1T01A

Vinculin complexed with the vbs1 helix from talin
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
255
structure length
255
Chain Sequence
AMPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion, structural protein
molecule keywords unnamed protein product
publication title Activation of a vinculin-binding site in the talin rod involves rearrangement of a five-helix bundle
pubmed doi rcsb
source organism Gallus gallus
total genus 109
structure length 255
sequence length 255
ec nomenclature
pdb deposition date 2004-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1t01A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 1t01A01
3H2VA 2IBFA 1H6GA 1SYQA 4EHPA 4IGGA 3H2UA 1RKEB 5L0CA 2LQGA 4K1OA 2B0HA 4DJ9A 1ZVZA 2GWWA 5L0GA 3TJ5A 1T01A 1YDIA 1TR2A 1XWJA 3MYIA 2X0CA 3T6GB 3TJ6A 3S90A 5L0IA 1ZW3A 1RKCA 5FZTA 5L0HA 3RF3A 1L7CA 1U6HA 1QKRA 3VF0A 1ZW2A 2L7AA 5L0FA 1ST6A 5L0DA 1U89A 4PR9A 2GDCA 4W8PA 4ONSA 1RKEA 4P9TA 2HSQA 5L0JA 4E18A 4E17A 1DOWA 1DOVA 3ZDLA
chains in the Genus database with same CATH superfamily
4CS9C 2CW0F 2WVNA 1SF8A 1HE9A 2HMQA 2LCHA 5DS5A 4FX5A 1UFBA 2ETSA 3EFOA 3RIPA 1ZHZA 4CS9A 3ITFA 3CQZA 3L8JA 3RFYA 1QLEC 2NG1A 4HFKB 2P6VA 3R7CA 4BEMJ 4AE4A 1T01A 3DM9B 4Z9JA 3RQGA 4HE8D 3SZRA 5AC5A 1ZHXA 1SMYF 2P7VA 3ZC4A 5FZTA 4DRJB 5L0IA 1XZQA 1AUEA 3BRJA 2XM0A 3Q7LA 4G78A 4J7YA 3ZIBA 4BJ5C 2XXAA 1QSPA 5L0FA 3JT1A 2XL8A 4YWQA 2J9VA 3MFNA 3W2WA 2ZXOA 1BZ4A 1JR8A 1ZU5A 3DJNB 3LLIA 4U9DA 4LACB 3CAXA 1WTYA 3TOLA 1D1AA 2OEVA 3VYWA 5HV9A 5L3VA 4ZLDA 3EGXB 2J0XA 3E9VA 1VB5A 3K7DA 3POVA 1ZU4A 1K05A 4PJJA 2IYLD 1Q0KA 1W2WA 2WZGA 4E0IA 4E7SA 1LS4A 4DXWA 5JLIA 1ZVZA 2X51A 4U5CE 256BA 2LSEA 1R4TA 3F47A 4XTKA 3HTKC 3TJ5A 1CGME 4Q5SF 3O6XA 1TR2A 1G5ZA 2J46A 3MYIA 4IWBA 5A6KA 3TQOA 1QQ3A 4O79A 3AG2C 2A6EF 1VYIA 1QKRA 3JSEO 3M79A 3QTHA 2GAQA 3IQTA 4C3DA 1YAUO 2WVOA 5KYWA 1E83A 3JYHA 2Y69C 2IXMA 3QMKA 4GQHA 3HKKA 3A11A 4KC9A 4JZAA 4N6HA 3J06A 1CGNA 3K6BA 2HKVA 1I4YA 3MBGA 4DBQA 1YA9A 2EIMC 1LKXA 4LDQA 3H2VA 3KYJA 2WL8A 3DAFA 4M63A 3DD7A 2HV7A 1IW7F 1Z3IX 1ORYA 2IXPA 2R05A 1MNEA 3ATPA 3WAQA 4EIYA 2NSGA 4O7GA 4OIQF 4K7BA 1TFKB 2YLGA 5KYYB 2Q7RA 1QVXA 5IY5C 3T6GB 2YL7A 2I15A 3EZIA 3AG3C 3G50A 5COGA 1HY5A 1NZEA 1WGWA 1OCRC 2ASRA 2CNWA 4FWVA 3MX3A 3M1CB 3U9JA 1ZW2A 1PD1A 3B9QA 3RVYA 1G4WR 1M2VA 2XLVA 5K0IA 2CYDA 2GDCA 3GORA 3GANA 4YT8A 3UR3C 3DMDA 3OWTA 3I5QA 1A0BA 1G8XA 2WVQA 3K33A 3PMRA 2J45A 2Y3BA 1Q0MA 4CX9A 2Y3DA 2IBFA 2OU6A 2XLDA 4U5BE 5L0CA 2UUHA 4K1OA 2W4BA 2YVKA 4U5GA 4U9EA 3KPHA 4JTAB 1VYKA 3LNMB 3V5ZA 3RH3A 1FTSA 3CEXA 3QVZA 2KNHA 1ZYRF 4X0RA 1PV3A 1A41A 2EPNA 3LLKA 3MYFA 3EH1A 4PFOA 3S29A 1NU7D 4NTFA 3TD7A 1EKYA 3ZWIA 1YJGA 2Q9AA 3O55A 3I4UA 1LI7A 2JX0A 4U5HA 1Z63A 2DYSC 2OG2A 3W2VA 4AE4B 1Z6AA 4JE9A 2LFFA 4YT2A 2QY9A 1LE2A 4U5DE 2EPMX 1RKEA 5A6BA 3K1IC 3S0XA 1OW7A 4AX2A 4CSAA 5A6JA 4C3EA 4EBBA 3B0PA 2AVKA 3K1IA 5DQZA 2ZD9A 3IPMO 3AGUA 4CDVA 1SYQA 2YL0A 4G7HF 1JPJA 2EPLX 3KKBA 4OIPF 1KNYA 2R7OA 2NUPB 4CS8C 3FDQA 3E70C 3B29A 2NPUA 3DE9A 4YJWA 1M56C 4IAOA 1FNTc 2A68F 1FR0A 3SXKA 5JRAA 5KYXA 1TQGA 5DS6A 1OW6A 1ZHYA 2CNWD 3LJBA 3LS1A 2IXOA 4WGZA 3X1OA 4AK9A 3B0VC 3KH2A 3L8IA 4EBKA 3C8ZA 2KYHA 3PCVA 1U89A 2L6FA 1E84A 3NRHA 2UUIA 3HNJA 1LVKA 4PACA 2D4UA 4G0HA 1LE4A 3UGPA 2G3KA 1M57C 3IQCA 4XLNF 4W8KA 2EIJC 3O10A 4L6RA 3RYLA 3T9OA 3HNLA 1TKNA 2DI3A 2FAPB 4CDYA 1APCA 3NYMA 1OKKA 3QW1A 2HMZA 1K40A 3GM1A 4MVSA 2R7RA 2PFDA 3W4YA 1WN0A 3EG9A 5F5FA 3ZQYA 2L81A 1YDIA 3DWWA 1FMWA 2AU5A 1OR3A 2H7VC 3B71A 1T6IA 3WODF 3RF3A 4J30B 4BJTA 4D4NA 2VC9A 5BQIA 3SNHA 4CS7A 5A6BD 2YL3A 1GM5A 3LESA 3LAYA 2NUTB 4NTBA 4RDAA 1WOLA 5DLJA 1LS1A 4U5FE 5D91A 4E18A 4BJ5A 1A7DA 2D5RB 2JPUA 3M4CA 4XWJA 1YARO 3SEOA 5E2QA 3ZSUA 1NFNA 1J8MF 2DGJA 2OEXA 3DZAA 4R32A 3QZCA 3UGOA 2VCAA 4KI2A 2WB7A 4UDVA 3C8GB 5T1DB 4EUKB 1ORJA 2YHSA 3ZTMA 2A1DD 1D1CA 4O6NA 3UMHA 4BG0A 1T6UA 2F22A 3IHUA 3GM2A 3OA1A 3JRMO 4JEAA 2H8AA 5L0GA 1Q0FA 2Q9CA 1FMVA 2A0UA 1I5NA 3GWLA 4EKWA 4MVQA 1VLSA 2RSEB 3S27A 4Q7CA 3TJ6A 1RKCA 2A6HF 1A7VA 2HV6A 3FVYA 4QI2A 3U2MA 4XPXA 4C7OB 2HFIA 4YL1A 5KYUB 3S84A 1YYXA 1RJ9B 2AWYA 3O39A 4I44A 1ST6A 4JJGA 1O87A 5L0DA 2R7UA 5GPGB 2XSEA 1LPEA 3FOPA 3G4ZA 1HMDA 3KMIA 3OEOA 3EQLF 2VB6A 1A7EA 4K0DA 3S28A 4AL1A 1H6GA 3N24A 1OKKD 1TWCA 1YZAA 3AG4C 4RBNA 4G7ZF 1RKEB 4CJGA 2LQGA 5A69A 3U0CA 1Q0DA 1XZPA 3ABLC 4PJLA 4PJNA 2GWWA 2CGEA 3IQ5A 5D92A 4CIHA 5JS5A 3AJMA 2C03A 4MNDA 3T6JA 2R7TA 3DI5A 3V5YA 2G3VA 3KYIA 1HE1A 1D1BA 1YYJA 3ASNC 2XL4A 4KNVA 3B0UX 3U8PA 1WATA 2L9JA 3EH2A 5JUAA 2YWAA 1Y4CA 2GA0A 2XLHA 2W9YA 3NYLA 2VASA 3ASOC 3U2LA 1VLTA 4HFFB 1HW2A 4IRUA 5BQHA 2CCYA 4JEBA 3G4XA 3LS0A 3L0IA 1YZCA 1L3PA 2GFHA 3DKAA 5BUOA 1OXBA 3NYJA 3ZTZA 4IGGA 1FAPB 2PBEA 2Z15A 3DAGA 4JCHA 3FHDA 1O3UA 1Z7Qc 2XLOA 3HJCA 3RKOF 2XLEA 3ZVRA 2XS1A 1MMNA 1LI5A 1YVIA 2TMVP 2R7SA 2QTVA 4JIOA 4NCQA 5F28E 5CIVA 4LERA 2XRHA 3KL4A 2V26A 4CDAA 1GGQA 4N4WA 3EFOB 5F5HA 1NU9C 3A9CA 3C62A 3JYYA 3NMIA 4MW8A 4G7OF 1EI7A 2L7AA 3Q6MA 3CZ6A 5E33A 2HJMA 5T3WA 2OCCC 4JJFA 3SXZA 2H7OA 1KU2A 1NBBA 1C02A 2HSQA 4JRZA 2QUPA 4ULWA 3U5SA 4FAPB 2V3CC 3BEHA 4E17A 2DYRC 5E3AA 1J8YF 2ZXPA 3AGTA 4XPYA 5B3IA 4Q4ZF 5DS4A 5B3SC 3ABKC 3LEOA 2HSBA 3Q7GA 2XXAB 3GM3A 1MQVA 2KW3C 5AC4A 4FESA 5JVEA 4OD5A 2C04A 1TWGA 4MTOA 4Z9HA 1MNDA 2QNLA 2R02A 3GEEA 1OCOC 1T6QA 3NKEA 2LP4A 4NTAA 1EQ1A 3MLGA 4XEFA 2X0CA 3SYNA 4CS8A 4JURI 4CBEA 3NMJA 1BR1A 1L7CA 4MTFA 2R25A 1CGOA 4A2NB 5AGFA 3RW0A 3EPVA 4H54A 2VCBA 3HNKA 4MS2A 4PR9A 1V54C 4ZLCA 3W8HA 4MVMA 5L0JA 1OQCA 2A69F 1BBHA 4LDRA 1OR2A 1OW8A 5KYYA 2BC5A 5KYWB 2OJQA 1LM3B 4OIOF 4N6CA 3SXMA 1OCZC 2MWQA 3WG7C 1Z23A 3LNRA 1U0BB 3M4BA 5DVWA 3RQFA 3V5XA 4E7ZA 1MMDA 4ER9A 3EGDA 2P0NA 1G4US 5TJ5E 1H9TA 4YL0A 2B0JA 2XLWA 1NSGB 1HW1A 3ECSA 2R03A 4I1OB 5EHHA 4EBJA 4EWCA 1ZW3A 2P1AA 3L34A 3NG1A 4GYTA 4WGYA 1YLMA 2KC3A 3PHF2 1MMAA 1PD0A 4PK4A 4YT5A 3UNGC 2FFHA 4MQ9F 4XQ1A 1V4AA 4KBLA 4XEKA 4YK5A 2YRFA 1O5HA 2PP4A 1YA7O 3HLZA 1E85A 2MYSA 2EILC 1DOVA 3DM5A 2BE5F 2A0BA 1VMAA 3FXHA 3N2ZB 3TK0A 2J9UA 3U3BA 3US6A 3EHNA 2R7XA 1M2VB 4IB4A 4QDLA 3H2UA 4MVZA 4CJOA 1D0YA 1EA8A 2Y3GA 3NKDA 2B0HA 2IOQA 4DBRA 4CIPA 1JAFA 1CPQA 2EPKX 4IAQA 3EZHA 4O6YA 2XL6A 4PJMA 5DQTA 2PX3A 2G62A 2QE9A 1SZIA 2DB4A 2LFDA 1U6HA 2OOCA 3GWNA 4DRHB 2LD6A 1M6TA 3K66A 2KSFA 2BL2A 3JTLO 2ZXRA 4ONSA 4IARA 4I3MA 3LUTB 1Y6DA 1IZMA 2NUPA 1BR4A 5E3CA 3U3FA 3DXJF 4DVZA 3FOOA 4D4XA 4WABA 4J7TA 5A6AA 4JCZA 2PX0A 4LLEA 2EPOA 3N0TA 2NSFA 2MHRA 1T5OA 4DOZA 2KGOA 1H7IA 1TFOB 3SXYA 3WHNA 3IEEA 3DE8A 4YL3A 5CI8A 2WZFA 4LDKA 5FCLA 3GEHA 2OQMA 2Q00A 2JD3A 2ZPAA 2EINC 3NMKA 4WJ0A 5BQGA 3K1HA 1K04A 1JOGA 4ANJA 2J0WA 1HMOA 1JPNA 1XWJA 2KJGA 4IJJA 2J8WA 3S90A 4JW1A 1UG7A 3AG1C 5L0HA 2J9BA 5JP7A 1BR2A 3Q6NA 3H65A 4I1MA 4E0HA 1V74B 1NG1A 4HEAJ 3VAYA 5KYNA 4RD9A 4W8PA 4P9TA 2CDQA 2AP3A 2E87A 2LK4A 2W4MA 5KYXB 2QLAA 5COMA 1JRAA 2YLIA 3C18A 4NC3A 3PDMP 1VTMP 3HNIA 3FAJA 4BJ6C 1C03A 2YLDA 2YZSA 2HZ8A 4A4AA 3TULA 3DJUB 2YL1A 2Q4FA 3JZ0A 1ZZPA 4BJ6A 5JSLA 2I8BA 4JTDB 1CPRA 1MMGA 4J32B 4JC7A 2O9XA 2R9RB 4MVRA 3W8IA 3S9OA 1ZHWA 1AVOB 2EIKC 2NUTA 1S05A 4P6IC 2Y39A 5JT4A 2AWCA 1FFTC 1OCCC 3GEIA 2VH3A 2OKUA 2M4EA 1Q0GA 1QPUA 2KQ9A 1RCPA 1GS9A 2J7PA 2Q9BA 2YEVA 3EGXA 3EGDB 4JKVA 4P9FA 1RMVA 3EG9B 4JVSA 4N06A 3EJNA 3C8GA 4H4KC 5T3TA 3L1MA 4MVUA 2Y3HA 4YN0B 3SP1A 3X2QC 4BPMA 3F46A 5EK0A 3CSKA 2R7VA 1QZXA 4BJ1A 4XPWA 1I4ZA 1F1MA 5B1AC 3ZDLA 2KK1A 1Z5ZA 2R7WA 4OINF 1TWHA 4QI0A 4EHPA 3TOMA 1OXKA 1E2XA 4LLCA 2XS8A 4YT4A 4KNWA 4OIRF 1T9KA 2IXNA 4F4BA 2HJ3A 4DJ9A 4C7OA 1RXQA 5KYUA 1RJ9A 4GEHA 4MW3A 4MVOA 2ZXWC 1C17M 2L6HA 3UMKA 3ZQVA 2HUJA 4U5EE 1B68A 2J9WA 1N1CA 4NQFA 2M64A 3T4RA 3AQCA 3JRTA 3ABMC 3VF0A 1NFOA 2RD9A 4NY3A 1VOMA 3UMIA 1R5ID 3V7OA 1BDJB 1ORSC 1WWPA 4ULVA 5CI9A 3T6BA 4MTGA 4CSAC 2LIGA 1WASA 4DRIB 2H7BA 2IM8A 3RVZA 1H9GA 2FGYA 3I5PA 1AEPA 2L6GA 5COFA 5HSWA 2P61A 1GQAA 1S7ZA 2PNOA 1VK5A 4O6MA 4PFPA 2VCCA 2PF4E 3FMSA 3QVYA 4JTCB 3RQEA 1M2OA 1D0ZA 3R2PA 1JMWA 3FAPB 2ICWG 3ZG1A 2YQYA 1ZHTA 2Q3TA 4C3BA 2WZLA 2W45A 1NLXA 3IQ6A 3C63A 3VM6A 4BEJA 2R7QA 1FFHA 3U8VA 3C7JA 3M15A 2XLMA 2XM4A 1LIHA 2J7PD 3U9MA 4AL0A 3NDBB 2OJED 4DVYP 5L3QA 1SR2A 5B1BC 3AQBA 2YKZA 3EHMA 4OD4A 3C8GD 1KTMA 3JSZA 1D0XA 4Z9IA 5EGYA 1E86A 4XLPF 2HS5A 4XEVA 1V55C 1TWAA 4B6IA 3LEVA 3GODA 3JCUQ 3AOUA 3VRCA 1DOWA 1PCXA 3QW0A
chains in the Genus database with same CATH topology
3H2VA 2IBFA 1H6GA 1SYQA 4EHPA 4IGGA 3H2UA 1RKEB 5L0CA 2LQGA 4K1OA 2B0HA 4DJ9A 1ZVZA 2GWWA 5L0GA 3TJ5A 1T01A 1YDIA 1TR2A 1XWJA 3MYIA 2X0CA 3T6GB 3TJ6A 3S90A 5L0IA 1ZW3A 1RKCA 5FZTA 5L0HA 3RF3A 1L7CA 1U6HA 1QKRA 3VF0A 1ZW2A 2L7AA 5L0FA 1ST6A 5L0DA 1U89A 4PR9A 2GDCA 4W8PA 4ONSA 1RKEA 4P9TA 2HSQA 5L0JA 4E18A 4E17A 1DOWA 1DOVA 3ZDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H2V A;  2IBF A;  1H6G A;  1SYQ A;  4EHP A;  4IGG A;  3H2U A;  1RKE B;  5L0C A;  2LQG A;  4K1O A;  2B0H A;  4DJ9 A;  1ZVZ A;  2GWW A;  5L0G A;  3TJ5 A;  1T01 A;  1YDI A;  1TR2 A;  1XWJ A;  3MYI A;  2X0C A;  3T6G B;  3TJ6 A;  3S90 A;  5L0I A;  1ZW3 A;  1RKC A;  5FZT A;  5L0H A;  3RF3 A;  1L7C A;  1U6H A;  1QKR A;  3VF0 A;  1ZW2 A;  2L7A A;  5L0F A;  1ST6 A;  5L0D A;  1U89 A;  4PR9 A;  2GDC A;  4W8P A;  4ONS A;  1RKE A;  4P9T A;  2HSQ A;  5L0J A;  4E18 A;  4E17 A;  1DOW A;  1DOV A;  3ZDL A; 
#chains in the Genus database with same CATH topology
 4CS9 C;  2CW0 F;  2WVN A;  1SF8 A;  1HE9 A;  2HMQ A;  2LCH A;  5DS5 A;  4FX5 A;  1UFB A;  2ETS A;  3EFO A;  3RIP A;  1ZHZ A;  4CS9 A;  3ITF A;  3CQZ A;  3L8J A;  3RFY A;  1QLE C;  2NG1 A;  4HFK B;  2P6V A;  3R7C A;  4BEM J;  4AE4 A;  1T01 A;  3DM9 B;  4Z9J A;  3RQG A;  4HE8 D;  3SZR A;  5AC5 A;  1ZHX A;  1SMY F;  2P7V A;  3ZC4 A;  5FZT A;  4DRJ B;  5L0I A;  1XZQ A;  1AUE A;  3BRJ A;  2XM0 A;  3Q7L A;  4G78 A;  4J7Y A;  3ZIB A;  4BJ5 C;  2XXA A;  1QSP A;  5L0F A;  3JT1 A;  2XL8 A;  4YWQ A;  2J9V A;  3MFN A;  3W2W A;  2ZXO A;  1BZ4 A;  1JR8 A;  1ZU5 A;  3DJN B;  3LLI A;  4U9D A;  4LAC B;  3CAX A;  1WTY A;  3TOL A;  1D1A A;  2OEV A;  3VYW A;  5HV9 A;  5L3V A;  4ZLD A;  3EGX B;  2J0X A;  3E9V A;  1VB5 A;  3K7D A;  3POV A;  1ZU4 A;  1K05 A;  4PJJ A;  2IYL D;  1Q0K A;  1W2W A;  2WZG A;  4E0I A;  4E7S A;  1LS4 A;  4DXW A;  5JLI A;  1ZVZ A;  2X51 A;  4U5C E;  256B A;  2LSE A;  1R4T A;  3F47 A;  4XTK A;  3HTK C;  3TJ5 A;  1CGM E;  4Q5S F;  3O6X A;  1TR2 A;  1G5Z A;  2J46 A;  3MYI A;  4IWB A;  5A6K A;  3TQO A;  1QQ3 A;  4O79 A;  3AG2 C;  2A6E F;  1VYI A;  1QKR A;  3JSE O;  3M79 A;  3QTH A;  2GAQ A;  3IQT A;  4C3D A;  1YAU O;  2WVO A;  5KYW A;  1E83 A;  3JYH A;  2Y69 C;  2IXM A;  3QMK A;  4GQH A;  3HKK A;  3A11 A;  4KC9 A;  4JZA A;  4N6H A;  3J06 A;  1CGN A;  3K6B A;  2HKV A;  1I4Y A;  3MBG A;  4DBQ A;  1YA9 A;  2EIM C;  1LKX A;  4LDQ A;  3H2V A;  3KYJ A;  2WL8 A;  3DAF A;  4M63 A;  3DD7 A;  2HV7 A;  1IW7 F;  1Z3I X;  1ORY A;  2IXP A;  2R05 A;  1MNE A;  3ATP A;  3WAQ A;  4EIY A;  2NSG A;  4O7G A;  4OIQ F;  4K7B A;  1TFK B;  2YLG A;  5KYY B;  2Q7R A;  1QVX A;  5IY5 C;  3T6G B;  2YL7 A;  2I15 A;  3EZI A;  3AG3 C;  3G50 A;  5COG A;  1HY5 A;  1NZE A;  1WGW A;  1OCR C;  2ASR A;  2CNW A;  4FWV A;  3MX3 A;  3M1C B;  3U9J A;  1ZW2 A;  1PD1 A;  3B9Q A;  3RVY A;  1G4W R;  1M2V A;  2XLV A;  5K0I A;  2CYD A;  2GDC A;  3GOR A;  3GAN A;  4YT8 A;  3UR3 C;  3DMD A;  3OWT A;  3I5Q A;  1A0B A;  1G8X A;  2WVQ A;  3K33 A;  3PMR A;  2J45 A;  2Y3B A;  1Q0M A;  4CX9 A;  2Y3D A;  2IBF A;  2OU6 A;  2XLD A;  4U5B E;  5L0C A;  2UUH A;  4K1O A;  2W4B A;  2YVK A;  4U5G A;  4U9E A;  3KPH A;  4JTA B;  1VYK A;  3LNM B;  3V5Z A;  3RH3 A;  1FTS A;  3CEX A;  3QVZ A;  2KNH A;  1ZYR F;  4X0R A;  1PV3 A;  1A41 A;  2EPN A;  3LLK A;  3MYF A;  3EH1 A;  4PFO A;  3S29 A;  1NU7 D;  4NTF A;  3TD7 A;  1EKY A;  3ZWI A;  1YJG A;  2Q9A A;  3O55 A;  3I4U A;  1LI7 A;  2JX0 A;  4U5H A;  1Z63 A;  2DYS C;  2OG2 A;  3W2V A;  4AE4 B;  1Z6A A;  4JE9 A;  2LFF A;  4YT2 A;  2QY9 A;  1LE2 A;  4U5D E;  2EPM X;  1RKE A;  5A6B A;  3K1I C;  3S0X A;  1OW7 A;  4AX2 A;  4CSA A;  5A6J A;  4C3E A;  4EBB A;  3B0P A;  2AVK A;  3K1I A;  5DQZ A;  2ZD9 A;  3IPM O;  3AGU A;  4CDV A;  1SYQ A;  2YL0 A;  4G7H F;  1JPJ A;  2EPL X;  3KKB A;  4OIP F;  1KNY A;  2R7O A;  2NUP B;  4CS8 C;  3FDQ A;  3E70 C;  3B29 A;  2NPU A;  3DE9 A;  4YJW A;  1M56 C;  4IAO A;  1FNT c;  2A68 F;  1FR0 A;  3SXK A;  5JRA A;  5KYX A;  1TQG A;  5DS6 A;  1OW6 A;  1ZHY A;  2CNW D;  3LJB A;  3LS1 A;  2IXO A;  4WGZ A;  3X1O A;  4AK9 A;  3B0V C;  3KH2 A;  3L8I A;  4EBK A;  3C8Z A;  2KYH A;  3PCV A;  1U89 A;  2L6F A;  1E84 A;  3NRH A;  2UUI A;  3HNJ A;  1LVK A;  4PAC A;  2D4U A;  4G0H A;  1LE4 A;  3UGP A;  2G3K A;  1M57 C;  3IQC A;  4XLN F;  4W8K A;  2EIJ C;  3O10 A;  4L6R A;  3RYL A;  3T9O A;  3HNL A;  1TKN A;  2DI3 A;  2FAP B;  4CDY A;  1APC A;  3NYM A;  1OKK A;  3QW1 A;  2HMZ A;  1K40 A;  3GM1 A;  4MVS A;  2R7R A;  2PFD A;  3W4Y A;  1WN0 A;  3EG9 A;  5F5F A;  3ZQY A;  2L81 A;  1YDI A;  3DWW A;  1FMW A;  2AU5 A;  1OR3 A;  2H7V C;  3B71 A;  1T6I A;  3WOD F;  3RF3 A;  4J30 B;  4BJT A;  4D4N A;  2VC9 A;  5BQI A;  3SNH A;  4CS7 A;  5A6B D;  2YL3 A;  1GM5 A;  3LES A;  3LAY A;  2NUT B;  4NTB A;  4RDA A;  1WOL A;  5DLJ A;  1LS1 A;  4U5F E;  5D91 A;  4E18 A;  4BJ5 A;  1A7D A;  2D5R B;  2JPU A;  3M4C A;  4XWJ A;  1YAR O;  3SEO A;  5E2Q A;  3ZSU A;  1NFN A;  1J8M F;  2DGJ A;  2OEX A;  3DZA A;  4R32 A;  3QZC A;  3UGO A;  2VCA A;  4KI2 A;  2WB7 A;  4UDV A;  3C8G B;  5T1D B;  4EUK B;  1ORJ A;  2YHS A;  3ZTM A;  2A1D D;  1D1C A;  4O6N A;  3UMH A;  4BG0 A;  1T6U A;  2F22 A;  3IHU A;  3GM2 A;  3OA1 A;  3JRM O;  4JEA A;  2H8A A;  5L0G A;  1Q0F A;  2Q9C A;  1FMV A;  2A0U A;  1I5N A;  3GWL A;  4EKW A;  4MVQ A;  1VLS A;  2RSE B;  3S27 A;  4Q7C A;  3TJ6 A;  1RKC A;  2A6H F;  1A7V A;  2HV6 A;  3FVY A;  4QI2 A;  3U2M A;  4XPX A;  4C7O B;  2HFI A;  4YL1 A;  5KYU B;  3S84 A;  1YYX A;  1RJ9 B;  2AWY A;  3O39 A;  4I44 A;  1ST6 A;  4JJG A;  1O87 A;  5L0D A;  2R7U A;  5GPG B;  2XSE A;  1LPE A;  3FOP A;  3G4Z A;  1HMD A;  3KMI A;  3OEO A;  3EQL F;  2VB6 A;  1A7E A;  4K0D A;  3S28 A;  4AL1 A;  1H6G A;  3N24 A;  1OKK D;  1TWC A;  1YZA A;  3AG4 C;  4RBN A;  4G7Z F;  1RKE B;  4CJG A;  2LQG A;  5A69 A;  3U0C A;  1Q0D A;  1XZP A;  3ABL C;  4PJL A;  4PJN A;  2GWW A;  2CGE A;  3IQ5 A;  5D92 A;  4CIH A;  5JS5 A;  3AJM A;  2C03 A;  4MND A;  3T6J A;  2R7T A;  3DI5 A;  3V5Y A;  2G3V A;  3KYI A;  1HE1 A;  1D1B A;  1YYJ A;  3ASN C;  2XL4 A;  4KNV A;  3B0U X;  3U8P A;  1WAT A;  2L9J A;  3EH2 A;  5JUA A;  2YWA A;  1Y4C A;  2GA0 A;  2XLH A;  2W9Y A;  3NYL A;  2VAS A;  3ASO C;  3U2L A;  1VLT A;  4HFF B;  1HW2 A;  4IRU A;  5BQH A;  2CCY A;  4JEB A;  3G4X A;  3LS0 A;  3L0I A;  1YZC A;  1L3P A;  2GFH A;  3DKA A;  5BUO A;  1OXB A;  3NYJ A;  3ZTZ A;  4IGG A;  1FAP B;  2PBE A;  2Z15 A;  3DAG A;  4JCH A;  3FHD A;  1O3U A;  1Z7Q c;  2XLO A;  3HJC A;  3RKO F;  2XLE A;  3ZVR A;  2XS1 A;  1MMN A;  1LI5 A;  1YVI A;  2TMV P;  2R7S A;  2QTV A;  4JIO A;  4NCQ A;  5F28 E;  5CIV A;  4LER A;  2XRH A;  3KL4 A;  2V26 A;  4CDA A;  1GGQ A;  4N4W A;  3EFO B;  5F5H A;  1NU9 C;  3A9C A;  3C62 A;  3JYY A;  3NMI A;  4MW8 A;  4G7O F;  1EI7 A;  2L7A A;  3Q6M A;  3CZ6 A;  5E33 A;  2HJM A;  5T3W A;  2OCC C;  4JJF A;  3SXZ A;  2H7O A;  1KU2 A;  1NBB A;  1C02 A;  2HSQ A;  4JRZ A;  2QUP A;  4ULW A;  3U5S A;  4FAP B;  2V3C C;  3BEH A;  4E17 A;  2DYR C;  5E3A A;  1J8Y F;  2ZXP A;  3AGT A;  4XPY A;  5B3I A;  4Q4Z F;  5DS4 A;  5B3S C;  3ABK C;  3LEO A;  2HSB A;  3Q7G A;  2XXA B;  3GM3 A;  1MQV A;  2KW3 C;  5AC4 A;  4FES A;  5JVE A;  4OD5 A;  2C04 A;  1TWG A;  4MTO A;  4Z9H A;  1MND A;  2QNL A;  2R02 A;  3GEE A;  1OCO C;  1T6Q A;  3NKE A;  2LP4 A;  4NTA A;  1EQ1 A;  3MLG A;  4XEF A;  2X0C A;  3SYN A;  4CS8 A;  4JUR I;  4CBE A;  3NMJ A;  1BR1 A;  1L7C A;  4MTF A;  2R25 A;  1CGO A;  4A2N B;  5AGF A;  3RW0 A;  3EPV A;  4H54 A;  2VCB A;  3HNK A;  4MS2 A;  4PR9 A;  1V54 C;  4ZLC A;  3W8H A;  4MVM A;  5L0J A;  1OQC A;  2A69 F;  1BBH A;  4LDR A;  1OR2 A;  1OW8 A;  5KYY A;  2BC5 A;  5KYW B;  2OJQ A;  1LM3 B;  4OIO F;  4N6C A;  3SXM A;  1OCZ C;  2MWQ A;  3WG7 C;  1Z23 A;  3LNR A;  1U0B B;  3M4B A;  5DVW A;  3RQF A;  3V5X A;  4E7Z A;  1MMD A;  4ER9 A;  3EGD A;  2P0N A;  1G4U S;  5TJ5 E;  1H9T A;  4YL0 A;  2B0J A;  2XLW A;  1NSG B;  1HW1 A;  3ECS A;  2R03 A;  4I1O B;  5EHH A;  4EBJ A;  4EWC A;  1ZW3 A;  2P1A A;  3L34 A;  3NG1 A;  4GYT A;  4WGY A;  1YLM A;  2KC3 A;  3PHF 2;  1MMA A;  1PD0 A;  4PK4 A;  4YT5 A;  3UNG C;  2FFH A;  4MQ9 F;  4XQ1 A;  1V4A A;  4KBL A;  4XEK A;  4YK5 A;  2YRF A;  1O5H A;  2PP4 A;  1YA7 O;  3HLZ A;  1E85 A;  2MYS A;  2EIL C;  1DOV A;  3DM5 A;  2BE5 F;  2A0B A;  1VMA A;  3FXH A;  3N2Z B;  3TK0 A;  2J9U A;  3U3B A;  3US6 A;  3EHN A;  2R7X A;  1M2V B;  4IB4 A;  4QDL A;  3H2U A;  4MVZ A;  4CJO A;  1D0Y A;  1EA8 A;  2Y3G A;  3NKD A;  2B0H A;  2IOQ A;  4DBR A;  4CIP A;  1JAF A;  1CPQ A;  2EPK X;  4IAQ A;  3EZH A;  4O6Y A;  2XL6 A;  4PJM A;  5DQT A;  2PX3 A;  2G62 A;  2QE9 A;  1SZI A;  2DB4 A;  2LFD A;  1U6H A;  2OOC A;  3GWN A;  4DRH B;  2LD6 A;  1M6T A;  3K66 A;  2KSF A;  2BL2 A;  3JTL O;  2ZXR A;  4ONS A;  4IAR A;  4I3M A;  3LUT B;  1Y6D A;  1IZM A;  2NUP A;  1BR4 A;  5E3C A;  3U3F A;  3DXJ F;  4DVZ A;  3FOO A;  4D4X A;  4WAB A;  4J7T A;  5A6A A;  4JCZ A;  2PX0 A;  4LLE A;  2EPO A;  3N0T A;  2NSF A;  2MHR A;  1T5O A;  4DOZ A;  2KGO A;  1H7I A;  1TFO B;  3SXY A;  3WHN A;  3IEE A;  3DE8 A;  4YL3 A;  5CI8 A;  2WZF A;  4LDK A;  5FCL A;  3GEH A;  2OQM A;  2Q00 A;  2JD3 A;  2ZPA A;  2EIN C;  3NMK A;  4WJ0 A;  5BQG A;  3K1H A;  1K04 A;  1JOG A;  4ANJ A;  2J0W A;  1HMO A;  1JPN A;  1XWJ A;  2KJG A;  4IJJ A;  2J8W A;  3S90 A;  4JW1 A;  1UG7 A;  3AG1 C;  5L0H A;  2J9B A;  5JP7 A;  1BR2 A;  3Q6N A;  3H65 A;  4I1M A;  4E0H A;  1V74 B;  1NG1 A;  4HEA J;  3VAY A;  5KYN A;  4RD9 A;  4W8P A;  4P9T A;  2CDQ A;  2AP3 A;  2E87 A;  2LK4 A;  2W4M A;  5KYX B;  2QLA A;  5COM A;  1JRA A;  2YLI A;  3C18 A;  4NC3 A;  3PDM P;  1VTM P;  3HNI A;  3FAJ A;  4BJ6 C;  1C03 A;  2YLD A;  2YZS A;  2HZ8 A;  4A4A A;  3TUL A;  3DJU B;  2YL1 A;  2Q4F A;  3JZ0 A;  1ZZP A;  4BJ6 A;  5JSL A;  2I8B A;  4JTD B;  1CPR A;  1MMG A;  4J32 B;  4JC7 A;  2O9X A;  2R9R B;  4MVR A;  3W8I A;  3S9O A;  1ZHW A;  1AVO B;  2EIK C;  2NUT A;  1S05 A;  4P6I C;  2Y39 A;  5JT4 A;  2AWC A;  1FFT C;  1OCC C;  3GEI A;  2VH3 A;  2OKU A;  2M4E A;  1Q0G A;  1QPU A;  2KQ9 A;  1RCP A;  1GS9 A;  2J7P A;  2Q9B A;  2YEV A;  3EGX A;  3EGD B;  4JKV A;  4P9F A;  1RMV A;  3EG9 B;  4JVS A;  4N06 A;  3EJN A;  3C8G A;  4H4K C;  5T3T A;  3L1M A;  4MVU A;  2Y3H A;  4YN0 B;  3SP1 A;  3X2Q C;  4BPM A;  3F46 A;  5EK0 A;  3CSK A;  2R7V A;  1QZX A;  4BJ1 A;  4XPW A;  1I4Z A;  1F1M A;  5B1A C;  3ZDL A;  2KK1 A;  1Z5Z A;  2R7W A;  4OIN F;  1TWH A;  4QI0 A;  4EHP A;  3TOM A;  1OXK A;  1E2X A;  4LLC A;  2XS8 A;  4YT4 A;  4KNW A;  4OIR F;  1T9K A;  2IXN A;  4F4B A;  2HJ3 A;  4DJ9 A;  4C7O A;  1RXQ A;  5KYU A;  1RJ9 A;  4GEH A;  4MW3 A;  4MVO A;  2ZXW C;  1C17 M;  2L6H A;  3UMK A;  3ZQV A;  2HUJ A;  4U5E E;  1B68 A;  2J9W A;  1N1C A;  4NQF A;  2M64 A;  3T4R A;  3AQC A;  3JRT A;  3ABM C;  3VF0 A;  1NFO A;  2RD9 A;  4NY3 A;  1VOM A;  3UMI A;  1R5I D;  3V7O A;  1BDJ B;  1ORS C;  1WWP A;  4ULV A;  5CI9 A;  3T6B A;  4MTG A;  4CSA C;  2LIG A;  1WAS A;  4DRI B;  2H7B A;  2IM8 A;  3RVZ A;  1H9G A;  2FGY A;  3I5P A;  1AEP A;  2L6G A;  5COF A;  5HSW A;  2P61 A;  1GQA A;  1S7Z A;  2PNO A;  1VK5 A;  4O6M A;  4PFP A;  2VCC A;  2PF4 E;  3FMS A;  3QVY A;  4JTC B;  3RQE A;  1M2O A;  1D0Z A;  3R2P A;  1JMW A;  3FAP B;  2ICW G;  3ZG1 A;  2YQY A;  1ZHT A;  2Q3T A;  4C3B A;  2WZL A;  2W45 A;  1NLX A;  3IQ6 A;  3C63 A;  3VM6 A;  4BEJ A;  2R7Q A;  1FFH A;  3U8V A;  3C7J A;  3M15 A;  2XLM A;  2XM4 A;  1LIH A;  2J7P D;  3U9M A;  4AL0 A;  3NDB B;  2OJE D;  4DVY P;  5L3Q A;  1SR2 A;  5B1B C;  3AQB A;  2YKZ A;  3EHM A;  4OD4 A;  3C8G D;  1KTM A;  3JSZ A;  1D0X A;  4Z9I A;  5EGY A;  1E86 A;  4XLP F;  2HS5 A;  4XEV A;  1V55 C;  1TWA A;  4B6I A;  3LEV A;  3GOD A;  3JCU Q;  3AOU A;  3VRC A;  1DOW A;  1PCX A;  3QW0 A; 
#chains in the Genus database with same CATH homology
 3H2V A;  2IBF A;  1H6G A;  1SYQ A;  4EHP A;  4IGG A;  3H2U A;  1RKE B;  5L0C A;  2LQG A;  4K1O A;  2B0H A;  4DJ9 A;  1ZVZ A;  2GWW A;  5L0G A;  3TJ5 A;  1T01 A;  1YDI A;  1TR2 A;  1XWJ A;  3MYI A;  2X0C A;  3T6G B;  3TJ6 A;  3S90 A;  5L0I A;  1ZW3 A;  1RKC A;  5FZT A;  5L0H A;  3RF3 A;  1L7C A;  1U6H A;  1QKR A;  3VF0 A;  1ZW2 A;  2L7A A;  5L0F A;  1ST6 A;  5L0D A;  1U89 A;  4PR9 A;  2GDC A;  4W8P A;  4ONS A;  1RKE A;  4P9T A;  2HSQ A;  5L0J A;  4E18 A;  4E17 A;  1DOW A;  1DOV A;  3ZDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...