3ECSA

Crystal structure of human eif2b alpha
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
307
structure length
279
Chain Sequence
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the alpha subunit of human translation initiation factor 2B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Translation initiation factor eIF-2B subunit alpha
total genus 86
structure length 279
sequence length 307
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1070 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ecsA01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 3ecsA02
3A9CA 1W2WB 2YVKA 3A11A 4LDQA 3VM6A 4ZEMA 4LDRA 2A0UA 1T5OA 1VB5A 2YRFA 1T9KA 3ECSA 4ZEOA 5DBOA
chains in the Genus database with same CATH superfamily
2QMUA 5EUMA 4EW1A 5B4UA 3P2JA 4IR7A 2QV7A 3IUJA 4LJ7A 4MYDA 4BO4A 3VBEA 2D8AA 3OUTA 4X54A 2OGUA 4J2TA 2GYUA 3NPAA 1PBNA 2P4EA 5DSTA 3F2IA 2EPOA 3ZWQA 4EW6A 3EGXB 2FSGA 1NQ5A 3ROPA 5F23A 2KI5A 2D3TA 1NJ1A 3SR0A 3BDIA 2QM0A 2YXLA 2R00C 3GRYA 1U6HA 2J33A 3ABZA 4OQXA 1V5EA 3V1TC 2GXSA 3VTAA 3AB3A 3DDUA 4EATA 1OAOA 3ODGA 1MIHA 3GLHA 2PS9A 4YA6A 3T6KA 1X7WA 3UJNA 1MDBA 3MBGA 4IZ6A 1CU1A 1M34B 2FPUA 2QN1A 2VHJA 3K1ZA 1NZFA 2HA7A 5DN9A 5K3BA 4BFXA 1D4FA 2VWGA 1C4XA 2CDAA 3VJRA 1DBIA 1XN1A 3QMMA 4EECA 5AVVA 2YVQA 2OILA 2V0CA 1UMDA 1K8XB 1T8PA 1V5IA 4MV8A 3ITFA 2VUUA 4RDXA 1UOPA 5TC4A 3O4IA 4KQ2A 1A3CA 3OWHA 3UK6A 1I4TD 2BFCB 1P17A 4HXGA 4Y1EA 3HZZA 3P9IA 4YL1A 1E60A 4QQRA 4IICA 2XGGA 3AK4A 3OOYA 3UUFA 3KIPA 1USIA 5F7JA 2CUZA 3AU9A 4G9EA 2B4AA 1V54C 1HQKA 4KVZA 3KZCA 1HTBA 1EWQA 1ZHZA 5C7LO 3NVDA 1TM3E 3R7FA 5JYBA 4GMXA 5M7EA 3IQCA 5C5DA 2NMVA 2VZEA 5MN5A 2H00A 2O8BB 5F64A 3INGA 3IDOA 3P27A 4EJ6A 1A7AA 1KEVA 1ULBA 1P4GA 9ATCA 3O82A 2OXIA 3GLIB 4AWBA 2ZGVA 1XZCA 2Z1MA 4WOBA 3SR4A 3W1EA 4DMHA 1DKLA 5A2QA 1Z6GA 2B4YA 1TVMA 3C85A 4IFIA 4KR0A 5KYKA 1TA9A 1ZZPA 2PPVA 3DYIA 2I3AA 3EXEA 3HKDB 5D3ZA 3WLLA 1QFSA 3IAS6 1CS0A 4G2TA 1UM9A 3P45A 1OU4A 3NZEA 1WBDA 1W75A 2ID7A 3NTUA 1VKJA 4NU6A 1KVTA 4K9OA 3HB7A 4LMRA 2IEYA 3PNYA 4POOA 1N5IA 2ZIUB 4PFJA 3THYB 1YHNA 2G1PA 4CKWA 5LZ9A 4LQLA 1RKVA 4ROSA 3AI1A 1MQ9A 1OLOA 4KRXA 1I6WA 2P8JA 4MS4A 3HYTA 5CLGA 3UJAA 1VPEA 2PLRA 4D0RA 2NXJA 3Q3EA 4EY6A 5JEEA 5KOJA 4CU2A 3K35A 3CXUA 4L4YA 3QW0A 3WHPA 1TCVA 4DIKA 4JT8A 3AGPA 1IY1A 1IZ7A 4WY2A 3O84A 3DQZA 2XXAA 1JUDA 3PDUA 3WWDA 3U7HB 1DKRA 1NVAA 2DLDA 2LIVA 1FP7A 3EZXA 4PC6A 4B32A 4LHXA 2QVLA 4CLOB 2QPAA 4DCGA 3HXOA 5KNBH 3EIHA 3WB0A 4OHRA 4RPJA 3THOA 4FN4A 4CIXA 4P0TA 4Q6BA 2GLUA 4MUFA 3UA3A 1E4EA 3VR5H 3EX7C 2JH9A 2HX1A 2B7CA 2RARA 1PHPA 1ISIA 1SUDA 2X2FA 3ABRB 1XWIA 4J0KA 1TRKA 3SOZA 4B85A 4YUWA 5A7FA 1KP3A 3CV3A 2F8LA 2BDEA 4TUYA 1WWPA 1XKLA 3QA9A 2HAEA 3K0BA 3KHKA 1UBHS 1L4GA 3TRDA 4U2KA 3JARB 1EFRD 3SFZA 3HTKC 2O3UA 2PF4E 3NTLA 3K0CC 5F28E 2VHCA 3N53A 4CIYA 1KOJA 1T1RA 3GRZA 5FJIA 1FDOA 5JUWA 4ZAYA 4WCFB 3WLRA 4GKKB 1G60A 3BZUA 4OXXA 3W5JA 3SD7A 3VNUA 4LWZA 5CW2A 5AR1A 3JASA 4H6VA 1ZH0A 1PAUA 4LYDA 1F2TA 1I1OA 1YD7A 2NNLD 4PR0A 2R9RB 2HMQA 1CF9A 1XLUA 1XZEA 3EGWA 3LG2A 4Z1MD 5IJZA 2EG5A 1R88A 721PA 1DCTA 1KI2A 4YL3A 2AVNA 2IA5A 3W6ZA 3ZWXA 4PHGA 4R9RA 1JOGA 2IZZA 2DHEA 4MCAA 4OXYA 4ENSA 5HS4A 2P75A 2VSQA 3V3TA 5K6AA 3GJTA 1JFRA 3OM9A 1YL5A 5TPZD 5C7YA 1ZR4A 1E66A 1MAAA 1L8OA 1AKTA 3C3BA 1EE2A 2O7RA 3NDIA 1C9KA 1RBYA 1Z17A 3QBVA 4G85A 4P4SA 2FSUA 2V7QD 4BB6A 4IHAA 3DAGA 1J5XA 2MINA 2XHZA 4FQ8A 2GETA 4X9XA 4FWTA 3V7NA 4P3PA 2YHSA 1I5EA 1YONA 2FWMX 3NC0C 1UZNA 4EY7A 4JWTA 3E7XA 3NS7A 3K1TA 3ZDQA 1QRUA 4G0QA 4C0JA 4QPJC 1SUIA 3N39C 3DDOA 3GLQA 2DFNA 4K6KA 1P7WA 1EM6A 4LDPA 3MD0A 4RVNA 4RSGA 4I6GA 3OC0A 2ZRBA 3DL4A 1IN1A 5JIBA 2Q3EA 1KKMA 1V96A 3H7IA 1N6RA 4NBSA 4DL9A 1X1RA 2BEWA 4OLHA 4EG5A 2VAVA 2Q5JA 3L92A 2XNDA 4WUVA 1Y4SA 2IXNA 1Y5MA 3H6HA 3M9XA 5IKMA 5ALIA 4I5IA 1I1QB 2I0FA 4FXPA 1VI2A 1Z74A 4GUAA 3H5TA 3PICA 3CM0A 2O48X 3KR2A 1XQVA 2C5HA 3OZWA 4GX0A 4KIGA 4ND5A 1EFLA 2QDKA 1N2JA 3OFNA 1ZESA 1U7ZA 2A0YA 1V16B 4PXSA 4WSOA 4F4FA 5DEIA 3TFWA 5IC6A 1PW7A 4LNUB 4PC2A 1WP9A 5JS2A 1G7CA 1TOAA 3HVUA 2QT0A 3VKVA 4WLFA 5K8CA 3FXAA 4O2RA 2XI4A 2Q27A 4FDUA 3RASA 1KJ8A 3SEZA 1DKOA 1XCBA 3IIJA 4HDKA 4A1OA 4BQIA 2RGEA 4XSVA 1HT2E 3IO5A 4F7WA 3B1ZA 1GUFA 1CZKA 3GFQA 3I2YX 1Z0DA 3DS8A 2H2HA 2M6RA 3RIYA 5HFNA 2CNLA 2VTVA 1AGYA 2Q3LA 1ONNA 2WHPA 2PBEA 2P3QA 4B3MB 1CZUA 1KEPA 1J8FA 3UWMA 2YYZA 1NT4A 2HIGA 2L81A 2G5GX 1D1BA 4L9RA 4OH1A 3ILYA 4N4AA 4RD1A 4DJ5X 1NFOA 5G1NA 1AHHA 2ADOA 3O4FA 4XIYA 1Y4DE 1IJKA 1QBGA 1YVRA 2AUMA 1KDVA 2WW8A 3R3UA 2IF0A 3UJ7A 3W5BA 1P9OA 2ZBFA 4V0OA 5LN1A 3ZPXA 4BAUA 1MIOB 3WMEA 4LXYA 5C8VA 2GN6A 3CR7A 2JX0A 4CKZA 2FDCA 3H05A 4AJPA 3QTTA 3IUYA 3O8LA 5EESA 2W83A 4AT1A 4LE0A 2I4IA 4QUKA 2FCRA 1Z7GA 3ZBQA 3AQ4A 4YV2A 4QQ8A 1GGEA 3LZ6A 3NMIA 4IQ0A 4CIHA 4L6AA 4XQGA 4YDSA 5TS3A 3HRHA 2FZCA 4DPKA 1ENOA 5JTUA 3ZXXA 2JJ1A 1X1QA 2XTJA 3EWNA 2I15A 3MBKA 3RTCA 4EKEA 5GIOE 2J59A 3ETEA 1UFVA 2C5EA 5B6JA 1YE5A 3MBOA 4D81A 2II6A 3G13A 3C4VA 1KZGB 3FE2A 4J1SA 4L4SA 1IIBA 1E59A 3ISJA 1NT2A 4QA9A 3QOXA 3MRTA 1SKQA 1YI0A 1U8YA 1GTJ1 1D0SA 2ERCA 3FB4A 3ORYA 5DNEA 3RTAA 3GFBA 4AMUA 4WZBA 4BZQA 1QG0A 1FJHA 2CDCA 1XWJA 2GNPA 3GPDG 3PI7A 2CBXA 2HPVA 3AR8A 1QVZA 3CJRA 1PN3A 2QHXA 1VHWA 3C0KA 3R3XA 2FN8A 3R0ZA 3G1WA 3VPSA 4FE3A 4MI6A 3ONWA 1C1XA 3N0XA 4KGDA 2QZ4A 4ALNA 4BMNA 5L3SA 4M6WB 4OQZA 4Q7CA 2I4LA 2CHUA 2QPOA 4JXKA 3ONDA 3ITEA 3TX6A 3HNRA 3KOOA 2REQB 4L4RA 1JR3D 3RVBA 3KYIB 1VG0B 3VKWA 2OFWA 2CWWA 4F2WA 3NAMA 4BB9A 5E0KB 4RZSA 1YBAA 1MAVA 3S2IA 1Y9DA 4B84A 1RE1A 3VAAA 4D9GA 4PX9A 1JQKA 4YRDA 1N4DA 3UQZA 3U5ZB 5KWJA 2HDWA 5B1AC 2Q3JA 3LLVA 5CIVA 1U2EA 4MR8B 4M1QA 4O3FA 3VYSB 3QKWA 3GOHA 1KTVA 4QUJA 5EMMA 4MV5A 1RKEB 1UKBA 5T4BA 1ELOA 2PBLA 3BM5A 4UNSA 2VRCA 3KM0A 3A6PC 1XWFA 1N0VC 3L0IB 3MG9A 5D6OA 4I1RA 3STYA 1N0HA 4HPWA 1UDAA 1V9LA 3L7DA 4CS8C 2NWQA 1Y7PA 1SC6A 3AC0A 3SC2A 4E2ZA 5FPKA 3N24A 4P22A 1MOSA 4JC7A 5L3SB 1EUYA 1AZWA 1HE1C 5JZMA 1SZCA 1QC5B 2HA6A 1WF3A 1A27A 3HLTA 3IEIA 4JB3A 2VBFA 4QC2A 3T4XA 3HXPA 5ICGA 2Y92A 3PUVA 4B6PA 4H59A 1D2AA 3UWOA 4F2PA 3OWXA 3D7RA 2CXQA 4RC9A 3DE0X 1PFQA 2V9CA 5DP2A 5CU7A 3R76A 2G9UA 5EJ2A 5E8JA 4HHEA 1LW7A 4DMCA 1V74B 4CM6A 1HDGO 4IJJA 1KPIA 2QUHA 3F78A 4LY3A 3T0IA 4BDTA 821PA 2IXFA 1WXEA 3TB6A 3D43A 1M74A 4ON9A 1CUUA 2NXNA 2XKAA 4LMPA 1LV7A 1H5NA 3A27A 2GFIA 1R66A 2NO1A 4QUDA 5IAGA 3RYCB 4L8VA 2W48A 3A4YA 3HJBA 4QQNA 2VTEA 1NF3A 3V2IA 3HK2A 5E1DA 1EB8A 4BVAA 1IAQA 3HJAA 1I51A 1O96B 2PUTA 4M0FA 3GG2A 3DVLA 2P78A 3PRKE 4KHZA 5ALSA 4I5GA 3T9CA 3VNAA 3PHGA 5B2FA 4L5CA 3OX4A 5KSOA 3E82A 3EQ9A 3ZHTA 2WICA 4GGMX 3RTGA 1XGKA 5AKEA 3M6UA 2A9JA 2Z4SA 4ENRA 3J81k 4XPWA 4MDEA 3ER9A 3FGPA 2EPNA 2P6MA 3COSA 3MJHA 4BUCA 4CUKA 5JZVA 4YCLA 1UK7A 2BDTA 3EWIA 4H1HA 4Q05A 5DJ5A 5ADHA 4TZ6A 3TTTA 1ZWKA 3HFJA 1NP6A 3D2BA 1XAJA 1NRXA 4ZVOA 4HAZA 3DTTA 4GM4A 3IURA 2WSSA 2IBTA 1OH5A 3ENQA 3EPPA 2CXXA 4I1PA 3LGXA 4M38A 3VSBA 3GFPA 1EZZA 1UMDB 1KI6A 2NUTB 1YRAA 2LCFA 4N6NA 2GBIA 5GM2A 1FYEA 1UEJA 3CZMA 3RUFA 5CYGA 4YDQA 5FUQA 2ZREA 4FESA 5JW6A 3UB4A 3REFA 4YMHA 1DEXA 3EBPA 2R8RA 3K8OE 5E1MA 1XMVA 3K4QA 2XF8A 1U7TA 3COZA 3CZ6A 3C14C 4HX9A 1Q1EA 1JHAA 1IRXA 1R6XA 1R4ZA 3AOGA 1FW8A 3M7IA 3FVYA 4KQMA 5EIHA 1NBOA 5DS6A 3LJKA 1V16A 4MB0A 5FULA 4ZYTA 1B23P 4ZYXA 3LT1A 1GNSA 2BFOA 4POAA 4CQJA 4ZCMA 2FPIB 2W6OA 2ARKA 2OYSA 4ZA2A 3L34A 2OGZA 1RZ3A 4NU5A 3VPAA 3GUYA 2Z2KA 5ALGA 1PZFA 2D2IA 3B7WA 4EJSB 4P54A 4F7DA 1FL9A 1U0JA 2JVJA 2XF2A 3HUUA 4B83A 4DMMA 2HRCA 1I4LD 3LVRE 3OUZA 3V8BA 4COOA 2KLHA 1YSCA 1ZGAA 2FP4B 3D3NA 1GY8A 4HRYA 4QEKA 4G5GA 3VJLA 2RGGA 2X58A 1S7CA 3OX2A 3AF3A 3IELA 4L6CA 5DHFA 5DV9A 5AT1A 3WGQA 4AMBA 1ZMXA 1FNDA 4RAOA 4MWTA 5CTJA 4XWOA 2P0NA 1D1SA 1CETA 4XVCA 1QHHB 1VJCA 3DBLA 3KLPX 3SKXA 3PITA 3RIGA 4P7JA 4PGHA 4Q21A 4IUYA 3SM9A 3N5KA 4AE4B 1AUXA 4A4DA 4TTQA 1JIUA 4JXJA 4OBXA 1NGSA 3H9CA 3GDWA 2Q2OA 2C2ZA 4MKFA 5L7WA 1YTUA 1YOBA 2D0IA 1PLJA 2AW5A 3DT9A 1QMPA 4ZVUA 4AWAA 3THXA 1KIAA 4K7BA 2Q9AA 1WHTA 2Y1WA 4AIIA 3I61A 4YI3A 2RD2A 2YLDA 1AMOA 3K05A 3IT1A 4H0FA 3KSDO 4X45A 3WY9A 3U56A 2NZXA 1K3FA 2R7NA 2B9VA 3WNVA 4C07A 5A4IS 3MT9A 4GXRA 1QMGA 4PANA 2GN4A 1AS3A 2OTCA 3T3EA 4MZXA 3ZJ4A 4GHWA 4EJ0A 4OHWA 4TXJA 4DBLC 1AF4A 1CGOA 1W2GA 2WYWA 3ICPA 4CTNA 5FOXA 3DEFA 4MYSA 1M0TA 2EWMA 2H1RA 2YXDA 4G8DA 4A8PA 4YRGA 3PHHA 5LOVB 3RK4A 4HUQA 4QPNA 5A2GA 2JRLA 3KQYA 4FDVA 2ZJ0A 4OB6A 1HFEL 1ZMRA 2XBMA 3QLVC 2G8NA 3O92A 3QG5A 3ZNPA 2ZSHA 4KVGA 4WCFA 2BMAA 4GPBA 2ZXRA 2PSHA 2EWWA 5KEIA 4A5OA 4Z9AA 2IZ5A 3TNJA 3HDJA 4N1AA 3A3YA 4WHMA 1PEKE 2O7QA 2GNOA 3NEJA 3THSA 4DIUA 1N3IA 1S2NA 4OGWA 4PIPA 2J3LA 2ZRJA 2C2WA 2O2YA 5ADWA 4ZAFA 1YVUA 1KJZA 4G5HA 1DMSA 4ZC8A 4C0KA 3OE5A 4ZQFA 2FGKA 2VAXA 4OQFA 3ASOC 2BUBA 2HREA 5JV5A 1Y8CA 2CMHA 5H3LA 2Z83A 1XQYA 4MUBA 3V1LA 4E4RA 4F84A 1BW9B 2X5OA 2RK4A 4PIVA 3QY0A 1JSRA 3GUHA 4JUDX 1J0BA 4GE0A 2ORIA 2IYEA 1QDEA 4OO3A 3AQBA 1EDEA 3R5HA 5ANRB 3GA5A 5KAPA 5CDHA 2A5LA 5CIWA 1V45E 4ZVNA 5LIPA 2ZVJA 4KBYA 4XYEA 3BK1A 5ENZA 1G98A 2QJWA 1Z2OX 2ILTA 2E7ZA 4ARZA 4BLRA 4ENQA 4LJ5A 3H17A 1R9NA 3E4CA 4FFPA 2KJGA 2XCOA 4YN0B 3RYIA 2B36A 4DOZA 1MMAA 1K8RA 4DA7A 2GQ0A 5DM4A 1N6OA 3J06A 4KRFA 3CYFA 2JFUA 1XAHA 1VFPA 4Q03A 2P1DA 5C80A 4LJLA 2ZBEA 2EKBA 5SY6A 4E1VA 2GJSA 4B43A 3H1TA 1TJ4A 3G17A 4RHEA 4U5XA 5E4FA 1E86A 2Y1FA 3NHPA 4LOLA 4CFSA 2O54A 2MMCA 4ABYA 2XZPA 2Q3TA 1OY1A 5HRCA 1X3LA 3HLYA 4G41A 3O39A 1Q6ZA 1DJLA 4D0LB 3H75A 4WBNA 3UUEA 4A0HA 5KVAA 3KLOA 3WTCA 3WP1B 1YJCA 3R7BA 1VLMA 3IHKA 4LI3X 1XMIA 1GL6A 4XWYA 3ZWYA 3FOOA 2JGNA 4FJ0A 2XDWA 1KMMA 3HDYA 3GJ7A 3OFJA 5JC8A 1H1DA 1QS0B 1YQ9A 2FG7C 5C1OA 2ID4A 2G76A 1YRHA 2VNSA 3KKLA 4HAOA 4HGPA 4DCPA 1A9RA 3P4UA 1C4WA 1ZMOA 2Y77A 3AY3A 1XDDA 3SQXA 3TQCA 2ZRMA 4QYIB 2YN2A 2F55A 5IJ9A 3FOCA 1MEJA 1YZUA 1X7ZB 3STUA 2QUZA 1R00A 2IYTA 5CIQA 2NT3A 3UQYS 3HKCB 3QPUA 2R5NA 3N2EA 2A4MA 2EP8A 1T3LA 1PJTA 2JHFA 3FR8A 3K0KA 3LAWA 1A77A 4XM0A 4XX0B 2WB7A 1DAGA 1ORSC 3EXHA 3DTVB 3IQEA 2DT5A 1BZ4A 1KY5A 4P9TA 3NVAA 3D6MA 4BWVA 4LOJA 5JCZA 4N5MA 4F72A 4LF9B 3T3PB 3KYDA 4KQFA 2GAIA 2OPBA 5LQCA 2A5JA 5KYTA 4GVLA 1P75A 3ADOA 1CEXA 2EJWA 3BTVA 4IOJA 4OEHA 5TMPA 3Q8WA 5BWNA 1TLTA 2RAVA 4ZQEA 4HUTA 3UXEA 2XNJA 1XXHE 1ZRNA 2EIJC 1DP4A 1UBGA 4HQ6A 4K2AA 5ALKA 1R8SA 5FL3A 1QH1B 1QLHA 1TB4A 1U0FA 1YDMA 3RRFA 4WZBE 1GG9A 1RW4A 1SPBS 2FVXA 3DPUA 3HLZA 2BY4A 3OH8A 2LFFA 5BYKA 1QHEA 3ZY4A 4BEMJ 1TVCA 1W94A 3KCNA 1L5LA 1R18A 1O0SA 2XS1A 4OG2A 4UAVA 1NAHA 1DLIA 4UU1A 2CUNA 5KQLA 1GD1O 4YV7A 1VG8A 3FNGA 3PHIA 3TSWA 4EW2A 4E1AA 5KWEA 3KB1A 3V1NA 1T1EA 4QUEA 1D4ZA 4NECA 1UBNA 3O10A 1RFGE 1O97C 2ZBRA 1NQUA 3HCCA 4LPSA 2Z98A 3QQPA 4Y2HA 5ED0A 3RC3A 4QG3A 5JECA 3LCUA 3OHMA 3GROA 3PA6A 1QOZA 3JRNA 2NW6A 3H2GA 2YRWA 3O8BA 5G1PA 3N0TA 3C6ZA 3MGBA 4YUVA 2JFQA 2ZJ5A 2G5CA 2J5XA 4LOIA 2OE2A 2LCHA 1RMYA 2ZSAA 3B1WA 3EHDA 2AQKA 1DC3A 2VJNA 3LBFA 3AG6A 1ZOIA 3N8NA 4UCQA 3SLRA 3QEOA 2XCLA 1O08A 1MBZA 3DCNA 4ZCTA 1PL7A 3LIIA 2FVYA 2N3ZA 4G56A 3DW3X 4JSRA 1P9RA 1KFCB 1X80B 4HB3A 5EIFA 4X8LA 1EFKA 4N6OA 4BNZA 2ZOSA 1XDWA 2VT6A 3TIVA 2HBRA 5ECYA 1XTVA 4NH0A 5C8YA 4D3SA 2F1KA 1OFGA 5BMVA 4CT0A 1G4HA 5BORA 1XC7A 4A4AA 1GITA 4HNRA 4X7BA 1R0WA 2BN4A 2H1VA 2WIBA 3CUUA 2IHJA 4LSZA 3RC9A 2MIIA 4LV5B 1EAYA 2XT9A 1BR1A 2APJA 1QF9A 5B36A 5FR2A 4UKDA 3DOHA 1JTEA 1XA0A 3BMQB 1PZGA 2HS5A 5EMNA 1RQ7A 1Q92A 3DP7A 3I9OA 5B1YA 5IF3A 2O3QA 4FVTA 1WXDA 1Q77A 2YQZA 1O95D 3IVXA 4I99A 2VCAA 4B3FX 1FYFA 2QW8A 1F0NA 3TQIA 3HY6A 3OFSA 3ED1A 1ST6A 3S27A 2YL1A 2ZB4A 2D74A 5KMGA 3F90A 1BJKA 1YIDA 4BX2A 1QIEA 1K7CA 1PX2A 3KEFA 1PL8A 2QL7A 5CNKA 4LLCA 1FIUA 3DM9B 4UVDA 2LFDA 4ZANA 2Q2NA 1UBJS 2ZK7A 16PKA 2QAGC 1IMJA 2C1EA 5C0OE 4WI1A 1QIHA 2P9BA 4OA5A 1QTNA 2ZJ3A 1KS2A 5GV7A 5CFZA 4INPA 4PAMA 3RIHA 2VCBA 1WP4A 4ACAA 2EGUA 1GWNA 1PR1A 4GOLD 3SE7A 4ETIA 1A2BA 4Q18A 3W2FA 3FPGA 5FPQA 1J24A 3WV5A 2AC7A 1N8KA 1XO1A 4O4HA 3SVZA 1N92A 4EYEA 4EO7A 1P81A 3O4RA 4EHJA 3OO1A 4BO6A 1TMYA 1U02A 1L5WA 3ZE0B 4RYDA 5DASA 3W5DA 4Y30A 1KAOA 2P4SA 4DV4B 2XNSA 4MQ4A 4ALIA 3WWEA 4YAGA 1LDMA 1PEAA 1Z4NA 4Y6LA 2BD0A 2EXXA 3G88A 2ZI6A 1UJ2A 2G70A 5CT5A 4ZOLF 1JYSA 5DNVA 5GM1A 4RVOA 3ZE2B 4TQ9A 1C50A 1GA1A 2OSVA 4IKPA 4TUYB 1I6MA 3BCHA 3GFGA 5FYQA 4ALLA 3U19A 1JGTA 3F4KA 2XKJE 5DT9A 5FA8A 1B0UA 5LLSA 3EOBI 4DUPA 2RGNC 3BWXA 3OBBA 1EHYA 2D0DA 3FMIA 1IUNA 3E6AA 3KYCA 2CF6A 4NJEB 5BSTA 4B81A 4L2IA 3AYXB 2W8ZA 2IRWA 3CISA 2CFCA 3G59A 2H16A 4RSMA 5D92A 2VP3A 4Y6PA 4OU4A 3SG0A 3VNBA 2H4HA 2YV1A 1JDNA 1XV5A 2J30A 1UAAA 3EC7A 3SFVA 4YMUA 2PIAA 3GAFA 1BDMA 2GK3A 1L8XA 2VK2A 4YMSA 1LY1A 4F6CA 2QUPA 4MQEB 3CO0S 2DJ5A 3ZTMA 1GAXA 4OJKA 3AUJB 5HVNA 1CR1A 2I1QA 3THRA 2WFMA 3PJFA 3DE8A 1WJGA 2WUVA 1WCYA 4RMJA 3BQNB 5T3UA 1CGME 2UYOA 3AEQA 4NMXB 1S7GA 2HCFA 4LXQA 5FT9A 5JLAA 3ZZTA 3TGPA 4KLRA 3E9ZA 1GO2A 1EIWA 5FKJA 2X1LA 3OEED 4YJKA 4A0RA 5AK6A 4CMEC 3GLUA 4G89A 1H5QA 1T36B 1FFWA 2HMYB 1N3LA 2J9XB 4TXNA 1ATIA 1SU4A 4UXJA 3ZWAA 3LM8A 2QLFA 4ZXFA 2WWTA 2AMYA 4PFSA 4EMTA 1IZMA 4IO0A 2JI8A 3WE7A 1U8XX 1XVVA 3SHOA 3PVSA 3HM9A 4JLAA 4B80A 1DX9A 3F5SA 1KU2A 1PWYE 3EXFB 4U39A 3RS5A 3P9KA 4ASUA 3GLGE 3AONB 1E8DA 1ZOSA 2Y69C 2FSHA 2Y0PA 3BXOA 3KUUA 4Y2VA 1VI5A 4D7AA 1HC7A 1NM5A 1SKBA 1WD7A 2GHTA 2WC1A 2WK1A 2YDYA 3INTA 3CMMA 3GEIA 2G04A 4CDMA 5JFTA 5COBA 4KAFA 2DE0X 2DB4A 3KDAA 2PRJA 4UMEA 5CB0A 1VHQA 3WRXA 3V4FA 2A3NA 1MB9A 2R97A 2CKMA 3PUKA 4EWLA 1CUAA 3DXYA 4K05A 4Q3EA 3RSOA 1GPYA 4LK2A 1U2SA 4IV5A 3PZRA 3SQWA 3LC1O 4KP7A 2QPLA 5K8LA 1ANKA 2ZXOA 3NV7A 1U7PA 1VL2A 3HR7A 4F4HA 2ZM5A 2FTKE 3EC2A 3IYLW 4LRWA 5H81A 1F4PA 2Q4TA 5L7TA 4DLSA 3ZLJA 1JHQA 4URYR 2O0LA 1P2BA 2I7VA 3IMGA 1TIBA 5G0UA 4MKGA 2JAXA 5DX1A 1XTUA 3NIGB 3HVKA 4FYVA 3VSDA 1NOJA 1JQBA 3KQUA 3HCDA 2NU8A 2B5VA 5KCZA 4L27A 3BSFA 5T5QA 5EQDA 2EFEB 2C59A 1IXZA 1MG5A 1TF2A 4IDGA 1UQUA 4DC9A 1O9BA 4XCXA 4DJJA 1BDIA 3HB9A 2IXMA 1U3VA 2FI1A 5KDDA 2VJKA 3PFFA 3UWDA 2WJJA 1BTOA 1G9TA 2IVFA 4JELA 1QCDA 3PTAA 1NBIA 2WEKA 1Q22A 3HS3A 2YBDA 5BWLA 2W98A 3GBVA 1JA1A 1OLUA 2Y39A 3H5NA 3RS2A 5F77A 4C4AA 5D1NA 3LLUA 1NURA 2GM3A 2OP1A 2WTXA 1THGA 1JIQA 2P0EA 3LT2A 4GI3A 3K3PA 3DKKA 2CCJA 1D6NA 2JIPA 4R7GA 5NLLA 3HDGA 3W8FA 4K1OA 3SNHA 1DPFA 1H6AA 1UMCB 3EZ2A 4HX2A 5TJ5E 3I42A 4MAMA 1DXQA 1J9ZA 4Z9HA 2EKDA 2B3DA 4KK3A 4RPHA 2B3TA 1DJQA 5IJXA 3WK8A 1OXVA 4H6XA 1XEWY 3HJCA 1QYDA 2WJWA 1V11B 4RELA 4ZO6A 3FUWA 4Q34A 1I3LA 3KT6A 3LX6A 4ZLCA 3QKSA 1U0SY 4QYSA 1CYDA 5ALOA 5JG7A 5BVGA 5AVTA 1JWLA 1NX9A 4OP2A 1A72A 3KWMA 1KAQA 1G20B 2OO7A 1E9AA 4H7FA 4BFTA 2BKAA 1TFRA 5GWXA 1R0CA 2PT7A 2FMIA 2ZE5A 4GI7A 3F3YA 5EMLA 2VP2A 4UU8A 2HL6A 1Q7EA 1Z0AA 5DXJA 1B6GA 3HVIA 2J0UB 1JDUA 2WOOA 1L5SA 3FTDA 4PXYA 1MHPA 3PL1A 2C9MA 4CN9A 1SOUA 3HL0A 1TQ6A 3IKLA 1ZNXA 3L84A 3ZQ6A 2ZT7A 2RH9B 2DR3A 3G1UA 1EUCB 3UAWA 2HJ3A 1DEKA 3L8FA 3PI6A 2GLTA 1DT3A 4WCVA 3QPAA 2WIDA 3U7QA 2EVWX 5EJ9A 3A28A 1MAWA 1TR2A 2IOFA 3WRYA 4ZC1A 4AL0A 2IE8A 3ET4A 4C0LA 3EDOA 4U9UA 1G17A 3D1JA 3TLGA 1UJNA 3K20A 5J43A 3K8QA 3NLLA 3QPBA 1AN9A 4N03A 1BEEA 4BE4A 2XB8A 2ONYA 3KFVA 1CUBA 3CS3A 3IMCA 2JFNA 2JGMA 4OJMX 1CZOA 3SJ7A 1HNZB 2D62A 4OIOF 5E9QA 4AS3A 5DTRA 3FN4A 2P9ZA 2O05A 1XZ8A 2CNDA 2P40A 3LQFA 5CLIA 1OBCA 4BZXA 4S0XA 3BH6A 1AUEA 4LWPA 3SHQA 3RVNA 1GTZA 1PYOA 5FWNA 1APBA 3PVCA 3RBZA 3UAXA 4BJHB 3RVRA 2OJED 4YL0A 1IHXA 4O4HB 5CYFA 3LZCA 4CM8B 1ETUA 1DJMA 1EFVB 1Z83A 4FE4A 5IBPA 1CQJB 1VRCA 2EQ5A 3TKLA 4Z6KA 2YCBA 3QVOA 4QYIA 1O77A 4ALMA 2RMKA 1HE5A 3JZAA 2OFXA 4OJNA 4EG4A 3Q72A 4BGUA 5JD5A 2HLDA 1FFCA 3L02A 1UOQA 3QYAA 3GD7A 1Q15A 4LF4B 4BQPA 1MH9A 2FXVA 1B0AA 3OQIB 4G5FA 4D0GA 3DEYX 4JEUA 3OZBA 1HT3A 1EK5A 1X3SA 1OI4A 2W6PA 4PBTA 1BGXT 4DILA 2FFAA 2ZWAA 2OV1A 1L7OA 4M7WA 1XNGA 5DPMA 5LXTB 3POVA 5A62A 2FRDA 4ID9A 3FJ1A 4U4AA 3JR7A 1MT3A 3HP7A 5FWYB 1CEYA 2EILC 4CI0B 1H85A 1OXUA 4TGLA 1JIKA 1TUBA 1U6KA 2GF9A 2EW8A 1Z3IX 3TSZA 2VDWB 3NBXX 3V55A 4ZHQB 1RPAA 1U1EA 4Z7OB 4KACA 4PIMA 1M8KA 4BAZA 4D25A 4RS3A 1JU3A 1VMEA 2BEVB 4OGFA 5TT1A 3N6VA 3QX7A 4LWOA 3VHQA 4UNQA 3DTNA 5LQRA 1NJ2A 4OUKX 4DBVO 2YFKA 1UAYA 3A26A 1SRQA 3DBRB 3OEWA 4LBZA 4M89A 4OH7A 4GBED 1EXMA 1K5HA 2ZB7A 3FWZA 2V45A 1G41A 2AGVA 4C0HA 3FBGA 1NC1A 1PT8A 3EZIA 1K6XA 2FW1A 4HLUA 3AG3C 3TJMA 1KMQA 1QGZA 1TO1E 3QU9A 4AY5A 5AO9A 1IZ9A 1Q0HA 3A2KA 1AHNA 2AG0A 3U26A 5B1BC 5FQNA 3B3GA 3DJYA 2DSNA 1UXKA 4N40A 4RK4A 4F93B 1N6IA 3TD6A 1J2RA 4GNKA 3CWQA 3O9MA 4KR3A 5JLJA 4DIOA 2QBYB 1PR4A 3TZCA 2JGJA 4IRMA 3M6VA 2DHCA 1QHXA 4BVLA 4YTEA 1LTHR 1NU7D 3WL3A 3SEQA 4ZVPA 3VAYA 3BJEA 3DBHA 5D51S 3ZHZA 4YQZA 3BRJA 5AXDA 3O8QB 4DR5B 5JH7A 4E33A 3G7SA 2ZULA 3JY6A 3UMHA 1KR5A 1LGYA 2QQFA 2XA2A 4XGQA 2LDBA 1KJWA 3PNLA 4LC0A 4PTZA 5EHZA 2VF8A 3EDCA 5T7BA 2Q7OE 3M6XA 2HJ9A 3FR7A 1ZINA 1A1SA 4QUIA 4JU9A 1KVRA 3AP3A 3CW9A 1P39A 2WZGA 4WVLA 5D6NA 1HK7A 4UDXX 3D0QA 4I5EA 2VHWA 3S6JA 3WLQA 5CBPA 1HE9A 2CSUA 4AZ0B 2X9NA 1SVIA 4AF8A 1NW7A 2BBTA 3TTYA 1S96A 2K4MA 4IX1A 2ZSIA 1QIFA 4FOPA 2V97A 2PK3A 2GVDC 1L5HA 4Q4CA 2IODA 3L79A 4C7MA 3U4MA 2A57A 1GOTA 1X19A 1XKXA 2VHTA 3D4OA 3DE3X 3IOYA 1OPXA 4MYRA 5E3IA 5AM4A 3W05A 4BMSA 1TM2A 1GA6A 1PCXA 2ZRNA 3QY9A 4Q7JB 2QRUA 5H1YA 3AVQA 1SYQA 1SCNE 2QVZX 2WUDA 3MIIA 2G1JA 1ODFA 1WHTB 3PXBA 3QTHA 4ZMRA 4FZRA 2IYZA 3AYZB 4PQYA 3L7CA 3ZVMA 1E6EA 3TLBA 4D4IA 2NQ8A 3ED5A 2VUTA 1I2BA 3KKBA 3HYLA 4HDNB 3VU1A 2JFYA 5I7AA 5F21A 4UVHA 1EJ0A 3KKZA 1QO9A 1GYRA 2B8EA 2Z3VA 3TE7A 3I5XA 1RQPA 5KCMA 2J9BA 4G1UC 4X7MA 3DE9A 1DAEA 3OAAD 2CB9A 4NBRA 4DSNA 3R8CA 3TEJA 3BEHA 2D00A 4I4TB 4RWZA 3IVMA 4CBVA 1YMVA 4LS3A 2WUEA 3U2QA 3IT2A 3JYHA 2I8AA 4DKXA 4KBFA 1GLVA 4NV0A 5REQA 4HH4A 3N8IA 3RRXA 3FWNA 3OIVA 1TO6A 3BICA 5DYYA 5LYYA 3WO1A 1ZVVA 2BGGA 2GZ1A 1EGMB 5KYXA 1DRJA 1G2IA 5I9NA 2YHIA 1XD2A 1BR4A 1AVTA 1NP3A 1UJ6A 1R6UA 2H06A 2QMEA 2Y76A 2ZCVA 4C0XA 5I7SA 4O4JA 1W19A 5LLDA 1ZUWA 1LSUA 3CZAA 1CQIB 1U6JA 4RSHA 4Z9BA 5FHQA 1IBSA 4QJ4A 5TGZA 5BV1A 4NS4A 2IZ0A 1U0RA 2QU7A 3PC6A 1L4KA 4DIMA 1TD1A 4H3HB 5A02A 4RGBA 1KNQA 4N6GA 5B7GA 4JA0A 2HXYA 4UTPA 1RZRA 1J56A 1HLPA 3QHAA 5TQJA 3SQNA 1HNXB 1RSZA 2A0KA 1HFKA 5FTKA 1F2UA 4EIWA 1Z0ZA 2H4YA 3U44A 1OW7A 3ICWA 4LHEA 4DR3B 2DY1A 3IVCA 4IDEA 3KPJA 4B2PA 4KL8S 3M2TA 3KOYA 4MMYB 4KDRA 4JJFA 3OJCA 3GVIA 5A4JA 4AI6A 3X44A 4NULA 1U7HA 4IHJF 1UFOA 1YS9A 1KEUA 2H85A 2A88A 3T7EA 4EGAA 3E8XA 2DWUA 1ZJJA 2R96A 4LK3A 5EZQA 3RU2A 4E94A 1EXDA 2C4MA 2YHIB 2JLSA 1JKFA 1DOZA 5E3CA 4IIBA 1HO3A 5FEMA 1T91A 4BQNA 4RK0A 3T8YA 2HTFA 4KIWA 2W22A 1Q5PA 3IPRA 1G2PA 5DIFA 2X9LA 1OE0A 4J29A 4X1KA 3RFCA 3TSOA 3GLHB 4E03A 4W63A 5JCPA 3K6SA 1H2EA 5L0CA 2YVAA 1M8JA 3CLRC 3PXXA 4FUTA 3AUTA 3OTQA 2A59A 4BO3A 1T8UA 2BGKA 4Z4GA 4K0RA 3USCS 3UMMA 1B8NA 1FX0A 3WWYA 1ODCA 5ARBA 3MWDB 3NBZC 2Z2XA 2Z5GA 3ZHYA 3KJZA 5ESWA 2P2ZA 1FUUA 2XW6A 1GP2A 3DKIA 4OP1A 1ZK1A 1RBQA 4S1OA 4NSNA 5ALEA 3CCBA 5H3HA 5A71A 2JEZA 4P7BA 4RXTA 3QUCA 4BJTA 3IVAA 4A73A 4GKAA 4MVJP 2C2YA 3A1DA 3AIMA 4LXXA 4OUDA 4MEJA 4AN0A 5KYWA 1YZTA 3FLBA 1N2CB 2JA2A 1V25A 4G5QA 2FAPB 1RPJA 3B70A 4J0JA 4P3YA 1JKJA 3RWBA 3K66A 4OX9B 4B3JA 1NIPA 5DM2A 2B37A 4P83A 3FPAA 4IQ4A 1RPZA 3RS3A 2W11A 2HCRA 3VPDA 3Q7EA 1JE1A 2HTEA 1N75A 3JYNA 2NAPA 1F8UA 4CS9A 4PE5B 3N2ZB 3KPWA 2WWVD 3EGOA 4WT7A 3G2NA 2JC3A 4CDAA 1NJ5A 1E1CA 1ZIOA 3KOXA 1JKXA 4WNAA 4NNOA 1GA4A 2PLWA 3L0OA 3RIMA 3ZW8A 4B44A 4F2GA 2GD0A 3H1EA 4UM5A 1F6WA 4Y8VA 4EPWA 2OYCA 3DB2A 4QOGA 3E8MA 3UJBA 3FHOA 4DUZB 1U94A 1VDMA 3GEMA 4J90A 3L2OB 2XE7A 5LQMA 3ICQB 3BAFA 2C97A 2GD6A 3EYAA 4DIEA 2DLCX 1G64A 1B3RA 2IGTA 2SBTA 1SCUA 1YBFA 1VLLA 1DE0A 3AFNA 1OX6A 4IJWA 1EZ1A 2IPOA 2E1RA 1FE8A 2B6NA 4CKWB 4GRIA 2PSDA 3V4SA 4BXOB 3FYCA 3G5UA 1W9MA 1GTVA 4D9HA 1HQCA 1YCGA 2PJZA 1ISJA 3ECCA 5L45A 3UPTA 2XS8A 5EE5B 3FMFA 3LK7A 2ODBA 1MAUA 1FRQA 1YZKA 2Q5HA 1XTRA 2F1JA 2JJ8A 4UJ3A 5ERXA 3NVKI 1ODIA 3FRHA 3ZLTA 4YVFA 4W7HA 1GGVA 2A1DD 2HMVA 1NOIA 3DMDA 2QQEA 3VV2A 2HH9A 1F2TB 4L08A 3WMWA 4LNHA 3KG2A 3MB8A 3FFWA 4TYMA 3CMCO 3T6JA 1NZJA 3FYSA 1M5UA 1K9VF 3GFTA 4DLRA 3CZPA 3IV7A 2A8YA 4QOEA 1XMXA 4GXNA 4B6OA 1MOZA 3O94A 4B48A 2DBYA 3S2SA 1SXGA 4EG7A 4ZHQA 1RLMA 3I1FA 2ETSA 3ZZ1A 5AQEA 2XOEA 1PTJA 4GYTA 2HMTA 4M37A 1QH1A 5KTRA 3DEKA 4OFWA 5HA5A 1M66A 1ZH6A 4G4SP 5A4MS 2QD3A 4P4SB 5IW8A 5GQSA 2O06A 3EGEA 4CDVA 3LKZA 3KWLA 2QP9X 4NFLA 5PNTA 2P9QA 1J0AA 3C4JA 4DNOA 2XL8A 1DIGA 1M2JA 1ZCJA 3P2KA 1RMQA 3DOFA 4KNWA 4MUAA 2VJBA 4OKNA 4GR4A 5EMHA 4YRJA 1UKVY 2ZJOA 4KTVE 3L8DA 1DKPA 4NFSA 3C3MA 4Q3OA 4EPYA 3OWTA 2P65A 3LUGA 2V7GA 3RUHA 2HWYA 5I7WA 2HF2A 3F5MA 4CYMA 5JQWA 1VTMP 3T5BA 1IJEA 5DE3A 1TWAA 1DO8A 3TOXA 1F38A 1JA0A 1Z0KA 4GQAA 5CCDA 4MDFA 1XQ6A 4R0NA 3E7DA 4H7PA 2BTQB 1JMYA 2ZS8A 2BEJA 2CY0A 2ZJAA 3MHPA 3PQEA 4NMWA 4TSKA 4QJBA 1AH2A 3FDIA 1GNQA 4V0MA 1NR5A 2HN9A 3HYSA 1VMAA 1NW6A 4BNLA 4CG0A 2Z4TA 2ZVDA 5AKIA 2PUHA 1KO5A 2GTPA 3QH4A 4I55F 2V5AA 4JP5A 3VSAA 5BUZA 1SR8A 1LDNA 4URXR 4M4SA 4FOSA 2PRYA 4DWWA 4DBLE 2K2WA 3MLAA 1QIJA 2JJ2A 2QU8A 4TRRA 5A3VA 2VR1A 1NVVQ 4XFDA 4BX9A 1Y6DA 3H84A 5BSFA 1KMNA 1PQUA 3E1KA 2QR2A 2WHPB 3BPSA 1R6TA 1RYEA 5BSKA 1VJ0A 2AG5A 3MD9A 4Y98A 1XTIA 3ZLUA 5IBQA 4MRPA 4IM7A 5TR9A 5L4SA 1CJVC 5ISMA 1S1MA 2GDCA 2G67A 2RHJA 4KQKA 1M5TA 3P9ZA 3U62A 1TU0A 1X94A 1G63A 4B40A 2B1JA 4FINA 5JD6A 4RPCA 2XOKA 3Q11A 4DS3A 1VPWA 4LF8B 5CNIA 2B35A 2X6RA 4IRXA 4N7BA 1X86B 4R84A 4GP7A 2OMEA 2YHUA 4CVNA 1JDBB 1W35A 2WJZB 4B35A 3DVAA 4N3AA 5CFMA 4B4DA 1LNZA 4BPMA 4IGAA 4DV2B 1UPTA 3O03A 3OU6A 3MFNA 4WBNB 2RGCA 5C52B 4TLBA 2BGLA 3BRSA 3UY4A 2R4TA 4F91B 2P69A 3SC2B 5BYAA 2BKLA 4OQDA 4CCSA 2EFJA 2Y8EA 2DM6A 5KYUB 4JBYA 1V0JA 3EQ2A 3K73O 1U9JA 2IHZA 3GJSA 3MFYA 4B7ZA 5K0BA 2B8JA 3ZUPA 2GS9A 3H16A 2R7QA 2XDAA 3Q12A 2MYSA 3RHFA 4P3NA 3LPNA 4GI1A 1YA8A 2ZJZA 2M6SA 3IODA 4IJKA 1ZICA 4TWBA 3OQ1A 3VR3A 4D3YA 1S2OA 2E4UA 1SCBA 2BT4A 4BN5A 1OR8A 1UINA 1EFPA 4YJ3F 3FCEA 1NRIA 4I3GA 1YS2X 4IWYA 1ULUA 4JL5A 4F9GA 3G2LA 2LIPA 5G4LA 5KX5F 4IHJB 2P67A 3FZGA 3UK0A 3ZK9A 1AMUA 3GQBA 5HF8A 4EL5A 4DQDA 2HBZA 1RM0A 2Z5LA 1NYLA 4PC1A 4AMYA 1IMOA 5BV0A 1BXZA 3ZK8A 4R9VA 1LK7A 1BWRA 1CVRA 2RI6A 1OAAA 4M83A 4BL5A 4NBUA 4BKMA 1MX3A 4C1NA 1H6CA 1JWAB 3LWDA 1NUSA 2AIRA 3S2FA 3BE4A 1R12A 3C6XA 1XRMA 2JBWA 3H5WA 3LNMB 1DQZA 5TARA 1EPUA 1ES9A 4X00A 1ACJA 3LO5A 1V7PC 1OB2A 3GH1A 3CTMA 3I0MA 2A78A 4EW3A 1Q0ZA 2BFEB 1EXNA 1RLOA 4XA8A 5KTTA 4G0WA 4IHJA 1T1SA 2WQZA 3KJNA 3TLAA 1TKNA 3GLVA 4R2HA 1VKZA 1GUBA 3UJPA 2A0WA 1L7MA 4M9ZA 1Q0UA 4KKVA 13PKA 2HY7A 2J07A 1W44A 2AOTB 3CEJA 3IP6A 3WGZA 5I9BA 2CD7A 1G4WR 1MJHA 5B3JA 1I7NA 1JJIA 3AL3A 3GMDA 2P1AA 5KC9A 4Z9IA 4H7IA 1H2AS 2BCGY 2WE8A 3SZGA 2Y68A 2P6VA 4P36A 3F2VA 4NZPA 3NYLA 3C70A 4WXHA 1QFMA 5UKDA 4R8VA 3HADA 1RACA 2PGAA 4FGKA 1G8PA 4P92A 4Y2JA 1D7OA 4A8JB 6PFKA 1Y8ZA 3W2WA 1NX6A 2H29A 4GRAA 1FDTA 4YRLA 2JFBA 5EWLB 4C76A 5L3QA 1SXJA 3BE6A 2OHXA 5FIUA 2WFLA 1VGRA 4DLTA 3K9GA 4N5HX 4V02A 2XRZA 5IT5A 2X5JO 3GMSA 2EZTA 2AKAB 3X1KA 4ZIRB 2XA1A 4IDQA 4P3XA 4G7OF 1FQWA 2J6HA 4C4OA 3WLKX 3DCJA 3UXMA 2CVFA 2L17A 2Z5FA 4KUGA 4EQ6A 2W6ID 2OOKA 4FZJA 3TPFA 3K6SB 2H7YA 4E5UA 4EFDA 1J1UA 2YFYA 3A4VA 4Q7LA 1PV4A 3KJGA 4OD0A 5I9LA 4OP3A 1FUYB 3PCVA 1DQNA 1OTYA 1M56C 1U3DA 2XE8A 4I3HA 3L04A 1NVEA 3GZ4A 5CT4A 1CQZA 1QH8A 4H1WA 4MHTA 1R0KA 3QX8A 4D99A 4G7HF 3UYKA 4OOFA 3WHLA 3GX1A 3FHCB 256BA 4AFNA 1H2BA 3BFKA 3DBLB 3JTEA 3ABQB 3GT0A 1U1IA 4IWXA 4Q00A 2AE1A 1NC3A 4KYTA 1CERA 5FA6A 2REXB 4O33A 5GGXA 3SZOA 2RGUA 3ZX4A 3B53X 1BD4A 3DONA 1JEYB 4LF6B 1XQWA 1XZBA 2IYXA 4F3TA 2YN4A 1Z2DA 2GAFA 4JX9A 3URMA 1LPMA 2Y1LA 1QFYA 3HWRA 1DS6A 1O89A 2FETA 4ZREA 2JGFA 1T6ZA 3QJGA 5K0EA 2ZQYA 5ALLA 4ZJPA 4EOGA 3PXCX 1NLZA 1XVTA 4ZO9A 3A14A 4M9CA 3G0HA 1JEJA 2VJLA 3AUAA 3Q87B 5J5AA 1G6Q1 4N7RA 1K8QA 2VDRB 1FVFA 3L3BA 4TXMA 3FOFC 1ZHTA 3RYLA 4DDTA 5AK5A 1NR1A 4XQEA 4PNEA 4GM0A 3O4HA 5COMA 4A15A 3I3SR 5CH5A 1XL1A 2IXTA 3JYOA 3OJ0A 4RSRA 2DR2A 1WG8A 4MPTA 1ZD1A 1OILA 3ZC4A 2C9CA 1JZTA 4JLVA 1YKGA 4RY0A 5TF4A 3W0LB 2CZCA 2NM0A 4QQFA 2CGEA 4EJMA 3LCCA 4IY1A 1P31A 3LHKA 5KYYB 3UK7A 4U9IS 3TLZA 2H9IA 2IYFA 4WTOA 2I4RA 2QLLA 1F51E 2X8LA 4QULA 3V80A 1X38A 3KSRA 1JDPA 3B89A 2DZDA 4R8RA 5AYVA 1WY7A 3DVSX 4HRXA 3T7TA 4ZVKA 5FOQA 1G19A 3F9RA 2CVPA 2ZUSA 4QO8A 3M1AA 4DJAA 1LS1A 2P9GA 3B9RA 3R5FA 3WLJA 4EF6A 1YJXA 2YZSA 1QLJA 2WTNA 3AO0B 2C84A 3I9MA 3IXLA 2YTZA 3TW4A 1E0KA 1EBFA 1GZVA 2F3QA 4G7ZF 3QELB 4RCVA 1V8OA 3DDSA 2PMEA 3T9BA 3TTWA 1R5NA 2B92A 5BN4B 3SXJA 2P77A 2FF7A 1JN0A 2IDKA 3CJTA 4KU4A 4R01A 5EJMA 3SF0A 1QS0A 1DAIA 1WZ2A 1ZG3A 3WGVA 3V8NA 1GZ4A 4HWGA 1LVUA 4Y7CA 3C15C 2ZUTA 3A6KA 5AOCA 4DBRA 2QXUA 2JFWA 2XX3A 4UD6A 4R32A 2A6PA 4INJA 4N3GA 3U3RA 2CSXA 1I1NA 4I4NA 1Z6TA 5DQTA 3R7CA 2IH2A 1QVVA 4YAWA 2XY4A 3P71T 4Q9HA 5HM6A 1KVQA 2PV0A 2PCJA 2PKQP 3B5JA 3H4TA 3WK5A 1KJNA 4OQ4A 5CRIA 1NJSA 2GF0A 1TZCA 3LUKA 1LPAB 3FHDA 3K0EA 2UDPA 3LQ4A 3SI7A 3TIFA 3VPBA 1QC5A 3E5MA 3QPWA 3F5FA 5F2NA 5DYIA 3IQWA 1A9ZA 3PQDA 1WMDA 2V8OA 3JWPA 3NFRA 3FOPA 5JLIA 2JAHA 4HJRA 1J6UA 3QXSA 1OFUX 1Z5PA 5EQFA 4UOEA 4FI3F 1EFDN 3BN3A 2ZYUX 3EXG2 4R9SA 1HF3A 1TTHA 2CB0A 3DG9A 2HNAA 3C3KA 3M79A 5EIBD 1KFBB 3W6OA 4BFCA 1T0HB 4NVRA 5H16A 3CN9A 5KHOC 4HQLA 2O1WA 1VGVA 1PUJA 1ZPDA 3PQ2A 3ZDEA 3VQTA 1EGHA 1YJAA 4MB2A 4XTCS 4DV0B 1D3AA 2OHJA 1NBHA 1NA5A 5DGHA 3M6MD 1T1GA 3EUAA 2PVSA 5JDCC 3K1JA 4UNNA 1N2EA 4ND4A 3SMQA 1RNLA 4Q1AA 1J0XO 1SBNE 1DBWA 3DYBA 4NWIA 4UTRA 1CE8B 5L0JA 4XR4A 2VK8A 1GDHA 3PF9A 5HDBB 3FTFA 2COUA 4BMXA 3ICCA 4ZU6X 3NRHA 1L3CA 1Y48E 2I7TA 1QKRA 4QLBA 5LJIA 5JS6A 1MO3A 3EVBA 5HFAA 3RIPA 3H8SA 4R81A 3ZU2A 1XWWA 1AS0A 2W6NA 3SQMA 3RUEA 4RJ2A 4LBYA 4RORA 3RVDA 3KAJA 1E2PA 3RRZA 2OZPA 3K2QA 3B1JA 1VGQA 2OKGA 2F3PA 1D1AA 2KQUA 4H15A 1DO0A 3SZLA 2UXBB 5B3JC 4G1MB 4ICIA 3ZDDA 5A9RA 4KFCA 4XGRA 1AXRA 2DG2A 2FG6C 2Q0QA 3CW8X 1B3BA 1OLUB 1PVVA 4M99A 1KWKA 5I4KA 1T2AA 5KNCH 4CMIB 4LFAB 2O5VA 3MINB 2H1OA 1F2DA 2XT6A 3ZG6A 2YZNA 5JAUA 6Q21A 3C16C 3LYHA 1KTMA 4ZO7A 3U16A 3EVNA 1LRLA 1P0QA 2R0QC 1O4WA 4E09A 4QVIA 3SHFA 1T35A 1G0OA 3MXTA 1PVDA 1PS9A 2ZANA 4CHGA 4MIEA 5BRNA 2CL7X 3Q7LA 2GCNA 5DHSA 4HYEA 4KXXA 4PJLA 2HU7A 5JS8A 2ZT8A 3LA6A 4DJDC 3CX3A 1JAXA 2JKZA 3OTIA 4MVWA 3OKCA 4YP1A 4EUKB 1S8FA 3CH6A 1XHEA 1U7UA 2G83A 3JCZA 1A76A 4PLCA 1NN0A 4BZPA 4LV8B 5EIEA 5IDWA 1X13A 1ILEA 1FSPA 4NTBA 1JIXA 1H05A 2J9RA 2Q4DA 2JANA 3KQMA 4S1TA 3KJFA 4UE6A 5JQGA 8ABPA 1X1SA 1SBTA 1N5DA 4CHTA 1Q0LA 2HJVA 1GNVA 2O0KA 1RRCA 1NQAO 3OWOA 2IYOA 1OX5A 1VA5A 4GOND 5FD8A 1IHDA 2GHRA 2A30A 2XWQA 3ILVA 3UOAB 3AUKA 4NG5A 3VO2A 4A92A 3O75A 4IOMA 1U04A 3B1KA 3TR6A 2PGDA 3PBKA 4K9NA 2B98A 1KDPA 2ATCA 5EIBC 3EVCA 3O2SB 1WNFA 5EHXA 1CUHA 5EXPA 1XROA 4LY0A 1FFXB 4JJEA 3IAEA 1G7RA 1MA0A 1UP7A 4MR7B 3S1LA 1XMPA 2XMQA 4MRSA 3OZSA 2WTAA 4IPTA 3FDJA 1BH2A 4EDHA 3ROMA 1NWCA 1QKIA 1SVNA 3C8GA 4Y2YA 1B1CA 1P80A 1XQ9A 3NBMA 2ZIXA 3IQFA 3KO8A 1QE0A 3PQCA 4TLDA 3FHTA 4C04A 1U11A 1ZIXA 4O4JB 1DTEA 2XAUA 4Y0VA 3EA5A 2H1FA 2VWQA 3F47A 1U89A 1GYQA 2NNWB 3BWBA 1KSFX 3E3OA 4B4WA 5FTJA 4I1VA 3UGJA 1Q17A 3I5PA 3VSEA 1PZHA 2ZBUA 3P4XA 1KPGA 4XPXA 2I3ZA 4NATA 1RKQA 3LQ2A 2CLKB 2ZRAA 1LC3A 4UBJA 4E18A 3T4EA 3OX3A 3PUZA 4ZT6A 1PGQA 3KRTA 5JC1A 3OPVA 3IE1A 2QRNA 1HNWB 2I67A 3NHRA 3PPYA 2KX7A 1QCZA 4Y9RA 5L95A 3FPFA 1G5FA 1SXJB 2PO5A 1WLYA 4XFKA 3WLMA 4XTKA 3BJZA 4CM4B 5BN3B 3DJFA 1SZPA 5CFPA 4XFJA 1N8NA 1SQ0A 3OIFA 3G9UA 3RFTA 3SMVA 3THXB 1EP9A 4PZUA 4RLQA 1OLXB 3ZWCA 1JG4A 4ZDWA 3P0FA 1ZRHA 2KE5A 1RRVA 4C14A 3JSZA 3OJWA 2JIRA 5B58T 4FEYA 3EQZA 4BNKA 3Q7PA 1HFJA 4A2PA 4C78A 1CUVA 5CB4A 3SGLA 1CIVA 1XCJA 1RKUA 2PA3A 3COVA 3HJFA 1VPVA 5ER6A 4YS6A 3UB2A 3TAUA 3HWX1 1FFTC 1GNRA 4A8HA 1KAGA 1ZW2A 4XLZA 4EB6A 1P9LA 3MAJA 3WK7A 3WGUA 4HADA 2WY2D 1BRMA 3IOMA 1ZW1A 4KR2A 1S8AA 1X1BA 4Q4AA 3NHSA 3GDHA 3RUDA 3UJ8A 3HUEA 4ID3A 5H82A 3I04M 1VCIA 1VSBA 1YZVA 4GYKA 5ALZA 4W9NA 5EKSA 1EBBA 3M9LA 1WTCA 4NJEA 1IAVA 4NBLA 2PXXA 4AAYA 1OZHA 4ARCA 3QLTA 3A6HA 5G53C 3WNZA 2H7CA 2NU7A 5EY5B 4GKBA 2D7DA 5KSYA 3AERB 3NMJA 1UOOA 3LYLA 1W2HA 2FOIA 3KYJA 4AF6A 3DJUB 2GKGA 2KJQA 4LZOA 5KYVA 4R71A 1O5IA 1QGED 2H07A 1OW6A 2QX4A 3KKMA 5DXAA 1E83A 1EINA 1H8EA 2GRJA 2PKRA 3AESA 3BJRA 2R6HA 4P81A 1ZHWA 5AKYA 4TTSA 2L2QA 1RKCA 2CFOA 2M98A 2VEDA 3AEQB 3FOAA 4QDXA 3PE4A 1E6LA 5FUBA 2AV6A 3PXGA 1PJAA 4QM7A 1PJ8A 3MJVA 3S44A 3WSVA 1PTJC 2FSFA 5EIAA 3VOBA 1E1CB 1Z63A 1CKEA 3ZJ5A 5A6VA 3A04A 1MHTA 1JKIA 2G07A 3O1IC 3F6SA 1Z23A 1TQHA 3NYRA 3F6EX 5DBGA 4W7SA 4A0GA 4JR1A 1X70A 4EHIA 2PL1A 2PSJA 2Q99A 4PYRA 4RHUA 4WKCA 4BIIA 1X15A 4PJJA 1ZL0A 2J32A 3CURA 4F5DA 2YRFA 3M3PA 3L6CA 4AM8A 2B0CA 3GZJA 1BFUA 4NL4H 3RBAA 2FMFA 3F6PA 1HA3A 3VH1A 5JS5A 4Q4ZF 2YIVX 4ZOBA 3R6WA 1OWLA 1JFFA 4DE5A 2G9RA 1XMOB 2H3HA 2VPTA 2PH1A 3D3JA 4Q15A 2HK8A 4XLLA 5LU9A 1Y3BE 4B6IA 3EARA 3JXEA 5EQJB 3K7DA 1IN8A 4J0HA 4MLZA 5T6MA 2JF0A 2ASEA 3KQWA 3UBMA 1TLLA 3A05A 5FUWA 5JROA 1UBKS 4S3MA 3M89A 1JBEA 3FMOB 3Q6IA 1T24A 3QEJA 4Q4HA 3AOUA 4U2FA 4WLEA 1GNPA 1M0SA 2YWGA 1TJ3A 3OKPA 1O95C 4QDJA 1GNTA 1TLFA 3SHVA 4B4OA 1TU3A 1L7DA 1VHJA 1Y8RB 2FOLA 3MMXA 4FW9A 2I2BA 2SKCA 2PS1A 1ACLA 3TOCA 4C2BA 4XGKA 2WBLC 1BRTA 2H65A 1G8YA 1XJ0A 1EEHA 4XKJA 1JBQA 2JIDA 1NUTA 4FHGA 2PY6A 3PNSA 4RCZA 5JY6A 2BHTA 4A2QA 1GV0A 2R9VA 1ISSA 1K86A 2OUIA 3D8RA 3QXXA 4MRVA 1CDEA 3G0DA 4QIHA 2CZQA 7AT1A 3MRSA 1I2ZA 5D00A 3J81A 4KFUA 5DISB 1AX9A 1BHSA 3L4SO 3ODPA 4OIPF 3E61A 4F45A 1CR6A 1X42A 2IFTA 5TQ2A 4D9FA 1ZN9A 2NXWA 1Q12A 4QGFA 3TIXB 2JAPA 4D8WA 4PLHA 4EJSA 2O7VA 3A1FA 2JS7A 3ASVA 3NUQA 5ENDA 4AP6A 2YYYA 2VB6A 2ZIZA 2CLIB 3O4GA 4GI5A 4PQRA 5G1OA 5LP6B 1E3DA 4I1IA 4DQVA 3PB3A 2I8CA 5I01A 2HU5A 5DOZA 3AVXA 1QE3A 4KPEC 1Y3CE 2XV1A 3EDYA 4LYYA 2YJGA 2Z56A 4QXQA 1E2LA 1U7OA 4D8TA 2ZYWX 4KZKA 4L51A 3EZYA 5AHOA 3D1VA 1CJMA 1DKMA 3QE0A 3H97A 4UHJA 4MW0A 5FBHA 3UMRA 1Q7TA 1HYHA 4JP3A 3PFCA 4KIJA 4I6JA 4DDWA 4I9FA 3OETA 4QDZA 3DOCA 1QSPA 4FFWA 4RPLA 2PUEA 1V1MA 1SUCA 4HS9A 3CSUA 1E3TA 3AL0C 1AMNA 3K7EA 1OLSB 5BXYA 1F4LA 1XBTA 3VRCA 2X0DA 4NJMB 3G8CA 3Q9NA 4MV1A 2GCEA 4XEFA 1CUCA 2QAGB 2R1TB 4RVGA 5CI9A 2MYTA 1KYVA 3QVTA 3T7JA 3I37X 3VMMA 3OF2A 2ZVQX 3WWCA 4DR1B 2IUFA 2IEGA 1WUJS 3A9TA 3HJTA 3E03A 5FLKA 1U8CB 2Q0HA 4BMZA 3TF5A 2BJHA 1EVJA 4JKYA 4OHUA 1U31A 1N9GA 2ZTSA 5AKHA 1TO2E 2X76A 1KIFA 4DCMA 4DZRA 5F3RA 2RSLA 3N05A 4YFYA 5GONA 1EQ2A 3NWEA 3F6BX 4LMAA 3P9QA 4MSUA 2AFHA 3QYPA 2VASA 4I1MA 1ESMA 3BREA 3QFSA 3AX6A 2BKXA 1D4AA 3DWIA 4QEZA 4WACA 4JENA 1A50B 1QE5A 2A1TR 4M54A 3T4PA 4GC5A 1JHYA 4Y0NA 4A03A 4CCYA 4NY1A 4MQ9F 3LUJA 4CKBB 3ZQ4A 1QG4A 1WKBA 1G8MA 3LXMA 5F9HA 1L7RA 1IZZA 3GLRA 3K70C 3NTVA 3DVAB 5ELMA 1CNEA 3EVAA 2RKBA 1GPBA 4YONB 4CSAA 3W2EA 4I7EA 2HZBA 4JC0A 3LQYA 1A2OA 4HV4A 4NMHA 4IXNA 2FRXA 4F9FA 2CVOA 4E5DA 5JPCA 3K72B 1XB2A 3VC2A 1FY2A 3LNRA 4GPTA 5IJ0A 4J0QA 4EI8A 3T1HB 1YYXA 1GGNA 3G2MA 4PO9A 2HBQA 4IF4A 3O91A 1NW4A 4PZYA 2P2YA 1WCIA 3T4UA 1NI3A 2Q4FA 3AHCA 4MIOA 5FOWA 3T94A 1YT5A 1G4US 4UU0A 1VCHA 3NWBA 3OZDA 5EMJA 4KKXB 5LDGA 1VLZA 4DEYA 1FB5A 3T5TA 4MGEA 3IDFA 3BFXA 2UUOA 1XEXA 3KR9A 3LOPA 3QBJA 4L9AA 5HRAA 2J87A 1H7IA 5A6AA 1DCFA 4MV4A 4AN4A 2PQ6A 3KSAC 1VOTA 3T5AA 1ICEA 1R9MA 4IMPA 3KVVA 5JRDS 1XQ1A 1Z82A 3GQBB 2ZSBA 1VYUA 3NTOA 3PQ5A 2FZVA 3W5HA 5JAIA 1KEKA 4Q9KA 1H4VB 4OY3A 3KXLA 3UWKA 2JGAA 1TXGA 2FHPA 2R3SA 3L1KA 2B0HA 2CCYA 1J2TA 2VUIB 5F35A 1C4OA 4D3DA 5K45A 4DB4A 4YT2A 3LV8A 3LBHA 1MRSA 2GWWA 1IWOA 3ORHA 1ADCA 4LHYA 1Z2EA 2BEKA 3ZTTA 2R48A 4TVSA 1Q0TA 2R02A 2UYQA 3CPSA 1SKAA 3BHIA 4Y2XA 1Q19A 5ILOA 4JCHA 1PT5A 5HIAA 3CO5A 1OGJA 3JRWA 1PNRA 4CXMA 2GILA 3V1UA 1SA0A 5BW5A 4IH1A 3QUAA 2W2TA 4HE8D 1RZVA 3KX2A 2QQ0A 2XYVA 5E38A 3VU9B 5K99A 4BVHA 3TM4A 2XB4A 1OZ0A 4W5JA 4X0EA 3N2IA 1SB9A 2HDOA 3O8QA 1NW9B 4GSYA 4RH0A 2V4ZA 2Z9CA 2WZQA 2YZ7A 1PFGA 3GR6A 4CMIA 4DYHA 5JOQA 2ZJ8A 2R6JA 1E5XA 3NYWA 3RS7A 3VNQA 1BIFA 4V1CB 1T0JB 4ZYYA 1Z7BA 3JZFA 1ZM9A 2I62A 1MPXA 2Q1XA 2Y9PB 3M82A 3QFCA 4BP8A 2K7ZA 3GDGA 4CR8A 4JTAB 1Q20A 1OU0A 1ZNYA 2Y1GA 4FR0A 3I5UA 1POXA 3DMTA 3OEHA 2ODNA 5DCUA 3W3ZB 1NF2A 1V1RB 2VT3A 2HR1A 4ZT4A 3HFGA 2ATXA 4N82A 3IR5A 3BD8A 1Y98A 2ODAA 2V5VA 4O4LA 4AY3A 4A0QA 3ITNA 4CM8A 4Y3UA 3JYPA 1DSSG 1K7FB 1WMBA 5DTMA 5B6PA 2FE1A 1V7QA 2QN2A 5AJWA 4QBIA 1D8AA 2QN3A 1NNSA 2ECFA 3T9OA 2I34A 2I03A 1R4NA 1OBFO 1XRRA 3GJ0A 3KR1A 3ORRA 1LSOA 3QVSA 4X6XA 5HS6A 4ZZ0A 2RBKA 3U3DA 1T8RA 1S7ZA 2NZ8A 3GA0A 1IEQA 3VTKA 3L7BA 3Q3GE 3NORA 3FIUA 3NIFB 4JJ4A 5AJHA 3WK9A 2V6MA 5LXTA 4BFZA 1T4CA 2KQ9A 2J0EA 2UZ1A 2WSIA 2PVCA 2W93A 3IP1A 2PU5A 4ZALA 4MVJM 4DV6B 2X1VA 1W46A 4CG3A 3OZRA 3AUUA 4KVAA 4KQ1A 4RY2A 3ER8A 3A9WA 1L2TA 3JD0A 5K0NA 4CUJA 4CIAA 3QE3A 2DFDA 3JVEA 4Y7DA 4I46A 3V4OA 1NM5C 3UCFA 4B2YA 1GCAA 3N0VA 3PEWA 2FHSA 1A9SA 2FDRA 3RV4A 2R65A 2YJ3A 2OEXA 4B45A 5JP7A 4J3FA 4ZDIA 1EE9A 1D2MA 5BN1A 1FFYA 1GKIA 2NGRA 2VDJA 2XYRA 3AWDA 2B25A 5EAIA 3KD3A 1K2WA 3H1PA 1SBZA 4OV6B 4JLJA 3JQDA 4LYFA 3OLCX 1IN4A 1PFKA 3DEAA 1Z4KA 1SIUA 1UBLS 2IYNA 1GN8A 1D9ZA 1IONA 2GDZA 2H7XA 1OWMA 2JPDA 3JATA 4KN6A 3WGOA 1HI9A 1WPGA 4YACA 5CCBA 1X7YA 2AYXA 1I2CA 2VOJA 4WGZA 5HNKA 5C46F 1SQSA 3L9XA 1E1MA 3C5HA 4Y9UA 1KYZA 2PGXA 1SR2A 4KXWA 4J0EA 5SY4A 2GMWA 3HJRA 5HZGA 4RVUA 2VNJA 4BC0A 3O95A 4QASA 3O38A 3I39X 2H17A 2BHSA 5LP6F 3IP7A 3JYQA 5DM0A 4PPGA 3OZCA 2XMCA 4KFRA 4KBGA 4B9EA 3OOWA 1FRZA 4M1KA 3FNFA 3EVFA 1IB0A 2YHAA 3NHLA 3DKRA 3TNLA 3AVTA 2PCLA 3C1UA 2HADA 3WISA 5HR5A 1HLGA 4JC8A 2YIMA 1RM4A 2ZW9A 1YQXA 3DLPX 4X90A 3C18A 4LPKA 4B4VA 4FD3A 1S1CA 2HSDA 3SYKA 3KYCB 4FZ5A 3PLAE 3C62A 3ADKA 3H4MA 4WA8A 3T35A 1CZLA 4B74A 1VG1A 1F9AA 1G3QA 1QPZA 4QO7A 2IZOA 1OI2A 2GO1A 1JEDA 5C1IA 5SY9A 1XLTA 1D0VA 1QHYA 1WV1A 1UT6A 1Z2PX 3BFVA 3ZU5A 3ZV3A 4DPMA 5IJAA 2PMKA 4XDGA 1K7YA 4XIFA 5JYEA 2E82A 1LV8A 2J9FA 3BMOA 3UG7A 3QE9Y 3NKLA 3ZQVA 3MCAA 1H4QA 2AVDA 1OTHA 4IHKA 1OTXA 4HY3A 4NPAA 4U3JB 5H0IA 3ST7A 2B2NA 1TZKA 4NYJR 5EJ8A 1QZXA 2G71A 4KMRA 1YH3A 3K5IA 1F2UB 1DWQA 5J4HA 1WCIB 1YGPA 2M2IA 5BW4A 1B15A 4MP3A 1GL7A 1YMUA 4A2NB 2BJVA 3OZXA 4G84A 4D4XA 3HABA 3KUKA 5EPUA 3AHIA 1XZIA 3G85A 2R8XA 4LZNA 5T1DB 3TULA 4NKRA 3W9SA 1BOOA 5FORA 2J9UA 3D5QA 4IVPA 4CTKA 3KQHA 3GJYA 3A31A 3DTVA 3IAAA 3PKZA 4V39A 2N75A 3BMXA 3GLSA 3LUDA 1JSLA 1QPUA 1ZNWA 3AVYA 4JOQA 1QJCA 1RC1A 1FPQA 2B8TA 3SR3A 3UCXA 1VCMA 2DQ4A 4AJKA 4C4TA 2WSBA 2HJGA 1XG5A 1Y1SA 2OGWA 1IEWA 1PQWA 3E9QA 3H8JA 3L6OO 2J4FA 3ENKA 4OSOA 4P08A 4R2IA 5L0DA 1M1UA 3TQSA 3TMKA 1NVFA 3MZ0A 5FADA 3FPBA 3UANA 1KY2A 4L7QA 4M60A 2H1WA 4WLOA 4REQA 3DOEA 4N5NA 3STVA 3N07A 3FSGD 4HL6A 3NAGA 2ZYSA 2O9XA 1PZEA 1K4MA 3H2BA 3PIRA 3D3WB 4TTTS 4U63A 2AI2A 3IUPA 1DOAA 4CG1A 2GPBA 3VNSA 1SUEA 2O0HA 1EU1A 2EJUA 3A9SA 1SBHA 2G17A 4WL0A 3BFPA 4CU5A 3ZDCA 2ATEA 3ZCUA 4GL4A 3TQOA 1RQRA 1OQCA 2W2PA 3A1CA 3ASUA 4GRDA 4MPPA 4UAGA 4WLNA 4Y1GA 4DEVA 1HZZA 1P74A 2OBLA 3GGOA 3LY8A 1OYWA 1IQPA 3L18A 4PS1A 1Z5OA 1B42A 4OMUA 5NULA 4YRKA 4RDAA 2A69F 4JEAA 3B3JA 1HDXA 1Z08A 1XPRA 3GZTB 2Q7RA 2CXSA 1BKDR 4J2HA 1NXPA 1X7GA 2PUWA 2PZKA 4Y6QA 3IHLA 4GZMA 3T1OA 2XCSB 1N57A 1S9DA 3O47A 1IG3A 4A6PA 4D8YA 1M8PA 1CJTC 4XUEA 1WEKA 3GEDA 4WN9A 4ZT2A 4XYLA 5IASA 1HEUA 2VP4A 1AHPA 5EIOA 1J99A 3CH5A 4RY8A 6LDHA 4IH4A 4O6MA 4WNAB 4KIUA 4GMKA 4WAUA 2CHEA 4EJSC 1RAGA 3O3MB 2AN5A 3DI5A 3MERA 3TKAA 2PH7A 1I0LA 4CI9A 4YPOA 3OKFA 1QVAA 2EYQA 3WQBA 2V1XA 5AHKA 4B47A 2CDBA 2OAP1 3G02A 3HG7A 4M9UA 1EDZA 1SXJC 4DQLA 1FFAA 4PLZA 5BUQA 2IYVA 3HSSA 3FDXA 4WE3A 1O4VA 3GRPA 2YDXA 3DE1X 3G2IA 3L1VA 3OX1A 3JQAD 3LUPA 4W9MC 3CNQS 1IK4A 3F46A 1M8FA 3DAHA 3GNTA 2F1RA 2RGNA 3S3TA 3TRFA 4BNDB 5C2JB 2QP4A 4RULA 4AZWA 2W2LA 1UKZA 3OQBA 4G26A 5D01A 3TDNA 1RADA 2R7VA 1FVXA 4F0JA 4RTMA 1Z6QA 4DIDA 1ZC4A 3TVYA 2FPMA 3UC5A 3FJYA 5DNYB 1XTTA 4EMSA 4LVNA 5EP1A 4WXMA 2WD8A 4N3BA 3LBNA 3L0YA 2A9PA 3V8PA 5EHHA 2RHRA 3PUYA 5E0OA 1QVRA 1ZWLA 1N6LA 2VBCA 3LOUA 2EBUA 1RJDA 2O07A 3LX5A 1FFEA 4LJ9A 5FQOA 4B2LA 5IKXA 3U17A 3IJ5A 3LS2A 3FIJA 5BSMA 3M5DA 1AUPA 5D8DA 1ZN8A 2QD4A 4OXKA 1LLUA 1QANA 4JKVA 2JZNA 1DG3A 2OHIA 2YJZA 3D6HA 1QYCA 2B4RO 4RKWA 3LS0A 2FWAA 3U4CA 4EQZA 4O2AA 1JFVA 4MPJA 1MMDA 4E22A 2F1IA 5GMOA 4PWZA 3ZI0A 4RF2A 4TUYF 5IXJA 1CP3A 1T9AA 1CDZA 5KOHB 1RXWA 1SM4A 2Z6QA 3VPXA 1IQUA 1FP4A 1RKXA 3CINA 2HHLA 4JNKA 3FUTA 3QYJA 4BFUA 3L1MA 4J49A 3F98A 1NW5A 1SO8A 3RVOA 3E9NA 3QJYA 4YXWD 2OQVA 4HSEA 5KX5A 3S28A 3FKSA 3A11A 5CVJA 5T8KC 3B29A 1CR2A 4DUYB 4J9VA 4A27A 2Y9MB 1JDVA 1FP6A 1FLDA 4E7SA 3H1BA 4DEXA 1JQJC 4LUCA 5MN6A 3IEUA 4JGGA 1EX7A 4R6WA 4EELA 4LC9A 5BSGA 2ZFUA 2C8VA 3F4BA 1V1RA 3EODA 5LWQA 4CE6A 3QU7A 1NW3A 2NVUB 4DDVA 3N2LA 3MCVA 4P84A 3C3AA 4JYCA 3CBGA 1NTRA 3OEEA 1WUKS 1E61A 4X1YA 4BQQA 4DYDA 2BZ1A 2DQSA 3DF7A 4HYTA 1KYWA 2L42A 4Q4LA 3JSAA 4WY8A 3LH5A 1SHTX 1XU4A 3UJ6A 2YLIA 1SVSA 1OT3A 2QVBA 1BFKA 2EEZA 4JP8A 4TROA 4S05A 3H4IA 3M6IA 4FC6A 4O59O 5K01A 5KOHA 3KYJB 1LVHA 4RMIA 3BXEA 3KZKA 4DVYP 1L7NA 3KOUA 2QVCA 2P2GA 3QIAA 4UBOA 2Q8PA 4BV8A 3FXHA 1U2TA 4D45A 4XWKA 1C3LA 5FLXA 2VPXA 3LTEA 1Z7YA 5CB6A 3C5EA 1KDZA 4P4NA 2RB4A 1ABBA 3RAEC 2J0WA 3BERA 3Q2KA 2A92A 1FVHA 2G28A 4TV8B 4XEHA 4UUOA 3VGPA 4QRIA 3GPBA 3KYDB 3E84A 4X62B 2ADMA 3H18A 2X42A 2Y2UA 4N65A 1DZIA 1Y7TA 3AR6A 3CZ5A 1P1FA 3ROXA 2X5KO 3TZBA 3WWPA 4ACBA 1T2VA 4NOKA 5IH7A 1LDGA 3AJDA 4ANJA 2BSXA 1QP7A 1SD5A 1GPWB 1IE3A 1H9CA 3FMSA 1T4BA 2G08A 1I7SB 5DXFA 3NT5A 1J39A 2ZWVA 4TMZA 1CUIA 3IVGA 2B5WA 2LWIA 1ORVA 3K5PA 1EBUA 1V26A 1OFHA 2QUJA 1AUQA 4NS1A 2P3SA 4MS2A 1XEAA 4XE5A 4KPUB 4MV6A 1MABA 1HFWA 3EDQA 4MWBA 1KP9A 1VYTA 2RDMA 1JTFA 1CP2A 2ORWA 5H3CA 3SN6A 4CT5A 2QW0X 4I3MA 3L4JA 3CNBA 3U1BA 1BR2A 1JHXA 4O5OA 1OCRC 2R47A 3OECA 3H4VA 4B6SA 4NR0A 1JYEA 2CFTA 5HBGA 1GZHB 3OIDA 1VYKA 4OBEA 3T4RA 3O26A 4QKQA 2GEDA 2FMUA 4Q16A 3K4HA 4P6IC 1NVGA 3OQPA 4UUPA 4KIFA 1BA3A 1ZL2A 2JASA 3OZ7A 2P9CA 4MUMA 3F97A 4FILA 1Q0QA 4KREA 3K9WA 1EX1A 2JI7A 1YB5A 4JXZA 3K1AB 3I2HA 2DTEA 4FHFA 3C6YA 4M7OA 4U3JA 3TIGA 3T9EA 3ZZ0A 4DREA 3N6XA 3IUNA 4E07A 4KLNA 4H6WA 4S24A 4AKTA 5K0FA 1Q0DA 2V6IA 5ES3A 2V7EA 2X2OA 3FSGA 3NYIA 4JI6B 3ZN2A 3DLHA 1PG0A 1NHGA 3KAPA 3B6MA 3NHJA 1W25A 3X2QC 2NLOA 4X97A 4DYVA 4EI2A 1RTKA 3SZ3A 4MVQA 3ITKA 1V8PA 4HDMB 4RPKA 4QT0A 4BFLA 1QDLB 3MW8A 4KWEA 3RFUA 3OCYA 1EFCA 3PR3A 4C22A 4D43A 4F2DA 3BSSA 3K71B 1B73A 2I7XA 3I09A 5JI2E 1E20A 1WW8A 2AWCA 1JXAA 1YJQA 1YO6A 2VDKB 2CV1A 2YJ5A 2ZYHA 1N5RA 3MLBA 3G8AA 2WPNA 1AN0A 2H1CA 2IHBA 1L7PA 2XRYA 3SJZA 1P9NA 2X22A 2ZRKA 3DTVD 2XXAB 4B82A 4RIIA 1E99A 3UB3A 3L4EA 3VSCA 5DYWA 1GSIA 7ABPA 1HWYA 5IK2A 1YULA 2QT1A 2WHXA 1YVIA 5FI3A 3WKCA 2Q1WA 3HCAA 5AP9A 4YCSA 4MVJG 2WNSA 2F1OA 1XPJA 2LKDA 3TZKA 1TKBA 4F3YA 1WVMA 4P4UA 2FEMA 1T9BA 1TCUA 1ZKDA 3P94A 1EXWA 3TQTA 1P2TA 3UAYA 1UPUA 3FPKA 2AYYA 2ZD9A 2Q07A 1YK1A 3MLEA 1OYYA 3FDFA 1Q1AA 3P2EA 1LQUA 1TWGA 3A3KA 2M1XA 3RU9A 1TMGE 2CW5A 5AHWA 3B6ZA 3R0IA 2VQFB 1IOWA 4RBNA 2FKAA 1X2BA 2QGFA 1EEXB 3BMNA 1EX9A 3DZCA 3KQQA 4NTZA 4K88A 4U2CA 1O0BA 5AW4A 2HDHA 4YRBA 5HUJA 1YNOA 2P0AA 4RZHA 2ZUFA 3FG9A 3OMWA 3KQVA 2HSBA 1GJRA 1GTMA 2IM8A 1L5QA 1ORJA 4P86A 4W9NC 3QXGA 3ZGZA 1TTQB 1M1NA 2FMKA 4XASA 2GUWA 2QX7A 3PHLA 4GVPA 5FI5A 3W3AA 5IPFA 2C3YA 2P7HA 4DVZA 3H19A 4GPEA 4XM1A 1CRWG 1LZLA 3BKXA 2QM3A 3EUEA 4GX5A 1DEAA 1XTQA 1FNNA 3N3AC 4IEIA 4N0MA 2G8LA 4HOYA 3OESA 4FOLA 3OQMA 4EX6A 1KFJB 4C87A 2C00A 2BR5A 4Q3AA 4HNHA 3AM1A 3KT8A 1KJ9A 4AJLA 2MSWA 1D2RA 3H2YA 4KI2A 4DLKA 2J85A 3O55A 2NYUA 1KFEB 3GHHA 5JHHB 3IILA 4WABA 3R2JA 2GHQA 4P93A 4R83A 1KGDA 2H5JA 3E27A 3BBPA 2FW6A 3QVGA 4O1HA 2EATA 4EB8A 5AW2A 2H8AA 1XCGB 4CW7A 4R3UC 3VC7A 1A5ZA 4IXDA 4EHLA 3NM5A 4ZKEA 2UUIA 3AEUB 1C2YA 1FX1A 3M5WA 2VP6A 4II2A 4DA4A 2QYOA 3TINA 4BMYA 1FU4A 1KEEB 5CCEA 4I5DA 3QNWA 1T4DA 4RD4A 4OGKA 1N5OX 3AEZA 4LXUA 1QRDA 1RYFA 3OPYA 3UBTA 3FBWA 4QLOA 3IAXA 4O4IF 2HSWA 3URKA 1RJ9B 2GK4A 4LHZA 2GAJA 5A06A 2R1VB 4DN6A 1P4JA 1U65A 4PNHA 2X7XA 5JWHA 5P8WA 1W2WB 1PUIA 3G4ZA 3I0NA 2J3MA 1SOMA 2SCUA 1H2ZA 1X7YB 3RSHA 1E32A 1N8TA 1OREA 1T5IA 3CUYA 2C07A 3KWFA 1A0OA 1R5ID 1BX3A 3BVPA 4FDTA 2IHVA 4DY4A 4YV1A 2VVTA 2A7XA 4FU0A 1C8LA 3EH2A 2NZUG 5AOBA 3CQ9A 4IJ5A 1EI9A 1H4SA 3ELWA 5IBRA 3KELA 1LBHA 1TUGA 2EKLA 4MIYA 4E51A 1ZMBA 2A86A 2C2KA 2RH8A 5AOVA 2VCCA 4NTAA 2X86A 4YECA 5CVDA 2WP8J 3Q9SA 4PPQA 1X8JA 1GU0A 2PX5A 1SUFA 1PHRA 1E0DA 2QTBA 5LZ7A 4D0SA 2WJAA 3EF1A 3MJSA 4IKOA 1I4OA 1OXSC 3WADA 1JIIA 2Z0MA 3I9KA 2XUJA 5JISA 4L6RA 1MW9X 2R2GA 3D2AA 1MB0A 3DMNA 3DZJA 4W1QA 1PWXA 4R54A 2R8ZA 5IVHA 4YAJA 3AIOA 3SSOA 1U81A 4XB1A 5B1IA 5CDUA 1D0IA 1ZGBA 1HPLA 5J1SB 2C7QA 2I4OA 1QX4A 2CVQA 1Y3HA 2J5BA 4J0CA 2FWIA 4IDFA 3SFTA 1P5FA 2PLNA 2C0PA 2V8BA 5DW3A 1SHKA 4UHHA 2OQRA 4KR7A 3BJIC 5B2ZA 4JQOA 3TEMA 1MRZA 2VZ9A 4QJIA 5EA2A 2H11A 3KJIA 1NBMD 2PUJA 1GT6A 2QTNA 3B36A 4ZK6A 5K8JB 5CYPA 1FZTA 2A5FA 2UUPA 2OFOA 4Y2SA 1E9BA 1F8GA 1HM5A 3PKIA 3EBOA 4R1SA 5GPBA 5BVGB 3DHWC 3BL6A 4HGZA 1BX0A 1T4GA 2DKFA 2QTFA 4RF3A 3U9TA 1IM5A 3RROA 2Y0BA 4X71A 5JNLA 2J3EA 4ZRMA 3USES 1VIMA 2ZJBA 2XLHA 1ZHXA 1SC1A 2O20A 5MGNA 3DT6A 3ETCA 4PZPA 1O3UA 2O8VA 4B4UA 5F9FA 2GM9A 4DXDA 5B1EA 3AI3A 3H0CA 5HIJA 1YJ5A 1UJBA 1Y7IA 3QSGA 4LF5B 4UVIA 5F4ZA 4NC9A 4MNTA 2KW3C 5LB4A 4M0PA 1J90A