3ECSA

Crystal structure of human eif2b alpha
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
307
structure length
279
Chain Sequence
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor eIF-2B subunit alpha
publication title Crystal structure of the alpha subunit of human translation initiation factor 2B
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 279
sequence length 307
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1070 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ecsA01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 3ecsA02
3ECSA 3A11A 4ZEMA 2A0UA 1W2WB 4LDQA 4ZEOA 1VB5A 5DBOA 3VM6A 1T9KA 2YVKA 2YRFA 1T5OA 3A9CA 4LDRA
chains in the Genus database with same CATH superfamily
3RF3A 4A16A 3TIIA 2GHQA 2IOQA 1C03A 5BN3A 5DKFA 4EP1A 3PLAE 5CTAA 1GFSA 3B5IA 3DOOA 2YC2C 1KXJA 1A8SA 2BF4A 1RRPA 3HFRA 1TA4A 5I7AA 2CNDA 3FVVA 3FPGA 1SF8A 5BUCA 1SD1A 4C2TA 1V8OA 4QTYA 4FDTA 5COGA 5L3ZA 4R1TA 4CM6A 4AF6A 4TM8A 3KZMA 4XX0A 3TGWA 4BUZA 1ZNWA 1NQAO 1NRJB 1D0SA 3LT2A 1KETA 3WWYA 3UXEA 2FFJA 3KZXA 3S7ZA 1G7TA 4WZAA 5JLJA 2EX0A 3EXIB 4JZAA 4HWRA 5F4ZA 4U5DE 5JVDA 2X58A 4YWHA 4E2FA 4P08A 1Z0JA 2GZSA 3C3XA 1BDJA 8GPBA 4ZOLA 1SM4A 1SVWA 1JFSA 1XLWA 4ENPA 2JD1A 4JH0A 2QN3A 3KR2A 1P74A 1FNNA 4Y2RA 4EWLA 2V4UA 4M89A 1IQPA 4XQ0A 2CLHB 3IKLA 4FFPA 5IBQA 2PS9A 1YI8A 5KU1A 5IYZF 5CT8A 1WXHA 4RNCA 2CVQA 2Q8QA 1JR4A 3EZGA 1I3OA 3SPXA 1Y8AA 1P0CA 2R2AA 5EPOA 3UATA 2BE7A 3G2NA 5HA5A 4REQB 3PHLA 4H7EA 4TTVA 2H4HA 2WHPB 1DVRA 2D5IA 2AS0A 3PJDA 4PBTA 3I9NA 3R7CA 4JENA 1I33A 4LE1A 1JSCA 3EEBA 2ZBRA 4OHZA 1B8VA 5FL3A 3KT6A 4U5QA 3ANTA 2JX0A 3L7MA 3JQBC 2PUCA 5CDFA 3GN1A 1CQPA 3TBHA 2GARA 4NG4A 5FTMA 5B7QA 2CUTA 1GAWA 4JYZA 5KWEA 3GLFB 2CJPA 4H9GA 3IH5A 3FDXA 4I3MA 4JLOA 2GLUA 3VKHA 3RKUA 3GRZA 2FV8A 3MGBA 1RKVA 2XUOA 2RD2A 1QHNA 5KYXA 3LF1A 2YRFA 3IA2A 1CD5A 2JGAA 2H08A 1X3SA 4JDUA 2GXAA 2WZLA 4HZUB 1V5FA 2ZIZA 4MJXA 4H15A 2W98A 1FFXB 3O95A 4S1TA 1J06A 4LOLA 3D7LA 3K2IA 5EL0A 5HF6A 3I4FA 1ZHZA 1JALA 2IY7A 2ZWIA 3AM3A 3Q8XB 5J2TB 4E5KA 3A6DA 4YQZA 2FX2A 5AVOA 3SEFA 2JFNA 2H16A 3BRSA 3QOWA 2Q7XA 4DS3A 4RY0A 5F2NA 3T3MB 1YFLA 4AU1A 3BVPA 2QP9X 4D79A 3AY0A 1DKUA 3RREA 3F8WA 2ARKA 4WZBB 1TI7A 2IBFA 4HBZA 2FGYA 3UMIA 3NYWA 1ZHYA 1P17A 1NBMD 1U94A 4J2TA 3IMFA 1FJXA 1P9NA 1QTIA 1CQIB 2NTYC 2YICA 3R7SA 1T0PA 1II9A 2DGDA 3W9YA 4BN4A 2QTTA 4QBGB 3ZR4B 2FMHA 4P83A 1F60A 3GRYA 4JIOA 5HK9A 1WMAA 3ABKC 3GAAA 4BKUA 3PMRA 5A6JA 3K9FC 5M04A 1B0AA 1FLAA 1SCNE 3NDBB 1XPRA 3OJXA 2FPMA 3I01A 3T41A 4EDHA 4RV9A 2Y4OA 5H9WA 3QM1A 3NYMA 5KTOA 1H2HA 1RWMA 1J23A 5JVDF 5ILGA 3HEAA 5LMNB 3TSYA 3DF7A 2I4LA 2G1AA 4ZOLF 4JP3A 1QRAA 3FYDA 4IIEA 4CX9A 1B73A 1MO6A 5FADA 1XRPA 4ZQEA 5K45A 3D0QA 2HWWA 4GRAA 3HMKA 3LUBA 5CB6A 3AKZA 5JD6A 1M2EA 2VF5X 4K3VA 3LL7A 4RMJA 4KQCA 3EODA 5HE9A 3RS8A 3W4KA 4QOSA 2QQEA 4F04A 2WPDA 4FHEA 2Q6VA 3AR7A 1W47A 5HVNA 2WF9A 3I72A 1H2FA 4LDAA 1SXJC 1V4NA 2AJCA 4B3DA 2OB2A 4U02A 5GOZA 4GBMA 1HV8A 2C8LA 1Q7BA 3W79A 2IIPA 2COUA 4HCJA 4I44A 1QWSA 3OEOA 3WNDA 2OCBA 3DXZA 3LGXA 3K0AA 2CJXA 1M2GA 2FCRA 1GNPA 3VYRB 1EFRD 3BM5A 1DADA 5HQ3A 5MN6A 4KQGA 4HLUA 3DTYA 5K8UA 4PPFA 1SMYF 4YEDA 4EUNA 1K5DA 3H2JA 3QWBA 3BJEA 4JL6A 3NO4A 1EKXA 1I4OA 4DDTA 5BRAA 2GA8A 3DEHA 4QOIA 3AJRA 3L4KA 3W5CA 2AC2A 1QR2A 3S6JA 1UKEA 4YCLA 3QPDA 3IUYA 4TXJA 3QBTA 2TMYA 3QKSB 1EM8B 2G1UA 2XUFA 1NF3A 2K2WA 3GGJA 4EEKA 4D42A 2VHZA 9ATCA 1ZONA 3F74A 3EZNA 3GMIA 4DGQA 1RWQA 4J0HA 1ZMOA 2WIJA 4GI5A 4KPEC 3ITNA 5LQJA 1XZFA 5JY6A 3BMCB 1R5NA 1L7OA 2W83A 4GDMA 2W8BA 2GD1O 2P65A 4HLQB 4G4SO 1KEUA 3HKEB 4H77A 3SXUA 4HN4B 3VQTA 2J8ZA 3NMUF 3THWB 1VI2A 2B25A 1N2JA 3UY4A 1Y4SA 1YRWA 4R9SA 2Z15A 2OUIA 3E9RA 2NTNA 3P0FA 2EFHB 4MTLA 2BTQA 4YI3A 4EQ6A 2WAAA 5FAKA 4L22A 1RLOA 2I29A 4E03A 3PE4A 2ERXA 3LRPA 4EG0A 3TQRA 4RPJA 4RXUA 8MHTA 1HSOA 4IDPA 5BRNA 2HO4A 5DLQC 1LLDA 4YP0A 1IBRA 3DWWA 3IEXA 4YCAA 3R1IA 4MGZR 3NM4A 1X80B 5EUCA 4ZCSA 2OAQ1 3U7IA 3KKBA 1XTIA 5CK5A 4YYEA 5FOTA 4GFDA 2VHUA 1ZAYA 2PFDA 3ERCA 1BDBA 2XUZA 1NJ8A 3ABOB 3AP1A 4BECA 1XCJA 2YHIA 3WGUA 1TQ6A 3KOYA 3GGGA 3A9VA 1M2KA 2G72A 1RZ3A 4YP5A 4ZEOA 2X4LA 3CZQA 1A50B 1ZVZA 6YASA 1B1CA 3IBCA 1YQEA 2QR2A 1IK4A 1M7GA 3U3RA 3RM3A 3U7GA 3N8GA 2GLXA 1Q2XA 2PHZA 4Y2VA 3S3TA 2EIXA 1YB7A 3OQIA 5H3LA 3TRFA 2BKLA 1RCTE 4R1UA 3EGCA 4RTMA 4BP8A 4OLJA 2H5EA 2JARA 1OBFO 1LRKA 3B6KA 4CBVA 2I3AA 4CQMA 1R6UA 3ILYA 1CJTC 4G6ZA 2YXEA 1IBCA 2G7MC 4EB6A 1ZHWA 4Z0PA 3WGYA 1MABA 4C06A 1NAIA 4MICA 2Q4TA 5PNTA 3IPLA 5TGZA 5HUJA 3RRJA 3SZLA 4TRNA 1T9BA 3EDOA 4WY5A 1AB6A 3RUDA 1NBAA 3EYAA 2AMYA 3DGFC 5T1DB 2QGFA 2O0LA 5A4MS 1A88A 3BE8A 5HJEA 1MAHA 2OOCA 4ON9A 3KQKA 2VTDA 3EEIA 3GLGB 4FNAA 1SHJA 4RGQA 1DLJA 1Q3HA 4M0LA 4BO3A 2PL5A 1FP4A 3K20A 4GRDA 3B0VC 1P2VA 4LJSA 1GNSA 4F9FA 5HBGA 3T9OA 2X76A 4E5SA 3RW9A 3U0CA 2DTEA 4F3RA 4DWVA 5DOZA 1OHHA 1NVFA 4EABA 2P4SA 2AN4A 4UREA 3T1TA 2KSQA 1UMBA 4GEKA 4I5DA 1YGPA 5FCLA 3EAQA 3J06A 4O4JB 4I6GA 4D9JA 3K2QA 3H5VA 5DBFA 4U7GA 1BS9A 5L7YA 2RE8A 3PXAA 5J40A 2VG8A 2B5VA 4M0EA 2HIHA 3B3FA 2J6IA 4ZYYA 2O20A 3H11B 1Y9JA 3FD8A 3GROA 3QQ5A 4FKBA 4MVJG 3WBKA 5HCNA 4RY2A 4N6NA 2AR7A 5LKAA 4R2LA 1DEOA 1QV6A 4FYJA 3O9MA 4MW3A 1FK8A 1NRIA 3I64A 1EG2A 4V0NA 3W6PA 2PKEA 1ECJA 4NMHA 5I5EA 1T4MA 2OR3A 4EUHA 4G07A 4IVNA 3V3KA 1LH0A 2GPYA 4DNFA 4ALLA 1X9GA 4KQIA 3C5HA 2F8MA 4NFLA 1RXSA 5TF4A 3Q9NA 2NMVA 5FWAA 3G59A 1QVAA 4FOPA 5DVWA 4BDSA 1TFOB 2YHBA 1A8IA 3FNHA 4BXOA 1P91A 3NHFA 4CKZA 2IDKA 2QL7A 4G8DA 1VG0B 4C87A 1ZXLA 1OU0A 4EPXA 4BWFB 5KCMA 1NZFA 3W8NA 3O9ZA 1VXOA 1IC6A 1O9HA 3N6XA 4HEAJ 1YR2A 2HSZA 2IP4A 1ZH2A 1P1KA 4WZBE 1O94C 4PLPA 4FNOA 5AK3A 1EUZA 1P2GA 4OHMA 3BZWA 1AX9A 2BJHA 1YKSA 1AS3A 4P3NA 2J0EA 1FX1A 2CV1A 1O9GA 1RE0A 1XDDA 2RH8A 5AYVA 1TPYA 2QVZX 4NY1A 4ZAVA 3FUCA 2O2DA 5EZYB 1T5OA 4NATA 1YI1A 2PN1A 4V0RA 2P3LA 1IATA 4AB1A 1UK9A 3LRXA 1UBFA 3RC2A 3SEOA 2WJPA 2J9VA 2WFLA 5J3JA 2B4KA 2E4ZA 4EL0A 3OP4A 1PT8A 1G0OA 3D6JA 4RQUA 2PANA 1LDNA 1M75A 2DB3A 3PFNA 4EATA 1U5BB 4IX1A 4WY2A 1T24A 4HDOB 4E5UA 1CT9A 1JDSA 1WUJS 4W7HA 1KYYA 2BTEA 1RHUA 3G02A 4XASA 1QC5A 3ROQA 3TS1A 2A5FA 3SF0A 1JV2B 4UXIA 1WETA 3LP6A 4BX3A 1GZ3A 3MHTA 3B8HA 5L6MB 2PH1A 5EXDA 1KAMA 1OIXA 4MUMA 4KIUA 2OZKA 4MVUA 5AM4A 2ZIWB 2FZKA 3SI7A 2BP7A 4WXRA 3EGXB 1GKLA 4F71A 2NM0A 2EGGA 4JU8A 3DT9A 1AGXA 2FFRA 3T6GB 1Y82A 3K1IC 3DI5A 3K31A 2PXHA 1Z6XA 4UKDA 4ZDIA 4JT4A 4H35A 1Y9AA 1BX0A 3VBEA 3ZW7A 4P53A 4B3HA 1DE0A 3HKBB 1E1CA 2CC2A 4LTMA 3M1IA 3INNA 1RHQA 1WEKA 2HLDD 2A6PA 4LZLA 1QR6A 4EYEA 2CGEA 3IP1A 3GFVA 2FTKE 1V41E 3K3PA 4HQRA 3DP9A 4F0JA 1QG0A 4RX1A 1V95A 1A7DA 1AUQA 3RIYA 4LQ4A 2PUHA 2IXAA 1HY3A 4TKZA 1HE5A 1YQGA 5EE0A 4DLSA 1D0YA 4NTFA 4MUKA 5LPNA 3C18A 4GI3A 1ULUA 3PR3A 4CMIB 1GPBA 2CD7A 4IIJF 1EJ0A 1X13A 3GPCA 2R68A 1KSGA 1YZYA 1BGVA 4K2HA 3PSAA 4I2NA 2X40A 1W36C 2G07A 3OX2A 1OYWA 4HFFB 3EARA 1VMEA 4YJ3B 4UUNA 4OTZA 5B3IA 1YB4A 3OLQA 2WWVD 2XKBA 3GGCA 4KQEA 4G1VA 2HMUA 2JFOA 1I4DD 4NESA 3ZVMA 1HDGO 1YDFA 2AFIB 2QXYA 2H17A 4XUEA 2AZXA 1E2XA 5KYUB 1YULA 1S2NA 2JK0A 2AJTA 3ZZTA 4BN5A 4EKYA 3GPLA 4QHTA 3FKSA 5AW2A 1TDJA 2WV7A 1HDEA 3EGDA 1ZM2A 4XWOA 4QU5A 3WRWA 2XBUA 5DSXA 1ARZA 3H4VA 4CKBA 4L0QA 1QK3A 3T7CA 1U2EA 2YX1A 4FIZA 4R31A 4L4SA 1N5RA 4I1MA 2ENWA 4YS6A 4IQGA 2QN1A 2YL7A 1UM9A 3KTFA 4MYTA 2IP1A 4DMKA 1FVHA 4QXMA 1LS4A 1WV1A 4Q93A 1CY4A 1LGYA 2A1TS 2YVQA 3A6EA 4KV7A 4HJXA 2QK4A 2VRCA 2GK6A 4NFSA 4BO0A 5JHGB 4B73A 2P7VA 3IPRA 5GZ1A 3GO4A 3KTDA 5KVQA 5AIBA 3SYLA 2FDCA 3K0CC 3IV6A 1P0FA 3K35A 2BAGA 1K6IA 2ZIGA 3BDIA 3V1TC 2RGEA 3LP8A 4DBLE 1JRAA 1JJAA 2YTZA 2VPWA 1XF9A 3D4IA 1V11A 3G9QA 3MHPA 4UTXA 2MINB 5GQSA 1MF7A 2B1QA 2PUVA 2ZJYA 1TJ3A 1D2MA 3ZV6A 2NVOA 3OUZA 4BMZA 2PO7A 5HTKA 3N70A 2HMTA 2BEUB 3L40A 2OQMA 1Z2AA 1ECCA 3WGTA 3HQ4O 4GR5A 1GT6A 4JC4A 3IIIA 1G17A 4BB5A 1JN0A 4P4SA 4KBLA 1T2DA 1BAPA 1MB3A 2TSYB 3EGOA 2PFSA 1OOEA 3L93A 4R1QA 2FAPB 3I1IA 2G7ZA 4URXR 4HYQA 1YS2X 1R5BA 4OQ4A 4PAWA 3C41J 3KOUA 2I78A 5MN4A 4MWSA 2QMZA 2J0VA 3GLTA 1G3UA 2YMMA 3IRUA 1Y63A 4DWWA 1MIOA 1REQA 3BXGA 3ZNPA 5IZCC 5B1DA 1M33A 4F3KA 5IAEA 4HTAA 4EMBA 2R7VA 1MQSA 2NAFA 4RIEA 1IZMA 1XF1A 2JCVA 3DZHA 3DWGA 2GN0A 1SBTA 3OPXA 4UMDA 4WLFA 5L0IA 4CSAA 4DZTA 2VXBA 4QJ4A 1DL5A 4AJOA 1NTRA 1H6DA 2YLGA 5C1PA 5K03A 4D7AA 5HUHA 2IOFK 4LW8A 5BN4A 3D2LA 2DFLA 4WKBA 2WWFA 4EL5A 2XECA 4KAFA 5COBA 2CDBA 1W1IA 4BX9A 1EQ1A 5CDYA 3A2LA 2JD3A 1VHJA 3SHFA 3IEKA 2I4OA 1QLJA 3GMDA 2PMBA 1E7WA 5K4AA 5A9SB 5IH7A 3KOMA 2CMGA 1QNLA 5B64A 2ZCJA 4OJMX 3EW7A 1OBOA 3ADCA 1IU9A 5EN4A 4BFTA 4D8UA 1ZW3A 4Y2SA 1Y81A 3TRHA 3FJOA 1MN6A 5C8YA 2ZRLA 3FXAA 4IRXA 4KN6A 3HR4A 4BV2A 1A98A 5ED4A 5JYEA 5CFZA 4UVDA 3PPIA 5CFPA 3N7TA 5DI3A 1Y1KE 1CVRA 4U00A 3UGKA 3EGEA 1VE6A 4OI0A 1K6EA 1SCJA 1FNTc 1BVYF 4M37A 3LVBA 3HDHA 1GPUA 2FPLA 4LX0A 1QK5A 2OLEA 3TLZA 2XT6A 4B6PA 4C7KA 2O3JA 2VCYA 4TSFD 4AUNA 3BE4A 3U81A 5D84A 1RPZA 2EBWA 1H3EA 2VS1A 4Q34A 2FPUA 1X7ZB 2PGIA 3UMHA 1UT6A 4HNTA 1ZN2A 3QTHA 2QRVB 3TOMA 3LPAA 3W34A 3LC2O 3EIXA 3M81A 1CEYA 1YMQA 2JJ8A 4KN9S 1OU4A 1DX9A 4Q12A 3RYCB 2LXNA 3FB4A 4OQEA 1JAYA 4X90A 3SR3A 1EINA 1RZRD 2FOXA 4JJIA 4AX2A 3MTDA 1OFHA 4J1TA 5CEJA 5DHUA 3OKCA 2HUNA 1RWXA 4CUKA 5JJLA 4BVEA 5CFNA 1EK6A 4FSHA 2V7BA 3RS4A 4CFYA 3GZJA 2UU9B 2QVYX 2DBRA 1KMIY 4N54A 1STOA 1C3OB 1XHFA 3AFHA 4QDXA 2VXCA 4I1OB 1DI0A 2Q4OA 4ZANA 3NP9A 2Q4EA 1I0ZA 3DONA 5IDQA 1BYUA 2A8YA 1Y8RA 2YZNA 2FG7C 3R09A 1FYDA 4HFKB 4EKEA 2VJBA 1K68A 2TS1A 2K4MA 3KWMA 2AG8A 4ZV4A 5AKEA 1WSAA 2O07A 2W2VA 4ZICA 1B2RA 1KI3A 3MINA 4IFEA 2OFXA 1Q74A 2IH5A 3AEYA 1KPIA 1TQHA 1E2DA 1E7YA 3I6IA 1C9YA 1IH8A 1Q44A 1ST6A 1U3DA 2SCUB 3PA6A 3IBGA 3AUUA 1C9MA 2CXQA 4LRUA 4ZVMA 2C7RA 1BXGB 3TL6A 4TV8A 3L49A 3UPTA 4GVXA 1NYQA 2ENUA 4BKPA 3PUKA 3FXHA 2CLFB 3F6BX 1F5NA 3DMGA 5B1YA 3O9VA 4OPMA 2B7BA 5BSGA 4QU8A 5LWQA 3P0EA 4IRUA 5DT2A 1L4UA 3THOA 1D8TA 2VTEA 2CVZA 4OP1A 5E1MA 4QBIA 2H18A 2DQKA 3IHTA 4RKYA 1VYUA 2FLKA 4TRMA 3P9YA 4U0JA 5C8YF 1D04A 1N8KA 3AGQA 1ZBDA 4ILEA 4KPUA 3VJRA 2Q0SA 2A1DD 4YI5A 3NV7A 4XM1A 1KO5A 3R0VA 4NY3A 3KBBA 1NRXA 4M4SA 4MI1A 3O6XA 1QIDA 1Q12A 5T4FA 2WJ3A 3AIOA 3AHEA 1TAQA 1W6UA 3PUVA 3B7PA 1S1CA 2YZMA 1ATZA 4ZI3A 1G5RA 4DKJA 1UMKA 3MWLA 4QKQA 1TL7C 2XS8A 4E2YA 1DKMA 2G5PA 3MOSA 4B6IA 5KYTA 2YWRA 5CIQA 2IM8A 1UKBA 2OBFA 2OCDA 1G8MA 3ZJYA 4WLVA 1W2GA 4TS9A 3ESQA 2RJ3A 1BBHA 4ZZ1A 1BCSA 4E1AA 4RDHA 1JR3D 1GRRA 4EKGA 1GTMA 4YALA 1D1SA 1VKZA 4KQ2A 4MYHA 4BJ6A 2AMFA 3R40A 3U9TA 3TNLA 5J4KA 4EA9A 1X9HA 2BFBB 4GXQA 1CUIA 2IE0A 1I7PA 3CTMA 1PGJA 3KLOA 1NM5C 1ONSA 5EGNA 5CP8A 4OSOA 1R0WA 4B4DA 3S7TA 2WJHA 2J45A 3C3BA 3B36A 1C7RA 4NJOA 4F2WA 2OC9A 2HSDA 3UPUA 4BRWA 2C04A 4RPIA 3IAEA 3QNWA 2HIAA 2QUJA 5MGBA 3UJ7A 1U04A 3P8ZA 1EAMA 5FWXA 4KXXA 3ZE7A 1U3UA 3QVGB 4LGYA 1P45A 2K6GA 3FJ1A 2WP0A 3V8MA 2HA2A 1U2GA 3ZV3A 3ACCA 5B37A 1YZ3A 4ZVQA 2ODAA 3I4LA 3KZKA 3UENA 3VH1A 1V96A 2CCGA 1SU7A 5A5GA 4QPDA 1T10A 5KWJA 4ML3A 2I91A 4V0QA 1FXSA 1V3QE 3SVLA 2PP4A 2QUKA 4BJ5A 1Q0RA 1J1UA 1BW9A 4NBVA 4XTKA 4PG6A 3U17A 1UPFA 2NXNA 2WMOB 1A5ZA 3I01M 4DWJA 4LTNA 1QZTA 2PKQP 4XDHA 3U4QB 3RABA 2XUQA 1JE1A 5D7NA 1E1QD 3HBLA 4TV8F 2O7VA 1G6Q1 2A94A 1V9SA 3ESYA 2VDVE 1Y6JA 1RQRA 4CKEB 1CIJA 4Z9YA 5BSTA 2OWDA 3P0HA 2CXTA 3MT7A 3THSA 4U5EE 1Q0KA 4QYSA 3GP5A 1MC5A 4JLAA 1CNFA 4MQEB 3FROA 1YHZA 4BEVA 5C4MA 4PACA 2XRZA 3C6XA 4H1WA 1Y4UA 4LFBB 1UBLS 3QITA 2M1XA 3TLCA 4ZCIA 5EZQA 5EXSA 1NL3A 3HYLA 1P7PA 5FOWA 3CEJA 2EX4A 3QV1A 2OHGA 2ZUUA 3FBWA 3MXOA 3NC1C 3U4AA 2Z9DA 1K2VN 5DWQA 2NSGA 3GCGA 3DBHB 4DLYA 1JTEA 4PIMA 4UM9D 2ZXRA 4DJAA 2B7CA 4K9RA 3LZ6A 5FPTA 5DJ5A 1XKXA 4CLOB 1FBTA 4FCCA 3UM9A 1VKRA 4GXTA 1N2OA 3JPYA 4EA6A 2C0PA 3ZTYA 3Q85A 1E5QA 4ID9A 3LC0A 1NXPA 3OEHD 5DHSA 2WSBA 1U0SY 2UZAA 4PG8A 4KC9A 1NSTA 4NE2A 2O8FA 3WYBA 2GKOA 4IJ6A 1SQFA 1M6YA 4O0LA 5EAIA 2XNKA 4GL4A 4H3KB 4U2KA 3MOGA 1X8XA 1NZDA 1D6JA 1N34B 4GI7A 3SQWA 4ZKDA 4X7PA 3UMFA 1NBHA 1DIAA 2Q0QA 4KW7A 3DDUA 1OLSA 1V43A 1VXRA 3P0RA 3LH5A 1YDIA 2IXNA 4HUQB 2ZRGA 3KFVA 1XA0A 4AUMA 1OPRA 1TUGA 2BGWA 2EIJC 2DJ5A 2W6IA 5IKXA 1L4LA 4M9XA 1PNTA 1R4NA 2HT6A 3KZVA 4E70A 2IELA 4Q3DA 3VJMA 2PE5A 5HOEA 4PFKA 4YL0A 2AQKA 4ZYWA 2H29A 1E2KA 1RI5A 5D3KA 3T6JA 3OD1A 3MJSA 1HEYA 2WMNB 1R5OA 3VKUA 1PLJA 2M6SA 4OQZA 5A0FA 4CG0A 4OF4A 1F1BA 4JMLA 5HFJA 4YREA 3LOQA 3OE1A 1YL7A 5I7EA 4IJVA 4OHOA 2VT2A 1XRLA 1PSWA 1VCMA 4AN4A 3WLSA 3MPOA 4BNTA 3UV3A 1NLUA 1KOFA 4U7TB 5D5QA 3BE5A 4HFMA 4FMCF 3OQHA 4WLNA 1TIPA 2Q1YA 3VC1A 3ST7A 5HSGA 5BQ3A 4MINA 5DV9A 3GJ7A 1NVVR 1GL6A 3GCWA 4JYPA 2YZKA 3MC1A 3K0HA 3S5JA 1YJ5A 3A2KA 1JIQA 1S5PA 3S0XA 2WR8A 2GZHA 1ONOA 1XTSA 1C3XA 2VDLB 5HF9A 5K01A 5AK0A 2DFNA 3SDBA 3TB6A 3IYLW 1R74A 1WB4A 3HPQA 2YC4C 2P9YA 4JMPA 3EBOA 1JA0A 1IM2A 4OFZA 4MLPA 1YI0A 3O93A 4FQ5A 1VL6A 3BIJA 4X85A 4HZGA 1FFTC 2UDPA 3WRXC 5IF3A 2CMFA 3H6HA 1JUDA 4X7BA 1GDHA 3JW8A 4B8YA 4IWXA 4JFRA 2PKWA 2W7TA 1H9GA 1IDN1 5AM3A 4ND8B 1FAPB 2IDZA 2NU7A 2Q5LA 3Q7EA 2V7QD 4QZVA 5MFPA 4UDVA 3ICCA 4NARA 4FGSA 3F49S 4QICA 5I4BA 1YHYA 5DTMA 1PJTA 4YJDA 1TO1E 1TVCA 3AVYA 2O3UA 2IX3A 1RDFA 5I9BA 1ILWA 1JTVA 3KJIA 1RAHA 3BWVA 3UVEA 4ERNA 1KEPA 2I3ZA 1GKUB 3OCVA 1QKJA 2VQFB 3ABSB 3B6IA 5CDTA 4ZPJA 4BC1A 4ESHA 4MUFA 4F4JA 4EZIA 4KQ6A 1W0KD 4G86A 2C3YA 1RI1A 3ZU5A 1PJ3A 1AK1A 3B1KA 3N2KA 5IYZA 5IM4F 5LMZA 1EDBA 1QQ7A 3HNKA 2XYVA 5LUBA 1CB7A 1V6SA 5IABA 2XNSA 3RSCA 1WSWA 4IZIA 3EG9A 2OKCA 1MNEA 1O94D 4FBMA 4J3NA 4CFZA 4AUEA 2GLTA 4O6YA 2IYYA 3P94A 3OLCX 1IG0A 1Q1BA 5KQMA 3NANA 5BYJA 2D5RB 4LZOA 2XQIA 1EE9A 3K1AA 3PNLA 3B60A 1A9ZA 1ZZGA 3BMOA 3HDTA 3MVEA 5I6DA 2D1QA 1DZIA 3VR3D 1U28C 3KUUA 4U7DA 4KGDA 5C1OA 2VDQB 3VNSA 2L19A 4CM9D 5FBRB 4DJ5X 4ONEA 1DFHA 1RSZA 1YZVA 2BV3A 4WX2B 2KHZA 3OIFA 3RLFA 4H1UA 2GM4A 3FRJA 4MP3A 4J9UE 4DR3B 2VAVA 4OKNA 2IXPA 3EQ8A 1NG1A 3IOMA 1SD2A 1ND6A 2AJBA 4PZ0A 3QU7A 4FMBB 2P2CA 4YRDA 4OI2A 3QI7A 3LO8A 1HYHA 3T1QA 3R8FA 3KR0A 1G18A 4DLTA 2O6LA 3K6JA 3SYMA 4NCQA 3QLEA 4NPCA 4A10A 2O2EA 1QYXA 2RHHA 2BELA 1FDIA 1C1XA 2GPBA 2WKQA 3JRXA 4OU5A 1RHKA 2J4CA 4ONSA 4PJMA 4JQOA 1K3UB 4OFBA 1FNMA 3M8KA 1RM4A 1N6OA 1LBSA 1HT0A 1RAAA 4AKSA 1K6MA 5LZ9A 3NC0C 3WOHA 3L7CA 1A04A 3SS9X 1X1QA 4D56A 2I2BA 3MCVA 3ZDAA 1KY4A 3R7WA 3LAYA 3VR4A 1KPHA 1BJTA 4TMWA 3I1FA 3OE7D 4NX2A 3K09A 4P5EA 3JSAA 4BNUA 1G4WR 4AF7A 2ZLBA 1GVHA 3X1JA 4BX2A 4Q1EA 4N4AA 4C6RA 1PJRA 1TVEA 5T41A 2Q9BA 3R5FA 4QSHA 5DLDA 1Z2EA 1DO8A 4HGRA 1NPTO 5KNDH 1Q77A 1J1IA 3ZDYB 4HS9A 1IQ0A 3W2WA 1LDMA 4F4DA 3ECCA 4EW2A 3O10A 5HJ7A 5FJJA 4CIBA 3AB3A 1XZPA 2JNWA 4TZKA 3HRHA 2AVKA 3V4SA 4QUDA 3NHYA 3D8NA 4CWAA 4KXVA 2D8AA 1R8XA 1SKMA 2BM9A 1BHO1 1I7LA 4XLLA 3I5QA 1MOSA 1MEOA 2A5LA 5JNUA 3PUXA 2JJ2D 2ILTA 1W36D 1XVUA 1C4OA 2JIQA 1Z3CA 2JI8A 2AE1A 3L3BA 3MAJA 3N53A 1NBBA 4HLDA 3QEJA 1W25A 1J70A 3MLGA 1ICEA 3I9MA 2ID7A 2PCLA 3RVYA 1SCAA 1YCDA 2WC1A 3ND9A 2E4VA 3WGOA 4IIXA 2QE9A 1YVIA 3CT4A 1NQ5A 3OTHA 2VDRB 3REGA 4F06A 4CS8C 5DGIA 1CEQA 5IKMA 3HL0A 4YP7A 4C20A 2HD4A 3PLNA 5K6AA 1JDJA 1JMYA 2C2XA 2PCJA 2W45A 3JR7A 4YP9A 1H8HA 2RGGA 4JI1B 3VU3A 3DKPA 4M21A 3GORA 2HTFA 3BWCA 1RIFA 2ORIA 5E2QA 3G4ZA 1HZJA 4NPHA 3DE2X 4TMFA 3FFTA 1QXSA 1HLGA 2CNWD 2LBPA 1EVEA 4JL5A 1J39A 1M2FA 2VQDA 2AKYA 1U2DC 5DO9A 1VCOA 5BT9A 1LF0A 4HD8A 4EUKA 3ZC3A 2ZZNA 3BL8A 1YXMA 3EQ2A 3KPYA 5J2UB 2MSNA 5B3AA 1K5GA 4W5RA 1LDYA 1KOGA 4FJ1A 5T4HA 5HGXA 2WSMA 5GGXA 1U4SA 3DOJA 5LYYA 4QG7A 4LBVA 2P3SA 2NSJA 3SKYA 5JTTA 2JEYA 4A26A 4JSTA 1PQUA 4DKXA 3AL3A 3AKEA 2O8BA 3K9GA 1AKEA 2H7BA 1Q0ZA 3IQTA 3BHIA 4XCXA 2XKAA 3ZIDA 5FI3A 2PXXA 4WESA 2C7OA 1F4PA 1T36A 4B7ZA 2PUFA 2BUCA 3AF3A 4DRXA 2JH3A 2P4UA 3ZH2A 1AF7A 2L7AA 1VRVA 2BL4A 3VOAA 4NCHA 2AE2A 4MMZB 3L34A 1SU8A 2NNWB 3EIFA 2Q9AA 4JQSA 4YMSA 1Z0DA 1II8B 4E12A 1XZCA 3ODGA 3PNBA 1JFLA 4BZPA 5L7TA 3OPMA 4TQUS 3W4JA 1Z15A 2PV7A 2DKNA 3V1UA 3HSYA 2Q9UA 4B79A 5FL7D 1U7DA 3QJ5A 4U0KA 3V7WA 3QYJA 3HS3A 1NR5A 1GTL1 3TOXA 3MGAA 4CS9C 3NKFA 3B9BA 3O3MB 3WWZA 1CERA 3T7AA 3RVRA 1RKBA 5KYGA 4HDQB 4RCVA 3SMQA 4DCCA 4OH1A 4OMDA 1LPNA 4DCPA 1O54A 1XR3A 2CUZA 3F3SA 2HCRA 2ZM5A 2EYUA 1JDNA 5CW1A 2IZ6A 3H5AA 4MW8A 4R69A 1XXLA 1Z38A 4E5YA 1E2GA 3ASZA 1VCIA 1L5RA 4JJZA 2GZ2A 2XLEA 2WBLC 3QKWA 3WY9A 1WHTA 3ODPA 1J0XO 4Y2XA 2VK8A 4WSOA 3JQAD 1GN9A 2CNNA 2D54A 3MB8A 1E3QA 3TGPA 2RCYA 4PQGA 4Z0TA 1KDTA 3KAQA 4MWBA 3IDFA 1Y1SA 1YRBA 5FWYA 4B3GA 2BGNA 1Z6AA 4U5BE 5FTNA 1E9CA 4NYIR 3L6RA 2WUVA 4KDFA 1VM6A 4FYIA 2DKFA 4LZJA 5DASA 2RONA 3GOQA 3VYSB 3AF0A 5T5QA 2NXCA 4KXWA 3DC7A 2GZ3A 2XLBA 1ETUA 4DLLA 1GNRA 2GSWA 2BHSA 4N7RA 4HT3B 3ZQ4A 1B15A 5JWHA 4RJKA 1GQQA 2CXSA 3Q7RA 2B78A 4WNCA 4R16A 1H4TA 3GJYA 1ECFA 5G4KA 1BDIA 1YIDA 2FY8A 3CUYA 2CHVA 2YXBA 2PQ6A 1IZYA 3DOEA 4KYVA 3I9OA 1A5SB 2J9ZB 4MW2A 1E6KA 4DEVA 4CIDA 3HKDA 3U3ZA 2OBMA 3CT6A 5IS2A 3LF2A 2Z9CA 5DHPA 1QRRA 4XWTA 1S4MA 4O5OA 1CDOA 1FVOA 1VBFA 2R7AA 3KOWA 1ULBA 1EK1A 1MRSA 2GWRA 3IT0A 3G9UA 1O96A 4IRMA 1WB6A 2LD4A 1NDUA 4I55B 1YDWA 5J43A 4LS3A 4LJLA 5C52B 2P61A 5F5NA 3ZTZA 2Q5HA 2O8EA 3RQIA 3ZWDA 2UZIR 3OKPA 1YZKA 3ESZA 1R6VA 4TLLB 1YE3A 3M7IA 4N8SA 2NZVG 3ETDA 3AR9A 3V8BA 3SXMA 4F6LA 3K6KA 1T4CA 5ICMA 2PVCA 1RXIA 2ZITA 4RJTA 1SEVA 1F8GA 2V74B 2AL7A 3VVLA 3GP3A 3E18A 1X15A 4MWEA 5AW3A 5BQIA 3I0MA 3ZXUB 3Q3HA 2WWTA 4DLAA 4IGAA 1CGNA 4PSDA 3GQBA 2OA0A 2OSBA 3CQ9A 3AHIA 2HL6A 2FQ1A 1MMDA 5AOVA 3AEXA 2XZOA 2HSWA 2CLLB 3DL7A 1DQSA 5A4DA 5AJYA 4GYWA 4ENTA 1WTYA 3AHJA 4D26A 4O3MA 3LHIA 4NOJA 2GJKA 3GELA 4M8NE 1VE7A 4B3CA 4YJ2B 3PE3A 2PUGA 1IZ0A 3MRVA 2XA9A 1JPNA 1U1FA 4EJSA 2EGUA 4B6QA 3U7QA 2ZUTA 1X6VA 2FFBA 3PEVA 3AT1A 1UUFA 4KVGA 1E7MA 3UYLA 5CVDA 1Y6DA 5K3FA 4FFMA 5EEGA 1N9ZA 5KNBD 5BQGA 1HQKA 4REQA 3P26A 4RTQA 3JASB 4ND4A 3TDNA 2WHPA 3Q7LA 2OESA 2YJGA 3TD9A 2J9YB 2C03A 1ZVJA 4PYJA 3ETNA 2H5LA 1D1BA 1JDTA 4UEJA 3ZHXA 1P5RA 1ESNA 4LYHA 5K8LA 4CQNA 3JYHA 5JCXA 5F23A 4Q4JB 3K6SA 1U0RA 1OZFA 3KQTA 3JD4A 4X5OA 3KL4A 2WZFA 1BWSA 1W9HA 2RKOA 1WDMA 1OAAA 3SYTA 2BBWA 3JQ8B 3Q5GA 2BZSA 1CV2A 2AP3A 5E4YA 1C8BA 3GRPA 3GLFA 4NMWA 4EMTA 4LDKA 1ODKA 4ZAXA 2F1RA 1ND5A 1TYAE 1NBIA 2WSYB 3FF4A 2Q4FA 4FCVA 3LY9A 4BO8A 5JSFA 3W2IA 2IH4A 2REXB 4XQCA 4S1NA 5DNUA 1DSSG 2YVKA 1NHWA 4FUQA 4UJ3A 1ODCA 1PWEA 2GK7A 1ADFA 1VHQA 3DTNA 1V35A 3IO5A 1NVBA 4P4UA 1ZCBA 3LT5A 3Q7GA 2IU3A 3TTUA 1AKNA 3DE5X 3GLFE 3IP6A 2Q9CA 3MG9A 4H1TA 1O95D 2AZDA 3WLHA 2O8NA 1MQ8B 1APBA 1ISPA 6LDHA 2X8BA 3L0YA 3T12A 3A3OA 1RABA 3DDOA 1HETA 1UM8A 1I1NA 1ISIA 3HV2A 2MJLA 3CEPB 5I3CA 4QU0A 3NTRA 1DQRA 4ZO6A 4LHSA 2IV2X 1QPBA 1XEFA 1H69A 5A3JA 4WKNA 4WZBA 2Q2WA 2AW3A 3TIVA 5CT6A 3WWDA 4IIJA 1T9DA 2RGCA 4LYDA 1F7UA 4XJVA 5CXSA 1VHDA 4B84A 1NKTA 4MB0A 1C8KA 2FN7A 4MVJH 2IKSA 3UQYS 1CE8B 1V8ZA 3MRTA 1CQIA 3AUKA 4B9EA 2QG4A 3R5HA 2R2GA 2GASA 3VTZA 2ZVPX 1LQTA 3HY6A 4XJTA 4LDNA 4DCOA 4YB8A 3DWIA 3VPBA 4HP8A 2A1IA 2NXJA 3V32A 2QMOA 1WF6A 1P33A 1V1RA 1NONA 3K6BA 1PUIA 3HU2A 4J7CA 2V55B 5JPDA 4UEOA 3D81A 5BSHA 5FI1B 4L8YA 3LLSA 2HH9A 9GPBA 2ZTLA 1JIVA 2I5PO 5JLAA 1TEVA 2B5WA 3COZA 3KQUA 1ZJWA 3KLMX 2ZE7A 2LE0A 5LMUB 2OK7A 4HAXA 3AKDA 3WRYA 3CLRC 3BA6A 1P4RA 3P7MA 1R12A 4RA9B 1DRJA 2WY2D 2JJ1D 2LW7A 3EZ9A 4DLZA 1DHRA 2PRKA 3WX0A 3C8MA 2HA6A 3N87A 4DG8A 1MRNA 1TKAA 2W2NA 3VO9A 4AZVA 4MUYA 5KNCH 2VF7A 3L1HA 2TMKA 4H4KC 1SUSA 3NM6B 2BCJQ 1Y5IA 2H1WA 4AKHA 4FS3A 1M6EX 3CJTA 1HE3A 2FQQA 5FBLB 1TECE 5IJ9B 2ST1A 1VIAA 2H9YA 4F92B 3WK7A 3HBJA 3DMPA 3QEOA 1DX4A 3B6MA 2FETA 3DOIA 1S05A 3R5KA 1G8PA 1VOMA 1CX9B 2C5HA 3EISA 2QMUA 1DCKA 3VH4A 1II0A 2AVNA 5AC5A 1C5KA 3WAQA 3HDQA 1WZUA 2QUBA 5IPFA 4OHUA 1MX9A 2XTNA 1HORA 1U7OA 5AXBA 5IBPA 5LQRA 3JWHA 1WSDA 2EERA 3VPCA 2WD9A 3D9QX 3HFJA 3IE0A 1Q22A 2B21A 3NC4A 3PNQA 4I14A 2J1LA 1EE2A 4X3OA 4FWBA 2J7KA 3L92A 1HDYA 2FK7A 2ZJBA 2AD1A 3CSDA 4I50B 1SURA 5CYGA 1G1MA 1A4IA 3HKEA 2PXAA 5AI8A 1KDOA 2XB9A 1SU4A 2H3EA 2G70A 2WU0A 1RPNA 4RGYA 3P9KA 3UMRA 3V2HA 4A4AA 2Q3LA 3VO2A 2OEVA 3PA8A 1K4MA 3IUPA 2ZSBA 3RIHA 2AKEA 1KYZA 5JAZA 2LP4Y 3BDAA 4Z86A 3ZCRA 4YRTA 3ITKA 2HQBA 2WE8A 4WXPA 2H4WA 3OPVA 4XUGB 1SK8A 3PDJA 2HK9A 3RQEA 4LZPA 4B85A 1EX7A 4KXYA 5E6SB 3P20A 2MYNA 1WDLA 2CY0A 2X8JB 3UK6A 1CF2O 4LYGA 2A69F 4JEMA 3E15A 1XHLA 4IIDA 5FNVB 1XQXA 1Z6TA 4B34A 1H7IA 1X80A 3T54A 5FR2A 3ZQ6A 1T5HX 3L8DA 1RW4A 1PR0A 2R66A 1KGDA 1NZEA 4M9UA 2JLBA 4I3FA 1TT5B 2G09A 5EVJA 2XBLA 2X22A 3NUGA 1CYEA 5IX8A 2ID4A 4BZXA 5LBIA 1XEWY 2NTEA 3KVRA 1T25A 1HRKA 5JZMA 3L6BA 4B6RA 4US2R 4PRZA 1W52X 3TOCA 3GUVA 4QC2A 3ZW8A 2NZ8A 4RPHA 1GQAA 2FWMX 3W8IA 4I4NA 3O0DA 1U63A 2BC9A 3PLRA 4N7MA 3LNCA 4URZR 4YQEA 3QK7A 4K9NA 1ZLYA 3UQZA 4DM3A 3FGZA 1X1SA 2ZJ3A 3PK0A 4HPWA 2FCAA 4GLOA 1HTTA 4CIWA 1VPEA 2CD9A 2XS1A 4DDWA 2BGJA 2QQ0A 1PQWA 1TUBA 5IANA 4FHGA 2BD0A 4JI2B 1CUYA 4HY3A 3THXB 3PXEA 1J8YF 1V2HE 3WG9A 4KK3A 3M3HA 1KS2A 4G4SP 3UHJA 4DLRA 1OFVA 4JJKA 1N6KA 3HWWA 5JBQA 3GX1A 4C0KA 1Y9EA 4JVOA 4BNMA 2UYHA 2V9ZA 2WF7A 3DT6A 4AUKA 2H54A 2H63A 4LJ9A 5AOCA 1ULSA 2I22A 2TRSB 3ZY6A 1KIAA 1IOLA 3UT0A 3TLJA 3J7TA 5T3TA 4JR1A 4EMUA 3DVRX 3PB3A 1C7FA 3ED1A 4ASUD 2WYVA 4EJ2A 2C96A 1UDBA 3JSEO 2XUAA 1JHAA 4X93A 4CKYA 2HU7A 2HA4A 4P54A 2OKUA 4LJ4A 2HFJA 1C9DB 2QRQA 1NF9A 4LK2A 5BV2P 3MJTA 4F3TA 2C2HA 4P34A 1B6RA 3OHPA 3FX2A 5KTRA 1U65A 5JLIA 3ENZA 3NIWA 4KRGA 4K7JA 3R3UA 5AXAA 3GLGE 3GPDG 1NMZA 5CDUA 1P2DA 1GTG1 5HIAA 3AB7A 4AG3A 5DCWA 4Q3KA 2HBRA 4RAQA 1I36A 4ZIRB 2RG7A 2ATXA 2QM7A 3OPQA 1NVGA 3HP7A 2C2ZA 4PYMA 3QFTA 1NY6A 3TR6A 2QE7D 5GINE 2HS5A 1Z5VA 1H3FA 4TWBA 4UUMA 1K88A 4U8GA 1XRJA 5IH3A 4X7MA 2X51A 2WB4A 1MORA 3T38A 4PFOA 4BB9A 2F6RA 2C42A 2IYAA 3K96A 4IHAA 4JI7B 3LEVA 3EB9A 5TQ2B 1Q21A 1O77A 3L0BA 3REFA 1O6FA 3QVMA 2A3NA 5AKIA 1HKHA 4WFJA 1D6SA 2NXWA 5EKDA 3LLMA 4HGOA 5A4AA 3ZGZA 2D06A 5GJBA 1CQXA 4YCJA 1VJCA 4DQUA 2KX7A 5EINA 3EFOB 4UAJA 1AZWA 4BFSA 2QPTA 1NP7A 3S2IA 2YWCA 4CG3A 1RYHA 1XJQA 4HAVA 3PQ8A 2VYND 3BXHA 4HLNA 3TQFA 2C20A 5DS4A 4QYTA 3G2HA 2IXOA 2ANBA 5BURA 2AWOA 3NKDA 4ZHQB 4KIJA 4JLWA 3QW0A 6REQB 2P91A 3D5QA 4YVFA 1MNAA 1P1HA 3EXFB 4F7WA 1SN7A 2A0KA 1E3DA 3ON5A 2C88A 2QM8A 3BIOA 3AHFA 2QSYA 3HSKA 5EZYA 1YC5A 3SZOA 4MUNA 2VC9A 3ZY2A 3RFXA 1EFVB 1SZCA 3RE1A 2MR5A 2I6UA 3IGFA 1G38A 1OF1A 1A7KA 1HZZC 2CZQA 1ZWLA 3T3IA 1EX1A 3HCPA 3IJEB 1FNBA 2J48A 4KXNA 5FT9A 2WF5A 4AIIA 3I6BA 4C5AA 5NULA 1Y5NA 3IB3A 3O55A 1JG3A 3TX2A 4NU8X 3A9CA 5HCIA 3Q6IA 3GM3A 1JHRA 4DA0A 3ZV7A 2IEDA 3NZEA 3P5BA 1ES9A 1SKUA 4P9NA 2VQEB 3HWRA 3KZ1E 4WVLA 1QGYA 5JAPA 3P32A 4RETA 1WS6A 1KH3A 3GRRA 2HA5A 3IAHA 5CXUA 4E1VA 1J8MF 1YZAA 3RKOF 1O5IA 4INOA 4CCAA 2QN2A 4GYKA 1E2PA 1WMDA 2Q0HA 2J9BA 1UWVA 1KNYA 3L8MA 2RIPA 1TX4B 1R00A 4IQ0A 4LF4B 3QKTA 2C9MA 3PEFA 3FPCA 1E0DA 3EGXA 1H0SA 4HQOA 3A1EA 4CEIB 3CNBA 1CIVA 2FUG6 4MKGA 1RLJA 2FEPA 4J16A 1EI7A 4II3A 1L4HA 3HLYA 3N2IA 1BZ4A 3LFUA 4G1CA 4ARZB 3T5CA 3MNFA 1BXZA 3V5YA 5EIHA 3LFTA 1C80A 1SHTX 1XNQB 3AERB 4GXNA 5B3KA 3O90A 2XNCA 4LQCA 1G19A 2IHJA 4LHEA 5TEVA 2O1SA 1U5CA 4EJMA 3HVHA 1BJRE 3UCEA 2JFUA 1DIOB 4ZGBA 3UBTA 1C0LA 4G0UA 4OXKA 1H8ED 1H65A 2PX0A 1RRCA 1QHXA 3PJFA 4J30B 1LS1A 2FJPA 1OX6A 2W6JA 4JE9A 3AQIA 2PT6A 4CBEA 5BNWA 2LFFA 4RFVA 2FJUA 2O0KA 4DANA 5A02A 4IJKA 6CHYA 3V4OA 4NHEA 1QHHA 3OJ0A 1Z22A 3RDPA 1DOHA 4BL5A 3I61A 3PQ4A 2VJOA 2AC4A 4PV7A 1NKSA 3E9MA 3C48A 3T5DA 3UWKA 1GIAA 4YJ3A 4G5HA 4NBLA 1IUOA 1DUSA 2VSYA 3MWJA 2VWHA 4G41A 3HVJA 2ZUWA 4A8JC 4KHZA 4G1BA 5BUOA 5KYUA 4FMPA 1RR6A 3HCFA 4TTIA 3AZQA 5KWIA 2W6NA 2NU6B 1SIBE 1Y33E 3V97A 2WICA 4EHHA 3AIKA 5AOAA 2NYVA 5THXA 3DE8A 1WKVA 3ROPA 1QP4A 2V7WA 4DADA 1BO6A 4X97A 3G5LA 3COYA 1YS1X 5EZYF 1S2LA 4N0EA 1M3SA 3N8IA 1OWMA 3KCNA 5EEHA 3K8QA 1QHGA 2AFIE 3EBPA 5KBYA 4EHPA 4HYYA 2XODA 3TZBA 2WT4A 1E5TA 3AL0C 4UTVA 4S05A 4N4WA 1YMVA 1H66A 1HEIA 4OBWA 4EVRA 4F38A 2BKVA 2CZCA 4ILKA 4NYJR 1VL5A 2VCCA 4ZK2A 1M34B 1SPXA 1L6RA 2QVBA 1OLUB 3KALA 2YWJA 1T13A 3ICVA 3A9UA 1JPJA 3U4DA 4PO3X 1WXWA 1GG2A 2PJZA 4FGJA 2JIZA 1DUVG 5TC4A 1DMSA 2EILC 4ZEXA 2QZ4A 3LNRA 1XTKA 3CKMA 4D44A 2QIOA 1IVSA 1EFTA 3P2MA 1X1EA 3KWFA 1IPEA 2AN5A 3GNTA 3OY2A 4IIHA 5EXTA 4EJ0A 3L8FA 2RHMA 3MSCA 2BEUA 3L4SO 2ZWPA 1G8XA 4E5NA 1F4LA 1CZLA 1O95C 2SKEA 1KO1A 3H6GA 3OA1A 3I6ZA 2D4HA 5AHRA 2WZBA 3LX4A 4HAYA 3T6BA 2A0YA 2P0YA 2PGOA 3PJEA 4WOKA 1V1MB 3F9CA 3DHYA 4DIKA 1JLLA 3RKSA 4BWYA 3U31A 3LFHA 4E4YA 1U0GA 2WILA 1WBBA 3OT4A 1KEEA 2Y1DA 4ER3A 3MXTA 1TA9A 1U0JA 1LBIA 5JE8A 2FUKA 1UDWA 1PUXA 5K3EA 1XKTA 2CYAA 1X7GA 3G8YA 5AVXA 3SG0A 4F5WA 3M6WA 3WHPA 2W2XA 3HXOA 3UA3A 4CKWB 2OBYA 4GQAA 2Q21A 1KI4A 2ZJ7A 3FMVA 3MM4A 1NPYA 2UUIA 4UOZA 1DDGA 1XVTA 1G2OA 1COWA 3G7NA 4TKLA 5D51S 1XJ0A 2XTZA 4OMUA 3W5UA 3RVSA 2GF0A 2PNFA 3GK3A 3QVXA 1O97D 4EBBA 1DV2A 5JJ5A 1C7ZA 2DHEA 1L5GB 3UAWA 1BEZA 2QV0A 1GTSA 2CHGA 1R2QA 1GZDA 2G62A 1P9OA 3QUBA 3UUGA 1K7YA 3CNNA 5EIFA 4PVDA 1WX1A 1S0UA 3TE7A 1DIHA 3P52A 3H9BA 3IALA 4YJ3F 4CKCA 3OURA 4BQQA 2J9GA 5HK8A 3HYRA 4JB2A 2X0JA 4AWXA 2A1UA 2HK6A 4G5YA 1AXGA 4ZVSA 1I6WA 3FW1A 2GUGA 2COKA 4AW9A 1B4DA 2ZVJA 1PU2A 3PD7A 1TFUA 3EZIA 3EOAI 1U0OC 3IJPA 4G9BA 4JB8A 5JEDA 4DDMA 4JC8A 4BYMA 4MI3A 2PZBA 4AS3A 1IWOA 2DU8A 3EH1A 5JYDA 5JS6A 1ZIDA 3C6QA 3RS7A 3LQ1A 3OETA 3PUHA 1MJ5A 5G41A 3K33A 3H8SA 5F73A 3FNIA 1OD6A 4ED9A 2BL2A 4MUEA 5JROA 2WABA 4MLDA 2FSSA 2QJTA 1Z5WA 1EDDA 4UVEA 3WGIA 5C5IA 4XIYA 4J0EA 1FMLA 2ZKLA 5IM4A 3DAHA 4JSRA 3NYIA 4JOBA 4J6EA 4HNUA 4QNRA 5FPHA 3IKVA 3KB6A 2H8KA 4KTVE 1MOQA 3MJVA 3FTFA 2EPKX 4Y2YA 3URMA 2GCEA 4JROA 2V59A 2FB9A 2B82A 2QRVA 2YL0A 3CF2A 2P68A 4NE7A 5K99A 5BR1A 1Q0MA 4X60A 2FEAA 5AESA 3VXKA 4KB5A 4K9LA 2VATA 3N2YA 3W8FA 1EVLA 2HADA 1D9XA 3RYCA 3KBOA 5F4BA 1MB9A 2P0EA 3KQHA 4O3FA 1VOTA 2I6FA 3D59A 4UDXX 3KQYA 3KYCB 2F90A 4LRQA 3WLAA 1EFPB 4UNSA 4XA8A 3KQLA 3PG5A 3VA7A 1K2WA 1V3TA 3JR3A 4J43A 1V3UA 4HC4A 4XD7A 4LHWA 3PXUA 4MRMB 4WV3A 1PS8A 3JWJA 1GUDA 3RIPA 4X20A 3UB3A 2IYXA 1X7YB 3KYJB 2VJCA 1PWZA 4DVGA 2NV0A 1MRZA 3R9KA 1C3OA 4N5HX 4WADA 1AKYA 2YVUA 4RDIA 4I1OA 3KSDO 3I2IA 1OFUA 4OG2A 4R40A 4WJZA 3OWTA 3ZNOA 2G3KA 2FGKA 3HH8A 3FPHA 2O9XA 4U5CE 3KL2A 4W5HA 5HXAA 1FX0A 1U6KA 1NULA 2WUWE 1W8DA 1ECBA 1TAGA 1CZNA 2EARA 3BTUA 2XCSB 1LRJA 3EA4A 2SCUA 3BAZA 3DEFA 4GM4A 1PJQA 2BW0A 3HCBA 2CNKA 4B9AA 4WFKA 5ICEA 3DVAA 3ZH9B 3BEHA 1DAPA 4CF4A 5TGDA 1MNQA 4JC7A 3UB2A 4FZRA 5EIXA 3QWIA 1PS9A 3RUEA 3ED5A 2RGBA 2GDJA 2ON6A 4M6WA 5FO0A 3D8HA 2D5CA 4IJMA 4DDUA 6AT1A 4RHCA 1OZAA 3JTEA 4G26A 5EQFA 4B48A 3RSSA 1E6CA 4L7VA 3M6LA 2G17A 3B8EA 3EJ6A 4NXNB 3UGOA 2A9QA 5TT0A 4PC6A 1YACA 1MV8A 1DQYA 4JN6B 1JLKA 4EEXA 1WAMA 1J2UA 4N39A 4CGYA 3SE7A 3CY6A 4RKRA 4OUKX 1F48A 3IQHX 4H31A 2ZS8A 3N24A 2FX3A 2WKPA 5JAOA 1J6UA 3ZY3A 4LGCA 1OKKD 3ROEA 2EJWA 4YRGA 4RF5A 4MI9A 4AKTA 1F2UA 3IBFA 2JFBA 1HE4A 5AH0A 4E15A 2W71A 4MS2A 3SZMA 3O73A 5DBEX 4IDFA 1DKPA 4DARA 5DS5A 3EHDA 3VAYA 2W6MA 5LB4A 3KT0A 1C0EA 1PZXA 4MYSA 2P9GA 4J9VA 2F9FA 5JS5A 3TUJC 3AFNA 2UVPB 4X3PA 1GAEO 4Y9UA 2OJED 5HW0A 1ZRSA 4OMCA 3HUTA 2YOHA 2VJPA 4B3SB 1KJJA 1T6ZA 2P90A 4ZPXA 3CLRD 5FV4A 3WDKA 2RAPA 4LTDA 2AC7A 2YCBA 2VH5R 3OIUA 3RBXA 5JZBA 1CUBA 4LJAA 1DBIA 1U8FO 2FMXA 4RABA 2BFBA 3GC6A 2AHRA 3I9KA 1XQVA 4LPKA 1RC1A 2N42A 3A0UA 2AX4A 2VYVA 4US0R 2ZOSA 1A4RA 4ENRA 1WXXA 2RGYA 5KOYA 4ZCPA 1P1IA 1XK7A 1T8YA 3AINA 3EGIA 1KRHA 2XWJI 2JFXA 4WK4B 2VF4X 4R8KA 3HCCA 4FFNA 3PQ3A 4ZOQI 4QOEA 1W73A 4ER0A 4LK3A 4HG2A 3USES 2F1HA 4CG2A 1DTEA 2CFRA 2ZDQA 3I58A 4Q18A 4JXKA 4JUCA 1PG2A 4NONA 4JLVA 1S2GA 3A2MA 2FPIB 4ZYTA 3SWWA 3V7YA 5CAEB 1NI4A 2F1OA 3ADKA 3I76A 1QYDA 4F91B 4FN5A 3WLTA 3RIXA 4G7ZF 4MS4A 4MV7A 4JLNA 2MMGA 3RV4A 1PGQA 2RH5A 4R05A 4D6XA 2NUAA 1BVUA 1CQZA 1FP6A 4EPYA 2WUEA 2VHVA 2WDZA 1G20B 3TQCA 3TG8A 3CVYA 1WKBA 5AVZA 5I8ZA 4EGAA 3G9TA 5HZKA 4Q4DA 4HGZA 1NW4A 3GDGA 3R7FA 1PR1A 2QBYB 3AJEA 5EYPB 2XIQA 2G28A 2H4ZA 3ZGLA 4AX4A 121PA 4FXOA 1J5XA 4MQEA 5JHHB 3G5AA 1JR8A 4E3WA 2C77A 5CFOA 2R9RB 2R8BA 3KTOA 4B71A 4A0GA 3QMKA 3K70D 1O57A 1ESZA 4JLUA 3LGAA 2WQZA 4CDAA 4TTSA 3EYWA 3N8DA 4EPRA 4XYGA 4HXEB 4DLXA 3I8OA 5FORA 2VLIA 3WV5A 3SDZA 2WF8A 1M2NA 2NU9B 3UXMA 1VJ5A 3H6KA 3CV3A 5TJ5E 4UCFA 4BKQA 3ILSA 3WGMA 1OMOA 3UBMA 1B8NA 2ZFUA 2PZLA 1IDOA 2C9ZA 3NHSA 4M9CA 4W4TA 4BEBA 2OBBA 3JY6A 1M10A 2VZ9A 4JVSA 1N1DA 3AOEA 5L45A 4CV0A 4DA8A 4UVIA 4CM3A 4IHQA 3BXZA 3BTOA 3L7LA 1ZKDA 3DZGA 1A7UA 1EUYA 3CVJA 1E8MA 1DG1G 1P2FA 2GO1A 4URFA 3IVXA 4HUQA 3KXPA 2DUMA 4PLTA 3K9WA 4YJFB 1YFJA 4JUFA 4FFDA 4LI0A 3QOFA 3L2OB 1X3LA 1E59A 5SY4A 3GG2A 2D74A 3NHUA 4B32A 5DM70 4P84A 5FP0A 2RD9A 3BHNA 3H1AA 1I7QB 1N5KA 3A9SA 1WOLA 5CIVA 3FFAA 4MTGA 4C7BA 3LLIA 4JLMA 3VSAA 1L4MA 3LCMA 3KE8A 4XVRA 1U4OA 2X5XA 2A30A 3MMXA 4IUDS 3OT5A 1GL7A 3SP1A 2EW1A 1IULA 3HJTA 1LM3B 1QIMA 1XL1A 4WFIA 3I9LA 2QQFA 2JGEA 2DY0A 4F86A 1W87A 4XYMA 4DCMA 3ROMA 4XVHA 4EY5A 2GZAA 5L4SA 2HU8A 3OX4A 1XMJA 1IJBA 1OJ7A 2QU7A 4LSWA 3CG4A 3V4FA 1B3BA 2UYOA 1K8XB 4JBNA 4YV2A 4HRYA 4PZCA 3WK6A 1TC1A 4HB0A 2PZAA 4FR2A 3I83A 1VG8A 4G5GA 1XGKA 1CDDA 3TJ5A 4H7IA 2VJMB 4LXHA 5CNMA 4A2QA 4D0NA 4AJNA 1HT3A 2Y9PB 2BFDB 5HKLA 4OI1A 1YZUA 1YB5A 1QUFA 3JXEA 1NI5A 1JHQA 1PJSA 4V0KA 4MW1A 5IN4A 1QHSA 2O54A 1A41A 5F2KA 3IEMA 3V55A 4V0OA 2ZVQX 4ROTA 3G5MA 3PRJA 2CFCA 3WB2A 3P4UA 4G0XA 4NQZA 3GCXA 3AEUB 1U2RA 4N12A 1JEQB 4HHEA 5EGYA 4HV4A 4TT8A 1GPLA 3N6VA 3D8RA 4REOA 2XEXA 4UBNA 4TXMA 2ZYDA 2PMEA 3VPDA 4MIYA 4FLMA 2ZANA 3U37A 4D25A 4K1XA 2FRDC 2YINC 4MHSA 5EP3A 3DGEC 2ZAIA 4CMGA 4YRBA 2G0TA 2E37A 5C34B 4TX1A 2WG2A 1JQAA 4HQNA 1XCPA 1I94B 3D8UA 4GZ3A 4YRMA 4CMEA 2XI4A 4YHBA 2RH9B 5KS2A 1F0YA 3DTTA 3IELA 1RAGA 2SBTA 4Y18A 4B8ZA 3FDZB 1XZBA 3CNOA 2XVAA 4JIMA 3V7FA 1IXSB 1JB1A 1JDPA 1QOZA 1YASA 3AUXA 3C87A 3DDNA 5THQA 4JSYA 2BR3A 4QGHA 4QVGA 4W7IA 4OLBA 3H3JA 4F5EA 3FZYA 1ZK2A 4RPCA 2J9WA 4FR0A 3X1KA 4JZKA 4KO4S 3WJ2A 2ZTUA 2HRQA 3OPNA 4ZOCA 4DV2B 5DP2A 1YQXA 3TCNA 1ACJA 2CJWB 2C4MA 3O39A 1KMMA 3E82A 4CLXA 4P32A 1BRTA 3CVOA 1YC2A 5DP1A 4EG1A 1KJNA 4G78A 4CV3A 5K4HA 1FLNA 1YTLA 4X1IA 3ZDZB 1IRXA 1PJ8A 4LBWA 1K7EB 2RB5A 4UHBA 3CNEA 4ZMSA 2DY1A 4RU1A 2Q27A 3HK2A 1MPXA 2WB2A 3HGMA 3O31A 1X14A 2DWQA 1JOGA 3TW0A 3C45A 5IC5A 4R84A 3LECA 3SZRA 1PBNA 3CZCA 4HDKA 4NCKA 3C5EA 1V16A 1FFWA 3GJQA 3ABQB 3HKKA 2Q7DA 1G9XA 2HNBA 3DFMA 4DRHB 4IMPA 2I7VA 3IXLA 1MTOA 4A27A 1K6XA 4HSGA 3ORHA 2Q3CA 1BCRA 2JLQA 2W0SA 4HDRB 4AZ3A 3JYLA 2F9LA 1IBKB 4ZT7A 1OCEA 4G36A 3NXKA 4OUDA 1O97C 1OAKA 1QUEA 1M74A 2J09A 1SOMA 5BRJA 1XALA 4ZYZA 1IIBA 1Q1ZA 4FMDB 3N75A 4FE7A 3CUWA 4P3PA 3E8MA 5LD2B 4AMUA 4MOWA 4DXDA 4Z4QA 1MO5A 4EW6A 4PSKA 5FA5A 1QCDA 3HU3A 1HH4A 2AMJA 4CLRB 2EP5A 5HR5A 2NO4A 3ICEA 3GFGA 5G0VA 3JU3A 4Y8VA 1RMTA 4GDFA 1ITZA 1M2HA 1V6CA 4D43A 4ND2A 4FXPA 4FESA 1NN5A 4GOJA 5BWCA 2Z08A 1A8HA 4AYWA 4W5TA 1CUFA 1NSYA 4LBZA 4DEYA 3AYZB 1I01A 4CR6A 2JASA 3MN1A 2UUCB 1TQ4A 5GPGB 2Z1DA 1U8XX 2WJVA 3CVUA 3GEEA 2KW3C 3W3AD 5FA6A 3VFDA 2HA0A 4U7WA 4IXTA 2YHAA 2ZXFA 2OPHA 3IJRA 4H7DA 2R86A 2DWUA 2ES4A 1F2VA 5JAMA 3SXJA 1N2GA 1P7VA 3OO0A 3SHTA 5A6BD 1FYVA 5JAQA 3NH9A 2F7SA 3TD6A 5AVKA 3GLRA 2Z2JA 3TMKA 2G71A 1MP0A 1VJ0A 4BZWA 1QZ3A 3EXIA 1LLCA 4KAXA 3D54D 2OKGA 5ALLA 1TLFA 1G20E 3ESRA 2GCGA 1TKBA 1QPGA 2PA3A 3PEYA 1OCZC 4HADA 1AVTA 1YZGA 1RS0A 1LJLA 1T6NA 1VL0A 2C4HA 1FA9A 1LK0A 2H9IA 1XEAA 4OJQA 4WK2B 5B1IA 2O5CA 1TWGA 4WQMA 4LDJA 3UGPA 2Y66A 2VKTA 5F1OA 1GQSA 4CG1A 4EG7A 4LDPA 4KOEC 1AGPA 4L8WB 1G3IA 1RWNA 5JALA 4G0HA 4KWIA 4M0MA 3FPBA 3KPWA 2PL9A 4ZP1A 4HRXA 2WIBA 2OHOA 1HK7A 3B6JA 2QVXX 3V1MA 3HHEA 2XRFA 3IQZA 1F7VA 4ESVA 3I5UA 2DXIA 5C51B 3PHCA 3N8NA 4BV3A 1XN4A 1PR4A 2EIHA 2QJRA 4J0IA 5CVVA 3R3HA 1XDGA 3BRWA 3GNLA 2OFFA 4CN8A 1U1EA 2IQ5A 4MGYR 2B1JA 5DBGA 3UV6A 4XQEA 1OBCA 1SULA 3U7RA 2BOVA 3A2NA 3R5TA 4C43A 2IA5A 4GPBA 4R9RA 3RVKA 5GOTA 2DT5A 4IICA 1ZM7A 4XVCA 4N9QA 1DOWA 2G4CA 3E9ZA 3I30X 4MTOA 2R02A 4U7PB 2GFQA 1H42A 2VNJA 1THGA 3QY9A 5ILQA 2ECOA 2V1XA 3IP9A 4BGVA 4W9NA 5K0JA 2AFHB 5CBKA 3FCCA 4MV3A 2GHRA 1CQWA 2JLVA 2R48A 5J2UA 4JJ7A 2QAJA 5JZ9A 4HZUA 3L0PA 4D9GA 3HSSA 4R54A 3F98A 1ZIXA 1U3WA 2QZZA 1FFXA 4QXQA 1I1OA 4FDUA 1E89A 4I2VA 2R11A 4Y30A 3MRXA 3IAXA 3H2BA 3W9UA 4DXAA 3IAAA 4IFBA 1VIYA 3AF1A 5ETJA 1XO1A 5F2OA 4JBXA 3NRJA 5J2TA 3B13B 3PEUA 2O3TA 4BMCA 2R4QA 5KMGB 1F9AA 1E66A 2W4IA 2XMQA 2Z4SA 2B4QA 1PTKA 3SX4A 1YFKA 2JLWA 4JTDB 2BCEA 2IGTA 4HYEA 1B68A 5JNSA 4GX2A 5I48A 4R3WA 1NVXQ 2H59A 1ZN9A 4DABA 1U11A 2XVXA 3UW1A 2AXNA 3R3ZA 4J4BA 4CPDA 4N76A 1YRHA 4YL1A 3SX0A 3LQ4A 1Y4CA 4JJ6A 1ZJ4A 2I65A 5EWLB 1MB2A 3ZHQA 4MLCA 5ESXA 4Z9BA 3K1YA 4FN4A 5GJWC 1CVLA 1N2EA 2H1LA 1S8NA 3FCEA 2XV1A 4NS4A 4PLCA 3Q8KA 3KJGA 2LP4A 4IH4A 4KIFA 3TM4A 1EDZA 1SB9A 1I5NA 1FDRA 5TQJA 2ZJOA 421PA 3RVOA 1VI5A 1SB8A 4N9WA 4QEDA 1SA0B 4KIGA 3OEWA 3A1CA 3OPYB 2XGGA 2GA0A 4DCGA 4X24A 5CPFA 5AHWA 1YK1A 1NR7A 4KR0A 1O87A 4ZTZB 1UFOA 1XZHA 2GKSA 4ETIA 4ZRMA 4DM4A 1E3IA 4B80A 4R0NA 2RIRA 2FWBA 3G2IA 3RWBA 1N2HA 2P5UA 3W1EA 3PC2A 1QYRA 3QTLA 5BQPA 1Z2DA 1HLDA 1TZBA 3DZJA 2W9YA 4WBXC 1ST3A 4QPPA 4ZRDA 1TWHA 4IIVA 2FUG1 2IS2A 3PZBA 2UYGA 2R5NA 4N3AA 1R8YA 4MR7B 3M6FA 3DPSA 1UMCB 2NWQA 4KTTE 4P3XA 3R0IA 3E1KA 3PNSA 4RVDA 4BGDA 4OV6B 4OX9B 4FYPA 4WCFB 3W6OA 1ZHOA 3DLBA 3HTXA 1Z18A 4QO7A 4CRWB 5C8XA 1AZSC 4CL8A 1PFKA 2AK2A 2F62A 5LXTB 4BB0A 3GVPA 2PJRA 2ALJA 2BMDA 4PYQA 2CEAA 3CN7A 2OHVA 1UJMA 5KQSA 2VTBB 2GS9A 2FFHA 2AI1A 1PEKE 5CFQA 4UMVA 1OH8A 2SICE 4OHWA 3UWOA 3SBEA 3VYWA 3QKSA 4L8VA 2J5KA 1EM8A 5J2UF 2PPVA 3QUAA 4AKEA 1O6CA 4FYMA 2PWYA 2IYWA 2P5SA 4QT4A 2R6ZA 1ZQ9A 2UZ4A 2CLMB 4CU2A 3V5XA 4K81B 2GJ8A 5AI9A 2O0HA 3BMCA 3DHNA 4Q4LA 3C8GD 4XD2A 4AROA 5CEEA 3TSZA 1VZ2A 2VDKB 5J2TF 1GGKA 3B3AA 3GNSA 1ZA2A 1EWTA 3H7AA 2J85A 3DTVD 3WMGA 1J90A 3BGDA 2WIAA 3EF1A 3THWA 3D7KA 5ITSA 1H0KA 1Y9DA 3B2QA 3H04A 1E60A 4WPGA 5CH3A 1ZI8A 3K70C 4P82A 2WKSA 3ZBUA 1UEXC 4PVCA 1N6HA 1TM4E 3MUFA 5H59A 1GA4A 5JSKA 4I55A 3GW8A 4MQBA 1KH2A 3LUFA 2RHGB 4DILA 3F2VA 4HNSA 4PHCA 3CUUA 4POAA 4ZOBA 5KDLA 3CXRA 4JXJA 1RAFA 3W9SA 4I7EA 4UUOA 1OXTA 2ZWOA 2BEVB 2EF1A 4K6MA 5CDGA 2EBHX 4CEJB 4OHYA 2DPXA 5DGXA 3JYQA 3NTOA 3T1NA 2ATVA 2EJTA 2Q1UA 2WFMA 3K2EA 5GJCA 3DDZX 1GGEA 4UHHA 1LX7A 4NBNA 1H9TA 2VTVA 4PX5A 2IVFA 1ESCA 3GBPA 2V7XA 1GRCA 3RTDA 3G23A 4LI3X 5BQHA 3ZWIA 3IQFA 3R3JA 5BW8A 1B23P 4OIOF 1E4VA 4JDPA 5F7ZA 1K27A 1IZ9A 1YBFA 3WL8A 5CG1A 2V0GA 1UAGA 1SGWA 2O5VA 1QQAA 3EVFA 3EPHA 3MPUA 4R1MA 1QIEA 1I24A 1L5WA 5FTLA 5CLJA 3VHQA 5JUWA 2O23A 1GSHA 3GUYA 3G8DA 3K0FB 3KDPA 1GKYA 5TMBA 3E9CA 1YUNA 4BV8A 1EG7A 3W9BA 4X8LA 1CUXA 2DQYA 4G09A 4LF9B 1U9IA 3LNTA 1M9NA 3L8YA 2QUHA 3JVUA 1SH7A 4WUVA 1IOWA 2W6CX 3CUKA 4FEYA 1C17M 4Q4AB 1L7BA 4AJ9A 2RARA 2H7OA 4HH0A 3IP7A 3DMDA 4GM1A 2HDNB 2O8DB 2AF3C 3RAFC 3UPDA 5HSWA 1XZDA 2XLCA 4KPYA 4ANFA 3GLGA 2GI4A 3P2JA 3GANA 1D1CA 1QIGA 4OGGA 3RS9A 2XRHA 5IJ0B 2RC5A 5K3OA 1SQ6A 2XE7A 3KEQA 2IPAB 2D59A 4Z9IA 2EGHA 3FMOB 4XAQA 3W5DA 1WDTA 2KB0A 4BGEA 2AZMA 2GQ0A 2AN9A 3M34A 5DM2A 3TOSA 4BO2A 5KZMB 1SIOA 2IP2A 4O4JA 3W04A 2OZLB 1Z8HA 5KREA 3VR0A 4NK4A 4K40A 3CE6A 1FIUA 1XMSA 1VBMA 3TLEA 1ZK3A 1UPXA 3H11A 3ILHA 5G02A 3GB9A 1PV4A 3EQ9A 1EBFA 4PCVA 5A4KA 3A27A 3PENA 1ECPA 2EP7A 1HDRA 1TCCA 5KNDA 1HSZA 3HCWA 1OCCC 2IPLA 5U1PA 2FVYA 5THKA 1YJQA 3TX6A 3ACDA 3A4IA 4I55F 2RKBA 5B3JC 2AFHE 1U3FA 3C1UA 2Y0EA 1J5EB 2YOFA 2FAXA 3G4XA 2B3DA 5FPSA 5KWSA 2GN4A 1TM2A 1KC1A 4AMBA 2YV5A 3DL4A 4O2RA 1XL0A 3JD0A 4O6NA 1WB5A 4JNKA 1U8UA 2XNHA 3KLBA 1CE8A 3OLWA 4BS9A 3SXZA 4G1FA 4BAGA 2AOUB 5L51A 5JBIA 2D1FA 3A6ZA 4JA0A 4QAJA 4MUXA 1ULHA 1K7CA 5E9AA 1P8AA 2PH3A 5B58T 1QAQA 5BQOA 3C0KA 3JSXA 4QHYA 1B00A 4JFAA 4YAGA 3BZBA 5KKCA 4NZNA 5IT0A 3MGCA 4U2EA 4UHDA 2ZRNA 2VCBA 4EW1A 4HXYA 1VGVA 4XXHA 3D1LA 4LJ6A 4YONB 2Y1OA 3VRHA 2O2JA 3G6KA 1DCFA 4K9MA 3P2KA 4FGZA 4HNRA 3NBYC 2OJQA 2Z9BA 3PDCA 5LBUA 1RMQA 4LEIA 4EI7A 4RA9A 3F7MA 2EJBA 1CDZA 4XPIB 2Z5GA 5KOJB 4MO2A 3ECSA 1YIAA 5DB4A 3FOZA 3U62A 4Y9RA 5JZOA 3O26A 1YR6A 1RLTA 2P4QA 1CIPA 1G7CA 3SXKA 4XLZA 2QPLA 5FNZA 1P3Y1 3ZE2B 4AYTA 1EFHA 2ZUBA 3LNMB 3PRYA 3QU9A 4R9UC 2OOKA 3BH0A 1U5BA 3NKEA 4D4LA 2ZWMA 2QX4A 4TS1A 3TWOA 1OBHA 5TQ0B 5DGCA 1QJCA 5JUAA 3ROXA 2VCEA 4UBMA 2CE2X 3DCYA 4U2DA 4ALMA 1EZ4A 4XYEA 2AOTB 4P35A 2NW6A 1X2EA 4L16A 1NAHA 3K7EA 5YASA 1YCHA 4DBVO 4O4JF 2ICWG 3UHAA 1UBOS 2IU6A 4ANJA 1TYCA 1ML4A 5DN6D 3L0SA 1EVZA 4HYTA 2PD6A 1FDOA 4HGYA 2KNHA 4A03A 2IXEA 1U1CA 3ZG6A 4HQFA 3E81A 1T8WA 2V6GA 3OIVA 3HKBA 4I50A 5AI5A 1B43A 4JVLA 5JT4A 2JK1A 4O1IA 2P1RA 3G0BA 4H3SA 1L3PA 3G49A 1BYIA 1G7SA 4LGMA 1EDEA 2FU5C 1O7JA 2J6BA 3Q2KA 1CDEA 1BDHA 3KB2A 4C29A 5E2IA 2VUUA 4DUGD 4Q4CA 1P60A 2G25A 1ZVKA 4RZHA 3DEAA 5FYDA 2PM8A 4RXMA 2W4MA 1P80A 1RLMA 4OD4A 3GH3A 1HXHA 3ANXA 4M8SA 1FRZA 2EHJA 3AB8A 3TMAA 4C2AA 2MCFA 4E7PA 4WUTA 4CMIA 4MUJA 3WSVA 3Q3EA 3AG5A 4LY9A 1FNDA 5E6SA 1P4JA 3H1EA 1QIKA 2X8JA 1G8AA 4KFTA 2R7MA 5JQGB 1JRLA 3HUFA 4GKVA 1R4ZA 5FNVA 3WYAA 2TMGA 4B76A 4PWYA 2ZB2A 3ZXYA 1OW8A 3HZHA 4AP5A 3JQRA 5KUTA 1IBLB 3JZAA 2QUPA 4FOSA 4XPWA 4BTLA 5TB5A 2IXGA 1JDZA 1JHVA 3RPEA 2AFIA 2OZEA 4CS7A 5TSDA 3W2VA 2PUWA 2XCUA 3E1GA 4INPA 4R7TA 3B78A 1DC5A 4GWGA 2DQ4A 3C6KA 3Q7PA 5E2AA 4JY7A 3I0NA 4AL1A 1NNSA 4OX9Y 4P4TA 2Q1WA 4R0MA 1CF4A 4EHNA 3O03A 1RFGE 3VPFA 4ECEA 1N75A 2XLWA 2FE4A 1QO9A 3T5TA 2PPLA 4MULA 4LHYA 4P36A 5AKJA 1R0CA 4Y0VA 5B7GA 2QROA 2PGXA 4TMVA 1E6MA 2H9AA 1J0AA 1XD8A 2B6HA 1JEDA 3RNOA 1EP3B 1F8UA 4BPRA 2YFKA 5TPZA 1H2WA 4LFCB 1T91A 1E6UA 4B44A 4D9CA 2IE8A 1QSPA 3GDHA 4Y98A 2JGLA 1W49A 4NYMQ 3KOXA 1XOIA 4W8OA 5E33A 2MINA 5B5SA 7REQB 1QS0B 4ADSG 1JDVA 3DXJF 1JFRA 1A8UA 3V4VB 4LY0A 4IVRA 2N75A 4CM7A 2O19A 2F8SA 3QPBA 4MH0R 1UFBA 2PX8A 4AMYA 4RL4A 3LZDA 3G8BA 2JGFA 2AQIA 1SHLA 2V45A 3BQ9A 4QPJC 2GO7A 1Z33A 4C0JA 4U6SA 3DEZA 3TYXA 1L7VC 3JAKB 3HYTA 2R6HA 3PHHA 2CK3A 1W8IA 1FP7A 2NYRA 1JILA 1R0XA 2LTAA 3LQQA 1I4TD 3B1ZA 1EAYA 2CXRA 3U4CA 3A28A 3BGSA 2JCSA 4YXWA 1DTSA 4I50F 2G1PA 1Q6ZA 1J97A 1L5KA 1F06A 4IQFA 4QX6A 2DETA 2YWBA 2COEA 3SC3A 4TN1A 3RNLA 1EUDB 3T1HB 4N5MA 5AO9A 4J4TA 2I80A 2X0KA 3WIVA 2NZ2A 4L4RA 2FUNB 4C30A 5SYNA 1VKOA 4AZWA 3M4JA 5K8IA 1FDTA 3KLNA 1BU5A 5I7WA 3VZCA 1DTWB 4XR9A 5T8KC 3KKMA 1KEZA 4XJXA 3FSGD 3TZ6A 4ARVA 4HWPA 5DZSA 2RSLA 2A4MA 3IQEA 4W1SA 3BSSA 2Z0MA 1OIWA 4ENSA 3X3HA 1LTHR 1DAOA 4IJ5A 5FNVF 1IHDA 1LKXA 1EVYA 3JATB 3WA6A 3OMXA 1LVUA 3ELDA 4BQSA 5KC8A 5LQSA 3MLAA 3UJNA 4Z51A 3NYQA 1O89A 5AW4A 3RV3A 3R76A 4JLJA 2G9QA 3P2IA 4MS1B 1IYZA 2X7JA 5HIMA 3OWOA 5A0VA 2O2XA 3AETB 5A9SA 3LQKA 5IMSA 3EFOA 3LOPA 2D0PB 1E2JA 4L27A 4Z53A 5LZ2A 3NBAA 1GYRA 1JHYA 4BQRA 2Z1MA 1UOEA 3BOSA 4K3UA 4DSUA 1G42A 4OI4A 1JAIA 1LVHA 3DFZA 5I45A 2WA1A 1N3YA 1QMGA 4DPKA 3CIOA 5JATA 2YNMA 5FA8A 2P9QA 1GUZA 4L0DA 3KPUA 3D3JA 4ZHQA 2EEZA 1R27A 1L1EA 1L5FA 2R7QA 2P6NA 1ZK1A 4NDZA 3EXFA 2FRXA 2LKDA 4D4IA 3ROZA 2O8VA 2RGNA 2R7OA 2E89A 4O2BB 2X0EA 1QG4A 3WVNA 4UQOA 3W5AA 2GDCA 2X77A 4X64B 1HUQA 1CJMA 3E9YA 1AQ6A 3P2YA 3ZDRA 5TPWB 5AKGA 1NZJA 4RMNA 1X7ZA 2NU8B 3ME5A 4G9EA 1WIWA 1XB2A 3JVVA 3HWX1 5AGFA 1NOJA 3K9BA 1FFCA 5BV1A 4BMNA 3RVMA 4EX6A 1GAXA 4JOCA 4TYNA 4Y9SA 4ZXPA 3K5WA 4DNQA 4KI7A 3UHFA 2G5CA 5CLGA 3I5PA 1ONNA 4QYMA 1M1YB 4Q24A 4ZV7A 3CYFA 3ZTTA 4PSCA 1VA5A 3DUFB 4NSNA 3B2EA 4P22A 3QLJA 1RYZA 3B1VA 1O0BA 1XMVA 5FUWA 3R74A 1ZXXA 3RSQA 1TIKA 2V9CA 3UEOA 1SUIA 1T0HB 5B4VA 3OOJA 4OXQA 4M46A 2OQVA 1EWVA 1PK7A 1R0BA 3DPIA 4QBFA 4AZ0B 3V46A 1HFJA 4NOKA 5KVVA 3ASNC 2O1XA 4BIIA 2HHLA 1D7OA 1E20A 4K8RB 5LCXA 5DYTA 4CMBA 1J7KA 1W0JA 1J0DA 4K26A 4CEIA 3TPZA 4LECA 2Q7OE 1Z34A 4Q7CA 4Y6OA 1NXSA 5ALHA 3ESAA 3I23A 5AJHA 4ZV9A 3SGLA 3PPWA 5EMHA 3DQQA 4CMHA 3OFND 2BFEB 4B4OA 4DDKA 4UZFA 3ENKA 1EGHA 4MVJA 5NLLA 3CC8A 3AERA 4BNFA 3EHNA 3A1WA 5I4IA 5AJXA 3RGWS 3E7XA 1Q7GA 2G4VA 2ZVDA 2YUTA 1RQ2A 1QYVA 3U2MA 2WJZB 1G3QA 3KJNA 4QRIA 1UANA 5DLYA 2KQUA 5EKTA 3HP1A 4WGFA 4PHTA 4GAEA 3T0FA 1TK2A 3AV0B 5HZMA 3ZI7A 2O05A 4PJJA 1BXGA 1JT9A 3DFKA 2VBGA 2WWGA 3A6FA 3IMKA 3WKAA 1ENPA 1US8B 1EEHA 4YGXB 5TXGA 1DWQA 2ZSKA 4MWTA 2CVPA 5K3CA 1T9HA 4QPZA 4MVJE 2MTBA 1HDCA 3GY0A 2QL9A 5IULC 3OTWA 3D2AA 3QWHA 4QULA 1Q0GA 1SKAA 3BGOS 2AZ4A 4WEOA 4JS0A 4FBLA 5EI5A 3RYLA 4Q39A 2H2WA 2I4NA 3RHFA 1JHXA 1TM5E 2DH6A 2YJTD 4JEIA 1Y1LA 3ZEAA 3DZFA 5EE1A 2REOA 2AN1A 4NZOA 2MSLA 4M99A 4DQ0A 5HPYB 4EBKA 1C1HA 2AG0A 5KNCA 1U90A 3TG2A 4MGEA 4INZA 4Y6RA 3TI7A 4DLKA 4ZHQF 3J81A 3B3QA 1NXWA 4TT3D 1ZN8A 3UIEA 3G88A 2VNKA 2ZIXB 4IY1A 3KYDB 5ECWA 1JVNA 2P11A 1OC2A 5B4UA 3PPXA 2D1RA 5IAAA 1U3CA 3N2NA 2Q5QA 2GPWA 3SS7X 4KE7A 3UUEA 3F7OA 3UWDA 1A2BA 3EWIA 5I7UA 3S55A 2ZSJA 3PUIA 2GNOA 3JD3A 4O8ZA 5JAIA 3QMWA 10MHA 5JJCA 1Z6QA 4PRLA 5CLLA 2A5JA 4DJTA 1JB9A 4Q7JB 4MKXA 4LJ8A 1H2AS 5E3IA 3UHPA 1YZTA 3IILA 2KMLA 2BISA 2HSGA 3BS4A 4N8DA 2PBEA 1O6BA 3R3SA 1XVLA 3RODA 2O1EA 4JI3B 2FK8A 5JDIA 1ISGA 2I76A 1EHCA 4F1JA 4KLZA 1EK0A 3B3GA 1RRVA 2KI5A 2WTNA 3SCZA 3VVCA 5ESWA 3KEMA 2JI9A 3DYIA 3OF2A 1XV5A 3Q9SA 2QTNA 5SZIA 2IBSA 2HOQA 1UK8A 4BMDA 3DZDA 3AG4C 2Q6IA 3IUSA 3OQNA 3IPMO 4FS8A 1UT5A 1DDIA 2V8OA 5F1YA 1LLQA 1VHWA 1PL0A 3PC4A 2C3UA 2ZT8A 4YA6A 1M34E 1V1MA 2ODEA 1ZO8A 3QVGA 2ROQA 2XMRA 3GFQA 2L69A 2P75A 1CNEA 1OZGA 1VL8A 2ZRIA 3EUEA 4PPNA 2ORWA 4WERA 2IY8A 4MVJF 1LK7A 2BFOA 4NS1A 4LE0A