1F1MA

Crystal structure of outer surface protein c (ospc)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
162
structure length
162
Chain Sequence
b'PNLTEISKKITESNAVVLAVKEVETLLTSIDELAKAIGKKIKSDVSLDNEADHNGSLMSGAYLISTLITKKISAIKDSGELKAEIEKAKKCSEEFTAKLKGEHTDLGKEGVTDDNAKKAILKTNNDKTKGADELEKLFESVKNLSKAAKEMLTNSVKELTSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER SURFACE PROTEIN C
publication title Crystal structure of outer surface protein C (OspC) from the Lyme disease spirochete, Borrelia burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Immune system
total genus 65
structure length 162
sequence length 162
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01441 Lipoprotein_6 Lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.240 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Lipoprotein, type 6 1f1mA00
1F1MA 2GA0A 1G5ZA 1GGQA 1YJGA
chains in the Genus database with same CATH superfamily
1Z3IX 2CNWA 2WVNA 5DLJA 2V26A 4B6IA 3NDBB 3UMIA 2XM4A 1Z6AA 3S29A 3DJUB 4G7ZF 4PJLA 5COFA 1JAFA 4IJJA 3NKEA 1YYXA 2ZPAA 4GYTA 4KBLA 5FCLA 2OKUA 3L8IA 2LK4A 5EGYA 1ZHTA 1NZEA 1XZPA 1H6GA 3ECSA 4MTOA 4MTFA 3OWTA 2IXMA 1V55C 1U0BB 1K05A 2B0HA 2JX0A 3NG1A 2P6VA 1YA7O 5T3WA 3RW0A 1DOVA 2XL8A 5DQZA 4OD5A 1CPQA 2QLAA 2FGYA 4DVYP 3JYHA 4I3MA 4ULWA 1YYJA 3EHMA 1LKXA 4EBJA 2FAPB 3DE9A 3US6A 1YLMA 1A7DA 2J9VA 4YWQA 3IHUA 2G62A 3FAJA 5GPGB 1PD1A 2MYSA 4JTDB 2LP4A 5KYWA 2R9RB 1S7ZA 1LIHA 3L1MA 3N24A 4U5DE 3IQCA 1WN0A 5BQHA 2IXOA 4PR9A 3EH1A 2G3KA 2GAQA 3DE8A 2BL2A 2IM8A 2KK1A 3RQGA 3G4ZA 4YN0B 4BG0A 4YJWA 4L6RA 3RYLA 1OKKD 1WTYA 2GDCA 2KSFA 2HMZA 1I4YA 3RF3A 3EZHA 3L0IA 4K1OA 3JTLO 4AE4B 5A6AA 4BJ5A 2HSQA 1IZMA 1ZYRF 2H8AA 3H65A 4F4BA 5IY5C 2H7VC 2LD6A 3I5QA 5DVWA 1Y6DA 4E17A 1VOMA 3HNLA 1MMNA 1QZXA 5B3IA 2J8WA 3LS1A 3EHNA 1WWPA 3B9QA 3OA1A 1LE2A 3PCVA 1H7IA 5B1AC 2M4EA 4CS7A 4LDQA 3AJMA 4Q4ZF 2OEXA 3LNRA 3NMIA 4MNDA 2Y39A 1WOLA 2ICWG 2NG1A 4Z9JA 3ZDLA 1BR4A 2YVKA 2NUPA 3C62A 3K66A 5L0JA 5A69A 5HSWA 1D0YA 1M56C 2A6HF 3GEEA 2J0XA 1VB5A 1Z63A 3B0PA 4JKVA 2J45A 2EIKC 4LDRA 1TFKB 4BEMJ 1L3PA 1TQGA 1TFOB 2LFDA 2UUHA 3DMDA 2AWYA 3FHDA 2WVQA 1OCOC 5E3CA 4PK4A 3ASOC 2VCCA 1HY5A 4H54A 3AGUA 3ITFA 4XEVA 3IEEA 2YLDA 1CGOA 2HJMA 2NSGA 2Y3HA 4JTCB 5A6JA 5TJ5E 3S28A 1CGNA 3IQ5A 3W8HA 4WABA 1T5OA 1HE1A 2XLHA 4ONSA 3VRCA 3FXHA 4O6MA 2AP3A 4BJ6A 4E0IA 4OIQF 4I1MA 1M6TA 3KH2A 1BBHA 3WG7C 2J0WA 3NKDA 2B0JA 2WZGA 2X51A 3K1IA 1WATA 3LAYA 4JW1A 4GEHA 1LM3B 3SXZA 1YAUO 3EGDB 2PBEA 4JCHA 2EINC 1OR3A 2J7PD 2BC5A 4MVZA 1EQ1A 1ZHYA 4NTBA 2L6GA 1PV3A 4CS9C 4DRJB 2XL6A 4XPYA 5L0GA 2L7AA 2GA0A 3EGXB 2CCYA 3SXKA 2YQYA 2H7OA 3L8JA 2MHRA 2Y3GA 3MLGA 4OIRF 2XLEA 4DOZA 3B0VC 3UGOA 1H9TA 1LE4A 1K40A 1OKKA 3M4CA 2XSEA 1E86A 2L9JA 3TJ6A 1E83A 1MNDA 2WB7A 1G4US 1O87A 1SZIA 3TOLA 2Q00A 3FMSA 3FOOA 1FFTC 4Z9HA 4CS8C 1ZU5A 2OG2A 2DYSC 5AC5A 3RVZA 1MNEA 1R5ID 3E9VA 1RKEA 3W8IA 1TWHA 4D4NA 5L0HA 5F5FA 3W2VA 5L0FA 4KC9A 3KL4A 1AEPA 2Q3TA 3DWWA 1E85A 4C7OB 2VCAA 2RSEB 4EIYA 4CSAA 5DS5A 256BA 5AGFA 1JRAA 1OXBA 2MWQA 4W8KA 4J30B 1D0ZA 3LLKA 2YL3A 3SNHA 1ZZPA 3U3FA 3TULA 1Q0GA 2D4UA 3S0XA 2YL7A 2Q7RA 3ASNC 1YZCA 4AE4A 3DD7A 1RXQA 2NUTB 3C63A 5L0CA 2XLMA 1GM5A 2HSBA 5DS4A 3LS0A 3S90A 3F46A 1WGWA 3I4UA 4JC7A 3GM1A 4MVQA 2QTVA 2W45A 3ABKC 3W2WA 3WAQA 5JVEA 4LLCA 4U9EA 3RQFA 3ZQVA 3V7OA 1VYIA 3ZIBA 3A9CA 2CDQA 2R7QA 1ZU4A 3GWLA 1B68A 2PX0A 3NMJA 4QDLA 5DS6A 1C17M 3T6BA 3UMHA 3POVA 3VF0A 4C3BA 1JPNA 3CAXA 4YT5A 1LVKA 2OU6A 3EH2A 4AL1A 3ZWIA 2DYRC 1EKYA 1ZVZA 5COGA 1BDJB 1O5HA 2ASRA 2A68F 2J9BA 3DI5A 2Q9CA 2R03A 2HV6A 3IPMO 5KYYB 2HS5A 1RMVA 1UG7A 4WGYA 3TOMA 3M79A 1LI5A 1V4AA 3A11A 1GGQA 3JSEO 2ETSA 1GS9A 1TR2A 2XLDA 3H2UA 4K0DA 4U5FE 4D4XA 4JCZA 2J7PA 2WZLA 4EBKA 1T9KA 3NMKA 4WJ0A 4CJOA 4CDAA 5JP7A 1WASA 3VM6A 3ZG1A 2EPOA 3X1OA 3O6XA 3C8GB 4JVSA 3Q7LA 1NFNA 2YL1A 5D92A 2LQGA 2XRHA 2R7SA 2WZFA 2LCHA 3GWNA 2XM0A 1FMWA 4MVSA 1C03A 4XEFA 5BUOA 1A7EA 3FAPB 4MW3A 4XLNF 2HV7A 3AQBA 3JRTA 4C3DA 2A69F 1VLTA 5E33A 4AK9A 1Q0FA 2EPLX 3OEOA 3R2PA 2EPMX 3F47A 4H4KC 4MW8A 4DXWA 4I44A 4EBBA 3EGXA 1LI7A 1U6HA 2HFIA 2EPKX 2YLGA 1FTSA 4IAOA 4RBNA 4MQ9F 4XPXA 1CPRA 1OQCA 3K6BA 1T01A 3U2MA 3UNGC 3GM2A 1A0BA 1Q0MA 2P7VA 3EFOA 3LEOA 4FESA 4OIOF 2X0CA 1QVXA 4E18A 3JSZA 2XS1A 2R7WA 3LLIA 3DAFA 1TKNA 3NRHA 4A4AA 2L6FA 1OCZC 2L6HA 2R05A 2UUIA 1LPEA 2YHSA 3GODA 2OEVA 4N6HA 2C03A 2Y3BA 2AWCA 4NTAA 4C7OA 4OINF 1T6QA 3FOPA 1PD0A 3LESA 5KYUB 1NU7D 1O3UA 3HKKA 1GQAA 3MYFA 2M64A 5FZTA 4NTFA 2BE5F 3GORA 3HNJA 2XXAA 3U5SA 3WHNA 3L34A 5K0IA 3KKBA 4BPMA 2GWWA 2YL0A 4IWBA 1TWGA 5F28E 4EHPA 1CGME 3UMKA 5B3SC 4CDVA 4XTKA 1SF8A 3K1HA 2QNLA 4JRZA 2WVOA 2QUPA 4X0RA 5JUAA 2L81A 4OD4A 3TJ5A 4KI2A 5JT4A 1NSGB 2GFHA 3M1CB 2Y69C 1E2XA 1L7CA 3RH3A 1BZ4A 3S84A 3HLZA 5JS5A 2DB4A 3ZVRA 2EIJC 3HNKA 3JCUQ 3RFYA 3HNIA 5KYNA 2Z15A 4MS2A 3SXYA 3FVYA 2HMQA 1M57C 3AG1C 3QW0A 4EUKB 1M2OA 5KYYA 1V74B 1C02A 1NLXA 1G4WR 2AVKA 4JZAA 5B1BC 4YK5A 4IAQA 2V3CC 1HW1A 1H9GA 2PF4E 4J32B 3QMKA 2OCCC 4N6CA 4U9DA 1SYQA 1D0XA 5JSLA 3DM5A 2IXPA 3CEXA 1HE9A 4CS9A 5KYWB 2R02A 4N06A 4ZLCA 4FX5A 1OW6A 5A6KA 4BEJA 3MYIA 4DRHB 3RIPA 4CDYA 1OCRC 4PJJA 2RD9A 2Q9BA 4U5CE 4LACB 3DXJF 2VH3A 2OJED 4CS8A 3E70C 3M15A 4MVMA 4MVUA 3FDQA 4DJ9A 1TWAA 3V5ZA 2FFHA 2R25A 3NYMA 3X2QC 1YARO 2J9WA 2YEVA 3C18A 1IW7F 2ZD9A 3NYLA 4E7SA 1QKRA 1K04A 4U5EE 2I15A 4XPWA 2NSFA 5CIVA 1FR0A 4CBEA 4NCQA 4Q7CA 1M2VB 3PHF2 1LS1A 4P9TA 4QI2A 3QVYA 5EHHA 1XZQA 2I8BA 1A7VA 2R7OA 4U5GA 4M63A 3EG9B 3U3BA 2J9UA 2R7UA 5AC4A 3MBGA 2HZ8A 1JMWA 1D1AA 5T1DB 4G7OF 5JRAA 4Z9IA 1ZHXA 2P61A 1FFHA 1A41A 3GANA 3JZ0A 3M4BA 2P1AA 5KYUA 5L0IA 4CX9A 4J7TA 2KQ9A 2G3VA 4RDAA 5CI8A 1E84A 4JURI 3T6JA 5CI9A 1HMOA 4LDKA 4YL0A 3T9OA 3HTKC 3B0UX 2XL4A 3EPVA 4P6IC 1V54C 2YLIA 3TQOA 2R7RA 4JJFA 1U89A 2EIMC 2P0NA 2KNHA 1AVOB 1OW8A 3V5XA 1HW2A 3CZ6A 1JPJA 4NC3A 3JYYA 2KC3A 1BR2A 5L3QA 3RQEA 4P9FA 1OCCC 1YDIA 4R32A 3WODF 1RJ9B 4FAPB 3K7DA 3C8ZA 1OXKA 2WL8A 1R4TA 4ZLDA 2Y3DA 4E7ZA 4DBQA 4N4WA 3TK0A 4WGZA 3AG3C 3AG2C 2D5RB 1QSPA 3O55A 4AL0A 5KYXB 4OIPF 1NU9C 3EJNA 4CIPA 1KTMA 2CW0F 3ZTZA 1MMAA 2YRFA 4ANJA 3Q6MA 3EGDA 2KW3C 4DBRA 1YZAA 4JTAB 4O6YA 2HUJA 3ATPA 1ZW3A 3R7CA 1JR8A 2A6EF 1MMDA 2NPUA 3H2VA 4LLEA 3T6GB 3U9JA 3MFNA 3QZCA 1DOWA 2OOCA 2EILC 3C8GD 5A6BD 3LNMB 2VB6A 4I1OB 4IARA 5COMA 3RKOF 1RKEB 1NBBA 1J8MF 2HKVA 1VYKA 4YL3A 2E87A 2PNOA 2VC9A 2C04A 3G50A 3GEHA 4BJ5C 3VAYA 4GQHA 4PJMA 1VTMP 3S9OA 2OJQA 2ZXOA 3HJCA 4HFKB 1QPUA 1Z23A 2JD3A 3GM3A 2PX3A 4IB4A 4C3EA 3AG4C 3CSKA 3JRMO 2AU5A 4CIHA 1FAPB 3V5YA 1UFBA 1N1CA 4G0HA 1RCPA 3DAGA 1YVIA 3JT1A 5D91A 2A1DD 2KYHA 3Q7GA 1ORSC 2A0BA 1ORJA 2IXNA 3QW1A 1JOGA 3N2ZB 4O7GA 4PFPA 4PFOA 3W4YA 4XWJA 5T3TA 3SEOA 1G8XA 1I5NA 1Y4CA 4MVOA 2VASA 4EKWA 1J8YF 3LUTB 1SMYF 4LERA 2NUTA 2O9XA 1I4ZA 3G4XA 3U8PA 4YT2A 5L0DA 3KPHA 3Q6NA 3PMRA 3S27A 1Q0DA 5L3VA 2LFFA 2IYLD 4NY3A 4CJGA 4JEAA 4E0HA 1M2VA 1VMAA 4KNVA 2LSEA 2ZXPA 4XQ1A 3B71A 2Q4FA 3EG9A 1NFOA 1YJGA 4MVRA 4HEAJ 3LEVA 2DI3A 4O6NA 4YL1A 5HV9A 4J7YA 4G78A 1SR2A 3KYIA 3U9MA 4O79A 4BJTA 3PDMP 5JLIA 3O39A 1TWCA 2CYDA 4XEKA 3ZSUA 4BJ6C 4Q5SF 1Z7Qc 1S05A 2KGOA 1VK5A 3U2LA 1BR1A 1D1CA 2CNWD 2W4BA 3ABLC 3KYJA 4HFFB 1W2WA 3K1IC 5E2QA 5BQGA 5F5HA 4NQFA 3QVZA 3DJNB 2LIGA 4FWVA 3EQLF 3B29A 4BJ1A 4PACA 3AOUA 4YT8A 5BQIA 3U8VA 1F1MA 1RJ9A 3C8GA 2IOQA 4HE8D 1EA8A 1KU2A 2J46A 3DZAA 5A6BA 2YKZA 3LJBA 3ZC4A 1YA9A 1VLSA 3BRJA 4U5HA 3SYNA 2ZXRA 5EK0A 3ZQYA 3I5PA 3UR3C 5KYXA 1HMDA 2F22A 3RVYA 2QY9A 1ZW2A 3MX3A 3SZRA 1MMGA 2W4MA 3AQCA 2H7BA 3T4RA 4XLPF 2IBFA 2TMVP 2EPNA 1APCA 4EWCA 3N0TA 4ULVA 2DGJA 3TD7A 4IRUA 1D1BA 1KNYA 4ER9A 4RD9A 2R7XA 2A0UA 2QE9A 4JJGA 1FMVA 4CSAC 3EFOB 1FNTc 2CGEA 3GEIA 2VCBA 3NYJA 2XLVA 1QQ3A 1G5ZA 2XLWA 5E3AA 1ZHWA 2JPUA 2NUPB 1ST6A 1MQVA 3J06A 4G7HF 3ABMC 3UGPA 4DRIB 1AUEA 4KNWA 4DVZA 4JE9A 2R7TA 1EI7A 4K7BA 2PP4A 2YZSA 3U0CA 1OR2A 1LS4A 1ORYA 1Q0KA 1NG1A 3CQZA 3IQ6A 2PFDA 4U5BE 3ZTMA 4YT4A 2XXAB 2R7VA 2Q9AA 2W9YA 4QI0A 1Z5ZA 2XLOA 4AX2A 4IGGA 2KJGA 2OQMA 3O10A 4MTGA 4A2NB 1OW7A 3SP1A 3C7JA 2YWAA 1PCXA 2HJ3A 4JIOA 3AGTA 3VYWA 3EZIA 5DQTA 3K33A 4UDVA 3DM9B 1XWJA 3KMIA 3SXMA 4W8PA 1RKCA 1ZHZA 1T6IA 4JEBA 1QLEC 3IQTA 2XS8A 3BEHA 3QTHA 2ZXWC 4PJNA 1T6UA 3DKAA
chains in the Genus database with same CATH topology
1F1MA 2GA0A 1G5ZA 1GGQA 1YJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F1M A;  2GA0 A;  1G5Z A;  1GGQ A;  1YJG A; 
#chains in the Genus database with same CATH topology
 1Z3I X;  2CNW A;  2WVN A;  5DLJ A;  2V26 A;  4B6I A;  3NDB B;  3UMI A;  2XM4 A;  1Z6A A;  3S29 A;  3DJU B;  4G7Z F;  4PJL A;  5COF A;  1JAF A;  4IJJ A;  3NKE A;  1YYX A;  2ZPA A;  4GYT A;  4KBL A;  5FCL A;  2OKU A;  3L8I A;  2LK4 A;  5EGY A;  1ZHT A;  1NZE A;  1XZP A;  1H6G A;  3ECS A;  4MTO A;  4MTF A;  3OWT A;  2IXM A;  1V55 C;  1U0B B;  1K05 A;  2B0H A;  2JX0 A;  3NG1 A;  2P6V A;  1YA7 O;  5T3W A;  3RW0 A;  1DOV A;  2XL8 A;  5DQZ A;  4OD5 A;  1CPQ A;  2QLA A;  2FGY A;  4DVY P;  3JYH A;  4I3M A;  4ULW A;  1YYJ A;  3EHM A;  1LKX A;  4EBJ A;  2FAP B;  3DE9 A;  3US6 A;  1YLM A;  1A7D A;  2J9V A;  4YWQ A;  3IHU A;  2G62 A;  3FAJ A;  5GPG B;  1PD1 A;  2MYS A;  4JTD B;  2LP4 A;  5KYW A;  2R9R B;  1S7Z A;  1LIH A;  3L1M A;  3N24 A;  4U5D E;  3IQC A;  1WN0 A;  5BQH A;  2IXO A;  4PR9 A;  3EH1 A;  2G3K A;  2GAQ A;  3DE8 A;  2BL2 A;  2IM8 A;  2KK1 A;  3RQG A;  3G4Z A;  4YN0 B;  4BG0 A;  4YJW A;  4L6R A;  3RYL A;  1OKK D;  1WTY A;  2GDC A;  2KSF A;  2HMZ A;  1I4Y A;  3RF3 A;  3EZH A;  3L0I A;  4K1O A;  3JTL O;  4AE4 B;  5A6A A;  4BJ5 A;  2HSQ A;  1IZM A;  1ZYR F;  2H8A A;  3H65 A;  4F4B A;  5IY5 C;  2H7V C;  2LD6 A;  3I5Q A;  5DVW A;  1Y6D A;  4E17 A;  1VOM A;  3HNL A;  1MMN A;  1QZX A;  5B3I A;  2J8W A;  3LS1 A;  3EHN A;  1WWP A;  3B9Q A;  3OA1 A;  1LE2 A;  3PCV A;  1H7I A;  5B1A C;  2M4E A;  4CS7 A;  4LDQ A;  3AJM A;  4Q4Z F;  2OEX A;  3LNR A;  3NMI A;  4MND A;  2Y39 A;  1WOL A;  2ICW G;  2NG1 A;  4Z9J A;  3ZDL A;  1BR4 A;  2YVK A;  2NUP A;  3C62 A;  3K66 A;  5L0J A;  5A69 A;  5HSW A;  1D0Y A;  1M56 C;  2A6H F;  3GEE A;  2J0X A;  1VB5 A;  1Z63 A;  3B0P A;  4JKV A;  2J45 A;  2EIK C;  4LDR A;  1TFK B;  4BEM J;  1L3P A;  1TQG A;  1TFO B;  2LFD A;  2UUH A;  3DMD A;  2AWY A;  3FHD A;  2WVQ A;  1OCO C;  5E3C A;  4PK4 A;  3ASO C;  2VCC A;  1HY5 A;  4H54 A;  3AGU A;  3ITF A;  4XEV A;  3IEE A;  2YLD A;  1CGO A;  2HJM A;  2NSG A;  2Y3H A;  4JTC B;  5A6J A;  5TJ5 E;  3S28 A;  1CGN A;  3IQ5 A;  3W8H A;  4WAB A;  1T5O A;  1HE1 A;  2XLH A;  4ONS A;  3VRC A;  3FXH A;  4O6M A;  2AP3 A;  4BJ6 A;  4E0I A;  4OIQ F;  4I1M A;  1M6T A;  3KH2 A;  1BBH A;  3WG7 C;  2J0W A;  3NKD A;  2B0J A;  2WZG A;  2X51 A;  3K1I A;  1WAT A;  3LAY A;  4JW1 A;  4GEH A;  1LM3 B;  3SXZ A;  1YAU O;  3EGD B;  2PBE A;  4JCH A;  2EIN C;  1OR3 A;  2J7P D;  2BC5 A;  4MVZ A;  1EQ1 A;  1ZHY A;  4NTB A;  2L6G A;  1PV3 A;  4CS9 C;  4DRJ B;  2XL6 A;  4XPY A;  5L0G A;  2L7A A;  2GA0 A;  3EGX B;  2CCY A;  3SXK A;  2YQY A;  2H7O A;  3L8J A;  2MHR A;  2Y3G A;  3MLG A;  4OIR F;  2XLE A;  4DOZ A;  3B0V C;  3UGO A;  1H9T A;  1LE4 A;  1K40 A;  1OKK A;  3M4C A;  2XSE A;  1E86 A;  2L9J A;  3TJ6 A;  1E83 A;  1MND A;  2WB7 A;  1G4U S;  1O87 A;  1SZI A;  3TOL A;  2Q00 A;  3FMS A;  3FOO A;  1FFT C;  4Z9H A;  4CS8 C;  1ZU5 A;  2OG2 A;  2DYS C;  5AC5 A;  3RVZ A;  1MNE A;  1R5I D;  3E9V A;  1RKE A;  3W8I A;  1TWH A;  4D4N A;  5L0H A;  5F5F A;  3W2V A;  5L0F A;  4KC9 A;  3KL4 A;  1AEP A;  2Q3T A;  3DWW A;  1E85 A;  4C7O B;  2VCA A;  2RSE B;  4EIY A;  4CSA A;  5DS5 A;  256B A;  5AGF A;  1JRA A;  1OXB A;  2MWQ A;  4W8K A;  4J30 B;  1D0Z A;  3LLK A;  2YL3 A;  3SNH A;  1ZZP A;  3U3F A;  3TUL A;  1Q0G A;  2D4U A;  3S0X A;  2YL7 A;  2Q7R A;  3ASN C;  1YZC A;  4AE4 A;  3DD7 A;  1RXQ A;  2NUT B;  3C63 A;  5L0C A;  2XLM A;  1GM5 A;  2HSB A;  5DS4 A;  3LS0 A;  3S90 A;  3F46 A;  1WGW A;  3I4U A;  4JC7 A;  3GM1 A;  4MVQ A;  2QTV A;  2W45 A;  3ABK C;  3W2W A;  3WAQ A;  5JVE A;  4LLC A;  4U9E A;  3RQF A;  3ZQV A;  3V7O A;  1VYI A;  3ZIB A;  3A9C A;  2CDQ A;  2R7Q A;  1ZU4 A;  3GWL A;  1B68 A;  2PX0 A;  3NMJ A;  4QDL A;  5DS6 A;  1C17 M;  3T6B A;  3UMH A;  3POV A;  3VF0 A;  4C3B A;  1JPN A;  3CAX A;  4YT5 A;  1LVK A;  2OU6 A;  3EH2 A;  4AL1 A;  3ZWI A;  2DYR C;  1EKY A;  1ZVZ A;  5COG A;  1BDJ B;  1O5H A;  2ASR A;  2A68 F;  2J9B A;  3DI5 A;  2Q9C A;  2R03 A;  2HV6 A;  3IPM O;  5KYY B;  2HS5 A;  1RMV A;  1UG7 A;  4WGY A;  3TOM A;  3M79 A;  1LI5 A;  1V4A A;  3A11 A;  1GGQ A;  3JSE O;  2ETS A;  1GS9 A;  1TR2 A;  2XLD A;  3H2U A;  4K0D A;  4U5F E;  4D4X A;  4JCZ A;  2J7P A;  2WZL A;  4EBK A;  1T9K A;  3NMK A;  4WJ0 A;  4CJO A;  4CDA A;  5JP7 A;  1WAS A;  3VM6 A;  3ZG1 A;  2EPO A;  3X1O A;  3O6X A;  3C8G B;  4JVS A;  3Q7L A;  1NFN A;  2YL1 A;  5D92 A;  2LQG A;  2XRH A;  2R7S A;  2WZF A;  2LCH A;  3GWN A;  2XM0 A;  1FMW A;  4MVS A;  1C03 A;  4XEF A;  5BUO A;  1A7E A;  3FAP B;  4MW3 A;  4XLN F;  2HV7 A;  3AQB A;  3JRT A;  4C3D A;  2A69 F;  1VLT A;  5E33 A;  4AK9 A;  1Q0F A;  2EPL X;  3OEO A;  3R2P A;  2EPM X;  3F47 A;  4H4K C;  4MW8 A;  4DXW A;  4I44 A;  4EBB A;  3EGX A;  1LI7 A;  1U6H A;  2HFI A;  2EPK X;  2YLG A;  1FTS A;  4IAO A;  4RBN A;  4MQ9 F;  4XPX A;  1CPR A;  1OQC A;  3K6B A;  1T01 A;  3U2M A;  3UNG C;  3GM2 A;  1A0B A;  1Q0M A;  2P7V A;  3EFO A;  3LEO A;  4FES A;  4OIO F;  2X0C A;  1QVX A;  4E18 A;  3JSZ A;  2XS1 A;  2R7W A;  3LLI A;  3DAF A;  1TKN A;  3NRH A;  4A4A A;  2L6F A;  1OCZ C;  2L6H A;  2R05 A;  2UUI A;  1LPE A;  2YHS A;  3GOD A;  2OEV A;  4N6H A;  2C03 A;  2Y3B A;  2AWC A;  4NTA A;  4C7O A;  4OIN F;  1T6Q A;  3FOP A;  1PD0 A;  3LES A;  5KYU B;  1NU7 D;  1O3U A;  3HKK A;  1GQA A;  3MYF A;  2M64 A;  5FZT A;  4NTF A;  2BE5 F;  3GOR A;  3HNJ A;  2XXA A;  3U5S A;  3WHN A;  3L34 A;  5K0I A;  3KKB A;  4BPM A;  2GWW A;  2YL0 A;  4IWB A;  1TWG A;  5F28 E;  4EHP A;  1CGM E;  3UMK A;  5B3S C;  4CDV A;  4XTK A;  1SF8 A;  3K1H A;  2QNL A;  4JRZ A;  2WVO A;  2QUP A;  4X0R A;  5JUA A;  2L81 A;  4OD4 A;  3TJ5 A;  4KI2 A;  5JT4 A;  1NSG B;  2GFH A;  3M1C B;  2Y69 C;  1E2X A;  1L7C A;  3RH3 A;  1BZ4 A;  3S84 A;  3HLZ A;  5JS5 A;  2DB4 A;  3ZVR A;  2EIJ C;  3HNK A;  3JCU Q;  3RFY A;  3HNI A;  5KYN A;  2Z15 A;  4MS2 A;  3SXY A;  3FVY A;  2HMQ A;  1M57 C;  3AG1 C;  3QW0 A;  4EUK B;  1M2O A;  5KYY A;  1V74 B;  1C02 A;  1NLX A;  1G4W R;  2AVK A;  4JZA A;  5B1B C;  4YK5 A;  4IAQ A;  2V3C C;  1HW1 A;  1H9G A;  2PF4 E;  4J32 B;  3QMK A;  2OCC C;  4N6C A;  4U9D A;  1SYQ A;  1D0X A;  5JSL A;  3DM5 A;  2IXP A;  3CEX A;  1HE9 A;  4CS9 A;  5KYW B;  2R02 A;  4N06 A;  4ZLC A;  4FX5 A;  1OW6 A;  5A6K A;  4BEJ A;  3MYI A;  4DRH B;  3RIP A;  4CDY A;  1OCR C;  4PJJ A;  2RD9 A;  2Q9B A;  4U5C E;  4LAC B;  3DXJ F;  2VH3 A;  2OJE D;  4CS8 A;  3E70 C;  3M15 A;  4MVM A;  4MVU A;  3FDQ A;  4DJ9 A;  1TWA A;  3V5Z A;  2FFH A;  2R25 A;  3NYM A;  3X2Q C;  1YAR O;  2J9W A;  2YEV A;  3C18 A;  1IW7 F;  2ZD9 A;  3NYL A;  4E7S A;  1QKR A;  1K04 A;  4U5E E;  2I15 A;  4XPW A;  2NSF A;  5CIV A;  1FR0 A;  4CBE A;  4NCQ A;  4Q7C A;  1M2V B;  3PHF 2;  1LS1 A;  4P9T A;  4QI2 A;  3QVY A;  5EHH A;  1XZQ A;  2I8B A;  1A7V A;  2R7O A;  4U5G A;  4M63 A;  3EG9 B;  3U3B A;  2J9U A;  2R7U A;  5AC4 A;  3MBG A;  2HZ8 A;  1JMW A;  1D1A A;  5T1D B;  4G7O F;  5JRA A;  4Z9I A;  1ZHX A;  2P61 A;  1FFH A;  1A41 A;  3GAN A;  3JZ0 A;  3M4B A;  2P1A A;  5KYU A;  5L0I A;  4CX9 A;  4J7T A;  2KQ9 A;  2G3V A;  4RDA A;  5CI8 A;  1E84 A;  4JUR I;  3T6J A;  5CI9 A;  1HMO A;  4LDK A;  4YL0 A;  3T9O A;  3HTK C;  3B0U X;  2XL4 A;  3EPV A;  4P6I C;  1V54 C;  2YLI A;  3TQO A;  2R7R A;  4JJF A;  1U89 A;  2EIM C;  2P0N A;  2KNH A;  1AVO B;  1OW8 A;  3V5X A;  1HW2 A;  3CZ6 A;  1JPJ A;  4NC3 A;  3JYY A;  2KC3 A;  1BR2 A;  5L3Q A;  3RQE A;  4P9F A;  1OCC C;  1YDI A;  4R32 A;  3WOD F;  1RJ9 B;  4FAP B;  3K7D A;  3C8Z A;  1OXK A;  2WL8 A;  1R4T A;  4ZLD A;  2Y3D A;  4E7Z A;  4DBQ A;  4N4W A;  3TK0 A;  4WGZ A;  3AG3 C;  3AG2 C;  2D5R B;  1QSP A;  3O55 A;  4AL0 A;  5KYX B;  4OIP F;  1NU9 C;  3EJN A;  4CIP A;  1KTM A;  2CW0 F;  3ZTZ A;  1MMA A;  2YRF A;  4ANJ A;  3Q6M A;  3EGD A;  2KW3 C;  4DBR A;  1YZA A;  4JTA B;  4O6Y A;  2HUJ A;  3ATP A;  1ZW3 A;  3R7C A;  1JR8 A;  2A6E F;  1MMD A;  2NPU A;  3H2V A;  4LLE A;  3T6G B;  3U9J A;  3MFN A;  3QZC A;  1DOW A;  2OOC A;  2EIL C;  3C8G D;  5A6B D;  3LNM B;  2VB6 A;  4I1O B;  4IAR A;  5COM A;  3RKO F;  1RKE B;  1NBB A;  1J8M F;  2HKV A;  1VYK A;  4YL3 A;  2E87 A;  2PNO A;  2VC9 A;  2C04 A;  3G50 A;  3GEH A;  4BJ5 C;  3VAY A;  4GQH A;  4PJM A;  1VTM P;  3S9O A;  2OJQ A;  2ZXO A;  3HJC A;  4HFK B;  1QPU A;  1Z23 A;  2JD3 A;  3GM3 A;  2PX3 A;  4IB4 A;  4C3E A;  3AG4 C;  3CSK A;  3JRM O;  2AU5 A;  4CIH A;  1FAP B;  3V5Y A;  1UFB A;  1N1C A;  4G0H A;  1RCP A;  3DAG A;  1YVI A;  3JT1 A;  5D91 A;  2A1D D;  2KYH A;  3Q7G A;  1ORS C;  2A0B A;  1ORJ A;  2IXN A;  3QW1 A;  1JOG A;  3N2Z B;  4O7G A;  4PFP A;  4PFO A;  3W4Y A;  4XWJ A;  5T3T A;  3SEO A;  1G8X A;  1I5N A;  1Y4C A;  4MVO A;  2VAS A;  4EKW A;  1J8Y F;  3LUT B;  1SMY F;  4LER A;  2NUT A;  2O9X A;  1I4Z A;  3G4X A;  3U8P A;  4YT2 A;  5L0D A;  3KPH A;  3Q6N A;  3PMR A;  3S27 A;  1Q0D A;  5L3V A;  2LFF A;  2IYL D;  4NY3 A;  4CJG A;  4JEA A;  4E0H A;  1M2V A;  1VMA A;  4KNV A;  2LSE A;  2ZXP A;  4XQ1 A;  3B71 A;  2Q4F A;  3EG9 A;  1NFO A;  1YJG A;  4MVR A;  4HEA J;  3LEV A;  2DI3 A;  4O6N A;  4YL1 A;  5HV9 A;  4J7Y A;  4G78 A;  1SR2 A;  3KYI A;  3U9M A;  4O79 A;  4BJT A;  3PDM P;  5JLI A;  3O39 A;  1TWC A;  2CYD A;  4XEK A;  3ZSU A;  4BJ6 C;  4Q5S F;  1Z7Q c;  1S05 A;  2KGO A;  1VK5 A;  3U2L A;  1BR1 A;  1D1C A;  2CNW D;  2W4B A;  3ABL C;  3KYJ A;  4HFF B;  1W2W A;  3K1I C;  5E2Q A;  5BQG A;  5F5H A;  4NQF A;  3QVZ A;  3DJN B;  2LIG A;  4FWV A;  3EQL F;  3B29 A;  4BJ1 A;  4PAC A;  3AOU A;  4YT8 A;  5BQI A;  3U8V A;  1F1M A;  1RJ9 A;  3C8G A;  2IOQ A;  4HE8 D;  1EA8 A;  1KU2 A;  2J46 A;  3DZA A;  5A6B A;  2YKZ A;  3LJB A;  3ZC4 A;  1YA9 A;  1VLS A;  3BRJ A;  4U5H A;  3SYN A;  2ZXR A;  5EK0 A;  3ZQY A;  3I5P A;  3UR3 C;  5KYX A;  1HMD A;  2F22 A;  3RVY A;  2QY9 A;  1ZW2 A;  3MX3 A;  3SZR A;  1MMG A;  2W4M A;  3AQC A;  2H7B A;  3T4R A;  4XLP F;  2IBF A;  2TMV P;  2EPN A;  1APC A;  4EWC A;  3N0T A;  4ULV A;  2DGJ A;  3TD7 A;  4IRU A;  1D1B A;  1KNY A;  4ER9 A;  4RD9 A;  2R7X A;  2A0U A;  2QE9 A;  4JJG A;  1FMV A;  4CSA C;  3EFO B;  1FNT c;  2CGE A;  3GEI A;  2VCB A;  3NYJ A;  2XLV A;  1QQ3 A;  1G5Z A;  2XLW A;  5E3A A;  1ZHW A;  2JPU A;  2NUP B;  1ST6 A;  1MQV A;  3J06 A;  4G7H F;  3ABM C;  3UGP A;  4DRI B;  1AUE A;  4KNW A;  4DVZ A;  4JE9 A;  2R7T A;  1EI7 A;  4K7B A;  2PP4 A;  2YZS A;  3U0C A;  1OR2 A;  1LS4 A;  1ORY A;  1Q0K A;  1NG1 A;  3CQZ A;  3IQ6 A;  2PFD A;  4U5B E;  3ZTM A;  4YT4 A;  2XXA B;  2R7V A;  2Q9A A;  2W9Y A;  4QI0 A;  1Z5Z A;  2XLO A;  4AX2 A;  4IGG A;  2KJG A;  2OQM A;  3O10 A;  4MTG A;  4A2N B;  1OW7 A;  3SP1 A;  3C7J A;  2YWA A;  1PCX A;  2HJ3 A;  4JIO A;  3AGT A;  3VYW A;  3EZI A;  5DQT A;  3K33 A;  4UDV A;  3DM9 B;  1XWJ A;  3KMI A;  3SXM A;  4W8P A;  1RKC A;  1ZHZ A;  1T6I A;  4JEB A;  1QLE C;  3IQT A;  2XS8 A;  3BEH A;  3QTH A;  2ZXW C;  4PJN A;  1T6U A;  3DKA A; 
#chains in the Genus database with same CATH homology
 1F1M A;  2GA0 A;  1G5Z A;  1GGQ A;  1YJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...