2HV7A

Crystal structure of phosphotyrosyl phosphatase activator bound to atpgammas
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
301
structure length
301
Chain Sequence
NFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Protein phosphatase 2A, regulatory subunit B
publication title Structure and mechanism of the phosphotyrosyl phosphatase activator.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 301
sequence length 301
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2006-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2hv7A02
2IXOA 2G62A 4LACB 2IXPA 2IXMA 2IXNA 2HV6A 2HV7A 4NY3A
chains in the Genus database with same CATH superfamily
2IXOA 4JJGA 3GWNA 4HFKB 3FHDA 1NZEA 4N6HA 3T6BA 3H2UA 5KYYA 3K1IC 3ABLC 3E9VA 3US6A 2NUPA 3S29A 2XL8A 3JCUQ 2A68F 3ABKC 3JRMO 4RDAA 3T4RA 1OW7A 2J8WA 5DS5A 5CI9A 3SP1A 3B0PA 1EQ1A 4CJOA 3EHNA 3SXMA 1VMAA 4JRZA 4LDKA 4M63A 3PCVA 1XWJA 2H8AA 1MMGA 4MVUA 2NUPB 1T6UA 2XLDA 4AK9A 3LEVA 1SF8A 3FVYA 1QQ3A 3KPHA 2W4BA 1FAPB 3G50A 3QW0A 5AGFA 4YL0A 3FMSA 1Q0GA 5L0CA 3DM9B 3GEHA 2LIGA 2IBFA 3IQCA 3ZQVA 4MVSA 4WABA 1JR8A 1CPQA 2PX3A 3L34A 1FNTc 4E7ZA 2L7AA 2A6EF 3DD7A 4W8PA 3ITFA 2ZPAA 4BJ6A 4U9DA 1TR2A 3CAXA 2KNHA 3ZTMA 1TFKB 1MQVA 4QDLA 5DS4A 2Y3GA 4Q5SF 1GS9A 1A7EA 1U89A 4NC3A 4RBNA 3SEOA 3W8HA 2LFFA 1Y4CA 2JD3A 3SYNA 5KYNA 3KYIA 3K6BA 3H2VA 1YJGA 1OKKD 4JTDB 1NU7D 1QSPA 2HV6A 2VB6A 1TKNA 2D5RB 2FFHA 3MBGA 1MMNA 1OR3A 2C04A 5E3CA 2A1DD 5L3QA 3PDMP 2J9BA 4JVSA 3U3FA 3GANA 4MS2A 4O79A 3AQCA 4AL1A 4D4NA 2Q4FA 2AU5A 4NTBA 1ZW2A 4E7SA 2IXNA 2YZSA 3C7JA 4XPWA 3EH2A 2XM4A 2NUTA 3ZTZA 4DRIB 2KSFA 5L3VA 3E70C 4XWJA 2P6VA 3DMDA 1WASA 3BEHA 3R2PA 4QI2A 5A6BA 1YA7O 1I4YA 2YL7A 5JRAA 2NG1A 4GEHA 4ZLCA 5T3TA 1Q0DA 2OEVA 2XLVA 2YL0A 1H6GA 4YWQA 2J9WA 2XS8A 4NQFA 1D1AA 2BE5F 2NUTB 2ZD9A 4J32B 3SXZA 5HSWA 3AGUA 2Q3TA 2J7PD 2YEVA 5A69A 5DLJA 4A4AA 4CIHA 2DYRC 1Z5ZA 3EZHA 4DBQA 2GFHA 2V26A 4BJTA 1OW6A 3UGPA 3JTLO 1RCPA 2EIJC 4PACA 4H4KC 3U0CA 3KL4A 1RMVA 2CCYA 3NMIA 4KNVA 4U5GA 4CJGA 1YARO 2CDQA 1IW7F 2EIMC 2J9VA 2ASRA 2Y3HA 3LAYA 4CS9C 4D4XA 1CPRA 4W8KA 1M2VA 3QZCA 4MW3A 2EPNA 2R7SA 3S27A 3W2VA 3OEOA 1K40A 3U2MA 4CS8A 3EG9A 5AC5A 3AG3C 3GWLA 3CSKA 3O10A 4XPYA 2J0XA 1H9GA 1A41A 1JRAA 2WB7A 2WVOA 1AEPA 1D0ZA 1HE9A 3S0XA 2J46A 3IHUA 4DRJB 3AQBA 4MW8A 3C8GD 3K66A 3Q7LA 4PFPA 4Z9JA 3EG9B 2YLIA 3RW0A 2G62A 4KBLA 5FCLA 2Q9BA 2OOCA 2J45A 2PNOA 4J7TA 4IB4A 3TOMA 3JSEO 4HE8D 3RVYA 3AG2C 4NTAA 3JT1A 2LFDA 4O6NA 5A6JA 2XM0A 2AVKA 1QKRA 1VK5A 5JT4A 4C3EA 1ZHZA 4JEAA 1YZCA 4ANJA 5EHHA 1OR2A 1M57C 4MVQA 3U9MA 5IY5C 3DAFA 3F46A 2XS1A 2Q7RA 3VYWA 1APCA 1YLMA 3JYYA 4E0IA 1GM5A 4IJJA 1TWHA 1WTYA 2NSFA 2HZ8A 3M4BA 3NYMA 1WWPA 2TMVP 1LS4A 5EK0A 4MNDA 1PV3A 5L0HA 3LESA 2AP3A 1L7CA 1SYQA 3HLZA 5JS5A 1KU2A 3SZRA 2QY9A 4NCQA 4MVOA 1FMWA 4ONSA 4PJJA 3IQ6A 5D91A 1JAFA 2FGYA 4BJ1A 4E0HA 4XLPF 3TK0A 2EPKX 1A7DA 1OCRC 2CGEA 2R03A 1SMYF 2Y69C 4MVMA 3U2LA 4BJ5C 3RKOF 2Z15A 3EH1A 1ZHXA 4IAOA 4BG0A 1CGOA 4EBJA 1I4ZA 2CNWD 1QVXA 2P7VA 5COFA 2X0CA 4OIOF 3N0TA 1RKCA 5JLIA 4CSAC 2VCBA 3B0UX 2WVNA 1OCZC 2OJED 2CW0F 1T6IA 3K1IA 1Z6AA 3NKEA 3VRCA 2L6GA 5JSLA 3ECSA 3RQGA 4OIPF 1A7VA 1K05A 1YYXA 2W4MA 1Y6DA 2QNLA 2R7WA 4Z9IA 3EJNA 5CIVA 4O6YA 3C63A 2VC9A 4PJLA 5KYYB 1J8MF 4Q7CA 2UUHA 3ABMC 5T1DB 1G4US 1L3PA 4XTKA 2DI3A 3TOLA 4EIYA 2W45A 2Y3DA 3WODF 4DRHB 2F22A 4C3BA 2CYDA 2QE9A 3HNJA 3ZVRA 1VYKA 1NFOA 1OXKA 2GAQA 1DOWA 1G4WR 3ASOC 2JX0A 3GM2A 3HNLA 5EGYA 3PMRA 1PD0A 1E2XA 3FDQA 4YL3A 1YA9A 2HUJA 4N4WA 2WZLA 3RH3A 4JTCB 4IGGA 4MTFA 1R5ID 3U8VA 1YAUO 3S28A 2HJMA 5DQTA 4MQ9F 3Q6MA 4YT4A 1Q0FA 2NPUA 4MTOA 5L0GA 2XRHA 2M4EA 3HNKA 1M2OA 1U6HA 4N06A 2ETSA 3NMJA 2B0JA 2MWQA 3ZDLA 3SXYA 4CBEA 2ZXOA 3KKBA 1MMAA 3MYIA 4WGYA 1HW2A 4P9FA 5AC4A 3NG1A 1GQAA 2KC3A 1I5NA 3HNIA 4DBRA 2PP4A 3DXJF 5KYUA 3B71A 3AG4C 1FTSA 1ST6A 4BJ6C 2HV7A 2GA0A 1H7IA 1QPUA 3DI5A 1BR4A 4JEBA 2LCHA 3DKAA 3GM3A 5T3WA 3WAQA 3EPVA 3LEOA 2R25A 2XLWA 4AL0A 3NKDA 4IWBA 3S90A 2HSBA 1OW8A 1LI7A 4C7OA 4CDYA 1Q0MA 3CZ6A 1ZW3A 3LNRA 1VTMP 3KH2A 4OD5A 1OQCA 3HKKA 1PD1A 2Q9AA 2XL6A 1GGQA 2NSGA 3DWWA 2EILC 2IYLD 3GEIA 3PHF2 2H7OA 2EIKC 1O3UA 1B68A 1CGNA 2UUIA 2LD6A 2P61A 5L0JA 3X2QC 3IQTA 4EWCA 3AGTA 4CIPA 2M64A 2GDCA 2MYSA 4JIOA 4ZLDA 1V54C 4X0RA 1HW1A 4WJ0A 1LE2A 1JOGA 5KYXA 4PR9A 3I5QA 3JYHA 5A6BD 3S84A 2R7QA 2RSEB 3N2ZB 4H54A 1UG7A 1Q0KA 3RF3A 3JZ0A 3Q6NA 3RQFA 2IM8A 2YVKA 4XQ1A 4BPMA 2R7TA 3UGOA 3F47A 3T6JA 1MNEA 1C03A 5L0IA 3FXHA 3ZG1A 4JE9A 2XLEA 1DOVA 3QW1A 4XPXA 2YL3A 2R7RA 4I44A 2EPOA 3EQLF 1M2VB 3G4ZA 3GM1A 4YN0B 4I1OB 3M79A 5E3AA 4EBBA 2KQ9A 2R05A 3NRHA 3QMKA 1ZHWA 1S7ZA 1T01A 1V4AA 3K33A 2WZGA 4HFFB 4C3DA 4EBKA 5BQHA 3U9JA 5JUAA 4AX2A 4YJWA 1ZZPA 4K0DA 4U5FE 1TWGA 3NYJA 3LS0A 3O55A 4IAQA 5COGA 1Z23A 1RKEA 4YT5A 3DJUB 1EKYA 2L9JA 3EGDA 4CS8C 1NFNA 3MYFA 3IQ5A 3ZIBA 4KI2A 3J06A 2QUPA 1TQGA 4ULVA 4XLNF 5BQIA 1KTMA 3HTKC 3HJCA 3UMKA 3UNGC 5F5FA 2EINC 1Z3IX 4BEJA 2PX0A 4LLCA 1ZYRF 2G3KA 2H7VC 1RKEB 1LS1A 4LACB 1ZU5A 1OCOC 3AG1C 4IARA 3U8PA 5L0FA 1QLEC 2HSQA 3NMKA 4FESA 2LK4A 3V5XA 3FOOA 4I3MA 3ZQYA 3EFOA 3M15A 2KJGA 1JPJA 4CX9A 3M4CA 4I1MA 4JCHA 1LM3B 2WL8A 5D92A 2YKZA 1SR2A 1BBHA 2KK1A 3TD7A 4N6CA 3U3BA 4U5CE 1ORSC 4PFOA 3WHNA 4XEVA 1F1MA 4LDRA 4NY3A 2ICWG 5B3SC 2XSEA 2X51A 3L0IA 2YWAA 1LVKA 3BRJA 2RD9A 2KW3C 3AJMA 3EFOB 3L8IA 3NYLA 1HMDA 3X1OA 4P6IC 2LQGA 2I15A 2J0WA 1LKXA 2VH3A 2YHSA 4ER9A 1WATA 4KNWA 4G7ZF 2R7XA 2VCAA 5KYXB 3FOPA 2HFIA 2J9UA 2IOQA 2WZFA 3KYJA 2D4UA 3LUTB 5L0DA 2B0HA 4XEKA 1FFHA 4EHPA 4FX5A 1T5OA 2EPMX 3MFNA 3I4UA 4GQHA 4J30B 3RFYA 2BL2A 3R7CA 1CGME 1HY5A 1LE4A 2AWYA 2OG2A 3GORA 4JZAA 2HMQA 4K7BA 1BZ4A 4O7GA 4U5EE 4YT8A 4L6RA 3TJ5A 3UMHA 1FMVA 4P9TA 4OIRF 4NTFA 1U0BB 2OJQA 2R7OA 2XLMA 3VF0A 1E84A 3S9OA 2XLOA 4Z9HA 4JTAB 3RYLA 2VASA 5JP7A 4B6IA 3RIPA 4Q4ZF 2L6FA 5DS6A 3T6GB 3QTHA 5A6AA 4EUKB 1V55C 2W9YA 3K7DA 3ATPA 4IRUA 4UDVA 1KNYA 3AOUA 1E83A 4KC9A 2EPLX 1C17M 3O39A 1T9KA 1WN0A 2VCCA 3FAJA 5FZTA 2R9RB 3TQOA 4AE4A 3U5SA 1HE1A 3G4XA 1OCCC 3H65A 1OKKA 1V74B 2Y3BA 1XZPA 2HMZA 4PJNA 4DOZA 4R32A 2OQMA 4U5HA 3SNHA 2YRFA 3MX3A 1W2WA 3C62A 2Y39A 2OEXA 3A11A 2C03A 4YT2A 4MVZA 1HMOA 3A9CA 1O87A 4AE4B 1M6TA 2R7UA 4O6MA 5E2QA 1FR0A 2OKUA 3K1HA 1VLSA 2R02A 3ZSUA 1NBBA 3VAYA 1M56C 4OIQF 4PJMA 1VB5A 1WOLA 2V3CC 3DJNB 4G7OF 3RVZA 5BUOA 2LP4A 4MVRA 1S05A 2L6HA 4DXWA 5KYUB 1MNDA 1AVOB 3JRTA 3L8JA 4G7HF 3GEEA 4E17A 1YDIA 1VYIA 1ORJA 2I8BA 1RXQA 1MMDA 2A6HF 3L1MA 4JCZA 2O9XA 1C02A 5KYWA 1T6QA 2G3VA 2J7PA 3KMIA 4DVYP 4C7OB 1LIHA 2PBEA 1ZHTA 2BC5A 2DB4A 4J7YA 3V5ZA 3NDBB 1ZHYA 3CQZA 1RJ9A 256BA 2HS5A 4CS9A 4OINF 1EI7A 1OXBA 3TJ6A 3LNMB 2A0BA 4U5DE 3UMIA 5DQZA 1J8YF 1ZVZA 1O5HA 1PCXA 2A69F 5KYWB 4K1OA 2Q00A 1YZAA 2GWWA 1NLXA 4DVZA 1EA8A 3EHMA 3ASNC 3W8IA 2Q9CA 2R7VA 2LSEA 3OWTA 2PF4E 1VOMA 5GPGB 3N24A 1G5ZA 3JSZA 1RJ9B 4U5BE 4MTGA 2KGOA 5JVEA 3EGXA 4CDAA 2YLDA 3SXKA 1R4TA 3LJBA 2IXMA 5CI8A 2A0UA 5F28E 2P0NA 4RD9A 3C8GA 3IEEA 3ZC4A 2OCCC 1A0BA 3DE9A 4JKVA 4OD4A 3B9QA 4CDVA 3EGXB 2KYHA 1BR2A 2QTVA 1Z7Qc 3M1CB 1FFTC 2JPUA 3FAPB 4G78A 3VM6A 1H9TA 2YQYA 4DJ9A 1BDJB 1LPEA 1E85A 3C8GB 1JPNA 5COMA 3TULA 3DZAA 2E87A 3B29A 4A2NB 4YK5A 2HJ3A 2ZXWC 5DVWA 3I5PA 3LS1A 5HV9A 2OU6A 3EZIA 3Q7GA 5B3IA 5BQGA 3EGDB 3QVYA 1TWCA 3W4YA 4PK4A 3UR3C 1BR1A 2PFDA 2XXAA 1N1CA 1D0YA 2MHRA 2XL4A 2IXPA 1IZMA 3DM5A 1Z63A 2HKVA 3DE8A 3V7OA 3C8ZA 1XZQA 3IPMO 3WG7C 1E86A 3W2WA 2P1AA 3LLKA 2L81A 4LDQA 5A6KA 3T9OA 1AUEA 2AWCA 5B1BC 4BJ5A 1WGWA 2XXAB 3C18A 1LI5A 1ZU4A 3QVZA 1TWAA 1SZIA 3CEXA 4XEFA 3MLGA 4HEAJ 1YYJA 3RQEA 4JJFA 1D1CA 1TFOB 3OA1A 2YL1A 4GYTA 3GODA 3LLIA 2CNWA 4JURI 4CSAA 1YVIA 2H7BA 4JC7A 1K04A 4BEMJ 1VLTA 2FAPB 1NU9C 2ZXRA 1UFBA 4G0HA 3V5YA 4CS7A 3DAGA 1ORYA 4U9EA 1NSGB 4ULWA 5F5HA 5K0IA 4QI0A 2XLHA 4FAPB 5E33A 1QZXA 4LERA 1D1BA 2DGJA 2ZXPA 1NG1A 3O6XA 4WGZA 2WVQA 3ZWIA 4E18A 5B1AC 2QLAA 4F4BA 3POVA 2YLGA 1JMWA 4FWVA 4EKWA 3B0VC 5TJ5E 4LLEA 4YL1A 2DYSC 4JW1A 1G8XA 1D0XA
chains in the Genus database with same CATH topology
2IXOA 4JJGA 4HFKB 3FHDA 1NZEA 3T6BA 5KYYA 3K1IC 3ABLC 3E9VA 2NUPA 3S29A 3JCUQ 2A68F 3ABKC 4RDAA 3T4RA 5DS5A 5CI9A 3SP1A 3B0PA 3EHNA 1VMAA 4M63A 1MMGA 2NUPB 4AK9A 3LEVA 1SF8A 3FVYA 2W4BA 3DM9B 2PX3A 3L34A 4E7ZA 2A6EF 3DD7A 3ITFA 2ZPAA 4BJ6A 1TR2A 2KNHA 4QDLA 5DS4A 2Y3GA 4Q5SF 4ZLCA 5KYNA 4RBNA 3SEOA 3W8HA 3SYNA 2JD3A 3K6BA 1OKKD 1NU7D 2HV6A 2VB6A 1TKNA 2D5RB 2FFHA 1MMNA 2C04A 5E3CA 2A1DD 5L3QA 4JVSA 3GANA 4O79A 3AQCA 4E7SA 2IXNA 2YZSA 3EH2A 2NUTA 5L3VA 3E70C 4XWJA 2P6VA 3DMDA 4QI2A 2NG1A 4GEHA 5T3TA 4YWQA 2J9WA 1D1AA 2BE5F 2NUTB 4J32B 5HSWA 2Q3TA 2J7PD 2YEVA 5DLJA 4CIHA 2DYRC 1Z5ZA 3EZHA 4DBQA 2GFHA 2V26A 4BJTA 3UGPA 2EIJC 4H4KC 3KL4A 4U5GA 4KNVA 2CDQA 2EIMC 1IW7F 2J9VA 2Y3HA 4CS9C 3LAYA 4W8KA 1M2VA 3QZCA 2R7SA 3S27A 3W2VA 3OEOA 4CS8A 3EG9A 3AG3C 3CSKA 2J0XA 2WB7A 2WVOA 1D0ZA 3S0XA 2J46A 3AQBA 3Q7LA 3K66A 4PFPA 3EG9B 2G62A 4KBLA 5FCLA 2Q9BA 2J45A 4HE8D 3AG2C 3JT1A 4O6NA 1VK5A 4C3EA 1ZHZA 4ANJA 5EHHA 1M57C 5IY5C 3DAFA 3F46A 3VYWA 4IJJA 1TWHA 3NYMA 4MNDA 3LESA 3HLZA 1KU2A 3SZRA 2QY9A 5KYXA 1FMWA 4PJJA 4XLPF 5D91A 2FGYA 4BJ1A 1OCRC 2CGEA 4BJ5C 1SMYF 2Y69C 3RKOF 2Z15A 3EH1A 1ZHXA 4IAOA 4BG0A 2CNWD 2P7VA 4OIOF 3N0TA 4CSAC 3B0UX 2WVNA 1OCZC 2CW0F 1Z6AA 3NKEA 3ECSA 4OIPF 2W4MA 2R7WA 3EJNA 4O6YA 4PJLA 5KYYB 1J8MF 4Q7CA 3ABMC 5T1DB 4XTKA 2W45A 2Y3DA 3WODF 4C3BA 3ZVRA 1VYKA 5EGYA 3ASOC 3PMRA 1PD0A 3FDQA 3RH3A 2WZLA 5DQTA 3S28A 4MQ9F 3Q6MA 4YT4A 2R7VA 2XRHA 2M4EA 1M2OA 4N06A 2B0JA 2MWQA 4CBEA 2ZXOA 3KKBA 1MMAA 3NG1A 4DBRA 2PP4A 3DXJF 5KYUA 3AG4C 1FTSA 1ST6A 4BJ6C 2HV7A 5T3WA 1BR4A 3EPVA 3NKDA 4IWBA 4C7OA 3CZ6A 3LNRA 3KH2A 4OD5A 1PD1A 2Q9AA 3PHF2 2EILC 2IYLD 2H7OA 2EIKC 3X2QC 4EWCA 2MYSA 4ZLDA 1V54C 4X0RA 4WJ0A 3I5QA 3JYHA 2R7QA 3N2ZB 3Q6NA 2R7TA 3UGOA 3F47A 3T6JA 1MNEA 3ZG1A 2R7RA 4I44A 3UMKA 3EQLF 1M2VB 4YN0B 5E3AA 4I1OB 4EBBA 2KQ9A 3NRHA 3QMKA 1ZHWA 1S7ZA 3K33A 4C3DA 2WZGA 4HFFB 4AX2A 4YJWA 4K0DA 4U5FE 1TWGA 3NYJA 3LS0A 1Z23A 4YT5A 3DJUB 2L9JA 3EGDA 4CS8C 3ZIBA 4KI2A 4XLNF 3HTKC 3HJCA 3UNGC 5F5FA 2EINC 1Z3IX 4BEJA 2PX0A 4LLCA 1ZYRF 2G3KA 2H7VC 1LS1A 4LACB 1ZU5A 1OCOC 3AG1C 1QLEC 4FESA 4I3MA 3EFOA 2KJGA 1JPJA 4I1MA 4JCHA 5D92A 2WL8A 3TD7A 4U5CE 4PFOA 4NY3A 5B3SC 2XSEA 2X51A 3L0IA 1LVKA 3EFOB 2KW3C 3NYLA 3X1OA 4P6IC 2VH3A 2J0WA 1LKXA 2YHSA 4KNWA 4G7ZF 2R7XA 5KYXB 2J9UA 2IOQA 2WZFA 1FFHA 4FX5A 3I4UA 4J30B 3RFYA 2OG2A 4JZAA 4K7BA 4U5EE 4YT8A 4O7GA 3UMHA 1FMVA 4OIRF 2R7OA 3RYLA 2VASA 4B6IA 3RIPA 4Q4ZF 5DS6A 1V55C 2W9YA 3K7DA 4IRUA 4KC9A 3O39A 3FAJA 4AE4A 1OCCC 3H65A 1OKKA 2Y3BA 4PJNA 4DOZA 4U5HA 3SNHA 3MX3A 1W2WA 2Y39A 2C03A 4YT2A 4AE4B 1O87A 2R7UA 4O6MA 5E2QA 3K1HA 3ZSUA 3VAYA 1M56C 4OIQF 4PJMA 2V3CC 3DJNB 4G7OF 5BUOA 5KYUB 1MNDA 3JRTA 4G7HF 1VYIA 2I8BA 1MMDA 2A6HF 2O9XA 5KYWA 2G3VA 2J7PA 3KMIA 4DVYP 4C7OB 1ZHTA 3NDBB 1ZHYA 3CQZA 1RJ9A 4CS9A 4OINF 4U5DE 3UMIA 5DQZA 1J8YF 1O5HA 1PCXA 2A69F 5KYWB 4DVZA 3EHMA 3ASNC 3W8IA 2Q9CA 2LSEA 3OWTA 2PF4E 1VOMA 3N24A 3JSZA 1RJ9B 4U5BE 2KGOA 3EGXA 3LJBA 2IXMA 5CI8A 4RD9A 3IEEA 3ZC4A 2OCCC 4OD4A 3B9QA 3EGXB 1BR2A 2QTVA 3M1CB 1FFTC 1JPNA 3DZAA 2E87A 4A2NB 2ZXWC 5DVWA 3I5PA 3LS1A 3EZIA 3Q7GA 3EGDB 1TWCA 4PK4A 3UR3C 1BR1A 2PFDA 2XXAA 1N1CA 1D0YA 2XL4A 2IXPA 1IZMA 3DM5A 1Z63A 3V7OA 3WG7C 3W2WA 3LLKA 2L81A 5B1BC 4BJ5A 1WGWA 2XXAB 1ZU4A 1TWAA 1SZIA 3MLGA 4HEAJ 4JJFA 1D1CA 3OA1A 4GYTA 3GODA 3LLIA 2CNWA 4JURI 4CSAA 2H7BA 2ZXRA 1NU9C 4G0HA 4CS7A 3DAGA 4ULWA 5F5HA 4QI0A 5E33A 1QZXA 4LERA 1D1BA 2DGJA 2ZXPA 1NG1A 3O6XA 2WVQA 5B1AC 4F4BA 3POVA 4FWVA 3B0VC 4LLEA 2DYSC 4JW1A 1G8XA 1D0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IXO A;  2G62 A;  4LAC B;  2IXP A;  2IXM A;  2IXN A;  2HV6 A;  2HV7 A;  4NY3 A; 
#chains in the Genus database with same CATH topology
 2IXO A;  4JJG A;  3GWN A;  4HFK B;  3FHD A;  1NZE A;  4N6H A;  3T6B A;  3H2U A;  5KYY A;  3K1I C;  3ABL C;  3E9V A;  3US6 A;  2NUP A;  3S29 A;  2XL8 A;  3JCU Q;  2A68 F;  3ABK C;  3JRM O;  4RDA A;  3T4R A;  1OW7 A;  2J8W A;  5DS5 A;  5CI9 A;  3SP1 A;  3B0P A;  1EQ1 A;  4CJO A;  3EHN A;  3SXM A;  1VMA A;  4JRZ A;  4LDK A;  4M63 A;  3PCV A;  1XWJ A;  2H8A A;  1MMG A;  4MVU A;  2NUP B;  1T6U A;  2XLD A;  4AK9 A;  3LEV A;  1SF8 A;  3FVY A;  1QQ3 A;  3KPH A;  2W4B A;  1FAP B;  3G50 A;  3QW0 A;  5AGF A;  4YL0 A;  3FMS A;  1Q0G A;  5L0C A;  3DM9 B;  3GEH A;  2LIG A;  2IBF A;  3IQC A;  3ZQV A;  4MVS A;  4WAB A;  1JR8 A;  1CPQ A;  2PX3 A;  3L34 A;  1FNT c;  4E7Z A;  2L7A A;  2A6E F;  3DD7 A;  4W8P A;  3ITF A;  2ZPA A;  4BJ6 A;  4U9D A;  1TR2 A;  3CAX A;  2KNH A;  3ZTM A;  1TFK B;  1MQV A;  4QDL A;  5DS4 A;  2Y3G A;  4Q5S F;  1GS9 A;  1A7E A;  1U89 A;  4NC3 A;  4RBN A;  3SEO A;  3W8H A;  2LFF A;  1Y4C A;  2JD3 A;  3SYN A;  5KYN A;  3KYI A;  3K6B A;  3H2V A;  1YJG A;  1OKK D;  4JTD B;  1NU7 D;  1QSP A;  2HV6 A;  2VB6 A;  1TKN A;  2D5R B;  2FFH A;  3MBG A;  1MMN A;  1OR3 A;  2C04 A;  5E3C A;  2A1D D;  5L3Q A;  3PDM P;  2J9B A;  4JVS A;  3U3F A;  3GAN A;  4MS2 A;  4O79 A;  3AQC A;  4AL1 A;  4D4N A;  2Q4F A;  2AU5 A;  4NTB A;  1ZW2 A;  4E7S A;  2IXN A;  2YZS A;  3C7J A;  4XPW A;  3EH2 A;  2XM4 A;  2NUT A;  3ZTZ A;  4DRI B;  2KSF A;  5L3V A;  3E70 C;  4XWJ A;  2P6V A;  3DMD A;  1WAS A;  3BEH A;  3R2P A;  4QI2 A;  5A6B A;  1YA7 O;  1I4Y A;  2YL7 A;  5JRA A;  2NG1 A;  4GEH A;  4ZLC A;  5T3T A;  1Q0D A;  2OEV A;  2XLV A;  2YL0 A;  1H6G A;  4YWQ A;  2J9W A;  2XS8 A;  4NQF A;  1D1A A;  2BE5 F;  2NUT B;  2ZD9 A;  4J32 B;  3SXZ A;  5HSW A;  3AGU A;  2Q3T A;  2J7P D;  2YEV A;  5A69 A;  5DLJ A;  4A4A A;  4CIH A;  2DYR C;  1Z5Z A;  3EZH A;  4DBQ A;  2GFH A;  2V26 A;  4BJT A;  1OW6 A;  3UGP A;  3JTL O;  1RCP A;  2EIJ C;  4PAC A;  4H4K C;  3U0C A;  3KL4 A;  1RMV A;  2CCY A;  3NMI A;  4KNV A;  4U5G A;  4CJG A;  1YAR O;  2CDQ A;  1IW7 F;  2EIM C;  2J9V A;  2ASR A;  2Y3H A;  3LAY A;  4CS9 C;  4D4X A;  1CPR A;  4W8K A;  1M2V A;  3QZC A;  4MW3 A;  2EPN A;  2R7S A;  3S27 A;  3W2V A;  3OEO A;  1K40 A;  3U2M A;  4CS8 A;  3EG9 A;  5AC5 A;  3AG3 C;  3GWL A;  3CSK A;  3O10 A;  4XPY A;  2J0X A;  1H9G A;  1A41 A;  1JRA A;  2WB7 A;  2WVO A;  1AEP A;  1D0Z A;  1HE9 A;  3S0X A;  2J46 A;  3IHU A;  4DRJ B;  3AQB A;  4MW8 A;  3C8G D;  3K66 A;  3Q7L A;  4PFP A;  4Z9J A;  3EG9 B;  2YLI A;  3RW0 A;  2G62 A;  4KBL A;  5FCL A;  2Q9B A;  2OOC A;  2J45 A;  2PNO A;  4J7T A;  4IB4 A;  3TOM A;  3JSE O;  4HE8 D;  3RVY A;  3AG2 C;  4NTA A;  3JT1 A;  2LFD A;  4O6N A;  5A6J A;  2XM0 A;  2AVK A;  1QKR A;  1VK5 A;  5JT4 A;  4C3E A;  1ZHZ A;  4JEA A;  1YZC A;  4ANJ A;  5EHH A;  1OR2 A;  1M57 C;  4MVQ A;  3U9M A;  5IY5 C;  3DAF A;  3F46 A;  2XS1 A;  2Q7R A;  3VYW A;  1APC A;  1YLM A;  3JYY A;  4E0I A;  1GM5 A;  4IJJ A;  1TWH A;  1WTY A;  2NSF A;  2HZ8 A;  3M4B A;  3NYM A;  1WWP A;  2TMV P;  1LS4 A;  5EK0 A;  4MND A;  1PV3 A;  5L0H A;  3LES A;  2AP3 A;  1L7C A;  1SYQ A;  3HLZ A;  5JS5 A;  1KU2 A;  3SZR A;  2QY9 A;  4NCQ A;  4MVO A;  1FMW A;  4ONS A;  4PJJ A;  3IQ6 A;  5D91 A;  1JAF A;  2FGY A;  4BJ1 A;  4E0H A;  4XLP F;  3TK0 A;  2EPK X;  1A7D A;  1OCR C;  2CGE A;  2R03 A;  1SMY F;  2Y69 C;  4MVM A;  3U2L A;  4BJ5 C;  3RKO F;  2Z15 A;  3EH1 A;  1ZHX A;  4IAO A;  4BG0 A;  1CGO A;  4EBJ A;  1I4Z A;  2CNW D;  1QVX A;  2P7V A;  5COF A;  2X0C A;  4OIO F;  3N0T A;  1RKC A;  5JLI A;  4CSA C;  2VCB A;  3B0U X;  2WVN A;  1OCZ C;  2OJE D;  2CW0 F;  1T6I A;  3K1I A;  1Z6A A;  3NKE A;  3VRC A;  2L6G A;  5JSL A;  3ECS A;  3RQG A;  4OIP F;  1A7V A;  1K05 A;  1YYX A;  2W4M A;  1Y6D A;  2QNL A;  2R7W A;  4Z9I A;  3EJN A;  5CIV A;  4O6Y A;  3C63 A;  2VC9 A;  4PJL A;  5KYY B;  1J8M F;  4Q7C A;  2UUH A;  3ABM C;  5T1D B;  1G4U S;  1L3P A;  4XTK A;  2DI3 A;  3TOL A;  4EIY A;  2W45 A;  2Y3D A;  3WOD F;  4DRH B;  2F22 A;  4C3B A;  2CYD A;  2QE9 A;  3HNJ A;  3ZVR A;  1VYK A;  1NFO A;  1OXK A;  2GAQ A;  1DOW A;  1G4W R;  3ASO C;  2JX0 A;  3GM2 A;  3HNL A;  5EGY A;  3PMR A;  1PD0 A;  1E2X A;  3FDQ A;  4YL3 A;  1YA9 A;  2HUJ A;  4N4W A;  2WZL A;  3RH3 A;  4JTC B;  4IGG A;  4MTF A;  1R5I D;  3U8V A;  1YAU O;  3S28 A;  2HJM A;  5DQT A;  4MQ9 F;  3Q6M A;  4YT4 A;  1Q0F A;  2NPU A;  4MTO A;  5L0G A;  2XRH A;  2M4E A;  3HNK A;  1M2O A;  1U6H A;  4N06 A;  2ETS A;  3NMJ A;  2B0J A;  2MWQ A;  3ZDL A;  3SXY A;  4CBE A;  2ZXO A;  3KKB A;  1MMA A;  3MYI A;  4WGY A;  1HW2 A;  4P9F A;  5AC4 A;  3NG1 A;  1GQA A;  2KC3 A;  1I5N A;  3HNI A;  4DBR A;  2PP4 A;  3DXJ F;  5KYU A;  3B71 A;  3AG4 C;  1FTS A;  1ST6 A;  4BJ6 C;  2HV7 A;  2GA0 A;  1H7I A;  1QPU A;  3DI5 A;  1BR4 A;  4JEB A;  2LCH A;  3DKA A;  3GM3 A;  5T3W A;  3WAQ A;  3EPV A;  3LEO A;  2R25 A;  2XLW A;  4AL0 A;  3NKD A;  4IWB A;  3S90 A;  2HSB A;  1OW8 A;  1LI7 A;  4C7O A;  4CDY A;  1Q0M A;  3CZ6 A;  1ZW3 A;  3LNR A;  1VTM P;  3KH2 A;  4OD5 A;  1OQC A;  3HKK A;  1PD1 A;  2Q9A A;  2XL6 A;  1GGQ A;  2NSG A;  3DWW A;  2EIL C;  2IYL D;  3GEI A;  3PHF 2;  2H7O A;  2EIK C;  1O3U A;  1B68 A;  1CGN A;  2UUI A;  2LD6 A;  2P61 A;  5L0J A;  3X2Q C;  3IQT A;  4EWC A;  3AGT A;  4CIP A;  2M64 A;  2GDC A;  2MYS A;  4JIO A;  4ZLD A;  1V54 C;  4X0R A;  1HW1 A;  4WJ0 A;  1LE2 A;  1JOG A;  5KYX A;  4PR9 A;  3I5Q A;  3JYH A;  5A6B D;  3S84 A;  2R7Q A;  2RSE B;  3N2Z B;  4H54 A;  1UG7 A;  1Q0K A;  3RF3 A;  3JZ0 A;  3Q6N A;  3RQF A;  2IM8 A;  2YVK A;  4XQ1 A;  4BPM A;  2R7T A;  3UGO A;  3F47 A;  3T6J A;  1MNE A;  1C03 A;  5L0I A;  3FXH A;  3ZG1 A;  4JE9 A;  2XLE A;  1DOV A;  3QW1 A;  4XPX A;  2YL3 A;  2R7R A;  4I44 A;  2EPO A;  3EQL F;  1M2V B;  3G4Z A;  3GM1 A;  4YN0 B;  4I1O B;  3M79 A;  5E3A A;  4EBB A;  2KQ9 A;  2R05 A;  3NRH A;  3QMK A;  1ZHW A;  1S7Z A;  1T01 A;  1V4A A;  3K33 A;  2WZG A;  4HFF B;  4C3D A;  4EBK A;  5BQH A;  3U9J A;  5JUA A;  4AX2 A;  4YJW A;  1ZZP A;  4K0D A;  4U5F E;  1TWG A;  3NYJ A;  3LS0 A;  3O55 A;  4IAQ A;  5COG A;  1Z23 A;  1RKE A;  4YT5 A;  3DJU B;  1EKY A;  2L9J A;  3EGD A;  4CS8 C;  1NFN A;  3MYF A;  3IQ5 A;  3ZIB A;  4KI2 A;  3J06 A;  2QUP A;  1TQG A;  4ULV A;  4XLN F;  5BQI A;  1KTM A;  3HTK C;  3HJC A;  3UMK A;  3UNG C;  5F5F A;  2EIN C;  1Z3I X;  4BEJ A;  2PX0 A;  4LLC A;  1ZYR F;  2G3K A;  2H7V C;  1RKE B;  1LS1 A;  4LAC B;  1ZU5 A;  1OCO C;  3AG1 C;  4IAR A;  3U8P A;  5L0F A;  1QLE C;  2HSQ A;  3NMK A;  4FES A;  2LK4 A;  3V5X A;  3FOO A;  4I3M A;  3ZQY A;  3EFO A;  3M15 A;  2KJG A;  1JPJ A;  4CX9 A;  3M4C A;  4I1M A;  4JCH A;  1LM3 B;  2WL8 A;  5D92 A;  2YKZ A;  1SR2 A;  1BBH A;  2KK1 A;  3TD7 A;  4N6C A;  3U3B A;  4U5C E;  1ORS C;  4PFO A;  3WHN A;  4XEV A;  1F1M A;  4LDR A;  4NY3 A;  2ICW G;  5B3S C;  2XSE A;  2X51 A;  3L0I A;  2YWA A;  1LVK A;  3BRJ A;  2RD9 A;  2KW3 C;  3AJM A;  3EFO B;  3L8I A;  3NYL A;  1HMD A;  3X1O A;  4P6I C;  2LQG A;  2I15 A;  2J0W A;  1LKX A;  2VH3 A;  2YHS A;  4ER9 A;  1WAT A;  4KNW A;  4G7Z F;  2R7X A;  2VCA A;  5KYX B;  3FOP A;  2HFI A;  2J9U A;  2IOQ A;  2WZF A;  3KYJ A;  2D4U A;  3LUT B;  5L0D A;  2B0H A;  4XEK A;  1FFH A;  4EHP A;  4FX5 A;  1T5O A;  2EPM X;  3MFN A;  3I4U A;  4GQH A;  4J30 B;  3RFY A;  2BL2 A;  3R7C A;  1CGM E;  1HY5 A;  1LE4 A;  2AWY A;  2OG2 A;  3GOR A;  4JZA A;  2HMQ A;  4K7B A;  1BZ4 A;  4O7G A;  4U5E E;  4YT8 A;  4L6R A;  3TJ5 A;  3UMH A;  1FMV A;  4P9T A;  4OIR F;  4NTF A;  1U0B B;  2OJQ A;  2R7O A;  2XLM A;  3VF0 A;  1E84 A;  3S9O A;  2XLO A;  4Z9H A;  4JTA B;  3RYL A;  2VAS A;  5JP7 A;  4B6I A;  3RIP A;  4Q4Z F;  2L6F A;  5DS6 A;  3T6G B;  3QTH A;  5A6A A;  4EUK B;  1V55 C;  2W9Y A;  3K7D A;  3ATP A;  4IRU A;  4UDV A;  1KNY A;  3AOU A;  1E83 A;  4KC9 A;  2EPL X;  1C17 M;  3O39 A;  1T9K A;  1WN0 A;  2VCC A;  3FAJ A;  5FZT A;  2R9R B;  3TQO A;  4AE4 A;  3U5S A;  1HE1 A;  3G4X A;  1OCC C;  3H65 A;  1OKK A;  1V74 B;  2Y3B A;  1XZP A;  2HMZ A;  4PJN A;  4DOZ A;  4R32 A;  2OQM A;  4U5H A;  3SNH A;  2YRF A;  3MX3 A;  1W2W A;  3C62 A;  2Y39 A;  2OEX A;  3A11 A;  2C03 A;  4YT2 A;  4MVZ A;  1HMO A;  3A9C A;  1O87 A;  4AE4 B;  1M6T A;  2R7U A;  4O6M A;  5E2Q A;  1FR0 A;  2OKU A;  3K1H A;  1VLS A;  2R02 A;  3ZSU A;  1NBB A;  3VAY A;  1M56 C;  4OIQ F;  4PJM A;  1VB5 A;  1WOL A;  2V3C C;  3DJN B;  4G7O F;  3RVZ A;  5BUO A;  2LP4 A;  4MVR A;  1S05 A;  2L6H A;  4DXW A;  5KYU B;  1MND A;  1AVO B;  3JRT A;  3L8J A;  4G7H F;  3GEE A;  4E17 A;  1YDI A;  1VYI A;  1ORJ A;  2I8B A;  1RXQ A;  1MMD A;  2A6H F;  3L1M A;  4JCZ A;  2O9X A;  1C02 A;  5KYW A;  1T6Q A;  2G3V A;  2J7P A;  3KMI A;  4DVY P;  4C7O B;  1LIH A;  2PBE A;  1ZHT A;  2BC5 A;  2DB4 A;  4J7Y A;  3V5Z A;  3NDB B;  1ZHY A;  3CQZ A;  1RJ9 A;  256B A;  2HS5 A;  4CS9 A;  4OIN F;  1EI7 A;  1OXB A;  3TJ6 A;  3LNM B;  2A0B A;  4U5D E;  3UMI A;  5DQZ A;  1J8Y F;  1ZVZ A;  1O5H A;  1PCX A;  2A69 F;  5KYW B;  4K1O A;  2Q00 A;  1YZA A;  2GWW A;  1NLX A;  4DVZ A;  1EA8 A;  3EHM A;  3ASN C;  3W8I A;  2Q9C A;  2R7V A;  2LSE A;  3OWT A;  2PF4 E;  1VOM A;  5GPG B;  3N24 A;  1G5Z A;  3JSZ A;  1RJ9 B;  4U5B E;  4MTG A;  2KGO A;  5JVE A;  3EGX A;  4CDA A;  2YLD A;  3SXK A;  1R4T A;  3LJB A;  2IXM A;  5CI8 A;  2A0U A;  5F28 E;  2P0N A;  4RD9 A;  3C8G A;  3IEE A;  3ZC4 A;  2OCC C;  1A0B A;  3DE9 A;  4JKV A;  4OD4 A;  3B9Q A;  4CDV A;  3EGX B;  2KYH A;  1BR2 A;  2QTV A;  1Z7Q c;  3M1C B;  1FFT C;  2JPU A;  3FAP B;  4G78 A;  3VM6 A;  1H9T A;  2YQY A;  4DJ9 A;  1BDJ B;  1LPE A;  1E85 A;  3C8G B;  1JPN A;  5COM A;  3TUL A;  3DZA A;  2E87 A;  3B29 A;  4A2N B;  4YK5 A;  2HJ3 A;  2ZXW C;  5DVW A;  3I5P A;  3LS1 A;  5HV9 A;  2OU6 A;  3EZI A;  3Q7G A;  5B3I A;  5BQG A;  3EGD B;  3QVY A;  1TWC A;  3W4Y A;  4PK4 A;  3UR3 C;  1BR1 A;  2PFD A;  2XXA A;  1N1C A;  1D0Y A;  2MHR A;  2XL4 A;  2IXP A;  1IZM A;  3DM5 A;  1Z63 A;  2HKV A;  3DE8 A;  3V7O A;  3C8Z A;  1XZQ A;  3IPM O;  3WG7 C;  1E86 A;  3W2W A;  2P1A A;  3LLK A;  2L81 A;  4LDQ A;  5A6K A;  3T9O A;  1AUE A;  2AWC A;  5B1B C;  4BJ5 A;  1WGW A;  2XXA B;  3C18 A;  1LI5 A;  1ZU4 A;  3QVZ A;  1TWA A;  1SZI A;  3CEX A;  4XEF A;  3MLG A;  4HEA J;  1YYJ A;  3RQE A;  4JJF A;  1D1C A;  1TFO B;  3OA1 A;  2YL1 A;  4GYT A;  3GOD A;  3LLI A;  2CNW A;  4JUR I;  4CSA A;  1YVI A;  2H7B A;  4JC7 A;  1K04 A;  4BEM J;  1VLT A;  2FAP B;  1NU9 C;  2ZXR A;  1UFB A;  4G0H A;  3V5Y A;  4CS7 A;  3DAG A;  1ORY A;  4U9E A;  1NSG B;  4ULW A;  5F5H A;  5K0I A;  4QI0 A;  2XLH A;  4FAP B;  5E33 A;  1QZX A;  4LER A;  1D1B A;  2DGJ A;  2ZXP A;  1NG1 A;  3O6X A;  4WGZ A;  2WVQ A;  3ZWI A;  4E18 A;  5B1A C;  2QLA A;  4F4B A;  3POV A;  2YLG A;  1JMW A;  4FWV A;  4EKW A;  3B0V C;  5TJ5 E;  4LLE A;  4YL1 A;  2DYS C;  4JW1 A;  1G8X A;  1D0X A; 
#chains in the Genus database with same CATH homology
 2IXO A;  4JJG A;  4HFK B;  3FHD A;  1NZE A;  3T6B A;  5KYY A;  3K1I C;  3ABL C;  3E9V A;  2NUP A;  3S29 A;  3JCU Q;  2A68 F;  3ABK C;  4RDA A;  3T4R A;  5DS5 A;  5CI9 A;  3SP1 A;  3B0P A;  3EHN A;  1VMA A;  4M63 A;  1MMG A;  2NUP B;  4AK9 A;  3LEV A;  1SF8 A;  3FVY A;  2W4B A;  3DM9 B;  2PX3 A;  3L34 A;  4E7Z A;  2A6E F;  3DD7 A;  3ITF A;  2ZPA A;  4BJ6 A;  1TR2 A;  2KNH A;  4QDL A;  5DS4 A;  2Y3G A;  4Q5S F;  4ZLC A;  5KYN A;  4RBN A;  3SEO A;  3W8H A;  3SYN A;  2JD3 A;  3K6B A;  1OKK D;  1NU7 D;  2HV6 A;  2VB6 A;  1TKN A;  2D5R B;  2FFH A;  1MMN A;  2C04 A;  5E3C A;  2A1D D;  5L3Q A;  4JVS A;  3GAN A;  4O79 A;  3AQC A;  4E7S A;  2IXN A;  2YZS A;  3EH2 A;  2NUT A;  5L3V A;  3E70 C;  4XWJ A;  2P6V A;  3DMD A;  4QI2 A;  2NG1 A;  4GEH A;  5T3T A;  4YWQ A;  2J9W A;  1D1A A;  2BE5 F;  2NUT B;  4J32 B;  5HSW A;  2Q3T A;  2J7P D;  2YEV A;  5DLJ A;  4CIH A;  2DYR C;  1Z5Z A;  3EZH A;  4DBQ A;  2GFH A;  2V26 A;  4BJT A;  3UGP A;  2EIJ C;  4H4K C;  3KL4 A;  4U5G A;  4KNV A;  2CDQ A;  2EIM C;  1IW7 F;  2J9V A;  2Y3H A;  4CS9 C;  3LAY A;  4W8K A;  1M2V A;  3QZC A;  2R7S A;  3S27 A;  3W2V A;  3OEO A;  4CS8 A;  3EG9 A;  3AG3 C;  3CSK A;  2J0X A;  2WB7 A;  2WVO A;  1D0Z A;  3S0X A;  2J46 A;  3AQB A;  3Q7L A;  3K66 A;  4PFP A;  3EG9 B;  2G62 A;  4KBL A;  5FCL A;  2Q9B A;  2J45 A;  4HE8 D;  3AG2 C;  3JT1 A;  4O6N A;  1VK5 A;  4C3E A;  1ZHZ A;  4ANJ A;  5EHH A;  1M57 C;  5IY5 C;  3DAF A;  3F46 A;  3VYW A;  4IJJ A;  1TWH A;  3NYM A;  4MND A;  3LES A;  3HLZ A;  1KU2 A;  3SZR A;  2QY9 A;  5KYX A;  1FMW A;  4PJJ A;  4XLP F;  5D91 A;  2FGY A;  4BJ1 A;  1OCR C;  2CGE A;  4BJ5 C;  1SMY F;  2Y69 C;  3RKO F;  2Z15 A;  3EH1 A;  1ZHX A;  4IAO A;  4BG0 A;  2CNW D;  2P7V A;  4OIO F;  3N0T A;  4CSA C;  3B0U X;  2WVN A;  1OCZ C;  2CW0 F;  1Z6A A;  3NKE A;  3ECS A;  4OIP F;  2W4M A;  2R7W A;  3EJN A;  4O6Y A;  4PJL A;  5KYY B;  1J8M F;  4Q7C A;  3ABM C;  5T1D B;  4XTK A;  2W45 A;  2Y3D A;  3WOD F;  4C3B A;  3ZVR A;  1VYK A;  5EGY A;  3ASO C;  3PMR A;  1PD0 A;  3FDQ A;  3RH3 A;  2WZL A;  5DQT A;  3S28 A;  4MQ9 F;  3Q6M A;  4YT4 A;  2R7V A;  2XRH A;  2M4E A;  1M2O A;  4N06 A;  2B0J A;  2MWQ A;  4CBE A;  2ZXO A;  3KKB A;  1MMA A;  3NG1 A;  4DBR A;  2PP4 A;  3DXJ F;  5KYU A;  3AG4 C;  1FTS A;  1ST6 A;  4BJ6 C;  2HV7 A;  5T3W A;  1BR4 A;  3EPV A;  3NKD A;  4IWB A;  4C7O A;  3CZ6 A;  3LNR A;  3KH2 A;  4OD5 A;  1PD1 A;  2Q9A A;  3PHF 2;  2EIL C;  2IYL D;  2H7O A;  2EIK C;  3X2Q C;  4EWC A;  2MYS A;  4ZLD A;  1V54 C;  4X0R A;  4WJ0 A;  3I5Q A;  3JYH A;  2R7Q A;  3N2Z B;  3Q6N A;  2R7T A;  3UGO A;  3F47 A;  3T6J A;  1MNE A;  3ZG1 A;  2R7R A;  4I44 A;  3UMK A;  3EQL F;  1M2V B;  4YN0 B;  5E3A A;  4I1O B;  4EBB A;  2KQ9 A;  3NRH A;  3QMK A;  1ZHW A;  1S7Z A;  3K33 A;  4C3D A;  2WZG A;  4HFF B;  4AX2 A;  4YJW A;  4K0D A;  4U5F E;  1TWG A;  3NYJ A;  3LS0 A;  1Z23 A;  4YT5 A;  3DJU B;  2L9J A;  3EGD A;  4CS8 C;  3ZIB A;  4KI2 A;  4XLN F;  3HTK C;  3HJC A;  3UNG C;  5F5F A;  2EIN C;  1Z3I X;  4BEJ A;  2PX0 A;  4LLC A;  1ZYR F;  2G3K A;  2H7V C;  1LS1 A;  4LAC B;  1ZU5 A;  1OCO C;  3AG1 C;  1QLE C;  4FES A;  4I3M A;  3EFO A;  2KJG A;  1JPJ A;  4I1M A;  4JCH A;  5D92 A;  2WL8 A;  3TD7 A;  4U5C E;  4PFO A;  4NY3 A;  5B3S C;  2XSE A;  2X51 A;  3L0I A;  1LVK A;  3EFO B;  2KW3 C;  3NYL A;  3X1O A;  4P6I C;  2VH3 A;  2J0W A;  1LKX A;  2YHS A;  4KNW A;  4G7Z F;  2R7X A;  5KYX B;  2J9U A;  2IOQ A;  2WZF A;  1FFH A;  4FX5 A;  3I4U A;  4J30 B;  3RFY A;  2OG2 A;  4JZA A;  4K7B A;  4U5E E;  4YT8 A;  4O7G A;  3UMH A;  1FMV A;  4OIR F;  2R7O A;  3RYL A;  2VAS A;  4B6I A;  3RIP A;  4Q4Z F;  5DS6 A;  1V55 C;  2W9Y A;  3K7D A;  4IRU A;  4KC9 A;  3O39 A;  3FAJ A;  4AE4 A;  1OCC C;  3H65 A;  1OKK A;  2Y3B A;  4PJN A;  4DOZ A;  4U5H A;  3SNH A;  3MX3 A;  1W2W A;  2Y39 A;  2C03 A;  4YT2 A;  4AE4 B;  1O87 A;  2R7U A;  4O6M A;  5E2Q A;  3K1H A;  3ZSU A;  3VAY A;  1M56 C;  4OIQ F;  4PJM A;  2V3C C;  3DJN B;  4G7O F;  5BUO A;  5KYU B;  1MND A;  3JRT A;  4G7H F;  1VYI A;  2I8B A;  1MMD A;  2A6H F;  2O9X A;  5KYW A;  2G3V A;  2J7P A;  3KMI A;  4DVY P;  4C7O B;  1ZHT A;  3NDB B;  1ZHY A;  3CQZ A;  1RJ9 A;  4CS9 A;  4OIN F;  4U5D E;  3UMI A;  5DQZ A;  1J8Y F;  1O5H A;  1PCX A;  2A69 F;  5KYW B;  4DVZ A;  3EHM A;  3ASN C;  3W8I A;  2Q9C A;  2LSE A;  3OWT A;  2PF4 E;  1VOM A;  3N24 A;  3JSZ A;  1RJ9 B;  4U5B E;  2KGO A;  3EGX A;  3LJB A;  2IXM A;  5CI8 A;  4RD9 A;  3IEE A;  3ZC4 A;  2OCC C;  4OD4 A;  3B9Q A;  3EGX B;  1BR2 A;  2QTV A;  3M1C B;  1FFT C;  1JPN A;  3DZA A;  2E87 A;  4A2N B;  2ZXW C;  5DVW A;  3I5P A;  3LS1 A;  3EZI A;  3Q7G A;  3EGD B;  1TWC A;  4PK4 A;  3UR3 C;  1BR1 A;  2PFD A;  2XXA A;  1N1C A;  1D0Y A;  2XL4 A;  2IXP A;  1IZM A;  3DM5 A;  1Z63 A;  3V7O A;  3WG7 C;  3W2W A;  3LLK A;  2L81 A;  5B1B C;  4BJ5 A;  1WGW A;  2XXA B;  1ZU4 A;  1TWA A;  1SZI A;  3MLG A;  4HEA J;  4JJF A;  1D1C A;  3OA1 A;  4GYT A;  3GOD A;  3LLI A;  2CNW A;  4JUR I;  4CSA A;  2H7B A;  2ZXR A;  1NU9 C;  4G0H A;  4CS7 A;  3DAG A;  4ULW A;  5F5H A;  4QI0 A;  5E33 A;  1QZX A;  4LER A;  1D1B A;  2DGJ A;  2ZXP A;  1NG1 A;  3O6X A;  2WVQ A;  5B1A C;  4F4B A;  3POV A;  4FWV A;  3B0V C;  4LLE A;  2DYS C;  4JW1 A;  1G8X A;  1D0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...