2M64A

1h, 13c and 15n chemical shift assignments for phl p 5a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
231
structure length
231
Chain Sequence
PAGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Flexible IgE epitope-containing domains of Phl p 5 cause high allergenic activity.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Plant protein
molecule keywords Phlp5
total genus 54
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2013-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.320 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Group V grass pollen allergen 2m64A02
1.20.120.320 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Group V grass pollen allergen 2m64A01
2M64A 1L3PA 1NLXA
chains in the Genus database with same CATH superfamily
1VOMA 4YL1A 4P6IC 4D4NA 1T6IA 2OEXA 4DRJB 5JS5A 2VCBA 2YL3A 2YEVA 3RH3A 1A0BA 4MW8A 2W4MA 2CNWA 1E84A 1JMWA 1MMGA 1TFOB 2R25A 1FR0A 1YAUO 3LNMB 3O39A 3TK0A 3G4ZA 3U0CA 2R7RA 3CQZA 2YL7A 2OJED 2MHRA 1OCCC 2KK1A 1DOVA 1LE2A 4E0IA 5L0DA 2MWQA 3C8GB 4ULWA 1Q0DA 3C8ZA 4XEKA 2ASRA 2A69F 1VYIA 2VCAA 3X1OA 3ZIBA 3QVYA 1ZVZA 2CYDA 2QTVA 2YQYA 1MMDA 4G7HF 2EPMX 2LFFA 2PP4A 4U5GA 4O7GA 4EKWA 3G50A 3SYNA 3F47A 3JCUQ 2R7QA 3EGXA 1RJ9B 1XZQA 3JYYA 4N6HA 5D91A 3RVZA 4PJMA 1J8YF 2IXMA 4JC7A 4K0DA 1ZYRF 1MMAA 4MVRA 3TQOA 3DJUB 4C3EA 4BJ6A 2R7TA 4YT4A 5L0CA 1BR1A 1QKRA 2WZGA 3MYIA 4LLCA 4HFKB 2L6FA 2L6GA 1PD0A 4NTAA 2P1AA 4E18A 3EGXB 3HNIA 4GEHA 1LIHA 2PX0A 1A7EA 2EINC 3FHDA 4BJ5C 1YA7O 5E3AA 3SXZA 1FFTC 3FAJA 1HMDA 5DQTA 1NU9C 4BPMA 4U9EA 3AQCA 3VM6A 4Z9IA 3AGUA 4LLEA 4Q7CA 2J7PD 3T9OA 4A2NB 4Q5SF 1M6TA 2A0UA 3KH2A 4O79A 3HTKC 3DM9B 4G7OF 3N0TA 3ZWIA 4U5BE 4F4BA 3RKOF 1E85A 4PJJA 4AX2A 1T6QA 3T6JA 2RSEB 3B9QA 1VMAA 3NYLA 2FGYA 1LM3B 2LFDA 1FTSA 2R03A 1UFBA 4C7OB 4EBKA 3NRHA 4U5DE 5T3TA 1TWAA 3CSKA 3BEHA 3DWWA 3UMKA 2J0WA 2XM0A 1QSPA 1KNYA 1M56C 4AL1A 1BZ4A 1K40A 1M2VB 2XLHA 4R32A 2IXOA 3RF3A 4EWCA 2KJGA 2L81A 2LIGA 3K33A 4JEBA 4NY3A 3L8JA 4WGZA 3GEIA 5COFA 3W2WA 3JTLO 1OXBA 3WHNA 2Q9CA 2A6EF 2AVKA 3EHNA 3EG9B 3EH1A 4P9FA 5E33A 1G4WR 5B1BC 4WABA 2OKUA 5BQGA 5DLJA 1M2VA 2BC5A 4IGGA 4DVYP 5KYWB 1OCOC 2YKZA 3U3BA 3KL4A 2L6HA 2VB6A 3IQCA 1ZHYA 1ZHXA 4RDAA 3B71A 2TMVP 1LKXA 2CNWD 3HLZA 5DVWA 2KGOA 2HSQA 5EK0A 5GPGB 3DJNB 5A6KA 3EGDA 4FWVA 4UDVA 3VYWA 2XL6A 3FDQA 3AG2C 5KYXA 4CS8C 5F5FA 3IPMO 1Q0FA 1YYJA 2A6HF 4NQFA 4YN0B 2J7PA 4BJTA 5L0FA 1JR8A 4WGYA 1OW8A 1Z23A 1AEPA 4I44A 1TWHA 2DI3A 1QZXA 2HSBA 1ZW2A 1CGNA 2LQGA 4IWBA 3RFYA 1HY5A 3C63A 3OEOA 2ZXRA 4BEMJ 1HW2A 2JX0A 3N2ZB 3T6GB 2NSGA 2CW0F 1OQCA 4CDVA 3UGOA 2ZPAA 3ITFA 3N24A 4HE8D 4K7BA 3OA1A 1NU7D 1OW6A 1V4AA 3AJMA 3HJCA 3LS0A 3M4CA 2ICWG 5E3CA 3M15A 1LS4A 1D1CA 1ZW3A 3JRTA 2QE9A 2IBFA 2L7AA 2G62A 4MS2A 3SEOA 2HMQA 3S29A 3UMHA 4CS9A 1QVXA 1AVOB 1D1AA 1RMVA 2Y3BA 4HEAJ 1SZIA 4LDKA 1WN0A 2A0BA 2KQ9A 1OCRC 1ZHWA 4K1OA 2YL0A 4OD5A 3RW0A 4DRHB 1OCZC 5KYUB 5JUAA 4CSAC 5AGFA 1N1CA 2YRFA 4BJ5A 3FXHA 3R2PA 4CS9C 1XZPA 3JT1A 3SZRA 1U6HA 1Y6DA 3FMSA 5B3SC 2MYSA 3S9OA 5HV9A 2Q00A 3EZHA 3F46A 3SNHA 5EGYA 2V26A 3VF0A 1K05A 5L0GA 3B0PA 4PFOA 2H7VC 3ASNC 3FOPA 3POVA 1H7IA 2J9UA 1FAPB 3C8GD 4MTGA 4Z9HA 2J9WA 3UMIA 2KW3C 3LLKA 1NZEA 1GQAA 1O87A 4LDQA 1M2OA 3AG1C 2P0NA 4OIRF 1LS1A 3NDBB 1TWCA 2ZXOA 1SR2A 3AOUA 1JOGA 3E9VA 4PFPA 4YWQA 5FCLA 4JW1A 3S0XA 1D0YA 1JAFA 1PV3A 1EKYA 3W8IA 2XLWA 4B6IA 5JVEA 4IARA 4JZAA 1JRAA 2Y69C 1OXKA 2LCHA 2P7VA 3NMJA 2YLGA 2HUJA 1RKCA 5KYNA 3U5SA 4KNWA 3U2LA 4A4AA 1H9GA 3ZSUA 3J06A 1V54C 1ZHTA 3TOMA 1Z7Qc 5CI8A 2I8BA 4J30B 1O3UA 4AE4B 2JPUA 3IQTA 3EH2A 2Y3HA 1PCXA 4DBRA 3L0IA 4WJ0A 3X2QC 4W8PA 4IJJA 1ZHZA 4OD4A 2UUHA 4PJNA 3V5ZA 4EBBA 1BBHA 1PD1A 2WVNA 4ULVA 1FMWA 5E2QA 4YT8A 1TFKB 1LI5A 1RJ9A 2IXNA 2D4UA 2XLMA 3GEEA 3K1IA 3ZQYA 3DD7A 1LPEA 3GM2A 1BR4A 1HE9A 2CCYA 2YHSA 3DAFA 4ONSA 2HV6A 3KPHA 5FZTA 4EHPA 4XQ1A 1R5ID 2NPUA 3GWLA 2NUPB 5KYYB 2W45A 3DZAA 4NC3A 2XLDA 1WASA 4H54A 1C03A 5A6BA 3WAQA 1BDJB 1L3PA 5KYXB 3EG9A 3V5YA 5L0HA 5T3WA 2Q9BA 1U0BB 1JPJA 3NMIA 3GWNA 2XXAA 4HFFB 1D0XA 1Q0MA 2EPNA 3H2VA 2ZXWC 3CZ6A 3K1HA 5COGA 4MVUA 3TJ5A 4DXWA 2PFDA 4JTAB 2EIKC 1A41A 4CDAA 2NUTB 4AK9A 1GGQA 4I1MA 1YARO 3SP1A 1K04A 1HW1A 1AUEA 2R9RB 4BJ6C 2IXPA 1C02A 2XLOA 1TKNA 4FX5A 4JURI 2C03A 2G3VA 4MTOA 1CGME 1VK5A 2ZXPA 4ER9A 4C7OA 3GANA 1RKEB 3UGPA 2NUPA 4YL3A 4MVOA 1F1MA 1O5HA 5IY5C 2E87A 2J9VA 1Z6AA 4CBEA 4PR9A 1E86A 3C7JA 1G4US 2QNLA 3ZVRA 4D4XA 2NSFA 3DM5A 3H65A 1ORSC 2Z15A 4GQHA 4CIPA 2OCCC 1I4YA 4BG0A 2WB7A 1MQVA 1WOLA 4IAQA 2OG2A 3L8IA 1HMOA 1SYQA 1XWJA 1TWGA 1CPRA 4XWJA 2NUTA 1WTYA 1Z5ZA 1YA9A 1GS9A 4U5FE 3LUTB 3U9JA 4YT2A 4CSAA 4XPWA 3TJ6A 1G8XA 1D0ZA 3U9MA 4L6RA 3GEHA 4QDLA 3ECSA 3H2UA 5A6AA 1YDIA 1OKKA 4MNDA 4XPXA 5HSWA 4RD9A 1IZMA 3I5QA 4BEJA 2KC3A 2OU6A 2DGJA 3EZIA 2WVQA 4ANJA 2AU5A 2Y3GA 4JIOA 2X0CA 2HS5A 3AG4C 3O10A 4MVSA 1RXQA 4G0HA 3GORA 4U5CE 2GWWA 3U8VA 2R7WA 1YZCA 3R7CA 3ZQVA 4X0RA 4JEAA 3RQGA 3NYMA 1H6GA 2JD3A 2WL8A 1C17M 2XS8A 2LK4A 2ZD9A 4XLNF 3QVZA 1HE1A 4E7ZA 4EIYA 3RQEA 3V7OA 4PJLA 4J32B 5A69A 3ZTZA 4DJ9A 3GM3A 3JZ0A 4LACB 1CPQA 3Q7LA 2WZFA 3FAPB 3L34A 4N6CA 3CEXA 2RD9A 3MBGA 2B0HA 1Q0KA 3DXJF 4JVSA 2M4EA 2YLDA 4RBNA 3E70C 3EQLF 1T5OA 4NTBA 5TJ5E 3TULA 2Q7RA 2H8AA 2LSEA 3DE8A 2QY9A 3RQFA 1GM5A 2EIJC 4ZLCA 3ABKC 3B0UX 3B29A 1NFOA 3EGDB 1ZU5A 2P6VA 3NG1A 1V74B 1FMVA 2J9BA 2OQMA 4DOZA 1G5ZA 5L0JA 3AGTA 2VCCA 2KNHA 3EFOA 3SXMA 4CJGA 1E2XA 3CAXA 2V3CC 4MVMA 3K6BA 3LESA 1I4ZA 1YVIA 3KMIA 4AL0A 4Z9JA 3ZTMA 1SMYF 2A1DD 3NKDA 4CDYA 2HJ3A 4JCHA 2R7UA 3K1IC 4O6YA 1ORJA 3LNRA 3G4XA 3DI5A 5CI9A 2HV7A 1V55C 3ABMC 3GODA 2M64A 2NG1A 3HNLA 3US6A 3Q6NA 4JJGA 2J8WA 2YLIA 5JT4A 4CS8A 2BE5F 1VTMP 2KSFA 1TQGA 2EPLX 3LLIA 1APCA 4XEVA 3DMDA 4CIHA 4G78A 5BQHA 3ASOC 3RVYA 5B3IA 5T1DB 4O6NA 2VH3A 2XSEA 4MVZA 2R02A 1QQ3A 4QI0A 1MNDA 1I5NA 2J0XA 1VLSA 4H4KC 3PHF2 2GAQA 3QZCA 2YZSA 3EHMA 3KYJA 3MX3A 4MVQA 4YK5A 3ZC4A 3A9CA 2AWCA 4FAPB 3C62A 4OIPF 5JSLA 1ORYA 2L9JA 3FOOA 3C18A 3JSEO 2IM8A 1L7CA 3I5PA 1CGOA 2AP3A 3Q7GA 4Q4ZF 3UNGC 4JTDB 1T6UA 3U2MA 3B0VC 4KI2A 2Q9AA 4E7SA 3S84A 3Q6MA 4JTCB 4M63A 4J7YA 5KYUA 1J8MF 1S7ZA 3NYJA 1QPUA 2C04A 2Q4FA 1VLTA 4KC9A 4BJ1A 3ATPA 1OKKD 5DQZA 3HNKA 2DYRC 5JLIA 4MTFA 3QW1A 3OWTA 3WG7C 1H9TA 2Y3DA 2G3KA 3U8PA 1OW7A 1T9KA 4LERA 2WVOA 2GA0A 4U5HA 1YYXA 256BA 3AQBA 3TOLA 3W8HA 4DRIB 5L3QA 3IHUA 4ZLDA 1LE4A 1JPNA 3DE9A 5F28E 2YL1A 4EBJA 5KYYA 3EFOB 3SXYA 1NSGB 5CIVA 3MLGA 4OINF 1RKEA 4JJFA 2X51A 4CX9A 1FNTc 5D92A 3RIPA 1WWPA 2EPOA 1MNEA 4XEFA 3HNJA 2R05A 1FFHA 2EIMC 3GM1A 1B68A 1A7DA 4P9TA 2HKVA 2DB4A 1NFNA 1Q0GA 2DYSC 2UUIA 5B1AC 3JRMO 3RYLA 4YL0A 5BUOA 4E17A 3C8GA 3EPVA 2PNOA 1R4TA 2H7OA 4MQ9F 3LEVA 3WODF 5BQIA 2I15A 3EJNA 3ZG1A 2IYLD 1OR3A 4W8KA 1Z3IX 1IW7F 2J45A 1E83A 4EUKB 1W2WA 3U3FA 4CJOA 2QLAA 4E0HA 3PMRA 5F5HA 5L0IA 1TR2A 3M1CB 2HFIA 4C3BA 2O9XA 4CS7A 5DS4A 2XXAB 3VAYA 3O55A 3MFNA 2XLVA 1KU2A 2D5RB 2XS1A 3QW0A 2OOCA 2CDQA 2CGEA 3T4RA 3DKAA 4MW3A 2AWYA 5DS5A 1Z63A 4DVZA 1NLXA 4J7TA 3TD7A 4DBQA 5A6JA 4IAOA 2LD6A 4U9DA 1U89A 1YJGA 2EPKX 3S27A 1ST6A 5K0IA 4IRUA 2KYHA 2HZ8A 1EA8A 2XLEA 1Y4CA 2R7SA 2WZLA 1A7VA 3K66A 2J46A 5COMA 3S28A 4JCZA 5L3VA 3QMKA 1S05A 5AC4A 3IQ5A 2B0JA 4PACA 3PDMP 5EHHA 1D1BA 4N06A 2BL2A 4XPYA 4JRZA 4XLPF 2F22A 3BRJA 1EI7A 1NG1A 3JSZA 3MYFA 3NKEA 3W2VA 3FVYA 2P61A 1QLEC 1RCPA 1MMNA 1UG7A 3K7DA 4LDRA 2EILC 1SF8A 5JP7A 4KNVA 4KBLA 4QI2A 3SXKA 4N4WA 2YVKA 3LEOA 1DOWA 1T01A 2Q3TA 5KYWA 2A68F 2FAPB 1NBBA 3O6XA 1KTMA 3S90A 3AG3C 4FESA 4IB4A 4I3MA 3L1MA 3DAGA 3IQ6A 3ZDLA 1EQ1A 2QUPA 4NTFA 3LS1A 2GDCA 2GFHA 5DS6A 4OIQF 2VC9A 5A6BD 2YWAA 4U5EE 1WGWA 1ZU4A 1VYKA 3JYHA 4I1OB 4O6MA 3UR3C 5JRAA 1LI7A 3M4BA 3PCVA 1M57C 4JE9A 4YJWA 2Y39A 3A11A 2IOQA 2OJQA 4XTKA 3W4YA 4AE4A 3LJBA 1LVKA 5AC5A 4JKVA 4C3DA 2XL4A 2XRHA 4NCQA 3VRCA 2H7BA 3ABLC 3I4UA 2FFHA 4PK4A 4YT5A 2XL8A 3T6BA 1YLMA 2R7XA 2ETSA 2PX3A 2OEVA 2HJMA 2W9YA 3IEEA 3KYIA 3M79A 1WATA 3V5XA 1BR2A 2LP4A 1VB5A 2HMZA 2PBEA 1ZZPA 3KKBA 4GYTA 4OIOF 3NMKA 3QTHA 1OR2A 2R7VA 3LAYA 2R7OA 2PF4E 2XM4A 2VASA 3HKKA 4G7ZF 1YZAA 2W4BA
chains in the Genus database with same CATH topology
2M64A 1L3PA 1NLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M64 A;  1L3P A;  1NLX A; 
#chains in the Genus database with same CATH topology
 1VOM A;  4YL1 A;  4P6I C;  4D4N A;  1T6I A;  2OEX A;  4DRJ B;  5JS5 A;  2VCB A;  2YL3 A;  2YEV A;  3RH3 A;  1A0B A;  4MW8 A;  2W4M A;  2CNW A;  1E84 A;  1JMW A;  1MMG A;  1TFO B;  2R25 A;  1FR0 A;  1YAU O;  3LNM B;  3O39 A;  3TK0 A;  3G4Z A;  3U0C A;  2R7R A;  3CQZ A;  2YL7 A;  2OJE D;  2MHR A;  1OCC C;  2KK1 A;  1DOV A;  1LE2 A;  4E0I A;  5L0D A;  2MWQ A;  3C8G B;  4ULW A;  1Q0D A;  3C8Z A;  4XEK A;  2ASR A;  2A69 F;  1VYI A;  2VCA A;  3X1O A;  3ZIB A;  3QVY A;  1ZVZ A;  2CYD A;  2QTV A;  2YQY A;  1MMD A;  4G7H F;  2EPM X;  2LFF A;  2PP4 A;  4U5G A;  4O7G A;  4EKW A;  3G50 A;  3SYN A;  3F47 A;  3JCU Q;  2R7Q A;  3EGX A;  1RJ9 B;  1XZQ A;  3JYY A;  4N6H A;  5D91 A;  3RVZ A;  4PJM A;  1J8Y F;  2IXM A;  4JC7 A;  4K0D A;  1ZYR F;  1MMA A;  4MVR A;  3TQO A;  3DJU B;  4C3E A;  4BJ6 A;  2R7T A;  4YT4 A;  5L0C A;  1BR1 A;  1QKR A;  2WZG A;  3MYI A;  4LLC A;  4HFK B;  2L6F A;  2L6G A;  1PD0 A;  4NTA A;  2P1A A;  4E18 A;  3EGX B;  3HNI A;  4GEH A;  1LIH A;  2PX0 A;  1A7E A;  2EIN C;  3FHD A;  4BJ5 C;  1YA7 O;  5E3A A;  3SXZ A;  1FFT C;  3FAJ A;  1HMD A;  5DQT A;  1NU9 C;  4BPM A;  4U9E A;  3AQC A;  3VM6 A;  4Z9I A;  3AGU A;  4LLE A;  4Q7C A;  2J7P D;  3T9O A;  4A2N B;  4Q5S F;  1M6T A;  2A0U A;  3KH2 A;  4O79 A;  3HTK C;  3DM9 B;  4G7O F;  3N0T A;  3ZWI A;  4U5B E;  4F4B A;  3RKO F;  1E85 A;  4PJJ A;  4AX2 A;  1T6Q A;  3T6J A;  2RSE B;  3B9Q A;  1VMA A;  3NYL A;  2FGY A;  1LM3 B;  2LFD A;  1FTS A;  2R03 A;  1UFB A;  4C7O B;  4EBK A;  3NRH A;  4U5D E;  5T3T A;  1TWA A;  3CSK A;  3BEH A;  3DWW A;  3UMK A;  2J0W A;  2XM0 A;  1QSP A;  1KNY A;  1M56 C;  4AL1 A;  1BZ4 A;  1K40 A;  1M2V B;  2XLH A;  4R32 A;  2IXO A;  3RF3 A;  4EWC A;  2KJG A;  2L81 A;  2LIG A;  3K33 A;  4JEB A;  4NY3 A;  3L8J A;  4WGZ A;  3GEI A;  5COF A;  3W2W A;  3JTL O;  1OXB A;  3WHN A;  2Q9C A;  2A6E F;  2AVK A;  3EHN A;  3EG9 B;  3EH1 A;  4P9F A;  5E33 A;  1G4W R;  5B1B C;  4WAB A;  2OKU A;  5BQG A;  5DLJ A;  1M2V A;  2BC5 A;  4IGG A;  4DVY P;  5KYW B;  1OCO C;  2YKZ A;  3U3B A;  3KL4 A;  2L6H A;  2VB6 A;  3IQC A;  1ZHY A;  1ZHX A;  4RDA A;  3B71 A;  2TMV P;  1LKX A;  2CNW D;  3HLZ A;  5DVW A;  2KGO A;  2HSQ A;  5EK0 A;  5GPG B;  3DJN B;  5A6K A;  3EGD A;  4FWV A;  4UDV A;  3VYW A;  2XL6 A;  3FDQ A;  3AG2 C;  5KYX A;  4CS8 C;  5F5F A;  3IPM O;  1Q0F A;  1YYJ A;  2A6H F;  4NQF A;  4YN0 B;  2J7P A;  4BJT A;  5L0F A;  1JR8 A;  4WGY A;  1OW8 A;  1Z23 A;  1AEP A;  4I44 A;  1TWH A;  2DI3 A;  1QZX A;  2HSB A;  1ZW2 A;  1CGN A;  2LQG A;  4IWB A;  3RFY A;  1HY5 A;  3C63 A;  3OEO A;  2ZXR A;  4BEM J;  1HW2 A;  2JX0 A;  3N2Z B;  3T6G B;  2NSG A;  2CW0 F;  1OQC A;  4CDV A;  3UGO A;  2ZPA A;  3ITF A;  3N24 A;  4HE8 D;  4K7B A;  3OA1 A;  1NU7 D;  1OW6 A;  1V4A A;  3AJM A;  3HJC A;  3LS0 A;  3M4C A;  2ICW G;  5E3C A;  3M15 A;  1LS4 A;  1D1C A;  1ZW3 A;  3JRT A;  2QE9 A;  2IBF A;  2L7A A;  2G62 A;  4MS2 A;  3SEO A;  2HMQ A;  3S29 A;  3UMH A;  4CS9 A;  1QVX A;  1AVO B;  1D1A A;  1RMV A;  2Y3B A;  4HEA J;  1SZI A;  4LDK A;  1WN0 A;  2A0B A;  2KQ9 A;  1OCR C;  1ZHW A;  4K1O A;  2YL0 A;  4OD5 A;  3RW0 A;  4DRH B;  1OCZ C;  5KYU B;  5JUA A;  4CSA C;  5AGF A;  1N1C A;  2YRF A;  4BJ5 A;  3FXH A;  3R2P A;  4CS9 C;  1XZP A;  3JT1 A;  3SZR A;  1U6H A;  1Y6D A;  3FMS A;  5B3S C;  2MYS A;  3S9O A;  5HV9 A;  2Q00 A;  3EZH A;  3F46 A;  3SNH A;  5EGY A;  2V26 A;  3VF0 A;  1K05 A;  5L0G A;  3B0P A;  4PFO A;  2H7V C;  3ASN C;  3FOP A;  3POV A;  1H7I A;  2J9U A;  1FAP B;  3C8G D;  4MTG A;  4Z9H A;  2J9W A;  3UMI A;  2KW3 C;  3LLK A;  1NZE A;  1GQA A;  1O87 A;  4LDQ A;  1M2O A;  3AG1 C;  2P0N A;  4OIR F;  1LS1 A;  3NDB B;  1TWC A;  2ZXO A;  1SR2 A;  3AOU A;  1JOG A;  3E9V A;  4PFP A;  4YWQ A;  5FCL A;  4JW1 A;  3S0X A;  1D0Y A;  1JAF A;  1PV3 A;  1EKY A;  3W8I A;  2XLW A;  4B6I A;  5JVE A;  4IAR A;  4JZA A;  1JRA A;  2Y69 C;  1OXK A;  2LCH A;  2P7V A;  3NMJ A;  2YLG A;  2HUJ A;  1RKC A;  5KYN A;  3U5S A;  4KNW A;  3U2L A;  4A4A A;  1H9G A;  3ZSU A;  3J06 A;  1V54 C;  1ZHT A;  3TOM A;  1Z7Q c;  5CI8 A;  2I8B A;  4J30 B;  1O3U A;  4AE4 B;  2JPU A;  3IQT A;  3EH2 A;  2Y3H A;  1PCX A;  4DBR A;  3L0I A;  4WJ0 A;  3X2Q C;  4W8P A;  4IJJ A;  1ZHZ A;  4OD4 A;  2UUH A;  4PJN A;  3V5Z A;  4EBB A;  1BBH A;  1PD1 A;  2WVN A;  4ULV A;  1FMW A;  5E2Q A;  4YT8 A;  1TFK B;  1LI5 A;  1RJ9 A;  2IXN A;  2D4U A;  2XLM A;  3GEE A;  3K1I A;  3ZQY A;  3DD7 A;  1LPE A;  3GM2 A;  1BR4 A;  1HE9 A;  2CCY A;  2YHS A;  3DAF A;  4ONS A;  2HV6 A;  3KPH A;  5FZT A;  4EHP A;  4XQ1 A;  1R5I D;  2NPU A;  3GWL A;  2NUP B;  5KYY B;  2W45 A;  3DZA A;  4NC3 A;  2XLD A;  1WAS A;  4H54 A;  1C03 A;  5A6B A;  3WAQ A;  1BDJ B;  1L3P A;  5KYX B;  3EG9 A;  3V5Y A;  5L0H A;  5T3W A;  2Q9B A;  1U0B B;  1JPJ A;  3NMI A;  3GWN A;  2XXA A;  4HFF B;  1D0X A;  1Q0M A;  2EPN A;  3H2V A;  2ZXW C;  3CZ6 A;  3K1H A;  5COG A;  4MVU A;  3TJ5 A;  4DXW A;  2PFD A;  4JTA B;  2EIK C;  1A41 A;  4CDA A;  2NUT B;  4AK9 A;  1GGQ A;  4I1M A;  1YAR O;  3SP1 A;  1K04 A;  1HW1 A;  1AUE A;  2R9R B;  4BJ6 C;  2IXP A;  1C02 A;  2XLO A;  1TKN A;  4FX5 A;  4JUR I;  2C03 A;  2G3V A;  4MTO A;  1CGM E;  1VK5 A;  2ZXP A;  4ER9 A;  4C7O A;  3GAN A;  1RKE B;  3UGP A;  2NUP A;  4YL3 A;  4MVO A;  1F1M A;  1O5H A;  5IY5 C;  2E87 A;  2J9V A;  1Z6A A;  4CBE A;  4PR9 A;  1E86 A;  3C7J A;  1G4U S;  2QNL A;  3ZVR A;  4D4X A;  2NSF A;  3DM5 A;  3H65 A;  1ORS C;  2Z15 A;  4GQH A;  4CIP A;  2OCC C;  1I4Y A;  4BG0 A;  2WB7 A;  1MQV A;  1WOL A;  4IAQ A;  2OG2 A;  3L8I A;  1HMO A;  1SYQ A;  1XWJ A;  1TWG A;  1CPR A;  4XWJ A;  2NUT A;  1WTY A;  1Z5Z A;  1YA9 A;  1GS9 A;  4U5F E;  3LUT B;  3U9J A;  4YT2 A;  4CSA A;  4XPW A;  3TJ6 A;  1G8X A;  1D0Z A;  3U9M A;  4L6R A;  3GEH A;  4QDL A;  3ECS A;  3H2U A;  5A6A A;  1YDI A;  1OKK A;  4MND A;  4XPX A;  5HSW A;  4RD9 A;  1IZM A;  3I5Q A;  4BEJ A;  2KC3 A;  2OU6 A;  2DGJ A;  3EZI A;  2WVQ A;  4ANJ A;  2AU5 A;  2Y3G A;  4JIO A;  2X0C A;  2HS5 A;  3AG4 C;  3O10 A;  4MVS A;  1RXQ A;  4G0H A;  3GOR A;  4U5C E;  2GWW A;  3U8V A;  2R7W A;  1YZC A;  3R7C A;  3ZQV A;  4X0R A;  4JEA A;  3RQG A;  3NYM A;  1H6G A;  2JD3 A;  2WL8 A;  1C17 M;  2XS8 A;  2LK4 A;  2ZD9 A;  4XLN F;  3QVZ A;  1HE1 A;  4E7Z A;  4EIY A;  3RQE A;  3V7O A;  4PJL A;  4J32 B;  5A69 A;  3ZTZ A;  4DJ9 A;  3GM3 A;  3JZ0 A;  4LAC B;  1CPQ A;  3Q7L A;  2WZF A;  3FAP B;  3L34 A;  4N6C A;  3CEX A;  2RD9 A;  3MBG A;  2B0H A;  1Q0K A;  3DXJ F;  4JVS A;  2M4E A;  2YLD A;  4RBN A;  3E70 C;  3EQL F;  1T5O A;  4NTB A;  5TJ5 E;  3TUL A;  2Q7R A;  2H8A A;  2LSE A;  3DE8 A;  2QY9 A;  3RQF A;  1GM5 A;  2EIJ C;  4ZLC A;  3ABK C;  3B0U X;  3B29 A;  1NFO A;  3EGD B;  1ZU5 A;  2P6V A;  3NG1 A;  1V74 B;  1FMV A;  2J9B A;  2OQM A;  4DOZ A;  1G5Z A;  5L0J A;  3AGT A;  2VCC A;  2KNH A;  3EFO A;  3SXM A;  4CJG A;  1E2X A;  3CAX A;  2V3C C;  4MVM A;  3K6B A;  3LES A;  1I4Z A;  1YVI A;  3KMI A;  4AL0 A;  4Z9J A;  3ZTM A;  1SMY F;  2A1D D;  3NKD A;  4CDY A;  2HJ3 A;  4JCH A;  2R7U A;  3K1I C;  4O6Y A;  1ORJ A;  3LNR A;  3G4X A;  3DI5 A;  5CI9 A;  2HV7 A;  1V55 C;  3ABM C;  3GOD A;  2M64 A;  2NG1 A;  3HNL A;  3US6 A;  3Q6N A;  4JJG A;  2J8W A;  2YLI A;  5JT4 A;  4CS8 A;  2BE5 F;  1VTM P;  2KSF A;  1TQG A;  2EPL X;  3LLI A;  1APC A;  4XEV A;  3DMD A;  4CIH A;  4G78 A;  5BQH A;  3ASO C;  3RVY A;  5B3I A;  5T1D B;  4O6N A;  2VH3 A;  2XSE A;  4MVZ A;  2R02 A;  1QQ3 A;  4QI0 A;  1MND A;  1I5N A;  2J0X A;  1VLS A;  4H4K C;  3PHF 2;  2GAQ A;  3QZC A;  2YZS A;  3EHM A;  3KYJ A;  3MX3 A;  4MVQ A;  4YK5 A;  3ZC4 A;  3A9C A;  2AWC A;  4FAP B;  3C62 A;  4OIP F;  5JSL A;  1ORY A;  2L9J A;  3FOO A;  3C18 A;  3JSE O;  2IM8 A;  1L7C A;  3I5P A;  1CGO A;  2AP3 A;  3Q7G A;  4Q4Z F;  3UNG C;  4JTD B;  1T6U A;  3U2M A;  3B0V C;  4KI2 A;  2Q9A A;  4E7S A;  3S84 A;  3Q6M A;  4JTC B;  4M63 A;  4J7Y A;  5KYU A;  1J8M F;  1S7Z A;  3NYJ A;  1QPU A;  2C04 A;  2Q4F A;  1VLT A;  4KC9 A;  4BJ1 A;  3ATP A;  1OKK D;  5DQZ A;  3HNK A;  2DYR C;  5JLI A;  4MTF A;  3QW1 A;  3OWT A;  3WG7 C;  1H9T A;  2Y3D A;  2G3K A;  3U8P A;  1OW7 A;  1T9K A;  4LER A;  2WVO A;  2GA0 A;  4U5H A;  1YYX A;  256B A;  3AQB A;  3TOL A;  3W8H A;  4DRI B;  5L3Q A;  3IHU A;  4ZLD A;  1LE4 A;  1JPN A;  3DE9 A;  5F28 E;  2YL1 A;  4EBJ A;  5KYY A;  3EFO B;  3SXY A;  1NSG B;  5CIV A;  3MLG A;  4OIN F;  1RKE A;  4JJF A;  2X51 A;  4CX9 A;  1FNT c;  5D92 A;  3RIP A;  1WWP A;  2EPO A;  1MNE A;  4XEF A;  3HNJ A;  2R05 A;  1FFH A;  2EIM C;  3GM1 A;  1B68 A;  1A7D A;  4P9T A;  2HKV A;  2DB4 A;  1NFN A;  1Q0G A;  2DYS C;  2UUI A;  5B1A C;  3JRM O;  3RYL A;  4YL0 A;  5BUO A;  4E17 A;  3C8G A;  3EPV A;  2PNO A;  1R4T A;  2H7O A;  4MQ9 F;  3LEV A;  3WOD F;  5BQI A;  2I15 A;  3EJN A;  3ZG1 A;  2IYL D;  1OR3 A;  4W8K A;  1Z3I X;  1IW7 F;  2J45 A;  1E83 A;  4EUK B;  1W2W A;  3U3F A;  4CJO A;  2QLA A;  4E0H A;  3PMR A;  5F5H A;  5L0I A;  1TR2 A;  3M1C B;  2HFI A;  4C3B A;  2O9X A;  4CS7 A;  5DS4 A;  2XXA B;  3VAY A;  3O55 A;  3MFN A;  2XLV A;  1KU2 A;  2D5R B;  2XS1 A;  3QW0 A;  2OOC A;  2CDQ A;  2CGE A;  3T4R A;  3DKA A;  4MW3 A;  2AWY A;  5DS5 A;  1Z63 A;  4DVZ A;  1NLX A;  4J7T A;  3TD7 A;  4DBQ A;  5A6J A;  4IAO A;  2LD6 A;  4U9D A;  1U89 A;  1YJG A;  2EPK X;  3S27 A;  1ST6 A;  5K0I A;  4IRU A;  2KYH A;  2HZ8 A;  1EA8 A;  2XLE A;  1Y4C A;  2R7S A;  2WZL A;  1A7V A;  3K66 A;  2J46 A;  5COM A;  3S28 A;  4JCZ A;  5L3V A;  3QMK A;  1S05 A;  5AC4 A;  3IQ5 A;  2B0J A;  4PAC A;  3PDM P;  5EHH A;  1D1B A;  4N06 A;  2BL2 A;  4XPY A;  4JRZ A;  4XLP F;  2F22 A;  3BRJ A;  1EI7 A;  1NG1 A;  3JSZ A;  3MYF A;  3NKE A;  3W2V A;  3FVY A;  2P61 A;  1QLE C;  1RCP A;  1MMN A;  1UG7 A;  3K7D A;  4LDR A;  2EIL C;  1SF8 A;  5JP7 A;  4KNV A;  4KBL A;  4QI2 A;  3SXK A;  4N4W A;  2YVK A;  3LEO A;  1DOW A;  1T01 A;  2Q3T A;  5KYW A;  2A68 F;  2FAP B;  1NBB A;  3O6X A;  1KTM A;  3S90 A;  3AG3 C;  4FES A;  4IB4 A;  4I3M A;  3L1M A;  3DAG A;  3IQ6 A;  3ZDL A;  1EQ1 A;  2QUP A;  4NTF A;  3LS1 A;  2GDC A;  2GFH A;  5DS6 A;  4OIQ F;  2VC9 A;  5A6B D;  2YWA A;  4U5E E;  1WGW A;  1ZU4 A;  1VYK A;  3JYH A;  4I1O B;  4O6M A;  3UR3 C;  5JRA A;  1LI7 A;  3M4B A;  3PCV A;  1M57 C;  4JE9 A;  4YJW A;  2Y39 A;  3A11 A;  2IOQ A;  2OJQ A;  4XTK A;  3W4Y A;  4AE4 A;  3LJB A;  1LVK A;  5AC5 A;  4JKV A;  4C3D A;  2XL4 A;  2XRH A;  4NCQ A;  3VRC A;  2H7B A;  3ABL C;  3I4U A;  2FFH A;  4PK4 A;  4YT5 A;  2XL8 A;  3T6B A;  1YLM A;  2R7X A;  2ETS A;  2PX3 A;  2OEV A;  2HJM A;  2W9Y A;  3IEE A;  3KYI A;  3M79 A;  1WAT A;  3V5X A;  1BR2 A;  2LP4 A;  1VB5 A;  2HMZ A;  2PBE A;  1ZZP A;  3KKB A;  4GYT A;  4OIO F;  3NMK A;  3QTH A;  1OR2 A;  2R7V A;  3LAY A;  2R7O A;  2PF4 E;  2XM4 A;  2VAS A;  3HKK A;  4G7Z F;  1YZA A;  2W4B A; 
#chains in the Genus database with same CATH homology
 2M64 A;  1L3P A;  1NLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...