2M64A

1h, 13c and 15n chemical shift assignments for phl p 5a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
231
structure length
231
Chain Sequence
PAGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Flexible IgE epitope-containing domains of Phl p 5 cause high allergenic activity.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Plant protein
molecule keywords Phlp5
total genus 54
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2013-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.320 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Group V grass pollen allergen 2m64A02
1.20.120.320 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Group V grass pollen allergen 2m64A01
2M64A 1NLXA 1L3PA
chains in the Genus database with same CATH superfamily
2NG1A 4RBNA 1MMGA 4C3EA 5JVEA 3C7JA 4QI0A 4C3DA 3DI5A 4W8KA 1A7VA 1E2XA 2VASA 4MVSA 5B1AC 2M64A 1VOMA 3C8GB 3LUTB 2W9YA 1ZW3A 3AG2C 3SXZA 2L6FA 3W2WA 3QMKA 3W4YA 3ZWIA 5KYYA 1TKNA 2ASRA 1BDJB 1V54C 3UNGC 4CS8A 1E84A 2UUIA 5A6AA 1J8MF 4LDKA 1U6HA 5COMA 3M4BA 3E9VA 3M1CB 1WATA 3OWTA 4JIOA 3DAFA 4YN0B 1L3PA 4L6RA 1Z3IX 1JAFA 3RIPA 4OIOF 2A0BA 4NCQA 1T01A 1TFOB 1ZYRF 1WOLA 2HMQA 3AG4C 3EFOA 4OINF 1YZCA 3QW0A 1BZ4A 3U8VA 4YT2A 5FZTA 1M6TA 1Q0FA 2IOQA 3LS0A 1SR2A 1OCRC 1SF8A 5E33A 1LS4A 4O6YA 2CNWA 5KYUB 1YDIA 1OXBA 2LFDA 3NMKA 5JSLA 3IQ5A 2J9BA 3KH2A 1Q0MA 4JC7A 3U5SA 5B3IA 2OJQA 2LD6A 4U5CE 2IXNA 2X51A 2AWCA 2MHRA 3C8GA 2L9JA 2VCAA 4XWJA 4YK5A 5HV9A 5E3AA 1WGWA 3NMJA 2ZXOA 1E85A 2ZPAA 2AVKA 4EBKA 1K40A 2YRFA 3B71A 4HEAJ 3T6JA 3HKKA 2PNOA 4JTCB 4O79A 4GYTA 5AC4A 1DOVA 2A0UA 4MVQA 3RQEA 1FAPB 3ASNC 3U9MA 4G78A 1QZXA 2Y3BA 3GM3A 4PJNA 2AP3A 4N06A 3POVA 2NPUA 2ZXRA 4XQ1A 1NU7D 2P61A 2PX3A 1VK5A 1OKKD 3EPVA 3UMIA 2KNHA 1I4ZA 4NQFA 1HY5A 4WABA 2WVQA 3KPHA 3QZCA 4ONSA 2QY9A 5L0IA 4I1MA 5BQHA 2VB6A 2OKUA 4YWQA 3S90A 3SXYA 1LPEA 4DRJB 1RJ9B 4DXWA 2KK1A 3QVYA 2VCCA 3U3FA 4BJ1A 1D0ZA 1ZU4A 3F47A 3MX3A 1TWHA 1FNTc 2YL0A 1NFOA 4JTAB 4BJ5C 2XLDA 1CGME 3B0UX 2WZGA 4YT5A 3VYWA 4NY3A 2EPNA 1AUEA 2HV6A 2Y3DA 4YL0A 2DGJA 1OXKA 4YT8A 4N4WA 1ST6A 2J9WA 4PACA 3RQGA 3MLGA 1KNYA 1OR2A 4JZAA 3C62A 4WGZA 3U0CA 2NUPB 2H8AA 2O9XA 5DVWA 1O5HA 1Q0DA 2JD3A 3K66A 3KYJA 2FFHA 3NMIA 4RD9A 1KTMA 3R2PA 3SNHA 4EBJA 2XLVA 1D1CA 2XLWA 4CBEA 1TR2A 2XL8A 5JLIA 2FGYA 3RYLA 4P9TA 3U3BA 4AK9A 4MTFA 2P7VA 1D0XA 3B9QA 3TOMA 4U5EE 4Q7CA 2P6VA 4U5DE 1APCA 3T4RA 3O6XA 3Q7LA 4NTFA 3F46A 3H65A 3M79A 5E2QA 2LK4A 2EPOA 1BR1A 3ECSA 3NRHA 3US6A 3T9OA 4CJGA 1BBHA 3NG1A 2LSEA 3IQ6A 4CS9A 1HE1A 2YLIA 3GODA 3K1HA 2VC9A 4KNWA 4O7GA 2H7VC 4E0IA 2P1AA 4C7OB 4CIHA 1JPJA 5CI9A 4BEJA 4G7OF 3TJ5A 2XLEA 2HKVA 4JE9A 4JEAA 4DJ9A 1YVIA 4M63A 3K33A 3Q7GA 3PHF2 5EHHA 3I5QA 3SZRA 3U9JA 5T3TA 4GQHA 1LI5A 3RQFA 5JP7A 2KJGA 1FMVA 4BG0A 4BEMJ 4YL1A 1J8YF 1LE4A 2I15A 3LESA 3VAYA 3S28A 2J0WA 1Y4CA 2A69F 4IRUA 1L7CA 2IYLD 2M4EA 2PFDA 4O6NA 3EG9B 5DLJA 1NFNA 1ZU5A 4BJ6A 4DBQA 2MWQA 5L3QA 4DOZA 4IAOA 3V5ZA 4EKWA 3H2VA 4NC3A 5A6JA 2GA0A 4KBLA 4JCZA 2NSGA 4PJMA 1MMNA 3GWNA 3DMDA 4G7ZF 1TQGA 2W4BA 2EPKX 1A41A 1RJ9A 4NTBA 1A7EA 4YL3A 256BA 2GWWA 1FR0A 4K1OA 4MVZA 1MMAA 3ZSUA 2E87A 1KU2A 2P0NA 5COFA 2HJ3A 4CS9C 1AEPA 5A6BD 4Q5SF 3NKDA 3SXKA 4UDVA 4U5GA 2Q9CA 4I44A 2X0CA 4EUKB 5KYXA 1RKEB 3DE8A 2L6GA 1WTYA 1XWJA 2R7OA 4X0RA 4XLPF 3LNMB 4D4XA 1M2VB 2B0HA 1PD0A 2QNLA 3GORA 3A11A 1W2WA 2YHSA 5T3WA 1S05A 2DYSC 2OCCC 4JKVA 3E70C 2YVKA 4HE8D 4AL1A 3AGTA 4XPWA 3U8PA 1MQVA 2R7UA 3GANA 5D91A 4EHPA 3N2ZB 2YL3A 3CEXA 2XLHA 3G50A 2YL1A 2R02A 3AJMA 4QI2A 2DB4A 1ZW2A 2OEVA 3EZHA 4CX9A 2XS1A 2EIMC 1JPNA 3JYYA 2IXPA 4PJLA 1ZHTA 3SP1A 5KYWB 1C02A 5BUOA 1H6GA 1TWGA 3RF3A 2PF4E 1VMAA 1LVKA 3QVZA 3JTLO 3M15A 4XTKA 3VF0A 4AE4B 3UGOA 1FFHA 4CSAA 1G8XA 3MFNA 5COGA 2R7QA 1R4TA 3TULA 3NYMA 2XL4A 3JT1A 2KW3C 3LEVA 1VB5A 4E7ZA 2PBEA 2ZD9A 3ZC4A 1VYKA 2XXAA 2NSFA 2Q7RA 4FAPB 4N6HA 1NU9C 2AWYA 4OIRF 1HMDA 5L3VA 1GQAA 1M2OA 1RXQA 1OQCA 2D4UA 1ORSC 2KC3A 3JYHA 4CIPA 1YYXA 5KYYB 3HLZA 4MW8A 1CPRA 2HUJA 2V3CC 1MMDA 1QQ3A 4QDLA 4XPYA 3LS1A 1CGNA 1RCPA 5JS5A 2XM0A 3IHUA 5K0IA 1IW7F 3FVYA 2J9VA 1Z5ZA 3FOOA 2Q3TA 2QLAA 4IGGA 3WHNA 4CS8C 4C3BA 1RMVA 1RKCA 3S0XA 2XRHA 3UR3C 3PDMP 1WWPA 1EA8A 1Q0GA 3T6BA 3U2LA 2XM4A 4WJ0A 4EBBA 5F5FA 1HE9A 4AE4A 3L1MA 2H7OA 1YLMA 3EHMA 3FOPA 1ZHZA 1OW7A 2CW0F 4CDYA 3B0PA 1BR2A 2G3VA 4ANJA 4EWCA 4U5BE 2J8WA 2J46A 3S9OA 3GEHA 3TOLA 4BJTA 1LS1A 3IQTA 4ZLCA 1M57C 1CPQA 3RH3A 1EQ1A 2R25A 1A7DA 2WZLA 3MYIA 2R03A 4MNDA 1LIHA 1T6QA 5E3CA 5L0JA 1ZHYA 3MYFA 2L81A 3S84A 3UGPA 3KYIA 2A1DD 5EGYA 2R7VA 4AL0A 3J06A 4KI2A 1HMOA 4MTOA 2VCBA 3GEIA 4FESA 3CZ6A 3LNRA 4OD5A 1XZPA 1UG7A 3HTKC 4IWBA 4CS7A 3Q6MA 4Q4ZF 4MVMA 3TJ6A 4J30B 3IQCA 4U5FE 1Q0KA 3TQOA 3ZG1A 1D0YA 4OD4A 3ZQYA 2FAPB 4MVUA 1DOWA 1M2VA 2PP4A 3V7OA 1H9GA 1K04A 2YKZA 3TD7A 1MNEA 2KSFA 1RKEA 1JMWA 4IAQA 4F4BA 3DKAA 3KL4A 4WGYA 4C7OA 4FWVA 3HNLA 4CDAA 4OIPF 1FFTC 2OJED 2NUTA 1M56C 1T6UA 2G62A 4E17A 2HSQA 4NTAA 4PJJA 4XEKA 3TK0A 3K6BA 1ORJA 1EI7A 3IPMO 3EH1A 5F28E 4OIQF 4MVOA 4O6MA 2L7AA 1BR4A 3K7DA 2XLMA 4H54A 4PFOA 1WN0A 4PFPA 4AX2A 2KQ9A 3N24A 2CDQA 3LAYA 5DS5A 1U0BB 2Y69C 4IARA 2HZ8A 2Q4FA 4JJFA 2A68F 1G4US 2KGOA 1U89A 2ZXPA 2QUPA 3IEEA 2WL8A 5CI8A 5AGFA 4P9FA 4KC9A 3HNIA 3W2VA 1V4AA 1R5ID 2QTVA 1UFBA 5L0DA 3LEOA 4XEVA 2OU6A 2AU5A 1QLEC 4U9DA 5L0FA 4MVRA 2NUPA 3ABMC 1B68A 4D4NA 2HSBA 3QW1A 4H4KC 1YJGA 3O55A 4FX5A 5B3SC 2CCYA 2R7RA 1T5OA 3RVZA 2WB7A 1XZQA 3HNJA 5F5HA 1OW8A 4P6IC 3JSZA 1OCZC 1O87A 3CQZA 2J9UA 2YZSA 3DJNB 3G4ZA 3LJBA 2B0JA 5A6BA 5DQZA 4A4AA 4J32B 3CAXA 4DBRA 4KNVA 2ETSA 1I5NA 3EHNA 3I5PA 3RKOF 3DJUB 4E0HA 5JUAA 1YA9A 2W45A 1Z7Qc 1Y6DA 2V26A 2ICWG 2QE9A 2Y39A 4Z9JA 1N1CA 1NLXA 1O3UA 2HMZA 5L0GA 2XXAB 4LDRA 1C17M 2LP4A 3AOUA 5BQIA 3ASOC 1YARO 1LM3B 3LLIA 1QVXA 2XLOA 2IXMA 2KYHA 3HNKA 1I4YA 2OG2A 2CYDA 3EGDA 3KKBA 2HJMA 2XL6A 3C63A 2LFFA 2GDCA 4J7YA 4J7TA 3WAQA 3HJCA 2HS5A 2UUHA 4MW3A 1ZZPA 1JOGA 3WODF 1K05A 4XEFA 4G0HA 3B0VC 3DE9A 3VM6A 4DRHB 1G5ZA 5L0HA 1LKXA 1OCCC 3GM1A 3AQBA 3OEOA 1H7IA 3L34A 3ZTMA 4YT4A 3B29A 1SMYF 3NYLA 2EINC 5D92A 3PMRA 1G4WR 3ABKC 3U2MA 4XPXA 5JT4A 1NG1A 4CDVA 4U5HA 4BJ6C 1FTSA 4PR9A 3FXHA 1YYJA 2DYRC 3UMHA 1FMWA 4MTGA 4BPMA 2D5RB 4Z9IA 1T6IA 2F22A 2YL7A 3BRJA 5GPGB 4JRZA 1YZAA 1TFKB 2BE5F 2J7PA 2JPUA 3C8ZA 5AC5A 2RD9A 1SZIA 3V5YA 4ZLDA 5A6KA 4LACB 3JRMO 1ZHXA 3L8JA 2R7WA 1A0BA 1Z6AA 2HV7A 1PD1A 2Y3GA 3AGUA 4JEBA 5DS6A 1JRAA 1QKRA 2IBFA 3S27A 3V5XA 1GM5A 3EGDB 3EZIA 2R9RB 2IM8A 1ORYA 2W4MA 3OA1A 4YJWA 3UMKA 3SXMA 3L0IA 3WG7C 1HW2A 3RFYA 3ZQVA 3FHDA 3O39A 4JW1A 3NYJA 5DS4A 3C8GD 2GAQA 4I3MA 2Q00A 3DM9B 1OCOC 2YEVA 4U9EA 1VYIA 5EK0A 3ZVRA 2R05A 1AVOB 4R32A 2YQYA 3DXJF 5KYNA 4K0DA 1D1BA 5KYWA 4E18A 3Q6NA 4DVZA 4JVSA 3AG3C 3JCUQ 1S7ZA 1OKKA 1TWCA 3QTHA 2JX0A 3L8IA 1TWAA 2Q9BA 2YLGA 1GGQA 1ZHWA 3FAJA 3ITFA 4HFFB 3W8IA 2YWAA 3DD7A 4B6IA 2EIKC 1D1AA 1MNDA 3JZ0A 3RW0A 4ER9A 2BL2A 2J7PD 2L6HA 4JTDB 2RSEB 5BQGA 5T1DB 1PV3A 4ULWA 3R7CA 3N0TA 3DM5A 3NKEA 4CSAC 1C03A 1YAUO 4W8PA 1NZEA 3H2UA 4EIYA 5FCLA 1E86A 1GS9A 4BJ5A 1JR8A 2J0XA 1NBBA 1V74B 3AQCA 2WVOA 2H7BA 3GWLA 3JSEO 3C18A 2TMVP 3K1IA 2R7TA 3KMIA 2R7XA 4G7HF 5KYUA 1VLSA 3EH2A 2CGEA 4Z9HA 2EPMX 2XSEA 3W8HA 2IXOA 3ZDLA 5L0CA 1QSPA 2OEXA 3GM2A 3DZAA 3M4CA 3A9CA 2OQMA 3AG1C 2XS8A 2EILC 3EGXA 4I1OB 4JCHA 4LERA 3EFOB 2ZXWC 1WASA 4LDQA 1LI7A 2Z15A 4DRIB 1OR3A 4IB4A 2WVNA 2A6HF 3S29A 3EQLF 3EG9A 2LIGA 3SYNA 4CJOA 3FDQA 1CGOA 2CNWD 5B1BC 3ATPA 3FMSA 2Y3HA 5KYXB 1H9TA 1EKYA 5DQTA 1Z63A 1LE2A 1OW6A 1YA7O 2I8BA 5HSWA 2LQGA 3T6GB 4MQ9F 1F1MA 1SYQA 1ZVZA 3DWWA 1T9KA 3G4XA 4ULVA 2GFHA 3X1OA 2LCHA 3K1IC 5IY5C 2C04A 3I4UA 2BC5A 3VRCA 2VH3A 4XLNF 2MYSA 1HW1A 4RDAA 2NUTB 2R7SA 1IZMA 2WZFA 4HFKB 2A6EF 1E83A 4IJJA 4JURI 4LLCA 3DAGA 4K7BA 3MBGA 1NSGB 2G3KA 3ZTZA 3RVYA 3CSKA 4MS2A 3EJNA 2EIJC 3ABLC 1VTMP 3SEOA 3PCVA 1VLTA 3JRTA 3X2QC 3LLKA 4GEHA 5JRAA 4JJGA 5TJ5E 1QPUA 4E7SA 2DI3A 2EPLX 3BEHA 3NDBB 4DVYP 5A69A 2J45A 1V55C 2YLDA 4PK4A 2OOCA 3FAPB 4LLEA 3GEEA 2PX0A 2HFIA 1PCXA 3O10A 4A2NB 3EGXB 5CIVA 2C03A 4N6CA 2Q9AA 3ZIBA 1Z23A
chains in the Genus database with same CATH topology
2M64A 1NLXA 1L3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M64 A;  1NLX A;  1L3P A; 
#chains in the Genus database with same CATH topology
 2NG1 A;  4RBN A;  1MMG A;  4C3E A;  5JVE A;  3C7J A;  4QI0 A;  4C3D A;  3DI5 A;  4W8K A;  1A7V A;  1E2X A;  2VAS A;  4MVS A;  5B1A C;  2M64 A;  1VOM A;  3C8G B;  3LUT B;  2W9Y A;  1ZW3 A;  3AG2 C;  3SXZ A;  2L6F A;  3W2W A;  3QMK A;  3W4Y A;  3ZWI A;  5KYY A;  1TKN A;  2ASR A;  1BDJ B;  1V54 C;  3UNG C;  4CS8 A;  1E84 A;  2UUI A;  5A6A A;  1J8M F;  4LDK A;  1U6H A;  5COM A;  3M4B A;  3E9V A;  3M1C B;  1WAT A;  3OWT A;  4JIO A;  3DAF A;  4YN0 B;  1L3P A;  4L6R A;  1Z3I X;  1JAF A;  3RIP A;  4OIO F;  2A0B A;  4NCQ A;  1T01 A;  1TFO B;  1ZYR F;  1WOL A;  2HMQ A;  3AG4 C;  3EFO A;  4OIN F;  1YZC A;  3QW0 A;  1BZ4 A;  3U8V A;  4YT2 A;  5FZT A;  1M6T A;  1Q0F A;  2IOQ A;  3LS0 A;  1SR2 A;  1OCR C;  1SF8 A;  5E33 A;  1LS4 A;  4O6Y A;  2CNW A;  5KYU B;  1YDI A;  1OXB A;  2LFD A;  3NMK A;  5JSL A;  3IQ5 A;  2J9B A;  3KH2 A;  1Q0M A;  4JC7 A;  3U5S A;  5B3I A;  2OJQ A;  2LD6 A;  4U5C E;  2IXN A;  2X51 A;  2AWC A;  2MHR A;  3C8G A;  2L9J A;  2VCA A;  4XWJ A;  4YK5 A;  5HV9 A;  5E3A A;  1WGW A;  3NMJ A;  2ZXO A;  1E85 A;  2ZPA A;  2AVK A;  4EBK A;  1K40 A;  2YRF A;  3B71 A;  4HEA J;  3T6J A;  3HKK A;  2PNO A;  4JTC B;  4O79 A;  4GYT A;  5AC4 A;  1DOV A;  2A0U A;  4MVQ A;  3RQE A;  1FAP B;  3ASN C;  3U9M A;  4G78 A;  1QZX A;  2Y3B A;  3GM3 A;  4PJN A;  2AP3 A;  4N06 A;  3POV A;  2NPU A;  2ZXR A;  4XQ1 A;  1NU7 D;  2P61 A;  2PX3 A;  1VK5 A;  1OKK D;  3EPV A;  3UMI A;  2KNH A;  1I4Z A;  4NQF A;  1HY5 A;  4WAB A;  2WVQ A;  3KPH A;  3QZC A;  4ONS A;  2QY9 A;  5L0I A;  4I1M A;  5BQH A;  2VB6 A;  2OKU A;  4YWQ A;  3S90 A;  3SXY A;  1LPE A;  4DRJ B;  1RJ9 B;  4DXW A;  2KK1 A;  3QVY A;  2VCC A;  3U3F A;  4BJ1 A;  1D0Z A;  1ZU4 A;  3F47 A;  3MX3 A;  1TWH A;  1FNT c;  2YL0 A;  1NFO A;  4JTA B;  4BJ5 C;  2XLD A;  1CGM E;  3B0U X;  2WZG A;  4YT5 A;  3VYW A;  4NY3 A;  2EPN A;  1AUE A;  2HV6 A;  2Y3D A;  4YL0 A;  2DGJ A;  1OXK A;  4YT8 A;  4N4W A;  1ST6 A;  2J9W A;  4PAC A;  3RQG A;  3MLG A;  1KNY A;  1OR2 A;  4JZA A;  3C62 A;  4WGZ A;  3U0C A;  2NUP B;  2H8A A;  2O9X A;  5DVW A;  1O5H A;  1Q0D A;  2JD3 A;  3K66 A;  3KYJ A;  2FFH A;  3NMI A;  4RD9 A;  1KTM A;  3R2P A;  3SNH A;  4EBJ A;  2XLV A;  1D1C A;  2XLW A;  4CBE A;  1TR2 A;  2XL8 A;  5JLI A;  2FGY A;  3RYL A;  4P9T A;  3U3B A;  4AK9 A;  4MTF A;  2P7V A;  1D0X A;  3B9Q A;  3TOM A;  4U5E E;  4Q7C A;  2P6V A;  4U5D E;  1APC A;  3T4R A;  3O6X A;  3Q7L A;  4NTF A;  3F46 A;  3H65 A;  3M79 A;  5E2Q A;  2LK4 A;  2EPO A;  1BR1 A;  3ECS A;  3NRH A;  3US6 A;  3T9O A;  4CJG A;  1BBH A;  3NG1 A;  2LSE A;  3IQ6 A;  4CS9 A;  1HE1 A;  2YLI A;  3GOD A;  3K1H A;  2VC9 A;  4KNW A;  4O7G A;  2H7V C;  4E0I A;  2P1A A;  4C7O B;  4CIH A;  1JPJ A;  5CI9 A;  4BEJ A;  4G7O F;  3TJ5 A;  2XLE A;  2HKV A;  4JE9 A;  4JEA A;  4DJ9 A;  1YVI A;  4M63 A;  3K33 A;  3Q7G A;  3PHF 2;  5EHH A;  3I5Q A;  3SZR A;  3U9J A;  5T3T A;  4GQH A;  1LI5 A;  3RQF A;  5JP7 A;  2KJG A;  1FMV A;  4BG0 A;  4BEM J;  4YL1 A;  1J8Y F;  1LE4 A;  2I15 A;  3LES A;  3VAY A;  3S28 A;  2J0W A;  1Y4C A;  2A69 F;  4IRU A;  1L7C A;  2IYL D;  2M4E A;  2PFD A;  4O6N A;  3EG9 B;  5DLJ A;  1NFN A;  1ZU5 A;  4BJ6 A;  4DBQ A;  2MWQ A;  5L3Q A;  4DOZ A;  4IAO A;  3V5Z A;  4EKW A;  3H2V A;  4NC3 A;  5A6J A;  2GA0 A;  4KBL A;  4JCZ A;  2NSG A;  4PJM A;  1MMN A;  3GWN A;  3DMD A;  4G7Z F;  1TQG A;  2W4B A;  2EPK X;  1A41 A;  1RJ9 A;  4NTB A;  1A7E A;  4YL3 A;  256B A;  2GWW A;  1FR0 A;  4K1O A;  4MVZ A;  1MMA A;  3ZSU A;  2E87 A;  1KU2 A;  2P0N A;  5COF A;  2HJ3 A;  4CS9 C;  1AEP A;  5A6B D;  4Q5S F;  3NKD A;  3SXK A;  4UDV A;  4U5G A;  2Q9C A;  4I44 A;  2X0C A;  4EUK B;  5KYX A;  1RKE B;  3DE8 A;  2L6G A;  1WTY A;  1XWJ A;  2R7O A;  4X0R A;  4XLP F;  3LNM B;  4D4X A;  1M2V B;  2B0H A;  1PD0 A;  2QNL A;  3GOR A;  3A11 A;  1W2W A;  2YHS A;  5T3W A;  1S05 A;  2DYS C;  2OCC C;  4JKV A;  3E70 C;  2YVK A;  4HE8 D;  4AL1 A;  3AGT A;  4XPW A;  3U8P A;  1MQV A;  2R7U A;  3GAN A;  5D91 A;  4EHP A;  3N2Z B;  2YL3 A;  3CEX A;  2XLH A;  3G50 A;  2YL1 A;  2R02 A;  3AJM A;  4QI2 A;  2DB4 A;  1ZW2 A;  2OEV A;  3EZH A;  4CX9 A;  2XS1 A;  2EIM C;  1JPN A;  3JYY A;  2IXP A;  4PJL A;  1ZHT A;  3SP1 A;  5KYW B;  1C02 A;  5BUO A;  1H6G A;  1TWG A;  3RF3 A;  2PF4 E;  1VMA A;  1LVK A;  3QVZ A;  3JTL O;  3M15 A;  4XTK A;  3VF0 A;  4AE4 B;  3UGO A;  1FFH A;  4CSA A;  1G8X A;  3MFN A;  5COG A;  2R7Q A;  1R4T A;  3TUL A;  3NYM A;  2XL4 A;  3JT1 A;  2KW3 C;  3LEV A;  1VB5 A;  4E7Z A;  2PBE A;  2ZD9 A;  3ZC4 A;  1VYK A;  2XXA A;  2NSF A;  2Q7R A;  4FAP B;  4N6H A;  1NU9 C;  2AWY A;  4OIR F;  1HMD A;  5L3V A;  1GQA A;  1M2O A;  1RXQ A;  1OQC A;  2D4U A;  1ORS C;  2KC3 A;  3JYH A;  4CIP A;  1YYX A;  5KYY B;  3HLZ A;  4MW8 A;  1CPR A;  2HUJ A;  2V3C C;  1MMD A;  1QQ3 A;  4QDL A;  4XPY A;  3LS1 A;  1CGN A;  1RCP A;  5JS5 A;  2XM0 A;  3IHU A;  5K0I A;  1IW7 F;  3FVY A;  2J9V A;  1Z5Z A;  3FOO A;  2Q3T A;  2QLA A;  4IGG A;  3WHN A;  4CS8 C;  4C3B A;  1RMV A;  1RKC A;  3S0X A;  2XRH A;  3UR3 C;  3PDM P;  1WWP A;  1EA8 A;  1Q0G A;  3T6B A;  3U2L A;  2XM4 A;  4WJ0 A;  4EBB A;  5F5F A;  1HE9 A;  4AE4 A;  3L1M A;  2H7O A;  1YLM A;  3EHM A;  3FOP A;  1ZHZ A;  1OW7 A;  2CW0 F;  4CDY A;  3B0P A;  1BR2 A;  2G3V A;  4ANJ A;  4EWC A;  4U5B E;  2J8W A;  2J46 A;  3S9O A;  3GEH A;  3TOL A;  4BJT A;  1LS1 A;  3IQT A;  4ZLC A;  1M57 C;  1CPQ A;  3RH3 A;  1EQ1 A;  2R25 A;  1A7D A;  2WZL A;  3MYI A;  2R03 A;  4MND A;  1LIH A;  1T6Q A;  5E3C A;  5L0J A;  1ZHY A;  3MYF A;  2L81 A;  3S84 A;  3UGP A;  3KYI A;  2A1D D;  5EGY A;  2R7V A;  4AL0 A;  3J06 A;  4KI2 A;  1HMO A;  4MTO A;  2VCB A;  3GEI A;  4FES A;  3CZ6 A;  3LNR A;  4OD5 A;  1XZP A;  1UG7 A;  3HTK C;  4IWB A;  4CS7 A;  3Q6M A;  4Q4Z F;  4MVM A;  3TJ6 A;  4J30 B;  3IQC A;  4U5F E;  1Q0K A;  3TQO A;  3ZG1 A;  1D0Y A;  4OD4 A;  3ZQY A;  2FAP B;  4MVU A;  1DOW A;  1M2V A;  2PP4 A;  3V7O A;  1H9G A;  1K04 A;  2YKZ A;  3TD7 A;  1MNE A;  2KSF A;  1RKE A;  1JMW A;  4IAQ A;  4F4B A;  3DKA A;  3KL4 A;  4WGY A;  4C7O A;  4FWV A;  3HNL A;  4CDA A;  4OIP F;  1FFT C;  2OJE D;  2NUT A;  1M56 C;  1T6U A;  2G62 A;  4E17 A;  2HSQ A;  4NTA A;  4PJJ A;  4XEK A;  3TK0 A;  3K6B A;  1ORJ A;  1EI7 A;  3IPM O;  3EH1 A;  5F28 E;  4OIQ F;  4MVO A;  4O6M A;  2L7A A;  1BR4 A;  3K7D A;  2XLM A;  4H54 A;  4PFO A;  1WN0 A;  4PFP A;  4AX2 A;  2KQ9 A;  3N24 A;  2CDQ A;  3LAY A;  5DS5 A;  1U0B B;  2Y69 C;  4IAR A;  2HZ8 A;  2Q4F A;  4JJF A;  2A68 F;  1G4U S;  2KGO A;  1U89 A;  2ZXP A;  2QUP A;  3IEE A;  2WL8 A;  5CI8 A;  5AGF A;  4P9F A;  4KC9 A;  3HNI A;  3W2V A;  1V4A A;  1R5I D;  2QTV A;  1UFB A;  5L0D A;  3LEO A;  4XEV A;  2OU6 A;  2AU5 A;  1QLE C;  4U9D A;  5L0F A;  4MVR A;  2NUP A;  3ABM C;  1B68 A;  4D4N A;  2HSB A;  3QW1 A;  4H4K C;  1YJG A;  3O55 A;  4FX5 A;  5B3S C;  2CCY A;  2R7R A;  1T5O A;  3RVZ A;  2WB7 A;  1XZQ A;  3HNJ A;  5F5H A;  1OW8 A;  4P6I C;  3JSZ A;  1OCZ C;  1O87 A;  3CQZ A;  2J9U A;  2YZS A;  3DJN B;  3G4Z A;  3LJB A;  2B0J A;  5A6B A;  5DQZ A;  4A4A A;  4J32 B;  3CAX A;  4DBR A;  4KNV A;  2ETS A;  1I5N A;  3EHN A;  3I5P A;  3RKO F;  3DJU B;  4E0H A;  5JUA A;  1YA9 A;  2W45 A;  1Z7Q c;  1Y6D A;  2V26 A;  2ICW G;  2QE9 A;  2Y39 A;  4Z9J A;  1N1C A;  1NLX A;  1O3U A;  2HMZ A;  5L0G A;  2XXA B;  4LDR A;  1C17 M;  2LP4 A;  3AOU A;  5BQI A;  3ASO C;  1YAR O;  1LM3 B;  3LLI A;  1QVX A;  2XLO A;  2IXM A;  2KYH A;  3HNK A;  1I4Y A;  2OG2 A;  2CYD A;  3EGD A;  3KKB A;  2HJM A;  2XL6 A;  3C63 A;  2LFF A;  2GDC A;  4J7Y A;  4J7T A;  3WAQ A;  3HJC A;  2HS5 A;  2UUH A;  4MW3 A;  1ZZP A;  1JOG A;  3WOD F;  1K05 A;  4XEF A;  4G0H A;  3B0V C;  3DE9 A;  3VM6 A;  4DRH B;  1G5Z A;  5L0H A;  1LKX A;  1OCC C;  3GM1 A;  3AQB A;  3OEO A;  1H7I A;  3L34 A;  3ZTM A;  4YT4 A;  3B29 A;  1SMY F;  3NYL A;  2EIN C;  5D92 A;  3PMR A;  1G4W R;  3ABK C;  3U2M A;  4XPX A;  5JT4 A;  1NG1 A;  4CDV A;  4U5H A;  4BJ6 C;  1FTS A;  4PR9 A;  3FXH A;  1YYJ A;  2DYR C;  3UMH A;  1FMW A;  4MTG A;  4BPM A;  2D5R B;  4Z9I A;  1T6I A;  2F22 A;  2YL7 A;  3BRJ A;  5GPG B;  4JRZ A;  1YZA A;  1TFK B;  2BE5 F;  2J7P A;  2JPU A;  3C8Z A;  5AC5 A;  2RD9 A;  1SZI A;  3V5Y A;  4ZLD A;  5A6K A;  4LAC B;  3JRM O;  1ZHX A;  3L8J A;  2R7W A;  1A0B A;  1Z6A A;  2HV7 A;  1PD1 A;  2Y3G A;  3AGU A;  4JEB A;  5DS6 A;  1JRA A;  1QKR A;  2IBF A;  3S27 A;  3V5X A;  1GM5 A;  3EGD B;  3EZI A;  2R9R B;  2IM8 A;  1ORY A;  2W4M A;  3OA1 A;  4YJW A;  3UMK A;  3SXM A;  3L0I A;  3WG7 C;  1HW2 A;  3RFY A;  3ZQV A;  3FHD A;  3O39 A;  4JW1 A;  3NYJ A;  5DS4 A;  3C8G D;  2GAQ A;  4I3M A;  2Q00 A;  3DM9 B;  1OCO C;  2YEV A;  4U9E A;  1VYI A;  5EK0 A;  3ZVR A;  2R05 A;  1AVO B;  4R32 A;  2YQY A;  3DXJ F;  5KYN A;  4K0D A;  1D1B A;  5KYW A;  4E18 A;  3Q6N A;  4DVZ A;  4JVS A;  3AG3 C;  3JCU Q;  1S7Z A;  1OKK A;  1TWC A;  3QTH A;  2JX0 A;  3L8I A;  1TWA A;  2Q9B A;  2YLG A;  1GGQ A;  1ZHW A;  3FAJ A;  3ITF A;  4HFF B;  3W8I A;  2YWA A;  3DD7 A;  4B6I A;  2EIK C;  1D1A A;  1MND A;  3JZ0 A;  3RW0 A;  4ER9 A;  2BL2 A;  2J7P D;  2L6H A;  4JTD B;  2RSE B;  5BQG A;  5T1D B;  1PV3 A;  4ULW A;  3R7C A;  3N0T A;  3DM5 A;  3NKE A;  4CSA C;  1C03 A;  1YAU O;  4W8P A;  1NZE A;  3H2U A;  4EIY A;  5FCL A;  1E86 A;  1GS9 A;  4BJ5 A;  1JR8 A;  2J0X A;  1NBB A;  1V74 B;  3AQC A;  2WVO A;  2H7B A;  3GWL A;  3JSE O;  3C18 A;  2TMV P;  3K1I A;  2R7T A;  3KMI A;  2R7X A;  4G7H F;  5KYU A;  1VLS A;  3EH2 A;  2CGE A;  4Z9H A;  2EPM X;  2XSE A;  3W8H A;  2IXO A;  3ZDL A;  5L0C A;  1QSP A;  2OEX A;  3GM2 A;  3DZA A;  3M4C A;  3A9C A;  2OQM A;  3AG1 C;  2XS8 A;  2EIL C;  3EGX A;  4I1O B;  4JCH A;  4LER A;  3EFO B;  2ZXW C;  1WAS A;  4LDQ A;  1LI7 A;  2Z15 A;  4DRI B;  1OR3 A;  4IB4 A;  2WVN A;  2A6H F;  3S29 A;  3EQL F;  3EG9 A;  2LIG A;  3SYN A;  4CJO A;  3FDQ A;  1CGO A;  2CNW D;  5B1B C;  3ATP A;  3FMS A;  2Y3H A;  5KYX B;  1H9T A;  1EKY A;  5DQT A;  1Z63 A;  1LE2 A;  1OW6 A;  1YA7 O;  2I8B A;  5HSW A;  2LQG A;  3T6G B;  4MQ9 F;  1F1M A;  1SYQ A;  1ZVZ A;  3DWW A;  1T9K A;  3G4X A;  4ULV A;  2GFH A;  3X1O A;  2LCH A;  3K1I C;  5IY5 C;  2C04 A;  3I4U A;  2BC5 A;  3VRC A;  2VH3 A;  4XLN F;  2MYS A;  1HW1 A;  4RDA A;  2NUT B;  2R7S A;  1IZM A;  2WZF A;  4HFK B;  2A6E F;  1E83 A;  4IJJ A;  4JUR I;  4LLC A;  3DAG A;  4K7B A;  3MBG A;  1NSG B;  2G3K A;  3ZTZ A;  3RVY A;  3CSK A;  4MS2 A;  3EJN A;  2EIJ C;  3ABL C;  1VTM P;  3SEO A;  3PCV A;  1VLT A;  3JRT A;  3X2Q C;  3LLK A;  4GEH A;  5JRA A;  4JJG A;  5TJ5 E;  1QPU A;  4E7S A;  2DI3 A;  2EPL X;  3BEH A;  3NDB B;  4DVY P;  5A69 A;  2J45 A;  1V55 C;  2YLD A;  4PK4 A;  2OOC A;  3FAP B;  4LLE A;  3GEE A;  2PX0 A;  2HFI A;  1PCX A;  3O10 A;  4A2N B;  3EGX B;  5CIV A;  2C03 A;  4N6C A;  2Q9A A;  3ZIB A;  1Z23 A; 
#chains in the Genus database with same CATH homology
 2M64 A;  1NLX A;  1L3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...