The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
86
|
sequence length |
307
|
structure length |
279
|
Chain Sequence |
b'MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYLAA'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Translation initiation factor eIF-2B subunit alpha
|
molecule tags |
Translation
|
source organism |
Homo sapiens
|
publication title |
Crystal structure of the alpha subunit of human translation initiation factor 2B
pubmed doi rcsb |
total genus |
86
|
structure length |
279
|
sequence length |
307
|
chains with identical sequence |
B, C, D, E, F, G, H
|
ec nomenclature | |
pdb deposition date | 2008-09-01 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01008 | IF-2B | Initiation factor 2 subunit family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Four Helix Bundle (Hemerythrin (Met), subunit A) | Four Helix Bundle (Hemerythrin (Met), subunit A) | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Translation initiation factor eif-2b; domain 2 |