2M64A

1h, 13c and 15n chemical shift assignments for phl p 5a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
231
structure length
231
Chain Sequence
PAGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phlp5
publication title Flexible IgE epitope-containing domains of Phl p 5 cause high allergenic activity.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Plant protein
total genus 54
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2013-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.320 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Group V grass pollen allergen 2m64A02
1.20.120.320 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Group V grass pollen allergen 2m64A01
1L3PA 2M64A 1NLXA
chains in the Genus database with same CATH superfamily
4JCHA 4KNVA 2WVQA 3U8PA 2J9UA 3EFOA 1PV3A 2DYRC 5T3TA 5L0GA 2I8BA 1NZEA 4N6HA 4PR9A 5A6KA 4EBJA 2VCAA 3F47A 3S28A 4C7OB 5L0FA 4BEJA 3AGUA 3SXYA 2V26A 3FHDA 3Q7GA 3C62A 1J8MF 1EI7A 2WVNA 3NRHA 4MTOA 3J06A 1GGQA 3JZ0A 3OA1A 3DKAA 1ZU4A 4JE9A 4Z9IA 3GORA 3AG4C 3K7DA 1JPNA 5EHHA 1GQAA 1T5OA 4JEBA 1G8XA 5BQGA 4LACB 4KNWA 4NCQA 2UUHA 3CZ6A 3U2LA 2R7VA 2PFDA 2H8AA 2YL0A 3K1HA 4BJTA 3CQZA 4C3EA 5CI8A 5L0IA 3S29A 3UGOA 3VF0A 2CYDA 2W4BA 4G78A 1E83A 2YKZA 2OG2A 3UMKA 3FAPB 2Y3HA 2XS8A 2G3KA 1JPJA 5K0IA 1BR4A 1LVKA 3UGPA 1LI5A 3GEIA 1RCPA 5JLIA 4ER9A 3RYLA 3NKEA 4CDAA 2BL2A 3ZIBA 2YEVA 5B3IA 1FTSA 1T6QA 2D4UA 3QMKA 3W8IA 1ZHWA 3TK0A 2RD9A 2R7TA 2PBEA 1D0XA 3DM9B 4XWJA 2R05A 4LLEA 2ZXWC 2GWWA 3OEOA 4GQHA 3E70C 4YT2A 2H7VC 3SP1A 4DOZA 1HMDA 1HMOA 2DYSC 1T9KA 3UMHA 5BQHA 3B0PA 3BRJA 4O7GA 4Z9HA 2NUTA 3DZAA 5DS5A 5JP7A 1S05A 2KYHA 1JOGA 1VLSA 4PJNA 1BZ4A 5DQTA 3KL4A 3L8IA 1GM5A 2L9JA 1A7EA 2NG1A 3EGXB 4MS2A 4DBQA 1HE1A 2QE9A 4IARA 1T01A 4Q5SF 2EPKX 4BJ6A 2OU6A 2ETSA 2M64A 1ZHYA 2P0NA 4PFOA 3O55A 4E7SA 3HKKA 3SZRA 3V7OA 1TWAA 4Z9JA 1WATA 1XZQA 3L0IA 3TJ6A 4AK9A 3KH2A 4CSAA 1V54C 3VAYA 2FFHA 4BJ5A 5AC4A 2J9WA 3TOLA 2Z15A 4MVSA 3AQCA 3S90A 1QQ3A 3KMIA 2FGYA 3US6A 2QTVA 4GYTA 5CIVA 4JJFA 3ZQYA 2PX0A 4RBNA 3LEVA 1OCCC 1V55C 4U5DE 3JSEO 2QUPA 3ASOC 2YQYA 4GEHA 5FZTA 2HV7A 5JT4A 1CGME 2A6EF 1V74B 2OKUA 4I1OB 3ZG1A 4BJ6C 1EKYA 1B68A 1Z5ZA 1MMAA 1RJ9A 2KC3A 2J9VA 2GAQA 2L6HA 1YA7O 2CNWD 2PF4E 4CSAC 3DJNB 1E84A 4BJ5C 3RIPA 1YAUO 1G5ZA 3L8JA 1DOWA 1VK5A 1YYJA 2CNWA 3DJUB 4U5BE 4YT4A 3ATPA 3MBGA 1M2VB 4J32B 3K33A 2XLDA 1IW7F 2GFHA 3Q6MA 3TQOA 3AOUA 3ABKC 4ULVA 2YWAA 5A6BD 3FMSA 1OW7A 2HMQA 3EG9B 4DRJB 4JCZA 5A6BA 4OD5A 5JSLA 3M4CA 2QNLA 4H4KC 3RFYA 1ZW3A 2ICWG 1T6IA 1EA8A 1I4ZA 2PNOA 1VLTA 1JRAA 4FWVA 2Y3DA 2YL3A 5FCLA 2TMVP 3UMIA 4DRHB 3T6GB 1NU7D 3MYFA 2XSEA 1LS4A 3SEOA 4JTCB 1AEPA 2FAPB 4C7OA 2KW3C 2YZSA 3SXMA 4EWCA 5T3WA 3O10A 2D5RB 5AGFA 4C3BA 2YLDA 5DS4A 1G4US 3R2PA 4WGYA 4EKWA 1U0BB 2YL1A 1FFTC 1I5NA 2E87A 3A9CA 4MVOA 4U5GA 5T1DB 4RD9A 3SXZA 3U5SA 5A6JA 5KYNA 2Q00A 2C04A 4AE4B 4DJ9A 5L3VA 5COMA 2VCBA 1Q0KA 2CGEA 2XLOA 2JX0A 4OIRF 5L0HA 1RMVA 4G7OF 2LFDA 2LQGA 3EZIA 1QVXA 4C3DA 2G62A 1BDJB 1VYIA 1L3PA 1ZYRF 2R7QA 4RDAA 3TD7A 4U9DA 5B3SC 2L6GA 4CS7A 2I15A 3LNRA 5DQZA 4FESA 4ZLCA 3WG7C 1A41A 1PD1A 1TWHA 4YL3A 4D4NA 1D1CA 4ZLDA 4YL1A 5DVWA 5DS6A 1RKEB 3QW0A 2ZD9A 2XXAB 3MFNA 2Q9CA 4B6IA 3B9QA 3FDQA 4A2NB 2X0CA 2G3VA 3LS0A 1MNDA 2KQ9A 1VMAA 3CAXA 4EHPA 1OXBA 5B1BC 3W4YA 4A4AA 3HNIA 3Q7LA 2OQMA 1HY5A 3RH3A 1LS1A 4LDKA 4NTAA 2J8WA 1OW6A 4N6CA 4NTBA 4PJJA 2L7AA 2OJQA 4AL1A 2AU5A 4FX5A 4MW3A 4JTAB 4M63A 3C8GB 3T6JA 2HV6A 5KYXB 3S0XA 1C02A 3EGXA 3OWTA 4DRIB 3DAGA 3V5XA 3SXKA 3SYNA 1Z23A 3H2UA 2X51A 4W8PA 4YT5A 1Z3IX 3DD7A 3K6BA 3LESA 1ORSC 3NYLA 3EZHA 2YLGA 2OCCC 1OQCA 4I3MA 5JRAA 1TWCA 1CPRA 2Q3TA 3RKOF 1R4TA 3AQBA 2NUPB 4KC9A 2LSEA 3LJBA 1VB5A 4JVSA 4O6MA 4YK5A 4K0DA 3RF3A 3RQGA 5E33A 3T9OA 3Q6NA 4CDYA 1NG1A 4AX2A 4P9TA 4U5HA 3EFOB 3U8VA 2ASRA 4XEVA 2EPNA 3WAQA 2WZGA 1D0YA 1TQGA 1PD0A 2LFFA 2R9RB 3AG3C 3N2ZB 1H9TA 4NTFA 4BEMJ 2J9BA 4BPMA 2YVKA 1TKNA 5L0CA 3LLIA 2H7OA 4PJLA 2A6HF 3U2MA 2J0WA 1UFBA 4HFKB 1W2WA 3GM3A 2NSGA 1IZMA 4WGZA 4KBLA 3NYMA 3L1MA 1M2VA 3EGDB 2HFIA 2R7SA 2Q9BA 2HJ3A 1NSGB 2XLVA 2XS1A 2PP4A 2R7XA 4DXWA 4XEFA 2XL6A 3LEOA 1OXKA 3C7JA 5L0DA 1OCRC 1YDIA 3EG9A 1LPEA 1QZXA 3DE9A 4J7YA 4CDVA 3KYIA 3AG1C 2R7WA 1M56C 3S27A 2LCHA 2XL4A 1K04A 1OKKD 1TR2A 1YA9A 1ZHZA 3ABMC 5E3AA 4OIOF 1E85A 1U89A 2XLEA 4XLNF 3GM1A 1OKKA 2IBFA 2A0BA 1O5HA 3EJNA 5D91A 3ZWIA 3PDMP 3SNHA 4CS9A 2QY9A 3RVZA 5JS5A 2C03A 4IJJA 4NC3A 2HS5A 1HE9A 1QPUA 2HUJA 1ZHTA 3GEEA 4MW8A 4NY3A 3O6XA 2IOQA 3W2VA 4DVZA 2ZPAA 3NMIA 4U5EE 2P61A 5TJ5E 1ORYA 4EUKB 1KTMA 4JEAA 1WTYA 3DXJF 3M1CB 3C8ZA 4Q7CA 4FAPB 4MVZA 2VH3A 1BR2A 3C18A 3ITFA 4IB4A 3B0VC 3DWWA 4P6IC 4YL0A 3W8HA 1I4YA 2EIJC 4AE4A 1MMDA 3WHNA 4JIOA 3E9VA 3I5QA 4LDQA 3S9OA 4AL0A 3IQCA 4K7BA 4XTKA 1VTMP 4CS9C 4HFFB 2IYLD 2KNHA 3N0TA 4ULWA 3ZTZA 1SMYF 2VCCA 4CIPA 2NUPA 2HMZA 2P1AA 5CI9A 4YJWA 4XPYA 3HNJA 2A69F 2AP3A 1WN0A 2EPMX 3HNKA 3IHUA 4OD4A 1E86A 3ABLC 4U5FE 1K40A 1J8YF 5KYUB 1DOVA 5HSWA 2CCYA 2P6VA 2JPUA 4DVYP 4YT8A 3KPHA 1CPQA 3FAJA 1D1AA 3K1IA 2IXPA 3VRCA 3ZDLA 1OR3A 2XXAA 3QVZA 4XPXA 5F28E 3HTKC 4QI2A 3W2WA 4N4WA 3JRMO 3FOOA 2HZ8A 1ZHXA 3EHMA 4CX9A 1SZIA 4G7ZF 3B0UX 2ZXPA 4L6RA 2W45A 2OEXA 1ZZPA 2UUIA 3V5YA 4XQ1A 2GA0A 1LI7A 1Y6DA 2R02A 3NMJA 1Q0MA 2BE5F 3JYHA 2HSBA 3K66A 4PJMA 4F4BA 4PACA 3IEEA 1AVOB 2H7BA 5KYWB 2Q4FA 3JT1A 4YWQA 2B0JA 2CW0F 3C8GD 1NFOA 3X2QC 2W9YA 3ZC4A 5IY5C 1G4WR 2EPOA 3IQ5A 2AVKA 3K1IC 5KYXA 3C8GA 2MYSA 2DGJA 1YVIA 3PMRA 4G0HA 3L34A 4O79A 1FNTc 3H65A 1FMVA 3RW0A 4EBBA 3A11A 3NG1A 2R03A 3VYWA 2EIMC 4JZAA 1RXQA 2YHSA 2PX3A 3V5ZA 1APCA 1WGWA 1LIHA 3CEXA 3TJ5A 1YARO 3S84A 3HLZA 3I4UA 5E3CA 2XM4A 3I5PA 3MLGA 5B1AC 4CJOA 2QLAA 4J30B 3LAYA 3F46A 4PK4A 1FMWA 1TFOB 3UNGC 3ZVRA 3U9MA 1JR8A 2EIKC 3DAFA 1KNYA 3KYJA 1QKRA 1BR1A 4I1MA 3LLKA 3ZQVA 5KYYB 2Y39A 4I44A 4J7TA 2Y3BA 1MMNA 2VC9A 4MQ9F 3HNLA 4CBEA 1M6TA 1JAFA 4E7ZA 2HJMA 3DI5A 2B0HA 4EBKA 1C17M 4CIHA 3GM2A 2YLIA 2Q7RA 1OCOC 2LIGA 3QVYA 2R7UA 1FAPB 2AWCA 1LE2A 2DI3A 1H6GA 1Q0DA 1YLMA 5EGYA 1O87A 4JTDB 2RSEB 1GS9A 3DE8A 3EGDA 1R5ID 2P7VA 1H7IA 1LE4A 2Y69C 3NMKA 5F5HA 5JUAA 1LM3B 4Q4ZF 4U9EA 1M2OA 2WB7A 3EQLF 4BG0A 2YL7A 3FVYA 4JC7A 1K05A 1U6HA 3QW1A 3U3FA 1Q0GA 2OOCA 3ZTMA 3MYIA 2LD6A 2EPLX 3GODA 2KK1A 3FXHA 1CGOA 1O3UA 4R32A 1M57C 4WABA 4BJ1A 4JRZA 3IPMO 3RVYA 1HW2A 2NPUA 3PCVA 1PCXA 1Q0FA 1SR2A 3G50A 1OR2A 3KKBA 4H54A 3IQ6A 4MTGA 4O6YA 4CJGA 4CS8A 1Y4CA 1SYQA 3IQTA 4IWBA 1H9GA 4JKVA 3QZCA 3B29A 5JVEA 3GEHA 4MVMA 4ONSA 1F1MA 2EILC 1YZCA 1CGNA 3R7CA 3EPVA 2NSFA 2GDCA 1XZPA 3TOMA 5EK0A 4MTFA 256BA 1ST6A 4YN0B 2IXOA 3RQFA 3WODF 4E0HA 1LKXA 1VYKA 3JTLO 4PFPA 1ZU5A 2HKVA 4E17A 4KI2A 1T6UA 4CS8C 2ZXOA 5A6AA 1HW1A 3B71A 1MQVA 3LUTB 1VOMA 3G4ZA 5E2QA 1D1BA 2J46A 2WL8A 2V3CC 2J7PD 1E2XA 2XL8A 5GPGB 1SF8A 1NFNA 2BC5A 4MVRA 4XEKA 3JCUQ 2A68F 2J7PA 3O39A 2AWYA 1Z63A 4HEAJ 3M4BA 1RKCA 3UR3C 1NBBA 2VB6A 2W4MA 2LK4A 3JSZA 2L6FA 5KYUA 3GWLA 4UDVA 1V4AA 4JJGA 2A1DD 2OJED 2ZXRA 3AGTA 3H2VA 1Z7Qc 3BEHA 4XLPF 4IRUA 4ANJA 2NUTB 3M79A 2M4EA 5BQIA 1TFKB 1YZAA 1C03A 3NYJA 4JW1A 2J0XA 3T4RA 2F22A 3PHF2 1KU2A 3NDBB 1NU9C 1XWJA 3ECSA 4N06A 2KJGA 2R7OA 1EQ1A 2LP4A 4EIYA 5BUOA 2L81A 4XPWA 4W8KA 4WJ0A 3M15A 5KYWA 3DMDA 3JRTA 1WOLA 1A7DA 3LNMB 4NQFA 4O6NA 4MVQA 4U5CE 5D92A 1Z6AA 2CDQA 3U9JA 4D4XA 1OW8A 2JD3A 5COGA 4JURI 1FFHA 2WZFA 5A69A 2Q9AA 3RQEA 2WZLA 1JMWA 1A7VA 1QLEC 2IXNA 4IAOA 3JYYA 3ZSUA 1RKEA 1TWGA 1N1CA 2O9XA 3HJCA 4IAQA 4IGGA 4LLCA 3TULA 3LS1A 2J45A 2XLMA 3AJMA 3DM5A 1YJGA 3CSKA 4P9FA 1BBHA 4E18A 2EINC 4MVUA 4OIPF 3EH1A 1AUEA 4K1OA 3VM6A 1UG7A 3POVA 1D0ZA 2KSFA 1NLXA 2VASA 4LDRA 2YRFA 5COFA 4OINF 3U3BA 1RJ9B 3AG2C 3C63A 5HV9A 2XM0A 3G4XA 4HE8D 1MNEA 2MWQA 4QDLA 1L7CA 1MMGA 1FR0A 1ZVZA 1ORJA 5F5FA 5KYYA 2IXMA 2WVOA 2A0UA 2OEVA 2XRHA 5L0JA 1S7ZA 1WWPA 2XLWA 3FOPA 3MX3A 5AC5A 2DB4A 2HSQA 1OCZC 1ZW2A 2KGOA 2Y3GA 4LERA 1QSPA 1WASA 2IM8A 4DBRA 3GANA 4QI0A 4G7HF 3QTHA 4E0IA 1YYXA 4X0RA 3U0CA 5DLJA 3NKDA 2XLHA 2R7RA 3ASNC 4OIQF 3X1OA 2R25A 3EH2A 4MNDA 5L3QA 3GWNA 3EHNA 1A0BA 2MHRA 3N24A 3T6BA
chains in the Genus database with same CATH topology
1L3PA 2M64A 1NLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L3P A;  2M64 A;  1NLX A; 
#chains in the Genus database with same CATH topology
 4JCH A;  4KNV A;  2WVQ A;  3U8P A;  2J9U A;  3EFO A;  1PV3 A;  2DYR C;  5T3T A;  5L0G A;  2I8B A;  1NZE A;  4N6H A;  4PR9 A;  5A6K A;  4EBJ A;  2VCA A;  3F47 A;  3S28 A;  4C7O B;  5L0F A;  4BEJ A;  3AGU A;  3SXY A;  2V26 A;  3FHD A;  3Q7G A;  3C62 A;  1J8M F;  1EI7 A;  2WVN A;  3NRH A;  4MTO A;  3J06 A;  1GGQ A;  3JZ0 A;  3OA1 A;  3DKA A;  1ZU4 A;  4JE9 A;  4Z9I A;  3GOR A;  3AG4 C;  3K7D A;  1JPN A;  5EHH A;  1GQA A;  1T5O A;  4JEB A;  1G8X A;  5BQG A;  4LAC B;  4KNW A;  4NCQ A;  2UUH A;  3CZ6 A;  3U2L A;  2R7V A;  2PFD A;  2H8A A;  2YL0 A;  3K1H A;  4BJT A;  3CQZ A;  4C3E A;  5CI8 A;  5L0I A;  3S29 A;  3UGO A;  3VF0 A;  2CYD A;  2W4B A;  4G78 A;  1E83 A;  2YKZ A;  2OG2 A;  3UMK A;  3FAP B;  2Y3H A;  2XS8 A;  2G3K A;  1JPJ A;  5K0I A;  1BR4 A;  1LVK A;  3UGP A;  1LI5 A;  3GEI A;  1RCP A;  5JLI A;  4ER9 A;  3RYL A;  3NKE A;  4CDA A;  2BL2 A;  3ZIB A;  2YEV A;  5B3I A;  1FTS A;  1T6Q A;  2D4U A;  3QMK A;  3W8I A;  1ZHW A;  3TK0 A;  2RD9 A;  2R7T A;  2PBE A;  1D0X A;  3DM9 B;  4XWJ A;  2R05 A;  4LLE A;  2ZXW C;  2GWW A;  3OEO A;  4GQH A;  3E70 C;  4YT2 A;  2H7V C;  3SP1 A;  4DOZ A;  1HMD A;  1HMO A;  2DYS C;  1T9K A;  3UMH A;  5BQH A;  3B0P A;  3BRJ A;  4O7G A;  4Z9H A;  2NUT A;  3DZA A;  5DS5 A;  5JP7 A;  1S05 A;  2KYH A;  1JOG A;  1VLS A;  4PJN A;  1BZ4 A;  5DQT A;  3KL4 A;  3L8I A;  1GM5 A;  2L9J A;  1A7E A;  2NG1 A;  3EGX B;  4MS2 A;  4DBQ A;  1HE1 A;  2QE9 A;  4IAR A;  1T01 A;  4Q5S F;  2EPK X;  4BJ6 A;  2OU6 A;  2ETS A;  2M64 A;  1ZHY A;  2P0N A;  4PFO A;  3O55 A;  4E7S A;  3HKK A;  3SZR A;  3V7O A;  1TWA A;  4Z9J A;  1WAT A;  1XZQ A;  3L0I A;  3TJ6 A;  4AK9 A;  3KH2 A;  4CSA A;  1V54 C;  3VAY A;  2FFH A;  4BJ5 A;  5AC4 A;  2J9W A;  3TOL A;  2Z15 A;  4MVS A;  3AQC A;  3S90 A;  1QQ3 A;  3KMI A;  2FGY A;  3US6 A;  2QTV A;  4GYT A;  5CIV A;  4JJF A;  3ZQY A;  2PX0 A;  4RBN A;  3LEV A;  1OCC C;  1V55 C;  4U5D E;  3JSE O;  2QUP A;  3ASO C;  2YQY A;  4GEH A;  5FZT A;  2HV7 A;  5JT4 A;  1CGM E;  2A6E F;  1V74 B;  2OKU A;  4I1O B;  3ZG1 A;  4BJ6 C;  1EKY A;  1B68 A;  1Z5Z A;  1MMA A;  1RJ9 A;  2KC3 A;  2J9V A;  2GAQ A;  2L6H A;  1YA7 O;  2CNW D;  2PF4 E;  4CSA C;  3DJN B;  1E84 A;  4BJ5 C;  3RIP A;  1YAU O;  1G5Z A;  3L8J A;  1DOW A;  1VK5 A;  1YYJ A;  2CNW A;  3DJU B;  4U5B E;  4YT4 A;  3ATP A;  3MBG A;  1M2V B;  4J32 B;  3K33 A;  2XLD A;  1IW7 F;  2GFH A;  3Q6M A;  3TQO A;  3AOU A;  3ABK C;  4ULV A;  2YWA A;  5A6B D;  3FMS A;  1OW7 A;  2HMQ A;  3EG9 B;  4DRJ B;  4JCZ A;  5A6B A;  4OD5 A;  5JSL A;  3M4C A;  2QNL A;  4H4K C;  3RFY A;  1ZW3 A;  2ICW G;  1T6I A;  1EA8 A;  1I4Z A;  2PNO A;  1VLT A;  1JRA A;  4FWV A;  2Y3D A;  2YL3 A;  5FCL A;  2TMV P;  3UMI A;  4DRH B;  3T6G B;  1NU7 D;  3MYF A;  2XSE A;  1LS4 A;  3SEO A;  4JTC B;  1AEP A;  2FAP B;  4C7O A;  2KW3 C;  2YZS A;  3SXM A;  4EWC A;  5T3W A;  3O10 A;  2D5R B;  5AGF A;  4C3B A;  2YLD A;  5DS4 A;  1G4U S;  3R2P A;  4WGY A;  4EKW A;  1U0B B;  2YL1 A;  1FFT C;  1I5N A;  2E87 A;  3A9C A;  4MVO A;  4U5G A;  5T1D B;  4RD9 A;  3SXZ A;  3U5S A;  5A6J A;  5KYN A;  2Q00 A;  2C04 A;  4AE4 B;  4DJ9 A;  5L3V A;  5COM A;  2VCB A;  1Q0K A;  2CGE A;  2XLO A;  2JX0 A;  4OIR F;  5L0H A;  1RMV A;  4G7O F;  2LFD A;  2LQG A;  3EZI A;  1QVX A;  4C3D A;  2G62 A;  1BDJ B;  1VYI A;  1L3P A;  1ZYR F;  2R7Q A;  4RDA A;  3TD7 A;  4U9D A;  5B3S C;  2L6G A;  4CS7 A;  2I15 A;  3LNR A;  5DQZ A;  4FES A;  4ZLC A;  3WG7 C;  1A41 A;  1PD1 A;  1TWH A;  4YL3 A;  4D4N A;  1D1C A;  4ZLD A;  4YL1 A;  5DVW A;  5DS6 A;  1RKE B;  3QW0 A;  2ZD9 A;  2XXA B;  3MFN A;  2Q9C A;  4B6I A;  3B9Q A;  3FDQ A;  4A2N B;  2X0C A;  2G3V A;  3LS0 A;  1MND A;  2KQ9 A;  1VMA A;  3CAX A;  4EHP A;  1OXB A;  5B1B C;  3W4Y A;  4A4A A;  3HNI A;  3Q7L A;  2OQM A;  1HY5 A;  3RH3 A;  1LS1 A;  4LDK A;  4NTA A;  2J8W A;  1OW6 A;  4N6C A;  4NTB A;  4PJJ A;  2L7A A;  2OJQ A;  4AL1 A;  2AU5 A;  4FX5 A;  4MW3 A;  4JTA B;  4M63 A;  3C8G B;  3T6J A;  2HV6 A;  5KYX B;  3S0X A;  1C02 A;  3EGX A;  3OWT A;  4DRI B;  3DAG A;  3V5X A;  3SXK A;  3SYN A;  1Z23 A;  3H2U A;  2X51 A;  4W8P A;  4YT5 A;  1Z3I X;  3DD7 A;  3K6B A;  3LES A;  1ORS C;  3NYL A;  3EZH A;  2YLG A;  2OCC C;  1OQC A;  4I3M A;  5JRA A;  1TWC A;  1CPR A;  2Q3T A;  3RKO F;  1R4T A;  3AQB A;  2NUP B;  4KC9 A;  2LSE A;  3LJB A;  1VB5 A;  4JVS A;  4O6M A;  4YK5 A;  4K0D A;  3RF3 A;  3RQG A;  5E33 A;  3T9O A;  3Q6N A;  4CDY A;  1NG1 A;  4AX2 A;  4P9T A;  4U5H A;  3EFO B;  3U8V A;  2ASR A;  4XEV A;  2EPN A;  3WAQ A;  2WZG A;  1D0Y A;  1TQG A;  1PD0 A;  2LFF A;  2R9R B;  3AG3 C;  3N2Z B;  1H9T A;  4NTF A;  4BEM J;  2J9B A;  4BPM A;  2YVK A;  1TKN A;  5L0C A;  3LLI A;  2H7O A;  4PJL A;  2A6H F;  3U2M A;  2J0W A;  1UFB A;  4HFK B;  1W2W A;  3GM3 A;  2NSG A;  1IZM A;  4WGZ A;  4KBL A;  3NYM A;  3L1M A;  1M2V A;  3EGD B;  2HFI A;  2R7S A;  2Q9B A;  2HJ3 A;  1NSG B;  2XLV A;  2XS1 A;  2PP4 A;  2R7X A;  4DXW A;  4XEF A;  2XL6 A;  3LEO A;  1OXK A;  3C7J A;  5L0D A;  1OCR C;  1YDI A;  3EG9 A;  1LPE A;  1QZX A;  3DE9 A;  4J7Y A;  4CDV A;  3KYI A;  3AG1 C;  2R7W A;  1M56 C;  3S27 A;  2LCH A;  2XL4 A;  1K04 A;  1OKK D;  1TR2 A;  1YA9 A;  1ZHZ A;  3ABM C;  5E3A A;  4OIO F;  1E85 A;  1U89 A;  2XLE A;  4XLN F;  3GM1 A;  1OKK A;  2IBF A;  2A0B A;  1O5H A;  3EJN A;  5D91 A;  3ZWI A;  3PDM P;  3SNH A;  4CS9 A;  2QY9 A;  3RVZ A;  5JS5 A;  2C03 A;  4IJJ A;  4NC3 A;  2HS5 A;  1HE9 A;  1QPU A;  2HUJ A;  1ZHT A;  3GEE A;  4MW8 A;  4NY3 A;  3O6X A;  2IOQ A;  3W2V A;  4DVZ A;  2ZPA A;  3NMI A;  4U5E E;  2P61 A;  5TJ5 E;  1ORY A;  4EUK B;  1KTM A;  4JEA A;  1WTY A;  3DXJ F;  3M1C B;  3C8Z A;  4Q7C A;  4FAP B;  4MVZ A;  2VH3 A;  1BR2 A;  3C18 A;  3ITF A;  4IB4 A;  3B0V C;  3DWW A;  4P6I C;  4YL0 A;  3W8H A;  1I4Y A;  2EIJ C;  4AE4 A;  1MMD A;  3WHN A;  4JIO A;  3E9V A;  3I5Q A;  4LDQ A;  3S9O A;  4AL0 A;  3IQC A;  4K7B A;  4XTK A;  1VTM P;  4CS9 C;  4HFF B;  2IYL D;  2KNH A;  3N0T A;  4ULW A;  3ZTZ A;  1SMY F;  2VCC A;  4CIP A;  2NUP A;  2HMZ A;  2P1A A;  5CI9 A;  4YJW A;  4XPY A;  3HNJ A;  2A69 F;  2AP3 A;  1WN0 A;  2EPM X;  3HNK A;  3IHU A;  4OD4 A;  1E86 A;  3ABL C;  4U5F E;  1K40 A;  1J8Y F;  5KYU B;  1DOV A;  5HSW A;  2CCY A;  2P6V A;  2JPU A;  4DVY P;  4YT8 A;  3KPH A;  1CPQ A;  3FAJ A;  1D1A A;  3K1I A;  2IXP A;  3VRC A;  3ZDL A;  1OR3 A;  2XXA A;  3QVZ A;  4XPX A;  5F28 E;  3HTK C;  4QI2 A;  3W2W A;  4N4W A;  3JRM O;  3FOO A;  2HZ8 A;  1ZHX A;  3EHM A;  4CX9 A;  1SZI A;  4G7Z F;  3B0U X;  2ZXP A;  4L6R A;  2W45 A;  2OEX A;  1ZZP A;  2UUI A;  3V5Y A;  4XQ1 A;  2GA0 A;  1LI7 A;  1Y6D A;  2R02 A;  3NMJ A;  1Q0M A;  2BE5 F;  3JYH A;  2HSB A;  3K66 A;  4PJM A;  4F4B A;  4PAC A;  3IEE A;  1AVO B;  2H7B A;  5KYW B;  2Q4F A;  3JT1 A;  4YWQ A;  2B0J A;  2CW0 F;  3C8G D;  1NFO A;  3X2Q C;  2W9Y A;  3ZC4 A;  5IY5 C;  1G4W R;  2EPO A;  3IQ5 A;  2AVK A;  3K1I C;  5KYX A;  3C8G A;  2MYS A;  2DGJ A;  1YVI A;  3PMR A;  4G0H A;  3L34 A;  4O79 A;  1FNT c;  3H65 A;  1FMV A;  3RW0 A;  4EBB A;  3A11 A;  3NG1 A;  2R03 A;  3VYW A;  2EIM C;  4JZA A;  1RXQ A;  2YHS A;  2PX3 A;  3V5Z A;  1APC A;  1WGW A;  1LIH A;  3CEX A;  3TJ5 A;  1YAR O;  3S84 A;  3HLZ A;  3I4U A;  5E3C A;  2XM4 A;  3I5P A;  3MLG A;  5B1A C;  4CJO A;  2QLA A;  4J30 B;  3LAY A;  3F46 A;  4PK4 A;  1FMW A;  1TFO B;  3UNG C;  3ZVR A;  3U9M A;  1JR8 A;  2EIK C;  3DAF A;  1KNY A;  3KYJ A;  1QKR A;  1BR1 A;  4I1M A;  3LLK A;  3ZQV A;  5KYY B;  2Y39 A;  4I44 A;  4J7T A;  2Y3B A;  1MMN A;  2VC9 A;  4MQ9 F;  3HNL A;  4CBE A;  1M6T A;  1JAF A;  4E7Z A;  2HJM A;  3DI5 A;  2B0H A;  4EBK A;  1C17 M;  4CIH A;  3GM2 A;  2YLI A;  2Q7R A;  1OCO C;  2LIG A;  3QVY A;  2R7U A;  1FAP B;  2AWC A;  1LE2 A;  2DI3 A;  1H6G A;  1Q0D A;  1YLM A;  5EGY A;  1O87 A;  4JTD B;  2RSE B;  1GS9 A;  3DE8 A;  3EGD A;  1R5I D;  2P7V A;  1H7I A;  1LE4 A;  2Y69 C;  3NMK A;  5F5H A;  5JUA A;  1LM3 B;  4Q4Z F;  4U9E A;  1M2O A;  2WB7 A;  3EQL F;  4BG0 A;  2YL7 A;  3FVY A;  4JC7 A;  1K05 A;  1U6H A;  3QW1 A;  3U3F A;  1Q0G A;  2OOC A;  3ZTM A;  3MYI A;  2LD6 A;  2EPL X;  3GOD A;  2KK1 A;  3FXH A;  1CGO A;  1O3U A;  4R32 A;  1M57 C;  4WAB A;  4BJ1 A;  4JRZ A;  3IPM O;  3RVY A;  1HW2 A;  2NPU A;  3PCV A;  1PCX A;  1Q0F A;  1SR2 A;  3G50 A;  1OR2 A;  3KKB A;  4H54 A;  3IQ6 A;  4MTG A;  4O6Y A;  4CJG A;  4CS8 A;  1Y4C A;  1SYQ A;  3IQT A;  4IWB A;  1H9G A;  4JKV A;  3QZC A;  3B29 A;  5JVE A;  3GEH A;  4MVM A;  4ONS A;  1F1M A;  2EIL C;  1YZC A;  1CGN A;  3R7C A;  3EPV A;  2NSF A;  2GDC A;  1XZP A;  3TOM A;  5EK0 A;  4MTF A;  256B A;  1ST6 A;  4YN0 B;  2IXO A;  3RQF A;  3WOD F;  4E0H A;  1LKX A;  1VYK A;  3JTL O;  4PFP A;  1ZU5 A;  2HKV A;  4E17 A;  4KI2 A;  1T6U A;  4CS8 C;  2ZXO A;  5A6A A;  1HW1 A;  3B71 A;  1MQV A;  3LUT B;  1VOM A;  3G4Z A;  5E2Q A;  1D1B A;  2J46 A;  2WL8 A;  2V3C C;  2J7P D;  1E2X A;  2XL8 A;  5GPG B;  1SF8 A;  1NFN A;  2BC5 A;  4MVR A;  4XEK A;  3JCU Q;  2A68 F;  2J7P A;  3O39 A;  2AWY A;  1Z63 A;  4HEA J;  3M4B A;  1RKC A;  3UR3 C;  1NBB A;  2VB6 A;  2W4M A;  2LK4 A;  3JSZ A;  2L6F A;  5KYU A;  3GWL A;  4UDV A;  1V4A A;  4JJG A;  2A1D D;  2OJE D;  2ZXR A;  3AGT A;  3H2V A;  1Z7Q c;  3BEH A;  4XLP F;  4IRU A;  4ANJ A;  2NUT B;  3M79 A;  2M4E A;  5BQI A;  1TFK B;  1YZA A;  1C03 A;  3NYJ A;  4JW1 A;  2J0X A;  3T4R A;  2F22 A;  3PHF 2;  1KU2 A;  3NDB B;  1NU9 C;  1XWJ A;  3ECS A;  4N06 A;  2KJG A;  2R7O A;  1EQ1 A;  2LP4 A;  4EIY A;  5BUO A;  2L81 A;  4XPW A;  4W8K A;  4WJ0 A;  3M15 A;  5KYW A;  3DMD A;  3JRT A;  1WOL A;  1A7D A;  3LNM B;  4NQF A;  4O6N A;  4MVQ A;  4U5C E;  5D92 A;  1Z6A A;  2CDQ A;  3U9J A;  4D4X A;  1OW8 A;  2JD3 A;  5COG A;  4JUR I;  1FFH A;  2WZF A;  5A69 A;  2Q9A A;  3RQE A;  2WZL A;  1JMW A;  1A7V A;  1QLE C;  2IXN A;  4IAO A;  3JYY A;  3ZSU A;  1RKE A;  1TWG A;  1N1C A;  2O9X A;  3HJC A;  4IAQ A;  4IGG A;  4LLC A;  3TUL A;  3LS1 A;  2J45 A;  2XLM A;  3AJM A;  3DM5 A;  1YJG A;  3CSK A;  4P9F A;  1BBH A;  4E18 A;  2EIN C;  4MVU A;  4OIP F;  3EH1 A;  1AUE A;  4K1O A;  3VM6 A;  1UG7 A;  3POV A;  1D0Z A;  2KSF A;  1NLX A;  2VAS A;  4LDR A;  2YRF A;  5COF A;  4OIN F;  3U3B A;  1RJ9 B;  3AG2 C;  3C63 A;  5HV9 A;  2XM0 A;  3G4X A;  4HE8 D;  1MNE A;  2MWQ A;  4QDL A;  1L7C A;  1MMG A;  1FR0 A;  1ZVZ A;  1ORJ A;  5F5F A;  5KYY A;  2IXM A;  2WVO A;  2A0U A;  2OEV A;  2XRH A;  5L0J A;  1S7Z A;  1WWP A;  2XLW A;  3FOP A;  3MX3 A;  5AC5 A;  2DB4 A;  2HSQ A;  1OCZ C;  1ZW2 A;  2KGO A;  2Y3G A;  4LER A;  1QSP A;  1WAS A;  2IM8 A;  4DBR A;  3GAN A;  4QI0 A;  4G7H F;  3QTH A;  4E0I A;  1YYX A;  4X0R A;  3U0C A;  5DLJ A;  3NKD A;  2XLH A;  2R7R A;  3ASN C;  4OIQ F;  3X1O A;  2R25 A;  3EH2 A;  4MND A;  5L3Q A;  3GWN A;  3EHN A;  1A0B A;  2MHR A;  3N24 A;  3T6B A; 
#chains in the Genus database with same CATH homology
 1L3P A;  2M64 A;  1NLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...