYL A;  1MNE A;  2VCA A;  4CS8 C;  1I4Z A;  1E83 A;  1KNY A;  3ZTM A;  4O79 A;  4RBN A;  2R7Q A;  5KYX B;  4BJT A;  2GWW A;  2XLD A;  3G4Z A;  4YT8 A;  2H7B A;  4C7O A;  2HSB A;  1XZQ A;  1GS9 A;  1TWH A;  1RKE B;  1SYQ A;  2CGE A;  2Y3H A;  3NYM A;  3PCV A;  4HEA J;  4MS2 A;  4Q7C A;  4EKW A;  2IOQ A;  1QVX A;  2LSE A;  4PR9 A;  3ZSU A;  1M56 C;  4MVZ A;  2XL8 A;  5JSL A;  4BJ5 C;  3NKE A;  3V7O A;  2PBE A;  2V26 A;  3MYI A;  1T6Q A;  5T3W A;  3M79 A;  2BC5 A;  2NUP B;  3ZQY A;  1QPU A;  4YT4 A;  2KC3 A;  1O5H A;  4JTA B;  3X2Q C;  4U5F E;  1D0Y A;  4MVQ A;  3L34 A;  4BJ5 A;  4EBK A;  1SMY F;  2W4M A;  3EGD B;  3U3F A;  2VH3 A;  2HV7 A;  1G4U S;  4G0H A;  4ER9 A;  1M57 C;  3ABL C;  4J30 B;  2AWY A;  1E2X A;  5L0J A;  5B1B C;  1LPE A;  4DOZ A;  4FX5 A;  4KNV A;  5L0D A;  3TUL A;  3C8G B;  5A6J A;  3B71 A;  4NTF A;  3O6X A;  3DJN B;  2J7P A;  2LIG A;  4JRZ A;  3UGO A;  1MMG A;  3HKK A;  3SXK A;  4AL1 A;  3IQT A;  3DKA A;  1S7Z A;  1T6I A;  1WN0 A;  3QW0 A;  4JTD B;  5T3T A;  3LEO A;  3TOM A;  1FFT C;  2QUP A;  5DVW A;  2AVK A;  2H7V C;  2LCH A;  4DBQ A;  4WGZ A;  1ZYR F;  1L7C A;  3HNK A;  2Y3D A;  2HMZ A;  3SNH A;  5L3Q A;  4J32 B;  3B0U X;  3EQL F;  2P61 A;  2Y3G A;  3DD7 A;  1RCP A;  4JC7 A;  3C8Z A;  1FFH A;  2NUT A;  1Z23 A;  3SXY A;  2W9Y A;  2A6E F;  1O87 A;  2PX3 A;  5AC5 A;  4LDQ A;  3B9Q A;  3MYF A;  5AGF A;  1LIH A;  5IY5 C;  1E85 A;  3C7J A;  4MW8 A;  2ZXO A;  3DI5 A;  4CS8 A;  3IHU A;  3EPV A;  4EBJ A;  1FAP B;  1ZU5 A;  3VF0 A;  1Q0D A;  1F1M A;  2Q9C A;  3EJN A;  2J7P D;  3N24 A;  4LAC B;  1HW1 A;  2Y3B A;  1A7E A;  3ASN C;  4PJJ A;  3US6 A;  5FCL A;  2KYH A;  2M4E A;  3VRC A;  2QTV A;  4NC3 A;  1WWP A;  3KH2 A;  4CDA A;  4IAQ A;  1I5N A;  3ATP A;  2QLA A;  3KPH A;  3LAY A;  3AGU A;  4XTK A;  3LS1 A;  2GAQ A;  1FR0 A;  2PF4 E;  3U3B A;  3M4B A;  4O6N A;  3FOO A;  1JMW A;  2B0J A;  1H7I A;  5HV9 A;  2XXA A;  4Z9H A;  3ZTZ A;  1VK5 A;  1U6H A;  1XWJ A;  4IB4 A;  1YYX A;  2IXM A;  2HS5 A;  3AG3 C;  3DWW A;  4JEB A;  3SEO A;  1VYK A;  2FGY A;  4MVS A;  4CX9 A;  4IJJ A;  5COM A;  4BJ6 C;  1D0X A;  1M2V B;  2QE9 A;  4ANJ A;  3UNG C;  2XSE A;  5D91 A;  4LDK A;  2ASR A;  4H4K C;  4XEK A;  4D4N A;  4M63 A;  4HFF B;  2G3V A;  3GOD A;  4JJF A;  3TOL A;  4BJ6 A;  5KYY A;  4N6H A;  5B3S C;  4XLP F;  3S29 A;  3LS0 A;  4Q4Z F;  2YL0 A;  3UGP A;  2FAP B;  3VAY A;  3NKD A;  1Z63 A;  2IXP A;  2HFI A;  3I5Q A;  1Z3I X;  3NRH A;  1NU7 D;  1DOV A;  3DM9 B;  4YL1 A;  1GGQ A;  1Q0F A;  2R9R B;  2CNW A;  3Q6N A;  4QDL A;  1RMV A;  3LEV A;  3PDM P;  3DAF A;  2A0B A;  1RKC A;  5L0G A;  3EH1 A;  3C8G D;  1FMW A;  2Q4F A;  5F5H A;  2R7W A;  2J8W A;  3EH2 A;  4YT2 A;  4IAR A;  1QSP A;  2XLV A;  1OXK A;  4WAB A;  1Q0M A;  4RD9 A;  2QNL A;  2YEV A;  4G78 A;  3AG4 C;  1NBB A;  1SZI A;  5COF A;  1A41 A;  3TJ6 A;  1OKK A;  256B A;  1CGO A;  1WAS A;  1OR2 A;  4U9D A;  3T4R A;  2YLD A;  2XLM A;  2HV6 A;  3V5Y A;  4U9E A;  1MND A;  3RIP A;  1M6T A;  4DXW A;  1IZM A;  1C03 A;  2F22 A;  2EPL X;  2HZ8 A;  2M64 A;  2VC9 A;  1SR2 A;  1Z5Z A;  3ZQV A;  1D0Z A;  4PAC A;  2WVN A;  2CNW D;  2J9B A;  2CCY A;  3QVZ A;  3EZI A;  4MQ9 F;  5EK0 A;  4P6I C;  4E7Z A;  2EIL C;  3W4Y A;  3K7D A;  2XL4 A;  1Y6D A;  1PD0 A;  4KC9 A;  2ZXR A;  4JTC B;  4C3B A;  3U8P A;  2PFD A;  1VTM P;  3V5Z A;  4K1O A;  5EHH A;  3RKO F;  1A0B A;  1HMD A;  1OKK D;  3AQC A;  4J7T A;  1OR3 A;  4ULV A;  4I44 A;  2GDC A;  2OJQ A;  3SYN A;  2IBF A;  1ORJ A;  2QY9 A;  2LQG A;  2C03 A;  2R7U A;  2YZS A;  1TQG A;  1ZVZ A;  2XM4 A;  4G7O F;  3QW1 A;  4CS9 C;  3RVY A;  1O3U A;  1MQV A;  2OEV A;  3EGX A;  1PCX A;  4MTO A;  4NTA A;  4AL0 A;  5KYN A;  2P7V A;  2L81 A;  2RD9 A;  2Q00 A;  4A4A A;  3NYL A;  3NMJ A;  4CS9 A;  5L0C A;  2OQM A;  2Z15 A;  1QKR A;  4JEA A;  2R7S A;  4NTB A;  1ZU4 A; 
#chains in the Genus database with same CATH homology
 3ABM C;  2PX0 A;  2GFH A;  2Q3T A;  4HE8 D;  3Q7L A;  4I3M A;  2V3C C;  4AE4 B;  1KU2 A;  3CZ6 A;  2G3K A;  3K33 A;  3DXJ F;  3S0X A;  2WZF A;  5KYU A;  1D1A A;  4I1O B;  4LLE A;  2J45 A;  3N0T A;  2DYS C;  4XLN F;  5T1D B;  2J0W A;  4IRU A;  2D5R B;  5KYX A;  2WB7 A;  3ECS A;  4OD5 A;  3X1O A;  2Y69 C;  2I8B A;  3F46 A;  1OCZ C;  4DVY P;  1BR4 A;  2W4B A;  2R7O A;  5DQT A;  4DBR A;  2G62 A;  3POV A;  4EBB A;  2NUP A;  2EIM C;  3EG9 B;  3WG7 C;  4KNW A;  3EGD A;  4AK9 A;  3QMK A;  1RJ9 B;  1ZHY A;  2PP4 A;  2WZL A;  5HSW A;  1G8X A;  1J8Y F;  5DLJ A;  4U5B E;  4FES A;  2EIN C;  5DS6 A;  3EFO B;  3HTK C;  1FTS A;  4N06 A;  4CSA C;  4HFK B;  3L0I A;  3EHN A;  5KYW B;  3DJU B;  2KW3 C;  2ZXP A;  1D1C A;  4JW1 A;  4CSA A;  3I5P A;  3FHD A;  4G7H F;  4OIQ F;  5DQZ A;  4KBL A;  3LLI A;  4WJ0 A;  4C3D A;  4QI0 A;  1V54 C;  3M1C B;  5F5F A;  4U5C E;  3WOD F;  2Y39 A;  3E70 C;  3PHF 2;  3JYH A;  3W8H A;  2R7T A;  2Q9B A;  4RDA A;  3MX3 A;  4AX2 A;  4O6Y A;  4CS7 A;  4PJL A;  1D1B A;  3EG9 A;  2J46 A;  4ULW A;  3OWT A;  4PFO A;  1TWA A;  4YT5 A;  4C7O B;  1JPN A;  1TWG A;  2E87 A;  3LES A;  3K6B A;  4OIR F;  4YJW A;  1LS1 A;  4F4B A;  4IWB A;  2WZG A;  4FWV A;  3N2Z B;  3F47 A;  1PD1 A;  2BE5 F;  2KJG A;  3T6B A;  3EZH A;  3Q7G A;  4YWQ A;  1ZHT A;  1M2V A;  2O9X A;  3O39 A;  5KYW A;  1VYI A;  2IXO A;  1ZHZ A;  3PMR A;  4C3E A;  3ITF A;  1ZHW A;  2CDQ A;  1BR2 A;  2A6H F;  2IYL D;  3AG1 C;  3VYW A;  2ZPA A;  4PJM A;  3ASO C;  1IW7 F;  4U5H A;  5CI9 A;  4JJG A;  1ZHX A;  3CQZ A;  4O6M A;  3IEE A;  3ZG1 A;  3TD7 A;  2WL8 A;  4BEJ A;  1Z6A A;  3JSZ A;  4GEH A;  3KMI A;  2KGO A;  2L9J A;  1WGW A;  1LVK A;  3ZVR A;  2A69 F;  3JCU Q;  2NUT B;  2WVO A;  3JT1 A;  4OIO F;  2KQ9 A;  4JZA A;  3AQB A;  5EGY A;  4OIN F;  4B6I A;  2JD3 A;  4O7G A;  5E33 A;  3K1H A;  4OIP F;  2IXN A;  4QI2 A;  3T6J A;  3NDB B;  2P6V A;  3B0P A;  3E9V A;  4CIH A;  3MLG A;  2R7R A;  3FDQ A;  3ZC4 A;  3FAJ A;  4E7S A;  4MND A;  1ST6 A;  2J9U A;  2C04 A;  4EWC A;  3EHM A;  1NZE A;  2XXA B;  2R7U A;  2YHS A;  3JRT A;  5E2Q A;  1TKN A;  1TWC A;  4BJ1 A;  3K66 A;  1M2O A;  3ZIB A;  4CBE A;  1OCR C;  2CW0 F;  5KYY B;  3UMH A;  1N1C A;  2J9W A;  3W2W A;  2Q9A A;  2KNH A;  2VB6 A;  4NY3 A;  4PFP A;  1V55 C;  4W8K A;  3DMD A;  4U5G A;  3DAG A;  1JPJ A;  3UMK A;  2A68 F;  3S27 A;  4PJN A;  4AE4 A;  2WVQ A;  4XWJ A;  1MMA A;  3KL4 A;  3OEO A;  3ABK C;  1BR1 A;  2J9V A;  4ZLC A;  3RH3 A;  1QZX A;  2MWQ A;  1MMN A;  3NYJ A;  1LKX A;  2R7X A;  1J8M F;  2DYR C;  3SP1 A;  3UMI A;  1W2W A;  4JUR I;  2H7O A;  4KI2 A;  4GYT A;  4JCH A;  4I1M A;  5B3S C;  2OG2 A;  4LER A;  2EIJ C;  2FFH A;  3W8I A;  4LLC A;  3AG2 C;  3SZR A;  2MYS A;  3LLK A;  3H65 A;  5L3V A;  5B1A C;  4ZLD A;  4A2N B;  3NG1 A;  2R7V A;  3LNR A;  5DS5 A;  5E3A A;  2A1D D;  3UR3 C;  1QLE C;  3I4U A;  1TR2 A;  1NU9 C;  3CSK A;  5CI8 A;  3K1I C;  4PK4 A;  2X51 A;  3HJC A;  5BUO A;  4DVZ A;  1FMV A;  3KKB A;  1RJ9 A;  2XRH A;  2VAS A;  1OCC C;  4G7Z F;  1SF8 A;  1MMD A;  3EGX B;  3HLZ A;  3W2V A;  4X0R A;  3OA1 A;  3B0V C;  3EFO A;  1OCO C;  2DGJ A;  2J0X A;  3GAN A;  3FVY A;  2EIK C;  3RFY A;  3S28 A;  1VOM A;  4K0D A;  4U5E E;  2W45 A;  3DZA A;  4OD4 A;  4YN0 B;  4BG0 A;  3QZC A;  4U5D E;  2ZXW C;  1NG1 A;  3LJB A;  5E3C A;  4JVS A;  4Q5S F;  5KYU B;  1VMA A;  3Q6M A;  5DS4 A;  4K7B A;  2NG1 A;  4IAO A;  3DM5 A;  2OCC C;  5D92 A;  3RYL A;  1MNE A;  4O79 A;  4RBN A;  2R7Q A;  5KYX B;  4BJT A;  4YT8 A;  4C7O A;  2H7B A;  4G7O F;  1TWH A;  2Y3H A;  2CGE A;  3NYM A;  4HEA J;  4Q7C A;  2IOQ A;  2LSE A;  3ZSU A;  1M56 C;  4BJ5 C;  3NKE A;  3V7O A;  5T3W A;  2V26 A;  4YT4 A;  2NUP B;  1O5H A;  3X2Q C;  4U5F E;  1D0Y A;  4BJ5 A;  3L34 A;  1SMY F;  2W4M A;  3EGD B;  2VH3 A;  2HV7 A;  4G0H A;  1M57 C;  3ABL C;  4J30 B;  5B1B C;  4DOZ A;  4FX5 A;  4KNV A;  3O6X A;  3DJN B;  2J7P A;  3UGO A;  1MMG A;  1S7Z A;  5T3T A;  1FFT C;  5DVW A;  2H7V C;  4DBQ A;  1ZYR F;  2Y3D A;  3SNH A;  5L3Q A;  4J32 B;  3B0U X;  3EQL F;  4CS8 C;  2Y3G A;  3DD7 A;  2NUT A;  1FFH A;  1Z23 A;  2W9Y A;  2A6E F;  1O87 A;  2PX3 A;  3B9Q A;  5IY5 C;  2ZXO A;  4CS8 A;  3EPV A;  1ZU5 A;  2Q9C A;  3EJN A;  2J7P D;  3N24 A;  4LAC B;  2Y3B A;  3ASN C;  4PJJ A;  5FCL A;  2M4E A;  2QTV A;  3KH2 A;  3LAY A;  4XTK A;  3LS1 A;  2PF4 E;  4O6N A;  2B0J A;  2XXA A;  1VK5 A;  3SEO A;  3AG3 C;  2IXM A;  1VYK A;  2FGY A;  4IJJ A;  4BJ6 C;  1D0X A;  1M2V B;  4ANJ A;  3UNG C;  2XSE A;  5D91 A;  4H4K C;  4M63 A;  4HFF B;  2G3V A;  3GOD A;  4JJF A;  4BJ6 A;  5KYY A;  4XLP F;  4Q4Z F;  3S29 A;  3LS0 A;  3UGP A;  3VAY A;  3NKD A;  1Z63 A;  2IXP A;  3I5Q A;  1Z3I X;  3NRH A;  1NU7 D;  3DM9 B;  2CNW A;  3Q6N A;  4QDL A;  3LEV A;  3DAF A;  3EH1 A;  1FMW A;  5F5H A;  2R7W A;  4YT2 A;  3EH2 A;  4RD9 A;  2YEV A;  3AG4 C;  1SZI A;  1OKK A;  3T4R A;  2HV6 A;  1MND A;  3RIP A;  1IZM A;  1Z5Z A;  1D0Z A;  2WVN A;  2CNW D;  3EZI A;  4MQ9 F;  4P6I C;  4E7Z A;  2EIL C;  3K7D A;  2XL4 A;  1PD0 A;  4KC9 A;  2ZXR A;  4C3B A;  2PFD A;  5EHH A;  3RKO F;  1OKK D;  3AQC A;  4I44 A;  3SYN A;  2QY9 A;  2C03 A;  2YZS A;  4CS9 C;  3EGX A;  1PCX A;  5KYN A;  2P7V A;  2L81 A;  3NYL A;  4CS9 A;  2Z15 A;  2R7S A;  1ZU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...