3GORA

Crystal structure of putative metal-dependent hydrolase apc36150
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
157
structure length
157
Chain Sequence
SNAMSRAKKWVQYFLSHRHVTMELIHKIDEAHYDYKPTPTSMTAKQLATHMLFSFYNFANTAKHGDPSLFRQKIEEPETNLAKLAETYTEKTRQLIESMSDDDFDRTLDLTAIFGTQMSTAQFLQLAMDHEIHHKGQLFVYVRGMGHTDLPLFVKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative metal-dependent hydrolase
publication title The structure of DinB from Geobacillus stearothermophilus: a representative of a unique four-helix-bundle superfamily.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 50
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 3gorA01
2QNLA 2YQYA 5COFA 3CEXA 5COGA 3GORA 2NSFA 2QE9A 3DI5A 1RXQA 2OQMA 3DKAA 2NSGA 2RD9A 2F22A 2P1AA 2OU6A 2HKVA 5COMA 5CIVA 4N6CA 3QTHA
chains in the Genus database with same CATH superfamily
1VYIA 1L7CA 4NCQA 3U9JA 4YT4A 2YKZA 4NC3A 3U2LA 2DYSC 3SXMA 1RMVA 4JC7A 4PFPA 2QUPA 3IEEA 3DWWA 3GM1A 4MS2A 1FAPB 1OCRC 2ZD9A 4XPXA 2EILC 5E2QA 2R7VA 4LERA 1Q0FA 3ASOC 2KK1A 1J8MF 1YZAA 1YDIA 2LP4A 3TQOA 3EGDA 4WGYA 3SEOA 5T1DB 1YYJA 1SMYF 2J0XA 3C8GD 4MTOA 2CCYA 4PACA 3EHNA 5DVWA 4EUKB 3US6A 1JR8A 2VCBA 2Q9CA 2XLMA 5CI9A 4CS9C 4JKVA 5BQGA 3K6BA 1E2XA 3MLGA 3G4XA 4MVZA 5DS5A 3Q7LA 1E86A 2EINC 4X0RA 2IM8A 4NY3A 4HE8D 2E87A 4XEKA 4CJOA 4EBBA 3M4BA 1H9GA 1FR0A 2LD6A 3KL4A 2DB4A 2EIJC 3EQLF 1M56C 1R4TA 4IWBA 3Q7GA 5E3AA 1V54C 4EWCA 1D0XA 1T6QA 2Q00A 3B71A 3DJNB 4JIOA 2EPKX 1ZZPA 1NFOA 1V4AA 4LLEA 1IW7F 3K1IC 2R9RB 3KYJA 4JTCB 4KBLA 4O79A 4C3BA 1QLEC 2IBFA 4YL3A 5KYYA 2R05A 4MVUA 3C7JA 4E0HA 1OKKD 2R03A 3U2MA 1ZHZA 4IRUA 4RBNA 4Q4ZF 3ZQYA 3U3FA 3O55A 2Y3GA 4PJMA 2TMVP 1T5OA 4W8KA 5COGA 5D91A 4W8PA 2WL8A 2OJED 1EKYA 4BG0A 4DJ9A 3W4YA 3K1HA 4JURI 4N06A 1PCXA 2QE9A 1HE9A 2V3CC 2Y69C 1MMDA 1NSGB 2OCCC 4JRZA 4J7YA 3LS0A 3KPHA 2YL7A 4NTFA 3V5ZA 2VCAA 4EBJA 1A0BA 2HJMA 1ST6A 2AU5A 2NUTB 2P1AA 2PX0A 2W4MA 3I5QA 5JT4A 4GYTA 3V5YA 3ATPA 5JVEA 3CZ6A 4CDYA 2OU6A 3HKKA 3J06A 4GEHA 4EHPA 3ZDLA 3CQZA 2J7PA 2LSEA 3AG2C 3C62A 3LUTB 3VRCA 2ZXRA 2DGJA 3RIPA 5CI8A 256BA 1LS1A 3QMKA 4LDKA 3G50A 2A0BA 1YLMA 2L6GA 4U5FE 2KYHA 2BE5F 4JCHA 2J8WA 4O6MA 2A6HF 4XEFA 3C8ZA 1CPQA 1ZHXA 4YK5A 3IQ6A 2P7VA 1SZIA 2JX0A 2A6EF 3RF3A 2OEVA 1HMOA 5HSWA 3T9OA 4MTGA 2BL2A 1LI5A 4PR9A 4U9EA 1KNYA 4MVSA 5HV9A 2HJ3A 3R2PA 2RSEB 4ZLCA 4CDVA 1VLTA 4C7OB 4NTBA 1IZMA 3W2VA 3NYLA 3RQFA 1U89A 1M2OA 3MBGA 3OWTA 5BQIA 4I3MA 3EJNA 3HJCA 1BZ4A 1T9KA 2I15A 2QTVA 4D4NA 3F47A 2ZPAA 4DBQA 5KYXB 2IXMA 1RKEA 3ABKC 3AQBA 4N6HA 3N0TA 4MTFA 1WATA 1C02A 3ITFA 3C8GB 2R7TA 2XLOA 3DM9B 2AVKA 1ORJA 2C03A 3V5XA 2H7BA 2NG1A 2EPNA 2IXOA 5B3IA 1OXBA 3VM6A 4KNVA 1Q0KA 5A6KA 2XRHA 4QI2A 3EFOB 4YT8A 2L6FA 5A6BA 2WZFA 5AC5A 4OIPF 1MMGA 2XXAA 2EPOA 2XS1A 3U3BA 1OW6A 1TQGA 1O87A 2DI3A 3PMRA 2HSQA 3Q6MA 3L1MA 2JD3A 1MMAA 3EHMA 1OCCC 1RJ9B 3DXJF 4PJLA 5T3WA 1CGOA 1QKRA 2R25A 1NLXA 2HFIA 2OOCA 4JEBA 4PK4A 1HW2A 3JSEO 4KC9A 4FESA 1OCZC 4J32B 3UMHA 3U9MA 4NQFA 5KYWB 3S0XA 1NG1A 3GWLA 4C3DA 4G78A 4YWQA 2QLAA 2XLHA 4QI0A 2J45A 4DVYP 2EPMX 4YN0B 1A7DA 2CYDA 2Q7RA 4Z9JA 1MMNA 3EH1A 3GANA 4E7SA 2ZXWC 2KC3A 1Y4CA 1A7EA 1APCA 3QW1A 4EIYA 3JSZA 2F22A 4BJ5A 5KYNA 3LLIA 3L34A 3W2WA 5B3SC 4O7GA 3EPVA 1M6TA 1LE4A 2FGYA 1K05A 2GFHA 3DE9A 3S84A 2J9BA 4C3EA 1MQVA 4DXWA 2Y3BA 4BEJA 5CIVA 3DJUB 3RQEA 1C03A 2VC9A 1ZW3A 1HMDA 1G8XA 3ZVRA 3ZIBA 5DQTA 1ORSC 1Q0DA 3DAFA 4BJ1A 1OR2A 4CBEA 1UG7A 2W45A 5COFA 5FZTA 1CGNA 2C04A 4XLNF 3DZAA 3EZHA 3JYHA 4Z9HA 4P9TA 1FFTC 3FAPB 1HY5A 1PV3A 4RD9A 4XEVA 2PFDA 3GEEA 3IQ5A 2X51A 2Q4FA 2YLDA 2NSGA 3EGXB 1AEPA 4U5BE 1PD1A 2Q3TA 5T3TA 3BEHA 5IY5C 1G4WR 1TWCA 3T6JA 4CS7A 4ULVA 1RCPA 3ZSUA 4WJ0A 2M4EA 2WZGA 3N24A 4K0DA 4BJ5C 4CDAA 2UUHA 3MX3A 2I8BA 2XLWA 4L6RA 2A1DD 2YZSA 3ZG1A 4OIOF 1YA7O 3AJMA 3AQCA 1YJGA 3T4RA 1VOMA 3JCUQ 3O39A 5JS5A 1M2VA 1Z6AA 4XWJA 1BR2A 4AE4A 3EG9A 3EGDB 1G5ZA 2P61A 1RKCA 3JTLO 4XPWA 1OXKA 3NDBB 4G0HA 2FAPB 5KYUA 1T6UA 3S9OA 4DRIB 1NFNA 3F46A 1Z7Qc 3AGUA 4U5CE 3TOMA 1EA8A 3BRJA 3M79A 4MW8A 3B0PA 5D92A 3A9CA 1E84A 2GWWA 1B68A 4K1OA 4R32A 5GPGB 4MNDA 2WVQA 1XWJA 4CS8A 2CNWA 1ZU5A 3IPMO 2D5RB 4YT2A 3A11A 1YAUO 1VYKA 2Z15A 3NKEA 4G7ZF 2P6VA 1GQAA 2ICWG 2GAQA 1A41A 1N1CA 2KNHA 2A68F 1DOWA 2WVNA 1SF8A 4WGZA 3DE8A 1GS9A 1V55C 5F5HA 4AX2A 1Z3IX 1T01A 4XLPF 4AK9A 4MVOA 3RH3A 2H8AA 2QNLA 2G3KA 3OA1A 2G3VA 1I4YA 1XZPA 4LACB 4N4WA 3DM5A 2HMZA 2YLGA 1VMAA 3NRHA 1QVXA 4Z9IA 4QDLA 2NSFA 3LLKA 4ULWA 1WGWA 5F28E 1W2WA 1LE2A 1HW1A 3TOLA 2MWQA 5EGYA 1OW7A 2YL0A 5KYYB 5EHHA 2J9UA 2XL4A 3DAGA 1ZHTA 1D1AA 3MFNA 5JRAA 2XL8A 2LK4A 3NMJA 3O6XA 1NBBA 3LEVA 2JPUA 4AL0A 1T6IA 3POVA 1U6HA 3L8JA 1FMWA 3IHUA 2ZXOA 4O6NA 5JSLA 3RKOF 2UUIA 4PFOA 5COMA 3SXZA 4DRJB 1BR1A 3T6GB 2VB6A 2WB7A 3G4ZA 3T6BA 2EIKC 3LS1A 3UNGC 2XSEA 4CS8C 4P9FA 3OEOA 2NPUA 3QVYA 1JAFA 3WG7C 2V26A 5DS4A 2R7UA 1K40A 2YQYA 1Q0GA 3M4CA 4U5DE 3HNLA 4XPYA 1D1BA 4U5GA 3AG3C 3PCVA 2L81A 1SYQA 3K66A 3TK0A 2VH3A 2FFHA 3C63A 2R7SA 2NUPA 1YYXA 2WZLA 2GA0A 1AVOB 2ZXPA 3FOPA 4JW1A 3MYIA 4MVQA 1ZHWA 1NU9C 5K0IA 3K7DA 4HEAJ 4G7OF 2RD9A 3IQCA 2Y3DA 1ZU4A 1ZW2A 4JTDB 3PHF2 3FMSA 5L0FA 1Z63A 5L0DA 1WOLA 1H7IA 1FMVA 2HKVA 1VLSA 1YA9A 2YWAA 1LM3B 1AUEA 5L0CA 1JOGA 4WABA 3ZTMA 2OKUA 4YL0A 5EK0A 2LFFA 1S05A 3FAJA 1TR2A 4LDRA 3AGTA 2WVOA 2YL3A 1TWGA 2L9JA 4H54A 1BDJB 3RW0A 4EBKA 3B9QA 4JVSA 4DRHB 1JRAA 1FFHA 1MNDA 3E70C 1LS4A 1G4US 2CGEA 3TULA 1OR3A 4KNWA 2R7OA 3AOUA 3DD7A 3FDQA 1TFOB 3SXKA 1C17M 2O9XA 2IXPA 2W4BA 3HNIA 3RFYA 1RKEB 2LIGA 4YJWA 5A69A 2YRFA 1HE1A 2IOQA 2YLIA 2Q9BA 3JRMO 3JYYA 3KH2A 2KW3C 2YHSA 4IAOA 4O6YA 5A6JA 1A7VA 3DMDA 3SNHA 5L3QA 3GM3A 3UMIA 2NUPB 4I1OB 4JEAA 4MVMA 5JP7A 3K33A 1JPNA 3GM2A 1Z5ZA 3N2ZB 1EI7A 1LIHA 2J7PD 2YEVA 4ER9A 3KMIA 4N6CA 3WODF 2Q9AA 1TFKB 2LCHA 3EZIA 3HTKC 4GQHA 2XM0A 2AP3A 2CDQA 4YT5A 4JE9A 4F4BA 5L0IA 1BBHA 3V7OA 4JJGA 4DBRA 2J9VA 2VCCA 3GODA 1D1CA 3L8IA 4HFFB 4A4AA 4JCZA 3H2VA 3NYJA 2XXAB 2AWCA 2HMQA 2XLDA 3NG1A 4IAQA 3VAYA 1MNEA 2QY9A 4JTAB 4YL1A 3WHNA 4E0IA 4CSAA 1K04A 1YZCA 3E9VA 4XQ1A 3UGOA 3AG1C 3WAQA 5DS6A 5AC4A 3ABLC 3MYFA 5FCLA 3NMKA 3ZQVA 2DYRC 5B1AC 2IXNA 3DKAA 3K1IA 3L0IA 3PDMP 2HUJA 2KSFA 3NYMA 1H6GA 2LFDA 4J30B 4J7TA 4RDAA 5BUOA 2H7OA 1KTMA 3UR3C 2R7QA 3EH2A 2AWYA 2X0CA 2MYSA 4EKWA 1Y6DA 1ZVZA 2KGOA 4G7HF 4BJ6A 3B0UX 1D0YA 2G62A 3ABMC 1BR4A 1EQ1A 1CPRA 4K7BA 5DQZA 4OINF 1PD0A 1QPUA 2NUTA 3HNJA 4HFKB 3M15A 4U5EE 1Z23A 2R7WA 1XZQA 4H4KC 3W8HA 2HV7A 1I5NA 1S7ZA 2B0HA 2HSBA 5DLJA 4ZLDA 3CSKA 3ECSA 5F5FA 1WASA 1YARO 2OQMA 1F1MA 3HNKA 4MQ9F 3CAXA 1OQCA 4CSAC 1LVKA 2M64A 2P0NA 3FXHA 2YL1A 2EIMC 5E3CA 3LEOA 1JMWA 2VASA 2GDCA 2W9YA 3JRTA 1LI7A 3RYLA 5A6BD 2EPLX 2D4UA 3KYIA 1FNTc 3LESA 4DVZA 4FWVA 4ONSA 3JZ0A 2H7VC 1OCOC 4LDQA 2L7AA 4JZAA 5E33A 3I5PA 1GM5A 3GEIA 3LJBA 1O3UA 2KQ9A 2MHRA 3I4UA 1O5HA 3O10A 3VYWA 1E85A 4IGGA 1GGQA 2XL6A 2XLEA 1WWPA 3U8VA 3LNRA 4BJ6C 5BQHA 4CJGA 4C7OA 2Y39A 3H65A 3JT1A 2OG2A 4I1MA 3R7CA 4P6IC 2LQGA 3RVZA 3TJ5A 3SP1A 5L0GA 3QZCA 4E18A 3DI5A 4E17A 4MW3A 5KYXA 5JLIA 2Y3HA 2XS8A 1M2VB 4IB4A 1Q0MA 2ETSA 3LNMB 4AE4B 3LAYA 3Q6NA 3EG9B 4U5HA 3B29A 1QSPA 3C8GA 3S28A 4KI2A 4Q7CA 5KYUB 4UDVA 3S29A 4IJJA 5JUAA 1JPJA 3TJ6A 1QQ3A 3QVZA 4U9DA 2PP4A 1YVIA 4I44A 3S27A 2J0WA 2PBEA 1ZYRF 3M1CB 3EFOA 3UGPA 3W8IA 2L6HA 3U8PA 3C18A 4B6IA 3SYNA 4BJTA 4LLCA 5TJ5E 3GORA 4AL1A 2YVKA 3SZRA 3ZWIA 4OIRF 3TD7A 4PJJA 1CGME 4PJNA 4E7ZA 1RJ9A 4BEMJ 5A6AA 1TWAA 3UMKA 3S90A 1RXQA 1WN0A 2XLVA 2IYLD 2A0UA 3U0CA 2OEXA 4BPMA 1V74B 3HLZA 4FX5A 5KYWA 3GWNA 5L0JA 3FOOA 2HS5A 4OIQF 1VK5A 2HZ8A 4IARA 4OD5A 1UFBA 1NU7D 5L3VA 3KKBA 1E83A 1OKKA 5AGFA 3X2QC 1TWHA 4JJFA 3QTHA 1U0BB 4NTAA 4ANJA 2PX3A 4XTKA 1OW8A 3U5SA 1I4ZA 5L0HA 2XM4A 4OD4A 2A69F 4Q5SF 3FVYA 2R02A 3ZTZA 3H2UA 4CX9A 3CEXA 2PF4E 3IQTA 1FTSA 1LPEA 2J46A 1KU2A 2ASRA 3B0VC 4MVRA 1LKXA 1L3PA 3ASNC 1H9TA 2KJGA 2PNOA 1SR2A 4CIHA 1M57C 1NZEA 3AG4C 1QZXA 2B0JA 3X1OA 3VF0A 4FAPB 1R5ID 2R7RA 3RQGA 1WTYA 2BC5A 4D4XA 3RVYA 4CIPA 4CS9A 1VTMP 2OJQA 3NMIA 1ORYA 1TKNA 4M63A 3QW0A 2HV6A 2CNWD 2J9WA 3SXYA 1J8YF 1D0ZA 4A2NB 1ZHYA 3FHDA 3NKDA 4DOZA 1VB5A 3GEHA 1DOVA 5B1BC 3ZC4A 2R7XA 2CW0F 3EGXA
chains in the Genus database with same CATH topology
2QNLA 2YQYA 5COFA 3CEXA 5COGA 3GORA 2NSFA 2QE9A 3DI5A 1RXQA 2OQMA 3DKAA 2NSGA 2RD9A 2F22A 2P1AA 2OU6A 2HKVA 5COMA 5CIVA 4N6CA 3QTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QNL A;  2YQY A;  5COF A;  3CEX A;  5COG A;  3GOR A;  2NSF A;  2QE9 A;  3DI5 A;  1RXQ A;  2OQM A;  3DKA A;  2NSG A;  2RD9 A;  2F22 A;  2P1A A;  2OU6 A;  2HKV A;  5COM A;  5CIV A;  4N6C A;  3QTH A; 
#chains in the Genus database with same CATH topology
 1VYI A;  1L7C A;  4NCQ A;  3U9J A;  4YT4 A;  2YKZ A;  4NC3 A;  3U2L A;  2DYS C;  3SXM A;  1RMV A;  4JC7 A;  4PFP A;  2QUP A;  3IEE A;  3DWW A;  3GM1 A;  4MS2 A;  1FAP B;  1OCR C;  2ZD9 A;  4XPX A;  2EIL C;  5E2Q A;  2R7V A;  4LER A;  1Q0F A;  3ASO C;  2KK1 A;  1J8M F;  1YZA A;  1YDI A;  2LP4 A;  3TQO A;  3EGD A;  4WGY A;  3SEO A;  5T1D B;  1YYJ A;  1SMY F;  2J0X A;  3C8G D;  4MTO A;  2CCY A;  4PAC A;  3EHN A;  5DVW A;  4EUK B;  3US6 A;  1JR8 A;  2VCB A;  2Q9C A;  2XLM A;  5CI9 A;  4CS9 C;  4JKV A;  5BQG A;  3K6B A;  1E2X A;  3MLG A;  3G4X A;  4MVZ A;  5DS5 A;  3Q7L A;  1E86 A;  2EIN C;  4X0R A;  2IM8 A;  4NY3 A;  4HE8 D;  2E87 A;  4XEK A;  4CJO A;  4EBB A;  3M4B A;  1H9G A;  1FR0 A;  2LD6 A;  3KL4 A;  2DB4 A;  2EIJ C;  3EQL F;  1M56 C;  1R4T A;  4IWB A;  3Q7G A;  5E3A A;  1V54 C;  4EWC A;  1D0X A;  1T6Q A;  2Q00 A;  3B71 A;  3DJN B;  4JIO A;  2EPK X;  1ZZP A;  1NFO A;  1V4A A;  4LLE A;  1IW7 F;  3K1I C;  2R9R B;  3KYJ A;  4JTC B;  4KBL A;  4O79 A;  4C3B A;  1QLE C;  2IBF A;  4YL3 A;  5KYY A;  2R05 A;  4MVU A;  3C7J A;  4E0H A;  1OKK D;  2R03 A;  3U2M A;  1ZHZ A;  4IRU A;  4RBN A;  4Q4Z F;  3ZQY A;  3U3F A;  3O55 A;  2Y3G A;  4PJM A;  2TMV P;  1T5O A;  4W8K A;  5COG A;  5D91 A;  4W8P A;  2WL8 A;  2OJE D;  1EKY A;  4BG0 A;  4DJ9 A;  3W4Y A;  3K1H A;  4JUR I;  4N06 A;  1PCX A;  2QE9 A;  1HE9 A;  2V3C C;  2Y69 C;  1MMD A;  1NSG B;  2OCC C;  4JRZ A;  4J7Y A;  3LS0 A;  3KPH A;  2YL7 A;  4NTF A;  3V5Z A;  2VCA A;  4EBJ A;  1A0B A;  2HJM A;  1ST6 A;  2AU5 A;  2NUT B;  2P1A A;  2PX0 A;  2W4M A;  3I5Q A;  5JT4 A;  4GYT A;  3V5Y A;  3ATP A;  5JVE A;  3CZ6 A;  4CDY A;  2OU6 A;  3HKK A;  3J06 A;  4GEH A;  4EHP A;  3ZDL A;  3CQZ A;  2J7P A;  2LSE A;  3AG2 C;  3C62 A;  3LUT B;  3VRC A;  2ZXR A;  2DGJ A;  3RIP A;  5CI8 A;  256B A;  1LS1 A;  3QMK A;  4LDK A;  3G50 A;  2A0B A;  1YLM A;  2L6G A;  4U5F E;  2KYH A;  2BE5 F;  4JCH A;  2J8W A;  4O6M A;  2A6H F;  4XEF A;  3C8Z A;  1CPQ A;  1ZHX A;  4YK5 A;  3IQ6 A;  2P7V A;  1SZI A;  2JX0 A;  2A6E F;  3RF3 A;  2OEV A;  1HMO A;  5HSW A;  3T9O A;  4MTG A;  2BL2 A;  1LI5 A;  4PR9 A;  4U9E A;  1KNY A;  4MVS A;  5HV9 A;  2HJ3 A;  3R2P A;  2RSE B;  4ZLC A;  4CDV A;  1VLT A;  4C7O B;  4NTB A;  1IZM A;  3W2V A;  3NYL A;  3RQF A;  1U89 A;  1M2O A;  3MBG A;  3OWT A;  5BQI A;  4I3M A;  3EJN A;  3HJC A;  1BZ4 A;  1T9K A;  2I15 A;  2QTV A;  4D4N A;  3F47 A;  2ZPA A;  4DBQ A;  5KYX B;  2IXM A;  1RKE A;  3ABK C;  3AQB A;  4N6H A;  3N0T A;  4MTF A;  1WAT A;  1C02 A;  3ITF A;  3C8G B;  2R7T A;  2XLO A;  3DM9 B;  2AVK A;  1ORJ A;  2C03 A;  3V5X A;  2H7B A;  2NG1 A;  2EPN A;  2IXO A;  5B3I A;  1OXB A;  3VM6 A;  4KNV A;  1Q0K A;  5A6K A;  2XRH A;  4QI2 A;  3EFO B;  4YT8 A;  2L6F A;  5A6B A;  2WZF A;  5AC5 A;  4OIP F;  1MMG A;  2XXA A;  2EPO A;  2XS1 A;  3U3B A;  1OW6 A;  1TQG A;  1O87 A;  2DI3 A;  3PMR A;  2HSQ A;  3Q6M A;  3L1M A;  2JD3 A;  1MMA A;  3EHM A;  1OCC C;  1RJ9 B;  3DXJ F;  4PJL A;  5T3W A;  1CGO A;  1QKR A;  2R25 A;  1NLX A;  2HFI A;  2OOC A;  4JEB A;  4PK4 A;  1HW2 A;  3JSE O;  4KC9 A;  4FES A;  1OCZ C;  4J32 B;  3UMH A;  3U9M A;  4NQF A;  5KYW B;  3S0X A;  1NG1 A;  3GWL A;  4C3D A;  4G78 A;  4YWQ A;  2QLA A;  2XLH A;  4QI0 A;  2J45 A;  4DVY P;  2EPM X;  4YN0 B;  1A7D A;  2CYD A;  2Q7R A;  4Z9J A;  1MMN A;  3EH1 A;  3GAN A;  4E7S A;  2ZXW C;  2KC3 A;  1Y4C A;  1A7E A;  1APC A;  3QW1 A;  4EIY A;  3JSZ A;  2F22 A;  4BJ5 A;  5KYN A;  3LLI A;  3L34 A;  3W2W A;  5B3S C;  4O7G A;  3EPV A;  1M6T A;  1LE4 A;  2FGY A;  1K05 A;  2GFH A;  3DE9 A;  3S84 A;  2J9B A;  4C3E A;  1MQV A;  4DXW A;  2Y3B A;  4BEJ A;  5CIV A;  3DJU B;  3RQE A;  1C03 A;  2VC9 A;  1ZW3 A;  1HMD A;  1G8X A;  3ZVR A;  3ZIB A;  5DQT A;  1ORS C;  1Q0D A;  3DAF A;  4BJ1 A;  1OR2 A;  4CBE A;  1UG7 A;  2W45 A;  5COF A;  5FZT A;  1CGN A;  2C04 A;  4XLN F;  3DZA A;  3EZH A;  3JYH A;  4Z9H A;  4P9T A;  1FFT C;  3FAP B;  1HY5 A;  1PV3 A;  4RD9 A;  4XEV A;  2PFD A;  3GEE A;  3IQ5 A;  2X51 A;  2Q4F A;  2YLD A;  2NSG A;  3EGX B;  1AEP A;  4U5B E;  1PD1 A;  2Q3T A;  5T3T A;  3BEH A;  5IY5 C;  1G4W R;  1TWC A;  3T6J A;  4CS7 A;  4ULV A;  1RCP A;  3ZSU A;  4WJ0 A;  2M4E A;  2WZG A;  3N24 A;  4K0D A;  4BJ5 C;  4CDA A;  2UUH A;  3MX3 A;  2I8B A;  2XLW A;  4L6R A;  2A1D D;  2YZS A;  3ZG1 A;  4OIO F;  1YA7 O;  3AJM A;  3AQC A;  1YJG A;  3T4R A;  1VOM A;  3JCU Q;  3O39 A;  5JS5 A;  1M2V A;  1Z6A A;  4XWJ A;  1BR2 A;  4AE4 A;  3EG9 A;  3EGD B;  1G5Z A;  2P61 A;  1RKC A;  3JTL O;  4XPW A;  1OXK A;  3NDB B;  4G0H A;  2FAP B;  5KYU A;  1T6U A;  3S9O A;  4DRI B;  1NFN A;  3F46 A;  1Z7Q c;  3AGU A;  4U5C E;  3TOM A;  1EA8 A;  3BRJ A;  3M79 A;  4MW8 A;  3B0P A;  5D92 A;  3A9C A;  1E84 A;  2GWW A;  1B68 A;  4K1O A;  4R32 A;  5GPG B;  4MND A;  2WVQ A;  1XWJ A;  4CS8 A;  2CNW A;  1ZU5 A;  3IPM O;  2D5R B;  4YT2 A;  3A11 A;  1YAU O;  1VYK A;  2Z15 A;  3NKE A;  4G7Z F;  2P6V A;  1GQA A;  2ICW G;  2GAQ A;  1A41 A;  1N1C A;  2KNH A;  2A68 F;  1DOW A;  2WVN A;  1SF8 A;  4WGZ A;  3DE8 A;  1GS9 A;  1V55 C;  5F5H A;  4AX2 A;  1Z3I X;  1T01 A;  4XLP F;  4AK9 A;  4MVO A;  3RH3 A;  2H8A A;  2QNL A;  2G3K A;  3OA1 A;  2G3V A;  1I4Y A;  1XZP A;  4LAC B;  4N4W A;  3DM5 A;  2HMZ A;  2YLG A;  1VMA A;  3NRH A;  1QVX A;  4Z9I A;  4QDL A;  2NSF A;  3LLK A;  4ULW A;  1WGW A;  5F28 E;  1W2W A;  1LE2 A;  1HW1 A;  3TOL A;  2MWQ A;  5EGY A;  1OW7 A;  2YL0 A;  5KYY B;  5EHH A;  2J9U A;  2XL4 A;  3DAG A;  1ZHT A;  1D1A A;  3MFN A;  5JRA A;  2XL8 A;  2LK4 A;  3NMJ A;  3O6X A;  1NBB A;  3LEV A;  2JPU A;  4AL0 A;  1T6I A;  3POV A;  1U6H A;  3L8J A;  1FMW A;  3IHU A;  2ZXO A;  4O6N A;  5JSL A;  3RKO F;  2UUI A;  4PFO A;  5COM A;  3SXZ A;  4DRJ B;  1BR1 A;  3T6G B;  2VB6 A;  2WB7 A;  3G4Z A;  3T6B A;  2EIK C;  3LS1 A;  3UNG C;  2XSE A;  4CS8 C;  4P9F A;  3OEO A;  2NPU A;  3QVY A;  1JAF A;  3WG7 C;  2V26 A;  5DS4 A;  2R7U A;  1K40 A;  2YQY A;  1Q0G A;  3M4C A;  4U5D E;  3HNL A;  4XPY A;  1D1B A;  4U5G A;  3AG3 C;  3PCV A;  2L81 A;  1SYQ A;  3K66 A;  3TK0 A;  2VH3 A;  2FFH A;  3C63 A;  2R7S A;  2NUP A;  1YYX A;  2WZL A;  2GA0 A;  1AVO B;  2ZXP A;  3FOP A;  4JW1 A;  3MYI A;  4MVQ A;  1ZHW A;  1NU9 C;  5K0I A;  3K7D A;  4HEA J;  4G7O F;  2RD9 A;  3IQC A;  2Y3D A;  1ZU4 A;  1ZW2 A;  4JTD B;  3PHF 2;  3FMS A;  5L0F A;  1Z63 A;  5L0D A;  1WOL A;  1H7I A;  1FMV A;  2HKV A;  1VLS A;  1YA9 A;  2YWA A;  1LM3 B;  1AUE A;  5L0C A;  1JOG A;  4WAB A;  3ZTM A;  2OKU A;  4YL0 A;  5EK0 A;  2LFF A;  1S05 A;  3FAJ A;  1TR2 A;  4LDR A;  3AGT A;  2WVO A;  2YL3 A;  1TWG A;  2L9J A;  4H54 A;  1BDJ B;  3RW0 A;  4EBK A;  3B9Q A;  4JVS A;  4DRH B;  1JRA A;  1FFH A;  1MND A;  3E70 C;  1LS4 A;  1G4U S;  2CGE A;  3TUL A;  1OR3 A;  4KNW A;  2R7O A;  3AOU A;  3DD7 A;  3FDQ A;  1TFO B;  3SXK A;  1C17 M;  2O9X A;  2IXP A;  2W4B A;  3HNI A;  3RFY A;  1RKE B;  2LIG A;  4YJW A;  5A69 A;  2YRF A;  1HE1 A;  2IOQ A;  2YLI A;  2Q9B A;  3JRM O;  3JYY A;  3KH2 A;  2KW3 C;  2YHS A;  4IAO A;  4O6Y A;  5A6J A;  1A7V A;  3DMD A;  3SNH A;  5L3Q A;  3GM3 A;  3UMI A;  2NUP B;  4I1O B;  4JEA A;  4MVM A;  5JP7 A;  3K33 A;  1JPN A;  3GM2 A;  1Z5Z A;  3N2Z B;  1EI7 A;  1LIH A;  2J7P D;  2YEV A;  4ER9 A;  3KMI A;  4N6C A;  3WOD F;  2Q9A A;  1TFK B;  2LCH A;  3EZI A;  3HTK C;  4GQH A;  2XM0 A;  2AP3 A;  2CDQ A;  4YT5 A;  4JE9 A;  4F4B A;  5L0I A;  1BBH A;  3V7O A;  4JJG A;  4DBR A;  2J9V A;  2VCC A;  3GOD A;  1D1C A;  3L8I A;  4HFF B;  4A4A A;  4JCZ A;  3H2V A;  3NYJ A;  2XXA B;  2AWC A;  2HMQ A;  2XLD A;  3NG1 A;  4IAQ A;  3VAY A;  1MNE A;  2QY9 A;  4JTA B;  4YL1 A;  3WHN A;  4E0I A;  4CSA A;  1K04 A;  1YZC A;  3E9V A;  4XQ1 A;  3UGO A;  3AG1 C;  3WAQ A;  5DS6 A;  5AC4 A;  3ABL C;  3MYF A;  5FCL A;  3NMK A;  3ZQV A;  2DYR C;  5B1A C;  2IXN A;  3DKA A;  3K1I A;  3L0I A;  3PDM P;  2HUJ A;  2KSF A;  3NYM A;  1H6G A;  2LFD A;  4J30 B;  4J7T A;  4RDA A;  5BUO A;  2H7O A;  1KTM A;  3UR3 C;  2R7Q A;  3EH2 A;  2AWY A;  2X0C A;  2MYS A;  4EKW A;  1Y6D A;  1ZVZ A;  2KGO A;  4G7H F;  4BJ6 A;  3B0U X;  1D0Y A;  2G62 A;  3ABM C;  1BR4 A;  1EQ1 A;  1CPR A;  4K7B A;  5DQZ A;  4OIN F;  1PD0 A;  1QPU A;  2NUT A;  3HNJ A;  4HFK B;  3M15 A;  4U5E E;  1Z23 A;  2R7W A;  1XZQ A;  4H4K C;  3W8H A;  2HV7 A;  1I5N A;  1S7Z A;  2B0H A;  2HSB A;  5DLJ A;  4ZLD A;  3CSK A;  3ECS A;  5F5F A;  1WAS A;  1YAR O;  2OQM A;  1F1M A;  3HNK A;  4MQ9 F;  3CAX A;  1OQC A;  4CSA C;  1LVK A;  2M64 A;  2P0N A;  3FXH A;  2YL1 A;  2EIM C;  5E3C A;  3LEO A;  1JMW A;  2VAS A;  2GDC A;  2W9Y A;  3JRT A;  1LI7 A;  3RYL A;  5A6B D;  2EPL X;  2D4U A;  3KYI A;  1FNT c;  3LES A;  4DVZ A;  4FWV A;  4ONS A;  3JZ0 A;  2H7V C;  1OCO C;  4LDQ A;  2L7A A;  4JZA A;  5E33 A;  3I5P A;  1GM5 A;  3GEI A;  3LJB A;  1O3U A;  2KQ9 A;  2MHR A;  3I4U A;  1O5H A;  3O10 A;  3VYW A;  1E85 A;  4IGG A;  1GGQ A;  2XL6 A;  2XLE A;  1WWP A;  3U8V A;  3LNR A;  4BJ6 C;  5BQH A;  4CJG A;  4C7O A;  2Y39 A;  3H65 A;  3JT1 A;  2OG2 A;  4I1M A;  3R7C A;  4P6I C;  2LQG A;  3RVZ A;  3TJ5 A;  3SP1 A;  5L0G A;  3QZC A;  4E18 A;  3DI5 A;  4E17 A;  4MW3 A;  5KYX A;  5JLI A;  2Y3H A;  2XS8 A;  1M2V B;  4IB4 A;  1Q0M A;  2ETS A;  3LNM B;  4AE4 B;  3LAY A;  3Q6N A;  3EG9 B;  4U5H A;  3B29 A;  1QSP A;  3C8G A;  3S28 A;  4KI2 A;  4Q7C A;  5KYU B;  4UDV A;  3S29 A;  4IJJ A;  5JUA A;  1JPJ A;  3TJ6 A;  1QQ3 A;  3QVZ A;  4U9D A;  2PP4 A;  1YVI A;  4I44 A;  3S27 A;  2J0W A;  2PBE A;  1ZYR F;  3M1C B;  3EFO A;  3UGP A;  3W8I A;  2L6H A;  3U8P A;  3C18 A;  4B6I A;  3SYN A;  4BJT A;  4LLC A;  5TJ5 E;  3GOR A;  4AL1 A;  2YVK A;  3SZR A;  3ZWI A;  4OIR F;  3TD7 A;  4PJJ A;  1CGM E;  4PJN A;  4E7Z A;  1RJ9 A;  4BEM J;  5A6A A;  1TWA A;  3UMK A;  3S90 A;  1RXQ A;  1WN0 A;  2XLV A;  2IYL D;  2A0U A;  3U0C A;  2OEX A;  4BPM A;  1V74 B;  3HLZ A;  4FX5 A;  5KYW A;  3GWN A;  5L0J A;  3FOO A;  2HS5 A;  4OIQ F;  1VK5 A;  2HZ8 A;  4IAR A;  4OD5 A;  1UFB A;  1NU7 D;  5L3V A;  3KKB A;  1E83 A;  1OKK A;  5AGF A;  3X2Q C;  1TWH A;  4JJF A;  3QTH A;  1U0B B;  4NTA A;  4ANJ A;  2PX3 A;  4XTK A;  1OW8 A;  3U5S A;  1I4Z A;  5L0H A;  2XM4 A;  4OD4 A;  2A69 F;  4Q5S F;  3FVY A;  2R02 A;  3ZTZ A;  3H2U A;  4CX9 A;  3CEX A;  2PF4 E;  3IQT A;  1FTS A;  1LPE A;  2J46 A;  1KU2 A;  2ASR A;  3B0V C;  4MVR A;  1LKX A;  1L3P A;  3ASN C;  1H9T A;  2KJG A;  2PNO A;  1SR2 A;  4CIH A;  1M57 C;  1NZE A;  3AG4 C;  1QZX A;  2B0J A;  3X1O A;  3VF0 A;  4FAP B;  1R5I D;  2R7R A;  3RQG A;  1WTY A;  2BC5 A;  4D4X A;  3RVY A;  4CIP A;  4CS9 A;  1VTM P;  2OJQ A;  3NMI A;  1ORY A;  1TKN A;  4M63 A;  3QW0 A;  2HV6 A;  2CNW D;  2J9W A;  3SXY A;  1J8Y F;  1D0Z A;  4A2N B;  1ZHY A;  3FHD A;  3NKD A;  4DOZ A;  1VB5 A;  3GEH A;  1DOV A;  5B1B C;  3ZC4 A;  2R7X A;  2CW0 F;  3EGX A; 
#chains in the Genus database with same CATH homology
 2QNL A;  2YQY A;  5COF A;  3CEX A;  5COG A;  3GOR A;  2NSF A;  2QE9 A;  3DI5 A;  1RXQ A;  2OQM A;  3DKA A;  2NSG A;  2RD9 A;  2F22 A;  2P1A A;  2OU6 A;  2HKV A;  5COM A;  5CIV A;  4N6C A;  3QTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...