2M64A

1h, 13c and 15n chemical shift assignments for phl p 5a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
231
structure length
231
Chain Sequence
PAGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords Phlp5
publication title Flexible IgE epitope-containing domains of Phl p 5 cause high allergenic activity.
pubmed doi rcsb
source organism Phleum pratense
total genus 54
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2013-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.320 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Group V grass pollen allergen 2m64A02
1.20.120.320 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Group V grass pollen allergen 2m64A01
2M64A 1NLXA 1L3PA
chains in the Genus database with same CATH superfamily
2LP4A 2ZXPA 1PD1A 3B0PA 2XLMA 4IRUA 4QDLA 3SEOA 4E0IA 4CS7A 2HFIA 3EZHA 4XPXA 2DI3A 4KNWA 5D91A 1NLXA 5T3TA 4K1OA 4U9EA 2R7TA 2OQMA 1EA8A 1Q0DA 3AG1C 3GM3A 3LLIA 1LS1A 2EPLX 4IJJA 5L3QA 3DAFA 2VASA 4U9DA 2EPKX 5GPGB 3RQEA 3ZDLA 1EQ1A 2OJQA 2GFHA 1V55C 3M4BA 5AC4A 2KQ9A 4CBEA 3PMRA 2H7OA 1VYKA 2PX3A 3ATPA 4MS2A 2VB6A 3HNKA 3EFOA 2Y3BA 1QQ3A 2OU6A 3KKBA 4DVYP 4FESA 4JJGA 4CJGA 4Q5SF 1LS4A 3C8GB 1YYJA 4PJLA 2GWWA 2A6HF 1QZXA 2R03A 2YEVA 4WJ0A 2XM4A 3RFYA 2QTVA 3OEOA 2PBEA 4O79A 3ZG1A 3DXJF 1RMVA 1WATA 1BR1A 4DBRA 3MYIA 2IXMA 3T6GB 2B0JA 5F28E 5JUAA 4C3BA 1BDJB 1LE4A 2R7RA 2XLEA 3QW1A 1ORYA 4ER9A 4XLPF 1SZIA 1SF8A 1LE2A 2KNHA 4PJNA 1Z63A 4MVOA 1I4ZA 1LIHA 4MVSA 5EGYA 1KTMA 3A9CA 4MVQA 1AVOB 2CNWD 4YWQA 2R7UA 2L6HA 3W2VA 5COGA 4PFPA 2XLDA 2Y3GA 4JW1A 2KC3A 2J9WA 4JJFA 4C7OA 2A0UA 3HNIA 3LS1A 1RKCA 3QW0A 4BJ1A 5B3IA 3M1CB 3E70C 3IQTA 3AG4C 4EBKA 1QVXA 5L0GA 4K7BA 4RBNA 3C63A 2XL4A 3AQCA 1RJ9A 1APCA 1FTSA 1M2OA 3C8ZA 3EPVA 4XTKA 1SR2A 3T4RA 4EHPA 1M57C 1ORJA 3GWNA 1BR4A 1LPEA 3K33A 4P9TA 3ZTZA 5KYWB 2P0NA 1YZCA 3HNLA 2L7AA 2HS5A 2IBFA 3K6BA 1CPQA 1OW6A 3DM9B 3U3BA 3L8JA 4JTCB 5T1DB 3RVZA 4U5FE 5BQIA 3ASOC 2XS1A 4AL1A 4CS9C 4MW8A 1G4WR 3NYMA 2L6GA 2YZSA 2PP4A 4YL3A 3JZ0A 3KYJA 3MYFA 4IWBA 3ZC4A 4E17A 4YT8A 1D1BA 1MQVA 1O3UA 4LLCA 5KYXB 5JRAA 1NFOA 1KNYA 2XL6A 4OD5A 1MMGA 3H2UA 1HW1A 3W8HA 2A69F 3EG9B 4BJ5C 5JLIA 5L0CA 3EGDA 3SXKA 3LLKA 1UG7A 4C3EA 4CSAC 4IAOA 2YL0A 4KI2A 3LUTB 2FAPB 2W9YA 4KBLA 3WHNA 3A11A 1TWCA 2XXAB 3FOOA 3JCUQ 3J06A 2YL7A 3U2LA 3HTKC 5JSLA 1TR2A 4I1MA 4N6HA 1M2VB 4JCZA 3CQZA 1E86A 2HSBA 2G62A 1Z3IX 3K7DA 2EIJC 3AJMA 3DD7A 3C8GD 3SXYA 4PACA 3VM6A 3JTLO 3L8IA 2ZXRA 3EHNA 1H9TA 2EIMC 1WWPA 1C03A 5L0FA 1JPJA 3L1MA 4K0DA 4Z9JA 2LD6A 1GM5A 2NUTA 3S29A 3WG7C 3BRJA 3S27A 1DOVA 3GEEA 5DLJA 4CIHA 1ZHXA 3IEEA 4MTFA 2Q9AA 3ZWIA 2YWAA 3TOLA 3TD7A 1Y4CA 2HJMA 3TQOA 3QMKA 4CJOA 4U5GA 5BQGA 2CYDA 1UFBA 4HFKB 1YJGA 5BQHA 4AE4A 1PCXA 3AQBA 2DYRC 1T01A 2Q9CA 3O55A 4JE9A 2J0XA 4NTAA 3EFOB 5L0IA 1CPRA 3UGOA 4OIPF 2OJED 4YL1A 3FOPA 3KYIA 2B0HA 2XLWA 2HZ8A 2PX0A 2ZD9A 4KC9A 4RD9A 5E33A 4LDQA 3HNJA 4CS8A 1RKEB 2D4UA 3PCVA 4ZLCA 4EWCA 1T6QA 4B6IA 1BR2A 4JC7A 1BBHA 2WVNA 4RDAA 4XWJA 5CI9A 4G78A 2Q4FA 4PR9A 5DS6A 1D0ZA 1QPUA 5F5HA 2J9BA 4U5HA 2OG2A 2ASRA 256BA 2R7SA 3POVA 1OKKD 3UNGC 4AL0A 5A6BA 3L34A 3I5PA 3G50A 4O7GA 1XWJA 3JRMO 5K0IA 3SXMA 4Z9HA 1G4US 1OR2A 4OIQF 1XZPA 1A0BA 2RD9A 4ZLDA 1Q0FA 2A6EF 1CGME 2IXOA 1E84A 3B9QA 1R4TA 1TWGA 2H7BA 2G3VA 1FMWA 1LKXA 3LS0A 4DRIB 3SYNA 5DS5A 4YL0A 4C7OB 2EILC 3C18A 2GAQA 5L0JA 2OKUA 2LQGA 4D4XA 2HUJA 4E0HA 4NCQA 1HY5A 1NSGB 4BJ6A 4CDVA 1U0BB 1K05A 1YA7O 4JEBA 1H6GA 5JVEA 2CNWA 4BG0A 4ONSA 3RH3A 5KYYB 1D0XA 1WASA 1LI7A 2MHRA 2R9RB 2W45A 1V74B 2EINC 4JEAA 3ZVRA 3QTHA 1Y6DA 1QKRA 4MTOA 3U8PA 1QLEC 1RJ9B 2X51A 1OQCA 3ABMC 3EQLF 2VCBA 4JTDB 3SP1A 1ST6A 3EZIA 3KH2A 4J7YA 1YDIA 4LDKA 1J8YF 1FR0A 3K66A 1VLSA 4G7ZF 4OIRF 3UMIA 3LEVA 5BUOA 2JPUA 2CGEA 1MNDA 3LNRA 2YLGA 2GA0A 2VC9A 3KL4A 4OINF 3S84A 1R5ID 2FFHA 2YHSA 1VTMP 1ORSC 4KNVA 4JTAB 5JP7A 5KYUA 3O6XA 4ULVA 3QVYA 3MFNA 2AWCA 2RSEB 2Z15A 3DMDA 3CEXA 2V26A 3Q6NA 3B0VC 1Q0KA 2CDQA 4IAQA 3EGXB 4YK5A 3UMKA 2CW0F 1S7ZA 1T9KA 1OXKA 3EGDB 4W8KA 3U2MA 1O5HA 2OEVA 1LM3B 2C04A 2LK4A 3ASNC 3IHUA 3JYHA 3TOMA 3ZTMA 2KJGA 4E7SA 1A7DA 3Q7GA 1N1CA 2XM0A 1JPNA 2NUPA 2H7VC 4XEFA 5E3CA 3RIPA 4FX5A 3U5SA 4CDAA 4CDYA 2IOQA 4MTGA 4A2NB 2LCHA 1GGQA 1RCPA 1ZW3A 3RQFA 1BZ4A 3US6A 2MYSA 2J45A 3ZSUA 5A6AA 2V3CC 1FFHA 4DOZA 2J7PA 2YKZA 4ULWA 2NUTB 1K04A 4WGZA 1CGNA 2IYLD 1H9GA 1JOGA 4YJWA 3WODF 3NMJA 1FFTC 4DBQA 1JMWA 3TJ6A 3GM1A 1C17M 2IXPA 2R7OA 3F47A 2MWQA 2YRFA 4MVZA 5JT4A 1A41A 3DKAA 1D0YA 4DJ9A 4CS9A 4CX9A 2YL1A 2EPMX 2M64A 4MVMA 1YAUO 2P6VA 3AG3C 4AE4B 3MX3A 4PJMA 3EH1A 3UGPA 4JIOA 2PNOA 3RKOF 5EK0A 3FHDA 1EI7A 3S90A 1B68A 3N0TA 4MW3A 1E85A 3I5QA 4EBJA 3DZAA 3KMIA 3S28A 4O6MA 1T6IA 4P9FA 4XPYA 1F1MA 1XZQA 3LJBA 4X0RA 2JX0A 1E83A 2VCCA 1D1CA 1G8XA 3NMIA 1LI5A 2YQYA 3OA1A 5A6JA 2BE5F 3B29A 2JD3A 4HFFB 2D5RB 2J46A 2LFFA 5IY5C 3DM5A 5AC5A 2OCCC 3AGTA 1VK5A 4C3DA 1KU2A 3ECSA 4A4AA 3C62A 2NPUA 3L0IA 2W4MA 4XPWA 3UMHA 4N4WA 1NU9C 1G5ZA 2R7QA 3ABKC 4U5BE 4Q4ZF 3QZCA 1SYQA 4OD4A 5T3WA 3DE9A 3U3FA 5KYWA 2R7WA 5TJ5E 4JCHA 5DS4A 4YT2A 2WL8A 5HV9A 1Z23A 3T6BA 3PDMP 5L0DA 2HSQA 3V5XA 2A1DD 4LACB 3JT1A 1O87A 5B1AC 2IM8A 3N2ZB 4EUKB 3VYWA 2QLAA 2Q7RA 2OEXA 5CIVA 1L7CA 2YL3A 5E2QA 3VF0A 1ZU5A 4J32B 3NKEA 4NQFA 2IXNA 1ZZPA 3ZQVA 4GYTA 1U89A 1WTYA 1A7VA 1JRAA 1TWAA 2I8BA 2HV7A 1V54C 3DI5A 2HKVA 3GEIA 3K1IA 3IQ5A 4N06A 4PFOA 2XLVA 2LFDA 1AUEA 3ZIBA 3EG9A 3CAXA 3BEHA 3JRTA 4O6NA 3S9OA 2HMQA 3H2VA 1U6HA 4CS8C 5FZTA 2LIGA 2WZFA 2BC5A 3N24A 4I44A 3VAYA 4ANJA 4FAPB 4CIPA 2Q3TA 4G7OF 2L9JA 1RXQA 1I5NA 1YYXA 2QY9A 3O10A 1MMDA 4LDRA 4D4NA 1OW8A 3CSKA 5KYUB 4NC3A 3EH2A 2XLOA 3RW0A 3V5YA 3W2WA 1E2XA 1OXBA 3FVYA 3NRHA 2A0BA 3IQCA 1C02A 3JSZA 3VRCA 1QSPA 2XRHA 1HW2A 3C7JA 2XLHA 1VYIA 1TQGA 2AP3A 2UUHA 4GQHA 1YLMA 2GDCA 2QUPA 4DXWA 3QVZA 2J9VA 1WGWA 3IQ6A 1IZMA 3LNMB 4DVZA 3V5ZA 4I1OB 1OCOC 4NTFA 1IW7F 1JAFA 1Q0GA 2J0WA 5COMA 3U9MA 3FDQA 2NUPB 3LESA 2KYHA 4BJ6C 1OCZC 2NSFA 2O9XA 4QI0A 1OR3A 5DVWA 3HJCA 2QNLA 1MNEA 5A6KA 3T6JA 4MQ9F 2ZXOA 1M6TA 1VOMA 3GM2A 3NYJA 3U8VA 5F5FA 4F4BA 2Q9BA 2AVKA 4I3MA 4L6RA 2W4BA 2DGJA 1YA9A 3HLZA 1DOWA 3AOUA 3DWWA 3MLGA 5E3AA 5DQZA 1OCRC 4NY3A 2G3KA 1A7EA 1VB5A 2H8AA 2L81A 3GANA 3K1HA 3TJ5A 2BL2A 2KW3C 1RKEA 2Y3DA 2YLDA 3DAGA 3G4XA 2NG1A 3NKDA 2HMZA 4M63A 3WAQA 5AGFA 4E7ZA 5A6BD 3RYLA 1HE1A 3M4CA 4IARA 1TFKB 3OWTA 5B3SC 2E87A 1TFOB 4BPMA 1WOLA 3M79A 2XSEA 1ZHZA 4DRJB 1ZW2A 3RVYA 3B0UX 3Q7LA 1GS9A 3NDBB 2NSGA 3SNHA 4WGYA 1Z5ZA 3TULA 5EHHA 1CGOA 2XL8A 1NFNA 3GORA 4O6YA 1YZAA 3I4UA 4Z9IA 4BEMJ 1M56C 1J8MF 4N6CA 5D92A 2QE9A 3O39A 4BEJA 5HSWA 2P61A 1EKYA 2WZGA 1OCCC 2WB7A 2ICWG 2XS8A 2DB4A 2P7VA 2Q00A 2P1AA 4IB4A 4JZAA 2C03A 4G0HA 1FMVA 3FMSA 5A69A 3G4ZA 2PF4E 1ZHWA 3T9OA 3ZQYA 2PFDA 1ZHTA 1YARO 1OW7A 1ZVZA 2EIKC 2J8WA 3HKKA 2L6FA 3FAJA 2I15A 3JYYA 1HMOA 1L3PA 3C8GA 3R2PA 5KYYA 1JR8A 4Q7CA 5L0HA 3R7CA 1S05A 2AWYA 3H65A 4JKVA 4AX2A 1PV3A 3RQGA 3F46A 3KPHA 1Z6AA 3NMKA 3X2QC 2A68F 3B71A 4H54A 1NG1A 2F22A 4LERA 4U5DE 5B1BC 4UDVA 4XQ1A 3TK0A 4QI2A 2WZLA 4JVSA 5COFA 3GEHA 1K40A 3U0CA 1VMAA 2Y3HA 3CZ6A 3DJUB 1FNTc 4U5EE 3GODA 4JRZA 2VCAA 3U9JA 4BJ5A 4DRHB 1MMNA 2ZPAA 4AK9A 1D1AA 2YLIA 3SZRA 3X1OA 3W4YA 3S0XA 1NU7D 4CSAA 4LLEA 2AU5A 3E9VA 3FAPB 4XEVA 5CI8A 3UR3C 4WABA 4YT4A 3EGXA 2VH3A 3NYLA 1LVKA 3IPMO 4P6IC 4OIOF 2ZXWC 3EJNA 3M15A 4W8PA 2KSFA 1H7IA 1YVIA 2HJ3A 2DYSC 1FAPB 2Y39A 4MVUA 4YT5A 1WN0A 1TKNA 4EBBA 1ZU4A 2R7XA 3AG2C 2R05A 3W8IA 2WVQA 2TMVP 1T6UA 3SXZA 1HE9A 1T5OA 5JS5A 3DE8A 2WVOA 2KGOA 2J7PD 2FGYA 3LEOA 3NG1A 2HV6A 2KK1A 1I4YA 1ZHYA 2Y69C 3ITFA 2EPOA 4HE8D 4PK4A 4R32A 1Z7Qc 3PHF2 4JURI 1OKKA 4G7HF 1ZYRF 5DQTA 2J9UA 2R25A 3MBGA 2YVKA 1PD0A 4XEKA 4YN0B 2R7VA 3V7OA 3FXHA 4J7TA 4HEAJ 3EHMA 1V4AA 2CCYA 2UUIA 3RF3A 1GQAA 2ETSA 2X0CA 2LSEA 4XLNF 5KYXA 2OOCA 4E18A 2M4EA 2EPNA 4J30B 1VLTA 1SMYF 1TWHA 3K1IC 3LAYA 4MVRA 4H4KC 3Q6MA 2XXAA 4FWVA 4NTBA 1HMDA 3DJNB 4IGGA 5KYNA 4GEHA 4EKWA 1MMAA 1Q0MA 1AEPA 4U5CE 5L3VA 1W2WA 2R02A 1M2VA 4MNDA 1NBBA 5FCLA 3JSEO 4PJJA 4BJTA 1NZEA 3AGUA 4EIYA 3GWLA 3ABLC
chains in the Genus database with same CATH topology
2M64A 1NLXA 1L3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M64 A;  1NLX A;  1L3P A; 
#chains in the Genus database with same CATH topology
 2LP4 A;  2ZXP A;  1PD1 A;  3B0P A;  2XLM A;  4IRU A;  4QDL A;  3SEO A;  4E0I A;  4CS7 A;  2HFI A;  3EZH A;  4XPX A;  2DI3 A;  4KNW A;  5D91 A;  1NLX A;  5T3T A;  4K1O A;  4U9E A;  2R7T A;  2OQM A;  1EA8 A;  1Q0D A;  3AG1 C;  3GM3 A;  3LLI A;  1LS1 A;  2EPL X;  4IJJ A;  5L3Q A;  3DAF A;  2VAS A;  4U9D A;  2EPK X;  5GPG B;  3RQE A;  3ZDL A;  1EQ1 A;  2OJQ A;  2GFH A;  1V55 C;  3M4B A;  5AC4 A;  2KQ9 A;  4CBE A;  3PMR A;  2H7O A;  1VYK A;  2PX3 A;  3ATP A;  4MS2 A;  2VB6 A;  3HNK A;  3EFO A;  2Y3B A;  1QQ3 A;  2OU6 A;  3KKB A;  4DVY P;  4FES A;  4JJG A;  4CJG A;  4Q5S F;  1LS4 A;  3C8G B;  1YYJ A;  4PJL A;  2GWW A;  2A6H F;  1QZX A;  2R03 A;  2YEV A;  4WJ0 A;  2XM4 A;  3RFY A;  2QTV A;  3OEO A;  2PBE A;  4O79 A;  3ZG1 A;  3DXJ F;  1RMV A;  1WAT A;  1BR1 A;  4DBR A;  3MYI A;  2IXM A;  3T6G B;  2B0J A;  5F28 E;  5JUA A;  4C3B A;  1BDJ B;  1LE4 A;  2R7R A;  2XLE A;  3QW1 A;  1ORY A;  4ER9 A;  4XLP F;  1SZI A;  1SF8 A;  1LE2 A;  2KNH A;  4PJN A;  1Z63 A;  4MVO A;  1I4Z A;  1LIH A;  4MVS A;  5EGY A;  1KTM A;  3A9C A;  4MVQ A;  1AVO B;  2CNW D;  4YWQ A;  2R7U A;  2L6H A;  3W2V A;  5COG A;  4PFP A;  2XLD A;  2Y3G A;  4JW1 A;  2KC3 A;  2J9W A;  4JJF A;  4C7O A;  2A0U A;  3HNI A;  3LS1 A;  1RKC A;  3QW0 A;  4BJ1 A;  5B3I A;  3M1C B;  3E70 C;  3IQT A;  3AG4 C;  4EBK A;  1QVX A;  5L0G A;  4K7B A;  4RBN A;  3C63 A;  2XL4 A;  3AQC A;  1RJ9 A;  1APC A;  1FTS A;  1M2O A;  3C8Z A;  3EPV A;  4XTK A;  1SR2 A;  3T4R A;  4EHP A;  1M57 C;  1ORJ A;  3GWN A;  1BR4 A;  1LPE A;  3K33 A;  4P9T A;  3ZTZ A;  5KYW B;  2P0N A;  1YZC A;  3HNL A;  2L7A A;  2HS5 A;  2IBF A;  3K6B A;  1CPQ A;  1OW6 A;  3DM9 B;  3U3B A;  3L8J A;  4JTC B;  5T1D B;  3RVZ A;  4U5F E;  5BQI A;  3ASO C;  2XS1 A;  4AL1 A;  4CS9 C;  4MW8 A;  1G4W R;  3NYM A;  2L6G A;  2YZS A;  2PP4 A;  4YL3 A;  3JZ0 A;  3KYJ A;  3MYF A;  4IWB A;  3ZC4 A;  4E17 A;  4YT8 A;  1D1B A;  1MQV A;  1O3U A;  4LLC A;  5KYX B;  5JRA A;  1NFO A;  1KNY A;  2XL6 A;  4OD5 A;  1MMG A;  3H2U A;  1HW1 A;  3W8H A;  2A69 F;  3EG9 B;  4BJ5 C;  5JLI A;  5L0C A;  3EGD A;  3SXK A;  3LLK A;  1UG7 A;  4C3E A;  4CSA C;  4IAO A;  2YL0 A;  4KI2 A;  3LUT B;  2FAP B;  2W9Y A;  4KBL A;  3WHN A;  3A11 A;  1TWC A;  2XXA B;  3FOO A;  3JCU Q;  3J06 A;  2YL7 A;  3U2L A;  3HTK C;  5JSL A;  1TR2 A;  4I1M A;  4N6H A;  1M2V B;  4JCZ A;  3CQZ A;  1E86 A;  2HSB A;  2G62 A;  1Z3I X;  3K7D A;  2EIJ C;  3AJM A;  3DD7 A;  3C8G D;  3SXY A;  4PAC A;  3VM6 A;  3JTL O;  3L8I A;  2ZXR A;  3EHN A;  1H9T A;  2EIM C;  1WWP A;  1C03 A;  5L0F A;  1JPJ A;  3L1M A;  4K0D A;  4Z9J A;  2LD6 A;  1GM5 A;  2NUT A;  3S29 A;  3WG7 C;  3BRJ A;  3S27 A;  1DOV A;  3GEE A;  5DLJ A;  4CIH A;  1ZHX A;  3IEE A;  4MTF A;  2Q9A A;  3ZWI A;  2YWA A;  3TOL A;  3TD7 A;  1Y4C A;  2HJM A;  3TQO A;  3QMK A;  4CJO A;  4U5G A;  5BQG A;  2CYD A;  1UFB A;  4HFK B;  1YJG A;  5BQH A;  4AE4 A;  1PCX A;  3AQB A;  2DYR C;  1T01 A;  2Q9C A;  3O55 A;  4JE9 A;  2J0X A;  4NTA A;  3EFO B;  5L0I A;  1CPR A;  3UGO A;  4OIP F;  2OJE D;  4YL1 A;  3FOP A;  3KYI A;  2B0H A;  2XLW A;  2HZ8 A;  2PX0 A;  2ZD9 A;  4KC9 A;  4RD9 A;  5E33 A;  4LDQ A;  3HNJ A;  4CS8 A;  1RKE B;  2D4U A;  3PCV A;  4ZLC A;  4EWC A;  1T6Q A;  4B6I A;  1BR2 A;  4JC7 A;  1BBH A;  2WVN A;  4RDA A;  4XWJ A;  5CI9 A;  4G78 A;  2Q4F A;  4PR9 A;  5DS6 A;  1D0Z A;  1QPU A;  5F5H A;  2J9B A;  4U5H A;  2OG2 A;  2ASR A;  256B A;  2R7S A;  3POV A;  1OKK D;  3UNG C;  4AL0 A;  5A6B A;  3L34 A;  3I5P A;  3G50 A;  4O7G A;  1XWJ A;  3JRM O;  5K0I A;  3SXM A;  4Z9H A;  1G4U S;  1OR2 A;  4OIQ F;  1XZP A;  1A0B A;  2RD9 A;  4ZLD A;  1Q0F A;  2A6E F;  1CGM E;  2IXO A;  1E84 A;  3B9Q A;  1R4T A;  1TWG A;  2H7B A;  2G3V A;  1FMW A;  1LKX A;  3LS0 A;  4DRI B;  3SYN A;  5DS5 A;  4YL0 A;  4C7O B;  2EIL C;  3C18 A;  2GAQ A;  5L0J A;  2OKU A;  2LQG A;  4D4X A;  2HUJ A;  4E0H A;  4NCQ A;  1HY5 A;  1NSG B;  4BJ6 A;  4CDV A;  1U0B B;  1K05 A;  1YA7 O;  4JEB A;  1H6G A;  5JVE A;  2CNW A;  4BG0 A;  4ONS A;  3RH3 A;  5KYY B;  1D0X A;  1WAS A;  1LI7 A;  2MHR A;  2R9R B;  2W45 A;  1V74 B;  2EIN C;  4JEA A;  3ZVR A;  3QTH A;  1Y6D A;  1QKR A;  4MTO A;  3U8P A;  1QLE C;  1RJ9 B;  2X51 A;  1OQC A;  3ABM C;  3EQL F;  2VCB A;  4JTD B;  3SP1 A;  1ST6 A;  3EZI A;  3KH2 A;  4J7Y A;  1YDI A;  4LDK A;  1J8Y F;  1FR0 A;  3K66 A;  1VLS A;  4G7Z F;  4OIR F;  3UMI A;  3LEV A;  5BUO A;  2JPU A;  2CGE A;  1MND A;  3LNR A;  2YLG A;  2GA0 A;  2VC9 A;  3KL4 A;  4OIN F;  3S84 A;  1R5I D;  2FFH A;  2YHS A;  1VTM P;  1ORS C;  4KNV A;  4JTA B;  5JP7 A;  5KYU A;  3O6X A;  4ULV A;  3QVY A;  3MFN A;  2AWC A;  2RSE B;  2Z15 A;  3DMD A;  3CEX A;  2V26 A;  3Q6N A;  3B0V C;  1Q0K A;  2CDQ A;  4IAQ A;  3EGX B;  4YK5 A;  3UMK A;  2CW0 F;  1S7Z A;  1T9K A;  1OXK A;  3EGD B;  4W8K A;  3U2M A;  1O5H A;  2OEV A;  1LM3 B;  2C04 A;  2LK4 A;  3ASN C;  3IHU A;  3JYH A;  3TOM A;  3ZTM A;  2KJG A;  4E7S A;  1A7D A;  3Q7G A;  1N1C A;  2XM0 A;  1JPN A;  2NUP A;  2H7V C;  4XEF A;  5E3C A;  3RIP A;  4FX5 A;  3U5S A;  4CDA A;  4CDY A;  2IOQ A;  4MTG A;  4A2N B;  2LCH A;  1GGQ A;  1RCP A;  1ZW3 A;  3RQF A;  1BZ4 A;  3US6 A;  2MYS A;  2J45 A;  3ZSU A;  5A6A A;  2V3C C;  1FFH A;  4DOZ A;  2J7P A;  2YKZ A;  4ULW A;  2NUT B;  1K04 A;  4WGZ A;  1CGN A;  2IYL D;  1H9G A;  1JOG A;  4YJW A;  3WOD F;  3NMJ A;  1FFT C;  4DBQ A;  1JMW A;  3TJ6 A;  3GM1 A;  1C17 M;  2IXP A;  2R7O A;  3F47 A;  2MWQ A;  2YRF A;  4MVZ A;  5JT4 A;  1A41 A;  3DKA A;  1D0Y A;  4DJ9 A;  4CS9 A;  4CX9 A;  2YL1 A;  2EPM X;  2M64 A;  4MVM A;  1YAU O;  2P6V A;  3AG3 C;  4AE4 B;  3MX3 A;  4PJM A;  3EH1 A;  3UGP A;  4JIO A;  2PNO A;  3RKO F;  5EK0 A;  3FHD A;  1EI7 A;  3S90 A;  1B68 A;  3N0T A;  4MW3 A;  1E85 A;  3I5Q A;  4EBJ A;  3DZA A;  3KMI A;  3S28 A;  4O6M A;  1T6I A;  4P9F A;  4XPY A;  1F1M A;  1XZQ A;  3LJB A;  4X0R A;  2JX0 A;  1E83 A;  2VCC A;  1D1C A;  1G8X A;  3NMI A;  1LI5 A;  2YQY A;  3OA1 A;  5A6J A;  2BE5 F;  3B29 A;  2JD3 A;  4HFF B;  2D5R B;  2J46 A;  2LFF A;  5IY5 C;  3DM5 A;  5AC5 A;  2OCC C;  3AGT A;  1VK5 A;  4C3D A;  1KU2 A;  3ECS A;  4A4A A;  3C62 A;  2NPU A;  3L0I A;  2W4M A;  4XPW A;  3UMH A;  4N4W A;  1NU9 C;  1G5Z A;  2R7Q A;  3ABK C;  4U5B E;  4Q4Z F;  3QZC A;  1SYQ A;  4OD4 A;  5T3W A;  3DE9 A;  3U3F A;  5KYW A;  2R7W A;  5TJ5 E;  4JCH A;  5DS4 A;  4YT2 A;  2WL8 A;  5HV9 A;  1Z23 A;  3T6B A;  3PDM P;  5L0D A;  2HSQ A;  3V5X A;  2A1D D;  4LAC B;  3JT1 A;  1O87 A;  5B1A C;  2IM8 A;  3N2Z B;  4EUK B;  3VYW A;  2QLA A;  2Q7R A;  2OEX A;  5CIV A;  1L7C A;  2YL3 A;  5E2Q A;  3VF0 A;  1ZU5 A;  4J32 B;  3NKE A;  4NQF A;  2IXN A;  1ZZP A;  3ZQV A;  4GYT A;  1U89 A;  1WTY A;  1A7V A;  1JRA A;  1TWA A;  2I8B A;  2HV7 A;  1V54 C;  3DI5 A;  2HKV A;  3GEI A;  3K1I A;  3IQ5 A;  4N06 A;  4PFO A;  2XLV A;  2LFD A;  1AUE A;  3ZIB A;  3EG9 A;  3CAX A;  3BEH A;  3JRT A;  4O6N A;  3S9O A;  2HMQ A;  3H2V A;  1U6H A;  4CS8 C;  5FZT A;  2LIG A;  2WZF A;  2BC5 A;  3N24 A;  4I44 A;  3VAY A;  4ANJ A;  4FAP B;  4CIP A;  2Q3T A;  4G7O F;  2L9J A;  1RXQ A;  1I5N A;  1YYX A;  2QY9 A;  3O10 A;  1MMD A;  4LDR A;  4D4N A;  1OW8 A;  3CSK A;  5KYU B;  4NC3 A;  3EH2 A;  2XLO A;  3RW0 A;  3V5Y A;  3W2W A;  1E2X A;  1OXB A;  3FVY A;  3NRH A;  2A0B A;  3IQC A;  1C02 A;  3JSZ A;  3VRC A;  1QSP A;  2XRH A;  1HW2 A;  3C7J A;  2XLH A;  1VYI A;  1TQG A;  2AP3 A;  2UUH A;  4GQH A;  1YLM A;  2GDC A;  2QUP A;  4DXW A;  3QVZ A;  2J9V A;  1WGW A;  3IQ6 A;  1IZM A;  3LNM B;  4DVZ A;  3V5Z A;  4I1O B;  1OCO C;  4NTF A;  1IW7 F;  1JAF A;  1Q0G A;  2J0W A;  5COM A;  3U9M A;  3FDQ A;  2NUP B;  3LES A;  2KYH A;  4BJ6 C;  1OCZ C;  2NSF A;  2O9X A;  4QI0 A;  1OR3 A;  5DVW A;  3HJC A;  2QNL A;  1MNE A;  5A6K A;  3T6J A;  4MQ9 F;  2ZXO A;  1M6T A;  1VOM A;  3GM2 A;  3NYJ A;  3U8V A;  5F5F A;  4F4B A;  2Q9B A;  2AVK A;  4I3M A;  4L6R A;  2W4B A;  2DGJ A;  1YA9 A;  3HLZ A;  1DOW A;  3AOU A;  3DWW A;  3MLG A;  5E3A A;  5DQZ A;  1OCR C;  4NY3 A;  2G3K A;  1A7E A;  1VB5 A;  2H8A A;  2L81 A;  3GAN A;  3K1H A;  3TJ5 A;  2BL2 A;  2KW3 C;  1RKE A;  2Y3D A;  2YLD A;  3DAG A;  3G4X A;  2NG1 A;  3NKD A;  2HMZ A;  4M63 A;  3WAQ A;  5AGF A;  4E7Z A;  5A6B D;  3RYL A;  1HE1 A;  3M4C A;  4IAR A;  1TFK B;  3OWT A;  5B3S C;  2E87 A;  1TFO B;  4BPM A;  1WOL A;  3M79 A;  2XSE A;  1ZHZ A;  4DRJ B;  1ZW2 A;  3RVY A;  3B0U X;  3Q7L A;  1GS9 A;  3NDB B;  2NSG A;  3SNH A;  4WGY A;  1Z5Z A;  3TUL A;  5EHH A;  1CGO A;  2XL8 A;  1NFN A;  3GOR A;  4O6Y A;  1YZA A;  3I4U A;  4Z9I A;  4BEM J;  1M56 C;  1J8M F;  4N6C A;  5D92 A;  2QE9 A;  3O39 A;  4BEJ A;  5HSW A;  2P61 A;  1EKY A;  2WZG A;  1OCC C;  2WB7 A;  2ICW G;  2XS8 A;  2DB4 A;  2P7V A;  2Q00 A;  2P1A A;  4IB4 A;  4JZA A;  2C03 A;  4G0H A;  1FMV A;  3FMS A;  5A69 A;  3G4Z A;  2PF4 E;  1ZHW A;  3T9O A;  3ZQY A;  2PFD A;  1ZHT A;  1YAR O;  1OW7 A;  1ZVZ A;  2EIK C;  2J8W A;  3HKK A;  2L6F A;  3FAJ A;  2I15 A;  3JYY A;  1HMO A;  1L3P A;  3C8G A;  3R2P A;  5KYY A;  1JR8 A;  4Q7C A;  5L0H A;  3R7C A;  1S05 A;  2AWY A;  3H65 A;  4JKV A;  4AX2 A;  1PV3 A;  3RQG A;  3F46 A;  3KPH A;  1Z6A A;  3NMK A;  3X2Q C;  2A68 F;  3B71 A;  4H54 A;  1NG1 A;  2F22 A;  4LER A;  4U5D E;  5B1B C;  4UDV A;  4XQ1 A;  3TK0 A;  4QI2 A;  2WZL A;  4JVS A;  5COF A;  3GEH A;  1K40 A;  3U0C A;  1VMA A;  2Y3H A;  3CZ6 A;  3DJU B;  1FNT c;  4U5E E;  3GOD A;  4JRZ A;  2VCA A;  3U9J A;  4BJ5 A;  4DRH B;  1MMN A;  2ZPA A;  4AK9 A;  1D1A A;  2YLI A;  3SZR A;  3X1O A;  3W4Y A;  3S0X A;  1NU7 D;  4CSA A;  4LLE A;  2AU5 A;  3E9V A;  3FAP B;  4XEV A;  5CI8 A;  3UR3 C;  4WAB A;  4YT4 A;  3EGX A;  2VH3 A;  3NYL A;  1LVK A;  3IPM O;  4P6I C;  4OIO F;  2ZXW C;  3EJN A;  3M15 A;  4W8P A;  2KSF A;  1H7I A;  1YVI A;  2HJ3 A;  2DYS C;  1FAP B;  2Y39 A;  4MVU A;  4YT5 A;  1WN0 A;  1TKN A;  4EBB A;  1ZU4 A;  2R7X A;  3AG2 C;  2R05 A;  3W8I A;  2WVQ A;  2TMV P;  1T6U A;  3SXZ A;  1HE9 A;  1T5O A;  5JS5 A;  3DE8 A;  2WVO A;  2KGO A;  2J7P D;  2FGY A;  3LEO A;  3NG1 A;  2HV6 A;  2KK1 A;  1I4Y A;  1ZHY A;  2Y69 C;  3ITF A;  2EPO A;  4HE8 D;  4PK4 A;  4R32 A;  1Z7Q c;  3PHF 2;  4JUR I;  1OKK A;  4G7H F;  1ZYR F;  5DQT A;  2J9U A;  2R25 A;  3MBG A;  2YVK A;  1PD0 A;  4XEK A;  4YN0 B;  2R7V A;  3V7O A;  3FXH A;  4J7T A;  4HEA J;  3EHM A;  1V4A A;  2CCY A;  2UUI A;  3RF3 A;  1GQA A;  2ETS A;  2X0C A;  2LSE A;  4XLN F;  5KYX A;  2OOC A;  4E18 A;  2M4E A;  2EPN A;  4J30 B;  1VLT A;  1SMY F;  1TWH A;  3K1I C;  3LAY A;  4MVR A;  4H4K C;  3Q6M A;  2XXA A;  4FWV A;  4NTB A;  1HMD A;  3DJN B;  4IGG A;  5KYN A;  4GEH A;  4EKW A;  1MMA A;  1Q0M A;  1AEP A;  4U5C E;  5L3V A;  1W2W A;  2R02 A;  1M2V A;  4MND A;  1NBB A;  5FCL A;  3JSE O;  4PJJ A;  4BJT A;  1NZE A;  3AGU A;  4EIY A;  3GWL A;  3ABL C; 
#chains in the Genus database with same CATH homology
 2M64 A;  1NLX A;  1L3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...