3GORA

Crystal structure of putative metal-dependent hydrolase apc36150
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
157
structure length
157
Chain Sequence
SNAMSRAKKWVQYFLSHRHVTMELIHKIDEAHYDYKPTPTSMTAKQLATHMLFSFYNFANTAKHGDPSLFRQKIEEPETNLAKLAETYTEKTRQLIESMSDDDFDRTLDLTAIFGTQMSTAQFLQLAMDHEIHHKGQLFVYVRGMGHTDLPLFVKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative metal-dependent hydrolase
publication title The structure of DinB from Geobacillus stearothermophilus: a representative of a unique four-helix-bundle superfamily.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
total genus 50
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 3gorA01
3QTHA 2OQMA 3DKAA 5COFA 3DI5A 2QE9A 2OU6A 2NSFA 2F22A 3GORA 2NSGA 3CEXA 5CIVA 2YQYA 2P1AA 5COMA 2QNLA 2RD9A 2HKVA 1RXQA 5COGA 4N6CA
chains in the Genus database with same CATH superfamily
1AEPA 3Q7LA 3V7OA 3QTHA 3LLKA 3B71A 2BL2A 4JZAA 3FAPB 2EIKC 4O6MA 4AL1A 5L0GA 3S0XA 1GGQA 2D4UA 1PCXA 2FFHA 1SF8A 3EQLF 4JCHA 5KYYA 1KNYA 1LS1A 2YL0A 3C8GD 2Q9AA 2R05A 4IJJA 4I1OB 4C3DA 2VASA 1M56C 2L7AA 2EIMC 2HMZA 5CIVA 2ETSA 1OQCA 3CAXA 5COMA 1B68A 1CPQA 2KJGA 1LE4A 2KGOA 1RCPA 4MW8A 4ULVA 2IXPA 3VAYA 3I4UA 2QLAA 2JX0A 2J45A 1ZYRF 4JEBA 4U9EA 5GPGB 1A7VA 3B0VC 3VYWA 5F5FA 4BJ6C 2BE5F 1U6HA 2XLHA 2KK1A 2J46A 3RQEA 2LSEA 4BJ5C 2R9RB 2XXAA 3T6BA 1EI7A 3ABMC 1MMNA 5HV9A 4Z9HA 3DKAA 4CIPA 3IQTA 1OCOC 1VYIA 1XZQA 1XZPA 3N2ZB 1T9KA 4YT5A 5A6BA 3EGXB 3ZVRA 5E3CA 4BJ1A 1BR2A 2I15A 4I3MA 3L8IA 4CX9A 4AE4B 3U2LA 2EPLX 4MVOA 3EPVA 4Q4ZF 3PCVA 3VRCA 1MQVA 2XRHA 1D1BA 3L1MA 3LNRA 4CS9C 1JOGA 4JCZA 4U5DE 4CDYA 2HUJA 3OWTA 2J9VA 4EKWA 3DJUB 1CPRA 3LJBA 3LS1A 4MS2A 3FAJA 4EUKB 5L0FA 1WWPA 4OIQF 2PF4E 2RD9A 1QVXA 3DJNB 4ANJA 5DQZA 3ATPA 2EINC 4CSAC 4EBBA 1WN0A 1ZHXA 2VCAA 4DJ9A 1K40A 1S05A 3EFOB 4IARA 3HKKA 4XPXA 3AG1C 3T6JA 2L6GA 4JTCB 1ORYA 2WZGA 5JLIA 4IWBA 3GM2A 4KNVA 2C03A 2IXMA 2EILC 3EJNA 4JTDB 1J8MF 1I4ZA 2HFIA 3C8GA 4OD4A 1FFHA 2EPKX 2VCCA 3LLIA 4MNDA 2R25A 3ZDLA 1E85A 3EH1A 4KC9A 1RKEB 3L34A 5BUOA 5EGYA 3CEXA 1GS9A 3KKBA 5E3AA 5E33A 1MMAA 5L0DA 1VTMP 4YT4A 2P1AA 3QVZA 4PJMA 2LCHA 3VF0A 4YT2A 4ZLDA 1T5OA 5T3TA 4Q5SF 1Y6DA 4YJWA 1QPUA 3SXYA 2R7RA 3QVYA 4BJTA 1V54C 3I5QA 3NKDA 1YAUO 3T9OA 4QDLA 3ZQYA 2LFFA 5KYUA 4F4BA 3GEHA 1G4US 2WVNA 1S7ZA 2KQ9A 2KSFA 2XL4A 1Z63A 1D0YA 3ZG1A 5KYYB 1E2XA 1EQ1A 4JVSA 4O79A 4YL0A 3IHUA 3SYNA 4KBLA 2P61A 1D0XA 1H6GA 4MVZA 4YL1A 4E0HA 3DXJF 3F46A 2ZXPA 4MVQA 4J7YA 4UDVA 1D1CA 4NQFA 2Q7RA 1UG7A 1ZW2A 2XLWA 4LLEA 4B6IA 4BJ6A 2WB7A 1HMDA 1I5NA 1C02A 1ZHTA 3JZ0A 4K0DA 5D92A 4BJ5A 2VCBA 3JTLO 2J9BA 4U5GA 2VC9A 1PD0A 2HJ3A 5B1AC 1IW7F 3B0PA 3NG1A 2KYHA 3K66A 3UMIA 2ASRA 4J7TA 2XXAB 1H9GA 3FOOA 4E7SA 256BA 1I4YA 2LK4A 4DBRA 3POVA 1CGNA 1K05A 3NMIA 3SEOA 4OIRF 3QW0A 3UMHA 1YDIA 3EH2A 3DE8A 2Y3BA 2NG1A 3CSKA 4HE8D 4OIPF 2O9XA 4CS9A 3HNLA 4Z9IA 3IQ6A 2ZXWC 3H65A 1FFTC 2FAPB 5F28E 1JAFA 2GAQA 3TOMA 2ZXOA 3V5YA 2R7QA 4MVRA 3K6BA 4OD5A 4CSAA 3JRMO 3S28A 3T6GB 1YYJA 4XQ1A 1HW1A 4E7ZA 1YLMA 2OEVA 1G5ZA 2GWWA 1YVIA 3HNKA 4LDKA 5DS5A 4EBJA 4G0HA 3O39A 2QUPA 1LPEA 2R03A 2Q9BA 4AX2A 3DAGA 4J32B 3C8GB 4XPYA 3RYLA 2QTVA 2LFDA 4PFPA 4AK9A 4DBQA 4W8PA 3AOUA 1LKXA 3DMDA 3EHMA 4HFKB 2YRFA 1OKKA 3FVYA 3S29A 4C3EA 4GYTA 3RH3A 4Q7CA 1A7DA 3HLZA 1CGOA 1JPJA 3LEOA 1TWAA 2R7OA 3Q7GA 4BEMJ 2R7WA 5HSWA 4JW1A 4IRUA 4JRZA 3UNGC 5FZTA 4EIYA 2UUHA 2J0WA 3O10A 1YJGA 3GM1A 5L0IA 1R4TA 4M63A 5KYUB 1CGME 3NYLA 2MHRA 2JPUA 4NCQA 2X0CA 5EK0A 3X1OA 3ZTZA 1E86A 2E87A 3RFYA 2R02A 5T1DB 2PBEA 4PACA 3K33A 2G3VA 2Q3TA 2XLEA 5JRAA 2A68F 3AGTA 1MNDA 2J0XA 2WL8A 1NU9C 4N4WA 4JKVA 4O7GA 1UFBA 2CNWA 3C18A 3ABKC 2Y3GA 2YHSA 3C7JA 4A2NB 5F5HA 4LDRA 5KYXA 1LI5A 4AL0A 1N1CA 2PX3A 4C7OA 1M2VA 2P7VA 3A9CA 3U0CA 1WGWA 4H54A 4H4KC 1PD1A 4OINF 1NFOA 1YZAA 2G3KA 2Y39A 2YLDA 3ASOC 2YQYA 3ITFA 2Y3HA 2M4EA 4IGGA 1A0BA 4WJ0A 4Z9JA 3S27A 4KI2A 3Q6MA 4P9FA 1C03A 2P0NA 3LUTB 3AG4C 3H2VA 5DS4A 5K0IA 3S9OA 3ECSA 4JE9A 2GDCA 3N0TA 4XWJA 3ZWIA 5AGFA 2XLVA 4BPMA 2LP4A 2B0HA 3DM5A 1OR2A 1TWHA 2KNHA 2YKZA 4IB4A 3V5ZA 2EPMX 2CDQA 3Q6NA 1QZXA 2CGEA 4A4AA 4LDQA 1ZHZA 1LI7A 4U5EE 3M4BA 1WATA 3IQCA 3WODF 4W8KA 2J9WA 4FAPB 3HJCA 1GQAA 1V4AA 3KH2A 3RIPA 4D4NA 3BEHA 3N24A 4NTFA 1BR1A 1PV3A 4CDVA 2F22A 3AG2C 2YWAA 1Q0DA 2XS1A 4QI2A 2VH3A 1Z6AA 4JEAA 4PR9A 3RVZA 5BQIA 1F1MA 2YZSA 2J7PD 3U9JA 3ZC4A 2W4BA 4EHPA 4LACB 1VLTA 3EZIA 1ORJA 4JIOA 4MTFA 4BG0A 4DRJB 4EWCA 1O5HA 2CCYA 4MVMA 4N6CA 4CS7A 3TULA 2XM4A 4FX5A 5KYWB 1TQGA 3B9QA 1AUEA 2PFDA 4JURI 5DS6A 4G7OF 4U5CE 4XEFA 4DRHB 3W2VA 1A41A 3PHF2 4RDAA 3SXMA 1YZCA 2OQMA 1ORSC 5A69A 3SXZA 4U5HA 3S90A 5CI8A 3LESA 2D5RB 4YL3A 2IYLD 4YK5A 2J9UA 3G50A 2XSEA 1T6QA 3OEOA 3ZSUA 3JCUQ 3NYJA 1TKNA 4PFOA 4PK4A 1Y4CA 1EKYA 2V3CC 2OOCA 2NSGA 4G7HF 3RW0A 1VMAA 1RJ9A 1JRAA 3LAYA 3SZRA 1M57C 1TFOB 1ZZPA 5JSLA 2WZLA 3O6XA 1IZMA 5IY5C 1WTYA 3DD7A 1NU7D 3QMKA 3UR3C 1KU2A 3PMRA 1Z5ZA 3KYIA 3U5SA 4CDAA 2A6HF 2I8BA 4WGYA 5D91A 2IBFA 1J8YF 3K1IA 5KYXB 4DVYP 2YLGA 1NLXA 2G62A 3FXHA 1MMGA 3IEEA 2RSEB 2QY9A 3MYIA 1OCCC 1TWGA 4ONSA 4C7OB 4I44A 1M2VB 3EG9A 2BC5A 3QW1A 2HZ8A 5DVWA 4CJGA 4DRIB 2PNOA 5COFA 1VLSA 2QE9A 1H9TA 1HY5A 3DE9A 1KTMA 1D0ZA 1Q0GA 3R2PA 3ZIBA 2R7TA 4I1MA 5AC5A 2NUPA 2NSFA 1LIHA 1RMVA 3TJ6A 1M6TA 1TR2A 2J7PA 4OIOF 3NKEA 1DOWA 2M64A 4NY3A 3T4RA 4R32A 3AG3C 4XEVA 2HV7A 1L3PA 1SYQA 3B29A 3NMJA 1U0BB 3U3BA 3US6A 3U8VA 3GWLA 2PX0A 2W45A 3GANA 2LD6A 3JYHA 3RKOF 1O3UA 2HKVA 2OKUA 4N06A 3GWNA 3ZTMA 4CS8A 1BDJB 4EBKA 1TFKB 2A6EF 1ZW3A 3QZCA 1V55C 5DLJA 2WZFA 3KMIA 5CI9A 1FAPB 1OXBA 3LS0A 3HNJA 3NRHA 1RKCA 4K7BA 3TOLA 3WG7C 1BZ4A 1LVKA 2R7UA 3FHDA 2Q9CA 5KYNA 1VYKA 5KYWA 3KL4A 2HV6A 2IXNA 1OW8A 3B0UX 2R7XA 5B3SC 5A6BD 1Q0MA 2WVQA 3JT1A 2CW0F 1VB5A 3E70C 4NTBA 2H7BA 3GODA 3A11A 2XLDA 4MQ9F 4XEKA 4HFFB 3FDQA 3GM3A 1E83A 3ABLC 4O6NA 1T01A 4HEAJ 4XLNF 3J06A 2B0JA 3S84A 3CZ6A 3JRTA 1ZU5A 1QLEC 2HJMA 2YL7A 3WAQA 5AC4A 5BQHA 2AWCA 5JUAA 1FMVA 3EGDA 2AVKA 1Z23A 1C17M 2IM8A 1A7EA 2ZXRA 3TQOA 4XLPF 3L0IA 4C3BA 2XM0A 3E9VA 2L9JA 5DQTA 1APCA 1ZHYA 2AP3A 3U8PA 1Z7Qc 3M15A 4U9DA 5JP7A 2XL8A 3FMSA 2W9YA 1RJ9B 3W8HA 3UGOA 3UGPA 4LLCA 2KC3A 2OU6A 4DVZA 2LQGA 3K1IC 1JR8A 1OCZC 2X51A 2XS8A 3TD7A 4E17A 2L81A 2L6FA 5L0JA 2QNLA 2FGYA 3HTKC 3GEEA 1FR0A 1BBHA 2UUIA 3NYMA 1NFNA 2A0BA 2YEVA 3W4YA 4CBEA 4U5BE 1Z3IX 3EG9B 3KYJA 2DGJA 4MTGA 1HMOA 3H2UA 4CJOA 1OR3A 1HW2A 3NMKA 5L0CA 1LE2A 3BRJA 4DOZA 3NDBB 2HS5A 2NUPB 1HE9A 3DAFA 4WGZA 3AQBA 1GM5A 2NPUA 3R7CA 5L0HA 4ZLCA 1MNEA 4YWQA 5JS5A 4DXWA 1ZVZA 3X2QC 1WOLA 2YVKA 1LM3B 2AWYA 4CS8C 2P6VA 2R7SA 2Q00A 4WABA 3OA1A 3SXKA 5L3VA 2R7VA 2W4MA 3W8IA 1K04A 3F47A 3UMKA 1VOMA 4P6IC 4X0RA 2NUTA 2V26A 3AQCA 3ZQVA 3O55A 3U9MA 1XWJA 3C63A 1T6UA 1ZHWA 2EIJC 2MWQA 3IPMO 2A69F 4U5FE 1SZIA 2YLIA 3RQFA 3RF3A 1SMYF 3KPHA 3PDMP 3MX3A 1T6IA 1JMWA 2DB4A 5T3WA 1M2OA 2ZPAA 3JYYA 3K7DA 4P9TA 4JC7A 3JSEO 4J30B 4FWVA 4ULWA 1FNTc 2YL3A 3RQGA 1ZU4A 4GQHA 3WHNA 5BQGA 2DYRC 4QI0A 2JD3A 1VK5A 3DZAA 1OCRC 1G4WR 1W2WA 1YARO 1V74B 2A1DD 2C04A 2OG2A 2XLOA 3ASNC 2HSBA 1QKRA 2VB6A 3G4XA 1JPNA 2LIGA 3JSZA 2H7OA 1AVOB 4N6HA 5B3IA 4XTKA 2YL1A 3SNHA 2CYDA 3EGDB 1FMWA 1OW7A 2Y69C 2OJQA 4CIHA 5FCLA 3VM6A 1NBBA 1ST6A 2ZD9A 3C62A 1RXQA 2OJED 3C8ZA 2MYSA 5COGA 5EHHA 4MTOA 1HE1A 2Z15A 2DYSC 3GEIA 5JT4A 1TWCA 2HSQA 2XL6A 3EHNA 3K1HA 2H8AA 2AU5A 2EPNA 3L8JA 3EZHA 3M4CA 4O6YA 2IOQA 3MBGA 3RVYA 1NG1A 2J8WA 1OKKD 3LNMB 1WASA 2H7VC 1OW6A 1Q0KA 1R5ID 3M79A 4PJLA 4D4XA 5A6AA 3AGUA 3TJ5A 4MW3A 1BR4A 3GORA 4GEHA 3DM9B 2KW3C 2GFHA 5L3QA 1L7CA 3CQZA 1OXKA 3LEVA 4K1OA 1Q0FA 3EGXA 2L6HA 4FESA 5B1BC 1EA8A 3HNIA 4AE4A 4RD9A 1YA7O 2EPOA 4NTAA 2Y3DA 1FTSA 1NZEA 1YYXA 4G7ZF 4ER9A 4PJNA 1SR2A 2ICWG 2PP4A 2IXOA 1E84A 1LS4A 5JVEA 3IQ5A 4LERA 4BEJA 5E2QA 3MYFA 2DI3A 4IAQA 5TJ5E 4MVSA 1NSGB 3DWWA 4JTAB 1QSPA 1MMDA 4JJGA 4PJJA 4MVUA 4RBNA 3DI5A 1O87A 2CNWD 3FOPA 2Q4FA 3I5PA 3EFOA 2NUTB 3AJMA 4JJFA 4L6RA 4G78A 3TK0A 4E0IA 3MFNA 3MLGA 1D1AA 4KNWA 2OEXA 4E18A 5A6JA 3M1CB 2OCCC 2HMQA 1H7IA 4XPWA 4YN0B 3SP1A 2XLMA 2WVOA 1QQ3A 3U3FA 5A6KA 2GA0A 3U2MA 1RKEA 2TMVP 3W2WA 1DOVA 1G8XA 1U89A 2A0UA 4IAOA 4YT8A 4NC3A 1YA9A 3G4ZA 3V5XA
chains in the Genus database with same CATH topology
3QTHA 2OQMA 3DKAA 5COFA 3DI5A 2QE9A 2OU6A 2NSFA 2F22A 3GORA 2NSGA 3CEXA 5CIVA 2YQYA 2P1AA 5COMA 2QNLA 2RD9A 2HKVA 1RXQA 5COGA 4N6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QTH A;  2OQM A;  3DKA A;  5COF A;  3DI5 A;  2QE9 A;  2OU6 A;  2NSF A;  2F22 A;  3GOR A;  2NSG A;  3CEX A;  5CIV A;  2YQY A;  2P1A A;  5COM A;  2QNL A;  2RD9 A;  2HKV A;  1RXQ A;  5COG A;  4N6C A; 
#chains in the Genus database with same CATH topology
 1AEP A;  3Q7L A;  3V7O A;  3QTH A;  3LLK A;  3B71 A;  2BL2 A;  4JZA A;  3FAP B;  2EIK C;  4O6M A;  4AL1 A;  5L0G A;  3S0X A;  1GGQ A;  2D4U A;  1PCX A;  2FFH A;  1SF8 A;  3EQL F;  4JCH A;  5KYY A;  1KNY A;  1LS1 A;  2YL0 A;  3C8G D;  2Q9A A;  2R05 A;  4IJJ A;  4I1O B;  4C3D A;  2VAS A;  1M56 C;  2L7A A;  2EIM C;  2HMZ A;  5CIV A;  2ETS A;  1OQC A;  3CAX A;  5COM A;  1B68 A;  1CPQ A;  2KJG A;  1LE4 A;  2KGO A;  1RCP A;  4MW8 A;  4ULV A;  2IXP A;  3VAY A;  3I4U A;  2QLA A;  2JX0 A;  2J45 A;  1ZYR F;  4JEB A;  4U9E A;  5GPG B;  1A7V A;  3B0V C;  3VYW A;  5F5F A;  4BJ6 C;  2BE5 F;  1U6H A;  2XLH A;  2KK1 A;  2J46 A;  3RQE A;  2LSE A;  4BJ5 C;  2R9R B;  2XXA A;  3T6B A;  1EI7 A;  3ABM C;  1MMN A;  5HV9 A;  4Z9H A;  3DKA A;  4CIP A;  3IQT A;  1OCO C;  1VYI A;  1XZQ A;  1XZP A;  3N2Z B;  1T9K A;  4YT5 A;  5A6B A;  3EGX B;  3ZVR A;  5E3C A;  4BJ1 A;  1BR2 A;  2I15 A;  4I3M A;  3L8I A;  4CX9 A;  4AE4 B;  3U2L A;  2EPL X;  4MVO A;  3EPV A;  4Q4Z F;  3PCV A;  3VRC A;  1MQV A;  2XRH A;  1D1B A;  3L1M A;  3LNR A;  4CS9 C;  1JOG A;  4JCZ A;  4U5D E;  4CDY A;  2HUJ A;  3OWT A;  2J9V A;  4EKW A;  3DJU B;  1CPR A;  3LJB A;  3LS1 A;  4MS2 A;  3FAJ A;  4EUK B;  5L0F A;  1WWP A;  4OIQ F;  2PF4 E;  2RD9 A;  1QVX A;  3DJN B;  4ANJ A;  5DQZ A;  3ATP A;  2EIN C;  4CSA C;  4EBB A;  1WN0 A;  1ZHX A;  2VCA A;  4DJ9 A;  1K40 A;  1S05 A;  3EFO B;  4IAR A;  3HKK A;  4XPX A;  3AG1 C;  3T6J A;  2L6G A;  4JTC B;  1ORY A;  2WZG A;  5JLI A;  4IWB A;  3GM2 A;  4KNV A;  2C03 A;  2IXM A;  2EIL C;  3EJN A;  4JTD B;  1J8M F;  1I4Z A;  2HFI A;  3C8G A;  4OD4 A;  1FFH A;  2EPK X;  2VCC A;  3LLI A;  4MND A;  2R25 A;  3ZDL A;  1E85 A;  3EH1 A;  4KC9 A;  1RKE B;  3L34 A;  5BUO A;  5EGY A;  3CEX A;  1GS9 A;  3KKB A;  5E3A A;  5E33 A;  1MMA A;  5L0D A;  1VTM P;  4YT4 A;  2P1A A;  3QVZ A;  4PJM A;  2LCH A;  3VF0 A;  4YT2 A;  4ZLD A;  1T5O A;  5T3T A;  4Q5S F;  1Y6D A;  4YJW A;  1QPU A;  3SXY A;  2R7R A;  3QVY A;  4BJT A;  1V54 C;  3I5Q A;  3NKD A;  1YAU O;  3T9O A;  4QDL A;  3ZQY A;  2LFF A;  5KYU A;  4F4B A;  3GEH A;  1G4U S;  2WVN A;  1S7Z A;  2KQ9 A;  2KSF A;  2XL4 A;  1Z63 A;  1D0Y A;  3ZG1 A;  5KYY B;  1E2X A;  1EQ1 A;  4JVS A;  4O79 A;  4YL0 A;  3IHU A;  3SYN A;  4KBL A;  2P61 A;  1D0X A;  1H6G A;  4MVZ A;  4YL1 A;  4E0H A;  3DXJ F;  3F46 A;  2ZXP A;  4MVQ A;  4J7Y A;  4UDV A;  1D1C A;  4NQF A;  2Q7R A;  1UG7 A;  1ZW2 A;  2XLW A;  4LLE A;  4B6I A;  4BJ6 A;  2WB7 A;  1HMD A;  1I5N A;  1C02 A;  1ZHT A;  3JZ0 A;  4K0D A;  5D92 A;  4BJ5 A;  2VCB A;  3JTL O;  2J9B A;  4U5G A;  2VC9 A;  1PD0 A;  2HJ3 A;  5B1A C;  1IW7 F;  3B0P A;  3NG1 A;  2KYH A;  3K66 A;  3UMI A;  2ASR A;  4J7T A;  2XXA B;  1H9G A;  3FOO A;  4E7S A;  256B A;  1I4Y A;  2LK4 A;  4DBR A;  3POV A;  1CGN A;  1K05 A;  3NMI A;  3SEO A;  4OIR F;  3QW0 A;  3UMH A;  1YDI A;  3EH2 A;  3DE8 A;  2Y3B A;  2NG1 A;  3CSK A;  4HE8 D;  4OIP F;  2O9X A;  4CS9 A;  3HNL A;  4Z9I A;  3IQ6 A;  2ZXW C;  3H65 A;  1FFT C;  2FAP B;  5F28 E;  1JAF A;  2GAQ A;  3TOM A;  2ZXO A;  3V5Y A;  2R7Q A;  4MVR A;  3K6B A;  4OD5 A;  4CSA A;  3JRM O;  3S28 A;  3T6G B;  1YYJ A;  4XQ1 A;  1HW1 A;  4E7Z A;  1YLM A;  2OEV A;  1G5Z A;  2GWW A;  1YVI A;  3HNK A;  4LDK A;  5DS5 A;  4EBJ A;  4G0H A;  3O39 A;  2QUP A;  1LPE A;  2R03 A;  2Q9B A;  4AX2 A;  3DAG A;  4J32 B;  3C8G B;  4XPY A;  3RYL A;  2QTV A;  2LFD A;  4PFP A;  4AK9 A;  4DBQ A;  4W8P A;  3AOU A;  1LKX A;  3DMD A;  3EHM A;  4HFK B;  2YRF A;  1OKK A;  3FVY A;  3S29 A;  4C3E A;  4GYT A;  3RH3 A;  4Q7C A;  1A7D A;  3HLZ A;  1CGO A;  1JPJ A;  3LEO A;  1TWA A;  2R7O A;  3Q7G A;  4BEM J;  2R7W A;  5HSW A;  4JW1 A;  4IRU A;  4JRZ A;  3UNG C;  5FZT A;  4EIY A;  2UUH A;  2J0W A;  3O10 A;  1YJG A;  3GM1 A;  5L0I A;  1R4T A;  4M63 A;  5KYU B;  1CGM E;  3NYL A;  2MHR A;  2JPU A;  4NCQ A;  2X0C A;  5EK0 A;  3X1O A;  3ZTZ A;  1E86 A;  2E87 A;  3RFY A;  2R02 A;  5T1D B;  2PBE A;  4PAC A;  3K33 A;  2G3V A;  2Q3T A;  2XLE A;  5JRA A;  2A68 F;  3AGT A;  1MND A;  2J0X A;  2WL8 A;  1NU9 C;  4N4W A;  4JKV A;  4O7G A;  1UFB A;  2CNW A;  3C18 A;  3ABK C;  2Y3G A;  2YHS A;  3C7J A;  4A2N B;  5F5H A;  4LDR A;  5KYX A;  1LI5 A;  4AL0 A;  1N1C A;  2PX3 A;  4C7O A;  1M2V A;  2P7V A;  3A9C A;  3U0C A;  1WGW A;  4H54 A;  4H4K C;  1PD1 A;  4OIN F;  1NFO A;  1YZA A;  2G3K A;  2Y39 A;  2YLD A;  3ASO C;  2YQY A;  3ITF A;  2Y3H A;  2M4E A;  4IGG A;  1A0B A;  4WJ0 A;  4Z9J A;  3S27 A;  4KI2 A;  3Q6M A;  4P9F A;  1C03 A;  2P0N A;  3LUT B;  3AG4 C;  3H2V A;  5DS4 A;  5K0I A;  3S9O A;  3ECS A;  4JE9 A;  2GDC A;  3N0T A;  4XWJ A;  3ZWI A;  5AGF A;  2XLV A;  4BPM A;  2LP4 A;  2B0H A;  3DM5 A;  1OR2 A;  1TWH A;  2KNH A;  2YKZ A;  4IB4 A;  3V5Z A;  2EPM X;  2CDQ A;  3Q6N A;  1QZX A;  2CGE A;  4A4A A;  4LDQ A;  1ZHZ A;  1LI7 A;  4U5E E;  3M4B A;  1WAT A;  3IQC A;  3WOD F;  4W8K A;  2J9W A;  4FAP B;  3HJC A;  1GQA A;  1V4A A;  3KH2 A;  3RIP A;  4D4N A;  3BEH A;  3N24 A;  4NTF A;  1BR1 A;  1PV3 A;  4CDV A;  2F22 A;  3AG2 C;  2YWA A;  1Q0D A;  2XS1 A;  4QI2 A;  2VH3 A;  1Z6A A;  4JEA A;  4PR9 A;  3RVZ A;  5BQI A;  1F1M A;  2YZS A;  2J7P D;  3U9J A;  3ZC4 A;  2W4B A;  4EHP A;  4LAC B;  1VLT A;  3EZI A;  1ORJ A;  4JIO A;  4MTF A;  4BG0 A;  4DRJ B;  4EWC A;  1O5H A;  2CCY A;  4MVM A;  4N6C A;  4CS7 A;  3TUL A;  2XM4 A;  4FX5 A;  5KYW B;  1TQG A;  3B9Q A;  1AUE A;  2PFD A;  4JUR I;  5DS6 A;  4G7O F;  4U5C E;  4XEF A;  4DRH B;  3W2V A;  1A41 A;  3PHF 2;  4RDA A;  3SXM A;  1YZC A;  2OQM A;  1ORS C;  5A69 A;  3SXZ A;  4U5H A;  3S90 A;  5CI8 A;  3LES A;  2D5R B;  4YL3 A;  2IYL D;  4YK5 A;  2J9U A;  3G50 A;  2XSE A;  1T6Q A;  3OEO A;  3ZSU A;  3JCU Q;  3NYJ A;  1TKN A;  4PFO A;  4PK4 A;  1Y4C A;  1EKY A;  2V3C C;  2OOC A;  2NSG A;  4G7H F;  3RW0 A;  1VMA A;  1RJ9 A;  1JRA A;  3LAY A;  3SZR A;  1M57 C;  1TFO B;  1ZZP A;  5JSL A;  2WZL A;  3O6X A;  1IZM A;  5IY5 C;  1WTY A;  3DD7 A;  1NU7 D;  3QMK A;  3UR3 C;  1KU2 A;  3PMR A;  1Z5Z A;  3KYI A;  3U5S A;  4CDA A;  2A6H F;  2I8B A;  4WGY A;  5D91 A;  2IBF A;  1J8Y F;  3K1I A;  5KYX B;  4DVY P;  2YLG A;  1NLX A;  2G62 A;  3FXH A;  1MMG A;  3IEE A;  2RSE B;  2QY9 A;  3MYI A;  1OCC C;  1TWG A;  4ONS A;  4C7O B;  4I44 A;  1M2V B;  3EG9 A;  2BC5 A;  3QW1 A;  2HZ8 A;  5DVW A;  4CJG A;  4DRI B;  2PNO A;  5COF A;  1VLS A;  2QE9 A;  1H9T A;  1HY5 A;  3DE9 A;  1KTM A;  1D0Z A;  1Q0G A;  3R2P A;  3ZIB A;  2R7T A;  4I1M A;  5AC5 A;  2NUP A;  2NSF A;  1LIH A;  1RMV A;  3TJ6 A;  1M6T A;  1TR2 A;  2J7P A;  4OIO F;  3NKE A;  1DOW A;  2M64 A;  4NY3 A;  3T4R A;  4R32 A;  3AG3 C;  4XEV A;  2HV7 A;  1L3P A;  1SYQ A;  3B29 A;  3NMJ A;  1U0B B;  3U3B A;  3US6 A;  3U8V A;  3GWL A;  2PX0 A;  2W45 A;  3GAN A;  2LD6 A;  3JYH A;  3RKO F;  1O3U A;  2HKV A;  2OKU A;  4N06 A;  3GWN A;  3ZTM A;  4CS8 A;  1BDJ B;  4EBK A;  1TFK B;  2A6E F;  1ZW3 A;  3QZC A;  1V55 C;  5DLJ A;  2WZF A;  3KMI A;  5CI9 A;  1FAP B;  1OXB A;  3LS0 A;  3HNJ A;  3NRH A;  1RKC A;  4K7B A;  3TOL A;  3WG7 C;  1BZ4 A;  1LVK A;  2R7U A;  3FHD A;  2Q9C A;  5KYN A;  1VYK A;  5KYW A;  3KL4 A;  2HV6 A;  2IXN A;  1OW8 A;  3B0U X;  2R7X A;  5B3S C;  5A6B D;  1Q0M A;  2WVQ A;  3JT1 A;  2CW0 F;  1VB5 A;  3E70 C;  4NTB A;  2H7B A;  3GOD A;  3A11 A;  2XLD A;  4MQ9 F;  4XEK A;  4HFF B;  3FDQ A;  3GM3 A;  1E83 A;  3ABL C;  4O6N A;  1T01 A;  4HEA J;  4XLN F;  3J06 A;  2B0J A;  3S84 A;  3CZ6 A;  3JRT A;  1ZU5 A;  1QLE C;  2HJM A;  2YL7 A;  3WAQ A;  5AC4 A;  5BQH A;  2AWC A;  5JUA A;  1FMV A;  3EGD A;  2AVK A;  1Z23 A;  1C17 M;  2IM8 A;  1A7E A;  2ZXR A;  3TQO A;  4XLP F;  3L0I A;  4C3B A;  2XM0 A;  3E9V A;  2L9J A;  5DQT A;  1APC A;  1ZHY A;  2AP3 A;  3U8P A;  1Z7Q c;  3M15 A;  4U9D A;  5JP7 A;  2XL8 A;  3FMS A;  2W9Y A;  1RJ9 B;  3W8H A;  3UGO A;  3UGP A;  4LLC A;  2KC3 A;  2OU6 A;  4DVZ A;  2LQG A;  3K1I C;  1JR8 A;  1OCZ C;  2X51 A;  2XS8 A;  3TD7 A;  4E17 A;  2L81 A;  2L6F A;  5L0J A;  2QNL A;  2FGY A;  3HTK C;  3GEE A;  1FR0 A;  1BBH A;  2UUI A;  3NYM A;  1NFN A;  2A0B A;  2YEV A;  3W4Y A;  4CBE A;  4U5B E;  1Z3I X;  3EG9 B;  3KYJ A;  2DGJ A;  4MTG A;  1HMO A;  3H2U A;  4CJO A;  1OR3 A;  1HW2 A;  3NMK A;  5L0C A;  1LE2 A;  3BRJ A;  4DOZ A;  3NDB B;  2HS5 A;  2NUP B;  1HE9 A;  3DAF A;  4WGZ A;  3AQB A;  1GM5 A;  2NPU A;  3R7C A;  5L0H A;  4ZLC A;  1MNE A;  4YWQ A;  5JS5 A;  4DXW A;  1ZVZ A;  3X2Q C;  1WOL A;  2YVK A;  1LM3 B;  2AWY A;  4CS8 C;  2P6V A;  2R7S A;  2Q00 A;  4WAB A;  3OA1 A;  3SXK A;  5L3V A;  2R7V A;  2W4M A;  3W8I A;  1K04 A;  3F47 A;  3UMK A;  1VOM A;  4P6I C;  4X0R A;  2NUT A;  2V26 A;  3AQC A;  3ZQV A;  3O55 A;  3U9M A;  1XWJ A;  3C63 A;  1T6U A;  1ZHW A;  2EIJ C;  2MWQ A;  3IPM O;  2A69 F;  4U5F E;  1SZI A;  2YLI A;  3RQF A;  3RF3 A;  1SMY F;  3KPH A;  3PDM P;  3MX3 A;  1T6I A;  1JMW A;  2DB4 A;  5T3W A;  1M2O A;  2ZPA A;  3JYY A;  3K7D A;  4P9T A;  4JC7 A;  3JSE O;  4J30 B;  4FWV A;  4ULW A;  1FNT c;  2YL3 A;  3RQG A;  1ZU4 A;  4GQH A;  3WHN A;  5BQG A;  2DYR C;  4QI0 A;  2JD3 A;  1VK5 A;  3DZA A;  1OCR C;  1G4W R;  1W2W A;  1YAR O;  1V74 B;  2A1D D;  2C04 A;  2OG2 A;  2XLO A;  3ASN C;  2HSB A;  1QKR A;  2VB6 A;  3G4X A;  1JPN A;  2LIG A;  3JSZ A;  2H7O A;  1AVO B;  4N6H A;  5B3I A;  4XTK A;  2YL1 A;  3SNH A;  2CYD A;  3EGD B;  1FMW A;  1OW7 A;  2Y69 C;  2OJQ A;  4CIH A;  5FCL A;  3VM6 A;  1NBB A;  1ST6 A;  2ZD9 A;  3C62 A;  1RXQ A;  2OJE D;  3C8Z A;  2MYS A;  5COG A;  5EHH A;  4MTO A;  1HE1 A;  2Z15 A;  2DYS C;  3GEI A;  5JT4 A;  1TWC A;  2HSQ A;  2XL6 A;  3EHN A;  3K1H A;  2H8A A;  2AU5 A;  2EPN A;  3L8J A;  3EZH A;  3M4C A;  4O6Y A;  2IOQ A;  3MBG A;  3RVY A;  1NG1 A;  2J8W A;  1OKK D;  3LNM B;  1WAS A;  2H7V C;  1OW6 A;  1Q0K A;  1R5I D;  3M79 A;  4PJL A;  4D4X A;  5A6A A;  3AGU A;  3TJ5 A;  4MW3 A;  1BR4 A;  3GOR A;  4GEH A;  3DM9 B;  2KW3 C;  2GFH A;  5L3Q A;  1L7C A;  3CQZ A;  1OXK A;  3LEV A;  4K1O A;  1Q0F A;  3EGX A;  2L6H A;  4FES A;  5B1B C;  1EA8 A;  3HNI A;  4AE4 A;  4RD9 A;  1YA7 O;  2EPO A;  4NTA A;  2Y3D A;  1FTS A;  1NZE A;  1YYX A;  4G7Z F;  4ER9 A;  4PJN A;  1SR2 A;  2ICW G;  2PP4 A;  2IXO A;  1E84 A;  1LS4 A;  5JVE A;  3IQ5 A;  4LER A;  4BEJ A;  5E2Q A;  3MYF A;  2DI3 A;  4IAQ A;  5TJ5 E;  4MVS A;  1NSG B;  3DWW A;  4JTA B;  1QSP A;  1MMD A;  4JJG A;  4PJJ A;  4MVU A;  4RBN A;  3DI5 A;  1O87 A;  2CNW D;  3FOP A;  2Q4F A;  3I5P A;  3EFO A;  2NUT B;  3AJM A;  4JJF A;  4L6R A;  4G78 A;  3TK0 A;  4E0I A;  3MFN A;  3MLG A;  1D1A A;  4KNW A;  2OEX A;  4E18 A;  5A6J A;  3M1C B;  2OCC C;  2HMQ A;  1H7I A;  4XPW A;  4YN0 B;  3SP1 A;  2XLM A;  2WVO A;  1QQ3 A;  3U3F A;  5A6K A;  2GA0 A;  3U2M A;  1RKE A;  2TMV P;  3W2W A;  1DOV A;  1G8X A;  1U89 A;  2A0U A;  4IAO A;  4YT8 A;  4NC3 A;  1YA9 A;  3G4Z A;  3V5X A; 
#chains in the Genus database with same CATH homology
 3QTH A;  2OQM A;  3DKA A;  5COF A;  3DI5 A;  2QE9 A;  2OU6 A;  2NSF A;  2F22 A;  3GOR A;  2NSG A;  3CEX A;  5CIV A;  2YQY A;  2P1A A;  5COM A;  2QNL A;  2RD9 A;  2HKV A;  1RXQ A;  5COG A;  4N6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...