3GORA

Crystal structure of putative metal-dependent hydrolase apc36150
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
157
structure length
157
Chain Sequence
SNAMSRAKKWVQYFLSHRHVTMELIHKIDEAHYDYKPTPTSMTAKQLATHMLFSFYNFANTAKHGDPSLFRQKIEEPETNLAKLAETYTEKTRQLIESMSDDDFDRTLDLTAIFGTQMSTAQFLQLAMDHEIHHKGQLFVYVRGMGHTDLPLFVKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of DinB from Geobacillus stearothermophilus: a representative of a unique four-helix-bundle superfamily.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
molecule keywords Putative metal-dependent hydrolase
total genus 50
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-03-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) dinb family like domain 3gorA01
2F22A 5CIVA 1RXQA 3CEXA 2RD9A 3DKAA 5COMA 3DI5A 2HKVA 3QTHA 2NSGA 3GORA 2OQMA 2P1AA 5COGA 2OU6A 2NSFA 2YQYA 2QE9A 2QNLA 4N6CA 5COFA
chains in the Genus database with same CATH superfamily
2DYSC 5CIVA 2X0CA 1M57C 2L6FA 4EBKA 5KYNA 2J45A 1FAPB 3AG1C 2UUIA 1APCA 1PV3A 1ORYA 1TR2A 1GS9A 1NSGB 4U5GA 4WABA 3RIPA 2GAQA 3I5PA 1NFNA 3UNGC 4U5EE 1XWJA 2WVNA 2LK4A 4PACA 3DJUB 3TD7A 3T6BA 1GGQA 2XLMA 4W8KA 4BJTA 2JD3A 4KBLA 3K33A 2J0XA 3S27A 2BL2A 3CSKA 5B3IA 3TOMA 4BG0A 3ZQYA 3DE9A 2ZPAA 5JRAA 1EA8A 3HKKA 4IGGA 3US6A 5DVWA 2Y69C 2OKUA 3NMJA 3QZCA 2Z15A 4P9FA 1H9GA 1ZU4A 2P6VA 1LVKA 4P6IC 4XPWA 2AU5A 2G62A 2OJED 4PJLA 1QKRA 1VLTA 2J46A 1C03A 2L81A 3DE8A 3EZHA 2XL4A 2BE5F 3JCUQ 4MTFA 5L3QA 4ANJA 4MS2A 4MVMA 4IB4A 2HUJA 5FZTA 2Y39A 1T6IA 1VK5A 2YRFA 3I5QA 4B6IA 1NG1A 1SR2A 2LD6A 2V26A 4YL3A 2J7PA 5KYXB 2IXPA 4DBRA 1BDJB 2D4UA 3EGXB 2NUTB 1G8XA 3U8PA 1Q0KA 3LS1A 1NFOA 3HJCA 4MQ9F 2CCYA 2GFHA 3VM6A 1AUEA 1K05A 2RSEB 2WZLA 2OJQA 3GWNA 4C3DA 2L7AA 4G7ZF 1L7CA 3AQBA 4AE4B 2YL1A 4GYTA 2WVOA 3F47A 1NU9C 3AG2C 4FX5A 3KH2A 4CIPA 4Q7CA 3N0TA 1NZEA 2YEVA 2WB7A 3K7DA 2MHRA 1FNTc 4O7GA 4CBEA 1FMVA 1AEPA 1O5HA 2EPKX 1YA7O 1OR2A 2GWWA 2OEXA 3C8GA 3DKAA 4BEJA 1FFTC 3EQLF 4IAOA 4JC7A 3LLKA 2IBFA 2OOCA 3AG3C 2R7SA 1T9KA 2JPUA 4G7OF 3HNJA 4GEHA 1OCCC 2Y3DA 1VMAA 4DJ9A 4Z9JA 3EH2A 4JIOA 2ICWG 1CPRA 2I15A 4JTAB 2J7PD 1UFBA 1LI5A 1TWAA 3B29A 5KYUA 1ZYRF 2H7VC 3H2VA 3K1IA 4ER9A 2C04A 5F28E 5K0IA 2QTVA 5A6BD 3RQFA 5DQTA 2R7RA 1FR0A 3OA1A 2ZXRA 3AOUA 1C17M 1TFOB 2A68F 1QPUA 2XL8A 2YWAA 4I1MA 1H6GA 2YLGA 3U0CA 1GQAA 2R05A 2EINC 5IY5C 4U9DA 4RDAA 3WG7C 4C3BA 1ORJA 1VLSA 3FVYA 4LACB 4EWCA 1LIHA 3JT1A 2I8BA 3Q6NA 3SXZA 1A0BA 1ZU5A 4LERA 4H54A 4KNWA 5JUAA 2HJMA 3EGXA 4MW8A 1OW8A 1M56C 3ZWIA 1D1BA 2KW3C 3O6XA 1Z6AA 1ZHYA 3W2VA 3G4XA 3KL4A 1YARO 2LQGA 4EKWA 1MMNA 2CYDA 3KYIA 1KU2A 2P61A 2W4BA 3O39A 4IAQA 2NUTA 3POVA 4ONSA 2AWCA 4CS8A 1VTMP 2DI3A 5EGYA 5JSLA 4AE4A 4WGZA 256BA 2A0UA 3BEHA 4XTKA 2BC5A 4DRHB 4YT4A 5DLJA 2V3CC 2FAPB 3L8IA 4IJJA 3JYYA 3GANA 4JJFA 4JEBA 2L6HA 2ZXOA 2R7TA 3ECSA 4JW1A 5BQGA 3UMHA 2YVKA 1YZAA 1RJ9B 2VH3A 3T6GB 1AVOB 3DM5A 2QLAA 3LNRA 3F46A 1FFHA 1Z7Qc 3SXMA 4CSAC 2VC9A 3DM9B 4XQ1A 4CS9A 2J9VA 3LESA 3IQ5A 5T1DB 2HKVA 1OCOC 3X2QC 5F5HA 5A6JA 3GEEA 1IZMA 1V74B 3CQZA 3LLIA 1BR4A 3L1MA 1KTMA 2HV7A 4DBQA 2OCCC 2CNWA 1BR2A 2R7OA 3DMDA 2MYSA 4MNDA 2R9RB 4X0RA 3RYLA 3M1CB 4E7ZA 2C03A 4RBNA 4CDVA 3S28A 1BBHA 2HSQA 2FFHA 2XLOA 5JVEA 3ZSUA 1TQGA 2KSFA 3GM1A 2B0JA 4PFPA 3QW1A 4PJMA 3ZDLA 1S05A 1A7EA 4KC9A 5KYWA 3DD7A 1QLEC 2LCHA 3EG9A 3OEOA 2IYLD 4RD9A 3ZTZA 4DXWA 5AC4A 5DS6A 3DZAA 4MTGA 4NY3A 4CX9A 4Q4ZF 5CI9A 3C18A 5FCLA 4QDLA 1A41A 4XEKA 3RKOF 1E2XA 3FOOA 4HFFB 5L0IA 3HNKA 1YA9A 5B1BC 2YLIA 4EUKB 1V54C 3DXJF 3GORA 3O10A 1J8YF 3ZTMA 1RMVA 2IXNA 2XM4A 4YWQA 2Y3GA 3RW0A 2H7OA 4UDVA 4NQFA 4K7BA 1XZQA 3ITFA 4CJGA 4OIQF 4O6MA 3MFNA 1CGNA 1OCZC 1ZZPA 3FAPB 4J32B 4CJOA 1E86A 5B1AC 5GPGB 2NUPA 4Z9IA 4MVUA 2E87A 5TJ5E 5D91A 3S9OA 4AL1A 5DS4A 2XS8A 2KNHA 2JX0A 3EH1A 5BQHA 2O9XA 4KNVA 3RFYA 4MVRA 2XLHA 1D0ZA 2A0BA 3SXKA 1YYXA 1Z3IX 3LAYA 4JRZA 1ORSC 1BR1A 3NDBB 1SF8A 4QI0A 2VCCA 3ZG1A 1TWGA 3B0UX 2CW0F 1W2WA 4AX2A 3JTLO 1JAFA 1WTYA 2WVQA 3RQGA 4E18A 3HTKC 3JSEO 1G5ZA 3SNHA 5E3AA 4CS8C 3S90A 2J0WA 1WASA 3A11A 2A6EF 2J8WA 4O79A 1CGME 4JTCB 2HJ3A 2VASA 4U5BE 4J7TA 4G7HF 3JRMO 2W9YA 5COFA 4CDAA 2J9BA 4OIOF 2PX0A 5HSWA 3EZIA 5A69A 2A6HF 1K04A 1U6HA 1M2OA 3QMKA 2EIKC 2QY9A 3QVZA 4O6NA 4CS9C 2R7WA 3C62A 2HSBA 1R4TA 3DWWA 2D5RB 2NUPB 3K6BA 3T6JA 1J8MF 1WWPA 2Q9AA 2P7VA 2R03A 3NYJA 1H7IA 4FWVA 3U3FA 2EPNA 5L0CA 4D4NA 1JPJA 4JJGA 4XEFA 3T9OA 3J06A 4PR9A 3JYHA 1O87A 4EBJA 1FMWA 2VB6A 1OKKD 2P1AA 3GM2A 2Q3TA 2EIJC 2KQ9A 1O3UA 2X51A 2YLDA 3M4CA 4XPXA 1OQCA 4DVZA 3R7CA 4XLPF 1VB5A 4XWJA 1VOMA 5F5FA 3TK0A 5KYWB 5JS5A 1F1MA 3GWLA 4LDRA 1Q0MA 4OINF 1I4YA 3LJBA 2YKZA 1G4US 1YLMA 2J9UA 2LFFA 1NLXA 2OEVA 2XRHA 1WATA 3B0PA 2PP4A 1EI7A 4GQHA 3SXYA 3PDMP 1FTSA 4I44A 2AP3A 1XZPA 2R02A 1M2VA 2QUPA 3IQCA 3MYFA 5CI8A 4Z9HA 1JR8A 3TQOA 1N1CA 2YL7A 2H8AA 2XSEA 1D1AA 3VRCA 4JKVA 4ZLCA 3U2MA 3M15A 4JZAA 5E3CA 5BUOA 3FDQA 5JLIA 1Q0FA 3CZ6A 4IARA 2DB4A 3UMIA 1Y6DA 4FESA 4N4WA 1I4ZA 1Y4CA 4XLNF 1ZHZA 3RH3A 4KI2A 2EIMC 5JP7A 2NSFA 3V5ZA 4R32A 4MVOA 2VCBA 3WAQA 2TMVP 1Z5ZA 3W4YA 3DJNB 1OKKA 4FAPB 3EHNA 1IW7F 3KPHA 4E17A 1OXBA 2CGEA 1E84A 1HY5A 3AJMA 4DOZA 2PX3A 4U9EA 5HV9A 3DAFA 2ZXWC 4N06A 2YHSA 3U5SA 2HMQA 4YT2A 5DS5A 5EK0A 2GA0A 1YJGA 3M4BA 4MTOA 4XPYA 1U89A 2LFDA 3VYWA 3X1OA 4YJWA 4LDKA 5L0FA 3I4UA 2AWYA 3PMRA 4P9TA 1LE2A 1RKCA 3EGDA 1G4WR 2Y3BA 1M2VB 1QVXA 2UUHA 3ATPA 1Q0DA 3FOPA 3OWTA 4IWBA 3RF3A 2MWQA 5L0DA 5KYYA 5AC5A 2R7VA 2W4MA 1UG7A 4MVZA 1D0XA 5COGA 3Q7GA 4E0HA 2YL3A 3VF0A 3EFOB 2WL8A 1RCPA 4XEVA 1U0BB 1YZCA 4C3EA 4D4XA 4G0HA 3UGOA 2LSEA 3N24A 2PFDA 1EQ1A 3SP1A 3V5XA 1PCXA 3M79A 4YL0A 3PCVA 1CPQA 3GEIA 4M63A 3IEEA 3G50A 1V4AA 4JURI 3EG9B 3BRJA 2XM0A 2XLWA 3ABMC 1WN0A 3FXHA 3W2WA 3S84A 1E83A 4A4AA 3EPVA 3AGTA 1OXKA 1HW1A 2XXAB 2XXAA 2R7UA 3CAXA 3E70C 1R5ID 1YYJA 2A69F 4OD5A 1MMDA 1S7ZA 3AQCA 1Z63A 3V5YA 5BQIA 2XLEA 5L0HA 2OG2A 4C7OB 3GM3A 4YL1A 4BJ6C 2ETSA 2W45A 1PD1A 3L8JA 4EHPA 3H2UA 2F22A 4LLEA 2WZFA 4JCHA 2HZ8A 1HE9A 3HLZA 3MYIA 1OW7A 1RXQA 2HFIA 1YVIA 4J30B 2NPUA 1T5OA 2XLVA 3ZQVA 5T3TA 2KC3A 2CDQA 4MVSA 3TJ6A 3ABKC 3IPMO 2M64A 4JTDB 4JVSA 5EHHA 1OR3A 4A2NB 3W8IA 3O55A 1RKEA 3Q6MA 1JOGA 3K1HA 2KK1A 2LIGA 1TKNA 2L6GA 3EJNA 4F4BA 4YK5A 4W8PA 4U5FE 2R7QA 2Q9CA 5KYUB 1VYIA 2OQMA 1MNDA 4PJJA 4U5CE 1I5NA 5KYYB 1A7VA 2YQYA 1RJ9A 1DOVA 4HE8D 1JMWA 4PK4A 1DOWA 2EPOA 4K0DA 3Q7LA 4YT8A 4I3MA 3UGPA 3NMIA 4LLCA 3V7OA 4NCQA 4N6CA 3EFOA 1Z23A 3U2LA 2IXOA 3B0VC 2CNWD 4JE9A 4J7YA 3C8GD 4BJ5A 4CS7A 2H7BA 4ZLDA 2HMZA 1SMYF 3EHMA 5DQZA 4NC3A 3ASNC 4MW3A 3G4ZA 2G3VA 2KGOA 3NKDA 3KKBA 4E7SA 1NU7D 2ZXPA 1LI7A 4EBBA 1LM3B 3L34A 4O6YA 1SYQA 1YDIA 3B71A 3DAGA 3NG1A 4L6RA 3NKEA 5A6KA 5L3VA 1T6UA 5AGFA 1Q0GA 3R2PA 1D0YA 1V55C 3IHUA 3NMKA 1A7DA 3HNLA 3NRHA 1QZXA 2Q4FA 3U8VA 2KJGA 2VCAA 1HMOA 2XL6A 2NG1A 2ZD9A 1TFKB 4WGYA 1RKEB 3T4RA 1H9TA 2FGYA 3W8HA 2HS5A 1VYKA 4K1OA 4U5HA 3C63A 1ZHTA 1ST6A 4DVYP 1LS4A 3C7JA 3LEVA 3LNMB 3RVZA 1JRAA 2L9JA 1BZ4A 3MLGA 3NYMA 1TWCA 4AL0A 4WJ0A 1ZVZA 2EILC 4CSAA 4DRIB 1ZW2A 3FMSA 2XLDA 2J9WA 3QVYA 4I1OB 4MVQA 4NTBA 1EKYA 1GM5A 2PF4E 3AG4C 4H4KC 5A6AA 2GDCA 2NSGA 2R25A 2EPMX 4BPMA 3JSZA 4ULWA 4EIYA 3K1IC 2IOQA 2YZSA 4CDYA 4BJ6A 3ZC4A 3AGUA 3GODA 3H65A 3KMIA 4PFOA 3ZIBA 3E9VA 4QI2A 3UMKA 3SYNA 2WZGA 2QNLA 1T6QA 3L0IA 4OIRF 3PHF2 2PNOA 2PBEA 5D92A 1ZHWA 2Y3HA 3LUTB 3C8ZA 3FHDA 3VAYA 2R7XA 2AVKA 2HV6A 3K66A 3KYJA 2IM8A 4Q5SF 4JCZA 3JRTA 3WHNA 1L3PA 3A9CA 3TOLA 3ABLC 4AK9A 4OIPF 4ULVA 1B68A 2G3KA 1PD0A 3DI5A 1YAUO 3N2ZB 3RVYA 4HEAJ 3MX3A 1ZW3A 1CGOA 2IXMA 2LP4A 1WGWA 1M6TA 2ASRA 1C02A 5KYXA 3S29A 1MMAA 1SZIA 4N6HA 4CIHA 3LS0A 2OU6A 3ASOC 2M4EA 2QE9A 4BEMJ 1KNYA 3QW0A 2Q00A 5E2QA 1LE4A 4JEAA 5E33A 4BJ5C 4IRUA 2DYRC 4G78A 3IQ6A 4YN0B 2DGJA 4OD4A 2YL0A 3NYLA 4LDQA 4HFKB 4DRJB 3HNIA 3TJ5A 3S0XA 2Q7RA 5A6BA 3CEXA 1JPNA 5B3SC 1NBBA 2B0HA 1OCRC 1OW6A 1QQ3A 1LS1A 2EPLX 2RD9A 1LPEA 1T01A 4PJNA 1TWHA 5COMA 3FAJA 3U3BA 1HW2A 1HE1A 3SZRA 3U9JA 3U9MA 4BJ1A 5JT4A 3RQEA 2KYHA 3IQTA 3QTHA 3LEOA 3EGDB 3UR3C 3SEOA 1E85A 3C8GB 4NTAA 4YT5A 5L0JA 1MNEA 2P0NA 1QSPA 3GEHA 4E0IA 5L0GA 2Q9BA 1WOLA 3TULA 4C7OA 2XS1A 1HMDA 1D1CA 1K40A 3B9QA 4U5DE 1ZHXA 1MMGA 4NTFA 3WODF 1MQVA 5T3WA 3JZ0A 3MBGA 3ZVRA 2A1DD 1LKXA
chains in the Genus database with same CATH topology
2F22A 5CIVA 1RXQA 3CEXA 2RD9A 3DKAA 5COMA 3DI5A 2HKVA 3QTHA 2NSGA 3GORA 2OQMA 2P1AA 5COGA 2OU6A 2NSFA 2YQYA 2QE9A 2QNLA 4N6CA 5COFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F22 A;  5CIV A;  1RXQ A;  3CEX A;  2RD9 A;  3DKA A;  5COM A;  3DI5 A;  2HKV A;  3QTH A;  2NSG A;  3GOR A;  2OQM A;  2P1A A;  5COG A;  2OU6 A;  2NSF A;  2YQY A;  2QE9 A;  2QNL A;  4N6C A;  5COF A; 
#chains in the Genus database with same CATH topology
 2DYS C;  5CIV A;  2X0C A;  1M57 C;  2L6F A;  4EBK A;  5KYN A;  2J45 A;  1FAP B;  3AG1 C;  2UUI A;  1APC A;  1PV3 A;  1ORY A;  1TR2 A;  1GS9 A;  1NSG B;  4U5G A;  4WAB A;  3RIP A;  2GAQ A;  3I5P A;  1NFN A;  3UNG C;  4U5E E;  1XWJ A;  2WVN A;  2LK4 A;  4PAC A;  3DJU B;  3TD7 A;  3T6B A;  1GGQ A;  2XLM A;  4W8K A;  4BJT A;  2JD3 A;  4KBL A;  3K33 A;  2J0X A;  3S27 A;  2BL2 A;  3CSK A;  5B3I A;  3TOM A;  4BG0 A;  3ZQY A;  3DE9 A;  2ZPA A;  5JRA A;  1EA8 A;  3HKK A;  4IGG A;  3US6 A;  5DVW A;  2Y69 C;  2OKU A;  3NMJ A;  3QZC A;  2Z15 A;  4P9F A;  1H9G A;  1ZU4 A;  2P6V A;  1LVK A;  4P6I C;  4XPW A;  2AU5 A;  2G62 A;  2OJE D;  4PJL A;  1QKR A;  1VLT A;  2J46 A;  1C03 A;  2L81 A;  3DE8 A;  3EZH A;  2XL4 A;  2BE5 F;  3JCU Q;  4MTF A;  5L3Q A;  4ANJ A;  4MS2 A;  4MVM A;  4IB4 A;  2HUJ A;  5FZT A;  2Y39 A;  1T6I A;  1VK5 A;  2YRF A;  3I5Q A;  4B6I A;  1NG1 A;  1SR2 A;  2LD6 A;  2V26 A;  4YL3 A;  2J7P A;  5KYX B;  2IXP A;  4DBR A;  1BDJ B;  2D4U A;  3EGX B;  2NUT B;  1G8X A;  3U8P A;  1Q0K A;  3LS1 A;  1NFO A;  3HJC A;  4MQ9 F;  2CCY A;  2GFH A;  3VM6 A;  1AUE A;  1K05 A;  2RSE B;  2WZL A;  2OJQ A;  3GWN A;  4C3D A;  2L7A A;  4G7Z F;  1L7C A;  3AQB A;  4AE4 B;  2YL1 A;  4GYT A;  2WVO A;  3F47 A;  1NU9 C;  3AG2 C;  4FX5 A;  3KH2 A;  4CIP A;  4Q7C A;  3N0T A;  1NZE A;  2YEV A;  2WB7 A;  3K7D A;  2MHR A;  1FNT c;  4O7G A;  4CBE A;  1FMV A;  1AEP A;  1O5H A;  2EPK X;  1YA7 O;  1OR2 A;  2GWW A;  2OEX A;  3C8G A;  3DKA A;  4BEJ A;  1FFT C;  3EQL F;  4IAO A;  4JC7 A;  3LLK A;  2IBF A;  2OOC A;  3AG3 C;  2R7S A;  1T9K A;  2JPU A;  4G7O F;  3HNJ A;  4GEH A;  1OCC C;  2Y3D A;  1VMA A;  4DJ9 A;  4Z9J A;  3EH2 A;  4JIO A;  2ICW G;  1CPR A;  2I15 A;  4JTA B;  2J7P D;  1UFB A;  1LI5 A;  1TWA A;  3B29 A;  5KYU A;  1ZYR F;  2H7V C;  3H2V A;  3K1I A;  4ER9 A;  2C04 A;  5F28 E;  5K0I A;  2QTV A;  5A6B D;  3RQF A;  5DQT A;  2R7R A;  1FR0 A;  3OA1 A;  2ZXR A;  3AOU A;  1C17 M;  1TFO B;  2A68 F;  1QPU A;  2XL8 A;  2YWA A;  4I1M A;  1H6G A;  2YLG A;  3U0C A;  1GQA A;  2R05 A;  2EIN C;  5IY5 C;  4U9D A;  4RDA A;  3WG7 C;  4C3B A;  1ORJ A;  1VLS A;  3FVY A;  4LAC B;  4EWC A;  1LIH A;  3JT1 A;  2I8B A;  3Q6N A;  3SXZ A;  1A0B A;  1ZU5 A;  4LER A;  4H54 A;  4KNW A;  5JUA A;  2HJM A;  3EGX A;  4MW8 A;  1OW8 A;  1M56 C;  3ZWI A;  1D1B A;  2KW3 C;  3O6X A;  1Z6A A;  1ZHY A;  3W2V A;  3G4X A;  3KL4 A;  1YAR O;  2LQG A;  4EKW A;  1MMN A;  2CYD A;  3KYI A;  1KU2 A;  2P61 A;  2W4B A;  3O39 A;  4IAQ A;  2NUT A;  3POV A;  4ONS A;  2AWC A;  4CS8 A;  1VTM P;  2DI3 A;  5EGY A;  5JSL A;  4AE4 A;  4WGZ A;  256B A;  2A0U A;  3BEH A;  4XTK A;  2BC5 A;  4DRH B;  4YT4 A;  5DLJ A;  2V3C C;  2FAP B;  3L8I A;  4IJJ A;  3JYY A;  3GAN A;  4JJF A;  4JEB A;  2L6H A;  2ZXO A;  2R7T A;  3ECS A;  4JW1 A;  5BQG A;  3UMH A;  2YVK A;  1YZA A;  1RJ9 B;  2VH3 A;  3T6G B;  1AVO B;  3DM5 A;  2QLA A;  3LNR A;  3F46 A;  1FFH A;  1Z7Q c;  3SXM A;  4CSA C;  2VC9 A;  3DM9 B;  4XQ1 A;  4CS9 A;  2J9V A;  3LES A;  3IQ5 A;  5T1D B;  2HKV A;  1OCO C;  3X2Q C;  5F5H A;  5A6J A;  3GEE A;  1IZM A;  1V74 B;  3CQZ A;  3LLI A;  1BR4 A;  3L1M A;  1KTM A;  2HV7 A;  4DBQ A;  2OCC C;  2CNW A;  1BR2 A;  2R7O A;  3DMD A;  2MYS A;  4MND A;  2R9R B;  4X0R A;  3RYL A;  3M1C B;  4E7Z A;  2C03 A;  4RBN A;  4CDV A;  3S28 A;  1BBH A;  2HSQ A;  2FFH A;  2XLO A;  5JVE A;  3ZSU A;  1TQG A;  2KSF A;  3GM1 A;  2B0J A;  4PFP A;  3QW1 A;  4PJM A;  3ZDL A;  1S05 A;  1A7E A;  4KC9 A;  5KYW A;  3DD7 A;  1QLE C;  2LCH A;  3EG9 A;  3OEO A;  2IYL D;  4RD9 A;  3ZTZ A;  4DXW A;  5AC4 A;  5DS6 A;  3DZA A;  4MTG A;  4NY3 A;  4CX9 A;  4Q4Z F;  5CI9 A;  3C18 A;  5FCL A;  4QDL A;  1A41 A;  4XEK A;  3RKO F;  1E2X A;  3FOO A;  4HFF B;  5L0I A;  3HNK A;  1YA9 A;  5B1B C;  2YLI A;  4EUK B;  1V54 C;  3DXJ F;  3GOR A;  3O10 A;  1J8Y F;  3ZTM A;  1RMV A;  2IXN A;  2XM4 A;  4YWQ A;  2Y3G A;  3RW0 A;  2H7O A;  4UDV A;  4NQF A;  4K7B A;  1XZQ A;  3ITF A;  4CJG A;  4OIQ F;  4O6M A;  3MFN A;  1CGN A;  1OCZ C;  1ZZP A;  3FAP B;  4J32 B;  4CJO A;  1E86 A;  5B1A C;  5GPG B;  2NUP A;  4Z9I A;  4MVU A;  2E87 A;  5TJ5 E;  5D91 A;  3S9O A;  4AL1 A;  5DS4 A;  2XS8 A;  2KNH A;  2JX0 A;  3EH1 A;  5BQH A;  2O9X A;  4KNV A;  3RFY A;  4MVR A;  2XLH A;  1D0Z A;  2A0B A;  3SXK A;  1YYX A;  1Z3I X;  3LAY A;  4JRZ A;  1ORS C;  1BR1 A;  3NDB B;  1SF8 A;  4QI0 A;  2VCC A;  3ZG1 A;  1TWG A;  3B0U X;  2CW0 F;  1W2W A;  4AX2 A;  3JTL O;  1JAF A;  1WTY A;  2WVQ A;  3RQG A;  4E18 A;  3HTK C;  3JSE O;  1G5Z A;  3SNH A;  5E3A A;  4CS8 C;  3S90 A;  2J0W A;  1WAS A;  3A11 A;  2A6E F;  2J8W A;  4O79 A;  1CGM E;  4JTC B;  2HJ3 A;  2VAS A;  4U5B E;  4J7T A;  4G7H F;  3JRM O;  2W9Y A;  5COF A;  4CDA A;  2J9B A;  4OIO F;  2PX0 A;  5HSW A;  3EZI A;  5A69 A;  2A6H F;  1K04 A;  1U6H A;  1M2O A;  3QMK A;  2EIK C;  2QY9 A;  3QVZ A;  4O6N A;  4CS9 C;  2R7W A;  3C62 A;  2HSB A;  1R4T A;  3DWW A;  2D5R B;  2NUP B;  3K6B A;  3T6J A;  1J8M F;  1WWP A;  2Q9A A;  2P7V A;  2R03 A;  3NYJ A;  1H7I A;  4FWV A;  3U3F A;  2EPN A;  5L0C A;  4D4N A;  1JPJ A;  4JJG A;  4XEF A;  3T9O A;  3J06 A;  4PR9 A;  3JYH A;  1O87 A;  4EBJ A;  1FMW A;  2VB6 A;  1OKK D;  2P1A A;  3GM2 A;  2Q3T A;  2EIJ C;  2KQ9 A;  1O3U A;  2X51 A;  2YLD A;  3M4C A;  4XPX A;  1OQC A;  4DVZ A;  3R7C A;  4XLP F;  1VB5 A;  4XWJ A;  1VOM A;  5F5F A;  3TK0 A;  5KYW B;  5JS5 A;  1F1M A;  3GWL A;  4LDR A;  1Q0M A;  4OIN F;  1I4Y A;  3LJB A;  2YKZ A;  1G4U S;  1YLM A;  2J9U A;  2LFF A;  1NLX A;  2OEV A;  2XRH A;  1WAT A;  3B0P A;  2PP4 A;  1EI7 A;  4GQH A;  3SXY A;  3PDM P;  1FTS A;  4I44 A;  2AP3 A;  1XZP A;  2R02 A;  1M2V A;  2QUP A;  3IQC A;  3MYF A;  5CI8 A;  4Z9H A;  1JR8 A;  3TQO A;  1N1C A;  2YL7 A;  2H8A A;  2XSE A;  1D1A A;  3VRC A;  4JKV A;  4ZLC A;  3U2M A;  3M15 A;  4JZA A;  5E3C A;  5BUO A;  3FDQ A;  5JLI A;  1Q0F A;  3CZ6 A;  4IAR A;  2DB4 A;  3UMI A;  1Y6D A;  4FES A;  4N4W A;  1I4Z A;  1Y4C A;  4XLN F;  1ZHZ A;  3RH3 A;  4KI2 A;  2EIM C;  5JP7 A;  2NSF A;  3V5Z A;  4R32 A;  4MVO A;  2VCB A;  3WAQ A;  2TMV P;  1Z5Z A;  3W4Y A;  3DJN B;  1OKK A;  4FAP B;  3EHN A;  1IW7 F;  3KPH A;  4E17 A;  1OXB A;  2CGE A;  1E84 A;  1HY5 A;  3AJM A;  4DOZ A;  2PX3 A;  4U9E A;  5HV9 A;  3DAF A;  2ZXW C;  4N06 A;  2YHS A;  3U5S A;  2HMQ A;  4YT2 A;  5DS5 A;  5EK0 A;  2GA0 A;  1YJG A;  3M4B A;  4MTO A;  4XPY A;  1U89 A;  2LFD A;  3VYW A;  3X1O A;  4YJW A;  4LDK A;  5L0F A;  3I4U A;  2AWY A;  3PMR A;  4P9T A;  1LE2 A;  1RKC A;  3EGD A;  1G4W R;  2Y3B A;  1M2V B;  1QVX A;  2UUH A;  3ATP A;  1Q0D A;  3FOP A;  3OWT A;  4IWB A;  3RF3 A;  2MWQ A;  5L0D A;  5KYY A;  5AC5 A;  2R7V A;  2W4M A;  1UG7 A;  4MVZ A;  1D0X A;  5COG A;  3Q7G A;  4E0H A;  2YL3 A;  3VF0 A;  3EFO B;  2WL8 A;  1RCP A;  4XEV A;  1U0B B;  1YZC A;  4C3E A;  4D4X A;  4G0H A;  3UGO A;  2LSE A;  3N24 A;  2PFD A;  1EQ1 A;  3SP1 A;  3V5X A;  1PCX A;  3M79 A;  4YL0 A;  3PCV A;  1CPQ A;  3GEI A;  4M63 A;  3IEE A;  3G50 A;  1V4A A;  4JUR I;  3EG9 B;  3BRJ A;  2XM0 A;  2XLW A;  3ABM C;  1WN0 A;  3FXH A;  3W2W A;  3S84 A;  1E83 A;  4A4A A;  3EPV A;  3AGT A;  1OXK A;  1HW1 A;  2XXA B;  2XXA A;  2R7U A;  3CAX A;  3E70 C;  1R5I D;  1YYJ A;  2A69 F;  4OD5 A;  1MMD A;  1S7Z A;  3AQC A;  1Z63 A;  3V5Y A;  5BQI A;  2XLE A;  5L0H A;  2OG2 A;  4C7O B;  3GM3 A;  4YL1 A;  4BJ6 C;  2ETS A;  2W45 A;  1PD1 A;  3L8J A;  4EHP A;  3H2U A;  2F22 A;  4LLE A;  2WZF A;  4JCH A;  2HZ8 A;  1HE9 A;  3HLZ A;  3MYI A;  1OW7 A;  1RXQ A;  2HFI A;  1YVI A;  4J30 B;  2NPU A;  1T5O A;  2XLV A;  3ZQV A;  5T3T A;  2KC3 A;  2CDQ A;  4MVS A;  3TJ6 A;  3ABK C;  3IPM O;  2M64 A;  4JTD B;  4JVS A;  5EHH A;  1OR3 A;  4A2N B;  3W8I A;  3O55 A;  1RKE A;  3Q6M A;  1JOG A;  3K1H A;  2KK1 A;  2LIG A;  1TKN A;  2L6G A;  3EJN A;  4F4B A;  4YK5 A;  4W8P A;  4U5F E;  2R7Q A;  2Q9C A;  5KYU B;  1VYI A;  2OQM A;  1MND A;  4PJJ A;  4U5C E;  1I5N A;  5KYY B;  1A7V A;  2YQY A;  1RJ9 A;  1DOV A;  4HE8 D;  1JMW A;  4PK4 A;  1DOW A;  2EPO A;  4K0D A;  3Q7L A;  4YT8 A;  4I3M A;  3UGP A;  3NMI A;  4LLC A;  3V7O A;  4NCQ A;  4N6C A;  3EFO A;  1Z23 A;  3U2L A;  2IXO A;  3B0V C;  2CNW D;  4JE9 A;  4J7Y A;  3C8G D;  4BJ5 A;  4CS7 A;  2H7B A;  4ZLD A;  2HMZ A;  1SMY F;  3EHM A;  5DQZ A;  4NC3 A;  3ASN C;  4MW3 A;  3G4Z A;  2G3V A;  2KGO A;  3NKD A;  3KKB A;  4E7S A;  1NU7 D;  2ZXP A;  1LI7 A;  4EBB A;  1LM3 B;  3L34 A;  4O6Y A;  1SYQ A;  1YDI A;  3B71 A;  3DAG A;  3NG1 A;  4L6R A;  3NKE A;  5A6K A;  5L3V A;  1T6U A;  5AGF A;  1Q0G A;  3R2P A;  1D0Y A;  1V55 C;  3IHU A;  3NMK A;  1A7D A;  3HNL A;  3NRH A;  1QZX A;  2Q4F A;  3U8V A;  2KJG A;  2VCA A;  1HMO A;  2XL6 A;  2NG1 A;  2ZD9 A;  1TFK B;  4WGY A;  1RKE B;  3T4R A;  1H9T A;  2FGY A;  3W8H A;  2HS5 A;  1VYK A;  4K1O A;  4U5H A;  3C63 A;  1ZHT A;  1ST6 A;  4DVY P;  1LS4 A;  3C7J A;  3LEV A;  3LNM B;  3RVZ A;  1JRA A;  2L9J A;  1BZ4 A;  3MLG A;  3NYM A;  1TWC A;  4AL0 A;  4WJ0 A;  1ZVZ A;  2EIL C;  4CSA A;  4DRI B;  1ZW2 A;  3FMS A;  2XLD A;  2J9W A;  3QVY A;  4I1O B;  4MVQ A;  4NTB A;  1EKY A;  1GM5 A;  2PF4 E;  3AG4 C;  4H4K C;  5A6A A;  2GDC A;  2NSG A;  2R25 A;  2EPM X;  4BPM A;  3JSZ A;  4ULW A;  4EIY A;  3K1I C;  2IOQ A;  2YZS A;  4CDY A;  4BJ6 A;  3ZC4 A;  3AGU A;  3GOD A;  3H65 A;  3KMI A;  4PFO A;  3ZIB A;  3E9V A;  4QI2 A;  3UMK A;  3SYN A;  2WZG A;  2QNL A;  1T6Q A;  3L0I A;  4OIR F;  3PHF 2;  2PNO A;  2PBE A;  5D92 A;  1ZHW A;  2Y3H A;  3LUT B;  3C8Z A;  3FHD A;  3VAY A;  2R7X A;  2AVK A;  2HV6 A;  3K66 A;  3KYJ A;  2IM8 A;  4Q5S F;  4JCZ A;  3JRT A;  3WHN A;  1L3P A;  3A9C A;  3TOL A;  3ABL C;  4AK9 A;  4OIP F;  4ULV A;  1B68 A;  2G3K A;  1PD0 A;  3DI5 A;  1YAU O;  3N2Z B;  3RVY A;  4HEA J;  3MX3 A;  1ZW3 A;  1CGO A;  2IXM A;  2LP4 A;  1WGW A;  1M6T A;  2ASR A;  1C02 A;  5KYX A;  3S29 A;  1MMA A;  1SZI A;  4N6H A;  4CIH A;  3LS0 A;  2OU6 A;  3ASO C;  2M4E A;  2QE9 A;  4BEM J;  1KNY A;  3QW0 A;  2Q00 A;  5E2Q A;  1LE4 A;  4JEA A;  5E33 A;  4BJ5 C;  4IRU A;  2DYR C;  4G78 A;  3IQ6 A;  4YN0 B;  2DGJ A;  4OD4 A;  2YL0 A;  3NYL A;  4LDQ A;  4HFK B;  4DRJ B;  3HNI A;  3TJ5 A;  3S0X A;  2Q7R A;  5A6B A;  3CEX A;  1JPN A;  5B3S C;  1NBB A;  2B0H A;  1OCR C;  1OW6 A;  1QQ3 A;  1LS1 A;  2EPL X;  2RD9 A;  1LPE A;  1T01 A;  4PJN A;  1TWH A;  5COM A;  3FAJ A;  3U3B A;  1HW2 A;  1HE1 A;  3SZR A;  3U9J A;  3U9M A;  4BJ1 A;  5JT4 A;  3RQE A;  2KYH A;  3IQT A;  3QTH A;  3LEO A;  3EGD B;  3UR3 C;  3SEO A;  1E85 A;  3C8G B;  4NTA A;  4YT5 A;  5L0J A;  1MNE A;  2P0N A;  1QSP A;  3GEH A;  4E0I A;  5L0G A;  2Q9B A;  1WOL A;  3TUL A;  4C7O A;  2XS1 A;  1HMD A;  1D1C A;  1K40 A;  3B9Q A;  4U5D E;  1ZHX A;  1MMG A;  4NTF A;  3WOD F;  1MQV A;  5T3W A;  3JZ0 A;  3MBG A;  3ZVR A;  2A1D D;  1LKX A; 
#chains in the Genus database with same CATH homology
 2F22 A;  5CIV A;  1RXQ A;  3CEX A;  2RD9 A;  3DKA A;  5COM A;  3DI5 A;  2HKV A;  3QTH A;  2NSG A;  3GOR A;  2OQM A;  2P1A A;  5COG A;  2OU6 A;  2NSF A;  2YQY A;  2QE9 A;  2QNL A;  4N6C A;  5COF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...