2M64A

1h, 13c and 15n chemical shift assignments for phl p 5a
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
231
structure length
231
Chain Sequence
b'PAGKATTEEQKLIEKINAGFKAALAAAAGVQPADKYRTFVATFGAASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDAIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phlp5
publication title Flexible IgE epitope-containing domains of Phl p 5 cause high allergenic activity.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Plant protein
total genus 54
structure length 231
sequence length 231
ec nomenclature
pdb deposition date 2013-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.320 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Group V grass pollen allergen 2m64A02
1.20.120.320 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Group V grass pollen allergen 2m64A01
1L3PA 2M64A 1NLXA
chains in the Genus database with same CATH superfamily
5JUAA 1OCRC 4I3MA 2KW3C 1R4TA 4G7OF 4L6RA 1KU2A 4YL1A 1OR2A 3MYIA 3C18A 2YLIA 3R2PA 2R7WA 2JD3A 2XL8A 4KI2A 3T6JA 1QPUA 1YAUO 1CPRA 5JT4A 3J06A 2DI3A 5FCLA 2L81A 2WZFA 3EH2A 2OQMA 5BQGA 4JEAA 4DBQA 4I1OB 3V5YA 1Z6AA 3NDBB 5A6KA 2PX3A 1M2VB 2WZGA 3N24A 2P6VA 1D0YA 3HNKA 3L1MA 2YL1A 3U2MA 1ZU4A 1SZIA 3TOMA 1BR1A 1F1MA 4F4BA 4JTAB 3MX3A 3AGTA 1HE1A 3EGDB 2Y69C 3S9OA 3K33A 1SMYF 2HSBA 4PJJA 1PD0A 4PJLA 3WHNA 1PV3A 3FOOA 3VF0A 1H6GA 1VK5A 3DE9A 5DLJA 4ZLCA 2KSFA 1H9TA 2HV7A 2VASA 2D4UA 2VCBA 1NBBA 4O6YA 2G3VA 5BQHA 1GM5A 1C03A 2GFHA 2E87A 4G7ZF 4K7BA 2X0CA 3PCVA 2EPLX 2IXMA 4C7OA 1ZVZA 2DYRC 1A7VA 3IQTA 2YEVA 2H7VC 3F47A 4J7YA 4EIYA 3T6BA 5DS5A 1RCPA 2AU5A 2LK4A 4AL1A 2ASRA 1W2WA 2YL7A 4JCZA 3UNGC 3ZQVA 4ER9A 3Q6MA 5E2QA 5FZTA 2FGYA 2VH3A 2B0JA 1OCZC 3U3FA 2R7SA 5JRAA 1T6IA 2EINC 2YLDA 2ZXOA 3CSKA 4NQFA 2C03A 3IQ6A 1JMWA 3T6GB 4EBKA 3B0UX 1U6HA 3QTHA 3M15A 1FMVA 5KYWB 3ZSUA 2PP4A 3JSZA 1B68A 2Q9CA 2A0BA 2IYLD 3Q7LA 3Q6NA 1UG7A 1MMNA 2EIMC 3NMIA 4JTCB 5L0IA 1M6TA 4OIOF 1SYQA 4GYTA 3WG7C 3Q7GA 2OKUA 3UMKA 1FNTc 3H65A 1Q0MA 2OOCA 2KYHA 256BA 3PMRA 3B0PA 1O5HA 2ETSA 3U8PA 4DVZA 1E86A 3AJMA 2A1DD 2Y3GA 3EZHA 4MQ9F 2VC9A 3O55A 5DS6A 1PD1A 3DE8A 4U5BE 4MVQA 2QY9A 5D92A 1HW2A 2XSEA 1G5ZA 4Z9HA 4MVZA 1HMOA 1I5NA 4JIOA 1Z5ZA 4JKVA 3K6BA 5KYNA 4N6HA 5L0CA 1M2OA 1WGWA 2HMQA 1ZHTA 3VAYA 2I15A 2XLHA 4OIPF 4DRHB 1OR3A 3R7CA 4NTAA 2D5RB 2Q00A 3JT1A 4RD9A 3TOLA 2R05A 3ZTZA 1VYIA 1SR2A 2XM0A 3JYYA 4B6IA 3LEOA 1J8MF 2YZSA 1T01A 1YJGA 4HFFB 4K0DA 2XXAA 1FR0A 4DRJB 1ST6A 5JP7A 2L7AA 4K1OA 1YA7O 2OU6A 3FDQA 3MYFA 4E7SA 3S90A 3GWNA 3RKOF 4EBJA 1CGOA 2OJED 1ZZPA 1QLEC 1JAFA 2H8AA 3JRMO 4JE9A 4ULWA 3TULA 2NPUA 4CDAA 1VOMA 2XLOA 1RXQA 1XZPA 1ZU5A 3SXZA 3I5QA 3MLGA 4GQHA 3DI5A 1YLMA 4MW3A 4U5CE 1ZHXA 4XPXA 1IZMA 4C3DA 2J7PD 4CJGA 2XM4A 1T6UA 3G4XA 1Z7Qc 5B3IA 5TJ5E 3T9OA 1J8YF 3M4BA 4DOZA 1XWJA 2LIGA 1LE4A 2NUPB 3S27A 3VRCA 1M2VA 1OCOC 2XS8A 3ZIBA 4EWCA 2W45A 4YWQA 4BJ5A 2WVOA 3W8IA 2G3KA 1MNEA 3E70C 4C3BA 1YDIA 5AC5A 4QI2A 2R7XA 1YVIA 4WJ0A 3L0IA 1M56C 3SEOA 3GORA 1C17M 4BEJA 3QVYA 3EGDA 2EIKC 4YL3A 3MBGA 1HMDA 2XLEA 3DJUB 4E7ZA 2J0WA 5CI9A 5F28E 4CS8A 1C02A 1GQAA 2MYSA 3CAXA 4BJ5C 1YARO 4LLEA 2W4BA 2ZXRA 5DQTA 1VTMP 1OXKA 4BJ1A 3B9QA 1OW8A 1TWGA 1PCXA 4YT2A 4P9FA 2LFDA 2PX0A 5EGYA 2IBFA 2YLGA 3C62A 4XTKA 3S29A 3KKBA 4A2NB 4U5GA 3RH3A 3DJNB 4D4XA 2YWAA 3K1HA 2F22A 2Y3BA 5E33A 3LNRA 4QI0A 5A6BD 1FTSA 5CI8A 4AL0A 3LEVA 3M1CB 4LERA 3W2WA 1ZW3A 3ITFA 3N2ZB 4JVSA 4MVSA 5F5FA 3VM6A 4OIQF 5B1AC 4NTFA 4ZLDA 1LS1A 4RBNA 3TD7A 1WWPA 5KYYB 4DRIB 5KYWA 1FAPB 2EILC 5DVWA 1RKCA 1WTYA 2BL2A 2CNWD 3IQ5A 2XLVA 2XS1A 1D1BA 1R5ID 3U5SA 2UUIA 1VMAA 1JR8A 3DMDA 2MWQA 1E84A 3RIPA 2B0HA 3CZ6A 3GM3A 1XZQA 5IY5C 4H54A 1TKNA 1HE9A 1OKKD 4C3EA 2EPKX 3L8JA 1MMGA 2GA0A 1MMDA 1U89A 3G50A 3ABMC 3FVYA 4N4WA 3RQFA 3BRJA 3DWWA 4OIRF 1LM3B 5JVEA 2AWYA 1SF8A 3FXHA 1HY5A 3UMHA 3L8IA 3EHNA 4IJJA 5B1BC 1E85A 2OJQA 1DOVA 4NCQA 5GPGB 1MQVA 1Z23A 2YQYA 2W9YA 3RFYA 1D1AA 3DM9B 4JJGA 4R32A 1RMVA 3U2LA 4JURI 2R7VA 4PACA 4YK5A 3QW0A 2HUJA 3L34A 5JSLA 3LJBA 1GS9A 3NYLA 2A68F 3SNHA 3A11A 4BJTA 1WATA 4AX2A 4YN0B 3SXKA 1RJ9A 2ZXWC 4ULVA 3OWTA 3V5XA 4MVMA 5L3VA 2EIJC 3GEIA 2BE5F 3LS1A 4U9EA 2ZXPA 1QQ3A 2HJMA 3FHDA 4M63A 4J30B 5L0GA 2GDCA 2VCCA 3CQZA 4Z9JA 4DJ9A 1ORYA 4CIPA 1E83A 3SYNA 1AUEA 1BR4A 1K04A 2FFHA 3ASNC 3K66A 4ONSA 2LFFA 3GM1A 2X51A 4DXWA 4IAQA 5A6JA 3GANA 2H7OA 4N06A 3DKAA 4EKWA 2EPOA 2NUPA 1Q0KA 2R7QA 4YL0A 4WGYA 4D4NA 3S0XA 2OEVA 5COMA 4KNWA 3NG1A 5AC4A 3ABKC 3NMKA 3S84A 2NUTA 2PFDA 4PK4A 1YYXA 1CPQA 2AP3A 4PJNA 3ZVRA 1YA9A 2Q4FA 1EKYA 2Y39A 2TMVP 2LCHA 1ORJA 3U8VA 2XLWA 5DQZA 5A69A 2XL6A 3G4ZA 4AK9A 4I1MA 1JPJA 4O6NA 2YL0A 4MTOA 4PR9A 4A4AA 1RJ9B 2L6GA 1S7ZA 2CCYA 3LLIA 1BR2A 5EK0A 1JOGA 1S05A 3DXJF 1H7IA 4CDVA 3JTLO 3LNMB 1WASA 2QE9A 1V74B 2YRFA 5L0DA 4UDVA 4JRZA 3GODA 1D1CA 5KYUB 5COGA 4U5HA 4OINF 3TJ6A 3A9CA 3C8GD 4OD5A 1TWHA 2EPNA 3K1IA 2A69F 1LE2A 5F5HA 3UGPA 1T9KA 1QVXA 2J46A 1VYKA 1OQCA 2V26A 4MTGA 2QUPA 2R7TA 2AWCA 3NYMA 2HS5A 4OD4A 5JLIA 4YT8A 1YZCA 1YYJA 3EHMA 3UR3C 2R7RA 2P61A 3GM2A 1APCA 3RF3A 3LESA 5KYYA 3FAJA 3ATPA 1TWAA 1KNYA 3K1IC 2W4MA 5L0JA 4MVUA 3H2VA 3X1OA 2O9XA 5DS4A 1Z3IX 1ZHZA 1QSPA 4WABA 2OG2A 2NUTB 4XPYA 2GAQA 1EI7A 5AGFA 3W2VA 2V3CC 4PJMA 4XEVA 4XLNF 4ANJA 5A6BA 1V54C 2XLMA 3OA1A 1L3PA 2ZD9A 2ZPAA 3HNJA 3M4CA 3RYLA 5A6AA 4O79A 4IRUA 3H2UA 4FX5A 1VB5A 3JSEO 3EFOB 1G4WR 3QZCA 4IB4A 4CX9A 3LS0A 1JRAA 4JC7A 3QW1A 4E17A 1TQGA 5L3QA 3O6XA 2A6EF 2CNWA 2KQ9A 3TK0A 3C8ZA 2LQGA 1RKEB 4G0HA 4CS8C 2OCCC 1ZHWA 1LKXA 3NKEA 4MVOA 3ZWIA 5EHHA 3U0CA 3BEHA 3HNLA 2J8WA 3W4YA 1NG1A 3NKDA 4P9TA 4CIHA 3NRHA 2R7UA 1NFOA 1NLXA 2P7VA 3B29A 4O7GA 1Q0FA 4BG0A 3V5ZA 4G7HF 5CIVA 5E3AA 4LDKA 1BDJB 4N6CA 3T4RA 1EQ1A 2J0XA 3N0TA 2KGOA 3KMIA 2LD6A 4WGZA 1U0BB 4JTDB 4MW8A 1MMAA 4U5DE 3B0VC 4NTBA 3KL4A 3RQGA 4JCHA 3EGXB 3LUTB 4PFPA 5K0IA 4GEHA 1NZEA 3UGOA 2MHRA 2PF4E 1TWCA 1VLTA 4YT4A 2VB6A 3NYJA 1V55C 5BUOA 2WZLA 5T3TA 2QNLA 2CYDA 3ZQYA 3AG1C 2J9UA 3DAGA 4J7TA 4YJWA 3ZTMA 3C63A 1Y4CA 4NY3A 2NG1A 3K7DA 2PBEA 3RVZA 1TFOB 4CJOA 1AVOB 2QLAA 4KC9A 2J9BA 3EG9B 4XPWA 4Q5SF 2M64A 3HJCA 3HLZA 1D0XA 2WVNA 3JZ0A 2L6FA 4X0RA 3WODF 4Q4ZF 1JPNA 1EA8A 4AE4B 2DGJA 1QZXA 1TR2A 3VYWA 4IWBA 1CGME 2J9VA 2YL3A 4U5EE 2R25A 2YHSA 2Q3TA 3AG4C 1WOLA 2LP4A 2Q9BA 3FMSA 1D0ZA 1NU9C 3JCUQ 4IAOA 2NSGA 1LS4A 4JW1A 2HFIA 2G62A 1LPEA 3W8HA 2OEXA 3IHUA 3IPMO 1FFTC 4H4KC 4O6MA 5B3SC 1LVKA 1I4ZA 4P6IC 4CS9A 2ICWG 4CBEA 2HZ8A 5BQIA 2CW0F 1T5OA 4Q7CA 4MTFA 1FMWA 5KYUA 1A41A 4MVRA 1H9GA 2KJGA 4U9DA 5HSWA 4U5FE 3EQLF 4I44A 1G4US 3JYHA 2HKVA 2IOQA 1O87A 1Q0DA 4CSAA 2CDQA 3U9JA 2CGEA 2HJ3A 1KTMA 2P0NA 3EH1A 1E2XA 4E0HA 4CS9C 2J9WA 4J32B 3AQCA 4LDRA 4EHPA 4EBBA 1MNDA 2KK1A 2DYSC 1Z63A 2Y3HA 1NSGB 3DAFA 4FESA 4RDAA 2DB4A 4CSAC 3RW0A 3CEXA 2IM8A 3TJ5A 2I8BA 3FOPA 5KYXA 1BZ4A 2GWWA 2JPUA 2UUHA 2Z15A 3IQCA 3KPHA 4LDQA 4XEKA 3U9MA 1LI5A 4FWVA 3C8GA 4QDLA 3EJNA 3AGUA 4Z9IA 2R9RB 1IW7F 2RSEB 4XQ1A 2WVQA 3HKKA 2P1AA 3IEEA 4FAPB 2WB7A 3PDMP 2KNHA 3SXYA 2J7PA 3AQBA 3KYJA 4BPMA 4E18A 1L7CA 3EFOA 4JEBA 3I4UA 3V7OA 3HNIA 5HV9A 2R03A 1NFNA 3ECSA 2WL8A 3I5PA 2VCAA 4KBLA 1AEPA 4E0IA 3GEHA 1G8XA 1RKEA 3ASOC 3EZIA 2XL4A 3MFNA 4XEFA 4JJFA 4C7OB 3LAYA 3NMJA 4BEMJ 1DOWA 1O3UA 1QKRA 2FAPB 1Y6DA 3KH2A 5T1DB 2YVKA 2Y3DA 2Q9AA 3M79A 3OEOA 4DVYP 1N1CA 1K05A 2QTVA 5T3WA 1A0BA 3GWLA 2R02A 1HW1A 2JX0A 1Q0GA 1UFBA 2BC5A 1TFKB 3SP1A 3C7JA 5D91A 4DBRA 3SXMA 2M4EA 4BJ6A 3O39A 5L0FA 2A6HF 3O10A 1V4AA 3GEEA 3TQOA 1LIHA 1ZYRF 2A0UA 4JZAA 2Q7RA 3RQEA 4IGGA 4LACB 4KNVA 2PNOA 5KYXB 2L9JA 1ZW2A 3EGXA 4MS2A 5L0HA 1A7DA 3QMKA 3C8GB 1OW7A 3E9VA 4W8PA 3ZDLA 3SZRA 4BJ6C 4HE8D 3ABLC 2NSFA 3U3BA 1LI7A 2IXNA 3KYIA 3DM5A 1I4YA 3DD7A 3B71A 3EPVA 3POVA 3F46A 3WAQA 3AG3C 1VLSA 3RVYA 1M57C 2HSQA 4HEAJ 1OW6A 1T6QA 2J45A 3EG9A 5COFA 1CGNA 1YZAA 3PHF2 1BBHA 4XLPF 2HMZA 1GGQA 4IARA 2YKZA 1FFHA 1A7EA 3S28A 3ZC4A 4YT5A 3ZG1A 2XRHA 4CDYA 4AE4A 2XLDA 1ZHYA 2C04A 4CS7A 3FAPB 4MNDA 3AOUA 5JS5A 3US6A 3AG2C 2L6HA 3JRTA 4NC3A 2IXOA 3UMIA 3X2QC 2AVKA 4W8KA 3HTKC 3QVZA 1OKKA 1ORSC 4HFKB 1OCCC 2LSEA 2IXPA 4LLCA 2RD9A 2EPMX 2KC3A 1OXBA 2R7OA 2XXAB 4EUKB 1WN0A 1K40A 3DZAA 3LLKA 4PFOA 2HV6A 5E3CA 2H7BA 4XWJA 1NU7D 4G78A
chains in the Genus database with same CATH topology
1L3PA 2M64A 1NLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L3P A;  2M64 A;  1NLX A; 
#chains in the Genus database with same CATH topology
 5JUA A;  1OCR C;  4I3M A;  2KW3 C;  1R4T A;  4G7O F;  4L6R A;  1KU2 A;  4YL1 A;  1OR2 A;  3MYI A;  3C18 A;  2YLI A;  3R2P A;  2R7W A;  2JD3 A;  2XL8 A;  4KI2 A;  3T6J A;  1QPU A;  1YAU O;  1CPR A;  5JT4 A;  3J06 A;  2DI3 A;  5FCL A;  2L81 A;  2WZF A;  3EH2 A;  2OQM A;  5BQG A;  4JEA A;  4DBQ A;  4I1O B;  3V5Y A;  1Z6A A;  3NDB B;  5A6K A;  2PX3 A;  1M2V B;  2WZG A;  3N24 A;  2P6V A;  1D0Y A;  3HNK A;  3L1M A;  2YL1 A;  3U2M A;  1ZU4 A;  1SZI A;  3TOM A;  1BR1 A;  1F1M A;  4F4B A;  4JTA B;  3MX3 A;  3AGT A;  1HE1 A;  3EGD B;  2Y69 C;  3S9O A;  3K33 A;  1SMY F;  2HSB A;  4PJJ A;  1PD0 A;  4PJL A;  3WHN A;  1PV3 A;  3FOO A;  3VF0 A;  1H6G A;  1VK5 A;  3DE9 A;  5DLJ A;  4ZLC A;  2KSF A;  1H9T A;  2HV7 A;  2VAS A;  2D4U A;  2VCB A;  1NBB A;  4O6Y A;  2G3V A;  5BQH A;  1GM5 A;  1C03 A;  2GFH A;  2E87 A;  4G7Z F;  4K7B A;  2X0C A;  3PCV A;  2EPL X;  2IXM A;  4C7O A;  1ZVZ A;  2DYR C;  1A7V A;  3IQT A;  2YEV A;  2H7V C;  3F47 A;  4J7Y A;  4EIY A;  3T6B A;  5DS5 A;  1RCP A;  2AU5 A;  2LK4 A;  4AL1 A;  2ASR A;  1W2W A;  2YL7 A;  4JCZ A;  3UNG C;  3ZQV A;  4ER9 A;  3Q6M A;  5E2Q A;  5FZT A;  2FGY A;  2VH3 A;  2B0J A;  1OCZ C;  3U3F A;  2R7S A;  5JRA A;  1T6I A;  2EIN C;  2YLD A;  2ZXO A;  3CSK A;  4NQF A;  2C03 A;  3IQ6 A;  1JMW A;  3T6G B;  4EBK A;  3B0U X;  1U6H A;  3QTH A;  3M15 A;  1FMV A;  5KYW B;  3ZSU A;  2PP4 A;  3JSZ A;  1B68 A;  2Q9C A;  2A0B A;  2IYL D;  3Q7L A;  3Q6N A;  1UG7 A;  1MMN A;  2EIM C;  3NMI A;  4JTC B;  5L0I A;  1M6T A;  4OIO F;  1SYQ A;  4GYT A;  3WG7 C;  3Q7G A;  2OKU A;  3UMK A;  1FNT c;  3H65 A;  1Q0M A;  2OOC A;  2KYH A;  256B A;  3PMR A;  3B0P A;  1O5H A;  2ETS A;  3U8P A;  4DVZ A;  1E86 A;  3AJM A;  2A1D D;  2Y3G A;  3EZH A;  4MQ9 F;  2VC9 A;  3O55 A;  5DS6 A;  1PD1 A;  3DE8 A;  4U5B E;  4MVQ A;  2QY9 A;  5D92 A;  1HW2 A;  2XSE A;  1G5Z A;  4Z9H A;  4MVZ A;  1HMO A;  1I5N A;  4JIO A;  1Z5Z A;  4JKV A;  3K6B A;  5KYN A;  4N6H A;  5L0C A;  1M2O A;  1WGW A;  2HMQ A;  1ZHT A;  3VAY A;  2I15 A;  2XLH A;  4OIP F;  4DRH B;  1OR3 A;  3R7C A;  4NTA A;  2D5R B;  2Q00 A;  3JT1 A;  4RD9 A;  3TOL A;  2R05 A;  3ZTZ A;  1VYI A;  1SR2 A;  2XM0 A;  3JYY A;  4B6I A;  3LEO A;  1J8M F;  2YZS A;  1T01 A;  1YJG A;  4HFF B;  4K0D A;  2XXA A;  1FR0 A;  4DRJ B;  1ST6 A;  5JP7 A;  2L7A A;  4K1O A;  1YA7 O;  2OU6 A;  3FDQ A;  3MYF A;  4E7S A;  3S90 A;  3GWN A;  3RKO F;  4EBJ A;  1CGO A;  2OJE D;  1ZZP A;  1QLE C;  1JAF A;  2H8A A;  3JRM O;  4JE9 A;  4ULW A;  3TUL A;  2NPU A;  4CDA A;  1VOM A;  2XLO A;  1RXQ A;  1XZP A;  1ZU5 A;  3SXZ A;  3I5Q A;  3MLG A;  4GQH A;  3DI5 A;  1YLM A;  4MW3 A;  4U5C E;  1ZHX A;  4XPX A;  1IZM A;  4C3D A;  2J7P D;  4CJG A;  2XM4 A;  1T6U A;  3G4X A;  1Z7Q c;  5B3I A;  5TJ5 E;  3T9O A;  1J8Y F;  3M4B A;  4DOZ A;  1XWJ A;  2LIG A;  1LE4 A;  2NUP B;  3S27 A;  3VRC A;  1M2V A;  1OCO C;  2XS8 A;  3ZIB A;  4EWC A;  2W45 A;  4YWQ A;  4BJ5 A;  2WVO A;  3W8I A;  2G3K A;  1MNE A;  3E70 C;  4C3B A;  1YDI A;  5AC5 A;  4QI2 A;  2R7X A;  1YVI A;  4WJ0 A;  3L0I A;  1M56 C;  3SEO A;  3GOR A;  1C17 M;  4BEJ A;  3QVY A;  3EGD A;  2EIK C;  4YL3 A;  3MBG A;  1HMD A;  2XLE A;  3DJU B;  4E7Z A;  2J0W A;  5CI9 A;  5F28 E;  4CS8 A;  1C02 A;  1GQA A;  2MYS A;  3CAX A;  4BJ5 C;  1YAR O;  4LLE A;  2W4B A;  2ZXR A;  5DQT A;  1VTM P;  1OXK A;  4BJ1 A;  3B9Q A;  1OW8 A;  1TWG A;  1PCX A;  4YT2 A;  4P9F A;  2LFD A;  2PX0 A;  5EGY A;  2IBF A;  2YLG A;  3C62 A;  4XTK A;  3S29 A;  3KKB A;  4A2N B;  4U5G A;  3RH3 A;  3DJN B;  4D4X A;  2YWA A;  3K1H A;  2F22 A;  2Y3B A;  5E33 A;  3LNR A;  4QI0 A;  5A6B D;  1FTS A;  5CI8 A;  4AL0 A;  3LEV A;  3M1C B;  4LER A;  3W2W A;  1ZW3 A;  3ITF A;  3N2Z B;  4JVS A;  4MVS A;  5F5F A;  3VM6 A;  4OIQ F;  5B1A C;  4NTF A;  4ZLD A;  1LS1 A;  4RBN A;  3TD7 A;  1WWP A;  5KYY B;  4DRI B;  5KYW A;  1FAP B;  2EIL C;  5DVW A;  1RKC A;  1WTY A;  2BL2 A;  2CNW D;  3IQ5 A;  2XLV A;  2XS1 A;  1D1B A;  1R5I D;  3U5S A;  2UUI A;  1VMA A;  1JR8 A;  3DMD A;  2MWQ A;  1E84 A;  3RIP A;  2B0H A;  3CZ6 A;  3GM3 A;  1XZQ A;  5IY5 C;  4H54 A;  1TKN A;  1HE9 A;  1OKK D;  4C3E A;  2EPK X;  3L8J A;  1MMG A;  2GA0 A;  1MMD A;  1U89 A;  3G50 A;  3ABM C;  3FVY A;  4N4W A;  3RQF A;  3BRJ A;  3DWW A;  4OIR F;  1LM3 B;  5JVE A;  2AWY A;  1SF8 A;  3FXH A;  1HY5 A;  3UMH A;  3L8I A;  3EHN A;  4IJJ A;  5B1B C;  1E85 A;  2OJQ A;  1DOV A;  4NCQ A;  5GPG B;  1MQV A;  1Z23 A;  2YQY A;  2W9Y A;  3RFY A;  1D1A A;  3DM9 B;  4JJG A;  4R32 A;  1RMV A;  3U2L A;  4JUR I;  2R7V A;  4PAC A;  4YK5 A;  3QW0 A;  2HUJ A;  3L34 A;  5JSL A;  3LJB A;  1GS9 A;  3NYL A;  2A68 F;  3SNH A;  3A11 A;  4BJT A;  1WAT A;  4AX2 A;  4YN0 B;  3SXK A;  1RJ9 A;  2ZXW C;  4ULV A;  3OWT A;  3V5X A;  4MVM A;  5L3V A;  2EIJ C;  3GEI A;  2BE5 F;  3LS1 A;  4U9E A;  2ZXP A;  1QQ3 A;  2HJM A;  3FHD A;  4M63 A;  4J30 B;  5L0G A;  2GDC A;  2VCC A;  3CQZ A;  4Z9J A;  4DJ9 A;  1ORY A;  4CIP A;  1E83 A;  3SYN A;  1AUE A;  1BR4 A;  1K04 A;  2FFH A;  3ASN C;  3K66 A;  4ONS A;  2LFF A;  3GM1 A;  2X51 A;  4DXW A;  4IAQ A;  5A6J A;  3GAN A;  2H7O A;  4N06 A;  3DKA A;  4EKW A;  2EPO A;  2NUP A;  1Q0K A;  2R7Q A;  4YL0 A;  4WGY A;  4D4N A;  3S0X A;  2OEV A;  5COM A;  4KNW A;  3NG1 A;  5AC4 A;  3ABK C;  3NMK A;  3S84 A;  2NUT A;  2PFD A;  4PK4 A;  1YYX A;  1CPQ A;  2AP3 A;  4PJN A;  3ZVR A;  1YA9 A;  2Q4F A;  1EKY A;  2Y39 A;  2TMV P;  2LCH A;  1ORJ A;  3U8V A;  2XLW A;  5DQZ A;  5A69 A;  2XL6 A;  3G4Z A;  4AK9 A;  4I1M A;  1JPJ A;  4O6N A;  2YL0 A;  4MTO A;  4PR9 A;  4A4A A;  1RJ9 B;  2L6G A;  1S7Z A;  2CCY A;  3LLI A;  1BR2 A;  5EK0 A;  1JOG A;  1S05 A;  3DXJ F;  1H7I A;  4CDV A;  3JTL O;  3LNM B;  1WAS A;  2QE9 A;  1V74 B;  2YRF A;  5L0D A;  4UDV A;  4JRZ A;  3GOD A;  1D1C A;  5KYU B;  5COG A;  4U5H A;  4OIN F;  3TJ6 A;  3A9C A;  3C8G D;  4OD5 A;  1TWH A;  2EPN A;  3K1I A;  2A69 F;  1LE2 A;  5F5H A;  3UGP A;  1T9K A;  1QVX A;  2J46 A;  1VYK A;  1OQC A;  2V26 A;  4MTG A;  2QUP A;  2R7T A;  2AWC A;  3NYM A;  2HS5 A;  4OD4 A;  5JLI A;  4YT8 A;  1YZC A;  1YYJ A;  3EHM A;  3UR3 C;  2R7R A;  2P61 A;  3GM2 A;  1APC A;  3RF3 A;  3LES A;  5KYY A;  3FAJ A;  3ATP A;  1TWA A;  1KNY A;  3K1I C;  2W4M A;  5L0J A;  4MVU A;  3H2V A;  3X1O A;  2O9X A;  5DS4 A;  1Z3I X;  1ZHZ A;  1QSP A;  4WAB A;  2OG2 A;  2NUT B;  4XPY A;  2GAQ A;  1EI7 A;  5AGF A;  3W2V A;  2V3C C;  4PJM A;  4XEV A;  4XLN F;  4ANJ A;  5A6B A;  1V54 C;  2XLM A;  3OA1 A;  1L3P A;  2ZD9 A;  2ZPA A;  3HNJ A;  3M4C A;  3RYL A;  5A6A A;  4O79 A;  4IRU A;  3H2U A;  4FX5 A;  1VB5 A;  3JSE O;  3EFO B;  1G4W R;  3QZC A;  4IB4 A;  4CX9 A;  3LS0 A;  1JRA A;  4JC7 A;  3QW1 A;  4E17 A;  1TQG A;  5L3Q A;  3O6X A;  2A6E F;  2CNW A;  2KQ9 A;  3TK0 A;  3C8Z A;  2LQG A;  1RKE B;  4G0H A;  4CS8 C;  2OCC C;  1ZHW A;  1LKX A;  3NKE A;  4MVO A;  3ZWI A;  5EHH A;  3U0C A;  3BEH A;  3HNL A;  2J8W A;  3W4Y A;  1NG1 A;  3NKD A;  4P9T A;  4CIH A;  3NRH A;  2R7U A;  1NFO A;  1NLX A;  2P7V A;  3B29 A;  4O7G A;  1Q0F A;  4BG0 A;  3V5Z A;  4G7H F;  5CIV A;  5E3A A;  4LDK A;  1BDJ B;  4N6C A;  3T4R A;  1EQ1 A;  2J0X A;  3N0T A;  2KGO A;  3KMI A;  2LD6 A;  4WGZ A;  1U0B B;  4JTD B;  4MW8 A;  1MMA A;  4U5D E;  3B0V C;  4NTB A;  3KL4 A;  3RQG A;  4JCH A;  3EGX B;  3LUT B;  4PFP A;  5K0I A;  4GEH A;  1NZE A;  3UGO A;  2MHR A;  2PF4 E;  1TWC A;  1VLT A;  4YT4 A;  2VB6 A;  3NYJ A;  1V55 C;  5BUO A;  2WZL A;  5T3T A;  2QNL A;  2CYD A;  3ZQY A;  3AG1 C;  2J9U A;  3DAG A;  4J7T A;  4YJW A;  3ZTM A;  3C63 A;  1Y4C A;  4NY3 A;  2NG1 A;  3K7D A;  2PBE A;  3RVZ A;  1TFO B;  4CJO A;  1AVO B;  2QLA A;  4KC9 A;  2J9B A;  3EG9 B;  4XPW A;  4Q5S F;  2M64 A;  3HJC A;  3HLZ A;  1D0X A;  2WVN A;  3JZ0 A;  2L6F A;  4X0R A;  3WOD F;  4Q4Z F;  1JPN A;  1EA8 A;  4AE4 B;  2DGJ A;  1QZX A;  1TR2 A;  3VYW A;  4IWB A;  1CGM E;  2J9V A;  2YL3 A;  4U5E E;  2R25 A;  2YHS A;  2Q3T A;  3AG4 C;  1WOL A;  2LP4 A;  2Q9B A;  3FMS A;  1D0Z A;  1NU9 C;  3JCU Q;  4IAO A;  2NSG A;  1LS4 A;  4JW1 A;  2HFI A;  2G62 A;  1LPE A;  3W8H A;  2OEX A;  3IHU A;  3IPM O;  1FFT C;  4H4K C;  4O6M A;  5B3S C;  1LVK A;  1I4Z A;  4P6I C;  4CS9 A;  2ICW G;  4CBE A;  2HZ8 A;  5BQI A;  2CW0 F;  1T5O A;  4Q7C A;  4MTF A;  1FMW A;  5KYU A;  1A41 A;  4MVR A;  1H9G A;  2KJG A;  4U9D A;  5HSW A;  4U5F E;  3EQL F;  4I44 A;  1G4U S;  3JYH A;  2HKV A;  2IOQ A;  1O87 A;  1Q0D A;  4CSA A;  2CDQ A;  3U9J A;  2CGE A;  2HJ3 A;  1KTM A;  2P0N A;  3EH1 A;  1E2X A;  4E0H A;  4CS9 C;  2J9W A;  4J32 B;  3AQC A;  4LDR A;  4EHP A;  4EBB A;  1MND A;  2KK1 A;  2DYS C;  1Z63 A;  2Y3H A;  1NSG B;  3DAF A;  4FES A;  4RDA A;  2DB4 A;  4CSA C;  3RW0 A;  3CEX A;  2IM8 A;  3TJ5 A;  2I8B A;  3FOP A;  5KYX A;  1BZ4 A;  2GWW A;  2JPU A;  2UUH A;  2Z15 A;  3IQC A;  3KPH A;  4LDQ A;  4XEK A;  3U9M A;  1LI5 A;  4FWV A;  3C8G A;  4QDL A;  3EJN A;  3AGU A;  4Z9I A;  2R9R B;  1IW7 F;  2RSE B;  4XQ1 A;  2WVQ A;  3HKK A;  2P1A A;  3IEE A;  4FAP B;  2WB7 A;  3PDM P;  2KNH A;  3SXY A;  2J7P A;  3AQB A;  3KYJ A;  4BPM A;  4E18 A;  1L7C A;  3EFO A;  4JEB A;  3I4U A;  3V7O A;  3HNI A;  5HV9 A;  2R03 A;  1NFN A;  3ECS A;  2WL8 A;  3I5P A;  2VCA A;  4KBL A;  1AEP A;  4E0I A;  3GEH A;  1G8X A;  1RKE A;  3ASO C;  3EZI A;  2XL4 A;  3MFN A;  4XEF A;  4JJF A;  4C7O B;  3LAY A;  3NMJ A;  4BEM J;  1DOW A;  1O3U A;  1QKR A;  2FAP B;  1Y6D A;  3KH2 A;  5T1D B;  2YVK A;  2Y3D A;  2Q9A A;  3M79 A;  3OEO A;  4DVY P;  1N1C A;  1K05 A;  2QTV A;  5T3W A;  1A0B A;  3GWL A;  2R02 A;  1HW1 A;  2JX0 A;  1Q0G A;  1UFB A;  2BC5 A;  1TFK B;  3SP1 A;  3C7J A;  5D91 A;  4DBR A;  3SXM A;  2M4E A;  4BJ6 A;  3O39 A;  5L0F A;  2A6H F;  3O10 A;  1V4A A;  3GEE A;  3TQO A;  1LIH A;  1ZYR F;  2A0U A;  4JZA A;  2Q7R A;  3RQE A;  4IGG A;  4LAC B;  4KNV A;  2PNO A;  5KYX B;  2L9J A;  1ZW2 A;  3EGX A;  4MS2 A;  5L0H A;  1A7D A;  3QMK A;  3C8G B;  1OW7 A;  3E9V A;  4W8P A;  3ZDL A;  3SZR A;  4BJ6 C;  4HE8 D;  3ABL C;  2NSF A;  3U3B A;  1LI7 A;  2IXN A;  3KYI A;  3DM5 A;  1I4Y A;  3DD7 A;  3B71 A;  3EPV A;  3POV A;  3F46 A;  3WAQ A;  3AG3 C;  1VLS A;  3RVY A;  1M57 C;  2HSQ A;  4HEA J;  1OW6 A;  1T6Q A;  2J45 A;  3EG9 A;  5COF A;  1CGN A;  1YZA A;  3PHF 2;  1BBH A;  4XLP F;  2HMZ A;  1GGQ A;  4IAR A;  2YKZ A;  1FFH A;  1A7E A;  3S28 A;  3ZC4 A;  4YT5 A;  3ZG1 A;  2XRH A;  4CDY A;  4AE4 A;  2XLD A;  1ZHY A;  2C04 A;  4CS7 A;  3FAP B;  4MND A;  3AOU A;  5JS5 A;  3US6 A;  3AG2 C;  2L6H A;  3JRT A;  4NC3 A;  2IXO A;  3UMI A;  3X2Q C;  2AVK A;  4W8K A;  3HTK C;  3QVZ A;  1OKK A;  1ORS C;  4HFK B;  1OCC C;  2LSE A;  2IXP A;  4LLC A;  2RD9 A;  2EPM X;  2KC3 A;  1OXB A;  2R7O A;  2XXA B;  4EUK B;  1WN0 A;  1K40 A;  3DZA A;  3LLK A;  4PFO A;  2HV6 A;  5E3C A;  2H7B A;  4XWJ A;  1NU7 D;  4G78 A; 
#chains in the Genus database with same CATH homology
 1L3P A;  2M64 A;  1NLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...