1T01A

Vinculin complexed with the vbs1 helix from talin
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
255
structure length
255
Chain Sequence
AMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activation of a vinculin-binding site in the talin rod involves rearrangement of a five-helix bundle
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cell adhesion, structural protein
molecule keywords unnamed protein product
total genus 109
structure length 255
sequence length 255
ec nomenclature
pdb deposition date 2004-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1t01A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1t01A01
5L0IA 1DOWA 1TR2A 2GDCA 1ST6A 4IGGA 3H2VA 4PR9A 2L7AA 4E18A 1U6HA 4E17A 5L0JA 5L0DA 3H2UA 1H6GA 1RKEA 5L0GA 4EHPA 2HSQA 1XWJA 2GWWA 3VF0A 1U89A 2B0HA 1QKRA 1SYQA 2IBFA 1RKCA 1ZVZA 1L7CA 1DOVA 4P9TA 2LQGA 4DJ9A 5L0HA 1ZW2A 3S90A 1ZW3A 4W8PA 3TJ5A 1YDIA 2X0CA 1RKEB 1T01A 5L0FA 3TJ6A 5L0CA 3RF3A 4K1OA 3T6GB 3ZDLA 3MYIA 4ONSA 5FZTA
chains in the Genus database with same CATH superfamily
2J9UA 2QUPA 1RJ9B 1S7ZA 2XM4A 3H2VA 3DD7A 3A11A 4JIOA 2VCBA 1Q0MA 1TWCA 4EBKA 3HNIA 1NG1A 1JMWA 1U89A 5COMA 3L8IA 4EUKB 1ORSC 2XXAA 3S0XA 1JAFA 3NYJA 5E3CA 4IAQA 4PK4A 1QLEC 3S29A 1V4AA 3AOUA 1LVKA 4KC9A 1Z3IX 1KTMA 2R7SA 1Z7Qc 1YZAA 2OKUA 2BE5F 1T6UA 2P0NA 3U2LA 4U5DE 2G3VA 3CQZA 1YVIA 2Q00A 3EGDA 3FAPB 3K1IC 4CJGA 5A6KA 4G7ZF 1LS1A 4O7GA 1ZHTA 2YHSA 3TK0A 2G62A 3B9QA 1DOWA 1KU2A 5F28E 4EWCA 3JRTA 2R9RB 1ST6A 2BL2A 3LUTB 4QDLA 5L0DA 2L7AA 3MBGA 3GM2A 4WJ0A 4E17A 3U0CA 4OIQF 5B1AC 3GEIA 3JYHA 2HZ8A 2RSEB 1PCXA 3K7DA 3SXKA 2A69F 5COFA 1T5OA 2L81A 4PJNA 1EQ1A 1QKRA 1SYQA 1HMOA 4DJ9A 4JEBA 3JSZA 1TWHA 3AG2C 3S84A 2YL7A 4LERA 3C63A 5BQGA 4JJGA 3UMHA 3FDQA 2NUPA 4WGYA 1WASA 4ULVA 4IAOA 3UGPA 2R7XA 1Y6DA 3TULA 2J7PA 5DQZA 5L0CA 2VB6A 4EIYA 3JTLO 3O39A 2YRFA 3L0IA 2JPUA 4UDVA 2FAPB 5JVEA 2YWAA 2HMZA 3C8GD 3U8PA 4HFKB 4C3BA 2GFHA 4MW3A 5CIVA 3LEOA 2Q7RA 5KYNA 1WTYA 1OW8A 3C62A 1ZHWA 4I1MA 2EPMX 2C04A 1C03A 3LNRA 3HNJA 4BEMJ 1T6QA 2W4MA 3IQTA 2VCAA 3ZVRA 2ZPAA 2CYDA 3MX3A 4F4BA 4U5HA 1S05A 2XSEA 3EFOA 3ZTMA 1Q0GA 4Z9IA 1LM3B 1JOGA 3C8GA 2V3CC 3NRHA 3EHMA 4MTFA 3ZG1A 1YYJA 3JT1A 2R7UA 2R7VA 3BRJA 1QVXA 2IXOA 3NMJA 4MTGA 4XTKA 4OIRF 2XL4A 1LI7A 3LAYA 1T01A 3ZTZA 3TQOA 2DYRC 1RJ9A 2IM8A 2UUIA 3AQCA 3QZCA 5T1DB 2EINC 3A9CA 4PFOA 1K40A 3ZDLA 1NBBA 2DB4A 3EFOB 3NKEA 3F46A 5L0IA 5DS5A 4JC7A 5KYWB 1K04A 3LESA 2YL3A 3M4CA 3J06A 4N6HA 3DI5A 4Z9HA 2QY9A 3GEEA 4BJ5A 4MQ9F 3RW0A 3U5SA 1ZHZA 4JVSA 4JZAA 4OIOF 3DM9B 3DE9A 4NTBA 1PD1A 5A6BA 4D4NA 2J9BA 1LI5A 2B0HA 4ANJA 1WN0A 1ZVZA 1JRAA 2XS8A 5COGA 1EKYA 1NFOA 1OR2A 3HNLA 2AVKA 1WOLA 1ZYRF 3PMRA 4A2NB 1RXQA 3ABMC 1TWGA 4XLNF 4MW8A 2BC5A 2P61A 3KYIA 5EGYA 3JCUQ 256BA 1R5ID 1VK5A 5BUOA 4PACA 1FMVA 1Z5ZA 2CW0F 3SXZA 1HE1A 4BJ6C 2IOQA 4CIHA 3UMKA 3AG3C 3FOOA 5KYUA 4GEHA 4CS7A 3B71A 2EILC 2ZXPA 3AGUA 3UNGC 3WAQA 1U6HA 2XLVA 2KNHA 2E87A 4P9FA 1A7DA 1PV3A 2ZD9A 2NUTB 2YQYA 4JRZA 2YEVA 3SXYA 1RKCA 1D0YA 3O55A 1MNDA 4CDAA 2HSBA 2XLHA 3IEEA 2OU6A 5B1BC 4EBBA 4MVZA 3GWLA 4U5GA 2DGJA 3G4ZA 3DE8A 4C3DA 3FAJA 1MMGA 1RMVA 2OQMA 1UFBA 1I4YA 2AWYA 4AL0A 4JCHA 3RQFA 2CDQA 1YJGA 1GGQA 1NLXA 1V74B 3RVZA 3LLKA 2IXPA 1I4ZA 3Q7LA 2HFIA 3QVYA 4CS8A 4DBRA 3NYLA 4CDVA 1HW1A 3T4RA 1J8MF 2PBEA 1Z6AA 3ABKC 2KJGA 3AQBA 3GEHA 5JLIA 4PJMA 3KYJA 1RCPA 2J7PD 2X51A 1BR4A 1WGWA 2C03A 3H2UA 4GQHA 5E3AA 3QW0A 4FAPB 3DJNB 4G78A 3ASNC 1M2VB 4XQ1A 1VLTA 4DRHB 5CI9A 1AEPA 4XEVA 2IBFA 2OEXA 2J9WA 2EIMC 3M4BA 2GA0A 1YARO 1VYKA 3RIPA 4JKVA 1R4TA 4W8PA 3TJ5A 3IQCA 3DKAA 3DAGA 4CIPA 4J32B 2J46A 5L3QA 1KNYA 1RKEB 1T6IA 2NSGA 2Z15A 4JJFA 3GM3A 5T3TA 5TJ5E 1PD0A 4IWBA 2XLWA 4BJ5C 4B6IA 3NKDA 4KNVA 1JPJA 4ONSA 5BQIA 1GM5A 1TR2A 3ZQVA 2OG2A 3NG1A 3UMIA 3POVA 5D92A 4NC3A 4U5BE 4EHPA 1OKKA 1MMDA 3EH2A 4LLEA 1E84A 2OJQA 2Q9CA 3EG9B 1FAPB 3EHNA 4YL0A 5T3WA 2Q3TA 3KMIA 2QTVA 2W45A 4XEKA 5DVWA 1BR2A 2CGEA 2VC9A 3S90A 4LLCA 4YL1A 4DVZA 2Y3GA 1ZW3A 1BBHA 3GODA 2EPNA 1Q0KA 2I8BA 2R02A 3QMKA 3C7JA 1ORJA 3K1IA 1E86A 2A6EF 5BQHA 1OCOC 3I5QA 1VB5A 3E70C 4CBEA 3B0VC 4BEJA 3PDMP 2AU5A 3DMDA 1H9GA 1U0BB 4NY3A 4U9EA 1E83A 3W4YA 2XL6A 4MVSA 4BPMA 1BDJB 1MMNA 4G7HF 2CCYA 1BZ4A 4LACB 3S28A 2H7OA 3C18A 3T9OA 3SEOA 3IPMO 3JSEO 3KL4A 1GS9A 3ZC4A 4NTAA 1YAUO 3W2VA 2EPOA 3IQ5A 3VF0A 2ASRA 1FR0A 4QI0A 5FCLA 1M2OA 1EA8A 1EI7A 3T6JA 2NUPB 5A69A 5JS5A 1YYXA 2MWQA 2UUHA 1G4US 4P9TA 1V55C 2F22A 1H7IA 3BEHA 3LNMB 2A0UA 4OINF 3DWWA 1V54C 1OCRC 3EJNA 3N2ZB 4JURI 1HMDA 4YJWA 3VRCA 3ABLC 4AK9A 5L3VA 2L9JA 4JEAA 4ZLDA 3EG9A 1OW7A 2OJED 2YZSA 2L6GA 3G50A 1SF8A 2IXNA 4XPYA 4DRIB 3JYYA 4HE8D 3K1HA 2Q9BA 2CNWD 3X1OA 2QLAA 5L0JA 1A7EA 2GAQA 1H6GA 3W2WA 2A6HF 1SZIA 3DAFA 3HJCA 3LJBA 3CSKA 4YK5A 2WVOA 2H7VC 4I44A 4FX5A 3ECSA 1K05A 1ZW2A 2R03A 5F5FA 5KYUB 4BG0A 2Q9AA 4Z9JA 5AC5A 3IQ6A 5A6AA 3GM1A 3AGTA 4DXWA 1HW2A 1WATA 1WWPA 4O6YA 5JRAA 4YT4A 4YT8A 4JE9A 3MLGA 2PF4E 1M6TA 3V5XA 3NDBB 2TMVP 2EPKX 2CNWA 2L6HA 3LS0A 5JT4A 1TFKB 2L6FA 4P6IC 2DYSC 2J8WA 4KBLA 1I5NA 1D1CA 2QE9A 2ZXWC 3GWNA 2HUJA 4HFFB 4JTDB 4I3MA 1TFOB 2XL8A 3JRMO 3M15A 5D91A 1LIHA 1RKEA 1FNTc 1CGNA 2KYHA 2PFDA 1OCZC 1O3UA 3M79A 2JD3A 2R7TA 2A68F 1G5ZA 2P7VA 3I4UA 4RDAA 3SXMA 3B0UX 3HTKC 4MVQA 4L6RA 1HY5A 3DXJF 3U3FA 1VLSA 2JX0A 3CAXA 3KPHA 2HV7A 1LS4A 3K6BA 1Q0DA 1QZXA 4YL3A 5B3IA 2LCHA 1QSPA 3I5PA 2XXAB 1AVOB 5GPGB 2XS1A 4BJ6A 4CX9A 5KYYB 1ORYA 2R7WA 1O5HA 3VYWA 1O87A 2EIJC 2KSFA 2HJMA 1OW6A 1Z23A 3N0TA 3F47A 5KYXB 4HEAJ 4A4AA 3UR3C 4CDYA 4AL1A 2HV6A 2ETSA 3U9MA 4E0IA 1YA7O 4N4WA 3WODF 1L3PA 2LFFA 1OQCA 3KKBA 4O6MA 1E2XA 5HV9A 2XLMA 4Q7CA 4CSAA 4PR9A 2Y39A 4NQFA 2D4UA 3OA1A 1B68A 2KGOA 2WB7A 3PHF2 3HKKA 4XLPF 4CJOA 4LDRA 3W8HA 3L8JA 3R7CA 4C7OB 3Q6MA 1H9TA 1GQAA 1N1CA 2R7QA 1FMWA 4EKWA 2MYSA 4ZLCA 1NU9C 3AG4C 4YN0B 4R32A 2P6VA 1E85A 1NSGB 2LD6A 4G7OF 2J9VA 2YL1A 4XWJA 1QPUA 3S9OA 3ZIBA 4BJTA 3L1MA 1G8XA 4IJJA 3Q7GA 4PJJA 2V26A 4XEFA 2PX3A 1YA9A 2HMQA 1C02A 4U5EE 3T6GB 3RFYA 4RD9A 2I15A 2KQ9A 1VOMA 3EQLF 3SP1A 3U8VA 3NYMA 4MVRA 4D4XA 4K7BA 2ICWG 3ZSUA 5A6BD 4K0DA 3TOMA 3B29A 4LDQA 3ZQYA 3HNKA 2NG1A 1NU7D 4MS2A 4O79A 4AX2A 3CZ6A 4JTAB 4XPWA 2HS5A 2KW3C 1ZHXA 2VCCA 1HE9A 2YLDA 2XRHA 3FOPA 4KNWA 1VMAA 1F1MA 2W4BA 2OEVA 3LLIA 3LS1A 2KK1A 2J0XA 3NMIA 4NCQA 3RKOF 3W8IA 3EGDB 4OD5A 2R7RA 2XM0A 1SMYF 4AE4A 4N06A 1CPQA 1D1AA 2YVKA 1Z63A 4N6CA 1YZCA 2EIKC 4W8KA 3FMSA 3DJUB 3TJ6A 2AP3A 3TD7A 1TQGA 3OWTA 1TWAA 3ZWIA 4O6NA 1IW7F 3ASOC 2J45A 3IHUA 1M56C 3CEXA 4H4KC 4J30B 2H8AA 2ZXRA 2VH3A 1LKXA 2IYLD 4IGGA 4WABA 4E18A 2PNOA 2PP4A 3RQGA 3GORA 2LK4A 3U3BA 2ZXOA 2Q4FA 4ER9A 1APCA 1FTSA 5AGFA 3SNHA 1UG7A 2GWWA 2LIGA 2OOCA 4CS9A 3NMKA 5HSWA 1C17M 3C8ZA 2WZLA 2NSFA 1L7CA 3EH1A 3VM6A 4FWVA 5F5HA 3PCVA 1LE2A 2YL0A 2WL8A 1M57C 2IXMA 2Y69C 3HLZA 4I1OB 5A6JA 3UGOA 1IZMA 1ZU4A 2Y3BA 4JTCB 3L34A 4CS8C 3FHDA 4PJLA 4JW1A 3X2QC 3RVYA 5KYYA 5EK0A 4DBQA 4BJ1A 5DLJA 4MNDA 3EGXB 4U5FE 3RF3A 2RD9A 4K1OA 3RYLA 1LE4A 1FFTC 2M4EA 4YT2A 3AJMA 4E7ZA 5DS6A 3MYFA 4FESA 1AUEA 2WVQA 1M2VA 4YT5A 4Q4ZF 2HSQA 2VASA 1XZPA 4AE4B 2R25A 2XLDA 3SYNA 5K0IA 2FGYA 1OXBA 2YLGA 3QVZA 5L0HA 1G4WR 2A1DD 2LQGA 4EBJA 2HKVA 4YWQA 2W9YA 3KH2A 3C8GB 3ITFA 4U9DA 1CGME 1YDIA 5AC4A 4OD4A 4C3EA 2WZFA 1ZZPA 2P1AA 2Y3DA 2WVNA 4MVMA 5L0FA 2AWCA 1NZEA 3SZRA 3JZ0A 4OIPF 4DRJB 3B0PA 3V7OA 1MQVA 1QQ3A 1BR1A 5FZTA 5JP7A 2QNLA 5E33A 2GDCA 1D0ZA 2FFHA 4RBNA 3N24A 3TOLA 3O10A 1OR3A 3WHNA 5L0GA 2M64A 1OKKD 5IY5C 1XWJA 3EZHA 1VYIA 2Y3HA 4J7TA 3RH3A 3V5ZA 1ZU5A 2R05A 3K33A 1DOVA 1XZQA 3QTHA 4M63A 1VTMP 2EPLX 2MHRA 2OCCC 5DQTA 2G3KA 1T9KA 3E9VA 3OEOA 1CPRA 4MTOA 4E7SA 4QI2A 3FVYA 5EHHA 3U9JA 1Q0FA 4G0HA 2NPUA 3WG7C 2DI3A 3Q6NA 3QW1A 3EZIA 3GANA 2LP4A 1TKNA 1CGOA 4GYTA 1LPEA 3G4XA 4LDKA 1JPNA 1YLMA 3LEVA 1NFNA 4H54A 1MMAA 3MFNA 3RQEA 1A41A 2HJ3A 1W2WA 3H65A 2YKZA 3FXHA 3O6XA 2KC3A 4PFPA 1D1BA 1FFHA 2J0WA 3DZAA 2XLEA 5KYXA 2XLOA 4MVUA 3U2MA 3K66A 4DVYP 3EPVA 4IB4A 1A0BA 2A0BA 3ATPA 4NTFA 4MVOA 4ULWA 5JSLA 3S27A 1ZHYA 4X0RA 1D0XA 2H7BA 4IARA 4U5CE 4JCZA 1OCCC 5E2QA 4IRUA 3AG1C 3US6A 4E0HA 5B3SC 2LFDA 2WZGA 5CI8A 3T6BA 3V5YA 4CSAC 4J7YA 2LSEA 1Y4CA 2B0JA 2O9XA 3EGXA 1A7VA 4DOZA 2X0CA 3R2PA 4C7OA 3DM5A 4CS9C 1SR2A 3M1CB 2YLIA 2NUTA 4Q5SF 5JUAA 2PX0A 2D5RB 1MNEA 4WGZA 1OXKA 4XPXA 5KYWA 4KI2A 1J8YF 2R7OA 3VAYA 3MYIA 1JR8A 5DS4A
chains in the Genus database with same CATH topology
5L0IA 1DOWA 1TR2A 2GDCA 1ST6A 4IGGA 3H2VA 4PR9A 2L7AA 4E18A 1U6HA 4E17A 5L0JA 5L0DA 3H2UA 1H6GA 1RKEA 5L0GA 4EHPA 2HSQA 1XWJA 2GWWA 3VF0A 1U89A 2B0HA 1QKRA 1SYQA 2IBFA 1RKCA 1ZVZA 1L7CA 1DOVA 4P9TA 2LQGA 4DJ9A 5L0HA 1ZW2A 3S90A 1ZW3A 4W8PA 3TJ5A 1YDIA 2X0CA 1RKEB 1T01A 5L0FA 3TJ6A 5L0CA 3RF3A 4K1OA 3T6GB 3ZDLA 3MYIA 4ONSA 5FZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L0I A;  1DOW A;  1TR2 A;  2GDC A;  1ST6 A;  4IGG A;  3H2V A;  4PR9 A;  2L7A A;  4E18 A;  1U6H A;  4E17 A;  5L0J A;  5L0D A;  3H2U A;  1H6G A;  1RKE A;  5L0G A;  4EHP A;  2HSQ A;  1XWJ A;  2GWW A;  3VF0 A;  1U89 A;  2B0H A;  1QKR A;  1SYQ A;  2IBF A;  1RKC A;  1ZVZ A;  1L7C A;  1DOV A;  4P9T A;  2LQG A;  4DJ9 A;  5L0H A;  1ZW2 A;  3S90 A;  1ZW3 A;  4W8P A;  3TJ5 A;  1YDI A;  2X0C A;  1RKE B;  1T01 A;  5L0F A;  3TJ6 A;  5L0C A;  3RF3 A;  4K1O A;  3T6G B;  3ZDL A;  3MYI A;  4ONS A;  5FZT A; 
#chains in the Genus database with same CATH topology
 2J9U A;  2QUP A;  1RJ9 B;  1S7Z A;  2XM4 A;  3H2V A;  3DD7 A;  3A11 A;  4JIO A;  2VCB A;  1Q0M A;  1TWC A;  4EBK A;  3HNI A;  1NG1 A;  1JMW A;  1U89 A;  5COM A;  3L8I A;  4EUK B;  1ORS C;  2XXA A;  3S0X A;  1JAF A;  3NYJ A;  5E3C A;  4IAQ A;  4PK4 A;  1QLE C;  3S29 A;  1V4A A;  3AOU A;  1LVK A;  4KC9 A;  1Z3I X;  1KTM A;  2R7S A;  1Z7Q c;  1YZA A;  2OKU A;  2BE5 F;  1T6U A;  2P0N A;  3U2L A;  4U5D E;  2G3V A;  3CQZ A;  1YVI A;  2Q00 A;  3EGD A;  3FAP B;  3K1I C;  4CJG A;  5A6K A;  4G7Z F;  1LS1 A;  4O7G A;  1ZHT A;  2YHS A;  3TK0 A;  2G62 A;  3B9Q A;  1DOW A;  1KU2 A;  5F28 E;  4EWC A;  3JRT A;  2R9R B;  1ST6 A;  2BL2 A;  3LUT B;  4QDL A;  5L0D A;  2L7A A;  3MBG A;  3GM2 A;  4WJ0 A;  4E17 A;  3U0C A;  4OIQ F;  5B1A C;  3GEI A;  3JYH A;  2HZ8 A;  2RSE B;  1PCX A;  3K7D A;  3SXK A;  2A69 F;  5COF A;  1T5O A;  2L81 A;  4PJN A;  1EQ1 A;  1QKR A;  1SYQ A;  1HMO A;  4DJ9 A;  4JEB A;  3JSZ A;  1TWH A;  3AG2 C;  3S84 A;  2YL7 A;  4LER A;  3C63 A;  5BQG A;  4JJG A;  3UMH A;  3FDQ A;  2NUP A;  4WGY A;  1WAS A;  4ULV A;  4IAO A;  3UGP A;  2R7X A;  1Y6D A;  3TUL A;  2J7P A;  5DQZ A;  5L0C A;  2VB6 A;  4EIY A;  3JTL O;  3O39 A;  2YRF A;  3L0I A;  2JPU A;  4UDV A;  2FAP B;  5JVE A;  2YWA A;  2HMZ A;  3C8G D;  3U8P A;  4HFK B;  4C3B A;  2GFH A;  4MW3 A;  5CIV A;  3LEO A;  2Q7R A;  5KYN A;  1WTY A;  1OW8 A;  3C62 A;  1ZHW A;  4I1M A;  2EPM X;  2C04 A;  1C03 A;  3LNR A;  3HNJ A;  4BEM J;  1T6Q A;  2W4M A;  3IQT A;  2VCA A;  3ZVR A;  2ZPA A;  2CYD A;  3MX3 A;  4F4B A;  4U5H A;  1S05 A;  2XSE A;  3EFO A;  3ZTM A;  1Q0G A;  4Z9I A;  1LM3 B;  1JOG A;  3C8G A;  2V3C C;  3NRH A;  3EHM A;  4MTF A;  3ZG1 A;  1YYJ A;  3JT1 A;  2R7U A;  2R7V A;  3BRJ A;  1QVX A;  2IXO A;  3NMJ A;  4MTG A;  4XTK A;  4OIR F;  2XL4 A;  1LI7 A;  3LAY A;  1T01 A;  3ZTZ A;  3TQO A;  2DYR C;  1RJ9 A;  2IM8 A;  2UUI A;  3AQC A;  3QZC A;  5T1D B;  2EIN C;  3A9C A;  4PFO A;  1K40 A;  3ZDL A;  1NBB A;  2DB4 A;  3EFO B;  3NKE A;  3F46 A;  5L0I A;  5DS5 A;  4JC7 A;  5KYW B;  1K04 A;  3LES A;  2YL3 A;  3M4C A;  3J06 A;  4N6H A;  3DI5 A;  4Z9H A;  2QY9 A;  3GEE A;  4BJ5 A;  4MQ9 F;  3RW0 A;  3U5S A;  1ZHZ A;  4JVS A;  4JZA A;  4OIO F;  3DM9 B;  3DE9 A;  4NTB A;  1PD1 A;  5A6B A;  4D4N A;  2J9B A;  1LI5 A;  2B0H A;  4ANJ A;  1WN0 A;  1ZVZ A;  1JRA A;  2XS8 A;  5COG A;  1EKY A;  1NFO A;  1OR2 A;  3HNL A;  2AVK A;  1WOL A;  1ZYR F;  3PMR A;  4A2N B;  1RXQ A;  3ABM C;  1TWG A;  4XLN F;  4MW8 A;  2BC5 A;  2P61 A;  3KYI A;  5EGY A;  3JCU Q;  256B A;  1R5I D;  1VK5 A;  5BUO A;  4PAC A;  1FMV A;  1Z5Z A;  2CW0 F;  3SXZ A;  1HE1 A;  4BJ6 C;  2IOQ A;  4CIH A;  3UMK A;  3AG3 C;  3FOO A;  5KYU A;  4GEH A;  4CS7 A;  3B71 A;  2EIL C;  2ZXP A;  3AGU A;  3UNG C;  3WAQ A;  1U6H A;  2XLV A;  2KNH A;  2E87 A;  4P9F A;  1A7D A;  1PV3 A;  2ZD9 A;  2NUT B;  2YQY A;  4JRZ A;  2YEV A;  3SXY A;  1RKC A;  1D0Y A;  3O55 A;  1MND A;  4CDA A;  2HSB A;  2XLH A;  3IEE A;  2OU6 A;  5B1B C;  4EBB A;  4MVZ A;  3GWL A;  4U5G A;  2DGJ A;  3G4Z A;  3DE8 A;  4C3D A;  3FAJ A;  1MMG A;  1RMV A;  2OQM A;  1UFB A;  1I4Y A;  2AWY A;  4AL0 A;  4JCH A;  3RQF A;  2CDQ A;  1YJG A;  1GGQ A;  1NLX A;  1V74 B;  3RVZ A;  3LLK A;  2IXP A;  1I4Z A;  3Q7L A;  2HFI A;  3QVY A;  4CS8 A;  4DBR A;  3NYL A;  4CDV A;  1HW1 A;  3T4R A;  1J8M F;  2PBE A;  1Z6A A;  3ABK C;  2KJG A;  3AQB A;  3GEH A;  5JLI A;  4PJM A;  3KYJ A;  1RCP A;  2J7P D;  2X51 A;  1BR4 A;  1WGW A;  2C03 A;  3H2U A;  4GQH A;  5E3A A;  3QW0 A;  4FAP B;  3DJN B;  4G78 A;  3ASN C;  1M2V B;  4XQ1 A;  1VLT A;  4DRH B;  5CI9 A;  1AEP A;  4XEV A;  2IBF A;  2OEX A;  2J9W A;  2EIM C;  3M4B A;  2GA0 A;  1YAR O;  1VYK A;  3RIP A;  4JKV A;  1R4T A;  4W8P A;  3TJ5 A;  3IQC A;  3DKA A;  3DAG A;  4CIP A;  4J32 B;  2J46 A;  5L3Q A;  1KNY A;  1RKE B;  1T6I A;  2NSG A;  2Z15 A;  4JJF A;  3GM3 A;  5T3T A;  5TJ5 E;  1PD0 A;  4IWB A;  2XLW A;  4BJ5 C;  4B6I A;  3NKD A;  4KNV A;  1JPJ A;  4ONS A;  5BQI A;  1GM5 A;  1TR2 A;  3ZQV A;  2OG2 A;  3NG1 A;  3UMI A;  3POV A;  5D92 A;  4NC3 A;  4U5B E;  4EHP A;  1OKK A;  1MMD A;  3EH2 A;  4LLE A;  1E84 A;  2OJQ A;  2Q9C A;  3EG9 B;  1FAP B;  3EHN A;  4YL0 A;  5T3W A;  2Q3T A;  3KMI A;  2QTV A;  2W45 A;  4XEK A;  5DVW A;  1BR2 A;  2CGE A;  2VC9 A;  3S90 A;  4LLC A;  4YL1 A;  4DVZ A;  2Y3G A;  1ZW3 A;  1BBH A;  3GOD A;  2EPN A;  1Q0K A;  2I8B A;  2R02 A;  3QMK A;  3C7J A;  1ORJ A;  3K1I A;  1E86 A;  2A6E F;  5BQH A;  1OCO C;  3I5Q A;  1VB5 A;  3E70 C;  4CBE A;  3B0V C;  4BEJ A;  3PDM P;  2AU5 A;  3DMD A;  1H9G A;  1U0B B;  4NY3 A;  4U9E A;  1E83 A;  3W4Y A;  2XL6 A;  4MVS A;  4BPM A;  1BDJ B;  1MMN A;  4G7H F;  2CCY A;  1BZ4 A;  4LAC B;  3S28 A;  2H7O A;  3C18 A;  3T9O A;  3SEO A;  3IPM O;  3JSE O;  3KL4 A;  1GS9 A;  3ZC4 A;  4NTA A;  1YAU O;  3W2V A;  2EPO A;  3IQ5 A;  3VF0 A;  2ASR A;  1FR0 A;  4QI0 A;  5FCL A;  1M2O A;  1EA8 A;  1EI7 A;  3T6J A;  2NUP B;  5A69 A;  5JS5 A;  1YYX A;  2MWQ A;  2UUH A;  1G4U S;  4P9T A;  1V55 C;  2F22 A;  1H7I A;  3BEH A;  3LNM B;  2A0U A;  4OIN F;  3DWW A;  1V54 C;  1OCR C;  3EJN A;  3N2Z B;  4JUR I;  1HMD A;  4YJW A;  3VRC A;  3ABL C;  4AK9 A;  5L3V A;  2L9J A;  4JEA A;  4ZLD A;  3EG9 A;  1OW7 A;  2OJE D;  2YZS A;  2L6G A;  3G50 A;  1SF8 A;  2IXN A;  4XPY A;  4DRI B;  3JYY A;  4HE8 D;  3K1H A;  2Q9B A;  2CNW D;  3X1O A;  2QLA A;  5L0J A;  1A7E A;  2GAQ A;  1H6G A;  3W2W A;  2A6H F;  1SZI A;  3DAF A;  3HJC A;  3LJB A;  3CSK A;  4YK5 A;  2WVO A;  2H7V C;  4I44 A;  4FX5 A;  3ECS A;  1K05 A;  1ZW2 A;  2R03 A;  5F5F A;  5KYU B;  4BG0 A;  2Q9A A;  4Z9J A;  5AC5 A;  3IQ6 A;  5A6A A;  3GM1 A;  3AGT A;  4DXW A;  1HW2 A;  1WAT A;  1WWP A;  4O6Y A;  5JRA A;  4YT4 A;  4YT8 A;  4JE9 A;  3MLG A;  2PF4 E;  1M6T A;  3V5X A;  3NDB B;  2TMV P;  2EPK X;  2CNW A;  2L6H A;  3LS0 A;  5JT4 A;  1TFK B;  2L6F A;  4P6I C;  2DYS C;  2J8W A;  4KBL A;  1I5N A;  1D1C A;  2QE9 A;  2ZXW C;  3GWN A;  2HUJ A;  4HFF B;  4JTD B;  4I3M A;  1TFO B;  2XL8 A;  3JRM O;  3M15 A;  5D91 A;  1LIH A;  1RKE A;  1FNT c;  1CGN A;  2KYH A;  2PFD A;  1OCZ C;  1O3U A;  3M79 A;  2JD3 A;  2R7T A;  2A68 F;  1G5Z A;  2P7V A;  3I4U A;  4RDA A;  3SXM A;  3B0U X;  3HTK C;  4MVQ A;  4L6R A;  1HY5 A;  3DXJ F;  3U3F A;  1VLS A;  2JX0 A;  3CAX A;  3KPH A;  2HV7 A;  1LS4 A;  3K6B A;  1Q0D A;  1QZX A;  4YL3 A;  5B3I A;  2LCH A;  1QSP A;  3I5P A;  2XXA B;  1AVO B;  5GPG B;  2XS1 A;  4BJ6 A;  4CX9 A;  5KYY B;  1ORY A;  2R7W A;  1O5H A;  3VYW A;  1O87 A;  2EIJ C;  2KSF A;  2HJM A;  1OW6 A;  1Z23 A;  3N0T A;  3F47 A;  5KYX B;  4HEA J;  4A4A A;  3UR3 C;  4CDY A;  4AL1 A;  2HV6 A;  2ETS A;  3U9M A;  4E0I A;  1YA7 O;  4N4W A;  3WOD F;  1L3P A;  2LFF A;  1OQC A;  3KKB A;  4O6M A;  1E2X A;  5HV9 A;  2XLM A;  4Q7C A;  4CSA A;  4PR9 A;  2Y39 A;  4NQF A;  2D4U A;  3OA1 A;  1B68 A;  2KGO A;  2WB7 A;  3PHF 2;  3HKK A;  4XLP F;  4CJO A;  4LDR A;  3W8H A;  3L8J A;  3R7C A;  4C7O B;  3Q6M A;  1H9T A;  1GQA A;  1N1C A;  2R7Q A;  1FMW A;  4EKW A;  2MYS A;  4ZLC A;  1NU9 C;  3AG4 C;  4YN0 B;  4R32 A;  2P6V A;  1E85 A;  1NSG B;  2LD6 A;  4G7O F;  2J9V A;  2YL1 A;  4XWJ A;  1QPU A;  3S9O A;  3ZIB A;  4BJT A;  3L1M A;  1G8X A;  4IJJ A;  3Q7G A;  4PJJ A;  2V26 A;  4XEF A;  2PX3 A;  1YA9 A;  2HMQ A;  1C02 A;  4U5E E;  3T6G B;  3RFY A;  4RD9 A;  2I15 A;  2KQ9 A;  1VOM A;  3EQL F;  3SP1 A;  3U8V A;  3NYM A;  4MVR A;  4D4X A;  4K7B A;  2ICW G;  3ZSU A;  5A6B D;  4K0D A;  3TOM A;  3B29 A;  4LDQ A;  3ZQY A;  3HNK A;  2NG1 A;  1NU7 D;  4MS2 A;  4O79 A;  4AX2 A;  3CZ6 A;  4JTA B;  4XPW A;  2HS5 A;  2KW3 C;  1ZHX A;  2VCC A;  1HE9 A;  2YLD A;  2XRH A;  3FOP A;  4KNW A;  1VMA A;  1F1M A;  2W4B A;  2OEV A;  3LLI A;  3LS1 A;  2KK1 A;  2J0X A;  3NMI A;  4NCQ A;  3RKO F;  3W8I A;  3EGD B;  4OD5 A;  2R7R A;  2XM0 A;  1SMY F;  4AE4 A;  4N06 A;  1CPQ A;  1D1A A;  2YVK A;  1Z63 A;  4N6C A;  1YZC A;  2EIK C;  4W8K A;  3FMS A;  3DJU B;  3TJ6 A;  2AP3 A;  3TD7 A;  1TQG A;  3OWT A;  1TWA A;  3ZWI A;  4O6N A;  1IW7 F;  3ASO C;  2J45 A;  3IHU A;  1M56 C;  3CEX A;  4H4K C;  4J30 B;  2H8A A;  2ZXR A;  2VH3 A;  1LKX A;  2IYL D;  4IGG A;  4WAB A;  4E18 A;  2PNO A;  2PP4 A;  3RQG A;  3GOR A;  2LK4 A;  3U3B A;  2ZXO A;  2Q4F A;  4ER9 A;  1APC A;  1FTS A;  5AGF A;  3SNH A;  1UG7 A;  2GWW A;  2LIG A;  2OOC A;  4CS9 A;  3NMK A;  5HSW A;  1C17 M;  3C8Z A;  2WZL A;  2NSF A;  1L7C A;  3EH1 A;  3VM6 A;  4FWV A;  5F5H A;  3PCV A;  1LE2 A;  2YL0 A;  2WL8 A;  1M57 C;  2IXM A;  2Y69 C;  3HLZ A;  4I1O B;  5A6J A;  3UGO A;  1IZM A;  1ZU4 A;  2Y3B A;  4JTC B;  3L34 A;  4CS8 C;  3FHD A;  4PJL A;  4JW1 A;  3X2Q C;  3RVY A;  5KYY A;  5EK0 A;  4DBQ A;  4BJ1 A;  5DLJ A;  4MND A;  3EGX B;  4U5F E;  3RF3 A;  2RD9 A;  4K1O A;  3RYL A;  1LE4 A;  1FFT C;  2M4E A;  4YT2 A;  3AJM A;  4E7Z A;  5DS6 A;  3MYF A;  4FES A;  1AUE A;  2WVQ A;  1M2V A;  4YT5 A;  4Q4Z F;  2HSQ A;  2VAS A;  1XZP A;  4AE4 B;  2R25 A;  2XLD A;  3SYN A;  5K0I A;  2FGY A;  1OXB A;  2YLG A;  3QVZ A;  5L0H A;  1G4W R;  2A1D D;  2LQG A;  4EBJ A;  2HKV A;  4YWQ A;  2W9Y A;  3KH2 A;  3C8G B;  3ITF A;  4U9D A;  1CGM E;  1YDI A;  5AC4 A;  4OD4 A;  4C3E A;  2WZF A;  1ZZP A;  2P1A A;  2Y3D A;  2WVN A;  4MVM A;  5L0F A;  2AWC A;  1NZE A;  3SZR A;  3JZ0 A;  4OIP F;  4DRJ B;  3B0P A;  3V7O A;  1MQV A;  1QQ3 A;  1BR1 A;  5FZT A;  5JP7 A;  2QNL A;  5E33 A;  2GDC A;  1D0Z A;  2FFH A;  4RBN A;  3N24 A;  3TOL A;  3O10 A;  1OR3 A;  3WHN A;  5L0G A;  2M64 A;  1OKK D;  5IY5 C;  1XWJ A;  3EZH A;  1VYI A;  2Y3H A;  4J7T A;  3RH3 A;  3V5Z A;  1ZU5 A;  2R05 A;  3K33 A;  1DOV A;  1XZQ A;  3QTH A;  4M63 A;  1VTM P;  2EPL X;  2MHR A;  2OCC C;  5DQT A;  2G3K A;  1T9K A;  3E9V A;  3OEO A;  1CPR A;  4MTO A;  4E7S A;  4QI2 A;  3FVY A;  5EHH A;  3U9J A;  1Q0F A;  4G0H A;  2NPU A;  3WG7 C;  2DI3 A;  3Q6N A;  3QW1 A;  3EZI A;  3GAN A;  2LP4 A;  1TKN A;  1CGO A;  4GYT A;  1LPE A;  3G4X A;  4LDK A;  1JPN A;  1YLM A;  3LEV A;  1NFN A;  4H54 A;  1MMA A;  3MFN A;  3RQE A;  1A41 A;  2HJ3 A;  1W2W A;  3H65 A;  2YKZ A;  3FXH A;  3O6X A;  2KC3 A;  4PFP A;  1D1B A;  1FFH A;  2J0W A;  3DZA A;  2XLE A;  5KYX A;  2XLO A;  4MVU A;  3U2M A;  3K66 A;  4DVY P;  3EPV A;  4IB4 A;  1A0B A;  2A0B A;  3ATP A;  4NTF A;  4MVO A;  4ULW A;  5JSL A;  3S27 A;  1ZHY A;  4X0R A;  1D0X A;  2H7B A;  4IAR A;  4U5C E;  4JCZ A;  1OCC C;  5E2Q A;  4IRU A;  3AG1 C;  3US6 A;  4E0H A;  5B3S C;  2LFD A;  2WZG A;  5CI8 A;  3T6B A;  3V5Y A;  4CSA C;  4J7Y A;  2LSE A;  1Y4C A;  2B0J A;  2O9X A;  3EGX A;  1A7V A;  4DOZ A;  2X0C A;  3R2P A;  4C7O A;  3DM5 A;  4CS9 C;  1SR2 A;  3M1C B;  2YLI A;  2NUT A;  4Q5S F;  5JUA A;  2PX0 A;  2D5R B;  1MNE A;  4WGZ A;  1OXK A;  4XPX A;  5KYW A;  4KI2 A;  1J8Y F;  2R7O A;  3VAY A;  3MYI A;  1JR8 A;  5DS4 A; 
#chains in the Genus database with same CATH homology
 5L0I A;  1DOW A;  1TR2 A;  2GDC A;  1ST6 A;  4IGG A;  3H2V A;  4PR9 A;  2L7A A;  4E18 A;  1U6H A;  4E17 A;  5L0J A;  5L0D A;  3H2U A;  1H6G A;  1RKE A;  5L0G A;  4EHP A;  2HSQ A;  1XWJ A;  2GWW A;  3VF0 A;  1U89 A;  2B0H A;  1QKR A;  1SYQ A;  2IBF A;  1RKC A;  1ZVZ A;  1L7C A;  1DOV A;  4P9T A;  2LQG A;  4DJ9 A;  5L0H A;  1ZW2 A;  3S90 A;  1ZW3 A;  4W8P A;  3TJ5 A;  1YDI A;  2X0C A;  1RKE B;  1T01 A;  5L0F A;  3TJ6 A;  5L0C A;  3RF3 A;  4K1O A;  3T6G B;  3ZDL A;  3MYI A;  4ONS A;  5FZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...