1F1MA

Crystal structure of outer surface protein c (ospc)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
162
structure length
162
Chain Sequence
PNLTEISKKITESNAVVLAVKEVETLLTSIDELAKAIGKKIKSDVSLDNEADHNGSLMSGAYLISTLITKKISAIKDSGELKAEIEKAKKCSEEFTAKLKGEHTDLGKEGVTDDNAKKAILKTNNDKTKGADELEKLFESVKNLSKAAKEMLTNSVKELTSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords OUTER SURFACE PROTEIN C
publication title Crystal structure of outer surface protein C (OspC) from the Lyme disease spirochete, Borrelia burgdorferi.
pubmed doi rcsb
source organism Borrelia burgdorferi
total genus 65
structure length 162
sequence length 162
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01441 Lipoprotein_6 Lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.240 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Lipoprotein, type 6 1f1mA00
1YJGA 1F1MA 1GGQA 1G5ZA 2GA0A
chains in the Genus database with same CATH superfamily
2XXAB 4Z9HA 5L0HA 5A6AA 1Y6DA 2WL8A 3K33A 3TJ5A 3FDQA 1QLEC 1EQ1A 2IXNA 1WN0A 5EK0A 3MLGA 2J0XA 4KC9A 4YT8A 5L0IA 4XLNF 1RKEB 3QTHA 4MNDA 2QY9A 5JLIA 3K1IA 4XEVA 1PCXA 1NSGB 1RKEA 1BR2A 1TWHA 3M79A 4G78A 3JRTA 4JEAA 3C62A 4OINF 2YHSA 4IAQA 2X0CA 3M15A 3KKBA 4E0HA 2CYDA 2YQYA 4U5EE 1ORJA 4P6IC 1FFTC 1YJGA 3HJCA 4XPWA 3HNKA 2LFFA 1Z3IX 1OXBA 2BL2A 3EGDB 2HJMA 4XLPF 2WVNA 3EGXA 2XLWA 3PCVA 1O3UA 3NKEA 3UR3C 2AWCA 1GQAA 3EJNA 2R7RA 4E7ZA 1LVKA 4OD4A 3T6BA 1LI7A 4HEAJ 4PR9A 4I1OB 2UUIA 4BJ1A 4W8KA 1LIHA 4EKWA 2DYSC 4QDLA 5E2QA 4DBRA 2ZD9A 1V54C 1EA8A 1QQ3A 1FMWA 1OR3A 2P7VA 3RQEA 3MYFA 4YN0B 2J9UA 4XTKA 3H2VA 4KNWA 3X1OA 3RVZA 2R03A 2J0WA 4YT4A 1PD0A 1QKRA 3US6A 2VB6A 3GM3A 3RKOF 5B1BC 1SR2A 4DXWA 4YT2A 2A68F 2LK4A 3ITFA 4MTGA 1M56C 1HE1A 1Z23A 4HFFB 1AEPA 3G4ZA 1OW7A 1TKNA 2XLMA 4YL3A 2YL0A 3GWLA 2G62A 4MW8A 3W2WA 3EHMA 4U5GA 4A4AA 4IARA 4M63A 3GANA 4QI0A 5KYNA 1JPNA 2A0UA 5DS6A 3JSEO 5L0CA 1PD1A 2OQMA 4AE4A 4DJ9A 1LE2A 5GPGB 1OXKA 4YK5A 3F46A 4XPXA 4AK9A 3B0UX 3LNRA 5IY5C 5KYWA 1UFBA 4JRZA 1TR2A 4MVRA 1YLMA 3B0PA 3FAPB 4MTFA 4PJMA 1FFHA 2YL1A 4IWBA 3DMDA 4OD5A 2KGOA 5D92A 1D0XA 2A0BA 5F5HA 5A69A 1VLSA 2GA0A 3T9OA 4CS7A 1T6IA 2HZ8A 1I4ZA 2HSQA 2XLOA 4JCHA 3EQLF 4Q7CA 3MFNA 4J7TA 4PJNA 3UMIA 4DVZA 3V5ZA 4Z9IA 1OW6A 2LD6A 4JJFA 2R02A 1VB5A 3FAJA 2OOCA 1EI7A 2L7AA 3LEVA 2KC3A 2Q9BA 2V3CC 2FAPB 4B6IA 1YVIA 2GAQA 2J45A 1C02A 2ZXPA 2RD9A 3IHUA 1V55C 3JRMO 4PFOA 3S29A 1YYXA 3VRCA 2R7VA 1JRAA 1JR8A 2VCAA 2WZFA 4PACA 5AC5A 3ECSA 1ZHYA 3DKAA 2XL6A 4AL0A 1F1MA 2P1AA 2Y3HA 4U9EA 5DS4A 3ZC4A 2J8WA 3ZSUA 4U5DE 4U5FE 1BR1A 1TWGA 4BJ6A 5L0GA 1LM3B 1MMAA 2TMVP 3BRJA 2EINC 2HKVA 3GM2A 4G7OF 4OIPF 3DE9A 2L81A 1GGQA 1MNDA 1ZHTA 3AG2C 3FHDA 1HMOA 3TJ6A 2W4MA 1FMVA 2VH3A 2XM4A 1SYQA 2LSEA 2Q3TA 3CQZA 3QMKA 4MQ9F 1JPJA 3HLZA 3VAYA 3K6BA 3LLKA 5KYUB 1RCPA 2PFDA 2KW3C 5AC4A 4U5HA 4I1MA 3ASNC 1RJ9A 4O6MA 3SXYA 3HTKC 1LKXA 1OCRC 4QI2A 1EKYA 3DXJF 3IQCA 4FWVA 5EGYA 3FOPA 1FNTc 1S05A 1FAPB 2P61A 5JT4A 4WGYA 3E70C 2GDCA 2VASA 4ANJA 5JS5A 4EHPA 2XLEA 3IEEA 4PK4A 1TQGA 5KYXB 4EBJA 2Q4FA 2C04A 1GM5A 1QZXA 3NDBB 2WB7A 4C7OB 3LAYA 3A9CA 3EG9B 2CW0F 1I4YA 3EZHA 1B68A 1M57C 2F22A 4GQHA 4K1OA 1ZZPA 2DB4A 4LLCA 3CAXA 3T6JA 3EG9A 4AX2A 1CGME 4C7OA 1Q0FA 1G5ZA 2V26A 2G3KA 3DJUB 3VM6A 4C3BA 5FCLA 1C17M 3CEXA 1Z63A 1KTMA 2YLDA 2YWAA 3Q7GA 4NC3A 5FZTA 3T4RA 4ULVA 1AVOB 1LE4A 2QLAA 2KJGA 2UUHA 4N6HA 2XXAA 1CPRA 1NFOA 2XS1A 3K66A 2O9XA 1G8XA 3LNMB 4N06A 4BEMJ 2PF4E 4G7HF 1E85A 4MVUA 1OCOC 3NG1A 2EIKC 4U5CE 2FGYA 1MMDA 3L8IA 3QVZA 3ATPA 3NYMA 4RD9A 5CI8A 1W2WA 2AVKA 3AG1C 1YZCA 4MVOA 1NG1A 3Q6NA 3WODF 5A6JA 1E83A 3B9QA 2OJED 2C03A 2QE9A 3H2UA 2OG2A 1YYJA 1FR0A 3R2PA 1MQVA 3OWTA 3U2MA 5EHHA 2JX0A 3SP1A 5DVWA 2AWYA 4ULWA 5COMA 3GORA 3C18A 1R5ID 2L6GA 4OIRF 3U9JA 1D1BA 3AQBA 3EH2A 4E0IA 3ZDLA 2X51A 2NUPB 3NRHA 1D0YA 3EGDA 2XRHA 3IQ5A 1BDJB 1M2OA 4DVYP 2LIGA 5CI9A 2R7SA 2NUPA 2GFHA 2HMQA 4JTDB 3RQGA 5JSLA 4CDAA 3GEHA 1D0ZA 3QW1A 3NMIA 1CGNA 4CX9A 3EH1A 3DJNB 1T6QA 2HUJA 2Y3GA 4O6NA 4DRIB 2R05A 1U0BB 4W8PA 2IYLD 4JW1A 3ASOC 3C63A 3RYLA 1G4WR 1DOWA 2LCHA 5AGFA 2KSFA 4WJ0A 4YJWA 5F5FA 3QW0A 5HV9A 1L3PA 3LS0A 2EPNA 3B0VC 1T01A 2Y69C 3OA1A 4EIYA 2PX3A 4MW3A 4IB4A 1WOLA 4EUKB 3SNHA 1H9TA 3U5SA 1WATA 2OJQA 1Q0DA 1ZHWA 2FFHA 3JCUQ 1T6UA 1A7VA 3O39A 3ZQYA 1NU7D 2ZXWC 3G50A 1K40A 3RVYA 1YAUO 2VCBA 3AOUA 4JTAB 2NSFA 3IQTA 1V74B 2IBFA 4XPYA 4ONSA 4NQFA 4N6CA 3BEHA 4CS9C 5BQGA 2I15A 4DOZA 5L3QA 1SZIA 3I5PA 5B3IA 3NYJA 5E3AA 2HFIA 5B1AC 3ZQVA 5KYYB 4NY3A 2HV7A 2NPUA 2WVOA 4JURI 4IRUA 2QTVA 1O5HA 2P0NA 3SXKA 4GEHA 3IQ6A 4KNVA 1YDIA 2NG1A 3U0CA 3ZG1A 4CS8C 3M4CA 3PMRA 3G4XA 3MYIA 2PP4A 4NTBA 4Z9JA 4CSAA 4K0DA 1L7CA 2P6VA 3LUTB 4ZLDA 3X2QC 3UGPA 3U2LA 3RFYA 2YZSA 3NMJA 4HE8D 3NMKA 1OQCA 2VC9A 2OKUA 1A7EA 1C03A 3AGUA 4J7YA 4NTAA 1RMVA 4CJOA 2XLDA 2YLIA 1YA7O 3C8ZA 4BG0A 3SXZA 2R9RB 4J32B 3RF3A 2R25A 1HE9A 3DZAA 4WGZA 4IJJA 3U9MA 3WHNA 4BJ5A 3EFOB 3LJBA 3L34A 1MMGA 1TWCA 3O6XA 4C3DA 2M64A 1D1AA 3ZTZA 3EFOA 4YL1A 2Z15A 2OEVA 4IAOA 3W2VA 1M6TA 4U5BE 5L3VA 1GS9A 2Q9CA 3UNGC 3R7CA 5KYUA 4D4NA 3Q6MA 4RBNA 3SYNA 1SMYF 5DLJA 2YL7A 3RQFA 1NU9C 1ST6A 1OCCC 2J9VA 4H4KC 4IGGA 4H54A 2NUTB 4DRJB 1Z5ZA 1ZU4A 2OEXA 4LDKA 2NUTA 5E3CA 1TFKB 2H8AA 3E9VA 5JVEA 3MBGA 1E86A 1HW1A 1A41A 3JZ0A 2W4BA 4CBEA 3T6GB 5COGA 4F4BA 3IPMO 5A6BD 5K0IA 2R7UA 2EILC 5KYXA 2LP4A 3LESA 3U8VA 3LLIA 4JE9A 4I44A 1HMDA 2J9WA 4UDVA 3K1IC 3U3BA 2VCCA 1Q0MA 2QUPA 3UMHA 2HMZA 4PFPA 3DAFA 4A2NB 4KI2A 1K04A 1OR2A 1WASA 2JPUA 4JC7A 3C7JA 3C8GD 3DM5A 3S90A 2IXOA 4Q5SF 3W4YA 3C8GB 2Y39A 3EPVA 4MVZA 3H65A 3V5XA 4G7ZF 3LS1A 3C8GA 4E18A 2ASRA 3I4UA 2W45A 4E7SA 4JKVA 5T3TA 3ZVRA 4MTOA 2Q00A 2IXMA 2H7VC 3AG3C 1ZW3A 3FMSA 2L6HA 4G0HA 2Y3DA 5COFA 5DQTA 3B71A 3EZIA 4OIOF 1VMAA 2DI3A 3TQOA 2XS8A 4AL1A 1CPQA 1ZVZA 1BBHA 2D4UA 3K1HA 1M2VB 4I3MA 3ZTMA 2L9JA 1LPEA 3Q7LA 4BPMA 3F47A 2R7QA 2XL4A 3W8IA 3UMKA 1M2VA 2YL3A 3VYWA 1KNYA 2ETSA 3MX3A 2MWQA 5D91A 3DD7A 1NLXA 1LS4A 2IXPA 3NYLA 1H9GA 4GYTA 4XWJA 1J8YF 1ORYA 2AU5A 1S7ZA 3L0IA 1YZAA 2EPLX 2DGJA 2YVKA 2KNHA 2ZXOA 3S9OA 1IW7F 4EWCA 4JJGA 5DS5A 2BE5F 2R7TA 1ZHXA 5F28E 4YWQA 1WWPA 2IOQA 3SZRA 3JTLO 1OW8A 1FTSA 1YA9A 2EPKX 4OIQF 2CDQA 1NZEA 3NKDA 2KQ9A 4RDAA 1HY5A 3S28A 2DYRC 4EBKA 5BQIA 3U8PA 1VLTA 2M4EA 4CIPA 3AG4C 1JMWA 2Y3BA 1XZQA 2LQGA 4BEJA 2XL8A 2EIMC 3EGXB 1OKKD 2J7PD 1A7DA 3KH2A 1SF8A 3DM9B 2ZXRA 4PJJA 3S27A 3TOLA 3HNJA 3U3FA 4DBQA 2YLGA 4U9DA 2CCYA 4JIOA 3WAQA 2ZPAA 4PJLA 4FAPB 2HSBA 1OKKA 2J7PA 1TWAA 3A11A 3QVYA 3TK0A 1E2XA 3FXHA 3DI5A 2YEVA 3HNLA 4MVQA 5JP7A 3TULA 3DE8A 3FVYA 1D1CA 2EPMX 1BR4A 2RSEB 1H7IA 1VYKA 3JYYA 3KL4A 1V4AA 4JTCB 4C3EA 3PDMP 3J06A 2PNOA 4MVSA 5HSWA 1I5NA 2CGEA 2KYHA 4E17A 4MS2A 3AQCA 4CSAC 2ICWG 2XLHA 4O7GA 4JCZA 4LERA 2MYSA 3RIPA 1WTYA 1ZYRF 2NSGA 5L0JA 3HKKA 5KYYA 3L8JA 3QZCA 1NFNA 1JAFA 2HJ3A 2J46A 2R7OA 2XM0A 2A69F 3KYIA 2L6FA 4ER9A 3TD7A 1OCZC 3I5QA 1T5OA 3JYHA 2A6HF 4BJ6C 5BUOA 4AE4B 1ZU5A 3N24A 3SXMA 4J30B 3SEOA 5E33A 3V5YA 5KYWB 3N0TA 4BJ5C 3S0XA 4NTFA 3ZIBA 1RXQA 4HFKB 4XEFA 4CDVA 4FESA 3LEOA 4YL0A 3K7DA 1VOMA 2EPOA 2G3VA 2LFDA 3DAGA 3O55A 2Q7RA 1ORSC 3KYJA 2A1DD 3M4BA 4YT5A 2WZLA 4ZLCA 3POVA 4N4WA 4X0RA 1LS1A 1U89A 1Z6AA 3ABKC 2GWWA 3L1MA 3N2ZB 3PHF2 4P9FA 1PV3A 1O87A 3HNIA 2EIJC 4O79A 3V7OA 4FX5A 4CS9A 4EBBA 1AUEA 2YRFA 1A0BA 3OEOA 3DWWA 2R7WA 2WZGA 3VF0A 1IZMA 1MNEA 2PX0A 3M1CB 4KBLA 4O6YA 4K7BA 3S84A 5L0DA 3UGOA 1MMNA 1NBBA 3GODA 2HS5A 3GEIA 2IM8A 1QVXA 2HV6A 4XQ1A 4L6RA 1HW2A 2R7XA 2Q9AA 3WG7C 2W9YA 2MHRA 1G4US 3GEEA 5TJ5E 4D4XA 3CSKA 4CS8A 1APCA 1DOVA 1LI5A 1E84A 4CIHA 5T3WA 1WGWA 1U6HA 4BJTA 1YARO 1BZ4A 5A6KA 3AJMA 1UG7A 1R4TA 3O10A 5CIVA 1ZHZA 2XSEA 3ABMC 1VTMP 3JSZA 4R32A 4JZAA 4LDQA 2OCCC 5T1DB 3AGTA 2XLVA 2YKZA 2B0JA 2A6EF 2D5RB 1Q0KA 4LDRA 4P9TA 4XEKA 2I8BA 3ABLC 1Y4CA 5DQZA 2H7OA 1CGOA 3B29A 3FOOA 1RJ9B 5B3SC 1TFOB 5A6BA 1RKCA 4JVSA 1ZW2A 3RH3A 2QNLA 2J9BA 3CZ6A 5BQHA 4CDYA 4WABA 4DRHB 1N1CA 2CNWD 1QPUA 4LLEA 1XZPA 3KPHA 3GWNA 4NCQA 1J8MF 1H6GA 1QSPA 2CNWA 1KU2A 2JD3A 3EHNA 2OU6A 1T9KA 4LACB 3GM1A 1VK5A 4CJGA 5JRAA 3RW0A 3W8HA 256BA 2H7BA 2KK1A 3KMIA 3ZWIA 2BC5A 2E87A 3TOMA 5JUAA 3JT1A 2B0HA 2WVQA 4Q4ZF 1Q0GA 1Z7Qc 1XWJA 1K05A 1JOGA 2AP3A 4MVMA 5L0FA 4JEBA 1VYIA 2PBEA
chains in the Genus database with same CATH topology
1YJGA 1F1MA 1GGQA 1G5ZA 2GA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJG A;  1F1M A;  1GGQ A;  1G5Z A;  2GA0 A; 
#chains in the Genus database with same CATH topology
 2XXA B;  4Z9H A;  5L0H A;  5A6A A;  1Y6D A;  2WL8 A;  3K33 A;  3TJ5 A;  3FDQ A;  1QLE C;  1EQ1 A;  2IXN A;  1WN0 A;  5EK0 A;  3MLG A;  2J0X A;  4KC9 A;  4YT8 A;  5L0I A;  4XLN F;  1RKE B;  3QTH A;  4MND A;  2QY9 A;  5JLI A;  3K1I A;  4XEV A;  1PCX A;  1NSG B;  1RKE A;  1BR2 A;  1TWH A;  3M79 A;  4G78 A;  3JRT A;  4JEA A;  3C62 A;  4OIN F;  2YHS A;  4IAQ A;  2X0C A;  3M15 A;  3KKB A;  4E0H A;  2CYD A;  2YQY A;  4U5E E;  1ORJ A;  4P6I C;  1FFT C;  1YJG A;  3HJC A;  4XPW A;  3HNK A;  2LFF A;  1Z3I X;  1OXB A;  2BL2 A;  3EGD B;  2HJM A;  4XLP F;  2WVN A;  3EGX A;  2XLW A;  3PCV A;  1O3U A;  3NKE A;  3UR3 C;  2AWC A;  1GQA A;  3EJN A;  2R7R A;  4E7Z A;  1LVK A;  4OD4 A;  3T6B A;  1LI7 A;  4HEA J;  4PR9 A;  4I1O B;  2UUI A;  4BJ1 A;  4W8K A;  1LIH A;  4EKW A;  2DYS C;  4QDL A;  5E2Q A;  4DBR A;  2ZD9 A;  1V54 C;  1EA8 A;  1QQ3 A;  1FMW A;  1OR3 A;  2P7V A;  3RQE A;  3MYF A;  4YN0 B;  2J9U A;  4XTK A;  3H2V A;  4KNW A;  3X1O A;  3RVZ A;  2R03 A;  2J0W A;  4YT4 A;  1PD0 A;  1QKR A;  3US6 A;  2VB6 A;  3GM3 A;  3RKO F;  5B1B C;  1SR2 A;  4DXW A;  4YT2 A;  2A68 F;  2LK4 A;  3ITF A;  4MTG A;  1M56 C;  1HE1 A;  1Z23 A;  4HFF B;  1AEP A;  3G4Z A;  1OW7 A;  1TKN A;  2XLM A;  4YL3 A;  2YL0 A;  3GWL A;  2G62 A;  4MW8 A;  3W2W A;  3EHM A;  4U5G A;  4A4A A;  4IAR A;  4M63 A;  3GAN A;  4QI0 A;  5KYN A;  1JPN A;  2A0U A;  5DS6 A;  3JSE O;  5L0C A;  1PD1 A;  2OQM A;  4AE4 A;  4DJ9 A;  1LE2 A;  5GPG B;  1OXK A;  4YK5 A;  3F46 A;  4XPX A;  4AK9 A;  3B0U X;  3LNR A;  5IY5 C;  5KYW A;  1UFB A;  4JRZ A;  1TR2 A;  4MVR A;  1YLM A;  3B0P A;  3FAP B;  4MTF A;  4PJM A;  1FFH A;  2YL1 A;  4IWB A;  3DMD A;  4OD5 A;  2KGO A;  5D92 A;  1D0X A;  2A0B A;  5F5H A;  5A69 A;  1VLS A;  2GA0 A;  3T9O A;  4CS7 A;  1T6I A;  2HZ8 A;  1I4Z A;  2HSQ A;  2XLO A;  4JCH A;  3EQL F;  4Q7C A;  3MFN A;  4J7T A;  4PJN A;  3UMI A;  4DVZ A;  3V5Z A;  4Z9I A;  1OW6 A;  2LD6 A;  4JJF A;  2R02 A;  1VB5 A;  3FAJ A;  2OOC A;  1EI7 A;  2L7A A;  3LEV A;  2KC3 A;  2Q9B A;  2V3C C;  2FAP B;  4B6I A;  1YVI A;  2GAQ A;  2J45 A;  1C02 A;  2ZXP A;  2RD9 A;  3IHU A;  1V55 C;  3JRM O;  4PFO A;  3S29 A;  1YYX A;  3VRC A;  2R7V A;  1JRA A;  1JR8 A;  2VCA A;  2WZF A;  4PAC A;  5AC5 A;  3ECS A;  1ZHY A;  3DKA A;  2XL6 A;  4AL0 A;  1F1M A;  2P1A A;  2Y3H A;  4U9E A;  5DS4 A;  3ZC4 A;  2J8W A;  3ZSU A;  4U5D E;  4U5F E;  1BR1 A;  1TWG A;  4BJ6 A;  5L0G A;  1LM3 B;  1MMA A;  2TMV P;  3BRJ A;  2EIN C;  2HKV A;  3GM2 A;  4G7O F;  4OIP F;  3DE9 A;  2L81 A;  1GGQ A;  1MND A;  1ZHT A;  3AG2 C;  3FHD A;  1HMO A;  3TJ6 A;  2W4M A;  1FMV A;  2VH3 A;  2XM4 A;  1SYQ A;  2LSE A;  2Q3T A;  3CQZ A;  3QMK A;  4MQ9 F;  1JPJ A;  3HLZ A;  3VAY A;  3K6B A;  3LLK A;  5KYU B;  1RCP A;  2PFD A;  2KW3 C;  5AC4 A;  4U5H A;  4I1M A;  3ASN C;  1RJ9 A;  4O6M A;  3SXY A;  3HTK C;  1LKX A;  1OCR C;  4QI2 A;  1EKY A;  3DXJ F;  3IQC A;  4FWV A;  5EGY A;  3FOP A;  1FNT c;  1S05 A;  1FAP B;  2P61 A;  5JT4 A;  4WGY A;  3E70 C;  2GDC A;  2VAS A;  4ANJ A;  5JS5 A;  4EHP A;  2XLE A;  3IEE A;  4PK4 A;  1TQG A;  5KYX B;  4EBJ A;  2Q4F A;  2C04 A;  1GM5 A;  1QZX A;  3NDB B;  2WB7 A;  4C7O B;  3LAY A;  3A9C A;  3EG9 B;  2CW0 F;  1I4Y A;  3EZH A;  1B68 A;  1M57 C;  2F22 A;  4GQH A;  4K1O A;  1ZZP A;  2DB4 A;  4LLC A;  3CAX A;  3T6J A;  3EG9 A;  4AX2 A;  1CGM E;  4C7O A;  1Q0F A;  1G5Z A;  2V26 A;  2G3K A;  3DJU B;  3VM6 A;  4C3B A;  5FCL A;  1C17 M;  3CEX A;  1Z63 A;  1KTM A;  2YLD A;  2YWA A;  3Q7G A;  4NC3 A;  5FZT A;  3T4R A;  4ULV A;  1AVO B;  1LE4 A;  2QLA A;  2KJG A;  2UUH A;  4N6H A;  2XXA A;  1CPR A;  1NFO A;  2XS1 A;  3K66 A;  2O9X A;  1G8X A;  3LNM B;  4N06 A;  4BEM J;  2PF4 E;  4G7H F;  1E85 A;  4MVU A;  1OCO C;  3NG1 A;  2EIK C;  4U5C E;  2FGY A;  1MMD A;  3L8I A;  3QVZ A;  3ATP A;  3NYM A;  4RD9 A;  5CI8 A;  1W2W A;  2AVK A;  3AG1 C;  1YZC A;  4MVO A;  1NG1 A;  3Q6N A;  3WOD F;  5A6J A;  1E83 A;  3B9Q A;  2OJE D;  2C03 A;  2QE9 A;  3H2U A;  2OG2 A;  1YYJ A;  1FR0 A;  3R2P A;  1MQV A;  3OWT A;  3U2M A;  5EHH A;  2JX0 A;  3SP1 A;  5DVW A;  2AWY A;  4ULW A;  5COM A;  3GOR A;  3C18 A;  1R5I D;  2L6G A;  4OIR F;  3U9J A;  1D1B A;  3AQB A;  3EH2 A;  4E0I A;  3ZDL A;  2X51 A;  2NUP B;  3NRH A;  1D0Y A;  3EGD A;  2XRH A;  3IQ5 A;  1BDJ B;  1M2O A;  4DVY P;  2LIG A;  5CI9 A;  2R7S A;  2NUP A;  2GFH A;  2HMQ A;  4JTD B;  3RQG A;  5JSL A;  4CDA A;  3GEH A;  1D0Z A;  3QW1 A;  3NMI A;  1CGN A;  4CX9 A;  3EH1 A;  3DJN B;  1T6Q A;  2HUJ A;  2Y3G A;  4O6N A;  4DRI B;  2R05 A;  1U0B B;  4W8P A;  2IYL D;  4JW1 A;  3ASO C;  3C63 A;  3RYL A;  1G4W R;  1DOW A;  2LCH A;  5AGF A;  2KSF A;  4WJ0 A;  4YJW A;  5F5F A;  3QW0 A;  5HV9 A;  1L3P A;  3LS0 A;  2EPN A;  3B0V C;  1T01 A;  2Y69 C;  3OA1 A;  4EIY A;  2PX3 A;  4MW3 A;  4IB4 A;  1WOL A;  4EUK B;  3SNH A;  1H9T A;  3U5S A;  1WAT A;  2OJQ A;  1Q0D A;  1ZHW A;  2FFH A;  3JCU Q;  1T6U A;  1A7V A;  3O39 A;  3ZQY A;  1NU7 D;  2ZXW C;  3G50 A;  1K40 A;  3RVY A;  1YAU O;  2VCB A;  3AOU A;  4JTA B;  2NSF A;  3IQT A;  1V74 B;  2IBF A;  4XPY A;  4ONS A;  4NQF A;  4N6C A;  3BEH A;  4CS9 C;  5BQG A;  2I15 A;  4DOZ A;  5L3Q A;  1SZI A;  3I5P A;  5B3I A;  3NYJ A;  5E3A A;  2HFI A;  5B1A C;  3ZQV A;  5KYY B;  4NY3 A;  2HV7 A;  2NPU A;  2WVO A;  4JUR I;  4IRU A;  2QTV A;  1O5H A;  2P0N A;  3SXK A;  4GEH A;  3IQ6 A;  4KNV A;  1YDI A;  2NG1 A;  3U0C A;  3ZG1 A;  4CS8 C;  3M4C A;  3PMR A;  3G4X A;  3MYI A;  2PP4 A;  4NTB A;  4Z9J A;  4CSA A;  4K0D A;  1L7C A;  2P6V A;  3LUT B;  4ZLD A;  3X2Q C;  3UGP A;  3U2L A;  3RFY A;  2YZS A;  3NMJ A;  4HE8 D;  3NMK A;  1OQC A;  2VC9 A;  2OKU A;  1A7E A;  1C03 A;  3AGU A;  4J7Y A;  4NTA A;  1RMV A;  4CJO A;  2XLD A;  2YLI A;  1YA7 O;  3C8Z A;  4BG0 A;  3SXZ A;  2R9R B;  4J32 B;  3RF3 A;  2R25 A;  1HE9 A;  3DZA A;  4WGZ A;  4IJJ A;  3U9M A;  3WHN A;  4BJ5 A;  3EFO B;  3LJB A;  3L34 A;  1MMG A;  1TWC A;  3O6X A;  4C3D A;  2M64 A;  1D1A A;  3ZTZ A;  3EFO A;  4YL1 A;  2Z15 A;  2OEV A;  4IAO A;  3W2V A;  1M6T A;  4U5B E;  5L3V A;  1GS9 A;  2Q9C A;  3UNG C;  3R7C A;  5KYU A;  4D4N A;  3Q6M A;  4RBN A;  3SYN A;  1SMY F;  5DLJ A;  2YL7 A;  3RQF A;  1NU9 C;  1ST6 A;  1OCC C;  2J9V A;  4H4K C;  4IGG A;  4H54 A;  2NUT B;  4DRJ B;  1Z5Z A;  1ZU4 A;  2OEX A;  4LDK A;  2NUT A;  5E3C A;  1TFK B;  2H8A A;  3E9V A;  5JVE A;  3MBG A;  1E86 A;  1HW1 A;  1A41 A;  3JZ0 A;  2W4B A;  4CBE A;  3T6G B;  5COG A;  4F4B A;  3IPM O;  5A6B D;  5K0I A;  2R7U A;  2EIL C;  5KYX A;  2LP4 A;  3LES A;  3U8V A;  3LLI A;  4JE9 A;  4I44 A;  1HMD A;  2J9W A;  4UDV A;  3K1I C;  3U3B A;  2VCC A;  1Q0M A;  2QUP A;  3UMH A;  2HMZ A;  4PFP A;  3DAF A;  4A2N B;  4KI2 A;  1K04 A;  1OR2 A;  1WAS A;  2JPU A;  4JC7 A;  3C7J A;  3C8G D;  3DM5 A;  3S90 A;  2IXO A;  4Q5S F;  3W4Y A;  3C8G B;  2Y39 A;  3EPV A;  4MVZ A;  3H65 A;  3V5X A;  4G7Z F;  3LS1 A;  3C8G A;  4E18 A;  2ASR A;  3I4U A;  2W45 A;  4E7S A;  4JKV A;  5T3T A;  3ZVR A;  4MTO A;  2Q00 A;  2IXM A;  2H7V C;  3AG3 C;  1ZW3 A;  3FMS A;  2L6H A;  4G0H A;  2Y3D A;  5COF A;  5DQT A;  3B71 A;  3EZI A;  4OIO F;  1VMA A;  2DI3 A;  3TQO A;  2XS8 A;  4AL1 A;  1CPQ A;  1ZVZ A;  1BBH A;  2D4U A;  3K1H A;  1M2V B;  4I3M A;  3ZTM A;  2L9J A;  1LPE A;  3Q7L A;  4BPM A;  3F47 A;  2R7Q A;  2XL4 A;  3W8I A;  3UMK A;  1M2V A;  2YL3 A;  3VYW A;  1KNY A;  2ETS A;  3MX3 A;  2MWQ A;  5D91 A;  3DD7 A;  1NLX A;  1LS4 A;  2IXP A;  3NYL A;  1H9G A;  4GYT A;  4XWJ A;  1J8Y F;  1ORY A;  2AU5 A;  1S7Z A;  3L0I A;  1YZA A;  2EPL X;  2DGJ A;  2YVK A;  2KNH A;  2ZXO A;  3S9O A;  1IW7 F;  4EWC A;  4JJG A;  5DS5 A;  2BE5 F;  2R7T A;  1ZHX A;  5F28 E;  4YWQ A;  1WWP A;  2IOQ A;  3SZR A;  3JTL O;  1OW8 A;  1FTS A;  1YA9 A;  2EPK X;  4OIQ F;  2CDQ A;  1NZE A;  3NKD A;  2KQ9 A;  4RDA A;  1HY5 A;  3S28 A;  2DYR C;  4EBK A;  5BQI A;  3U8P A;  1VLT A;  2M4E A;  4CIP A;  3AG4 C;  1JMW A;  2Y3B A;  1XZQ A;  2LQG A;  4BEJ A;  2XL8 A;  2EIM C;  3EGX B;  1OKK D;  2J7P D;  1A7D A;  3KH2 A;  1SF8 A;  3DM9 B;  2ZXR A;  4PJJ A;  3S27 A;  3TOL A;  3HNJ A;  3U3F A;  4DBQ A;  2YLG A;  4U9D A;  2CCY A;  4JIO A;  3WAQ A;  2ZPA A;  4PJL A;  4FAP B;  2HSB A;  1OKK A;  2J7P A;  1TWA A;  3A11 A;  3QVY A;  3TK0 A;  1E2X A;  3FXH A;  3DI5 A;  2YEV A;  3HNL A;  4MVQ A;  5JP7 A;  3TUL A;  3DE8 A;  3FVY A;  1D1C A;  2EPM X;  1BR4 A;  2RSE B;  1H7I A;  1VYK A;  3JYY A;  3KL4 A;  1V4A A;  4JTC B;  4C3E A;  3PDM P;  3J06 A;  2PNO A;  4MVS A;  5HSW A;  1I5N A;  2CGE A;  2KYH A;  4E17 A;  4MS2 A;  3AQC A;  4CSA C;  2ICW G;  2XLH A;  4O7G A;  4JCZ A;  4LER A;  2MYS A;  3RIP A;  1WTY A;  1ZYR F;  2NSG A;  5L0J A;  3HKK A;  5KYY A;  3L8J A;  3QZC A;  1NFN A;  1JAF A;  2HJ3 A;  2J46 A;  2R7O A;  2XM0 A;  2A69 F;  3KYI A;  2L6F A;  4ER9 A;  3TD7 A;  1OCZ C;  3I5Q A;  1T5O A;  3JYH A;  2A6H F;  4BJ6 C;  5BUO A;  4AE4 B;  1ZU5 A;  3N24 A;  3SXM A;  4J30 B;  3SEO A;  5E33 A;  3V5Y A;  5KYW B;  3N0T A;  4BJ5 C;  3S0X A;  4NTF A;  3ZIB A;  1RXQ A;  4HFK B;  4XEF A;  4CDV A;  4FES A;  3LEO A;  4YL0 A;  3K7D A;  1VOM A;  2EPO A;  2G3V A;  2LFD A;  3DAG A;  3O55 A;  2Q7R A;  1ORS C;  3KYJ A;  2A1D D;  3M4B A;  4YT5 A;  2WZL A;  4ZLC A;  3POV A;  4N4W A;  4X0R A;  1LS1 A;  1U89 A;  1Z6A A;  3ABK C;  2GWW A;  3L1M A;  3N2Z B;  3PHF 2;  4P9F A;  1PV3 A;  1O87 A;  3HNI A;  2EIJ C;  4O79 A;  3V7O A;  4FX5 A;  4CS9 A;  4EBB A;  1AUE A;  2YRF A;  1A0B A;  3OEO A;  3DWW A;  2R7W A;  2WZG A;  3VF0 A;  1IZM A;  1MNE A;  2PX0 A;  3M1C B;  4KBL A;  4O6Y A;  4K7B A;  3S84 A;  5L0D A;  3UGO A;  1MMN A;  1NBB A;  3GOD A;  2HS5 A;  3GEI A;  2IM8 A;  1QVX A;  2HV6 A;  4XQ1 A;  4L6R A;  1HW2 A;  2R7X A;  2Q9A A;  3WG7 C;  2W9Y A;  2MHR A;  1G4U S;  3GEE A;  5TJ5 E;  4D4X A;  3CSK A;  4CS8 A;  1APC A;  1DOV A;  1LI5 A;  1E84 A;  4CIH A;  5T3W A;  1WGW A;  1U6H A;  4BJT A;  1YAR O;  1BZ4 A;  5A6K A;  3AJM A;  1UG7 A;  1R4T A;  3O10 A;  5CIV A;  1ZHZ A;  2XSE A;  3ABM C;  1VTM P;  3JSZ A;  4R32 A;  4JZA A;  4LDQ A;  2OCC C;  5T1D B;  3AGT A;  2XLV A;  2YKZ A;  2B0J A;  2A6E F;  2D5R B;  1Q0K A;  4LDR A;  4P9T A;  4XEK A;  2I8B A;  3ABL C;  1Y4C A;  5DQZ A;  2H7O A;  1CGO A;  3B29 A;  3FOO A;  1RJ9 B;  5B3S C;  1TFO B;  5A6B A;  1RKC A;  4JVS A;  1ZW2 A;  3RH3 A;  2QNL A;  2J9B A;  3CZ6 A;  5BQH A;  4CDY A;  4WAB A;  4DRH B;  1N1C A;  2CNW D;  1QPU A;  4LLE A;  1XZP A;  3KPH A;  3GWN A;  4NCQ A;  1J8M F;  1H6G A;  1QSP A;  2CNW A;  1KU2 A;  2JD3 A;  3EHN A;  2OU6 A;  1T9K A;  4LAC B;  3GM1 A;  1VK5 A;  4CJG A;  5JRA A;  3RW0 A;  3W8H A;  256B A;  2H7B A;  2KK1 A;  3KMI A;  3ZWI A;  2BC5 A;  2E87 A;  3TOM A;  5JUA A;  3JT1 A;  2B0H A;  2WVQ A;  4Q4Z F;  1Q0G A;  1Z7Q c;  1XWJ A;  1K05 A;  1JOG A;  2AP3 A;  4MVM A;  5L0F A;  4JEB A;  1VYI A;  2PBE A; 
#chains in the Genus database with same CATH homology
 1YJG A;  1F1M A;  1GGQ A;  1G5Z A;  2GA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...