3GORA

Crystal structure of putative metal-dependent hydrolase apc36150
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
157
structure length
157
Chain Sequence
SNAMSRAKKWVQYFLSHRHVTMELIHKIDEAHYDYKPTPTSMTAKQLATHMLFSFYNFANTAKHGDPSLFRQKIEEPETNLAKLAETYTEKTRQLIESMSDDDFDRTLDLTAIFGTQMSTAQFLQLAMDHEIHHKGQLFVYVRGMGHTDLPLFVKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative metal-dependent hydrolase
publication title The structure of DinB from Geobacillus stearothermophilus: a representative of a unique four-helix-bundle superfamily.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
total genus 50
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 3gorA01
5COMA 3QTHA 3DI5A 2OQMA 2YQYA 2QNLA 3DKAA 1RXQA 4N6CA 2RD9A 2QE9A 2HKVA 3CEXA 2F22A 2OU6A 2P1AA 2NSGA 3GORA 5CIVA 5COGA 2NSFA 5COFA
chains in the Genus database with same CATH superfamily
5KYXA 3DE8A 4BJ5A 1QPUA 1PCXA 2J9UA 3DI5A 4U5DE 4ZLDA 2KJGA 3HKKA 4CX9A 3LS0A 4K1OA 3DWWA 1PD0A 3LS1A 4NTFA 4XQ1A 1G5ZA 2XLWA 4KNVA 3U3BA 4AL0A 2EINC 4Q4ZF 2PFDA 4CS7A 2OJED 5FZTA 3IQTA 4F4BA 1VK5A 3I4UA 4CDAA 3UGPA 3O10A 1HW2A 1L7CA 1NU7D 1KNYA 3IPMO 4MVUA 4D4XA 4WJ0A 3ZWIA 3O55A 1E83A 4ANJA 1WOLA 3AQCA 3EQLF 5BQHA 4PJMA 3ECSA 2DI3A 2HZ8A 2Q9BA 1YLMA 2OG2A 2D4UA 1ZW3A 2GFHA 3SNHA 1GS9A 1SF8A 1S05A 2QTVA 4U5EE 2R7VA 3EGDA 3NDBB 1A7DA 2XS1A 4AE4A 4BJTA 1AVOB 3CQZA 2P7VA 3GANA 3T9OA 4BJ1A 2HJ3A 3FDQA 3B0VC 3JRTA 1OKKA 1F1MA 2OJQA 2XLVA 1K05A 2AVKA 1M6TA 2LSEA 4YL0A 1I4YA 4YN0B 3LLIA 3AG3C 1A7EA 1HY5A 1ORJA 1NFOA 3L1MA 3V5ZA 4DVYP 4U5FE 3S29A 5AC4A 2R7SA 3T4RA 1D0XA 4LLEA 2XRHA 1E2XA 3PHF2 3PMRA 2OOCA 2F22A 2M4EA 1NU9C 3BRJA 3N2ZB 4OD5A 1YAUO 2GWWA 5KYWA 4E18A 2YVKA 2IXOA 3HNIA 2JD3A 4YJWA 2C04A 2W4BA 2WZLA 3QVYA 2HUJA 4MVRA 3AGUA 4MVOA 2ETSA 2NSFA 3R2PA 4IGGA 3RVYA 4NTAA 1CGME 2BL2A 1FMVA 4FESA 1LPEA 2MYSA 3MLGA 3EHNA 4O79A 3QTHA 5E3CA 3HNKA 3ABLC 2KQ9A 1Q0FA 4YT4A 3H2UA 2XL6A 2R25A 1Z23A 4R32A 4P6IC 4XWJA 5L0JA 4N06A 3TULA 1TR2A 3FOPA 4K7BA 4JKVA 5DS6A 4HE8D 3QZCA 1E85A 3NYLA 3EFOB 2L6GA 3HNLA 1Z7Qc 3JSZA 1B68A 3KKBA 4IB4A 1ZHWA 3IHUA 2HMQA 3C8GD 3FOOA 3CSKA 1NG1A 2VC9A 4Q7CA 2EPNA 2P6VA 4BJ6C 5L0FA 5A69A 2YL0A 4WGZA 1FFTC 2LD6A 5L3QA 2H7OA 4YT2A 1YYXA 3KYJA 4XEKA 3TD7A 4BJ5C 4DBRA 2Y3GA 3S9OA 1CPQA 2KSFA 3NMIA 3HTKC 3VF0A 2BE5F 4PR9A 3U2LA 2NUTA 3R7CA 1UG7A 5L0HA 3TJ6A 3SXZA 2EILC 4O6NA 4OIQF 2XSEA 3DM9B 2XXAA 1OXBA 1XWJA 4N6HA 4DXWA 4RBNA 5DQZA 3L0IA 2IXNA 5JT4A 2Q4FA 3T6GB 1OW7A 5JSLA 2L7AA 2NUPB 3C63A 1T9KA 2B0HA 4PFOA 1M2VA 4JEAA 1EQ1A 1Z6AA 4I44A 4EBJA 1A41A 2CGEA 2E87A 4MW3A 1LI7A 2KGOA 2J9BA 2YL7A 3S90A 3QW1A 4PACA 2WVNA 2R9RB 2QUPA 3U8VA 4YT8A 4ULWA 4P9TA 4KBLA 5E2QA 3VRCA 4K0DA 4CS9A 4I1MA 4EIYA 2LCHA 2OEVA 2R05A 4EBBA 2P1AA 2Q3TA 3ATPA 3B9QA 1YA7O 3X1OA 1TWGA 2GA0A 4L6RA 1ZU5A 4QI0A 4C3DA 4I1OB 4EKWA 1QLEC 2YLDA 3JCUQ 4G0HA 1YARO 3SYNA 4EUKB 2W9YA 3TJ5A 3V5XA 2XLOA 1T6QA 3LLKA 3UR3C 5DQTA 5KYUB 3N24A 3QW0A 2HV6A 2LQGA 2YL1A 1TWCA 4JVSA 2DB4A 4Z9HA 3ZDLA 2R7XA 3JT1A 1JPNA 1N1CA 3N0TA 5T3WA 4CIPA 3C8GA 3F47A 3PDMP 1J8MF 4X0RA 1RJ9B 4H54A 4E7SA 2YLIA 2YHSA 1JMWA 2LFFA 3FMSA 1TQGA 2OCCC 4OIOF 3RIPA 3DMDA 3IQCA 2PP4A 1EKYA 4YL1A 5JUAA 1ZYRF 3GEEA 3S0XA 1WASA 3GM2A 1LI5A 4DRJB 4MVSA 3ASOC 3QVZA 3RQFA 4YWQA 4J32B 3JYYA 3LJBA 2A0UA 4JJGA 1WWPA 1LKXA 1M2OA 2LP4A 3AG4C 3WAQA 2OEXA 2R03A 3W8HA 1T6UA 1ZHYA 3EGXA 4Z9JA 1FAPB 5L0IA 1VOMA 3ZQVA 4W8KA 2YRFA 4HFKB 1LS1A 3LUTB 3RFYA 3JZ0A 1HW1A 3FXHA 3DZAA 1GM5A 1MNDA 1CGNA 5KYNA 2NG1A 2PX3A 2DYSC 5L3VA 2CNWD 3K66A 1IW7F 3AQBA 3LNRA 4CSAA 4YL3A 3U9MA 4D4NA 1Z5ZA 4XEFA 5KYYA 1Z3IX 4NQFA 5AC5A 2HSQA 3JRMO 3S28A 4EHPA 4MVZA 4C3BA 2IXPA 5BUOA 2V3CC 3KL4A 2UUIA 3ZQYA 3GM1A 3E70C 2Q9AA 3VM6A 3UGOA 1PV3A 2VASA 2VCAA 3L8JA 4XLNF 1H7IA 1G4WR 2WVOA 1D1AA 4JW1A 3RQEA 4YT5A 1JAFA 1XZQA 5EHHA 1BZ4A 5HV9A 5B3SC 3TQOA 3KPHA 3VAYA 1VLSA 2KYHA 2WB7A 3FHDA 3MYFA 1WN0A 5D91A 5L0GA 1WATA 2HJMA 2PBEA 3EGDB 4CS9C 5T3TA 3US6A 2J9VA 3LEVA 3U5SA 4BEMJ 3FAPB 4CBEA 2LFDA 1BBHA 3AOUA 3DKAA 3LAYA 3MFNA 4WGYA 1W2WA 2J0WA 2RD9A 3DM5A 3ZTZA 3GEIA 3WG7C 3S84A 4JURI 1QQ3A 4XLPF 1WGWA 3JTLO 3GORA 3LNMB 1T6IA 1T5OA 1YVIA 1D0YA 1YYJA 4CDYA 3M4BA 5IY5C 2EPLX 5KYWB 2AWCA 5B1AC 5JRAA 3PCVA 4C7OB 2RSEB 3M15A 5E33A 3T6BA 4FWVA 1O5HA 3EZHA 4J7TA 4JE9A 2UUHA 3I5PA 2CNWA 4CDVA 3K7DA 4IAQA 3U0CA 5DS5A 3B29A 2WL8A 4C3EA 2X51A 1U6HA 2Q00A 4IARA 2G3KA 4MTOA 3WODF 2A68F 2JPUA 3W4YA 1VB5A 3Q6NA 4E0IA 2R7UA 2J0XA 2PF4E 1Q0DA 2ZXRA 2O9XA 3CAXA 4MVMA 2IBFA 3OWTA 1QVXA 4NC3A 2IYLD 1C02A 4XEVA 1SMYF 4G7HF 3M4CA 2CCYA 1QSPA 2Y3HA 4JRZA 1AEPA 2ZD9A 3M79A 4MTGA 4JZAA 2PNOA 2YEVA 2H7VC 1KTMA 1V55C 4LDKA 5JVEA 4BPMA 1LM3B 4PJNA 4DJ9A 1R4TA 4U5BE 1V54C 2XS8A 1MMGA 3K6BA 4J30B 3K1HA 1IZMA 4AK9A 2TMVP 3GWLA 2XM4A 4G7ZF 4LACB 1FMWA 1CGOA 1OR3A 2YL3A 1Y6DA 3EFOA 2NUTB 2XLMA 3LESA 1DOVA 1ORYA 3T6JA 4CSAC 4P9FA 2XXAB 3NKEA 4E17A 5FCLA 4OINF 2YZSA 3EH2A 4MNDA 1GQAA 4MS2A 1BR1A 4DVZA 1FR0A 1TFKB 5EGYA 5A6BD 4Q5SF 1MNEA 1TWAA 2HKVA 2QLAA 2WVQA 1D1CA 1RCPA 5F28E 3MBGA 3SXMA 5L0CA 1OR2A 1QZXA 2P61A 3KYIA 4IWBA 1JOGA 3KH2A 1BR4A 1ZVZA 2FFHA 3HLZA 2R7RA 4GYTA 5COGA 4JC7A 2EIJC 1D0ZA 3RYLA 4IRUA 2EPOA 2D5RB 2GDCA 1ORSC 1OCZC 4PJJA 2AP3A 4A4AA 3NYMA 3JSEO 1LS4A 5L0DA 3C7JA 4QI2A 3GODA 3UMHA 4YK5A 1LIHA 2A6HF 4U5GA 3HJCA 1YZCA 3BEHA 4IAOA 1YDIA 5A6JA 1Q0GA 3C8GB 4HEAJ 3KMIA 1O3UA 1LE4A 3K33A 3QMKA 3J06A 2XM0A 3AG1C 2ASRA 1LVKA 1H9GA 5K0IA 2KNHA 2ZXOA 2VCCA 5CI8A 3EG9B 4XPYA 1TWHA 2OKUA 4JTAB 3Q7GA 5KYUA 4E0HA 1EA8A 2JX0A 1ZHTA 2V26A 3NRHA 3Q7LA 3Q6MA 5B1BC 3SZRA 4BEJA 1G4US 1NSGB 1OQCA 1QKRA 4OIRF 3B0UX 4ZLCA 2LIGA 1R5ID 1RJ9A 4DRIB 3DJNB 3RVZA 1NZEA 2J46A 2QY9A 3A9CA 3ZTMA 2C03A 5A6BA 3FAJA 3TK0A 4E7ZA 4GQHA 3EPVA 4JEBA 1RKEB 3DAGA 1TKNA 2IM8A 3TOMA 1OW6A 3U9JA 1ZU4A 1FTSA 5KYXB 1Y4CA 4NCQA 5B3IA 3UMKA 2Y69C 4ONSA 1APCA 2J7PD 4MQ9F 4I3MA 4MTFA 2FGYA 3CEXA 3UMIA 2M64A 3IEEA 4B6IA 4DBQA 1Z63A 4U5CE 2J45A 2Z15A 3G4ZA 1H9TA 2AWYA 1ZW2A 4CJOA 2IXMA 5DS4A 4JTDB 4XPXA 5D92A 4RDAA 2GAQA 5JLIA 5EK0A 3O6XA 1E84A 2EIKC 2XLHA 3C62A 3GM3A 1CPRA 3ZC4A 2L81A 5A6AA 5COMA 1O87A 1JRAA 3K1IA 2YWAA 1FNTc 1RMVA 1YZAA 3NMKA 3DD7A 2OQMA 1E86A 2L6HA 4U9EA 3RQGA 5F5HA 1XZPA 2MWQA 4O7GA 2J8WA 4AE4B 2HMZA 1RKCA 1BDJB 3NG1A 1JPJA 1OCCC 3M1CB 4UDVA 4JJFA 4JCHA 1MMAA 1C03A 3V7OA 4XTKA 5T1DB 2A69F 2WZFA 2OU6A 1K04A 1SZIA 3MYIA 4IJJA 4OD4A 2PX0A 1Q0KA 2CYDA 4N4WA 3RF3A 3W8IA 256BA 1M56C 3NYJA 3NKDA 5A6KA 4G78A 2B0JA 2P0NA 2YKZA 4WABA 2HS5A 1OCRC 3DAFA 3EJNA 5JS5A 1H6GA 3LEOA 3ZVRA 1PD1A 3L34A 3H2VA 1FFHA 2J7PA 3SP1A 4Z9IA 1MMNA 3B0PA 2J9WA 2A1DD 2EIMC 2I8BA 3F46A 1YJGA 3JYHA 4BG0A 4CIHA 2ZXWC 4AX2A 3DJUB 3G50A 3UNGC 1KU2A 2IOQA 1JR8A 1YA9A 4H4KC 1VYIA 2DYRC 2I15A 1U89A 3DXJF 2KW3C 2Q9CA 1HMOA 1NLXA 1GGQA 3CZ6A 2ICWG 2QE9A 4O6MA 4G7OF 4OIPF 1A0BA 2CDQA 4CS8A 4C7OA 1OCOC 5CI9A 2ZXPA 3V5YA 2LK4A 4EWCA 2L9JA 3O39A 3H65A 3WHNA 2HFIA 3ZSUA 3C18A 5HSWA 2VB6A 1V74B 2KC3A 1MMDA 2L6FA 1ZHZA 2A6EF 3RW0A 3S27A 3U3FA 3EH1A 4JIOA 1I5NA 2EPMX 2Y39A 4ER9A 4M63A 2VH3A 3ZG1A 2Q7RA 4U5HA 4PFPA 5BQIA 4LLCA 2YQYA 4NTBA 2R7OA 4CJGA 1SR2A 2YLGA 2CW0F 1ZZPA 1SYQA 3FVYA 2G62A 1RXQA 4LERA 3TOLA 3L8IA 5DVWA 3ASNC 1M2VB 1J8YF 1M57C 2NSGA 1D1BA 1WTYA 4KNWA 2A0BA 3IQ5A 4GEHA 3IQ6A 3U8PA 1S7ZA 4KC9A 3AJMA 3X2QC 3K1IC 3GEHA 4EBKA 1NBBA 5TJ5E 1HE1A 1Q0MA 3E9VA 2NUPA 3POVA 4DOZA 2KK1A 3G4XA 2R7QA 4FAPB 2H8AA 4FX5A 4HFFB 1VYKA 4J7YA 2W45A 4N6CA 2ZPAA 2FAPB 4A2NB 1U0BB 2W4MA 5E3AA 4AL1A 3MX3A 2DGJA 2BC5A 2WZGA 1HE9A 3SXYA 1MQVA 1ZHXA 3NMJA 4DRHB 2NPUA 3DE9A 3SEOA 3W2WA 4KI2A 5F5FA 3GWNA 1BR2A 3A11A 1VTMP 1ST6A 3B71A 2HV7A 1NFNA 2VCBA 4MVQA 5AGFA 1TFOB 5GPGB 1VLTA 2XLEA 2R7TA 1G8XA 5COFA 3ABMC 1OW8A 4JTCB 4MW8A 4O6YA 2H7BA 4RD9A 3EGXB 4U9DA 1L3PA 3RH3A 3RKOF 1DOWA 2X0CA 1HMDA 1I4ZA 1AUEA 2Y3DA 1LE2A 3ABKC 3AG2C 3VYWA 2QNLA 2MHRA 4PK4A 1A7VA 2XL8A 4CS8C 2R7WA 3EG9A 1EI7A 3C8ZA 3OA1A 2EPKX 4QDLA 5JP7A 3SXKA 4ULVA 1K40A 3ZIBA 3ITFA 3EZIA 2AU5A 1V4AA 1VMAA 3HNJA 1OKKD 4LDRA 5BQGA 5DLJA 1UFBA 2Y3BA 5CIVA 3U2MA 2G3VA 3AGTA 1OXKA 3EHMA 2XLDA 4LDQA 4PJLA 5KYYB 4XPWA 3W2VA 2HSBA 3I5QA 1T01A 4BJ6A 1RKEA 1C17M 2XL4A 2R02A 4W8PA 4JCZA 3OEOA 4NY3A
chains in the Genus database with same CATH topology
5COMA 3QTHA 3DI5A 2OQMA 2YQYA 2QNLA 3DKAA 1RXQA 4N6CA 2RD9A 2QE9A 2HKVA 3CEXA 2F22A 2OU6A 2P1AA 2NSGA 3GORA 5CIVA 5COGA 2NSFA 5COFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5COM A;  3QTH A;  3DI5 A;  2OQM A;  2YQY A;  2QNL A;  3DKA A;  1RXQ A;  4N6C A;  2RD9 A;  2QE9 A;  2HKV A;  3CEX A;  2F22 A;  2OU6 A;  2P1A A;  2NSG A;  3GOR A;  5CIV A;  5COG A;  2NSF A;  5COF A; 
#chains in the Genus database with same CATH topology
 5KYX A;  3DE8 A;  4BJ5 A;  1QPU A;  1PCX A;  2J9U A;  3DI5 A;  4U5D E;  4ZLD A;  2KJG A;  3HKK A;  4CX9 A;  3LS0 A;  4K1O A;  3DWW A;  1PD0 A;  3LS1 A;  4NTF A;  4XQ1 A;  1G5Z A;  2XLW A;  4KNV A;  3U3B A;  4AL0 A;  2EIN C;  4Q4Z F;  2PFD A;  4CS7 A;  2OJE D;  5FZT A;  3IQT A;  4F4B A;  1VK5 A;  3I4U A;  4CDA A;  3UGP A;  3O10 A;  1HW2 A;  1L7C A;  1NU7 D;  1KNY A;  3IPM O;  4MVU A;  4D4X A;  4WJ0 A;  3ZWI A;  3O55 A;  1E83 A;  4ANJ A;  1WOL A;  3AQC A;  3EQL F;  5BQH A;  4PJM A;  3ECS A;  2DI3 A;  2HZ8 A;  2Q9B A;  1YLM A;  2OG2 A;  2D4U A;  1ZW3 A;  2GFH A;  3SNH A;  1GS9 A;  1SF8 A;  1S05 A;  2QTV A;  4U5E E;  2R7V A;  3EGD A;  3NDB B;  1A7D A;  2XS1 A;  4AE4 A;  4BJT A;  1AVO B;  3CQZ A;  2P7V A;  3GAN A;  3T9O A;  4BJ1 A;  2HJ3 A;  3FDQ A;  3B0V C;  3JRT A;  1OKK A;  1F1M A;  2OJQ A;  2XLV A;  1K05 A;  2AVK A;  1M6T A;  2LSE A;  4YL0 A;  1I4Y A;  4YN0 B;  3LLI A;  3AG3 C;  1A7E A;  1HY5 A;  1ORJ A;  1NFO A;  3L1M A;  3V5Z A;  4DVY P;  4U5F E;  3S29 A;  5AC4 A;  2R7S A;  3T4R A;  1D0X A;  4LLE A;  2XRH A;  1E2X A;  3PHF 2;  3PMR A;  2OOC A;  2F22 A;  2M4E A;  1NU9 C;  3BRJ A;  3N2Z B;  4OD5 A;  1YAU O;  2GWW A;  5KYW A;  4E18 A;  2YVK A;  2IXO A;  3HNI A;  2JD3 A;  4YJW A;  2C04 A;  2W4B A;  2WZL A;  3QVY A;  2HUJ A;  4MVR A;  3AGU A;  4MVO A;  2ETS A;  2NSF A;  3R2P A;  4IGG A;  3RVY A;  4NTA A;  1CGM E;  2BL2 A;  1FMV A;  4FES A;  1LPE A;  2MYS A;  3MLG A;  3EHN A;  4O79 A;  3QTH A;  5E3C A;  3HNK A;  3ABL C;  2KQ9 A;  1Q0F A;  4YT4 A;  3H2U A;  2XL6 A;  2R25 A;  1Z23 A;  4R32 A;  4P6I C;  4XWJ A;  5L0J A;  4N06 A;  3TUL A;  1TR2 A;  3FOP A;  4K7B A;  4JKV A;  5DS6 A;  4HE8 D;  3QZC A;  1E85 A;  3NYL A;  3EFO B;  2L6G A;  3HNL A;  1Z7Q c;  3JSZ A;  1B68 A;  3KKB A;  4IB4 A;  1ZHW A;  3IHU A;  2HMQ A;  3C8G D;  3FOO A;  3CSK A;  1NG1 A;  2VC9 A;  4Q7C A;  2EPN A;  2P6V A;  4BJ6 C;  5L0F A;  5A69 A;  2YL0 A;  4WGZ A;  1FFT C;  2LD6 A;  5L3Q A;  2H7O A;  4YT2 A;  1YYX A;  3KYJ A;  4XEK A;  3TD7 A;  4BJ5 C;  4DBR A;  2Y3G A;  3S9O A;  1CPQ A;  2KSF A;  3NMI A;  3HTK C;  3VF0 A;  2BE5 F;  4PR9 A;  3U2L A;  2NUT A;  3R7C A;  1UG7 A;  5L0H A;  3TJ6 A;  3SXZ A;  2EIL C;  4O6N A;  4OIQ F;  2XSE A;  3DM9 B;  2XXA A;  1OXB A;  1XWJ A;  4N6H A;  4DXW A;  4RBN A;  5DQZ A;  3L0I A;  2IXN A;  5JT4 A;  2Q4F A;  3T6G B;  1OW7 A;  5JSL A;  2L7A A;  2NUP B;  3C63 A;  1T9K A;  2B0H A;  4PFO A;  1M2V A;  4JEA A;  1EQ1 A;  1Z6A A;  4I44 A;  4EBJ A;  1A41 A;  2CGE A;  2E87 A;  4MW3 A;  1LI7 A;  2KGO A;  2J9B A;  2YL7 A;  3S90 A;  3QW1 A;  4PAC A;  2WVN A;  2R9R B;  2QUP A;  3U8V A;  4YT8 A;  4ULW A;  4P9T A;  4KBL A;  5E2Q A;  3VRC A;  4K0D A;  4CS9 A;  4I1M A;  4EIY A;  2LCH A;  2OEV A;  2R05 A;  4EBB A;  2P1A A;  2Q3T A;  3ATP A;  3B9Q A;  1YA7 O;  3X1O A;  1TWG A;  2GA0 A;  4L6R A;  1ZU5 A;  4QI0 A;  4C3D A;  4I1O B;  4EKW A;  1QLE C;  2YLD A;  3JCU Q;  4G0H A;  1YAR O;  3SYN A;  4EUK B;  2W9Y A;  3TJ5 A;  3V5X A;  2XLO A;  1T6Q A;  3LLK A;  3UR3 C;  5DQT A;  5KYU B;  3N24 A;  3QW0 A;  2HV6 A;  2LQG A;  2YL1 A;  1TWC A;  4JVS A;  2DB4 A;  4Z9H A;  3ZDL A;  2R7X A;  3JT1 A;  1JPN A;  1N1C A;  3N0T A;  5T3W A;  4CIP A;  3C8G A;  3F47 A;  3PDM P;  1J8M F;  4X0R A;  1RJ9 B;  4H54 A;  4E7S A;  2YLI A;  2YHS A;  1JMW A;  2LFF A;  3FMS A;  1TQG A;  2OCC C;  4OIO F;  3RIP A;  3DMD A;  3IQC A;  2PP4 A;  1EKY A;  4YL1 A;  5JUA A;  1ZYR F;  3GEE A;  3S0X A;  1WAS A;  3GM2 A;  1LI5 A;  4DRJ B;  4MVS A;  3ASO C;  3QVZ A;  3RQF A;  4YWQ A;  4J32 B;  3JYY A;  3LJB A;  2A0U A;  4JJG A;  1WWP A;  1LKX A;  1M2O A;  2LP4 A;  3AG4 C;  3WAQ A;  2OEX A;  2R03 A;  3W8H A;  1T6U A;  1ZHY A;  3EGX A;  4Z9J A;  1FAP B;  5L0I A;  1VOM A;  3ZQV A;  4W8K A;  2YRF A;  4HFK B;  1LS1 A;  3LUT B;  3RFY A;  3JZ0 A;  1HW1 A;  3FXH A;  3DZA A;  1GM5 A;  1MND A;  1CGN A;  5KYN A;  2NG1 A;  2PX3 A;  2DYS C;  5L3V A;  2CNW D;  3K66 A;  1IW7 F;  3AQB A;  3LNR A;  4CSA A;  4YL3 A;  3U9M A;  4D4N A;  1Z5Z A;  4XEF A;  5KYY A;  1Z3I X;  4NQF A;  5AC5 A;  2HSQ A;  3JRM O;  3S28 A;  4EHP A;  4MVZ A;  4C3B A;  2IXP A;  5BUO A;  2V3C C;  3KL4 A;  2UUI A;  3ZQY A;  3GM1 A;  3E70 C;  2Q9A A;  3VM6 A;  3UGO A;  1PV3 A;  2VAS A;  2VCA A;  3L8J A;  4XLN F;  1H7I A;  1G4W R;  2WVO A;  1D1A A;  4JW1 A;  3RQE A;  4YT5 A;  1JAF A;  1XZQ A;  5EHH A;  1BZ4 A;  5HV9 A;  5B3S C;  3TQO A;  3KPH A;  3VAY A;  1VLS A;  2KYH A;  2WB7 A;  3FHD A;  3MYF A;  1WN0 A;  5D91 A;  5L0G A;  1WAT A;  2HJM A;  2PBE A;  3EGD B;  4CS9 C;  5T3T A;  3US6 A;  2J9V A;  3LEV A;  3U5S A;  4BEM J;  3FAP B;  4CBE A;  2LFD A;  1BBH A;  3AOU A;  3DKA A;  3LAY A;  3MFN A;  4WGY A;  1W2W A;  2J0W A;  2RD9 A;  3DM5 A;  3ZTZ A;  3GEI A;  3WG7 C;  3S84 A;  4JUR I;  1QQ3 A;  4XLP F;  1WGW A;  3JTL O;  3GOR A;  3LNM B;  1T6I A;  1T5O A;  1YVI A;  1D0Y A;  1YYJ A;  4CDY A;  3M4B A;  5IY5 C;  2EPL X;  5KYW B;  2AWC A;  5B1A C;  5JRA A;  3PCV A;  4C7O B;  2RSE B;  3M15 A;  5E33 A;  3T6B A;  4FWV A;  1O5H A;  3EZH A;  4J7T A;  4JE9 A;  2UUH A;  3I5P A;  2CNW A;  4CDV A;  3K7D A;  4IAQ A;  3U0C A;  5DS5 A;  3B29 A;  2WL8 A;  4C3E A;  2X51 A;  1U6H A;  2Q00 A;  4IAR A;  2G3K A;  4MTO A;  3WOD F;  2A68 F;  2JPU A;  3W4Y A;  1VB5 A;  3Q6N A;  4E0I A;  2R7U A;  2J0X A;  2PF4 E;  1Q0D A;  2ZXR A;  2O9X A;  3CAX A;  4MVM A;  2IBF A;  3OWT A;  1QVX A;  4NC3 A;  2IYL D;  1C02 A;  4XEV A;  1SMY F;  4G7H F;  3M4C A;  2CCY A;  1QSP A;  2Y3H A;  4JRZ A;  1AEP A;  2ZD9 A;  3M79 A;  4MTG A;  4JZA A;  2PNO A;  2YEV A;  2H7V C;  1KTM A;  1V55 C;  4LDK A;  5JVE A;  4BPM A;  1LM3 B;  4PJN A;  4DJ9 A;  1R4T A;  4U5B E;  1V54 C;  2XS8 A;  1MMG A;  3K6B A;  4J30 B;  3K1H A;  1IZM A;  4AK9 A;  2TMV P;  3GWL A;  2XM4 A;  4G7Z F;  4LAC B;  1FMW A;  1CGO A;  1OR3 A;  2YL3 A;  1Y6D A;  3EFO A;  2NUT B;  2XLM A;  3LES A;  1DOV A;  1ORY A;  3T6J A;  4CSA C;  4P9F A;  2XXA B;  3NKE A;  4E17 A;  5FCL A;  4OIN F;  2YZS A;  3EH2 A;  4MND A;  1GQA A;  4MS2 A;  1BR1 A;  4DVZ A;  1FR0 A;  1TFK B;  5EGY A;  5A6B D;  4Q5S F;  1MNE A;  1TWA A;  2HKV A;  2QLA A;  2WVQ A;  1D1C A;  1RCP A;  5F28 E;  3MBG A;  3SXM A;  5L0C A;  1OR2 A;  1QZX A;  2P61 A;  3KYI A;  4IWB A;  1JOG A;  3KH2 A;  1BR4 A;  1ZVZ A;  2FFH A;  3HLZ A;  2R7R A;  4GYT A;  5COG A;  4JC7 A;  2EIJ C;  1D0Z A;  3RYL A;  4IRU A;  2EPO A;  2D5R B;  2GDC A;  1ORS C;  1OCZ C;  4PJJ A;  2AP3 A;  4A4A A;  3NYM A;  3JSE O;  1LS4 A;  5L0D A;  3C7J A;  4QI2 A;  3GOD A;  3UMH A;  4YK5 A;  1LIH A;  2A6H F;  4U5G A;  3HJC A;  1YZC A;  3BEH A;  4IAO A;  1YDI A;  5A6J A;  1Q0G A;  3C8G B;  4HEA J;  3KMI A;  1O3U A;  1LE4 A;  3K33 A;  3QMK A;  3J06 A;  2XM0 A;  3AG1 C;  2ASR A;  1LVK A;  1H9G A;  5K0I A;  2KNH A;  2ZXO A;  2VCC A;  5CI8 A;  3EG9 B;  4XPY A;  1TWH A;  2OKU A;  4JTA B;  3Q7G A;  5KYU A;  4E0H A;  1EA8 A;  2JX0 A;  1ZHT A;  2V26 A;  3NRH A;  3Q7L A;  3Q6M A;  5B1B C;  3SZR A;  4BEJ A;  1G4U S;  1NSG B;  1OQC A;  1QKR A;  4OIR F;  3B0U X;  4ZLC A;  2LIG A;  1R5I D;  1RJ9 A;  4DRI B;  3DJN B;  3RVZ A;  1NZE A;  2J46 A;  2QY9 A;  3A9C A;  3ZTM A;  2C03 A;  5A6B A;  3FAJ A;  3TK0 A;  4E7Z A;  4GQH A;  3EPV A;  4JEB A;  1RKE B;  3DAG A;  1TKN A;  2IM8 A;  3TOM A;  1OW6 A;  3U9J A;  1ZU4 A;  1FTS A;  5KYX B;  1Y4C A;  4NCQ A;  5B3I A;  3UMK A;  2Y69 C;  4ONS A;  1APC A;  2J7P D;  4MQ9 F;  4I3M A;  4MTF A;  2FGY A;  3CEX A;  3UMI A;  2M64 A;  3IEE A;  4B6I A;  4DBQ A;  1Z63 A;  4U5C E;  2J45 A;  2Z15 A;  3G4Z A;  1H9T A;  2AWY A;  1ZW2 A;  4CJO A;  2IXM A;  5DS4 A;  4JTD B;  4XPX A;  5D92 A;  4RDA A;  2GAQ A;  5JLI A;  5EK0 A;  3O6X A;  1E84 A;  2EIK C;  2XLH A;  3C62 A;  3GM3 A;  1CPR A;  3ZC4 A;  2L81 A;  5A6A A;  5COM A;  1O87 A;  1JRA A;  3K1I A;  2YWA A;  1FNT c;  1RMV A;  1YZA A;  3NMK A;  3DD7 A;  2OQM A;  1E86 A;  2L6H A;  4U9E A;  3RQG A;  5F5H A;  1XZP A;  2MWQ A;  4O7G A;  2J8W A;  4AE4 B;  2HMZ A;  1RKC A;  1BDJ B;  3NG1 A;  1JPJ A;  1OCC C;  3M1C B;  4UDV A;  4JJF A;  4JCH A;  1MMA A;  1C03 A;  3V7O A;  4XTK A;  5T1D B;  2A69 F;  2WZF A;  2OU6 A;  1K04 A;  1SZI A;  3MYI A;  4IJJ A;  4OD4 A;  2PX0 A;  1Q0K A;  2CYD A;  4N4W A;  3RF3 A;  3W8I A;  256B A;  1M56 C;  3NYJ A;  3NKD A;  5A6K A;  4G78 A;  2B0J A;  2P0N A;  2YKZ A;  4WAB A;  2HS5 A;  1OCR C;  3DAF A;  3EJN A;  5JS5 A;  1H6G A;  3LEO A;  3ZVR A;  1PD1 A;  3L34 A;  3H2V A;  1FFH A;  2J7P A;  3SP1 A;  4Z9I A;  1MMN A;  3B0P A;  2J9W A;  2A1D D;  2EIM C;  2I8B A;  3F46 A;  1YJG A;  3JYH A;  4BG0 A;  4CIH A;  2ZXW C;  4AX2 A;  3DJU B;  3G50 A;  3UNG C;  1KU2 A;  2IOQ A;  1JR8 A;  1YA9 A;  4H4K C;  1VYI A;  2DYR C;  2I15 A;  1U89 A;  3DXJ F;  2KW3 C;  2Q9C A;  1HMO A;  1NLX A;  1GGQ A;  3CZ6 A;  2ICW G;  2QE9 A;  4O6M A;  4G7O F;  4OIP F;  1A0B A;  2CDQ A;  4CS8 A;  4C7O A;  1OCO C;  5CI9 A;  2ZXP A;  3V5Y A;  2LK4 A;  4EWC A;  2L9J A;  3O39 A;  3H65 A;  3WHN A;  2HFI A;  3ZSU A;  3C18 A;  5HSW A;  2VB6 A;  1V74 B;  2KC3 A;  1MMD A;  2L6F A;  1ZHZ A;  2A6E F;  3RW0 A;  3S27 A;  3U3F A;  3EH1 A;  4JIO A;  1I5N A;  2EPM X;  2Y39 A;  4ER9 A;  4M63 A;  2VH3 A;  3ZG1 A;  2Q7R A;  4U5H A;  4PFP A;  5BQI A;  4LLC A;  2YQY A;  4NTB A;  2R7O A;  4CJG A;  1SR2 A;  2YLG A;  2CW0 F;  1ZZP A;  1SYQ A;  3FVY A;  2G62 A;  1RXQ A;  4LER A;  3TOL A;  3L8I A;  5DVW A;  3ASN C;  1M2V B;  1J8Y F;  1M57 C;  2NSG A;  1D1B A;  1WTY A;  4KNW A;  2A0B A;  3IQ5 A;  4GEH A;  3IQ6 A;  3U8P A;  1S7Z A;  4KC9 A;  3AJM A;  3X2Q C;  3K1I C;  3GEH A;  4EBK A;  1NBB A;  5TJ5 E;  1HE1 A;  1Q0M A;  3E9V A;  2NUP A;  3POV A;  4DOZ A;  2KK1 A;  3G4X A;  2R7Q A;  4FAP B;  2H8A A;  4FX5 A;  4HFF B;  1VYK A;  4J7Y A;  2W45 A;  4N6C A;  2ZPA A;  2FAP B;  4A2N B;  1U0B B;  2W4M A;  5E3A A;  4AL1 A;  3MX3 A;  2DGJ A;  2BC5 A;  2WZG A;  1HE9 A;  3SXY A;  1MQV A;  1ZHX A;  3NMJ A;  4DRH B;  2NPU A;  3DE9 A;  3SEO A;  3W2W A;  4KI2 A;  5F5F A;  3GWN A;  1BR2 A;  3A11 A;  1VTM P;  1ST6 A;  3B71 A;  2HV7 A;  1NFN A;  2VCB A;  4MVQ A;  5AGF A;  1TFO B;  5GPG B;  1VLT A;  2XLE A;  2R7T A;  1G8X A;  5COF A;  3ABM C;  1OW8 A;  4JTC B;  4MW8 A;  4O6Y A;  2H7B A;  4RD9 A;  3EGX B;  4U9D A;  1L3P A;  3RH3 A;  3RKO F;  1DOW A;  2X0C A;  1HMD A;  1I4Z A;  1AUE A;  2Y3D A;  1LE2 A;  3ABK C;  3AG2 C;  3VYW A;  2QNL A;  2MHR A;  4PK4 A;  1A7V A;  2XL8 A;  4CS8 C;  2R7W A;  3EG9 A;  1EI7 A;  3C8Z A;  3OA1 A;  2EPK X;  4QDL A;  5JP7 A;  3SXK A;  4ULV A;  1K40 A;  3ZIB A;  3ITF A;  3EZI A;  2AU5 A;  1V4A A;  1VMA A;  3HNJ A;  1OKK D;  4LDR A;  5BQG A;  5DLJ A;  1UFB A;  2Y3B A;  5CIV A;  3U2M A;  2G3V A;  3AGT A;  1OXK A;  3EHM A;  2XLD A;  4LDQ A;  4PJL A;  5KYY B;  4XPW A;  3W2V A;  2HSB A;  3I5Q A;  1T01 A;  4BJ6 A;  1RKE A;  1C17 M;  2XL4 A;  2R02 A;  4W8P A;  4JCZ A;  3OEO A;  4NY3 A; 
#chains in the Genus database with same CATH homology
 5COM A;  3QTH A;  3DI5 A;  2OQM A;  2YQY A;  2QNL A;  3DKA A;  1RXQ A;  4N6C A;  2RD9 A;  2QE9 A;  2HKV A;  3CEX A;  2F22 A;  2OU6 A;  2P1A A;  2NSG A;  3GOR A;  5CIV A;  5COG A;  2NSF A;  5COF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...