3GORA

Crystal structure of putative metal-dependent hydrolase apc36150
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
157
structure length
157
Chain Sequence
b'SNAMSRAKKWVQYFLSHRHVTMELIHKIDEAHYDYKPTPTSMTAKQLATHMLFSFYNFANTAKHGDPSLFRQKIEEPETNLAKLAETYTEKTRQLIESMSDDDFDRTLDLTAIFGTQMSTAQFLQLAMDHEIHHKGQLFVYVRGMGHTDLPLFVKRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative metal-dependent hydrolase
publication title The structure of DinB from Geobacillus stearothermophilus: a representative of a unique four-helix-bundle superfamily.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
total genus 50
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 3gorA01
5CIVA 2F22A 3DI5A 2OU6A 2QE9A 2YQYA 5COFA 3DKAA 3GORA 3QTHA 2QNLA 3CEXA 2NSGA 2NSFA 4N6CA 2P1AA 2RD9A 5COGA 5COMA 1RXQA 2OQMA 2HKVA
chains in the Genus database with same CATH superfamily
4JVSA 3C18A 1JRAA 4MVMA 2CCYA 1JR8A 3F47A 1J8MF 3NYJA 3HNIA 4K0DA 3RKOF 3LNRA 3ECSA 2A0UA 2L6FA 2XL4A 1Q0GA 4WGYA 1GQAA 1V55C 4NC3A 1RJ9A 1K05A 4YL0A 4NY3A 3DKAA 4IB4A 1M57C 1M2OA 5DQZA 4BJTA 1YZAA 3B0UX 2EILC 4BJ1A 3K7DA 5D92A 3PHF2 1CPRA 2YL3A 3IQ6A 3N2ZB 5K0IA 1Q0DA 1A0BA 5JUAA 3E70C 3TD7A 3NMKA 1MQVA 3TULA 1Z6AA 2CW0F 3FAJA 2R02A 3NKDA 3SP1A 3A9CA 1APCA 4Z9IA 2GWWA 1QZXA 2R7WA 5DS5A 2J8WA 3Q6MA 1YYJA 2R03A 1JAFA 1NBBA 2I8BA 2HFIA 4IJJA 3W2VA 1R5ID 2WL8A 1I5NA 1QKRA 1S05A 3GWNA 2NUPA 4MW3A 3ABKC 3POVA 1UG7A 1ORJA 2VCAA 3JRMO 2Y3HA 3GEEA 1L7CA 3JT1A 2QE9A 1YZCA 2A1DD 4CS8C 4JE9A 1QSPA 4OINF 4PJMA 4BJ6C 4FAPB 2R25A 4LDQA 1VOMA 2HJ3A 3T4RA 2V3CC 2FGYA 2WZFA 2YL0A 1YLMA 2XLWA 3ZTMA 2KQ9A 4MNDA 4CBEA 1G5ZA 1NG1A 4U5CE 5KYNA 2QLAA 2NSFA 3JYYA 1BR4A 2VC9A 1XWJA 1A7DA 4JTAB 2Y3BA 2PX3A 4U5GA 5COGA 4AE4B 1TWAA 2FFHA 3H2VA 2V26A 1PD1A 2OJQA 3DMDA 2XXAA 4C3EA 4DJ9A 2AVKA 4MW8A 2J7PA 3O10A 4XEFA 3TJ6A 1H9TA 4OIPF 1Z3IX 3SXYA 5A69A 1A7EA 1Q0KA 2L81A 5L3QA 2HS5A 1NSGB 2KW3C 1FR0A 1BBHA 1M56C 2MWQA 3U5SA 4G78A 1E85A 2QNLA 2J9BA 2CYDA 1T6UA 1LPEA 2XRHA 3EGXB 4WJ0A 4MVUA 3R7CA 4HFKB 4JJGA 1TFKB 4O6MA 4A4AA 4CS9C 2QY9A 1ZHZA 2IBFA 4KC9A 3GODA 1ZHYA 3B0VC 4U5DE 2XLMA 1YYXA 4KBLA 4YJWA 5JLIA 1WOLA 1SZIA 3FHDA 3LEVA 3M1CB 5A6KA 2EINC 1HE1A 2JX0A 1DOVA 1QPUA 5JT4A 1VYKA 1BDJB 2OG2A 2YEVA 3QW1A 4LLEA 4EUKB 3O6XA 4BJ5A 1U6HA 2LP4A 4M63A 3X2QC 4CDVA 4FESA 1LS1A 3U0CA 3U3BA 2EIMC 2J9UA 4K7BA 1Z63A 4E17A 4F4BA 4ER9A 3L1MA 1ZHWA 2HUJA 3V5XA 3EH2A 4K1OA 4QDLA 2NUTB 1HMOA 3HNLA 2C03A 3U2MA 3NMIA 5DS4A 3FXHA 4AE4A 4XPYA 3UGOA 1MNDA 1F1MA 5HSWA 1FFTC 2BL2A 1TFOB 2WVOA 1T01A 2CNWD 3G4ZA 3KYIA 4KNVA 1HW2A 3JRTA 1ORYA 2A6EF 3TQOA 4YT2A 4NTFA 2J46A 2GA0A 1D0YA 1CGNA 3OEOA 2RD9A 1RKEB 2ETSA 3X1OA 5L0IA 2H8AA 4CIPA 1EA8A 3U2LA 4CSAC 4E18A 1YA9A 5CI8A 3C8ZA 4O7GA 3RIPA 1H7IA 3SNHA 3EH1A 3ABLC 2EPOA 1XZPA 3MFNA 4QI0A 5EK0A 1ST6A 1OR3A 2XS1A 4NTBA 1E83A 1MMNA 1YVIA 4C3DA 4PFOA 2W4BA 3U8VA 1BR2A 5EHHA 3TOMA 3C8GD 5KYXA 3L8IA 1V74B 1CPQA 3EGDB 4U5FE 4DRHB 4LLCA 4O6NA 2J0WA 2R7VA 1RKCA 1UFBA 3CEXA 2JPUA 4U5EE 4U9DA 1S7ZA 2DGJA 4GQHA 4P9FA 2LCHA 4CDYA 1NLXA 3M79A 2NG1A 4AX2A 3DAGA 3OA1A 4BG0A 4DRJB 3SYNA 4CJGA 2NPUA 1TWCA 1E86A 4CDAA 1TKNA 1MMDA 4C7OA 3RH3A 4CX9A 4LERA 3UR3C 1C17M 2ZPAA 3IQ5A 3LESA 4MVQA 4IARA 2EPNA 4D4NA 4ULVA 2NUTA 4D4XA 3DD7A 1Q0FA 5D91A 3MLGA 3UGPA 2XLVA 3U3FA 2VH3A 3DAFA 1YAUO 4P6IC 2PF4E 2PX0A 2LFFA 4PK4A 5COFA 3GORA 5CI9A 1ZW2A 2Q4FA 4BEMJ 1WN0A 5JVEA 3ZQYA 1CGME 1O5HA 4JC7A 4XLPF 4J32B 1RKEA 3R2PA 5KYUB 3FOOA 3J06A 3ZTZA 5JS5A 1GM5A 1OR2A 5DQTA 3RFYA 2Y39A 1MMAA 2VB6A 3RYLA 2WZLA 3W4YA 4Z9HA 4NCQA 2YLGA 3AQCA 2P1AA 3C62A 2YZSA 3M15A 3LUTB 2JD3A 5F28E 1RXQA 3DM5A 4PFPA 1M2VA 2Q9CA 2YLIA 3LNMB 3WODF 2PFDA 4YN0B 3C7JA 5AGFA 4JTCB 2YHSA 1VYIA 3LLKA 2DI3A 4MTFA 3C8GB 1XZQA 3DI5A 3IPMO 2GDCA 4G7ZF 3EGDA 1HMDA 3AG3C 4MS2A 3NMJA 1FTSA 1LVKA 3DZAA 1EQ1A 4GEHA 4DOZA 2GAQA 4NQFA 1TWHA 3I5PA 2PNOA 3DWWA 3EHMA 1OCOC 2DYRC 4C3BA 1K04A 5B1AC 5A6BD 2VCBA 2HV7A 2NSGA 3O39A 1VMAA 2R7OA 3I5QA 3KL4A 4J30B 3RQEA 2KC3A 4PACA 4H54A 1JPNA 4N6CA 4EBBA 5EGYA 2Y69C 1WASA 1BR1A 1GGQA 4O79A 1EKYA 2ZXPA 3ATPA 1V4AA 2KGOA 2CNWA 2AWCA 3HKKA 4YL1A 3EJNA 4BJ5C 4JRZA 3B29A 5KYUA 1LKXA 4MTGA 1HW1A 1ZU4A 4JCZA 2G3KA 3PCVA 4E7ZA 3NDBB 4JZAA 2YRFA 3DXJF 3I4UA 3ITFA 1I4YA 1LI5A 5BQGA 1Y4CA 1OKKD 1SF8A 3K1IC 4EBJA 2EIKC 1T5OA 1E84A 4YK5A 1T6QA 1W2WA 1AEPA 4MVOA 2ZXOA 4GYTA 5B1BC 3BEHA 4EHPA 4ZLDA 2OEXA 5TJ5E 1T9KA 1A41A 3SXKA 2C04A 1KNYA 3KH2A 4JJFA 3L8JA 2ASRA 2RSEB 3WAQA 1V54C 3RQGA 1O3UA 1OQCA 4EIYA 3Q6NA 2YL1A 4Q7CA 1LI7A 3LS0A 2OU6A 2ZD9A 3MBGA 3EPVA 3RW0A 1IZMA 5BUOA 4UDVA 1C03A 4OIOF 3GM2A 4Q5SF 4EWCA 2H7BA 1FMWA 2Q7RA 3S9OA 5F5FA 3VAYA 3IEEA 1OW8A 5KYWB 5L0CA 1FFHA 1TQGA 3DE9A 3L34A 3GM3A 3NYMA 1LS4A 3UMIA 3LEOA 4J7YA 4YT4A 3MYFA 2OJED 4BPMA 3JZ0A 4JIOA 2LK4A 1AVOB 1EI7A 2XLOA 4X0RA 2HMZA 3U9JA 256BA 2A68F 3FVYA 5JSLA 5B3SC 5IY5C 4MTOA 3F46A 2BC5A 4JURI 1WTYA 2EPLX 3QW0A 3K33A 1G8XA 1N1CA 3UNGC 1Y6DA 4MQ9F 2OQMA 1JMWA 1RCPA 4XQ1A 4XPXA 5FZTA 3WG7C 4N06A 2VCCA 5CIVA 1ZZPA 1QQ3A 3O55A 2Z15A 3HTKC 4OD4A 2IOQA 5T3TA 4QI2A 3EGXA 1HE9A 2MYSA 1ZHTA 1TR2A 1QVXA 2KJGA 3CAXA 2XM0A 3W2WA 5A6JA 5GPGB 3QTHA 2W9YA 1MNEA 3AG1C 1VLTA 3S27A 4G7HF 3A11A 3B0PA 3NG1A 4XLNF 3ZC4A 4B6IA 2J9WA 2A69F 2O9XA 3C63A 4LDRA 3UMKA 4MVSA 1YA7O 1TWGA 3ZSUA 2J7PD 4JEAA 4LACB 4N6HA 2D5RB 4DVZA 2YVKA 2ZXRA 4HE8D 5L3VA 3N0TA 3VRCA 1CGOA 2LSEA 3CZ6A 5A6BA 2OEVA 2OKUA 3SEOA 4BEJA 2HJMA 2XSEA 4IRUA 5L0GA 2LFDA 2HMQA 3EG9B 3HNJA 3ZIBA 4IGGA 2P7VA 5KYWA 3LJBA 2XS8A 3T6BA 2LD6A 2M64A 2ZXWC 3VYWA 4XEVA 2CGEA 2KK1A 1GS9A 3ZQVA 3SZRA 4NTAA 2YQYA 4C7OB 3ZWIA 1ZYRF 1M6TA 2MHRA 4IWBA 4L6RA 3IQCA 4CJOA 2FAPB 4OIRF 2OOCA 4MVZA 2EPMX 2IXPA 2L6HA 1D1BA 3HLZA 3CQZA 5DVWA 3BRJA 1NU9C 2G3VA 3H65A 4P9TA 4W8KA 4DRIB 2ICWG 2P0NA 4DXWA 1E2XA 1KU2A 4IAOA 4MVRA 4PJJA 1D1AA 2Y3GA 4CSAA 1DOWA 5T1DB 4XEKA 3K1HA 5AC4A 2LIGA 5L0FA 4O6YA 2YLDA 3CSKA 2R7QA 3B71A 2XL8A 3T9OA 1K40A 2Q9BA 4W8PA 4XTKA 4JW1A 1G4WR 4YL3A 1KTMA 2A0BA 3KPHA 3ZG1A 1OXBA 2UUIA 2XLEA 2QUPA 5L0JA 1VB5A 3VM6A 5B3IA 2XXAB 2J0XA 3DJUB 1LM3B 3JTLO 2HV6A 1PD0A 4U9EA 4XPWA 4H4KC 1D0XA 3GEIA 4YWQA 2R7TA 2YWAA 4JCHA 2J45A 1U89A 2Q3TA 4JKVA 3UMHA 3S84A 4DBRA 3EG9A 2WZGA 5FCLA 5L0HA 1SYQA 1ZW3A 3G50A 1L3PA 4ZLCA 2G62A 2TMVP 3N24A 5COMA 2H7VC 2P61A 1JPJA 3LS1A 3AJMA 4LDKA 4Z9JA 4U5BE 1YJGA 2J9VA 4WGZA 3US6A 3ZDLA 2L7AA 4AL0A 2F22A 1H6GA 3U8PA 4E7SA 2R05A 2L9JA 3VF0A 2IYLD 4YT8A 3V5ZA 3JCUQ 2WVNA 3AQBA 4RD9A 3TK0A 1I4ZA 3PMRA 4KI2A 3V5YA 4YT5A 1OW7A 1G4US 2L6GA 3QVYA 3L0IA 3MYIA 3JSZA 3RVYA 1VK5A 1WGWA 1ZU5A 1VLSA 1FAPB 2R7RA 1RMVA 3RVZA 5F5HA 3T6JA 4FX5A 2OCCC 2Y3DA 5HV9A 5KYYB 3JSEO 1A7VA 3FDQA 3QZCA 2WB7A 3LLIA 1ORSC 4IAQA 3C8GA 1IW7F 1O87A 2HSBA 2XM4A 3OWTA 1ZHXA 2EIJC 2HKVA 1FMVA 3M4CA 5E3AA 3EZHA 4XWJA 2E87A 4EBKA 3KMIA 1OCRC 3QMKA 3S90A 3AGTA 1JOGA 3EZIA 3T6GB 5L0DA 4Q4ZF 1YARO 2HSQA 2XLDA 3DM9B 3HNKA 5A6AA 4PJLA 4CS8A 2H7OA 5DS6A 4BJ6A 3KYJA 4JTDB 4U5HA 2PBEA 3GM1A 2B0HA 2IXMA 3GWLA 5E3CA 1Z5ZA 4HFFB 2HZ8A 2W45A 3EFOB 3K6BA 4AK9A 2KYHA 4DVYP 3GEHA 5E33A 1OW6A 2D4UA 4N4WA 3WHNA 1SMYF 2R7XA 2YL7A 1B68A 1D1CA 2Q00A 4I1MA 3RF3A 4ONSA 3GANA 1PCXA 5KYXB 1FNTc 3MX3A 3U9MA 1J8YF 4G0HA 2R9RB 1NZEA 3H2UA 4RBNA 3HJCA 1WATA 2BE5F 2XLHA 4KNWA 1OCCC 1YDIA 3W8HA 3QVZA 2B0JA 3B9QA 3NKEA 2IXOA 3LAYA 4JEBA 1SR2A 2W4MA 2CDQA 4AL1A 1VTMP 4E0HA 3G4XA 1OCZC 2I15A 3SXZA 3Q7GA 2EPKX 1LIHA 3FOPA 3PDMP 4I3MA 4WABA 1H9GA 1Q0MA 4DBQA 1NU7D 4CIHA 3ABMC 3ASOC 2AP3A 5JRAA 1PV3A 2GFHA 5T3WA 4RDAA 1T6IA 3K1IA 4I44A 5BQHA 4HEAJ 5KYYA 2KNHA 4PR9A 2PP4A 2IXNA 4CS9A 1D0ZA 1RJ9B 1OXKA 2DYSC 3DJNB 4PJNA 3S29A 5JP7A 1R4TA 4J7TA 3NYLA 3SXMA 1AUEA 3EHNA 4ANJA 2KSFA 1U0BB 4A2NB 2X0CA 3FAPB 1MMGA 3KKBA 1Z23A 3K66A 2AWYA 5BQIA 4EKWA 2R7UA 3EFOA 3IQTA 2M4EA 1C02A 1Z7Qc 3ASNC 2A6HF 1M2VB 1WWPA 3EQLF 3E9VA 1NFOA 1LE2A 2Q9AA 3Q7LA 4I1OB 5E2QA 3AOUA 2YKZA 3S28A 4CS7A 4G7OF 3NRHA 2R7SA 3AGUA 1HY5A 2NUPB 2X51A 3W8IA 2LQGA 3RQFA 3DE8A 3JYHA 4ULWA 3FMSA 1LE4A 3AG2C 4E0IA 1BZ4A 2VASA 4OIQF 2QTVA 3M4BA 4FWVA 3ZVRA 5DLJA 2IM8A 1NFNA 1QLEC 2P6VA 3AG4C 2XL6A 3TOLA 2UUHA 3IHUA 2WVQA 5AC5A 2AU5A 2DB4A 4OD5A 1ZVZA 1OKKA 3S0XA 3TJ5A 3V7OA 4R32A
chains in the Genus database with same CATH topology
5CIVA 2F22A 3DI5A 2OU6A 2QE9A 2YQYA 5COFA 3DKAA 3GORA 3QTHA 2QNLA 3CEXA 2NSGA 2NSFA 4N6CA 2P1AA 2RD9A 5COGA 5COMA 1RXQA 2OQMA 2HKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CIV A;  2F22 A;  3DI5 A;  2OU6 A;  2QE9 A;  2YQY A;  5COF A;  3DKA A;  3GOR A;  3QTH A;  2QNL A;  3CEX A;  2NSG A;  2NSF A;  4N6C A;  2P1A A;  2RD9 A;  5COG A;  5COM A;  1RXQ A;  2OQM A;  2HKV A; 
#chains in the Genus database with same CATH topology
 4JVS A;  3C18 A;  1JRA A;  4MVM A;  2CCY A;  1JR8 A;  3F47 A;  1J8M F;  3NYJ A;  3HNI A;  4K0D A;  3RKO F;  3LNR A;  3ECS A;  2A0U A;  2L6F A;  2XL4 A;  1Q0G A;  4WGY A;  1GQA A;  1V55 C;  4NC3 A;  1RJ9 A;  1K05 A;  4YL0 A;  4NY3 A;  3DKA A;  4IB4 A;  1M57 C;  1M2O A;  5DQZ A;  4BJT A;  1YZA A;  3B0U X;  2EIL C;  4BJ1 A;  3K7D A;  5D92 A;  3PHF 2;  1CPR A;  2YL3 A;  3IQ6 A;  3N2Z B;  5K0I A;  1Q0D A;  1A0B A;  5JUA A;  3E70 C;  3TD7 A;  3NMK A;  1MQV A;  3TUL A;  1Z6A A;  2CW0 F;  3FAJ A;  2R02 A;  3NKD A;  3SP1 A;  3A9C A;  1APC A;  4Z9I A;  2GWW A;  1QZX A;  2R7W A;  5DS5 A;  2J8W A;  3Q6M A;  1YYJ A;  2R03 A;  1JAF A;  1NBB A;  2I8B A;  2HFI A;  4IJJ A;  3W2V A;  1R5I D;  2WL8 A;  1I5N A;  1QKR A;  1S05 A;  3GWN A;  2NUP A;  4MW3 A;  3ABK C;  3POV A;  1UG7 A;  1ORJ A;  2VCA A;  3JRM O;  2Y3H A;  3GEE A;  1L7C A;  3JT1 A;  2QE9 A;  1YZC A;  2A1D D;  4CS8 C;  4JE9 A;  1QSP A;  4OIN F;  4PJM A;  4BJ6 C;  4FAP B;  2R25 A;  4LDQ A;  1VOM A;  2HJ3 A;  3T4R A;  2V3C C;  2FGY A;  2WZF A;  2YL0 A;  1YLM A;  2XLW A;  3ZTM A;  2KQ9 A;  4MND A;  4CBE A;  1G5Z A;  1NG1 A;  4U5C E;  5KYN A;  2QLA A;  2NSF A;  3JYY A;  1BR4 A;  2VC9 A;  1XWJ A;  1A7D A;  4JTA B;  2Y3B A;  2PX3 A;  4U5G A;  5COG A;  4AE4 B;  1TWA A;  2FFH A;  3H2V A;  2V26 A;  1PD1 A;  2OJQ A;  3DMD A;  2XXA A;  4C3E A;  4DJ9 A;  2AVK A;  4MW8 A;  2J7P A;  3O10 A;  4XEF A;  3TJ6 A;  1H9T A;  4OIP F;  1Z3I X;  3SXY A;  5A69 A;  1A7E A;  1Q0K A;  2L81 A;  5L3Q A;  2HS5 A;  1NSG B;  2KW3 C;  1FR0 A;  1BBH A;  1M56 C;  2MWQ A;  3U5S A;  4G78 A;  1E85 A;  2QNL A;  2J9B A;  2CYD A;  1T6U A;  1LPE A;  2XRH A;  3EGX B;  4WJ0 A;  4MVU A;  3R7C A;  4HFK B;  4JJG A;  1TFK B;  4O6M A;  4A4A A;  4CS9 C;  2QY9 A;  1ZHZ A;  2IBF A;  4KC9 A;  3GOD A;  1ZHY A;  3B0V C;  4U5D E;  2XLM A;  1YYX A;  4KBL A;  4YJW A;  5JLI A;  1WOL A;  1SZI A;  3FHD A;  3LEV A;  3M1C B;  5A6K A;  2EIN C;  1HE1 A;  2JX0 A;  1DOV A;  1QPU A;  5JT4 A;  1VYK A;  1BDJ B;  2OG2 A;  2YEV A;  3QW1 A;  4LLE A;  4EUK B;  3O6X A;  4BJ5 A;  1U6H A;  2LP4 A;  4M63 A;  3X2Q C;  4CDV A;  4FES A;  1LS1 A;  3U0C A;  3U3B A;  2EIM C;  2J9U A;  4K7B A;  1Z63 A;  4E17 A;  4F4B A;  4ER9 A;  3L1M A;  1ZHW A;  2HUJ A;  3V5X A;  3EH2 A;  4K1O A;  4QDL A;  2NUT B;  1HMO A;  3HNL A;  2C03 A;  3U2M A;  3NMI A;  5DS4 A;  3FXH A;  4AE4 A;  4XPY A;  3UGO A;  1MND A;  1F1M A;  5HSW A;  1FFT C;  2BL2 A;  1TFO B;  2WVO A;  1T01 A;  2CNW D;  3G4Z A;  3KYI A;  4KNV A;  1HW2 A;  3JRT A;  1ORY A;  2A6E F;  3TQO A;  4YT2 A;  4NTF A;  2J46 A;  2GA0 A;  1D0Y A;  1CGN A;  3OEO A;  2RD9 A;  1RKE B;  2ETS A;  3X1O A;  5L0I A;  2H8A A;  4CIP A;  1EA8 A;  3U2L A;  4CSA C;  4E18 A;  1YA9 A;  5CI8 A;  3C8Z A;  4O7G A;  3RIP A;  1H7I A;  3SNH A;  3EH1 A;  3ABL C;  2EPO A;  1XZP A;  3MFN A;  4QI0 A;  5EK0 A;  1ST6 A;  1OR3 A;  2XS1 A;  4NTB A;  1E83 A;  1MMN A;  1YVI A;  4C3D A;  4PFO A;  2W4B A;  3U8V A;  1BR2 A;  5EHH A;  3TOM A;  3C8G D;  5KYX A;  3L8I A;  1V74 B;  1CPQ A;  3EGD B;  4U5F E;  4DRH B;  4LLC A;  4O6N A;  2J0W A;  2R7V A;  1RKC A;  1UFB A;  3CEX A;  2JPU A;  4U5E E;  4U9D A;  1S7Z A;  2DGJ A;  4GQH A;  4P9F A;  2LCH A;  4CDY A;  1NLX A;  3M79 A;  2NG1 A;  4AX2 A;  3DAG A;  3OA1 A;  4BG0 A;  4DRJ B;  3SYN A;  4CJG A;  2NPU A;  1TWC A;  1E86 A;  4CDA A;  1TKN A;  1MMD A;  4C7O A;  3RH3 A;  4CX9 A;  4LER A;  3UR3 C;  1C17 M;  2ZPA A;  3IQ5 A;  3LES A;  4MVQ A;  4IAR A;  2EPN A;  4D4N A;  4ULV A;  2NUT A;  4D4X A;  3DD7 A;  1Q0F A;  5D91 A;  3MLG A;  3UGP A;  2XLV A;  3U3F A;  2VH3 A;  3DAF A;  1YAU O;  4P6I C;  2PF4 E;  2PX0 A;  2LFF A;  4PK4 A;  5COF A;  3GOR A;  5CI9 A;  1ZW2 A;  2Q4F A;  4BEM J;  1WN0 A;  5JVE A;  3ZQY A;  1CGM E;  1O5H A;  4JC7 A;  4XLP F;  4J32 B;  1RKE A;  3R2P A;  5KYU B;  3FOO A;  3J06 A;  3ZTZ A;  5JS5 A;  1GM5 A;  1OR2 A;  5DQT A;  3RFY A;  2Y39 A;  1MMA A;  2VB6 A;  3RYL A;  2WZL A;  3W4Y A;  4Z9H A;  4NCQ A;  2YLG A;  3AQC A;  2P1A A;  3C62 A;  2YZS A;  3M15 A;  3LUT B;  2JD3 A;  5F28 E;  1RXQ A;  3DM5 A;  4PFP A;  1M2V A;  2Q9C A;  2YLI A;  3LNM B;  3WOD F;  2PFD A;  4YN0 B;  3C7J A;  5AGF A;  4JTC B;  2YHS A;  1VYI A;  3LLK A;  2DI3 A;  4MTF A;  3C8G B;  1XZQ A;  3DI5 A;  3IPM O;  2GDC A;  4G7Z F;  3EGD A;  1HMD A;  3AG3 C;  4MS2 A;  3NMJ A;  1FTS A;  1LVK A;  3DZA A;  1EQ1 A;  4GEH A;  4DOZ A;  2GAQ A;  4NQF A;  1TWH A;  3I5P A;  2PNO A;  3DWW A;  3EHM A;  1OCO C;  2DYR C;  4C3B A;  1K04 A;  5B1A C;  5A6B D;  2VCB A;  2HV7 A;  2NSG A;  3O39 A;  1VMA A;  2R7O A;  3I5Q A;  3KL4 A;  4J30 B;  3RQE A;  2KC3 A;  4PAC A;  4H54 A;  1JPN A;  4N6C A;  4EBB A;  5EGY A;  2Y69 C;  1WAS A;  1BR1 A;  1GGQ A;  4O79 A;  1EKY A;  2ZXP A;  3ATP A;  1V4A A;  2KGO A;  2CNW A;  2AWC A;  3HKK A;  4YL1 A;  3EJN A;  4BJ5 C;  4JRZ A;  3B29 A;  5KYU A;  1LKX A;  4MTG A;  1HW1 A;  1ZU4 A;  4JCZ A;  2G3K A;  3PCV A;  4E7Z A;  3NDB B;  4JZA A;  2YRF A;  3DXJ F;  3I4U A;  3ITF A;  1I4Y A;  1LI5 A;  5BQG A;  1Y4C A;  1OKK D;  1SF8 A;  3K1I C;  4EBJ A;  2EIK C;  1T5O A;  1E84 A;  4YK5 A;  1T6Q A;  1W2W A;  1AEP A;  4MVO A;  2ZXO A;  4GYT A;  5B1B C;  3BEH A;  4EHP A;  4ZLD A;  2OEX A;  5TJ5 E;  1T9K A;  1A41 A;  3SXK A;  2C04 A;  1KNY A;  3KH2 A;  4JJF A;  3L8J A;  2ASR A;  2RSE B;  3WAQ A;  1V54 C;  3RQG A;  1O3U A;  1OQC A;  4EIY A;  3Q6N A;  2YL1 A;  4Q7C A;  1LI7 A;  3LS0 A;  2OU6 A;  2ZD9 A;  3MBG A;  3EPV A;  3RW0 A;  1IZM A;  5BUO A;  4UDV A;  1C03 A;  4OIO F;  3GM2 A;  4Q5S F;  4EWC A;  2H7B A;  1FMW A;  2Q7R A;  3S9O A;  5F5F A;  3VAY A;  3IEE A;  1OW8 A;  5KYW B;  5L0C A;  1FFH A;  1TQG A;  3DE9 A;  3L34 A;  3GM3 A;  3NYM A;  1LS4 A;  3UMI A;  3LEO A;  4J7Y A;  4YT4 A;  3MYF A;  2OJE D;  4BPM A;  3JZ0 A;  4JIO A;  2LK4 A;  1AVO B;  1EI7 A;  2XLO A;  4X0R A;  2HMZ A;  3U9J A;  256B A;  2A68 F;  3FVY A;  5JSL A;  5B3S C;  5IY5 C;  4MTO A;  3F46 A;  2BC5 A;  4JUR I;  1WTY A;  2EPL X;  3QW0 A;  3K33 A;  1G8X A;  1N1C A;  3UNG C;  1Y6D A;  4MQ9 F;  2OQM A;  1JMW A;  1RCP A;  4XQ1 A;  4XPX A;  5FZT A;  3WG7 C;  4N06 A;  2VCC A;  5CIV A;  1ZZP A;  1QQ3 A;  3O55 A;  2Z15 A;  3HTK C;  4OD4 A;  2IOQ A;  5T3T A;  4QI2 A;  3EGX A;  1HE9 A;  2MYS A;  1ZHT A;  1TR2 A;  1QVX A;  2KJG A;  3CAX A;  2XM0 A;  3W2W A;  5A6J A;  5GPG B;  3QTH A;  2W9Y A;  1MNE A;  3AG1 C;  1VLT A;  3S27 A;  4G7H F;  3A11 A;  3B0P A;  3NG1 A;  4XLN F;  3ZC4 A;  4B6I A;  2J9W A;  2A69 F;  2O9X A;  3C63 A;  4LDR A;  3UMK A;  4MVS A;  1YA7 O;  1TWG A;  3ZSU A;  2J7P D;  4JEA A;  4LAC B;  4N6H A;  2D5R B;  4DVZ A;  2YVK A;  2ZXR A;  4HE8 D;  5L3V A;  3N0T A;  3VRC A;  1CGO A;  2LSE A;  3CZ6 A;  5A6B A;  2OEV A;  2OKU A;  3SEO A;  4BEJ A;  2HJM A;  2XSE A;  4IRU A;  5L0G A;  2LFD A;  2HMQ A;  3EG9 B;  3HNJ A;  3ZIB A;  4IGG A;  2P7V A;  5KYW A;  3LJB A;  2XS8 A;  3T6B A;  2LD6 A;  2M64 A;  2ZXW C;  3VYW A;  4XEV A;  2CGE A;  2KK1 A;  1GS9 A;  3ZQV A;  3SZR A;  4NTA A;  2YQY A;  4C7O B;  3ZWI A;  1ZYR F;  1M6T A;  2MHR A;  4IWB A;  4L6R A;  3IQC A;  4CJO A;  2FAP B;  4OIR F;  2OOC A;  4MVZ A;  2EPM X;  2IXP A;  2L6H A;  1D1B A;  3HLZ A;  3CQZ A;  5DVW A;  3BRJ A;  1NU9 C;  2G3V A;  3H65 A;  4P9T A;  4W8K A;  4DRI B;  2ICW G;  2P0N A;  4DXW A;  1E2X A;  1KU2 A;  4IAO A;  4MVR A;  4PJJ A;  1D1A A;  2Y3G A;  4CSA A;  1DOW A;  5T1D B;  4XEK A;  3K1H A;  5AC4 A;  2LIG A;  5L0F A;  4O6Y A;  2YLD A;  3CSK A;  2R7Q A;  3B71 A;  2XL8 A;  3T9O A;  1K40 A;  2Q9B A;  4W8P A;  4XTK A;  4JW1 A;  1G4W R;  4YL3 A;  1KTM A;  2A0B A;  3KPH A;  3ZG1 A;  1OXB A;  2UUI A;  2XLE A;  2QUP A;  5L0J A;  1VB5 A;  3VM6 A;  5B3I A;  2XXA B;  2J0X A;  3DJU B;  1LM3 B;  3JTL O;  2HV6 A;  1PD0 A;  4U9E A;  4XPW A;  4H4K C;  1D0X A;  3GEI A;  4YWQ A;  2R7T A;  2YWA A;  4JCH A;  2J45 A;  1U89 A;  2Q3T A;  4JKV A;  3UMH A;  3S84 A;  4DBR A;  3EG9 A;  2WZG A;  5FCL A;  5L0H A;  1SYQ A;  1ZW3 A;  3G50 A;  1L3P A;  4ZLC A;  2G62 A;  2TMV P;  3N24 A;  5COM A;  2H7V C;  2P61 A;  1JPJ A;  3LS1 A;  3AJM A;  4LDK A;  4Z9J A;  4U5B E;  1YJG A;  2J9V A;  4WGZ A;  3US6 A;  3ZDL A;  2L7A A;  4AL0 A;  2F22 A;  1H6G A;  3U8P A;  4E7S A;  2R05 A;  2L9J A;  3VF0 A;  2IYL D;  4YT8 A;  3V5Z A;  3JCU Q;  2WVN A;  3AQB A;  4RD9 A;  3TK0 A;  1I4Z A;  3PMR A;  4KI2 A;  3V5Y A;  4YT5 A;  1OW7 A;  1G4U S;  2L6G A;  3QVY A;  3L0I A;  3MYI A;  3JSZ A;  3RVY A;  1VK5 A;  1WGW A;  1ZU5 A;  1VLS A;  1FAP B;  2R7R A;  1RMV A;  3RVZ A;  5F5H A;  3T6J A;  4FX5 A;  2OCC C;  2Y3D A;  5HV9 A;  5KYY B;  3JSE O;  1A7V A;  3FDQ A;  3QZC A;  2WB7 A;  3LLI A;  1ORS C;  4IAQ A;  3C8G A;  1IW7 F;  1O87 A;  2HSB A;  2XM4 A;  3OWT A;  1ZHX A;  2EIJ C;  2HKV A;  1FMV A;  3M4C A;  5E3A A;  3EZH A;  4XWJ A;  2E87 A;  4EBK A;  3KMI A;  1OCR C;  3QMK A;  3S90 A;  3AGT A;  1JOG A;  3EZI A;  3T6G B;  5L0D A;  4Q4Z F;  1YAR O;  2HSQ A;  2XLD A;  3DM9 B;  3HNK A;  5A6A A;  4PJL A;  4CS8 A;  2H7O A;  5DS6 A;  4BJ6 A;  3KYJ A;  4JTD B;  4U5H A;  2PBE A;  3GM1 A;  2B0H A;  2IXM A;  3GWL A;  5E3C A;  1Z5Z A;  4HFF B;  2HZ8 A;  2W45 A;  3EFO B;  3K6B A;  4AK9 A;  2KYH A;  4DVY P;  3GEH A;  5E33 A;  1OW6 A;  2D4U A;  4N4W A;  3WHN A;  1SMY F;  2R7X A;  2YL7 A;  1B68 A;  1D1C A;  2Q00 A;  4I1M A;  3RF3 A;  4ONS A;  3GAN A;  1PCX A;  5KYX B;  1FNT c;  3MX3 A;  3U9M A;  1J8Y F;  4G0H A;  2R9R B;  1NZE A;  3H2U A;  4RBN A;  3HJC A;  1WAT A;  2BE5 F;  2XLH A;  4KNW A;  1OCC C;  1YDI A;  3W8H A;  3QVZ A;  2B0J A;  3B9Q A;  3NKE A;  2IXO A;  3LAY A;  4JEB A;  1SR2 A;  2W4M A;  2CDQ A;  4AL1 A;  1VTM P;  4E0H A;  3G4X A;  1OCZ C;  2I15 A;  3SXZ A;  3Q7G A;  2EPK X;  1LIH A;  3FOP A;  3PDM P;  4I3M A;  4WAB A;  1H9G A;  1Q0M A;  4DBQ A;  1NU7 D;  4CIH A;  3ABM C;  3ASO C;  2AP3 A;  5JRA A;  1PV3 A;  2GFH A;  5T3W A;  4RDA A;  1T6I A;  3K1I A;  4I44 A;  5BQH A;  4HEA J;  5KYY A;  2KNH A;  4PR9 A;  2PP4 A;  2IXN A;  4CS9 A;  1D0Z A;  1RJ9 B;  1OXK A;  2DYS C;  3DJN B;  4PJN A;  3S29 A;  5JP7 A;  1R4T A;  4J7T A;  3NYL A;  3SXM A;  1AUE A;  3EHN A;  4ANJ A;  2KSF A;  1U0B B;  4A2N B;  2X0C A;  3FAP B;  1MMG A;  3KKB A;  1Z23 A;  3K66 A;  2AWY A;  5BQI A;  4EKW A;  2R7U A;  3EFO A;  3IQT A;  2M4E A;  1C02 A;  1Z7Q c;  3ASN C;  2A6H F;  1M2V B;  1WWP A;  3EQL F;  3E9V A;  1NFO A;  1LE2 A;  2Q9A A;  3Q7L A;  4I1O B;  5E2Q A;  3AOU A;  2YKZ A;  3S28 A;  4CS7 A;  4G7O F;  3NRH A;  2R7S A;  3AGU A;  1HY5 A;  2NUP B;  2X51 A;  3W8I A;  2LQG A;  3RQF A;  3DE8 A;  3JYH A;  4ULW A;  3FMS A;  1LE4 A;  3AG2 C;  4E0I A;  1BZ4 A;  2VAS A;  4OIQ F;  2QTV A;  3M4B A;  4FWV A;  3ZVR A;  5DLJ A;  2IM8 A;  1NFN A;  1QLE C;  2P6V A;  3AG4 C;  2XL6 A;  3TOL A;  2UUH A;  3IHU A;  2WVQ A;  5AC5 A;  2AU5 A;  2DB4 A;  4OD5 A;  1ZVZ A;  1OKK A;  3S0X A;  3TJ5 A;  3V7O A;  4R32 A; 
#chains in the Genus database with same CATH homology
 5CIV A;  2F22 A;  3DI5 A;  2OU6 A;  2QE9 A;  2YQY A;  5COF A;  3DKA A;  3GOR A;  3QTH A;  2QNL A;  3CEX A;  2NSG A;  2NSF A;  4N6C A;  2P1A A;  2RD9 A;  5COG A;  5COM A;  1RXQ A;  2OQM A;  2HKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...