3ECSA

Crystal structure of human eif2b alpha
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
307
structure length
279
Chain Sequence
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the alpha subunit of human translation initiation factor 2B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Translation initiation factor eIF-2B subunit alpha
total genus 86
structure length 279
sequence length 307
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1070 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ecsA01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 3ecsA02
2YRFA 2A0UA 3A9CA 1T5OA 1W2WB 1VB5A 1T9KA 3A11A 4LDRA 5DBOA 4ZEOA 4LDQA 3VM6A 4ZEMA 2YVKA 3ECSA
chains in the Genus database with same CATH superfamily
4C6SA 2ZB3A 2R85A 5EXXA 1II8B 2DMRA 2VDQB 2EX0A 2SKEA 3QKRA 3OMWA 4AQDA 2PL9A 1DUIA 2IOYA 3G88A 4UTVA 5COBA 5BMVA 5JAZA 1UKBA 4HEHA 1X70A 1VLZA 4LWPA 5ED0A 3B8EA 3O8NA 1ZVJA 5TJ9A 4HNVA 3K73O 3GXBA 4LX0A 5C51B 1K4YA 1YFKA 3NBZC 3P27A 3IKLA 2CFCA 1QR2A 2ET6A 1NN5A 4PYOA 1GRVA 5IBPA 2NU8A 3UHPA 2VTBA 3AHEA 1XMSA 1PNOA 4RMHA 5EAIA 4UNPA 4R1OA 3S99A 4Q9IA 2ECPA 4BNVA 1Z36A 2NXCA 2WUDA 3U3KA 3VYWA 5FBQB 3D3EA 1Z08A 1A96A 1ADJA 3BMNB 3ONFA 2XCRB 2FMXA 1II0A 4A8JA 3ZBQA 4GX1A 2IZZA 5FBLB 2AC4A 4RMJA 4X8LA 3ANYB 4GI1A 4NQZA 4Q3NA 4YBZA 4G25A 4HRXA 4X8OA 3UW3A 3JSEO 4UTOA 3R41A 5AW0A 1V16A 2YWCA 4DQLA 4N06A 1YI8A 3H6KA 1XRPA 4RQBA 3RKRA 3PXBA 4CQMD 4KTTE 4K7BA 4L8YA 4PGFA 2OZKA 2IYWA 4OUDB 1YZQA 4DCSA 3L7YA 3AJEA 3OT5A 5JNRA 4JT2A 3LHSA 3FSGA 3DO6A 4BAUA 1AQIA 2GJKA 3HGMA 2QLFA 1M8FA 3GJTA 3A6EA 4ZAFA 3A6PC 1P80A 4E51A 3NHUA 3T6JA 1RP1A 2CDRA 5AVSA 4FZVA 5ALSA 4BE9A 3C43A 2C84A 2II6A 2FPUA 2ECKA 3AUYA 3STXA 5ITZB 5JECA 1UMKA 2D54A 2XITA 3CVUA 4IIFA 1FC0A 2I33A 5JSUA 5U9CA 2NPFA 5IM4F 5AQ1A 1U8ZA 3JVUA 4LLCA 4LXXA 4AY3A 3FKSD 3GT4A 2C2HA 2GKGA 3LP6A 4WFQA 3MFNA 4BMZA 4MOWA 2EHDA 4I5EA 1K5GA 1FFDA 5JLJA 1TEZA 4D3XA 2I29A 1JI3A 2DTDA 1PAUA 3VTAA 3ZQ6A 4CJXA 1L5ZA 2VAMA 4IP0A 3PFWO 3ZKAA 4CKXA 4Z54A 3GEGA 2B8JA 2QL6A 1C5KA 1UBKS 1VLJA 3RKSA 5B5SA 4FLFA 1ZM2A 3IAM6 1DIBA 1KEWA 3D6AA 1LTHR 4MGZR 2HJHA 2PZAA 4CG1A 3ZIBA 4PNEA 5B3KA 4R0VA 5K4GA 3U37A 1LSUA 5CA1F 3M3PA 2HUNA 3CWZA 4BUZA 4D9JA 2WUWE 3NT4A 2W90A 4KQXA 4OL9A 4D57A 5K1ZA 4EHFA 4WUVA 3S3TA 3V4PB 3NWPA 5DW0A 3HVUA 2VCYA 2VJNA 2WF6A 2JLQA 3J7AC 4IDPA 5H5JA 4BNLA 2DBRA 2QR3A 1N9KA 5HOEA 4MR7B 1KYIA 5EQFA 3DLAA 3H11B 4ZVKA 4CI9A 4R8LA 3HDJA 4JKIA 4RNDB 1N77A 1BN6A 4MDEA 4KC0A 4G24A 2OWDA 1S2IA 1TKNA 1VTKA 2QPTA 2OFPA 3R4VA 1KQNA 3SLKA 1K0FA 1L3CA 2PRZA 1P8AA 1J0CA 2VT6A 2OZLB 4N7MA 4PQYA 5A4KA 3DFFA 2J4DA 3LLUA 5AKKA 2J0SA 2XYQA 4TMTA 5I9BA 3TKAA 4JBGA 1FRVA 821PA 5D1HA 4XD7D 4HEA6 3L18A 4OBBA 4W7IA 5AI6A 2Q0SA 3KBOA 3PPWA 1KARA 1A77A 3T94A 4D74A 4EG0A 2R9VA 1SF8A 1I9GA 2AQ8A 4B76A 4TTJA 3NIBA 2GPNA 3UK2A 2XWPA 4H3KB 3WJ2A 1JDBB 2FX3A 2A1DD 1XUOA 1KC3A 2R7XA 1QOQB 2B82A 3GGPA 3HCCA 4PHFA 1R0YA 3N86A 3UH1A 4KIWA 4YP1A 3D3WB 2NVWA 1Z26A 3PC2A 4O6NA 1LDYA 2JARA 1QOZA 4KJZA 4CGYA 4IIVA 1ZUIA 4RIHA 5BN5B 2M6KA 2H5IA 2CHVA 4HNSA 4M38A 5D3ZA 5KOHA 3FN4A 2VG8A 1ZM4A 2VKQA 2ZZNA 1ADCA 2KX7A 4GFDA 3BL8A 1NIJA 3EJ6A 2J9FA 3GP3A 3PZRA 5CYPA 3VNSA 2WTBA 2W6OA 4H6XA 4P4UA 1JN0A 3TBFA 4BN5A 4V1CB 1HDEA 1QFJA 4HL6A 3QHQA 3CRZA 4K28A 3SPXA 1ABEA 2J3MA 5TMEA 4NFYA 2ID7A 4WBNB 4YK7A 2FJ0A 1SCKA 3G8BA 2GFIA 4QPCA 1B73A 5AKJA 4J03A 4QGAA 1RW4A 2Q9UA 3BA1A 3DKVA 1XL1A 4AVYA 4QGHA 2ZUCA 4QXOA 3BBLA 3KUDA 4MV5A 2HDWA 2Q6OA 2QG9A 4LSZA 4PLPA 5K3SA 5AKZA 4DG9A 1P4SA 2F2TA 2VDJA 4M60A 4M1OA 3KEOA 3T5TA 3H0EA 2HLPA 5DTRA 1D6MA 2H1RA 5KQSA 1HNNA 2O8NA 4QATA 4XWTA 1IHDA 3FUUA 2FDXA 4ZK2A 3I92A 1OCEA 2C5LA 3GZJA 4FN4A 2VSOA 4M99A 4X20B 3B60A 3RT9A 3WOVA 1F60A 1QP0A 4QPPA 1S4QA 4V0SA 3ZCPA 1QHSA 2HMYB 1N1EA 1MRSA 2YY5A 1U7WA 4LHZA 5FP0A 5KYYA 1JLKA 1Z12A 1JG2A 1H9AA 5ABPA 3THWB 4MUBA 4OATA 5TE9A 2CDQA 1M1YE 5T67A 4BDSA 3K71B 1QHEA 3K9BA 2VDVE 4P92A 2H6EA 4C07A 6GPBA 1QGED 1TA4A 3OQPA 1L4FA 1KYZA 1RKQA 4ZDKA 5BMVB 3OE7D 2ISQA 2PN1A 4PHGA 1T3GA 4TZKA 1DFHA 1XZKA 4H9GA 4EYKA 3S8YA 1TGYA 2EJTA 3Q9SA 5EP4A 4E0BA 1Z0ZA 1GQQA 3ZTYA 1Z0DA 2XRZA 5F28E 1TJ4A 2XXJA 3K0AB 4BFZA 1K2VN 4TTAA 4N6GA 4ZO4A 5JPCA 4YCDA 3JALB 3DOHA 4A2CA 2JZOA 4E21A 4PY2A 2ZIZA 4O4LF 4TT3A 4DMMA 1YVPA 3N8NA 2JGLA 3OJEA 4XWGA 3U6BA 2DFNA 3P9SA 4CNBA 2XNDA 2POQX 4DXWA 1BOFA 3DGFC 4LKOA 3U17A 5JYDA 1V54C 4ZI2A 4Q7LA 2QT9A 5F98A 4DRHB 1PWHA 4NWIA 1K88A 2F9FA 1XMXA 3KEMA 1S2GA 5KINB 1MOSA 1DTEA 1FMVA 1I32A 3EQ7A 1W96A 2R8XA 2PSJA 4UULA 4EA9A 3RF3A 4H7DA 5CFRA 2YJZA 5DBFA 4CJOA 1I0IA 1Y6GA 3QBTA 2PCLA 2BI7A 3DWEX 1KS9A 1VE5A 3RFFA 2CSUA 4R71A 1JR6A 1I5EA 3TS1A 1ZA1A 4HVAA 3IBTA 3JD4A 4GYYA 4O79A 1ZNYA 1JRAA 3V8BA 4FHCA 2PUDA 3CZQA 3EYAA 4OQXA 1E7WA 4EHJA 1JJFA 4JGGA 4MW8A 2OO5A 2XOKD 1G1AA 2FPKA 3ESXA 5I8ZA 4EPVA 2VL7A 3DCJA 4CFYA 5I4BA 5FI0B 1K8XB 3L7KA 4WESB 1NFRA 4B6SA 3MBKA 5KSOA 3CY6A 3NUGA 2QAGC 3ZOZA 1UK8A 1WXXA 1YH3A 2G8LA 1GLVA 3N0TA 1UQUA 3LNRA 1PGOA 3BH7A 1FAPB 3HTXA 5EA2A 4BVEA 1AKVA 1IRXA 3HWWA 3ZDZB 1J4AA 4FOPA 4QWMA 3TZQA 4XPWA 1RACA 3JR7A 1Q92A 3N0WA 3HVKA 3U31A 3GLFA 2ISCA 3AO0B 3ECSA 1IWOA 2NZUG 1FDUA 3O3NB 2VDNB 1RPNA 3N6RA 1NJFA 4IL5A 3ODPA 1L3IA 1APCA 2VJLA 4HDRB 5BOSB 2EBFX 4G4SP 4MICA 4N41A 3GR6A 2EVWX 1RMVA 4PAMA 3IUYA 2ZJAA 1B8UA 2VFAA 3LZDA 4UPEA 3IKVA 4EKNB 2QLTA 5LB4A 2QTVA 2D4HA 3E61A 4LJRA 2ZWVA 1GKLA 2VYND 4UVEA 3X1MA 2WVGA 1DVRA 2MYTA 3VU8A 4X24A 5HV9A 1CR6A 2OZVA 1VPVA 1QH8A 2D4UA 5FFMA 3T7IA 3NM5A 4QECA 5TF4A 5KYWB 5BW5A 4QA9A 3GAFA 2OO3A 1EHYA 2YMQA 3IVXA 5DH9A 3GFTA 2AJDA 4HLUA 3NC0C 1PFWA 1PWYE 2NXJA 4U1RA 2UUAB 4U2KA 4C76A 1SXJC 4EGFA 2HKIA 4OH7A 4AMVA 3SKYA 3A6FA 1EKYA 2J45A 1F2UA 1HSOA 1TZ2A 3KZNA 1WQ4A 3CRNA 1NUSA 3EH1A 1UF9A 4HE8D 1SWVA 2JIBA 1X1EA 2RHWA 2J5XA 1WRBA 3CJTA 1QJCA 4V38A 1OYYA 5LDGA 1Q20A 2C94A 3DOFA 1MDFA 3UKOA 4YJFB 4WLOA 1BJTA 5CM8B 5FNZA 4D4NA 4RTSA 2WHYA 4JVSA 1DAOA 3WB9A 2NU7B 2IU6A 3K2IA 4ROTA 4YJ2F 3BXGA 3OEED 1V7QA 1CUAA 3V4FA 4Y0AA 2Y93A 5DSZA 2JKVA 2A4KA 1IXKA 2XUGA 2IZ6A 3IT3A 4MNTA 5G40A 2X0EA 1O0CA 4U5HA 1XQ6A 2YQ5A 4IV5A 4P22A 2LCIA 1WZEA 1Z3CA 4EJMA 2C8VA 3ZU3A 3LQRA 4IJKA 3G82C 2BUBA 3EZNA 1IZ9A 3W2EA 1HG1A 1M8PA 3B3QA 1NJ2A 6ABPA 4CQNA 1G8HA 4U5QA 2JHFA 2CXHA 2L0XA 3H1GA 4TS3A 4YWQA 4CM7A 3I2HA 4HWGA 1TL7C 3IPRA 1W9HA 1T1GA 2EKPA 1NSGB 2FSVC 1XJ0A 2I2AA 2ZYAA 2H2GA 3PPVA 4TV8F 3PHHA 1UFVA 5CM9C 3ZQ4A 3CPHA 5JUAA 3DTNA 4JEMA 2G8NA 5L0JA 2CXNA 1UMCB 4IFIA 2LIGA 2XWSA 5EZQA 5SV2A 1J20A 4LYAA 4J3NA 1V8OA 4HBZA 3T9DA 4A7PA 5K0BA 4L9RA 4EZEA 8OHMA 5B58C 1EPUA 3PHGA 3DYIA 1C9YA 2ZROA 4KV7A 3WL8A 2CEAA 2REQB 4JLMA 1VTMP 4NH4A 5DU2A 1FNSA 3HV0A 3HEAA 3H0CA 4KP7A 3PHF2 3H99A 4UC0A 1G64A 1FS5A 3EPJA 3GCGA 1M0EA 4ZHQB 2JIZD 3AV0B 3FIUA 3BE4A 3H1TA 3FMPB 4F92B 5KU1A 2R6FA 2VYFA 5COMA 1A3CA 1R6DA 1VBKA 1N3BA 3KX2A 4QJBA 4XUCA 2EZTA 1E94E 4RO0A 1PL6A 3OJ0A 2RH4A 1PWEA 2PRKA 4MWSA 2G40A 3FPGA 3GEEA 1CXZA 3G1UA 4IFTA 1QZZA 1EFCA 1XTJA 4ISBA 5L4NA 5K8JB 5AIAA 3ASOC 1NI4A 2EATA 2A78A 3HO8A 3T7EA 5CA1A 1J33A 4JP3A 2ZXPA 2GPAA 3EQ9A 4H27A 1D5WA 4AK9A 2LWIA 2AYZA 3AIOA 1D7OA 1G4AE 3KB1A 1YE3A 4R31A 3MJTA 5C8DA 1X7DA 4WASA 1JDNA 4YXFA 2D1QA 2X9LA 2Z57A 4GRDA 2ZUSA 1MEJA 1S2NA 4GMXA 4Y7CA 3ILYA 4AN0A 1BC5A 2NZYA 4NSNA 3EF0A 4OKNA 4XUDA 3K8ZA 1VE1A 3B70A 4L5BA 2GLXA 3JQCA 1PTKA 1PTJC 2YYZA 2YXDA 5EZ6B 3SZMA 4R32A 1X0XA 1YVRA 2OHFA 3FYHA 4WNAA 3VBEA 1B16A 3NCHA 4IMPA 1IWBB 4BFVA 3EC1A 1SHTX 3A4VA 3AFOA 2H3HA 4F3TA 1SIOA 1TZMA 4TKLA 3JD1A 4FS3A 3VKWA 4ALKA 3JT1A 3M1LA 5DM2A 1IN4A 1X7WA 3II6X 2QAGA 2QIOA 2RBGA 1QYWA 1UJBA 3PFGA 2KHZA 3WWYA 2A0BA 4AXBA 4YPFA 1I5OA 2MWQA 4IKOA 4XX1A 3AG3C 2C42A 5AJUA 3PXAA 2FETA 3QSYA 2F4NA 1S3FA 3CKYA 1DDIA 1N7HA 5HHTA 2I80A 1DO8A 2OV3A 1MC5A 4LRXA 3JQAA 4XB2A 4YL0A 4BEJA 2XTAA 1XFDA 3MAAC 4JL6A 1NV9A 4A26A 3ZJ4A 1BZYA 2Q49A 4AN1A 2PBZA 1XNHA 2D6FA 1OLXA 1E1RD 2BGMA 2XA1A 3PCTA 1DRKA 2GZ3A 1ZXLA 1WPXA 1X3LA 4KDCA 3U81A 1NKTA 1YA4A 2Y0DA 4GXRA 1H1LB 1QORA 3K9NA 5ALPA 2UXCB 1HE9A 1XRSB 1SU7A 1Z6GA 1RJ9B 2VS1A 3GJQA 3TCKA 3R9KA 3TLAA 3W79A 3BF8A 1F20A 3GY0A 1XKLA 2XZTA 1GZ7A 2WLTA 5LXTA 3GPDG 3RUAA 1DJPA 4FNGA 1IW7F 3AF2A 3NIDB 3O8OA 1Z0UA 4CM4A 2IITA 2WLSA 1U7HA 3NWBA 4L5AA 4GZMA 1HMYA 4HMQA 3NU1A 4TMWA 2XTJA 3NHYA 4L2IA 4EW3A 5JZMA 1DG3A 4IHJF 1KORA 1LPSA 2EYUA 2VHQA 2XRMA 1D9ZA 3GQBA 2D1YA 1TFRA 2ZLBA 3DMFA 4WESA 1ZD4A 4ARVA 1DOAA 2AG5A 2H7VA 3O2NA 1DI0A 2O3JA 1JLSA 5FJIA 4DY6A 1UWLA 2G0AA 2PJUA 3FBWA 4JIOA 1NF8A 3JWHA 3ZWVA 4URXR 5KX5B 3D6HA 1ANKA 1L7NA 3O4VA 3Q6IA 4XFJA 4XEKA 3ZHBA 3M3HA 4DYVA 1P45A 2VHXA 3OMXA 4FINA 1IY9A 3OE5A 3KQOA 2I6SA 5B3IA 4ARUA 3I01M 1HQCA 3S2GA 4M9RA 4DCMA 2X4IA 4HAVA 1U0BB 3DDZX 5CNKA 2VRWA 3LUPA 3VQTA 4AN4A 1G8JA 1JP7A 1UDAA 1YV9A 2YH2A 3FNBA 3WLRA 3EPKA 2BUCA 4Q34A 3BA6A 5KMGA 3KE8A 4JZKA 2AUMA 2ZE6A 2WJ4A 1C9NA 1IN5A 3CLTD 2O7RA 4ZCLA 2F55A 3KSMA 3EEFA 5HFAA 3LJBA 3DZDA 1CHNA 1TRKA 1P2FA 4P4NA 2IPMA 3W9UA 3ETLA 4YRSA 2P9ZA 2EFCB 1DOZA 1IUOA 5TMBA 5KNCD 1T5BA 2CNDA 2D0PB 2PMWB 3N3AC 5A6AA 4WCFA 1DRWA 4IOJA 2VRCD 2ZJYA 1AGYA 3GH3A 5E2BA 2I5PO 3B1WA 4AY6A 3NHBA 2HCRA 2XAUA 1H6AA 2Z2JA 3A10A 4J1TA 4YMWA 5GVSA 4HV4A 1AMOA 2VHCA 3NTUA 2BF4A 2D1RA 3L6RA 1N6HA 3TSYA 2JLYA 2O8BA 2GDCA 1WY7A 2D0OB 3NDPA 1FFWA 2JC3A 1YF3A 2PMDA 1FFCA 4RBNA 1S2MA 2RGGA 4E22A 3WBBA 4C6TA 2XLDA 3ID6C 5AVOA 4IS3A 4DKXA 4E07A 4R54A 4PRKA 3BAFA 1VJDA 3QVSA 4OINF 1H05A 3U7IA 5KVAA 5AC5A 3BL6A 1FYVA 5COAA 4JQCA 3L02A 1GUZA 3KT0A 3RRYA 3BS4A 1DGQA 1VDZA 2FUEA 4C22A 3B9PA 3DNPA 3VR2A 5HKBA 5FLXA 1G3UA 4K87A 4RVUA 1TZCA 3HVJA 4YWHA 2NP7A 1U0EA 2J3JA 4D56A 1P1HA 4LZZA 2ONCA 4ZOCA 2OFFA 1ZLXA 4RA9A 1ZC4A 5JCOA 1QDEA 3L07A 2BGIA 4N3BA 3P5BA 4Z1MD 3PCVA 3KYIA 3AR9A 3D1VA 3DT6A 2XUAA 1HLDA 3V7FA 4M1SA 1G2QA 1XTUA 1BDMA 3Q3VA 3FOAA 4OAQA 1FXUA 4S1WA 5C53B 2FOLA 1VKNA 2PUVA 2ST1A 2KQUA 2YYYA 1ZGAA 3B36A 3HU3A 5HILA 4XR9A 2NV0A 5DVZA 3KJHA 4FLMA 4LXTA 2CCYA 4TL7A 1QIMA 3T3DA 2VSNA 1MA3A 2IOFA 3G4XA 3R74A 3ZLTA 2N3ZA 5FHQA 4DVGA 4XPIB 1KMHB 3PJGA 1U8XX 5KVVA 5C52B 3WB2A 3OEHD 2BFFA 1G8AA 2HWWA 1PZHA 2AWYA 1F14A 5G02A 3WTCA 4MRAA 1A8SA 3IPCA 1TAUA 1KFEB 1G8FA 4TLDA 3R23A 3GK3A 2UZ1B 1E2PA 1QKIA 3O92A 2HV6A 3QUSA 4MR8A 4UXIA 3STYA 2OV4A 3HKEA 2EW1A 4LJ6A 1NVVQ 1U7OA 1VCHA 5DO9A 3R7LA 2WFLA 1KAHA 1U7PA 3O82A 3VOAA 5HQ3B 3LRTA 4EEZA 1DCMA 1NWCA 2QNIA 4IIBA 4LVOA 5AI8A 5CIVA 3X43A 5LQNA 1CSEE 5F3RA 1BXZA 3R75A 2C4HA 3X0DA 1FP4A 4C2BA 4V3CA 3OIYA 3SHWA 2ORVA 1K6EA 2I76A 3ZV7A 1NF2A 2J9ZB 3FAKA 3LIPA 3UKJA 2FCRA 3OFVA 1CR4A 4N3CA 4DIMA 2YV3A 4I36A 1XZMA 4EWLA 1WF3A 1OI2A 2ZRMA 5JVDB 2XHZA 3VUFA 5JS6A 2VUHB 4LDRA 3LL7A 5DW3A 4XYMA 5FR2A 4N8EA 2PGDA 1IBKB 2C2WA 3PNOA 2RHRA 1KDPA 3HYNA 3CSDA 1OZGA 1LPPA 2ZXFA 4MNDA 2R1TA 1D8TA 3LHFA 4OI1A 4UQLA 1HF3A 2NTYC 2EINC 3Q6NA 3Q5EA 2NAFA 3BJZA 2Z4TA 4WQMA 1BKDR 5DLQC 1XDZA 3FZEA 3ACBA 4MWDA 1UC9A 5AJXA 4NZYA 5IRCD 3IYLW 3UJDA 1AKWA 4O8CA 1L9KA 2RARA 4UHCA 4YJ2A 3AEUB 3WS7A 3MS7A 3GFBA 3ONVA 4JXJA 4RHCA 2GHIA 2PQ0A 4R9RA 3ZHYA 1Y8QA 4Q6WA 2YNMD 2QQFA 4FIZA 4INOA 4DWWA 1L8OA 2R00C 2FAXA 3EMKA 1P7PA 2C57A 1PT6A 5DWDA 5JDCC 4BWFB 2PX4A 3JQ6A 4RC9A 3JSZA 4QBGB 5GONA 3T4XA 4P5PA 3WL7A 4IQ0A 1EXNA 1Y3HA 1ZC3A 2DPGA 2X2OA 3LK7A 1IBSA 5K09A 1G3QA 2WG0A 4OHUA 4EM6A 1K1EA 3TG2A 4CF5A 1E2FA 3K09A 3MJEA 1ICIA 3FOEC 1E79D 3K0SA 1VG1A 1YS4A 3OY2A 4N76A 1LUAA 1RMQA 1ISFA 3O8QB 2AZDA 2CB0A 4MV0A 4UW9A 3KPHA 1RWMA 1U4NA 3P4UA 3OLXA 4DIUA 3V9AA 2HUJA 2GM9A 1GTMA 5BV1A 1LWOA 1F0PA 5CR9A 1WOMA 2PYDA 4FJ1A 4QNMA 4ZZ0A 3MUFA 3M15A 4B74A 3PJRA 1XK7A 4K9SA 4DM4A 5IC4A 2R7NA 3LAWA 4UOZA 4YR9A 4KN9S 1CRQA 2FFRA 3IE2A 4RVFA 1PQ4A 1I30A 1XDDA 1QK4A 3KQMA 4I0WB 3KEFA 4MQMA 4U7JA 5HIMA 3T1NA 4BLPA 5B57C 4IDOA 3QFTA 4HGYA 1O6GA 4L50A 2PT9A 5EJ7A 2MYNA 1JIJA 4MJ3A 1RKUA 1V3VA 2UVDA 2R7AA 4O2RA 3AIMA 2X76A 2GFHA 4PWYA 1D2AA 1WIWA 2V6BA 4JODA 4MINA 4TRMA 4CMEC 1JIVA 1EDOA 1Q0KA 4MQEB 1XTQA 1DS6A 2XUHA 3VUEA 4MDHA 1U2DA 1TF5A 3JAMA 3NBKA 3EX7C 3IUNA 2A0XA 5EC8A 4C3ZA 4EIYA 5LDDC 1YVDA 1GYQA 2JFWA 2PKXA 5IPFA 3QPCA 3Q8XB 2AK2A 1AMNA 1CY7A 2GCGA 2E82A 2HK9A 1BWQA 2HRQA 3PQFA 4A4AA 3BAZA 3WZMA 5M04A 4DR5B 2FFQA 2L17A 2R1TB 1QFSA 4CKCB 3O2QB 5EINA 4WJ0A 1I2CA 2HT6A 3U4QB 9ATCA 1RWQA 2WHPB 5LUAA 4RPCA 1R6AA 1F7VA 3DBLB 4EUEA 3O6XA 3WGUA 5AVUA 2PGNA 4QGGA 5LQKA 2ZT8A 2EPMX 1Q16A 3CH4B 3NDJA 3U39A 4LOHA 5CFNA 2VPZA 1Y8QB 2REBA 3KT8A 2XQVA 3TJZA 3KKEA 3K4HA 4G9EA 4YCBA 1YR9A 3RWBA 1DPFA 2HMUA 4JXZA 4BE4A 2NWQA 5F1OA 5TPZA 1X8XA 1GTJ1 4IUCS 1Y7HA 4AQ7A 3TLYA 3A1VA 4J94A 1PYOA 4UZEA 4BU0A 4X3OA 1XWWA 1R4NA 3GW8A 1XMQB 1L4EA 4QJ3A 1EQ2A 4LF9B 3T35A 3M81A 4JIGA 4UREA 4I4LA 4W1QA 4CCSA 4G5SA 4HYQA 3EOAI 1D2EA 1DQRA 4ZYTA 3AEQA 3N2NA 3EA0A 3GP5A 1U2EA 4GOMD 2QQ5A 4YCAA 3S81A 3GZNA 1AGXA 1OB2A 1DOVA 3SSAA 2WUEA 1B0UA 5CXSA 3THRA 2BEJA 3TMAA 4U7DA 2YZ2A 1DWOA 2E85A 1JT9A 3HUFA 1FSZA 1UMBB 3BEDA 2PMKA 4S2EA 5L51A 1NRWA 3TNFA 1AQLA 4YFYA 3HKDB 5DHPA 4DLTA 2QTBA 3RSQA 1ZD5A 2YV1A 4LG1A 4UBJA 2HQRA 1DKOA 1K6IA 3U2LA 1LBEA 2FMKA 2Q0XA 1XTBA 3GMTA 3X2QC 2Q2OA 2QRVB 4CKEA 4WCFB 3AL2A 3ETCA 4U5CE 1Y6RA 2CDCA 2NACA 3LUKA 4RL6A 4S1VA 2F8MA 5EE1A 3OY7A 1N32B 2Q3MA 3FGZA 4EEKA 2B36A 2WFLB 3OF5A 1OWLA 4HF7A 2WJWA 1SZPA 1H2HA 4D4LA 3OZDA 2OEPA 3HS3A 4MWGA 5LZ4A 3I04M 2BH9A 4JC7A 1NFQA 1JFRA 2QRHA 3G85A 3HYRA 3FJYA 1NAHA 3MJDA 5EIBC 2ZSBA 1QV7A 4XDHA 3LVBA 3RC3A 3SE0A 4ASUD 4OXNA 1RHKA 2JPDA 4HQ6A 2ZSUA 4UARA 1VG0B 2D2FA 4W99A 3WJ7A 4C6TB 2BTOA 5CT8A 1WS6A 3A6GA 3TECE 4BMNA 1ORIA 2YVLA 3OLVA 1PR4A 4C4PA 1E4EB 4RMNA 1ZN7A 3HY3A 4DCGA 3OG9A 1Q0MA 2QRQA 4B2LA 5KC9A 4WUTA 2CLSA 3CUSA 5ESRA 1ML4A 2CD9A 5A9SB 5B4VA 1BYIA 3HYSA 4L3OA 2I9KA 2LNDA 2JB9A 1WL8A 2NX2A 4P3NA 3FVYA 1IZZA 3TZ6A 5KYUB 2GCPA 2VQ3A 3ESQA 3WRYA 2PH3A 1C7ZA 1VLSA 1YRBA 5C5DA 2C97A 3E3LA 1B14A 2CBZA 1KO4A 3GRZA 1FJHA 1GNSA 1NMYA 3CG4A 1CBUA 3ZCSA 2X8LA 5LJLA 2DPYA 4Y9SA 5L0HA 1TR2A 4BNDB 1SKUA 4HH4A 2Z04A 3KUCA 2FPWA 1T8PA 3ETNA 1VPTA 5CNMA 3O8OB 4FFVA 3STUA 3UC5A 2A0FA 2YWFA 3ACDA 4C0KA 3UJNA 4B3MB 3KSZO 1T9ZA 1CY0A 3Q3HA 1Y6ZA 4UUMA 1CQIB 1NUHA 2RIRA 3TZBA 2VP2A 3ZHCA 1OTXA 1SUIA 2R5NA 4OXRA 5C35A 1WHTA 1NY6A 4ACBA 3A2NA 1ZK0A 4RXTA 2FQ1A 1UKVY 4E12A 2MTBA 4BMXA 2VHEA 2FSFA 3R24A 1IJFA 3OFSA 1O54A 4U02A 4U2DA 3ENWA 4R1SA 2HXSA 4WZAE 4UM9B 3JYLA 2WWFA 1GGVA 1SC1A 4RTQA 8ABPA 2MT9A 1P1KA 4GE3A 4BV2A 3S2IA 4E88A 3C3CA 1LZKA 1FPMA 1RXWA 2ZB4A 4O08A 4G86A 4RIEA 3CWQA 2HIAA 2FW7A 3KHUA 1ZKMA 2CWWA 2PGOA 1T9DA 4FSHA 1SUDA 1E7YA 4V39A 4Q39A 2AJ8A 2L42A 2LVBA 3E9DA 3IRVA 4WJLA 2YLIA 4G7HF 1W47A 3HRHA 4YUYA 2XKJE 5JR3A 3PIDA 3ED5A 2QJTA 5CDFE 1CVLA 3LFUA 1JDTA 4KTVE 2R7VA 4FR0A 2G0NA 1NUTA 3QI2A 4OQNA 2PZBA 1PK7A 4ESHA 1FOEB 3B89A 4C0WA 3ES9A 4R83A 1RYHA 4IIGA 4C4YA 1TK2A 4EY5A 2BGGA 3DDHA 4WKPA 1DQYA 2AR7A 1EGVB 1OQAA 4LVNA 4OA8A 2XF2A 1ULUA 5BXYA 4HWTA 2WB7A 1C3EA 1YMVA 4YB8A 3A7EA 1AD2A 1GGQA 3A4LA 3KKLA 4TQ9A 3WKDA 1E0KA 2WTNA 2WHXA 4RFSA 1MC4A 1Q7CA 2QHXA 1L4LA 3IIMA 1CJMA 1N3IA 3O8DA 1E66A 4UASA 2FPGB 1N34B 2EQAA 1Z2DA 2RK4A 3DVRX 3EBPA 5EUQB 4G9GA 3P2EA 2IIPA 4RM2A 3LLSA 5BYJA 5DEOA 1V5IA 2WD7A 3M4ZA 3WICA 1MW8X 2GWWA 1KY4A 2JGNA 4PG7A 1G4WR 4XQ1A 5C7OO 5E9WA 2FJUA 4GYWA 1RKEA 1CNFA 4BV3A 5JROA 1Q0LA 2KGOA 5JEDA 2XNJA 2QM3A 1BCSA 1W0CA 4EO4A 3VYSB 3D43A 4RTRA 2ATCA 3U1VA 4ZKEA 4DLZA 1KZ4A 4HPJB 2ZRBA 4YMHA 4NV0A 2DFTA 1P77A 4IJJA 3RSZA 2LGJA 4QBKA 1GA4A 3O93A 3QXHA 5A5VA 1U0LA 3L8DA 4ZYLA 5F9FA 3GANA 1NHWA 2BKVA 3D2CA 3JY6A 1NW5A 4NPAA 1E5QA 1YS1X 3SC2A 4D25A 4XWAA 1FXSA 3R9WA 1IY0A 1WXQA 3EISA 1K05A 2YYSA 1DO2A 1WWKA 2IF0A 2WYUA 1WCXA 3DLPX 3NHMA 3M4CA 4XYBA 5SZKB 2PANA 4EGJA 3IURA 1Q0TA 1BMQA 1FLVA 1QTRA 1B74A 1E1QD 2I0FA 2N1MA 3HNKA 1LRLA 3ELWA 2ROQA 1DU4A 1CB7A 1CQZA 2C2BA 2H8GA 3USCS 3NDRA 2DTXA 4OSOA 4UFPA 1TLLA 1PFUA 2I1VB 2KK1A 2WT9A 3IA2A 2Q41A 2AN3A 3WWPA 2JVJA 3T06B 3VR4H 3W04A 3DDNA 3DKAA 2P2GA 3DWGA 3MPUA 1D6JA 5CXUA 3BWDD 1T9CA 4PLHA 3BX1A 5DHTA 4IOMA 4PSAA 1HYHA 4ZA2A 4ZI3A 1EESA 3T61A 3KYIB 3CISA 4R9VA 3AG5A 4YASA 2OU6A 3JYPA 1JEQA 5JW6A 1L5QA 4PZAA 5TIIA 3TUIC 3LX8A 4E5DA 1G0NA 3H75A 4M8LA 4YP7A 1KDYA 1IMJA 2Q8PA 2REQA 4ZARA 3B5JA 1IQUA 3CLSD 5BSUA 4RS4A 3UYLA 4B2IA 4KX3A 2R7OA 4R5MA 5I45A 5KNBH 1US8A 2ECQA 2QYSA 3OQJA 3PWKA 1ST3A 3AGTA 2OFXA 4IMRA 3CH7A 1BCRA 3EZXA 4GEGA 5JJBA 1JR3D 4DV0B 1MJGM 1SUFA 2GXAA 3OQVA 3P4XA 1SWWA 1WB9A 1WLSA 1LVUA 1U1FA 4IRMA 4PVCA 1G21B 1A88A 1O03A 3HBAA 5DGHA 4DR3B 3RS0A 2W42A 3A9WA 3WIOA 4MTLA 1RI1A 4ZI7A 4HDOB 4HWPA 4ZO9A 3VSCA 3EDCA 3G2IA 1PQUA 2C2GA 3WQBA 4W8HA 4RVSA 1RADA 5CLFA 4XVHA 3V2GA 5BPFA 1AKTA 2PEZA 5AW9A 1V37A 2YRXA 4BFYA 1FS4A 3IIEA 1EFKA 1P0MA 4C08A 5JD4A 1OTHA 3AU8A 3E5RA 4DMHA 2Q3JA 4JHXA 2OUKA 3I76A 1N2HA 4IMJB 2B8TA 3ZPXA 4BNWA 4S05A 4Z9AA 1XCGB 2VNJA 1YK1A 3HUUA 3G0IA 3LU1A 3ONDA 2VEOA 5H0IA 3K70D 7MHTA 2L7AA 3R0XA 4MVJI 2WYVA 3A3PA 2FR1A 3FWPA 1CQJB 4JFAA 2B69A 4KO1S 1KGSA 1JDZA 1FNNA 2OESA 4E32A 2GD2A 3DC7A 4RJKA 1ZJ6A 5E6SA 3MS4A 4RANA 3ZC4A 2D2VA 3DSRA 3FCYA 5E1BA 3ZNQA 1CLEA 4JLKA 5BNWA 3MXTA 4ZOBA 1L7DA 2BDTA 2GI4A 2XGSA 2YZMA 3SKXA 4XVCA 1Y8AA 2FWAA 4DUGA 2D3TA 3B5EA 3KOZA 4Q03A 5JC8A 4E18A 5FWXA 1USIA 3SY8A 5K99A 4L8GA 4Y2HA 3BRCA 5D6NA 3CUYA 3BB3A 2OCIA 2H7BA 1WQ3A 3QG5A 2ZAOA 1RXVA 5JBIA 2Q5JA 3WWOA 1J0DA 2AVDA 2B7LA 1CUUA 2QTVB 3WC4A 1XA4A 1ZVKA 4MR7A 2AXPA 2YBEA 1ID1A 4OOEA 4E0HA 2UUCB 3QWFA 5HCNA 2KC3A 5DV9A 1PG0A 3L8IA 4MP6A 1KQ3A 1CZNA 5IYZA 5JSLA 2A2ZA 2NUPB 4ETNA 4MUIA 4KEAA 3OPXA 2VRBA 1OXVA 1YK0A 4UJ3A 5FLKA 3C5CA 5TPZD 2QWXA 3EIHA 4PCUA 3R9XB 2AUTA 3LQ4A 4IIHA 4IDDA 5DLPA 3WMRA 1AC5A 1TM4E 5LQAA 4UCXA 1Y3CE 3ILVA 3N07A 4NV1A 5B58T 2ETXA 2PH1A 2ODWA 3CX8A 1GILA 4PZCA 3UC9A 3SVZA 1GYPA 1XAHA 2V03A 4XD7A 1RNLA 3L8MA 4R8SA 4W1SA 4ZAWA 4IJVA 1DJMA 4BX0A 1LPEA 4JVNA 1V6SA 2WZDA 4LYFA 1DCKA 3LL4A 2XADA 1XZCA 4KXYA 1C81A 5EP2A 2DRIA 2IT1A 5EWLB 4TRNA 1OU0A 1M75A 1UJ4A 4MRNA 1I7DA 3S40A 5EWMB 3EEIA 3AF1A 1L7QA 2VJYA 3NHKA 1WULS 1HO3A 3ZHRA 4EARA 4QOSA 2V96A 2Y2VA 5K0GA 2C4TA 1NN3A 1Q3KA 4YIKA 1DAHA 2RHGB 3W6OA 2C96A 3FTPA 5F9MA 3LXUX 5CDSA 4CEIA 1N0WA 1GWNA 1NJ6A 4I14A 1JHMA 3ZI7A 3GGOA 4Z3OA 1YO6A 1SELA 2I91A 3IEPA 4RKFA 1H6CA 1NOIA 1YR8A 1ZWKA 2OXRA 2AW3A 2Y1CA 3EXEA 4PR0A 2YBDA 2ZYDA 4J29A 3TJRA 2RH5A 5K8CA 3C24A 3QK7A 2G77B 4JYMA 2XEXA 4IV0A 3IQFA 1EI7A 1OF1A 5A7GA 4JB2A 4XCQA 3UO8B 1PR3A 3HP4A 3JZDA 3ZDDA 3K8YA 4R16A 1NP7A 1V4VA 2XNKA 2IBSA 1CETA 2HMZA 3HWSA 4ZVTA 1NZJA 1OROA 1SHKA 3A05A 4LV5B 4EMBA 1YZNA 5KYUA 2RHHA 3E2PA 3PFIA 1IMOA 3NORA 1UMBA 1POXA 2IDKA 4TS1A 4HYTA 5LD2B 2ZBGA 5FIUA 3B1ZA 2UV8A 2UYHA 1XNQB 3N2LA 1Z5PA 5AHXA 4MPPA 1W2WA 1E18A 5K20A 4LF6B 2YVAA 1JGTA 2XBMA 4PR9A 3T1QA 2HV9A 1LWNA 2Q21A 3I5YA 2BV3A 4QZVA 3HB7A 2AJLI 3NIWA 4RCVA 1V7CA 1J99A 2FW8A 1LKXA 4BJ5C 4XZ3A 1WXEA 1L4GA 2ACWA 2QRPA 4MYCA 4PAWA 4DADA 4B6QA 4EQ6B 5FH9A 4I81A 3AVPA 1ZGJA 2ID9A 2PT5A 5A4FS 1JWAB 3ENZA 1SPXA 4LHEA 5B7NA 5MF6A 1Y9EA 2WHEA 3EDMA 5F52A 4RWZA 2EX4A 4Q16A 5A71A 1T8WA 2FPIB 2VT3A 1LQUA 5DCLA 5DNAA 1N36B 4BPBA 1KBOA 1UPBA 3U5SA 3NALA 3E35A 2I6FA 4YP9A 4X64B 4BZQA 2V6IA 1CULC 4B40A 1EIZA 2P9YA 3BDVA 3ANLA 3GV0A 4DN6A 3AJAA 3KEGA 4BIMA 2JLZA 4ESVA 3GNTA 1JG3A 1YQQA 4RWEA 2HDHA 4B34A 3Q8LA 5T6BA 3CZ5A 3K9QO 5ER9A 4YK5A 1A82A 3DAPA 2OCDA 3GJ4A 5FWYB 4FIDA 1BA3A 2G1JA 1FDWA 3LCRA 4A4DA 3MQFA 2RGXA 4BTEA 2C4VA 2HC9A 2XMQA 1KF0A 3KLNA 4S35A 3TW4A 4UBNA 4J7XA 5BQ3A 1QR6A 4TV8A 2JAXA 4C7OB 1JHUA 4JR2A 2FWPA 2IY7A 1UAYA 5EJMA 1LS4A 4ALNA 3EXIB 5J9FA 2WWXA 4REOA 1I3MA 3CX3A 1DKPA 5HZMA 2B7CA 2C5GA 4XOIA 4U3JA 2AG6A 2JRLA 4CTMA 2BY4A 2J9XB 2OD9A 2BR3A 5T64A 3GM1A 5L45A 1RAEA 2I2DA 4CEJB 4HUJA 1YZGA 4RK7A 4L5YA 3ZQUA 4N3NA 5B7QA 4WD3A 2B98A 3H2JA 3QYAA 1XN1A 3FSJX 1ODIA 2P77A 2BZ0A 1V8ZA 2PX5A 4TLLB 2Q7OE 1E3WA 1QYIA 2FHSA 3GGSA 4OXKA 3JCUQ 1KJQA 4R40A 1C3XA 2Q28A 2WVJA 2AMJA 2COKA 2I2BA 2I7CA 2ZR7A 3D6NB 4HAXA 5IDVA 4ZVLA 3DHYA 5A69A 2YOGA 2M6LA 1V48A 2O3UA 2Q9CA 1GRCA 2WD7B 1LX7A 3GJYA 5L9AA 4G9BA 3Q5DA 4FYXA 3HB4X 1W4BA 1GAJA 5B1YA 5JALA 1XKQA 4N0MA 2Y69C 3M2TA 3KKOA 3VKVA 2VAXA 1ULZA 1KY2A 5FZTA 1FVXA 1XF1A 2O7QA 3VHRA 3LS0A 1GL3A 2HJ9A 2Q4FA 1CT9A 4BEVA 5GPBA 1IG0A 2EXXA 3KTFA 1LSSA 2ZWAA 4C0HA 5BV0A 5SICE 1Z9BA 5BQOA 1F48A 1UBEA 1Q1QA 4MVSA 3RJMA 1DEOA 3W4JA 3KLMX 4FU0A 3HDTA 3I9KA 1A2KC 2PK3A 5DMXA 3GGJA 2O57A 1RKVA 2QMUA 1NN1A 2O0JA 2DKOA 4WI1A 4F11A 1WAMA 1E7MA 5IFKA 6REQA 3P9QA 1PVDA 3B82A 3FVWA 3T4EA 5E0KB 3TMKA 4B43A 3BGDA 3DBVO 3QXCA 2F1RA 3MMNA 4F85A 1B3BA 1PHPA 3RSOA 3C8GB 1UBGA 4AX8A 4PYMA 4ULVA 4AZ0A 2IS1A 1E98A 3V55A 4ER5A 3CNLA 2V6GA 3DE6X 3NH9A 4C7MA 2PX3A 1AF4A 4EYEA 1PR0A 2EPLX 2VZ0A 3JCZA 3KZVA 3S4YA 8MHTA 4NTZA 3HJTA 1FNBA 2HIMA 4CKBB 3A1NA 5BYAA 1YB4A 4ZOLA 3CVVA 5T8KA 1G19A 5ALMA 5A06A 1TF2A 4MLPA 2VPTA 1USVA 2R6DA 2VYVA 1YE5A 3WRVA 3TOZA 2NZWA 1HFEL 1MFZA 4B79A 2RI1A 3OLWA 4G2TA 1MAWA 2RBEA 2ZJOA 3MWYW 4JBHA 3PE4A 2JAOA 1E1QA 3OQIB 5CJJA 1XFAA 3L1MA 5EEGA 2XL4A 4URVR 3HJGA 2VTKA 4AKIA 4B3BA 4EG1A 4EPYA 1N75A 1QMGA 2MCFA 4QRIA 2Q6LA 4WABA 1BAPA 2XB8A 3UJ3X 1KFKB 2W93A 4TWZA 4ND8B 1IHUA 1XGKA 1PF7E 3AHCA 2PLNA 3A4NA 3I64A 1L4UA 4G01B 4B2YA 3WADA 4W8KA 1FSFA 1MB3A 3I9JA 3TTXA 4G2NA 1UBTS 2A0UA 3AUJB 3CCFA 1QZXA 1E96A 8GPBA 5LIPA 3ESZA 3KT3A 5AKIA 2I7TA 5HF8A 2PZ8A 5JO0A 3DMYA 1LY1A 1UADA 3HZRA 3CYFA 2FP3A 4W5QA 3H5TA 2OR3A 5KOYA 1W94A 2YC2C 1ELOA 4MARA 4DPKA 3MTBA 5DOVA 4BJ5A 4TZTA 3DW1X 4U7GA 3Q7TA 4MUMA 4Z7QB 4V0RA 5C5EA 5JNSA 2AKEA 5CI9A 2YL7A 1UANA 1GT6A 2BKEA 2YHBA 4Q93A 4U7FA 1PRYA 3X1ZA 3BQ9A 2HRRA 1DLJA 1Y3IA 3RVMA 3AGQA 3TMYA 3WLTA 1NVBA 2CZCA 2B1JA 3UCEA 5B7GA 3H5VA 4CLXA 1Y4ZA 4Z2AA 4JI7B 3PHJA 1P0CA 4G5XA 1E2UA 2VOEA 3DJUB 3HB1A 2FN8A 2XSZD 2PSEA 4KACA 5EESA 3TR0A 3IC5A 2RCYA 1RAFA 5JRAA 3EG9B 2DWCA 4BVJA 1KEKA 4ARCA 1AB6A 1LQTA 1FFEA 3AP1A 3K94A 3LYUA 3JR3A 5C9ZA 5JHHB 3LY5A 2FPPA 1DQNA 4DCOA 1C9EA 4NQRA 4ZREA 5TQ0B 4U5DE 1B0AA 3AEKA 4YA6A 4H7KA 1JX6A 1M6YA 5KCZA 1MO3A 5JCJA 2AFIB 1WWPA 4TXMA 4G09A 3VH3A 2LK4A 2VNAA 1VHWA 2E4ZA 4DM7A 4DC9A 2JZCA 1GPWB 2VZLA 4XQGA 1QCZA 3FWYA 3O9MA 1DCTA 1WY5A 2YN0A 1W0JA 3JZFA 1Y0BA 1PKEA 1VKJA 3WJAA 1ZSNA 2EP7A 2P4EA 1JPNA 3C6XA 2XDQB 2H54A 3NNDA 4M89A 4PSVA 1ZHFA 1OI3A 2M32A 1ZDMA 1ACMA 2RKBA 3DTVB 3QG1A 1UOQA 3UHOA 4BC1A 1LZLA 2I2XB 2Q5QA 4RPGA 5JD6A 4C5BA 2R1UA 2UDPA 2PT7A 4KN6A 5FPHA 1ZR4A 2IOQA 1IQRA 3HSKA 1FMCA 3F3KA 4GXQA 4A5OA 5A5DA 3AFIA 5HBGA 1ORRA 2HXGA 1HM5A 2FN7A 2NLOA 4TM8A 3MPOA 4IQFA 4H0CA 3FHDA 4KGZA 2FA9A 4DUGD 3B78A 3PHBE 1A97A 2CXTA 1RM4A 2WYIA 3TW6A 2I71A 1E61A 4FZRA 2JK1A 4GMDA 2OFOA 2HWUA 1NBAA 3M9WA 4GPEA 2PAFA 4TKMA 2Y3IA 3KMIA 3NBAA 4UMDA 4EG7A 5JNVA 2NN3C 3RIEA 4RTJA 3MF4A 3SMVA 3GLQA 1KY3A 4RTMA 4C3OB 4YRCA 2A9PA 5KTMA 2F8TA 4AP6A 4N9QA 1UFBA 2OQMA 4CTJA 1UK9A 1RJGA 4Z4IA 1H2AS 3HKKA 5CLHA 2AZ4A 2QF7A 3HPQA 3RFYA 3L0IB 4ZGBA 3CN7A 3CZ4A 4MVZA 3S27A 3B12A 3ELDA 3H7IA 4JJ4A 4MPJA 2JIPA 1ZOIA 4XLPF 1U98A 4TLEA 5PGMA 2QUKA 4LOLA 3PDJA 4RCYA 1JYEA 1NNLA 3HDVA 3QW4B 1D1BA 4MB6A 1MN6A 4CTNA 1Z33A 1ST2A 2XE7A 1JBQA 2OCXA 2QZSA 3HLYA 1Z13A 3HJBA 4GOXA 4OOFA 4OLFA 4XASA 1SG6A 2NZXA 5TXGA 2P79A 3HCPA 1U2QA 4YRJA 5B55A 1QIGA 4IZOA 1X14A 1W44A 5AKHA 1I36A 2HREA 2PQMA 1JEYA 4XW2A 2RGEA 4NTAA 3KETA 1XXHE 1C3JA 3AR7A 1LBQA 3A6ZA 3WIEA 5IX8A 3ZQKA 5JZSA 3AY3A 1ZKDA 2V6JA 3UM9A 4P53A 1GCOA 3NPMA 3VZDA 3KL4A 4Y6SA 5I6DA 2OCCC 4TV9F 1OPXA 1N9GB 3H2BA 2YMMA 5C0OE 4NCKA 2OEXA 3MCUA 2Z6VA 2IEGA 4EUKA 4N48A 4XVUA 2BLLA 3LC0A 5FYDA 1YZVA 2PE5A 1P19A 5MN5A 3M82A 2WL8A 1NULA 4DHEA 1YARO 1M8GA 4ONSA 2GKOA 4YRRA 2QT0A 2OM2A 1FEZA 1TECE 4Y1RA 5CLIA 4CFSA 1W581 2HFKA 5EWMA 1P7YA 3ZK7A 5GZ3A 5LSAA 3AQBA 256BA 4YJHA 3M6XA 3FVVA 1QHHA 3KHTA 4EJSB 2FOXA 1FMTA 3B6EA 3L7CA 5K4AA 5JNLA 4QVKA 2BR5A 3RBVA 4F1KA 4ILEA 1MVOA 3FPJA 1AO3A 2NSLA 1QXSA 4WZZA 5CB0A 3V7UA 5KO2A 2JVIA 4LQ4A 2C5AA 4M7RA 3OD5A 4CF7A 5CH3A 4TSRA 1YHNA 2ODEA 1XZQA 3F98A 4KUEA 4ZAYA 2WICA 3WLJA 4WJKB 1VKZA 4R84A 3V97A 3NETA 3OZBA 2RSEB 1KQPA 9MHTA 3B2QA 3L7AA 5T3YA 2ZJ3A 4AJLA 1W4CA 4LSGA 1QIJA 4WK0B 4ABYA 4Q12A 3T5BA 1SKMA 4INPA 5G4KA 2FX5A 1DNPA 1W5TA 3QENA 2B4QA 4UEKA 4US0R 4FC7A 4GKAA 1Y7TA 5FR1A 2X3FA 3KG2A 1FLAA 1QSGA 4QUHA 2PIDA 5GAJA 3ZV3A 3DVQX 1GDHA 2H2DA 2QMHA 3O90A 2WAYA 4U5XA 4WK6A 1OBCA 4JJFA 1JKJB 1Z0IA 5DF1A 4CG0A 1V5WA 4J7YA 1S1CA 3BFKA 5DDIP 4IFBA 4HDSB 4HUQB 3R8CA 1V11A 4MQ5A 4TQUS 4AJOA 2JHGA 4HBGA 2A3NA 1R6UA 3V1LA 2ZSEA 5B1BC 1PZNA 3ISJA 4TSFA 3WAGA 1NLMA 1K8QA 1RTKA 4OHOA 3PS9A 5D7NA 1TKRA 1YNOA 1T8RA 3QEMB 2BGRA 4YRLA 2CE7A 2E37A 3WNVA 3V7YA 1CUHA 5I3CA 1CEQA 1TKCA 4F4CA 1C17M 4C4AA 1VLQA 1CUWA 1OI7A 1AN0A 4X0RA 3GOQA 4D6YA 3TFOA 1ILWA 1RAGA 4JYAB 1MX5A 2NUTB 1SKYE 4YV2A 2ZULA 2Y67A 1TLTA 2H2AA 2O2IA 2C54A 4L4YA 3P45A 5F5NA 1N4AA 1FU8A 4HO1X 1L4YA 3LKBA 1KETA 1P7VA 5TT0A 3M5WA 5I7EA 3BMQB 1VIVA 3M7IA 4X3PA 2B5VA 5DI9A 4G84A 2OLJA 5BNZA 1ZS9A 4JB8A 2A3RA 3O31A 2ZI9A 1BH2A 1Q1GA 4NYMR 5EQDA 4Z1MA 5DNCA 3DKIA 2ODQA 2FYTA 4P3KA 4RJIA 5KI6A 2CBXA 3R0QA 4LJSA 4QOHA 1BQ4A 2P5YA 1W85B 2JJ2D 4WADA 1QAQA 5ALXA 1FQKA 1YR3A 2GZ1A 1CVRA 2AG8A 4UVDA 3KJGA 5H81A 1IXZA 4CV0A 1KMHA 4MMYB 4ERNA 1EXVA 3R7CA 4KRYA 4P34A 1VPWA 2G5GX 2BFEB 5EZYF 2D8MA 4LF5B 5JU6A 5A6BD 4BMVA 5GM1A 2AFVA 4IG9A 4CF6A 1BE8A 3K6SA 4K6GA 1BOOA 1TF7A 3VO8A 4HR7A 3CW9A 2JGRA 3AR3A 2I8BA 5BMOA 4JELA 2P6VA 1JR3E 2GTPA 3UK0A 1HEIA 4M0CA 3GUHA 4OGGA 2GN9A 3A37A 2OCPA 1NXWA 4XFDA 4ZU3A 4D82A 5D7BA 5KIAA 3IEEA 3U61B 4WA7A 4MUFA 4L07A 3KJEA 3JVEA 2A0WA 5DTJA 3OTGA 3GMSA 2Y1GA 2UYQA 3N75A 2P9GA 1R0XA 2NTNA 2V7UA 4NOMA 4R1UA 5CVVA 3U7GA 5KNDA 1IEQA 2G9UA 2C0PA 4AL1A 3RSFA 3EGVA 4OYLA 1IN6A 1AT1A 1ZGCA 1ESZA 3N58A 2DG2A 1GNTA 2GAIA 2Y3DA 3EXFB 1BS2A 1SBCA 3OU6A 1GNRA 3QITA 4EI8A 2QRLA 1I7PA 4AE4A 1RKXA 3RT7A 3A58B 4LF8B 3O3CA 4H1VA 1X7ZB 3AF5A 3A6LA 3NPAA 3JQFA 4NYJR 5E9QA 3WK4A 4KOAA 3AY0A 1Q0SA 3HCWA 4NFSA 5GJBA 1FX0A 3F6EX 1HFJA 2XE8A 5J5AA 1D2RA 3T7AA 2AFIE 4HQKA 4EH1A 3H17A 4R9SA 3ZE6A 1XTVA 1KJZA 3QTBA 1WD7A 3EXG1 4KKVA 3UN1A 2X4GA 3QM1A 3NT2A 1ESMA 4MKFA 4JA2A 3GVHA 3EEOA 3K09C 5D5HA 1HY3A 3IXQA 1JA9A 3ANMA 3TLCA 5J1SB 3ZD7A 2WSSA 3QXJA 1UPAA 1EVEA 4JCHA 1UOEA 3DH0A 4JUDX 1AZSC 1NA5A 5DBEX 4PAGA 4BQPA 2YNMA 4FB4A 4RHFA 3ENVA 2QZ4A 3N5CA 5SY9A 4BB0A 3TIIA 5EJ8A 4UUBA 4J7TA 1ULSA 1L6IA 1QIFA 4OJYA 5ECDA 1G8GA 2NP6A 3HI4A 4LY3A 1G18A 3P9PA 3C5WP 3ESYA 4Q02A 4ZD6A 3OM9A 1T6UA 4CLRB 3E9EA 4EY6A 1Z07A 3A4IA 1L4NA 2F3QA 4Q7KA 3ZI4A 2BMVA 2C9CA 5C4IA 4JVLA 3T5GA 1OXKB 4E3WA 3ZKWB 4O4IF 1F4VA 3LHKA 1CGME 1PLKA 1N2GA 1R8XA 2GPBA 3GRYA 4FGKA 4FX2A 3VRHA 1AVOB 4MV6A 3SDSA 1HUQA 4KAJA 4LGYA 3KYJB 1N1DA 2XLBA 3WSTA 4E46A 3EPLA 3GH1A 1I4DD 4PFJA 1JKMA 4MW9A 4NARA 4HDMB 2XDAA 2KB0A 2VTEA 4Z6KA 3ZQJA 4Z4HA 5E1OA 3V8VA 2P5SA 5C8YF 4R7GA 2JD0A 2C1XA 4FYMA 4NBLA 3I1JA 1LV8A 3JQGA 3JD3A 4D3FA 2C00A 4NXNB 1ZCFA 1QH1A 1NONA 4XGQA 1E2BA 5AI5A 4LK2A 3DW3X 3GD5A 3R5SA 2PTHA 2D5IA 3NOOA 3OQ6A 1YJ5A 4DJ9A 1M34A 4FZ3A 3FOOA 2YFYA 2GARA 2HSGA 2YL2A 4NAUA 1I1QB 2A9FA 1CHDA 1U9IA 5BO5A 5D2CA 4JOQA 3VAAA 3VDQA 4RACA 1DAFA 1VE3A 2NVUA 1A0BA 3JAKB 4J9VA 5DHRA 1CQXA 1KJ8A 2CVQA 4LXHA 1P9LA 4MS4A 3U0BA 4C87A 2B21A 3L4KA 1XTPA 1A5AB 3PDWA 1J2UA 3NT5A 4ZGWA 5CXXA 1GNQA 1YZHA 2HRDA 1W36C 1ZJYA 4FEEA 4B09A 4E7PA 2WSLA 3MIZA 2HYIC 2Z6AA 2KM1A 3QX9A 4HMPA 4DLVA 3I3SR 3AT1A 3CUEF 4IJMA 5CVJA 3OLZA 1RXQA 4M3NA 2JGDB 3PEEA 5TB5A 2DPMA 3JQBA 1KIFA 1EVKA 4HOYA 4JROA 5CGZA 4N65A 1BE1A 2XLCA 2YZSA 4WE3A 1NU8A 5DXAA 1BXGB 2D5AA 3SEAA 2Z3WA 5KEIA 4MHTA 5G41A 1SHJA 5DCYA 5ITZA 4PLVA 1L5HA 3PHIA 4HSGA 1F1JA 2UZIR 3K2QA 2C98A 3CLUC 4V0NA 5LIRA 1RDFA 1DWQA 4M9XA 4RVOA 1XG5A 4HTFB 4K9KA 1IHPA 4PX9A 1B4DA 3RVPA 4F8EA 3N2KA 2VDPB 2VJBA 3C3DA 3FCOA 3P20A 1NMXA 4GC9A 3KHKA 3KKBA 4HH3C 1A5BB 1XQYA 4MGEA 2LP4A 4RK4A 4EELA 2I15A 2BUAA 1FNCA 3I8OA 2AC2A 3VJLA 2XUOA 2HLDD 2XVMA 1Q0PA 4R0NA 5REQB 4OPMA 1JFVA 3GCZA 2H1OA 5IDWA 2AA3A 2XCOA 3Q10A 4IDGA 2GDJA 3RYTC 3SMQA 1QF9A 2BW0A 2PZFA 3GF4A 2DHEA 1W87A 4M49A 3KFVA 5IAAA 4BZWA 4RD4A 1TJPB 1VI6A 1HYEA 2YVQA 3OPQA 4IXMA 4NBNA 1G8SA 4QYXA 4XD2A 1EX7A 3OVMA 5AK6A 3BXPA 4ZQEA 1Z5NA 2X0DA 1GTG1 3AUKA 4K86A 4BNTA 5C32A 1X1BA 2NVOA 5IZCA 5T4HA 4M9CA 1M1YA 2BONA 3MWGA 4QUGA 3NYMA 1UG7A 3IXLA 5DYNA 5E38A 3WYBA 4AF6A 1Z5ZA 2IS6A 1VMEA 4Q1BA 3AHHA 4ZALA 3GCWA 1ILEA 5JXHA 2JCVA 1YDGA 5J63A 4AJHA 3T3MB 3KQNA 1K3UB 4Z4QA 1RWXA 3GIDA 1YAHA 4PEVA 2AK3A 2TMKA 3R3WA 4L95C 3VO9A 2J9UA 3KZCA 3JAWA 1DL5A 1BVUA 4K8RB 5DX1A 3I61A 2GXUA 3VR1A 4JDUA 4OGFA 4HRAA 2IYLD 2ZR8A 4YGYA 3EVEA 1G66A 1Y48E 2MJLA 4FVTA 4DJTA 3V4OA 3AG4C 3MWKA 4C7XA 2C7PA 3IP6A 3DGEC 2FDCA 2WKPA 4Q7EA 4KNYA 3O0DA 4BB9A 2WIFA 2FPIA 1BS1A 3D7NA 2P7VA 3QU2A 4MLZA 3SFVA 3ICQB 4UD2A 3I34X 4LV8B 4TT3D 4AZ3B 2NO5A 4O3MA 3ZK9A 3H9EO 2D7DA 2P0EA 2IU4A 4NL4H 4G1CA 3RVJA 4YDHB 1O87A 1T6XA 2P2ZA 2IEZA 2O2EA 3U8VA 1YDFA 2JIOA 1N2BA 3ER6A 3JS5A 4ITUA 4KYUA 4TTSA 3TDKA 5HIAA 1EU1A 1P18A 1WEHA 2XNHA 1XCJA 4EKIA 5G4LA 4HGZA 5K8IA 2WWYA 3M6VA 3DLBA 3W9YA 4PZZA 4RTNA 2GJ8A 2ZJ6A 2Z6UA 2P5UA 4PHHA 1E9RA 4YCJA 4RPLA 5K0IA 1SXQA 4A6PA 1UM9A 2H92A 1QVVA 2A0YA 2F8LA 5B1SA 4OHCA 2RDMA 1H2ZA 3M5DA 1YZFA 4TVSA 3HFJA 1L5OA 2G9QA 3BTOA 3CH5A 1FVHA 3R5JA 3TRKA 1CJBA 2WKRA 4Z7JA 2XCTB 4ZZ1A 1PG5A 4AXXA 3OECA 1IULA 1E1CB 3L0CA 1P0PA 3GT0A 4ARSA 1TAQA 3I52A 1CJTC 4CLHA 3GPIA 3ACCA 5A0VA 2XT6A 2V5VA 1I5RA 4EZBA 3BOSA 3ITFA 2ZVDA 3HNRA 3QYPA 1JQAA 3F6SA 4LJ8A 1A5ZA 4EI7A 4MA4A 2VQSA 3SBOA 1DIOB 1M2VA 3EPHA 3WP0A 4BP8A 1WSWA 4WOPA 2NUPA 4EUHA 5KHLB 4EG8A 2QRNA 4X7MA 1EAYA 2EV9A 3FI9A 2C0CA 4EBBA 4L6IA 1FXWA 1QV6A 2CXOA 2EEZA 4L7QA 3VO1A 1Q15A 3A1SA 3WLFA 4NCQA 4LISA 1QH1B 1F5NA 5LCXA 3ND6A 4C7JA 1FYFA 3B9BA 1O8CA 1V45E 4FYPA 1ADGA 4F12A 3LCUA 3E53A 2Q6KA 2GBIA 4BMDA 3L0OA 2V9CA 1B0ZA 1YOVB 2V97A 4WEOA 2B2XA 1XQ1A 3IMKA 5FWXB 4FYWA 4JC4A 2GESA 3P9XA 4IQGA 3LC7O 5GOTA 2EKBA 2IY8A 3HKBB 5A6SA 1IZ0A 2CGEA 1DT5A 4YT4A 4P4TA 3OFJA 1C14A 4FW8A 2PXCA 3L7IA 3HR7A 1GCIA 3C5VA 2AH5A 3IUEA 5U1PA 3EF1A 4XIYA 3TYXA 2PRSA 4CT4B 4JA0A 5DI3A 3USES 3THXA 1VE9A 4DLBA 1M2WA 3IPLA 1TIBA 1TWAA 5IYZB 4B3JA 4DMKA 2VQDA 3QLUA 4O0MA 1ZUHA 4EJSA 4HT3B 6YASA 1SU4A 1G8XA 4S1TA 4OJNA 4V2IA 4ZQFA 5ECGC 1M56C 3U56A 4RJLA 4C1BA 3MM4A 4X6LA 4WK4B 4IXDA 2EBUA 3VISA 3F6PA 2JASA 3BUSA 4TLBA 2YL1A 3OPNA 5C8YB 1ID8A 4ZU1X 2NPUA 3IKTA 1MBZA 1SZJG 5HTKA 1EWQA 3KXPA 5M3BA 4BRUA 1T4CA 2RHJA 3DVAA 3VVLA 1DKNA 6Q21A 1LEHA 3RW9A 1C9JA 2XCLA 3HWRA 4CL0A 1MMGA 3S28A 1S9DA 4XPYA 2JCYA 3SYKA 5A02A 1P0FA 2Y27A 3T15A 3JARA 1G21A 1JLLB 4D6XA 1ONNA 1FFXA 4MIKA 1ESDA 4OK5A 3W8IA 1XNGA 1BCRB 5FAXA 1ZD3A 1LLCA 1PS9A 2JKYA 3RGWS 3C4VA 1MG5A 1ZQ1A 2KI5A 2LE0A 1BX1A 2LDXA 4EBFA 4F71A 4OUKX 2X6TA 3OA0A 2FPMA 3BWBA 1ZNXA 2J3HA 5FPQA 1JR3A 3N0XA 3CRMA 3NS7A 1LDEA 3QPVA 3RF7A 2YV5A 1G6OA 4LRTB 5TMPA 4HVCA 4EHBA 2RD2A 3AR4A 1TZKA 4X92A 5K2MA 1E3WB 2G5TA 4YJ3A 5DASA 4PX3A 2I6UA 4JYZA 1E1LA 2J7KA 3PVSA 4O4LB 3EK2A 3KU4A 2O2DA 3TSZA 3ER9A 3RANA 1NBME 2RB4A 1QE3A 4IH1A 3EJNA 3INTA 4JK3A 2OORC 1CS0A 3ZK8A 4N7RA 5ITWA 4K5QA 2DSTA 1KZ1A 4XDZA 1N2IA 2O2SA 1M2EA 2C61A 3U3BA 1WV0A 1BTOA 1MQAA 1A4IA 2HBYA 1X2EA 2HK8A 2Q4EA 2OILA 2H2HA 4EUSA 3KXDA 2AGVA 3H8WA 4O0LA 3FPBA 1SIBE 3AP2A 2V7EA 4WY8A 1YS2X 2H06A 4QLAA 2Y3HA 7YASA 4K8OA 1IQ0A 3RWMB 2FSVA 3VH4A 1YSCA 3D31A 3NQ41 3F8SA 3QFHA 4HG2A 4YQZA 1IONA 4RFLA 2TMGA 1NG1A 1V8PA 4LCJA 5JWHA 3S5JA 3JSAA 5JQGA 2R02A 3MQ2A 4D46A 4DC1A 2YASA 1KEZA 3VH1A 1USGA 4I9NA 4REQB 4NZOA 3PGLA 5AW7A 2JANA 5ALJA 4YJ3F 4B3RB 2BM0A 1NY5A 3LDGA 3ESCA 4GPTA 1RCUA 3QU4A 2R25A 4HGQA 3T4UA 4GL2A 4H59A 2H11A 3WKAA 1OV6A 1LDBA 5L7TA 4CIHA 2VF7A 3WZ2A 2QE6A 3OQOA 4KLCA 1RIFA 4UVHA 1AURA 3NHLA 4NXMB 3NONA 5JZBA 3BRQA 4ZANA 3MWJA 3IPYA 3K4QA 1E9AA 4A6XA 3HZHA 1U5BB 5JAPA 1SHUX 3IEKA 1C29B 1NXPA 3KZ1E 4MS1A 2OQRA 3LP5A 2R751 5DNEA 4CQMA 1VBMA 2ID8A 3K35A 4JN6B 1HQDA 1ZEMA 2BZGA 3GNLA 1NE2A 3ITDA 3WMEA 3FFXA 2GBGA 4PWZA 2IOHA 4UHJA 1S01A 3C70A 2BVNA 5CCBA 4HRVA 4WECA 3CLSC 5EZ5A 1ZD9A 1FU4A 3ZD8A 2WU1A 1B2RA 4AMZA 2YC4C 3HR8A 3HR4A 2QTTA 5G0VA 3X1JA 2Q62A 4H15A 3BXZA 1DAMA 3U7JA 3JD0A 3PIIA 4JLJA 3DE4X 1DCFA 2Y05A 2PYZA 1W1WA 5YASA 3IHKA 2YHSA 1E1RA 4G1VA 1XSEA 3GWLA 3IGFA 4K88A 4A0HA 3DHVA 1TQDA 2VK4A 4QSMA 5ANRB 4YUZA 2EF0A 1Q57A 4ENSA 2QTAA 1EDZA 1T0JB 4O4HB 1XTZA 3GRUA 3IVAA 4QT4A 4C01A 9LDTA 5H4GA 4E5KA 4PU0A 3SYRA 5EKDA 4XWKA 1RVDA 1PV3A 1FRQA 4R81A 3MBGA 3LT2A 4OXIA 4LFAB 1K06A 3DM9B 4QI2A 1B6GA 2B7BA 3RODA 5B6JA 4OQPA 3ZR4B 1Y8RB 5LBUA 1SCAA 1FNMA 2VO1A 4N6NA 5E4YA 5U4XA 4HXYA 3SSNA 1PR1A 3TOMA 1AZWA 1LBHA 2CJXA 2HSZA 2J0UA 3QNUA 4IDCA 4N0QA 4PSUA 3RS7A 4MGKR 4JT4A 5GTDA 1ODTC 1WZ2A 4N8DA 4GQBA 3U9JA 4W9MC 2V3WA 1A5SB 4JDPA 5IYZF 1LJ8A 1Z7YA 2XE6A 3KLBA 5F23A 1GPMA 4HEAJ 5ENZA 1T10A 1FP1D 1ULTA 4FD3A 3ZBUA 1MTOA 4B8YA 1ZK2A 2TECE 3OQIA 5GJVC 5KYGA 1OILA 3VOBA 1LE4A 5GPGB 1IYZA 1OGIA 2FLWA 4KH1A 2QW1A 3LRPA 1XE3A 3IIIA 2IRWA 3I39X 7AT1A 1P9RA 3BSWA 5IVHA 5EIXA 1OI4A 1Z2NX 1HE2A 5JNWA 5DK4A 3J7TA 5BNTA 4JI4B 2ZRQA 2EW8A 3L4BC 3K0KA 1P2TA 4CRWB 1EX9A 1ODJA 1ZA2A 4DRJB 1FF9A 5L7WA 5GY7A 3DQQA 1JSRA 1BX0A 3NTVA 3CSSA 5CW2A 5I7VA 1IY1A 2DPHA 3M6FA 3MLBA 1VLMA 2OBXA 2IP4A 3EFHA 3ETJA 4H08A 1U94A 2Y1KA 3GA0A 3SXUB 1EK6A 1EXWA 1WB4A 2YN2A 3CPEA 4PIPA 5AM4A 1KKLA 2QV7A 4AO8A 4PTYA 1X2BA 4QQNA 4O4HA 3M1AA 4E5SA 3QE3A 5EMHA 1VYTA 1ZJ5A 4MIYA 4R5HA 4EBJA 3KCQA 3VPSA 2QN1A 3WIVA 3U1BA 2XHEA 3LOQA 1RYBA 1DRJA 3ENNA 2BELA 3DE1X 4HZIA 4NTBA 4X3CA 3GUCA 3QTTA 1H2XA 3WYFA 2GO1A 1NOKA 2QX9A 3DD1A 4KQKA 5C7IO 4W5RA 3I6IA 7MDHA 4J0KA 4X8HA 2VC9A 3OC0A 1Q0DA 1VYKA 2YQZA 1HMDA 3CUUA 3PGVA 2J09A 4QFCA 4FXPA 2Q1TA 5CRIA 3WGIA 3I2KA 2VYQA 1KMCA 4IWXA 3EQ8A 2GYVA 3HB9A 4PPYA 3U9SA 4HY3A 1ZHHA 2HFIA 3IMCA 5M29A 3P2KA 1OFTA 1VB3A 3NYRA 3JYYA 4CQLB 1FDIA 1K04A 5BSWA 1PEAA 1FJ2A 1FX1A 2AI1A 2IX9A 3EIXA 3KYCA 5CDTA 3GEIA 1UPXA 2BFNA 1L7PA 2GXQA 4JZYA 2OHOA 2OQ2A 3AI7A 4CMIA 1UBFA 1T5OA 2EBWA 5TJHA 5B37A 1QVZA 1RC0A 3CT6A 4GLOA 1TD1A 2C5BA 3MJ4A 1YC5A 4L8LA 5DWVA 2WABA 5DQZA 3TQCA 4DNXA 1D1TA 2IWHA 4DKJA 4FFOA 3E9VA 4J0HA 1NXXA 3ZWYA 3M0EA 1S0UA 3OX4A 3PTLA 5G0UA 3ZU2A 5DM60 4EUNA 2Q45A 3MWDA 1XROA 3T7SA 4ZHSA 4Q15A 2OVBA 2DX7A 1O7JA 2A0KA 2RAPA 2FF5A 3IB6A 3SCZA 4EY8A 5IKEA 2IS2A 5GQSA 3FX2A 4BMPB 3H65A 2X13A 1NGSA 2VXBA 1Y7LA 1B41A 3AEXA 3ASUA 1X1SA 4BNYA 3C0KA 3GBPA 5FPKA 4UM9D 3GZNB 3TTYA 1WNFA 1F7UA 4KUHA 2YL3A 1UT6A 3S70A 4AIIA 2VUIB 3BQMB 3K20A 5JSHA 1C50A 1GL7A 2NU9A 3HXPA 2GKSA 4BCCA 3QVGB 3AQIA 1YD7A 3W4KA 1RKBA 5DXJA 1SOAA 4HQ0A 5KTSA 5KPJA 5AXAA 3DAFA 4I99A 2DBZA 1DUVG 2B0HA 3PT9A 3IEMA 3CF2A 1RBMA 5AYVA 1QQ6A 1A41A 3GJ3A 3RK4A 4ALIA 1JQBA 3K9HA 3DBIA 4R6XA 2OV1A 3KYCB 4UAGA 5BWOA 2Y39A 2PL3A 4BNUA 3FDQA 2EZ8A 3N39C 1OAKA 2WHPA 1E89A 1AKNA 1G6HA 3OOEA 2V59A 4H1HA 1NMEA 3GRFA 1YJGA 1I2DA 1H5UA 1YRWA 2CBGA 2X9VA 4DZZA 4IMIB 4P35A 2V0GA 1RS0A 2H48A 1NKSA 2FWNA 4CM9D 1RLIA 3G5MA 1W0KD 1AOXA 3FI0A 3LHDA 3TBHA 1EDEA 4QXRA 3FMOB 2LSEA 2EGHA 2F17A 2VXYA 1UJ2A 3AY7A 2J08A 4PLFA 1OLOA 1T9AA 2R62A 2QUBA 1DQZA 1R4NB 4EFDA 4PO9A 1R3DA 1VFPA 5EUMA 1PT7A 3EQZA 4QSHA 1NW8A 3C4QA 2W6QA 3IILA 3OEHA 4GDFA 4Y6PA 2V8BA 2LXNA 2VP9A 4MKZA 4Q48A 2JJQA 5GJCA 3SC2B 3CAXA 1KJ9A 5L4LA 3BMQA 2OBNA 1QWSA 4GT1A 2Y8EA 1PL7A 1ISJA 3FVRA 4C04A 1K2WA 5GMOA 1C1XB 3NO4A 4M7WA 4MDFA 2R7TA 3CMCO 5KTKA 1RQGA 4QOFA 4PLZA 2IUYA 2VZEA 3BZBA 4CV3A 3RARA 1SCDA 3HJFA 1ETHA 2J3LA 3ZDFA 2FXIA 1H9TA 4ZV4A 2ODAA 1DIRA 2BRUA 2PXAA 3MMPA 1TU0A 1P29A 2ADFA 4FNAA 1Z2OX 4QGBA 3C3YA 5JATA 5FTKA 3RYLA 1V1JA 2FAPB 3FPHA 4QTXA 5JAQA 2QYTA 1QIEA 3M70A 5DBOA 2QVLA 4W8OA 5LQMA 3CPSA 2RFLA 4QQKA 5L53A 5EL0A 4E4RA 3T6KA 4L9AA 4JJGA 1VOMA 1E85A 3OSZA 4CHTA 4BC0A 2PLWA 2ZRJA 5LXTF 3GBVA 4TMVA 3FSGD 2ZD9A 1NOJA 1YS9A 2OQVA 4AYXA 2Q3BA 3W3AD 4R98A 4WY5A 1AMUA 1QFXA 1EWYA 3AVYA 4OK3A 4AS3A 3WAQA 1H2EA 4WZ6A 4EVIA 1E3SA 4D98A 3QU7A 4PRLA 1YAJA 3ZDCA 4NZ9A 3T3EA 1GAXA 1JQKA 1T9BA 3QY0A 3UUGA 2Z5VA 4O59O 2AWNA 2GN4A 3SR0A 3OUTA 1WR8A 1E2MA 4WLVA 2EF1A 2ZIEA 1SXJE 1A5TA 3I5MA 3PIRA 2V58A 4BV8A 1G5RA 3LWZA 1W7AA 3L43A 3H1BA 5THQA 3LBHA 4Y0VA 2XSZA 4H18A 3KZXA 3GNQA 4YJ2B 1A98A 4H7IA 1JA0A 5P21A 4C0JA 5COQA 4W5OA 2DLDA 1WDKA 2H4JA 3IRUA 4RLQA 4AJNA 3PWZA 3PUJA 3P2MA 1EB8A 1CGNA 5E33A 2D1TA 3JQGB 3MILA 1RJ9A 3DZCA 3I8SA 4MCAA 4NFLA 5P8WA 3TSWA 3V4VB 4RIFA 4BLUA 5H68A 3LUDA 4R1QA 2BL2A 5BSTA 2MSEB 3A1UA 3ZCUA 4E2ZA 1CDZA 2ZFUA 5JVDA 3CFYA 2WTUA 4IGGA 3RYCB 2QVYX 3EIFA 5MFPA 3ET5A 3FROA 4MW5A 1NQVA 4TXJA 1HYQA 3EMDA 3RVRA 2H2IA 4N5DA 5KS2A 4KE7A 3VKGA 2EJCA 4CS9C 4PJJA 3HU1A 4UCFA 4EDFA 4C2TA 2I4NA 3QLVA 4IYRA 4R8KA 1H1DA 2HH9A 1HMOA 1R7RA 1TJNA 1NVWQ 4F06A 1GZUA 4K9QA 2C8KA 3C3XA 3HRIA 1TM7E 4JJ6A 5EQJB 4I5FA 4AE4B 3W8EA 3BMOB 3PNPA 5L3VA 4OX9B 1OVGA 4KH0A 3G02A 3EXIA 3HCEA 3JZIA 2OTCA 4BKOA 1A9ZA 1U2DC 3UW1A 1PEDA 3MJCA 2AL7A 4INJA 3AMVA 2CC2A 4IGAA 1QLJA 1D1QA 1AKMA 5IABA 4WVFA 4ZXFA 1JHXA 1U1DA 2QSJA 4RZ3A 3H5IA 4BLTA 2QROA 4CTOA 2A88A 2OXCA 3NGXA 1M66A 1O58A 4BO7A 4Q4JA 3W8FA 5AFSA 2B8WA 3E22A 3TK0A 3PJDA 2P9FA 3QEJA 3W90A 4BTVA 4F56A 5F7ZA 3U0CA 1IHXA 2CEKA 4DQDA 2VYCA 2XDQA 3PV0A 3G8AA 1FR0A 3HBFA 1BWRA 3JV7A 3MJVA 2PBRA 4KODA 4Q4HB 4FR5A 3REQA 2ZR0A 3X2SA 5ADVA 2G7MC 2XQJA 4IIJF 3W8RA 1C2TA 3D3NA 3DUWA 2C7BA 4MW4A 1WW3A 2CNKA 4WX2B 3N59A 4MGIR 2HHJA 2FSHA 1ORSC 3SIWA 1TI7A 3OZEA 4L51A 4ADSG 3OCWA 5COFA 4KIFA 1JKFA 2Z43A 2PNJA 2DY0A 2B20A 3EMBA 3I4UA 2ZQ5A 4JJEA 1I4OA 1IEXA 3LHIA 4OKIA 2NQ8A 4E2YA 1UC4B 2A86A 3LEVA 2RIPA 2YJTD 3AM1A 1A7KA 1ULHA 1GUAA 1Z45A 2B99A 2GZRA 1V8FA 2JGJA 5AHOA 4C89A 4EG6A 2HF9A 3WY9A 3R3ZA 4DG8A 1IY2A 1I4YA 5EJGA 1ZYUA 1GTL1 3GT3A 1SUAA 2GBPA 2XOXA 4UHBA 4FDTA 3U13A 3GVXA 4KPUA 4C4SA 2H08A 2I1LA 3BTVA 3IBCA 3F90A 5KPDA 1IXRC 1MXHA 1PT9A 4K0KB 1OXSC 1VRCA 1EFVA 3I9V6 1KFJB 4HFKB 1XXHA 2BI4A 1FFHA 2B94A 3GUZA 3Q3CA 4ZAXA 3G7UA 5E9JA 2G09A 1FUUA 2JIMA 2BBTA 3GUYA 1E2GA 1T43A 2X9QA 3E3NA 2QV0A 3KXKA 4BVBA 3CINA 4LHXA 3EVAA 3ECAA 3O03A 3TLGA 3BE6A 3RJ9A 1LF5A 1MNEA 2D0IA 2V0CA 2ZG6A 5EHIA 1NW3A 3VO2A 5CNIA 1IEWA 1G20A 5BSMA 1NPYA 2CKMA 2XW6A 2YQ4A 4X7RA 4M2LA 2BGUA 2GN8A 4BVFA 4IAQA 3R8FA 3E9ZA 3OCCA 1BFUA 2WJGA 5MFZA 2K5UA 2P40A 1D0VA 1DE0A 3C63A 2OZLA 3EFOB 4XUGB 4AQYB 2XYGA 2PA0A 2J46A 3PEVA 4CS7A 3Q98A 4A1FA 1N8KA 4M7PA 4B85A 4DBLE 2CNWA 2B9VA 3AVVA 4R2KA 3WGKA 4AY5A 2WEKA 1H8ED 2X0FA 1AB5A 1N6PA 4O25A 4RVDA 1PP4A 1MVLA 3DM5A 1BCSB 1EBUA 2VP0A 2WYWA 3KOOA 4J6EA 4PSCA 4BMYA 2QX6A 5ETJA 3H2VA 1MZVA 3GEDA 4YEDA 1BEZA 4I9UA 1E2EA 3BIXA 1C9MA 3DJFA 2ZDQA 3HXLA 1C3OB 2QAJA 4FILA 5ALFA 1X8JA 4FUQA 2Z98A 4RPIA 1KWGA 3UPTA 5K8TA 2O6HA 1GJRA 1WMAA 1SCJA 3K16A 2O59A 2C7QA 5BVGB 4GR5A 2FPGA 2ORYA 1FRFS 3CQ9A 2B4KA 3KKMA 3R5FA 4WXPA 1OCOC 1QTIA 5B6IA 5LMCA 4EX6A 1IFXA 5JJIA 1UQRA 4Q3EA 3RWOA 1BIFA 1BBHA 1MPTA 1LPAB 1U3VA 2N1BA 3QKSA 4TMZA 1ZG3A 5FTWA 3WRXC 4D3YA 3FM9A 4O2AB 5INTA 3D4IA 3SJBA 4K9MA 3WGTA 4DLXA 5IF3A 1R5JA 1HOXA 1M6VA 3CZ6A 2XRHA 2Q1UA 3SJZA 4E4TA 1FBTA 4PS0A 1UT5A 3CZMA 1SBYA 3DKRA 2QY9A 4RFVA 2JFUA 4LZPA 4D9FA 5DS4A 4RHEA 4O6MA 1SG0A 1P72A 4KKXB 1H6BA 1O9HA 3DHNA 3ABMC 2ONKA 1G7RA 3BM5A 5DOZA 4N7JA 1GYRA 2GBCA 2XE4A 3BFVA 3GB9A 4QDXA 1XBTA 5K7SA 1T6IA 3K0FB 3GLSA 1XDSA 1LNQA 3LF1A 1W88A 2GF0A 2XWQA 4ZEWA 2ODTX 3RIHA 1EFPB 2I7XA 3JWGA 1EE9A 4L76A 4HI0E 4TSFD 3H19A 4CM8B 3OZFA 4URZR 2P4QA 3K0FA 5K5EA 1QP7A 2X0RA 4P1ZA 1IRIA 2GVNA 2PYIA 3K30A 4COOA 1J1IA 2CUKA 1T9KA 3M5PA 4DA8A 1U11A 2FSPA 3N6XA 4JR0A 4YV7A 1UM9B 5EMKA 4F5DA 5HFNA 5LWHA 3OZXA 3NATA 3OO0A 1GGHA 1SJ9A 1TM5E 2GJSA 1R4MA 1E5LA 2XMZA 4A91A 1SQ0A 4WOBA 1UT8A 1DSSG 1ZOLA 4PM4A 3I9NA 2VRCA 4WZBB 4QD3A 5EP1A 2HW8A 5ADWA 1KJYA 2WHQA 4E13A 4X9XA 3SXZA 2V7QA 2ODBA 4MKGA 1W29A 1U7TA 3F2IA 4HZGA 1VK5A 4XSVA 5KVCA 3NMJA 1FSSA 4NCAA 2GPTA 3WLLA 1IOLA 5MGBA 3WIUA 1KJWA 2PZGA 3LUGA 1JJBA 3JZ0A 3ZE7A 4GPAA 1UXHA 1ABBA 2HGSA 3A9SA 4YS6A 3T1TA 4X95A 3SIPA 2L6FA 3I9FA 4G0ZA 3Q3GE 2QNLA 4IVPA 2G28A 1KZ7B 2YJ5A 3PUZA 2ZRLA 2L69A 3NRBA 3LP8A 4CX9A 1OBVA 4MHOA 3U19A 4U4AA 4REMA 2W22A 4BYMA 1XZIA 1VJ0A 4EL0A 5IWCA 3C16C 2B34A 1G9XA 2HO4A 3D6FA 2JEOA 3JALA 1E2DA 1LDMA 1TCUA 2XTMA 4XJTA 5K6AA 2ZYRA 4NOJA 4ND7A 5C2JB 1UQTA 3C3PA 5BN4B 5IC5A 1VMDA 4GRIA 3UJ9A 1HE1C 4MW6A 5EJAA 2X8WA 2X0JA 3CUKA 3H04A 3DTVA 4I66A 3RAFC 1O96B 5AUQA 4FEGA 1M2FA 4V02A 1GVNB 1TYDE 4BQEA 1R37A 3DBRB 2E5LB 1V35A 5FBHA 4PFOA 3DFUA 1NURA 3FPCA 3FRHA 3IP9A 1TQ8A 3RHTA 1A7DA 1JHZA 2H0QA 4ND6A 5DB4A 4CUKA 2X23A 1TPZA 1ZNWA 3G0BA 2QZPA 4PPQA 3ZDYB 4QGSA 2DR2A 1SKYB 3V00A 1VBNA 5TQ2B 2E18A 1N57A 3ZLJA 2AX4A 2JIRA 2GZAA 4OYRA 3ABLC 4WDRA 2IHVA 3UWOA 1D2NA 4F5ZA 4FYKA 1ECLA 3ERCA 4ZQIA 4Q4HA 1Z4LA 2BIFA 2ZXWC 1H4TA 5BSKA 1WX1A 2R8EA 4MWOA 4YLEA 3V8RA 1FYDA 3DWIA 3L8CA 1W5BA 2IXTA 4I5DA 4QXPA 4R69A 3LG2A 1BMFD 2IHTA 4LDQA 1XXHB 2SCUA 4ZYUA 2FZGA 3OE4A 3ZU4A 1B8OA 3T9OA 2ZT6A 4MQFB 4QYSA 2O4CA 4KLRA 3DR5A 1MEOA 4R3NA 3H84A 4L57A 2WVAA 1GUYA 3SFZA 2DYSC 5EYPA 4PYLA 4LPSA 1Z75A 3ZWWA 3DEKA 2FFJA 3CH6A 3ZZUA 4CMGA 1P5ZB 1WLYA 3IQWA 1O95C 4BFUA 5LQUA 1DOWA 4OQZA 4ZT7A 3EHNA 5EG5A 4ETIA