1F1MA

Crystal structure of outer surface protein c (ospc)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
162
structure length
162
Chain Sequence
PNLTEISKKITESNAVVLAVKEVETLLTSIDELAKAIGKKIKSDVSLDNEADHNGSLMSGAYLISTLITKKISAIKDSGELKAEIEKAKKCSEEFTAKLKGEHTDLGKEGVTDDNAKKAILKTNNDKTKGADELEKLFESVKNLSKAAKEMLTNSVKELTSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER SURFACE PROTEIN C
publication title Crystal structure of outer surface protein C (OspC) from the Lyme disease spirochete, Borrelia burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Immune system
total genus 65
structure length 162
sequence length 162
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01441 Lipoprotein_6 Lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.240 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Lipoprotein, type 6 1f1mA00
1F1MA 1YJGA 1G5ZA 2GA0A 1GGQA
chains in the Genus database with same CATH superfamily
1EI7A 4H4KC 2YWAA 4E18A 5FCLA 1VYIA 2QE9A 3DE9A 3PHF2 2KC3A 5AC4A 3L8JA 1LS1A 4MNDA 3CZ6A 4P6IC 5TJ5E 1SYQA 1MMNA 1CPRA 4PJLA 4U5GA 3EPVA 3MBGA 3PCVA 3C7JA 5L0GA 2Q4FA 4BJ5A 1E86A 2J46A 3JRTA 4OINF 2HKVA 2XS8A 1TKNA 3E70C 1LIHA 3KKBA 4IRUA 4QI0A 4JEAA 4CS9A 5F5FA 3U0CA 1YZAA 2OG2A 2YL0A 3N24A 1MMGA 2Q00A 2HV6A 4IWBA 4J7YA 1Y4CA 1ZW2A 3DJNB 1VTMP 4P9FA 5B3IA 1V4AA 2KNHA 1OKKD 2G3KA 4X0RA 5JT4A 2OCCC 4C3DA 4CJOA 2Z15A 3RQGA 1T6UA 1MNDA 1TWCA 1YA9A 5A6AA 1G5ZA 2R9RB 2W9YA 3GM3A 3M4BA 4WJ0A 3U3BA 1H7IA 1VLTA 2R03A 3ABMC 3IQ6A 3M4CA 4N06A 4YL0A 2XM0A 2XM4A 4HFKB 1G4WR 2YL1A 2P6VA 4YWQA 1FFTC 2J0XA 5EGYA 3DWWA 2R7QA 3EZIA 4XEKA 3L0IA 3MX3A 2OJQA 2YHSA 3ATPA 3DZAA 2IYLD 5D91A 4A4AA 3Q7GA 4XEFA 1WASA 3SNHA 4WGZA 1DOVA 4EBJA 2A69F 2JD3A 4IAQA 4O79A 3ZG1A 2MYSA 1OXKA 3V5YA 1OCOC 4MVUA 3GEIA 3US6A 1YYJA 3B0VC 1YZCA 3E9VA 4JCZA 5L0DA 3K33A 1OQCA 4LLCA 4DOZA 2Y3BA 3QMKA 3U2MA 3T6JA 3RVYA 2OKUA 2ICWG 3W8IA 3NMIA 5KYYB 2L6FA 1AEPA 3SXYA 1A7VA 3NYMA 2ZXRA 2IM8A 5DLJA 1D0XA 1W2WA 1LKXA 4DBRA 2OQMA 2LP4A 5JVEA 5DQZA 2WZFA 3MLGA 4HFFB 3SXMA 4AL0A 4BJ1A 5A6BD 2XLMA 4DRIB 1Z6AA 3AJMA 3OA1A 3ZSUA 1VB5A 1ZVZA 2M64A 2P7VA 4IARA 4Q7CA 4XLNF 3NDBB 1RXQA 3ECSA 3QVYA 4DRHB 2IOQA 1QLEC 4OIRF 1FMWA 2VCBA 3G4ZA 4U5HA 4JEBA 3K1IC 4GQHA 1O5HA 1YA7O 2J9BA 5DVWA 5B1BC 4CBEA 3SEOA 2YKZA 4NY3A 2QTVA 2EILC 3FAJA 4U9DA 4O6YA 4XWJA 1T9KA 5DS4A 3ZQYA 1JR8A 3SP1A 2CCYA 2WB7A 2QUPA 4IGGA 2YL7A 4AE4A 1TFKB 3ZTZA 2DYRC 3VAYA 3V5ZA 1IW7F 2YQYA 1Q0KA 2VCAA 1ZHTA 4C7OA 3AGUA 2GDCA 3DKAA 1BBHA 1G4US 3IHUA 1XWJA 4QDLA 3X1OA 4BEJA 3K6BA 3AG3C 5AC5A 3AGTA 4FWVA 4DBQA 1E83A 4RD9A 1ORYA 4JVSA 2NUTA 3I5PA 2J0WA 2EPOA 3QZCA 3RFYA 3UR3C 1GQAA 4CIHA 4J30B 2R7RA 1EKYA 2ETSA 5CI9A 5T1DB 2LIGA 1HW1A 1LI7A 1VMAA 1ZZPA 2D4UA 2R7OA 3GM1A 2XLVA 4P9TA 2R7VA 3LJBA 1TFOB 1N1CA 2Q9BA 5T3TA 3IPMO 4MS2A 3FDQA 4MVMA 2HMZA 1ST6A 2QY9A 1OCCC 3IQTA 3X2QC 1A0BA 4JZAA 2NUPA 1KU2A 3KL4A 3UMHA 3OWTA 4DVZA 3ZIBA 1I4YA 4I1MA 1A41A 1M56C 3HNLA 2R7SA 2A0BA 4UDVA 4DVYP 2FAPB 3BEHA 4JIOA 4Q5SF 4EWCA 1B68A 3L34A 4XPWA 1T5OA 2CNWD 1ZW3A 3QVZA 4W8PA 2KQ9A 1H6GA 4MVSA 2H8AA 3RQEA 2KW3C 3VF0A 1D1BA 2OOCA 1LI5A 1OW7A 5EHHA 4JRZA 3VM6A 1ZU4A 4D4NA 2R05A 3LLIA 2HMQA 4Z9JA 3U9MA 2KYHA 2FGYA 2HUJA 4PACA 5A6BA 3M15A 3SYNA 4BEMJ 1HE1A 3NKDA 2Q9CA 5KYYA 2PFDA 5JSLA 4G7ZF 4BJ6C 3O55A 2XS1A 2YEVA 5F5HA 3LEVA 1E2XA 4IJJA 4Z9HA 5BQGA 5B1AC 1YJGA 1M57C 1S7ZA 4YT8A 1XZQA 4OIOF 3TULA 1MQVA 1YARO 2YLIA 3N0TA 5FZTA 4MVZA 3NYJA 4CJGA 5L3VA 3EGDA 2WZLA 3LAYA 3W2WA 2FFHA 2Y3HA 2R02A 4K1OA 2R25A 2EIKC 4MTOA 2NSGA 4XPYA 2JX0A 2QNLA 5CI8A 4U5FE 4AE4B 1OW8A 3DMDA 1TR2A 3EQLF 3EH2A 4N6HA 3QW1A 1NU7D 4NC3A 4CS8C 3NRHA 4CSAC 256BA 4F4BA 4YT2A 3W4YA 4C7OB 2PBEA 4N4WA 2BE5F 2Q9AA 1R5ID 1OCRC 1QSPA 3S84A 1JAFA 4ER9A 3O6XA 5KYWA 2NUTB 1Q0MA 2M4EA 4YK5A 3KMIA 1J8YF 4LDQA 4JTAB 5L0CA 3A9CA 4KC9A 2AP3A 4LDKA 2XLHA 4WGYA 3W2VA 3NMKA 1LS4A 4EBBA 2EPNA 1CGNA 3S28A 4U9EA 1WOLA 3TQOA 4EBKA 1CGME 2F22A 4MVRA 1BZ4A 4J7TA 2CNWA 3F47A 1JPJA 3EJNA 2V26A 3DJUB 3NKEA 2NG1A 5E3CA 2HS5A 2W45A 2NUPB 3DM5A 1NSGB 3AG2C 1C03A 2A1DD 2LD6A 4E7ZA 2G62A 3U9JA 4CIPA 2R7XA 3O39A 3POVA 2EIMC 4I3MA 3AG4C 5E33A 3K7DA 4J32B 4FAPB 4U5EE 3ZQVA 1YDIA 3L1MA 2DB4A 4U5BE 1NG1A 1QVXA 3TJ5A 2TMVP 4E0IA 1PD1A 1FMVA 5E3AA 1EA8A 1NU9C 1NBBA 3WAQA 1VLSA 3RKOF 2EINC 2YLGA 1BR1A 3IQCA 2L81A 3T6GB 3EHNA 2KSFA 5L0IA 5JP7A 4A2NB 5L0HA 4PJNA 5COFA 4R32A 3UNGC 1Q0DA 4OD5A 3UMIA 3SXZA 3WG7C 1ZU5A 5KYXA 2XXAA 1D0ZA 2UUIA 1Z3IX 1V74B 3G4XA 4BPMA 4ANJA 2EPKX 3RQFA 2LFFA 2HZ8A 4ULWA 1OR3A 4YL1A 2UUHA 3DD7A 4EHPA 5EK0A 4MW3A 5COGA 3U5SA 2GFHA 4XTKA 3I5QA 3EGDB 3Q6MA 1APCA 2KK1A 4E0HA 3T9OA 4BJ6A 1YAUO 2ASRA 1GM5A 3IQ5A 2D5RB 2XLEA 3T6BA 1F1MA 3IEEA 2BC5A 1Z63A 2NSFA 4LLEA 2J45A 2XLOA 4JJFA 3LNMB 5L0JA 5KYNA 4MW8A 2YVKA 2EPMX 2YZSA 3AOUA 2PP4A 4I44A 4KNVA 4CS9C 2CYDA 2LFDA 4B6IA 5KYWB 1U0BB 1MMAA 4C3EA 3MYIA 3DXJF 4EKWA 3JYYA 5BQIA 4WABA 2H7OA 2Y69C 2X0CA 5D92A 1UFBA 4CS8A 3KH2A 3CAXA 1HMDA 4U5DE 1PV3A 4JURI 3C18A 2P0NA 4HE8D 3I4UA 1SZIA 1AUEA 1SMYF 3RIPA 2YRFA 3A11A 4ONSA 4YL3A 5T3WA 2CW0F 1JMWA 4G7HF 1RKEA 2GA0A 2VC9A 2YLDA 2W4BA 3R7CA 4OIQF 4JJGA 1EQ1A 4G78A 1O3UA 1VOMA 4K0DA 4YJWA 2OEXA 3C62A 3K1HA 3LS0A 1RMVA 1NFOA 3EH1A 1M6TA 2HFIA 1K05A 3FHDA 4GYTA 3V5XA 2AU5A 3DE8A 2OEVA 5KYUA 3OEOA 2L9JA 3W8HA 4OD4A 1CPQA 2LSEA 2J9VA 3JYHA 2WVOA 2A6EF 4G0HA 5JRAA 1FFHA 1Z23A 1SR2A 4NTBA 1WN0A 2XXAB 5KYXB 3J06A 3B0UX 3M1CB 4MVOA 2JPUA 1M2VB 4PFOA 5IY5C 1VK5A 2LQGA 3CEXA 1T6IA 3FOOA 4LDRA 4CDAA 3Q7LA 4MQ9F 3MFNA 1NZEA 4GEHA 3ZC4A 1Z5ZA 4JC7A 1A7DA 2R7WA 2PNOA 2ZXPA 1BR4A 2EIJC 4IAOA 4CDYA 4OIPF 2P1AA 1YVIA 3KYJA 1RKCA 1Y6DA 2PX3A 3DAFA 3GWLA 4PJMA 3WHNA 2GWWA 3HKKA 3LS1A 2I8BA 3RVZA 5L3QA 3GWNA 4NTFA 4RDAA 2J9UA 3DM9B 3RH3A 1HE9A 5L0FA 3U3FA 1I4ZA 1S05A 3ABLC 1YYXA 2W4MA 2XLDA 2A0UA 4ZLDA 4G7OF 3S9OA 2NPUA 4XPXA 2LK4A 3K1IA 3UGPA 3U8PA 4CS7A 5BQHA 3H2VA 4O6NA 2GAQA 5AGFA 2HSQA 4JCHA 4KBLA 3SXKA 4LACB 4Z9IA 5HV9A 4NQFA 4W8KA 5K0IA 2ZPAA 2Y3DA 2HSBA 3HTKC 4PK4A 3S27A 3LUTB 4QI2A 4LERA 3S29A 1OCZC 3ASOC 2HJ3A 3ITFA 4AX2A 3K66A 4JTCB 3GEHA 5BUOA 1LE4A 1T6QA 1SF8A 1TWAA 1ORSC 1ZHWA 2AWCA 2DI3A 2P61A 3B71A 1HMOA 3DAGA 4YN0B 1TWHA 3GEEA 3KPHA 4M63A 1ZHYA 1IZMA 3C8GB 5E2QA 1D1AA 1RKEB 4AK9A 1I5NA 1M2OA 3NG1A 3TK0A 5F28E 3GORA 1LE2A 2A6HF 2KJGA 3FMSA 1C17M 4O7GA 2L7AA 3CQZA 1D1CA 3SZRA 3BRJA 1PCXA 3R2PA 5DS5A 3PMRA 4N6CA 1ZHZA 2DGJA 3EFOB 3TJ6A 3GM2A 2Q3TA 2VH3A 4BG0A 2VCCA 5KYUB 3C8GD 1Z7Qc 1A7EA 3S90A 3JT1A 1JRAA 3H2UA 1OW6A 1YLMA 2J9WA 2XLWA 1V54C 1L3PA 2MHRA 2AWYA 3NMJA 4JE9A 3RF3A 3ZVRA 2XL8A 2R7UA 1HY5A 1KTMA 3EGXA 2IXMA 3EG9A 2XRHA 3F46A 4FX5A 1M2VA 1MNEA 2WVQA 3HLZA 3LESA 5DS6A 1QZXA 3L8IA 4ULVA 3NYLA 4H54A 3TD7A 4XQ1A 1FR0A 1JOGA 3DI5A 2KGOA 2WZGA 3ZDLA 3ZTMA 4DJ9A 3S0XA 3CSKA 1VYKA 1ZYRF 2XL4A 4XEVA 4YT4A 3JCUQ 2H7VC 4RBNA 2Y39A 4O6MA 1J8MF 1K40A 1Q0FA 1RJ9B 3C8ZA 1OXBA 2RD9A 3HNKA 1MMDA 3TOMA 2R7TA 4DXWA 1U89A 1GS9A 1NLXA 2HV7A 4CDVA 2RSEB 5A6KA 1UG7A 4C3BA 1LPEA 1L7CA 1Q0GA 1TQGA 2YL3A 3GANA 3VRCA 1CGOA 3JSZA 2E87A 4BJ5C 1K04A 2C04A 5COMA 5HSWA 2J7PD 1V55C 3B29A 2CGEA 3LEOA 3ZWIA 1NFNA 1G8XA 3ASNC 3HNJA 2IXPA 1BDJB 3KYIA 3O10A 4MVQA 2IXOA 2OU6A 4NTAA 4KI2A 3T4RA 1H9TA 4E17A 2ZXWC 3FAPB 3RW0A 4CSAA 1FTSA 3H65A 4FESA 3U8VA 3AG1C 3FOPA 2CDQA 5A6JA 1OKKA 2MWQA 2PX0A 3JRMO 4E7SA 2ZXOA 4XLPF 4MTFA 4PJJA 1WGWA 1JPNA 2B0JA 1QPUA 3N2ZB 4EIYA 2OJED 3C8GA 3U2LA 4AL1A 3HJCA 3QW0A 2QLAA 4PR9A 3Q6NA 2V3CC 2X51A 1QKRA 1TWGA 4U5CE 2H7BA 2A68F 3EZHA 1BR2A 2L6GA 4K7BA 4KNWA 4MTGA 5JLIA 1XZPA 1ZHXA 3EFOA 2BL2A 4I1OB 3C63A 2IBFA 3WODF 5JUAA 3JZ0A 5CIVA 1E85A 1U6HA 4JW1A 1GGQA 1T01A 3FVYA 3PDMP 2XL6A 2B0HA 3HNIA 2ZD9A 3EGXB 3AQBA 3V7OA 3EHMA 3ABKC 2Y3GA 3AQCA 3EG9B 3TOLA 5JS5A 4Q4ZF 3QTHA 3GODA 4D4XA 1ORJA 1WTYA 2C03A 2IXNA 4JKVA 1FAPB 4BJTA 3B9QA 3JTLO 4EUKB 4ZLCA 1WWPA 3VYWA 4DRJB 1E84A 1LVKA 3G50A 3UMKA 3JSEO 3M79A 5A69A 3FXHA 3RYLA 2J8WA 2Q7RA 2I15A 5B3SC 1OR2A 1QQ3A 1RCPA 1FNTc 2WVNA 3UGOA 2O9XA 1PD0A 1D0YA 1DOWA 2WL8A 2XSEA 1C02A 2DYSC 2HJMA 1AVOB 4JTDB 4NCQA 2J7PA 4YT5A 3LNRA 1RJ9A 2L6HA 5GPGB 2VASA 2VB6A 2AVKA 4L6RA 5DQTA 1R4TA 1WATA 4CX9A 2PF4E 2EPLX 4HEAJ 3LLKA 2G3VA 3B0PA 4PFPA 4IB4A 1KNYA 3MYFA 1HW2A 2LCHA 1LM3B 1O87A 1H9GA
chains in the Genus database with same CATH topology
1F1MA 1YJGA 1G5ZA 2GA0A 1GGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F1M A;  1YJG A;  1G5Z A;  2GA0 A;  1GGQ A; 
#chains in the Genus database with same CATH topology
 1EI7 A;  4H4K C;  2YWA A;  4E18 A;  5FCL A;  1VYI A;  2QE9 A;  3DE9 A;  3PHF 2;  2KC3 A;  5AC4 A;  3L8J A;  1LS1 A;  4MND A;  3CZ6 A;  4P6I C;  5TJ5 E;  1SYQ A;  1MMN A;  1CPR A;  4PJL A;  4U5G A;  3EPV A;  3MBG A;  3PCV A;  3C7J A;  5L0G A;  2Q4F A;  4BJ5 A;  1E86 A;  2J46 A;  3JRT A;  4OIN F;  2HKV A;  2XS8 A;  1TKN A;  3E70 C;  1LIH A;  3KKB A;  4IRU A;  4QI0 A;  4JEA A;  4CS9 A;  5F5F A;  3U0C A;  1YZA A;  2OG2 A;  2YL0 A;  3N24 A;  1MMG A;  2Q00 A;  2HV6 A;  4IWB A;  4J7Y A;  1Y4C A;  1ZW2 A;  3DJN B;  1VTM P;  4P9F A;  5B3I A;  1V4A A;  2KNH A;  1OKK D;  2G3K A;  4X0R A;  5JT4 A;  2OCC C;  4C3D A;  4CJO A;  2Z15 A;  3RQG A;  1T6U A;  1MND A;  1TWC A;  1YA9 A;  5A6A A;  1G5Z A;  2R9R B;  2W9Y A;  3GM3 A;  3M4B A;  4WJ0 A;  3U3B A;  1H7I A;  1VLT A;  2R03 A;  3ABM C;  3IQ6 A;  3M4C A;  4N06 A;  4YL0 A;  2XM0 A;  2XM4 A;  4HFK B;  1G4W R;  2YL1 A;  2P6V A;  4YWQ A;  1FFT C;  2J0X A;  5EGY A;  3DWW A;  2R7Q A;  3EZI A;  4XEK A;  3L0I A;  3MX3 A;  2OJQ A;  2YHS A;  3ATP A;  3DZA A;  2IYL D;  5D91 A;  4A4A A;  3Q7G A;  4XEF A;  1WAS A;  3SNH A;  4WGZ A;  1DOV A;  4EBJ A;  2A69 F;  2JD3 A;  4IAQ A;  4O79 A;  3ZG1 A;  2MYS A;  1OXK A;  3V5Y A;  1OCO C;  4MVU A;  3GEI A;  3US6 A;  1YYJ A;  3B0V C;  1YZC A;  3E9V A;  4JCZ A;  5L0D A;  3K33 A;  1OQC A;  4LLC A;  4DOZ A;  2Y3B A;  3QMK A;  3U2M A;  3T6J A;  3RVY A;  2OKU A;  2ICW G;  3W8I A;  3NMI A;  5KYY B;  2L6F A;  1AEP A;  3SXY A;  1A7V A;  3NYM A;  2ZXR A;  2IM8 A;  5DLJ A;  1D0X A;  1W2W A;  1LKX A;  4DBR A;  2OQM A;  2LP4 A;  5JVE A;  5DQZ A;  2WZF A;  3MLG A;  4HFF B;  3SXM A;  4AL0 A;  4BJ1 A;  5A6B D;  2XLM A;  4DRI B;  1Z6A A;  3AJM A;  3OA1 A;  3ZSU A;  1VB5 A;  1ZVZ A;  2M64 A;  2P7V A;  4IAR A;  4Q7C A;  4XLN F;  3NDB B;  1RXQ A;  3ECS A;  3QVY A;  4DRH B;  2IOQ A;  1QLE C;  4OIR F;  1FMW A;  2VCB A;  3G4Z A;  4U5H A;  4JEB A;  3K1I C;  4GQH A;  1O5H A;  1YA7 O;  2J9B A;  5DVW A;  5B1B C;  4CBE A;  3SEO A;  2YKZ A;  4NY3 A;  2QTV A;  2EIL C;  3FAJ A;  4U9D A;  4O6Y A;  4XWJ A;  1T9K A;  5DS4 A;  3ZQY A;  1JR8 A;  3SP1 A;  2CCY A;  2WB7 A;  2QUP A;  4IGG A;  2YL7 A;  4AE4 A;  1TFK B;  3ZTZ A;  2DYR C;  3VAY A;  3V5Z A;  1IW7 F;  2YQY A;  1Q0K A;  2VCA A;  1ZHT A;  4C7O A;  3AGU A;  2GDC A;  3DKA A;  1BBH A;  1G4U S;  3IHU A;  1XWJ A;  4QDL A;  3X1O A;  4BEJ A;  3K6B A;  3AG3 C;  5AC5 A;  3AGT A;  4FWV A;  4DBQ A;  1E83 A;  4RD9 A;  1ORY A;  4JVS A;  2NUT A;  3I5P A;  2J0W A;  2EPO A;  3QZC A;  3RFY A;  3UR3 C;  1GQA A;  4CIH A;  4J30 B;  2R7R A;  1EKY A;  2ETS A;  5CI9 A;  5T1D B;  2LIG A;  1HW1 A;  1LI7 A;  1VMA A;  1ZZP A;  2D4U A;  2R7O A;  3GM1 A;  2XLV A;  4P9T A;  2R7V A;  3LJB A;  1TFO B;  1N1C A;  2Q9B A;  5T3T A;  3IPM O;  4MS2 A;  3FDQ A;  4MVM A;  2HMZ A;  1ST6 A;  2QY9 A;  1OCC C;  3IQT A;  3X2Q C;  1A0B A;  4JZA A;  2NUP A;  1KU2 A;  3KL4 A;  3UMH A;  3OWT A;  4DVZ A;  3ZIB A;  1I4Y A;  4I1M A;  1A41 A;  1M56 C;  3HNL A;  2R7S A;  2A0B A;  4UDV A;  4DVY P;  2FAP B;  3BEH A;  4JIO A;  4Q5S F;  4EWC A;  1B68 A;  3L34 A;  4XPW A;  1T5O A;  2CNW D;  1ZW3 A;  3QVZ A;  4W8P A;  2KQ9 A;  1H6G A;  4MVS A;  2H8A A;  3RQE A;  2KW3 C;  3VF0 A;  1D1B A;  2OOC A;  1LI5 A;  1OW7 A;  5EHH A;  4JRZ A;  3VM6 A;  1ZU4 A;  4D4N A;  2R05 A;  3LLI A;  2HMQ A;  4Z9J A;  3U9M A;  2KYH A;  2FGY A;  2HUJ A;  4PAC A;  5A6B A;  3M15 A;  3SYN A;  4BEM J;  1HE1 A;  3NKD A;  2Q9C A;  5KYY A;  2PFD A;  5JSL A;  4G7Z F;  4BJ6 C;  3O55 A;  2XS1 A;  2YEV A;  5F5H A;  3LEV A;  1E2X A;  4IJJ A;  4Z9H A;  5BQG A;  5B1A C;  1YJG A;  1M57 C;  1S7Z A;  4YT8 A;  1XZQ A;  4OIO F;  3TUL A;  1MQV A;  1YAR O;  2YLI A;  3N0T A;  5FZT A;  4MVZ A;  3NYJ A;  4CJG A;  5L3V A;  3EGD A;  2WZL A;  3LAY A;  3W2W A;  2FFH A;  2Y3H A;  2R02 A;  4K1O A;  2R25 A;  2EIK C;  4MTO A;  2NSG A;  4XPY A;  2JX0 A;  2QNL A;  5CI8 A;  4U5F E;  4AE4 B;  1OW8 A;  3DMD A;  1TR2 A;  3EQL F;  3EH2 A;  4N6H A;  3QW1 A;  1NU7 D;  4NC3 A;  4CS8 C;  3NRH A;  4CSA C;  256B A;  4F4B A;  4YT2 A;  3W4Y A;  4C7O B;  2PBE A;  4N4W A;  2BE5 F;  2Q9A A;  1R5I D;  1OCR C;  1QSP A;  3S84 A;  1JAF A;  4ER9 A;  3O6X A;  5KYW A;  2NUT B;  1Q0M A;  2M4E A;  4YK5 A;  3KMI A;  1J8Y F;  4LDQ A;  4JTA B;  5L0C A;  3A9C A;  4KC9 A;  2AP3 A;  4LDK A;  2XLH A;  4WGY A;  3W2V A;  3NMK A;  1LS4 A;  4EBB A;  2EPN A;  1CGN A;  3S28 A;  4U9E A;  1WOL A;  3TQO A;  4EBK A;  1CGM E;  2F22 A;  4MVR A;  1BZ4 A;  4J7T A;  2CNW A;  3F47 A;  1JPJ A;  3EJN A;  2V26 A;  3DJU B;  3NKE A;  2NG1 A;  5E3C A;  2HS5 A;  2W45 A;  2NUP B;  3DM5 A;  1NSG B;  3AG2 C;  1C03 A;  2A1D D;  2LD6 A;  4E7Z A;  2G62 A;  3U9J A;  4CIP A;  2R7X A;  3O39 A;  3POV A;  2EIM C;  4I3M A;  3AG4 C;  5E33 A;  3K7D A;  4J32 B;  4FAP B;  4U5E E;  3ZQV A;  1YDI A;  3L1M A;  2DB4 A;  4U5B E;  1NG1 A;  1QVX A;  3TJ5 A;  2TMV P;  4E0I A;  1PD1 A;  1FMV A;  5E3A A;  1EA8 A;  1NU9 C;  1NBB A;  3WAQ A;  1VLS A;  3RKO F;  2EIN C;  2YLG A;  1BR1 A;  3IQC A;  2L81 A;  3T6G B;  3EHN A;  2KSF A;  5L0I A;  5JP7 A;  4A2N B;  5L0H A;  4PJN A;  5COF A;  4R32 A;  3UNG C;  1Q0D A;  4OD5 A;  3UMI A;  3SXZ A;  3WG7 C;  1ZU5 A;  5KYX A;  2XXA A;  1D0Z A;  2UUI A;  1Z3I X;  1V74 B;  3G4X A;  4BPM A;  4ANJ A;  2EPK X;  3RQF A;  2LFF A;  2HZ8 A;  4ULW A;  1OR3 A;  4YL1 A;  2UUH A;  3DD7 A;  4EHP A;  5EK0 A;  4MW3 A;  5COG A;  3U5S A;  2GFH A;  4XTK A;  3I5Q A;  3EGD B;  3Q6M A;  1APC A;  2KK1 A;  4E0H A;  3T9O A;  4BJ6 A;  1YAU O;  2ASR A;  1GM5 A;  3IQ5 A;  2D5R B;  2XLE A;  3T6B A;  1F1M A;  3IEE A;  2BC5 A;  1Z63 A;  2NSF A;  4LLE A;  2J45 A;  2XLO A;  4JJF A;  3LNM B;  5L0J A;  5KYN A;  4MW8 A;  2YVK A;  2EPM X;  2YZS A;  3AOU A;  2PP4 A;  4I44 A;  4KNV A;  4CS9 C;  2CYD A;  2LFD A;  4B6I A;  5KYW B;  1U0B B;  1MMA A;  4C3E A;  3MYI A;  3DXJ F;  4EKW A;  3JYY A;  5BQI A;  4WAB A;  2H7O A;  2Y69 C;  2X0C A;  5D92 A;  1UFB A;  4CS8 A;  3KH2 A;  3CAX A;  1HMD A;  4U5D E;  1PV3 A;  4JUR I;  3C18 A;  2P0N A;  4HE8 D;  3I4U A;  1SZI A;  1AUE A;  1SMY F;  3RIP A;  2YRF A;  3A11 A;  4ONS A;  4YL3 A;  5T3W A;  2CW0 F;  1JMW A;  4G7H F;  1RKE A;  2GA0 A;  2VC9 A;  2YLD A;  2W4B A;  3R7C A;  4OIQ F;  4JJG A;  1EQ1 A;  4G78 A;  1O3U A;  1VOM A;  4K0D A;  4YJW A;  2OEX A;  3C62 A;  3K1H A;  3LS0 A;  1RMV A;  1NFO A;  3EH1 A;  1M6T A;  2HFI A;  1K05 A;  3FHD A;  4GYT A;  3V5X A;  2AU5 A;  3DE8 A;  2OEV A;  5KYU A;  3OEO A;  2L9J A;  3W8H A;  4OD4 A;  1CPQ A;  2LSE A;  2J9V A;  3JYH A;  2WVO A;  2A6E F;  4G0H A;  5JRA A;  1FFH A;  1Z23 A;  1SR2 A;  4NTB A;  1WN0 A;  2XXA B;  5KYX B;  3J06 A;  3B0U X;  3M1C B;  4MVO A;  2JPU A;  1M2V B;  4PFO A;  5IY5 C;  1VK5 A;  2LQG A;  3CEX A;  1T6I A;  3FOO A;  4LDR A;  4CDA A;  3Q7L A;  4MQ9 F;  3MFN A;  1NZE A;  4GEH A;  3ZC4 A;  1Z5Z A;  4JC7 A;  1A7D A;  2R7W A;  2PNO A;  2ZXP A;  1BR4 A;  2EIJ C;  4IAO A;  4CDY A;  4OIP F;  2P1A A;  1YVI A;  3KYJ A;  1RKC A;  1Y6D A;  2PX3 A;  3DAF A;  3GWL A;  4PJM A;  3WHN A;  2GWW A;  3HKK A;  3LS1 A;  2I8B A;  3RVZ A;  5L3Q A;  3GWN A;  4NTF A;  4RDA A;  2J9U A;  3DM9 B;  3RH3 A;  1HE9 A;  5L0F A;  3U3F A;  1I4Z A;  1S05 A;  3ABL C;  1YYX A;  2W4M A;  2XLD A;  2A0U A;  4ZLD A;  4G7O F;  3S9O A;  2NPU A;  4XPX A;  2LK4 A;  3K1I A;  3UGP A;  3U8P A;  4CS7 A;  5BQH A;  3H2V A;  4O6N A;  2GAQ A;  5AGF A;  2HSQ A;  4JCH A;  4KBL A;  3SXK A;  4LAC B;  4Z9I A;  5HV9 A;  4NQF A;  4W8K A;  5K0I A;  2ZPA A;  2Y3D A;  2HSB A;  3HTK C;  4PK4 A;  3S27 A;  3LUT B;  4QI2 A;  4LER A;  3S29 A;  1OCZ C;  3ASO C;  2HJ3 A;  3ITF A;  4AX2 A;  3K66 A;  4JTC B;  3GEH A;  5BUO A;  1LE4 A;  1T6Q A;  1SF8 A;  1TWA A;  1ORS C;  1ZHW A;  2AWC A;  2DI3 A;  2P61 A;  3B71 A;  1HMO A;  3DAG A;  4YN0 B;  1TWH A;  3GEE A;  3KPH A;  4M63 A;  1ZHY A;  1IZM A;  3C8G B;  5E2Q A;  1D1A A;  1RKE B;  4AK9 A;  1I5N A;  1M2O A;  3NG1 A;  3TK0 A;  5F28 E;  3GOR A;  1LE2 A;  2A6H F;  2KJG A;  3FMS A;  1C17 M;  4O7G A;  2L7A A;  3CQZ A;  1D1C A;  3SZR A;  3BRJ A;  1PCX A;  3R2P A;  5DS5 A;  3PMR A;  4N6C A;  1ZHZ A;  2DGJ A;  3EFO B;  3TJ6 A;  3GM2 A;  2Q3T A;  2VH3 A;  4BG0 A;  2VCC A;  5KYU B;  3C8G D;  1Z7Q c;  1A7E A;  3S90 A;  3JT1 A;  1JRA A;  3H2U A;  1OW6 A;  1YLM A;  2J9W A;  2XLW A;  1V54 C;  1L3P A;  2MHR A;  2AWY A;  3NMJ A;  4JE9 A;  3RF3 A;  3ZVR A;  2XL8 A;  2R7U A;  1HY5 A;  1KTM A;  3EGX A;  2IXM A;  3EG9 A;  2XRH A;  3F46 A;  4FX5 A;  1M2V A;  1MNE A;  2WVQ A;  3HLZ A;  3LES A;  5DS6 A;  1QZX A;  3L8I A;  4ULV A;  3NYL A;  4H54 A;  3TD7 A;  4XQ1 A;  1FR0 A;  1JOG A;  3DI5 A;  2KGO A;  2WZG A;  3ZDL A;  3ZTM A;  4DJ9 A;  3S0X A;  3CSK A;  1VYK A;  1ZYR F;  2XL4 A;  4XEV A;  4YT4 A;  3JCU Q;  2H7V C;  4RBN A;  2Y39 A;  4O6M A;  1J8M F;  1K40 A;  1Q0F A;  1RJ9 B;  3C8Z A;  1OXB A;  2RD9 A;  3HNK A;  1MMD A;  3TOM A;  2R7T A;  4DXW A;  1U89 A;  1GS9 A;  1NLX A;  2HV7 A;  4CDV A;  2RSE B;  5A6K A;  1UG7 A;  4C3B A;  1LPE A;  1L7C A;  1Q0G A;  1TQG A;  2YL3 A;  3GAN A;  3VRC A;  1CGO A;  3JSZ A;  2E87 A;  4BJ5 C;  1K04 A;  2C04 A;  5COM A;  5HSW A;  2J7P D;  1V55 C;  3B29 A;  2CGE A;  3LEO A;  3ZWI A;  1NFN A;  1G8X A;  3ASN C;  3HNJ A;  2IXP A;  1BDJ B;  3KYI A;  3O10 A;  4MVQ A;  2IXO A;  2OU6 A;  4NTA A;  4KI2 A;  3T4R A;  1H9T A;  4E17 A;  2ZXW C;  3FAP B;  3RW0 A;  4CSA A;  1FTS A;  3H65 A;  4FES A;  3U8V A;  3AG1 C;  3FOP A;  2CDQ A;  5A6J A;  1OKK A;  2MWQ A;  2PX0 A;  3JRM O;  4E7S A;  2ZXO A;  4XLP F;  4MTF A;  4PJJ A;  1WGW A;  1JPN A;  2B0J A;  1QPU A;  3N2Z B;  4EIY A;  2OJE D;  3C8G A;  3U2L A;  4AL1 A;  3HJC A;  3QW0 A;  2QLA A;  4PR9 A;  3Q6N A;  2V3C C;  2X51 A;  1QKR A;  1TWG A;  4U5C E;  2H7B A;  2A68 F;  3EZH A;  1BR2 A;  2L6G A;  4K7B A;  4KNW A;  4MTG A;  5JLI A;  1XZP A;  1ZHX A;  3EFO A;  2BL2 A;  4I1O B;  3C63 A;  2IBF A;  3WOD F;  5JUA A;  3JZ0 A;  5CIV A;  1E85 A;  1U6H A;  4JW1 A;  1GGQ A;  1T01 A;  3FVY A;  3PDM P;  2XL6 A;  2B0H A;  3HNI A;  2ZD9 A;  3EGX B;  3AQB A;  3V7O A;  3EHM A;  3ABK C;  2Y3G A;  3AQC A;  3EG9 B;  3TOL A;  5JS5 A;  4Q4Z F;  3QTH A;  3GOD A;  4D4X A;  1ORJ A;  1WTY A;  2C03 A;  2IXN A;  4JKV A;  1FAP B;  4BJT A;  3B9Q A;  3JTL O;  4EUK B;  4ZLC A;  1WWP A;  3VYW A;  4DRJ B;  1E84 A;  1LVK A;  3G50 A;  3UMK A;  3JSE O;  3M79 A;  5A69 A;  3FXH A;  3RYL A;  2J8W A;  2Q7R A;  2I15 A;  5B3S C;  1OR2 A;  1QQ3 A;  1RCP A;  1FNT c;  2WVN A;  3UGO A;  2O9X A;  1PD0 A;  1D0Y A;  1DOW A;  2WL8 A;  2XSE A;  1C02 A;  2DYS C;  2HJM A;  1AVO B;  4JTD B;  4NCQ A;  2J7P A;  4YT5 A;  3LNR A;  1RJ9 A;  2L6H A;  5GPG B;  2VAS A;  2VB6 A;  2AVK A;  4L6R A;  5DQT A;  1R4T A;  1WAT A;  4CX9 A;  2PF4 E;  2EPL X;  4HEA J;  3LLK A;  2G3V A;  3B0P A;  4PFP A;  4IB4 A;  1KNY A;  3MYF A;  1HW2 A;  2LCH A;  1LM3 B;  1O87 A;  1H9G A; 
#chains in the Genus database with same CATH homology
 1F1M A;  1YJG A;  1G5Z A;  2GA0 A;  1GGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...