3ECSA

Crystal structure of human eif2b alpha
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
307
structure length
279
Chain Sequence
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor eIF-2B subunit alpha
publication title Crystal structure of the alpha subunit of human translation initiation factor 2B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 86
structure length 279
sequence length 307
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1070 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ecsA01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 3ecsA02
1W2WB 4ZEOA 4LDRA 3ECSA 2YVKA 3A9CA 5DBOA 2A0UA 3A11A 3VM6A 4LDQA 4ZEMA 1T5OA 1VB5A 1T9KA 2YRFA
chains in the Genus database with same CATH superfamily
4A8JB 3M4JA 1WOYA 1JHQA 4MUBA 4I9FA 3KOWA 2F1RA 1TVMA 1IIRA 2LCHA 1JR4A 2YHBA 4B9EA 3RSZA 1WX1A 2IW1A 2IZZA 4UAUA 4A4AA 1OX5A 2YHIA 1G59A 2V3CC 3DOEA 1HSZA 2XXAB 5EGYA 5FFMA 1LE4A 2HW8A 4CUZA 4F5EA 4NU8X 5CT4A 3L8CA 3SE7A 1B6GA 2GKSA 4DBVO 4CFSA 1DEHA 2XTZA 3RRZA 3SJZA 4DLPA 3VSDA 5KWJA 2Q9BA 1CY8A 1E1RD 3H2KA 1FTYA 1CLUA 3MBIA 3LD9A 3EEFA 1ISFA 2JBAA 1G60A 1L5LA 2YWJA 1PT7A 5FUYA 4ZVRA 2WHQA 3MINB 2J3IA 3LP5A 4BPRA 4HGZA 3I32A 2YYAA 4G63A 4G4IA 3RD5A 1SUCA 2V97A 3IIEA 4N47A 5JSZA 1XRJA 3PX7A 3LSYA 3DDZX 1RPZA 3LA6A 2QG6A 2X0DA 4C20A 3BILA 1UPAA 1I7PA 3T3DA 5D3MA 1TF5A 4HK4A 3HVJA 3LVBA 2Z4RA 3HCBA 4Q9HA 2H85A 3FW1A 1L7PA 2IA5A 2BMFA 2J4FA 5EE9A 2HCRA 2XA1A 5KQSA 2PBEA 4ER9A 3HUDA 4ZC1A 4Z6KA 3CF4G 2XWSA 3MJDA 1SA0B 2WVNA 3FUXA 2WSMA 4CS9A 1GIAA 3TFQA 2CMDA 5MHTA 3VR5A 2ONCA 3SMQA 4UPDA 2HLPA 1JQEA 1CETA 1JFFB 3EDOA 3DTNA 2J9RA 4O29A 4QDZA 3DO5A 4MI6A 3DTYA 1VI6A 4CIWA 3MMSA 4I9UA 2REQB 1R0XA 4FS3A 1F38A 3A26A 5FT9A 3G85A 3FOOA 4S0XA 3GGCA 3NALA 1D9XA 1KEKA 3L9XA 2HJWA 4PGMA 4BU1A 3PFBA 2R6JA 2ZJBA 4LHWA 1G8MA 1LV7A 2QTWB 3ZBPA 1QZ3A 4OQDA 1UAAA 4FDAA 1ZOIA 1JHDA 4KQHA 2P61A 3P96A 1JKIA 1VP9A 4WXRA 3EXHA 1GZSA 5HIAA 1SZPA 1XBTA 4HNHA 3PWTA 5HF8A 5BV2P 4LF8B 4YP9A 4HQ6A 3OQ1A 3LX8A 3H2HA 3A1DA 2JFZA 2H1FA 4NF2A 1GADO 3ESXA 2B0JA 4BV3A 4GGPA 4BWFB 4MRAA 3DLCA 1YJXA 1Z6ZA 2VDWB 2BEVB 5A6BA 4UUOA 4Z9AA 3RTGA 3SPXA 3UM9A 1R9GA 4QA9A 2GF9A 2W0SA 1L2TA 1TZCA 4P4SB 2QN3A 3HFSA 1FL9A 1V8OA 1KVTA 3PPVA 4GWKA 2CLMB 3V6LA 2I67A 1QV7A 3ZZTA 2IBTA 1B7GO 4YMWA 4F6CA 5T67A 1NLZA 2C2HA 2OK7A 1T0PA 1PBNA 3T5TA 5BY2A 1ONOA 2PKWA 1A2QA 1SQGA 1RZ3A 2WKWA 1RQXA 4P4UA 1EE9A 1Z8NA 1GSOA 3CV3A 3LG2A 2GM3A 4O5OA 1N0HA 1NDHA 3U60B 5CIWA 2DPMA 4PSCA 4TT3A 2YWEA 5KDLA 3UMVA 3HQ4O 3EODA 4PG4A 4LNAA 2Q4RA 2EZUA 1JEOA 4BX8A 1MEOA 1MJGM 4R7TA 3TEJA 2JHCA 3MOIA 4G8JA 1WCIA 1COWD 5E9WA 2BC5A 2W2OA 1VHJA 2II6A 3RSLA 4C4PA 4BQPA 1V3QE 1C3OA 4AVYA 5IH3A 3ZWIA 2G17A 3LHSA 5H82A 2AJBA 3GMDA 4UJ3A 3S0XA 4BVHA 4M9UA 1FPMA 1G8AA 3PQCA 4AX8A 3EY9A 1IN7A 3SKYA 2FKAA 4WINA 3PNSA 1UPFA 4RNCA 1XRNA 5C8ZA 2ZSFA 1D4ZA 1ZD1A 2R7TA 1J2EA 3TEFA 5DM70 2FWBA 4FJ1A 1GNQA 1TI7A 1E77A 4ITRC 2YN0A 4XEKA 2EZTA 4UKDA 4EKDA 3ETLA 3UWKA 3ANTA 3RASA 2AUNA 3C3EA 5CGQB 3ZVRA 2FUG1 3IMEA 5FHQA 3ZXUB 1I2DA 1QRSA 1VYTA 1Q91A 1E1YA 2HCTA 5F5XA 1H1DA 4MUGA 1I2ZA 3B2NA 4R2XA 1X15A 5L7YA 3OBIA 1TR2A 5EJEA 4MTFA 4KQ2A 2ET6A 2HAEA 1GN9A 1JYEA 3E9EA 5AK0A 2NVOA 3DKAA 3ZNQA 2AG6A 1U90A 3NJ4A 2BAGA 2D0OB 1JJAA 3WLSA 3MTDA 3X0DA 5K99A 1V71A 5BSFA 3LC7O 3CF2A 3PQ3A 4FHCA 1ENYA 1PQ4A 1GTL1 2HMQA 2O52A 9LDTA 4DTCA 1VHWA 2GPSA 2EW8A 4P4TA 2LUOA 4K9PA 2OO3A 4LK3A 2WTUA 1JHMA 1EESA 4JEBA 3GVIA 4URVR 2ZWIA 1PJBA 2Q3JA 3OICA 3V4OA 1WTAA 2WABA 5ER9A 3UMHA 1S1CA 4HNUA 3GC6A 4WDQA 1MJGA 3Q2IA 2X0JA 1MMNA 1EJ0A 2ZYTX 2YOHA 4IINA 3SC6A 4I5IA 4BECA 4RS3A 2CBXA 4TTVA 5LQRA 5AH0A 2YR0A 1UADA 1AM4D 3H17A 3NYMA 2GN4A 3JWIA 4PGFA 2WJVA 1ECCA 2XB6A 3CINA 2YYYA 4E6PA 1DKUA 5HJ7A 4RZQA 5AJUA 1DKLA 2AXEA 4L07A 1Y48E 4IHAA 1XAHA 4J43A 4P9NA 5D7NA 3O95A 3BBLA 3FCXA 5FLXA 1W4RA 4D9JA 2QQ5A 4RL4A 3C5CA 1MC8A 4G25A 2XUPA 4DLNA 1XA3A 3KAPA 2XCSB 1XU7A 3L4JA 2FPPB 1V47A 4OBBA 2JAHA 4YAFA 4P1ZA 4J6EA 2FB9A 3AO0B 5FOQA 2YZSA 2WYWA 4JROA 4CG1A 1ADBA 2MSLA 3EZ7A 2QRNA 1R9NA 4NCHA 4FDUA 4D4GA 1J9GA 1IZ9A 1E2HA 1YGYA 1N5LA 2CVHA 3F4KA 3DBRB 1XF9A 3BFXA 1N1GA 1L7OA 1P9RA 2GKOA 1NR1A 1MOSA 1Z5VA 1NBAA 4ZU1X 1P2FA 1PTKA 1SUPA 2VDJA 2RARA 1KAEA 5AJXA 3OPMA 2FHSA 1RNLA 2GO7A 2Z15A 1A50B 1P0FA 4K6HA 2PPVA 4CKEB 2I1LA 4MQUA 4WBSA 2MYPA 3LXMA 4AWAA 3T34A 1YD7A 3FVVA 3BWDD 3SSAA 1QH9A 2HYDA 3R6TA 1N3LA 4X62B 2K7FA 5EXXA 5FTLA 2LW7A 5C1BA 3BHNA 2IXAA 2J1LA 4UM9B 4ZZ3A 4JP5A 2B1JA 2ODEA 1IW7F 3UMMA 1A98A 1SUSA 3VHXB 2PTHA 3WIOA 5JYDA 5CU7A 3AWIA 1JX6A 4OA5A 4YT5A 3R5SA 2PV0A 5EMLA 3OF2A 1T6ZA 1NW9B 4TV9B 1RQ7A 5E9QA 3AYZB 5A71A 2WSBA 3CRZA 3RIHA 3UMCA 3I53A 1D0ZA 1CDEA 3E9YA 2NZWA 2YTZA 1YFJA 4EPYA 1YZKA 4YWHA 5E7QA 4IIJA 3WO0A 4EB3A 4ES6A 521PA 2XUOA 1RRGA 2PZFA 2C58A 2QRQA 1OFHA 1VC2A 4N8EA 1YFKA 2DWQA 2VPZA 2ZIFA 4UMVA 2YRXA 3IEKA 5U4QA 3HXPA 3PFFA 3QPWA 5J47A 5EJ5A 2HEGA 4WADA 3C8GD 3TXAA 2VOEA 4WEQA 3AGTA 2LP4A 1L7DA 5KUTA 4KGXA 4LI0A 3FNFA 4QXOA 4M38A 1KJJA 1WETA 4WY2A 1DELA 3EUEA 1GPUA 1HW2A 2Z5FA 3INRA 4V0ME 4DANA 1RVV1 1NXVA 1I5OA 2A68F 1BFKA 4CR6A 2QM7A 2ZRKA 2IRWA 1I51A 3I0MA 4BB6A 3K1JA 4QT0A 5DHRA 1USIA 2NU6A 1T26A 1X86B 4LXYA 1IAQA 3TG8A 1W48A 3AHGA 4PC2A 2HSWA 1NPYA 3DWFA 1P6UA 4QI2A 3DFKA 4HTAA 4Y2TA 2X1HA 3BWBA 4ZKEA 2NMVA 3HJGA 1QVAA 5BV7A 1O6CA 4AO8A 4GRIA 2DQYA 2PFKA 5LZ7A 4G4JA 1DUSA 5HEKA 2XYRA 3OJLA 4G4SP 1W5EA 4HWTA 2I4LA 1N6NA 2WFLB 3W5BA 1EVLA 3FI9A 3K5WA 3GM1A 3O9VA 3MUFA 5CFOA 5C4IA 3LYAA 5CIVA 4KRXA 3UAOA 3FVQA 3OCYA 2G28A 2GXAA 2YY7A 1QK5A 2YNMC 2J9XB 1K8ZB 2EPKX 2AZ4A 2AMJA 1IWOA 3FCSB 4HDOB 5T64A 1F48A 3IXQA 4BAUA 4MVJF 3CVJA 4IVQA 1TK2A 4ZHQB 2NM0A 1W35A 1L5VA 2UVDA 2KQ9A 3GAFA 3WLMA 1M34E 3D3EA 1Z7Qc 4Q3LA 5EGSA 3CONA 5E6RA 4IS3A 4O2BA 1TIKA 3MBGA 1FYWA 3C6XA 1U80A 1OYYA 1B8PA 1TPYA 1QHYA 1RWXA 3O82A 4GR5A 2TMKA 2GZAA 4R6WA 1HE3A 5ITVA 4YRPA 4EHKA 5ELXA 3FLBA 5JZ9A 1Z68A 1YRWA 1QRRA 4H2DA 2EKLA 3UPTA 1VXRA 4LCEA 4BTVA 5B1AC 2QZ9A 1ZI6A 2H1RA 4KSCA 2XA9A 2H7XA 2RG1A 4KN8A 3U7QB 1J0AA 4A6XA 2H4WA 3H05A 3V4SA 3M4NA 4FKMA 4YYEA 3DUFA 4RELA 1L4YA 3U4GA 5JROA 3A4LA 3P20A 5EZ6B 4GX2A 2HSQA 4B6IA 1QFJA 2RHJA 2ZSBA 2JRLA 3B1WA 3IULA 2A9RA 2DHDA 4KO1S 4W5NA 3DOHA 3T6GB 2XS1A 4V1CB 3DE4X 4WLUA 4EZEA 4RTLA 5BSWA 1UMCB 1V11B 3HTXA 1SKUA 2WF7A 4BVEA 2P35A 2AK3A 1Y6DA 1MPTA 5K45A 4UBOA 2W8ZA 3SZUA 4BNTA 1XJWA 4I55B 3BCRA 3OEED 3GBPA 5JARA 5E1MA 1GHTA 1ZD4A 1A5ZA 3G9QA 3HGMA 4NTFA 4PS1A 4EUKA 3DEZA 4LG1A 1WB9A 4HGYA 1LS1A 3NJ8A 2HWUA 1T9AA 4XR9A 4JI8B 4N0EA 1P1FA 5T3WA 1W7AA 1V6AA 3NYLA 4HAYA 2BR4A 2ID9A 3T7SA 2CL5A 3TFOA 3OCZA 3M2TA 3NYRA 1SBYA 2PCLA 1MIOB 3IALA 2JFHA 1AQYA 5TXGA 3D2BA 4ZU3A 2AI3A 3GBVA 2XT0A 3RYHA 3ITEA 4DEYA 1Z45A 1Y5MA 1PGPA 1G8HA 3G02A 3OM8A 2J9WA 1XT6A 3C63A 3AVWA 3VNUA 2EWMA 1SEPA 4OM8A 2X2OA 2QLAA 3TH5A 4DV7B 1V35A 4EG7A 1NT4A 5ALTA 4BLSA 1ZGJA 5HUJA 2PE5A 4CL0A 4E17A 4NBKA 4DXHA 2GLTA 3C4QA 2P9ZA 4MI9A 3VMMA 4CEJA 4QG7A 4JT8A 5FNZA 2SECE 4IMIB 2IEAA 3T9AA 1OQCA 2IT1A 4NTZA 3WFJA 1SKYB 1DFIA 3ZHRA 4D0LB 2C4KA 2VZ0A 1XZJA 4M86A 5ALUA 5D91A 5B6JA 1LBHA 2GESA 3AXTA 2EJUA 1OI2A 3VTAA 3D8RA 1JNYA 1RD4A 2QZZA 1BHQ1 1P91A 1Q0SA 3RUAA 5COFA 5EHHA 4KUHA 2ZCJA 2NSJA 4EB0A 3ANLA 3BULA 3HB1A 4F7WA 3K9LA 4LJ5A 1H69A 1LPBB 8OHMA 2ZPUA 2YWBA 1TJNA 4MW5A 3QKRA 3EXIB 3BMNA 3ADPA 5K3DA 1YE5A 1ELOA 4LJ7A 2IHUA 4GMHA 2YL3A 3NAQA 4N5IX 2E7ZA 4TRJA 2TMGA 4UEKA 1UJ4A 1C41A 4JELA 1E7RA 3X1YA 2Q4BA 5B1EA 1ZD8A 1TEHA 1T6NA 5HYVA 3Q2OA 4BASA 4DV6B 5JMOA 4AZ0A 1UBOS 4D9IA 3IUYA 3BT7A 2JA2A 2PMDA 3KSMA 1G20E 3FD8A 1HNXB 4Y9TA 4MW7A 2FSFA 3DLHA 4KPFC 1L5YA 5A6SB 2X77A 5TSDA 1MC4A 1M6VA 3W9SA 4PHGA 2EF0A 3L9WA 3FFWA 2JGEA 1E4EA 1QLJA 3QUCA 3VR2A 1NX6A 3LUBA 1T3SA 3KB6A 2H2GA 3D0OA 3GAZA 1AKTA 3BWVA 1SWVA 4X92A 2GEKA 5B4VA 4EQ6A 5FA8A 2RMKA 5E3AA 1VE9A 4O6VA 1QHXA 1W5TA 5LZ2A 1BS9A 4HGQA 2QWXA 2R7SA 2R1TA 1D5CA 1UZMA 1PGQA 1P3Y1 2WSYB 4LWPA 3HDTA 2WRZA 3GLFB 3TD7A 5AOCA 1JA1A 1QONA 3OY7A 2VJKA 3DMTC 5DNYB 1KEWA 4YGXB 4UUNA 5I51A 3D1LA 3RKUA 1WSWA 3HB5X 5J5AA 3FTPA 1A9PA 3TEMA 4FMBB 5IVDA 5K1ZA 4NJMA 5D6OA 3L40A 1AUVA 1E3LA 2CLOB 2MCFA 1JEYA 1VL0A 5IRCD 4QU8A 4XIYA 1VSQA 2R6R1 1W59A 3M4CA 2RBKA 1WUJS 1N8TA 2PMFA 3QPDA 4XX1A 4FXPA 1VM6A 3K9BA 4NAVA 1BXZA 4QPPA 4BZWA 2UXDB 4Z1MA 3T38A 4W9NA 2J08A 5IEBA 5CCXA 3T3MB 1FSPA 2IXGA 2ZZMA 2X7JA 1GL9B 3IVCA 4C2UA 3ZCPA 4RK0A 2IDKA 4LISA 3FPLA 3ZVLA 3NWBA 2AN3A 3W1WA 4EY4A 5HMMA 3B85A 4EB8A 5H5JA 5KKAA 4OUDA 3DHYA 5HFAA 4QECA 3ELUA 1H2HA 4LJ4A 3ZE9A 2YMQA 1ZGHA 3C8ZA 4IKPA 4K1OA 4TLMB 5BVHA 3UN1A 2SCUB 4OB7A 3EUAA 4ZT6A 4GPAA 2FDXA 3CKLA 2KYHA 1N5DA 4JC4A 4IX1A 3QWIA 1Y1LA 2JLCA 4QQKA 3G0HA 5HK9A 3VR4A 5HZGA 5HOEA 1QLHA 5JHGB 2XB2A 3TNFA 3HXOA 2PZMA 3Q98A 4B40A 2UXBB 2I8CA 1FDUA 4H3HB 1HRDA 1D3AA 2ZDGA 1Y3BE 5A3QA 1ZSYA 3H0EA 2PXHA 5C3UA 3P9QA 3LVQE 3M6MD 2BSAA 5LLDA 3OSUA 3TUJC 3ITDA 3E53A 1IXKA 2BRUA 1E3MA 2VPTA 3WY9A 4DV0B 2I22A 3S40A 2IUFA 3A1WA 2PZJA 2E55A 2WHXA 5IJ9B 3VR0A 8LDHA 3G0DA 2F4NA 6LDHA 1Q0MA 4W1SA 2C03A 5EI5A 2X5NA 4GLBA 3TQIA 1GGJA 4DM3A 4IJUA 4OHYA 6CHYA 2HKVA 4M0MA 1WSAA 2IYAA 4ID3A 4HX9A 3WK4A 1HO3A 2QU7A 1IXYA 4WLOA 5HX7A 3KT3A 4RA6B 4GX0A 2B4KA 4ZOLF 2ZRHA 1D0YA 1P8JA 1FS5A 1WCWA 2IC5A 5JQWA 3AOGA 1PF7E 1CUWA 5J5VA 5AHWA 1JDNA 3CXRA 2Q3LA 4EVIA 1SVMA 2GJ8A 2DG2A 1M2OA 2CDQA 1PR6A 2BKLA 3B36A 3HPQA 4U5CE 3UENA 3AX6A 2G40A 4Z0NA 2RH9B 4C0BA 1Y8AA 1WULS 4M1OA 3TZKA 1VL6A 4LCJA 1XA0A 3JWGA 5DCYA 2K87A 1MDBA 3FVWA 4RMHA 1PV2A 4YCBA 3T3GA 1ZM9A 4YN0B 4PZLA 3PNQA 2N1BA 5D6NA 1CW2B 2VDVE 2GF2A 4XGIA 4KI7A 1LM3B 1CJSA 1UDBA 1I2AA 2FPGB 3TSCA 4TL8A 2O1SA 4TVBA 1QV6A 4OAQA 5E6SB 2C7VA 1J49A 1B8UA 3ZK7A 4HUJA 2DGJA 3PRHA 1D8AA 3SJUA 5EERA 2CD7A 3EZ9A 4MAMA 1DADA 2WD8A 3QEMB 1XVIA 4N54A 4YRZA 2CFCA 4IZHA 1HMPA 4C4OA 1Y1RA 3D81A 3IAM1 1UQUA 1R6UA 4Q9JA 1ZX1A 3A06A 3HYLA 4JJFA 2YZ2A 4ISCA 4RENA 3LTNC 2IF0A 4KXNA 1XCMA 2C2BA 4XSGA 2PQ0A 1JLKA 4CM7A 1WJGA 3PBKA 1ZUNB 3UHPA 1X8KA 3VAAA 5JO0A 4UVIA 1XQ9A 2WUEA 1S2OA 2L19A 4QD3A 4YI3A 3A6KA 4BV2A 1H8EA 1YJAA 3P2IA 3HLTA 3REQA 4XCXA 1EWYA 3GFRA 1GAJA 2W48A 3IVGA 3HUEA 4E14A 2B99A 3ROQA 1Y63A 4UAJA 1VMKA 3W5SA 3TK1A 1QP8A 1OW6A 1NULA 3T3IA 1JKFA 3B6EA 1UJMA 2IV2X 4NU6A 1T5DX 2P1AA 1YOVA 1ULHA 2XWBF 1VJRA 3AB7A 5DCUA 3DT9A 4YFVA 1DTEA 2JVKA 5JFOA 3I52A 4KQWA 1DUVG 1XZFA 3TIVA 4IWNA 2CV0A 2QKYA 4INPA 1JILA 4Y9RA 3RYTC 2R44A 3CCBA 1U28C 3V3TA 1J2UA 1ABEA 3DLTA 5K3SA 4LXIA 5GVRA 1VXOA 5AKIA 2W9YA 4R01A 2R60A 3PI7A 1IFXA 1G3RA 1CPYA 2QQFA 3D7KA 1E6KA 2GCIA 5KYYA 1KP9A 2RSLA 1VRCA 2IPXA 2C7QA 1ZOLA 3A6HA 3DFIA 5AI5A 4DCTA 2PAFA 1KAHA 4KPUB 1A76A 2D1TA 3WB0A 1H0HA 1RPNA 2OKUA 4HVLA 1TLLA 4XX0B 5F5HA 3X1XA 2IZ1A 4GX5A 3LK6A 5LU9A 3FMGA 2ZJ7A 3FBTA 4S2UA 4KVFA 5C8XA 2P62A 3GGOA 4KDRA 3HO8A 3UK6A 1ZNYA 2L0XA 3H5RA 1X7YA 3GLIB 4KH0A 1W2HA 1U94A 3PEUA 4P2BA 3W2VA 1CNMA 4PFSA 2R7AA 2O57A 1HEYA 2HK9A 3PPXA 4DZZA 1WOMA 3CR7A 2X51A 4DRZA 2XS8A 2GBGA 2WSIA 3RK0A 1DBQA 2RI1A 2RHCA 1X3LA 4B2PA 3FDFA 2HBQA 3QVOA 4TMFA 5TQ2A 5L3SB 4K9OA 4F46A 4YCAA 3CTMA 3A0UA 1SXQA 3VAYA 5KTPA 2EL7A 3FHOA 1LKXA 4R2WA 3AGUA 5E4TA 2UUAB 5HUHA 1UMBB 5D7BA 1A4XA 3GLHA 4DCOA 2XLEA 3NC4A 2G0NA 1WU8A 2VCCA 3IHKA 3RFUA 4V1CI 1JR3A 2Y1EA 3BE6A 2P9HA 4K5QA 5CG1A 3ZX4A 1AY0A 1VZ2A 4J0EA 2NV6A 1G64A 5JNSA 5L51A 4L9RA 3ESDA 2QBYA 2BL4A 4MV5A 1PFQA 4JL5A 4KITB 4BNDA 4OQMA 1KO4A 3NHZA 2C5GA 3JY6A 4NDNE 2QIOA 1Y1TA 3DD1A 1O3YA 2CB0A 4E03A 1NFQA 3QMMA 3U7RA 3ICWA 2PNOA 3H2IA 1JDBC 5E8JA 2V6IA 1DXYA 5TJ5E 1NLUA 1KK1A 3KEMA 3H1BA 3F4BA 2P4HX 1GLNA 1ISGA 2WPDA 4QUKA 2CZGA 3ZQ6A 1RAHA 3HB7A 1TWCA 1H6DA 5CA1A 2C59A 1U7HA 1N0UA 3B7PA 3FROA 4EIWA 2O1WA 5K3OA 2VCAA 4ND2A 3F6PA 1OCCC 3RIMA 1HDRA 3T7DA 4JYBA 2VQSA 3KJZA 3L4BA 4FFLA 5C5CA 1E1QD 3BDVA 4A1OA 2DT8A 4XYMA 3N0TA 4R1QA 2BH9A 1E18A 4EG1A 5LL6P 1F3LA 1Z0JA 3B9PA 4KAXA 1R4AA 1M1YE 1Y1PA 2IH4A 1KDVA 3N53A 1OLXA 1KSGA 3ACDA 4DF3A 1IY9A 3SYRA 2XXBA 2P2NA 2IYUA 2ZS8A 4F85A 2CUNA 1BEEA 3THOA 3KMIA 3GWNA 3GEBA 5L9AA 1Q1EA 3QW2A 2A0UA 1FNBA 3IQIX 1F12A 4AZWA 3H9GA 2QRPA 4AZSA 4J0CA 2I8AA 1OZHA 3ABLC 2D1QA 1U2GC 2OENG 5JNTA 2ZREA 4Y6GB 4R2HA 4YJGA 1NXSA 3F71A 3EMDA 5FORA 4LDJA 1YGPA 4MW9A 3K0FB 2CVFA 1IY2A 4F6RA 2WB7A 5JAMA 5CCBA 1XNQB 2OV1A 4CM9A 1DPFA 1S89A 5AI4A 5FHRA 4TWBA 5F2EA 5HRAA 3C6ZA 1NBBA 3FHDA 2WF9A 3RCBA 4YUVA 1MT0A 3OFSA 5LMNB 1RYHA 1B6TA 3SF0A 4V0LA 2YHUA 5IN5A 5CG2A 4KFUA 4GXTA 1K5DA 4W5HA 3SG0A 2B4TO 1A5BB 5GM2A 2HFIA 2O0KA 4REQB 3KU1A 4IZIA 1RWVA 4OOFA 2FWPA 3DWEX 1RAEA 4AO6A 5LU8A 2ZJZA 1SKMA 1Z8DA 5EJ4A 1AGXA 1KDZA 2BM0A 1IZ8A 3NYIA 1RAAA 1XYGA 4I81A 1LK0A 1NAIA 2H1IA 4JK3A 3OCXA 4EW3A 3PR3A 3EHMA 5THKA 1C30B 2H7CA 2JI8A 3QUSA 4ALNA 3SEAA 2WE8A 4D9BA 2E1RA 4DCJA 1M83A 1U3DA 2I3AA 3FPHA 2W7TA 1JUDA 4QATA 2HRDA 2QD5A 2GS9A 2CJFA 3TJZA 3OA1A 4UHBA 3UFBA 3SSNA 1B2RA 2R8OA 3BH7A 4H9GA 1PW7A 3PD1A 2DE0X 1Y3IA 2I2XB 4XVRA 1EFRD 1ZW2A 4NESA 4JJ4A 2PG3A 4DLKA 4FOLA 2I91A 4ENTA 2MSWA 1VJ0A 2FFRA 3H9UA 2F8TA 3L1MA 4P0QB 4MA5A 1T3ZA 1C7EA 3AHEA 4U7DA 1CYDA 4Q3NA 4HAXA 4GMKA 1J24A 3VVCA 5DGHA 1BGVA 1Q21A 3EXG2 2WW8A 1LTHR 4H7HA 1IBLB 2V6MA 2C96A 3H2GA 1BVHA 3SXKA 3BA1A 2VA9A 1VHQA 2NUTA 2ZRAA 4HWGA 2F1JA 4JC7A 2R8EA 4L22A 1DJNA 3SP1A 1K89A 2VHVA 3SZRA 1PYGA 2AXPA 2AYZA 4LXUA 2G3VA 3LMKA 1FDRA 1RYDA 3VI4B 3PGKA 3WDKA 5FD8A 1J0BA 5T8KC 3C2QA 1BX1A 4S1TA 1E63A 4NCQA 2ODQA 3TYXA 1DIHA 4IG4A 2TRSB 4G37A 5CFLA 1H5NA 4XVCA 4Q4AA 4XQCA 2PKEA 3HCWA 2BJWA 3VNRA 5A3SA 2Q9UA 2X0FA 2C7RA 2PF4E 1I1HA 5C8DA 3HADA 2LR0A 1IM2A 2ZTHA 1KJWA 3BGSA 1EDOA 1DRJA 1OU0A 3HN7A 4J4HA 5AVXA 1J1ZA 1KJQA 4FAPB 2QENA 3ZLUA 4HCJA 5A4MS 1TD9A 4ZAGA 3UAXA 2VJOA 5IU6A 1E3WA 2Q46A 4B34A 4H4KC 3GG2A 5IARA 4U5XA 1YF3A 3V2GA 2HI0A 3WAGA 2Z2XA 1E2IA 4HZUA 2K5UA 2C3PA 4NEQA 4FI3F 4CT4B 3DZJA 4HXFB 2PZLA 3K30A 5DVWA 4MDFA 4TRNA 3AG6A 1DC7A 2P8SA 5EJ6A 5SZJA 4RDIA 2W43A 1EUZA 3AJDA 4BNKA 5DNEA 2W2LA 1CVRA 1I6MA 3W2IA 4AP9A 3U1BA 1J4AA 4G8CA 1K2WA 4CM6A 4HDKA 3JPYA 1PJTA 2J6IA 1TMKA 1C9KA 2P2CA 5DHSA 4KX5A 5JH7B 2Z83A 3OUTA 1EAMA 5JZSA 4H3SA 2ZUFA 3SR3A 1X1DA 3TZEA 1A82A 1NVFA 3R0VA 4L4ZA 1X2EA 3MCVA 1W19A 1KMCA 2OFFA 5ALYA 3VKGA 5B6IA 1YI1A 5AI0A 1AJEA 1RJDA 2GRAA 4XD7A 3ZV5A 4AYTA 3RVQA 2CE2X 1PT8A 3GDHA 3PWZA 2I80A 4R3UC 3OT1B 5K09A 5KNDD 1X14A 3B38A 1LI5A 3GD7A 2FETA 4GG1A 3ACCA 4RV5A 2QMYA 1JAFA 4CMAA 2OILA 1BDMA 1U4OA 2ADOA 5FI0B 2NSFA 1V8BA 3I9V1 2A5GA 1RBQA 2HMSA 1KO7A 4NSNA 3OFNA 4L5BA 2R3SA 4BYMA 4DOZA 4Y2RA 1GU7A 5JRJA 1NBMD 3DQPA 3N7AA 4QYTA 1V26A 2JFOA 4KR6A 3QPUA 2CWDA 4E1BA 4N39A 4R54A 1R4TA 3AL0C 3ETJA 4J7UA 2J8WA 2OBYA 2H11A 3I8OA 1WHTB 1EUCA 3ZC3A 2A5LA 4NL4H 4OAPA 3TF5A 3A2NA 5IKOA 1QQBA 3ZH2A 3JU3A 4R1MA 2IZ7A 1RC0A 4N49A 1MNEA 4RIIA 4ZVKA 5IAJA 2ACVA 1WUTA 3JTLO 1T29A 2A30A 3B53X 3JQ7B 4Y2HA 2VJCA 4PX9A 3N0VA 1JG4A 3P2YA 3NKDA 4RA9B 1PFWA 2H2IA 2VTDA 5JWOA 4AJ2A 3LKDA 4JY7A 5JAIA 4MPJA 1ZN9A 3LCVB 5FF9A 1PNOA 2M98A 3RFYA 4TLAA 2EG5A 4YV2A 5DHTA 3OA2A 2XQFA 5HK8A 5FWYA 2EV9A 5A02A 3C14C 4IXTA 1AKYA 3AONB 3UCXA 4BJ5C 2HS5A 4BIIA 4B46A 5ICGA 3E22A 3GUVA 4XRGA 1DX6A 2QXTA 4JP8A 4UE6A 4EJSA 2BGGA 3J06A 4QQFA 1TO2E 1CQXA 3BJZA 1KSFX 3VM6A 1I7NA 3AT1A 3BD6A 3TQHA 3WGGA 2R1VB 3W5JA 3QWAA 1EEXB 4MB2A 3UT5B 4RXUA 2CFOA 4WCFC 4D99A 2VYNA 3S2ZA 3ZWDA 1F4VA 1KVUA 2X86A 4DLSA 2FW7A 4WX2B 1QFZA 2D59A 3ORQA 4DQVA 1EIZA 1L5HB 1Q0LA 3F7NA 2R7XA 4RESA 5KOHB 2BFOA 5ICSA 3RKSA 4FFOA 4IJKA 3CKYA 4IRXA 1PZGA 2EBWA 4JJGA 1XEWY 3TE6A 3ZDXB 4F93B 4QJIA 3A70A 5TARA 5A1TA 3CLHA 5D3QA 1D0SA 4YMGA 1DG3A 3FXAA 3DXZA 3GJTA 1L8QA 3QMWA 4MWOA 1GUAA 5KS2A 3T5MA 3T4XA 3SEZA 3KLPX 2GQ0A 2QTBA 2HBZA 3QWHA 4RK1A 1KFJB 1Z0AA 3U48A 4KO2S 1DPGA 2FG6C 1VLVA 2Z6QA 5KJCA 3WGOA 2J3DA 1Q3TA 5CW1A 2PUFA 4TVOA 1G8PA 1VBNA 3K09A 1P1IA 3C5HA 5J23A 4LOAA 2JLAA 3PJDA 3PEFA 3NWEA 4KXVA 5CHYA 5E7MA 2HBYA 4KP7A 3A7DA 2I0FA 2PRKA 2OWEA 2DWOA 4FUTA 4BGIA 4TTRA 1U31A 4PM4A 3E15A 1O57A 1B23P 3C5VA 4QHSA 1FX1A 1KVRA 4D74A 2FJUA 4K46A 4AU1A 4G5XA 1WCYA 1WWKA 2GDCA 3S6JA 3GODA 3NJRA 1AMUA 1Y3HA 4KR7A 2GZHA 2YFKA 1JT9A 5I9NA 2QSJA 3HVIA 2XIJA 3RLFA 5C34B 1U98A 3CW2A 3MT7A 2QA5A 1YUBA 1NNLA 2PR7A 1P62B 4TKUB 3HDHA 3F6CA 3PFIA 4L5CA 4IAOA 3L8DA 2OD7A 4CSAA 2KM1A 1R4NB 3PHBE 4RGVA 3V2IA 4AS1A 2JGJA 3QG1A 4ADSG 2X5OA 2DM6A 4JKVA 4CQNA 1PWXA 1H93A 3S1SA 1ZQ1A 2XQKA 3UJNA 4C0XA 4DCVA 4MQEA 3LRXA 5ALHA 1PNQA 2JGNA 4YMLA 4DG5A 2C78A 3CLTD 4PCVA 3B0VC 1TTQB 3OC6A 5IMBA 1TTTA 3A6GA 1GITA 2AFHB 1Z82A 4QRHA 3W8NA 1IC6A 4MDHA 3I0NA 3ZWPA 4BAGA 5JFTA 3IC5A 2GPAA 5FBRB 4R1PA 1I24A 2VHWA 4OP2A 2ICWG 4IMPA 3EVCA 3R3XA 3AETB 1TVEA 1KU6A 3PI6A 3IEEA 1ZK1A 4OFBA 2C5FA 2XGGA 1LPOA 3HCEA 1X80A 221PA 1FNMA 1Q11A 1KH1A 2XOXA 4KQEA 4AURA 3CZPA 2I6QA 2KS6A 2N3ZA 1UBSB 4OBXA 2FCRA 4WFQA 4KK3A 3PHCA 4PZ0A 1JDUA 4F0JA 1G0OA 1M74A 1XQ1A 4PYRA 1Z22A 2REXB 4CS7A 3NLLA 2QLLA 2OQMA 1U3FA 1FY2A 5GJBA 3ZKWA 1Z6QA 3W5IA 3QVUA 3RT1A 1MNQA 1N4AA 4HB2A 2VJPA 3TR6A 1Z07A 4HBZA 4KJXA 5L3VA 2BZSA 5IBCA 1TOAA 3PPYA 3AHFA 4CM3A 1OBHA 2EIHA 3OZIA 3ZZNA 5BSEA 3WI7A 1WVGA 1WBBA 1OI4A 1EP2B 5TDHA 1L5WA 2BF7A 4MR9B 1L5KA 5C46F 4TQ9A 1IHXA 1RYFA 4EFLA 1BXRB 1SWWA 3LECA 4JEMA 2A1TS 5JBIA 1KRHA 3IR6A 1P1CA 6ABPA 2W6PA 1E3QA 2XSZD 3WNQA 4N48A 2Q3MA 2Q4EA 3USES 3RNOA 4NHEA 4KLNA 5BN4A 2QMHA 4KVGA 2WM3A 4DUZB 1I7LA 3U49A 3SHFA 2WC1A 2RONA 3R40A 4MS4B 3OJWA 4ZV4A 2KQUA 1DAHA 4CMGA 4WKOA 2QRZA 3O3CA 2GHQA 1XKLA 4HJRA 4O6NA 1SN7A 3KPJA 1K6EA 1G3UA 2NO5A 5CVCA 1SCNE 2C7BA 2YC2C 4YTEA 4DSTA 2VK8A 4F71A 4DR3B 1EZ1A 3HTKC 3RSOA 2PS1A 4TXMA 3QVZA 1KDOA 2BHSA 5TJ9A 4S1WA 4GHWA 2QTVB 4CMIB 2NTEA 2Y76A 3MWGA 4Q3DA 4ZZ2A 2O2XA 2NO1A 4FFWA 1KBQA 3CEXA 5EHIA 3R7SA 2ZP1A 1E66A 4J16C 4L4XA 4Y7DA 4HVCA 4QC2A 1YS9A 4TS3A 3AEUB 4QFMA 3IPAA 3SKVA 3F9RA 3HR4A 1L8OA 1BGWA 1P9NA 2NNWB 2I3ZA 2JFGA 4I1IA 1Y1SA 3R4CA 3ICEA 3N2KA 1OV4A 1IZZA 1CZNA 5T4EA 1W2WA 5BYKA 5KX5B 1UQTA 1AIPA 3U5TA 4IIEA 5LXTA 7MHTA 4BO8A 3IT3A 4LWQA 2BE5F 5EEGA 3HFGA 4P22A 4S04A 1XKTA 5DXFA 3L7MA 1ZNQO 1NJ5A 3MVEA 4YDSA 4ENRA 2H2FA 1YQXA 4RULA 3GWZA 3UGPA 3OJEA 1TM2A 2W5UA 4LECA 4YR7A 1DG1G 3DMDA 1IY8A 5CYGA 2Q6IA 2KGOA 4B81A 1I80A 5BN3A 3ELYA 1CUIA 3OE5A 1ARZA 2IHBA 4RW0A 4HAWA 3SNKA 2PYIA 2YRWA 3FMIA 4DM7A 2LBPA 3FUUA 3OO0A 3V97A 3KXIA 1FMCA 1JLSA 5CPFA 1I5EA 2EOAA 2W6NA 2OSBA 1GXSA 2LWIA 4NTBA 1H2XA 3GA0A 3AUKA 1SQ0A 1D2EA 2QU8A 4QBKA 3SZGA 4B4OA 3PEVA 3TD9A 2AUTA 3TQRA 4RMIA 2ZUTA 4LMRA 5F7OA 2B98A 4EJ6A 1X13A 1YZTA 1RWQA 3L6CA 3F97A 3F9IA 2WIGA 1Q0PA 5AXCA 3TRKA 4EABA 1CPRA 1DAPA 1E89A 3WYNA 1CHNA 2P2ZA 2ETVA 4KXYA 4BX2A 1Y8ZA 3DCIA 3UF0A 3MD9A 5LMUB 4P5EA 4M8SA 1J8YF 2IPMA 2A0YA 5JNUA 3ND7A 1C0IA 4LJSA 4Y2SA 4C0WA 4Q7JB 2YZMA 3C3BA 3HWRA 3AW9A 1GZ5A 3IILA 1FU4A 2VH2A 1A88A 3SFVA 2B2CA 3ZE0B 2BHTA 1OXKA 3UPUA 3BFPA 4I1MA 3SQWA 3GUHA 3IDQA 3QY0A 2ZYRA 4MUHA 3VMFA 3DHEA 2J3EA 1VA5A 4E13A 1QQ3A 1HI9A 2DZDA 3U81A 1Z0UA 1DAFA 1UWVA 1EFTA 4RZUA 1G21E 3PFHA 4CM8A 3RC2A 4IHJB 1ZJ6A 1PKXA 2B9VA 4UTRA 4IOJA 4GWLA 2CCJA 4G01B 3RKRA 3TBKA 5I8PA 3IPCA 1BO6A 3HCOA 3Q4GA 3GDOA 2Q2WA 1NUSA 2V59A 4DYHA 3RFCA 1QV9A 4XEHA 5BSUA 4ER6A 2AD1A 3HNJA 1V2GA 4ZWNA 1IUNA 4FZ5A 1YZFA 3BKWA 5AYVA 3ITFA 2ODTX 1E79A 1FNCA 3O47A 2QW8A 3LBFA 2J0QA 1XDZA 4UTNA 3TUZC 1AKRA 4ZQGA 3INNA 5EP2A 3BPSA 4U63A 2G4VA 4ZK2A 1YHZA 5JBQA 4P6VF 1E9BA 4LGCA 2X4LA 4NCJA 3KAQA 1FK8A 3CGGA 4D81A 1NBIA 3VBCA 1NOKA 1Q0UA 3P4XA 4EHHA 4KFCA 2B0CA 3FZNA 2XJ4A 3OIYA 3JX9A 2QRJA 3X44A 3H5VA 4DFDA 5IHXA 1VMDA 2EJWA 5EG5A 2X9VA 2P90A 2A5DA 4GXQA 4YWQA 4QTTB 1O8BA 4FHDA 3GRFA 3CWCA 5EMKA 1R1DA 3NZEA 4Q24A 1U1DA 3L0SA 3FI0A 1H1LB 1K04A 3UGKA 1QVVA 1FUKA 3IMCA 3L6RA 2YQ5A 4U9DA 3OQHA 2EPMX 2A9KA 2UYGA 1LJLA 1ZH6A 4PLCA 1KFKB 5I7EA 1VFNA 1CG6A 2GZ1A 1ZL0A 2I2CA 2YWRA 4IIYA 5FULA 3UH0A 2BEUA 1ZVKA 2G8NA 4BJ3A 1TT5B 3LPMA 4A9AA 4EK9A 2CNWD 4HDMA 3P26A 1R0KA 1DXHA 2ZK7A 3FF4A 1PFGA 4DL9A 4RY2A 2DTXA 4CN9A 5LIPA 4RHEA 3T3EA 2R65A 3QSYA 3NM4A 3GLGB 3DD5A 1UR5A 2EJTA 3OLZA 2V58A 5HQ3A 1TF7A 1UKBA 3KE8A 3RROA 4AQYB 1PJ8A 1VRWA 1KY4A 3QYJA 4OBWA 5B12A 2FN3A 2GYYA 1FTQA 5AC5A 5BWNA 1PYOA 2ODNA 2R00C 4FB5A 4UUPA 3H9QA 1WUYA 3G59A 3DL0A 3QENA 4UDXX 3ROMA 2OWDA 2YVUA 3IAHA 4II2A 1XTJA 4CR8A 1T0IA 4H6XA 2UUHA 4OKIA 2VQEB 1QKJA 1OXXK 3AJMA 4FZJA 3HYNA 2C5SA 2YWXA 4AYWA 1XN1A 4BXOB 1DIAA 1AV6A 1HFEL 4C1NA 4M99A 3T7TA 4MRNA 3E7WA 3I3OA 1SQ5A 3V48A 3VBEA 3BE5A 4BNWA 3RUCA 3JWEA 2HPAA 4G0MA 2VF7A 1BRTA 3PIDA 3DEYX 3ZNPA 1P33A 4ACAA 3V6MA 4GQBA 1OLSB 3KPHA 2H16A 4LMBA 2EJBA 2ECPA 2JLXA 1P3DA 5CB4A 3N59A 1Q74A 2HUJA 4AG6A 5BVGA 3R7DA 1JG2A 3V1TC 1AO0A 3OVMA 1O94C 2WF5A 1GQFA 5J59A 3H2BA 3RJMA 4D9HA 3RVSA 3FWHA 5FWXA 4X94A 3JQGA 1K92A 4YROA 3AFGA 3QRWA 1J1IA 3SDBA 2AZXA 2A3RA 2WM2A 5ALDA 3O4JA 3EUWA 1OKKD 4IXNA 4LLCA 4EWCA 1VKJA 3WNCA 4IS2A 2RGEA 3N8KA 4XYEA 4M98A 4A36A 3G5AA 1H1TA 2E89A 4ZTUB 1DG9A 4JUFA 5J1TB 3PLNA 1NBWB 1SVLA 4X3OA 5ER6A 3ZQ4A 2P4SA 4PZYA 4X1KB 1U02A 3U4QA 4PTZA 2DT5A 1MQAA 2MSEB 4PZPA 3QVLA 1QQ7A 2J9BA 1ZHXA 1DBVO 3UMBA 2KJGA 2ZYIA 1A9SA 3OHMA 1NDUA 2NADA 4WESA 1O5TA 3FBGA 1JGTA 2WM8A 1TK3A 1QHGA 4HB3A 3HVRA 4MOWA 5JDCA 3BOSA 4G0NA 2DPLA 1PSZA 2MHRA 3L8HA 4G5QA 4QO8A 4A92A 1ZUIA 3CIOA 3S3TA 4Y2VA 1KRWA 5K8LA 2F64A 3W8HA 1U0BB 3OTIA 1O3UA 4D8XA 3WGIA 1K5PA 3FFBA 4PZZA 5CB6A 1H9CA 1N57A 4YCMA 5E1OA 3Q3EA 2CMHA 3OPYB 2GXUA 1UOEA 1ZLYA 5EPUA 1TQ2A 4FZVA 3AIIA 2QT1A 3R0ZA 3MTAA 1RYEA 4L74A 3T1HB 1U8AA 1FS4A 1V1MA 1XMSA 4CFYA 3R7BA 4QI0A 5JT4A 3BG5A 4G41A 4AK9A 1RCUA 1ZLXA 5I7VA 2A2ZA 3RF3A 4LHEA 4DDVA 4Q18A 4NS4A 1P1RA 2YVLA 2EW1A 3K8ZA 2ZBGA 4E3WA 1K6XA 4I5FA 5CVDA 4KKVA 3MWEB 3P2JA 3IE1A 3H1AA 1LPNA 2ID4A 4L5IA 2ZXFA 3GHYA 5TF0A 5EWLA 4HB4A 3JZAA 4HFNA 3EZ2A 2R25A 4Q16A 4Q1EA 3FCCA 4WW0A 3H4IA 4H6VA 1VG8A 1CHDA 2VJBA 5CEFA 1U2SA 3QBDA 5BOSA 1XXHE 3NASA 2IS2A 1DO2A 2EIMC 2A58A 2VP6A 4KYVA 4V0RA 3G2JA 2GXSA 1W75A 1D03A 1R18A 2YJ6A 4ITUA 4DLXA 3PPWA 1T5IA 1CUHA 4D9CA 4ED9A 1IVSA 5KC9A 1HDGO 1TFRA 1XZKA 3IR7A 3PT5A 4BEVA 4IICA 4KMSA 3BJRA 2JB9A 2CLIB 4JYMA 3KZMA 3W05A 4AZVA 2Y1FA 3T4UA 1A9ZA 5L3QA 5B2ZA 2C5BA 2HF8A 1YZQA 5U1PA 3OZBA 3MCWA 4FNMA 5MF6A 1T4BA 2Y1LA 4RVSA 5AK6A 2NUPA 2O5RA 2KW3C 3SVLA 4W63A 5IXYA 3DF7A 2PUEA 1ODLA 5AOVA 4OHBA 4R1NA 1M5TA 4JYPA 3LLSA 1POWA 3OM1A 2W2TA 3LC1O 1WATA 3VPGA 1OW7A 3W34A 5ED0A 1PQWA 2XADA 4CS8C 2YXLA 4FN5A 2D5RB 2CVQA 2JATA 3DVQX 3PNOA 1A9XA 4L8VA 1RBMA 1FP1D 4L75A 3H2SA 1ZK0A 1OF1A 5GMOA 5BN5A 1R3DA 4COOA 3T41A 2VSOA 2HTEA 1N4DA 1C1DA 5DLEA 3O7MA 3ET5A 1MENA 3KETA 4RKYA 5A9SB 2HJGA 3RQSA 2C5AA 3D7MA 4PC1A 5IM5A 4D8VA 1SXIA 2IEIA 4JTAB 2ZUSA 2DECA 6Q21A 3C70A 5IC6A 3CLSD 3E9QA 3DEFA 4PK4A 2BC9A 4LOKA 4B80A 1ZZPA 2QR3A 4GOKA 4LGMA 1ILWA 4OG2A 4QGAA 2YJ4A 1DCKA 3RH3A 3RGGA 4F2GA 4WXYB 5J4YA 1M1XB 3RQGA 3O0TA 3N9IA 2PX2A 1NU8A 3ZD8A 1CY0A 2FVXA 4XLZA 2IVZA 3GK3A 3AZOA 4EO4A 4NABA 5L53A 3FOZA 1KKUA 3O1HB 4RTNA 1GDTA 3E81A 3KVRA 1CDZA 1YDMA 2XNJA 4GPBA 3WAJA 3AESA 3E9NA 3ZHZA 3IURA 4Q47A 1MJNA 2DKFA 3TJ5A 4BLQA 3DJNB 1N2IA 4IGFA 1YS2X 4I1PA 2WAOA 3QU7A 4GKKB 3PE6A 2X5XA 1U7WA 4IIUA 1G55A 1NMSA 1D1CA 4IDEA 3ZDRA 1VGQA 7REQA 1N75A 4EFKA 1UC8A 4Y2GA 3P0RA 2PSHA 2CVZA 5JG7A 5C5EA 2FE4A 5J4LA 1LFDB 2Q5EA 4HVTA 3E58A 2UZAA 4EGFA 3KFVA 3LUDA 2BLLA 2JA1A 2ZVQX 4ATNA 1KEEB 1U4SA 4JODA 1F4PA 4ZDJA 2JIDA 1X7DA 3TLMA 2YLGA 1E8NA 3C98A 1NRWA 1OFTA 1VDZA 4MW3A 3TQFA 3D5TA 2P68A 4YALA 2I3BA 5CH8A 2VWPA 4WN3A 3B2EA 2I7TA 1HTBA 2DHRA 4MYDA 1SZDA 4XCVA 3LYHA 3MIZA 4BO2A 5KSZA 3S8YA 4L8YA 4R71A 1OREA 2CYDA 4ANJA 2HXSA 2WWGA 4KAFA 4G1VA 4MRMB 2IYNA 1JZQA 1C5KA 2ZQ5A 3DVRX 2F43B 2G9ZA 5JQGA 5FUXA 1AKMA 1Z3CA 4PGAA 1LRKA 1UJ6A 4Q7MB 3NDPA 3NWOA 2HV6A 3CG0A 5KYWB 1D6MA 4DLRA 4TWZA 4RM3A 4KI2A 2WTEA 5DTIA 2J9GA 1MD9A 4FP9A 1TDJA 1NC3A 2XVMA 4MVWA 3WFIA 4R32A 1SULA 2LXNA 4O4LF 3DB2A 3FIJA 4GMDA 3C41J 3W5CA 4EARA 4RAOA 3RC1A 3SNHA 1RCTE 3AKEA 4IZOA 1F8GA 2A1UA 2NT3A 3A25A 4W8GA 1GWNA 1TMOA 5IKPA 3HS3A 2BZGA 4KU4A 2VUHB 3DMFA 3QJ5A 4RSGA 2H3HA 3OLCX 5DASA 3TZHA 2PLNA 4UDNA 5I4CA 1GA4A 4EHBA 2QD1A 3HY3A 3HABA 4TZ0A 1JALA 3DDCA 3BAFA 3UV6A 3T7JA 5AXAA 4QM6A 5BUZA 4KMOA 4B3CA 1QGYA 2QMEA 2E6KA 3GEGA 4IEIA 5B2FA 4DLUA 3THYA 3STHA 3DZHA 3A36A 5B2EA 1DAGA 1XWFA 4KO8A 3UV3A 5H9VA 1WZNA 4ITVA 3ESQA 1KPGA 5KYGA 4QGSA 3VKVA 3CX3A 4RJKA 1NIPA 2DQZA 4AUEA 2VDOB 4G0OA 4V0OA 1RXUA 5DK6A 2FGJA 4EKYA 4ZGBA 3LCJA 4TV8F 4Q4LA 4KDEA 2VWHA 5A4IS 3ZGOA 3LIIA 1JH8A 2VXCA 3KK0A 1ZN2A 3I4FA 4V2UA 3FXHA 1BQ3A 5JPDA 3BFVA 3GO4A 3BXPA 5CFQA 2CXUA 3EVFA 4IV8A 3TINA 3W4JA 3W7VA 4TMWA 2CW5A 5DGTA 3DMNA 4AUNA 1K8QA 3FLEA 4N6HA 1X70A 4KW7A 3FZYA 2ZT6A 3F6YA 4D0RA 1I2BA 2QS9A 2PUCA 4ARUA 4FGKA 2IQIA 1ORVA 4CTOA 3CLRC 2V4UA 4RCYA 1PL0A 2XUFA 4MKGA 1PI3A 3CRRA 1JG6A 4TKMA 4ZVUA 2Y0PA 5C80A 1BVUA 5E1DA 1ZN7A 4G0XA 1B1CA 4ZVTA 1SQSA 3EGXB 2XBLA 1ZYUA 4G7HF 1GQSA 4RMJA 2BKVA 3O39A 4XPIA 2GM9A 2VJNA 3ES9A 2NUAA 1FVFA 3HY4A 4Z0HO 3HUTA 1UBTS 1M8GA 3HI6A 3B1VA 1CBUA 2X7XA 5E9JA 1P7CA 4LRXA 2AOXA 3E03A 3GGJA 1A2OA 2AD5A 1EFUA 4R9NA 4Z4HA 4KTTE 3C8GB 4TKLA 5L4SA 2ETSA 2QX8A 5DT9A 4LF4B 4LJLA 3W4YA 1HLPA 3F1KA 3EF0A 5G1NA 2QYSA 1H8HD 2KJQA 2O20A 4QG3A 3PK0A 2CFRA 1JDJA 5AC4A 3SIXA 1GTG1 3KOOA 4IJ5A 2NP7A 3ZK8A 5ALSA 4B0PA 4ZVQA 2B61A 3D2AA 2P0NA 3W9UA 2AZDA 3VXKA 4AWBA 1NN0A 3DL7A 1U1EA 4R8VA 1ECBA 3H2YA 3S29A 1RKCA 4WRRA 3JQPA 1QIJA 4W99A 1FRVA 2X6RA 2R6GA 5FTKA 2RHBA 5ALMA 1QKIA 3RREA 5LQNA 3ZQKA 1QDUA 4XVQA 1XEFA 1X1QA 3K70D 1R4MA 4WY8A 5C7LO 4AY6A 1ZBQA 4YRMA 1FX0A 1E69A 2JI9A 3D8SA 2BUAA 4II7A 3GI1A 2WVQA 5LD2B 3C3WA 2IHNA 3OAAA 3R9KA 5L40A 1Q0HA 2XTJA 1YNSA 1Q22A 3R76A 3IO5A 3QU9A 1JFRA 2Z1NA 1FP4B 2G04A 4V0QA 2A9FA 4DCNA 2RDMA 5AIAA 3K9NA 5I7WA 2XMDA 4QODA 4DCPA 4JMLA 2ZBEA 3EVAA 1MO3A 2UVQA 4PO3X 2HL6A 3BQMB 4RHCA 2VH5R 3KYIB 2E0IA 1ZIYA 3LRPA 2CKDA 3S90A 5F23A 3DB1A 1JEDA 5CLIA 1MO6A 8ADHA 2AE2A 2VNAA 4M8IA 1PD1A 4RFSB 3PP8A 3U39A 1GCIA 3BMCA 1X0XA 4J7CA 3SQDA 1NL3A 1W73A 1XRQA 2ORED 3TMKA 1EP9A 3VGPA 5HJ2A 2I87A 2FW6A 4HR7A 4BO1A 3JAMA 4NMHA 3L49A 3AG3C 4AMUA 5L0DA 2NWQA 3OIVA 1W4AA 2FEPA 4BN5A 1KYXA 3GM2A 1BX3A 2NU7B 4WECA 1VTMP 4NMWA 1M2FA 4O2LA 2EPNA 1QYWA 4AO7A 4L28A 1OVMA 3NT5A 1WABA 4JH0A 3M6WA 3C74A 2C98A 2XMGA 3WLEA 4G97A 3CNEA 3WL7A 1E2QA 4XD2A 2IPLA 3VO8A 1UIRA 5E2AA 5KNBD 5HG0A 3EXHC 5KVCA 3V7UA 1HBJA 3C7AA 3LC0A 3OPYI 1X8JA 5IMSA 2QN8A 2EDAA 3WLOA 3I1IA 3SR0A 4J0JA 2XT9A 3Q7IA 4DR4B 2DXIA 1W44A 2Y67A 3HACA 2IKSA 1ATZA 3SY8A 4LGYA 2UUCB 5GQSA 2NZ8A 2X0CA 1WKBA 2JNWA 1EBFA 3ZWCA 1ENZA 1LA2A 4XDZA 4A2PA 2HMUA 1G41A 4Y1GA 3SBXA 4DIDA 3SHWA 1E1KA 3BMOA 3ZHTA 1HH4A 3UUFA 4I8DA 1V74B 1X9HA 2QUZA 1CJVC 5F2KA 1YZ3A 1X1AA 2GCEA 4FDVA 1Z0KA 3K66A 2KLBA 5DCWA 3U26A 1U0RA 4PJMA 1VKHA 2OPBA 2QGZA 4LC0A 1A0BA 5G4LA 4JLNA 4AUMA 3UJBA 1THTA 4R69A 3RVJA 3GA7A 1ZBDA 1JKMA 1WZCA 5FL7A 1RKBA 1WBDA 3AP2A 4Q7LA 2EFJA 4O02B 4JI3B 4D8WA 3ADDA 1FF9A 3O91A 1EFPB 3E27A 5DYYA 2WJ3A 4Z8XA 3DVAB 2E4XA 2EBFX 4D02A 1P2DA 4X71A 3E9MA 5HKBA 1YL5A 4ZDKA 1PWYE 4FBMA 4UPVA 2ROQA 1KOLA 4WIAA 4X1OA 4CVNA 4AQDA 3EVBA 2WWYA 4GLOA 2FRDA 4PPYA 3TPCA 1W2GA 2Q3EA 4LRSB 4I4TB 1CQZA 1OVGA 1Y6JA 4KDCA 3VU9A 4DW8A 4JVSA 3ETGA 4DMUB 1FNDA 2C61A 2ZUDA 4P5DA 4FGSA 4N7RA 1FFXA 2F6RA 1Z0DA 3PKJA 1VCOA 1WDTA 4CF3A 1R5BA 1AKNA 4XKJA 3FPEA 4BJ6A 1NLYA 4CKCB 2DQSA 8GPBA 3G2OA 4V0NA 4CMJA 3C97A 1VCHA 1JL3A 5F98A 2VDLB 4G3XA 5I7UA 3WV5A 1UMDB 2WMDA 4XDGA 1G6OA 3DCNA 2BHLA 2FMKA 3WJ2A 1AURA 1PX0A 4UZFA 4EYKA 3QVXA 3FTNA 1E2UA 5CI9A 4O4IF 1T2UA 1I01A 2G0AA 3O4IA 1UP4A 2YV4A 1PEAA 4YAGA 3FAKA 4P92A 1PSDA 4DDWA 1O5IA 3LHDA 2O8CB 4TYQA 1RQNA 1PZFA 1BWSA 1DKRA 2IEDA 1E6LA 4PF1A 3MYIA 3BTUA 1PZMA 5AVQA 2CHUA 5LYJF 4REMA 4B6EA 3OZUA 4ESVA 2CLKB 2QUJA 3EF1A 2COUA 4PNHA 1Y80A 3I6MA 2H1HA 3RF7A 3IT2A 4R40A 3VV2A 1WY7A 4LUCA 2D3WA 3GVPA 4OLJA 2VO1A 1GAEO 2EWVA 4B6OA 2W6ZA 3PF8A 4HYTA 4MR8B 5GONB 4P9TA 3PICA 1TQGA 2ZQYA 3B13B 2MJLA 1QTRA 5KREA 4C7XA 1HPLA 4BRWA 1XDGA 1ZJ4A 4L57A 3UB3A 3WWZA 4WHMA 3K71B 3I4UA 4BWGA 4XJXA 2H48A 2ZVPX 4J1QA 3GNTA 2M6KA 3F8SA 3PXGA 5TLSA 4OXXA 3G5TA 5EXTA 3UJ8A 2LDBA 4YAOA 2HSZA 1LBEA 4JBXA 3SFZA 4WWHA 3BGDA 5INTA 1GG2A 2R05A 2QE7D 1RHMA 1N2EA 1PJQA 2JJ2D 1WF3A 3JYLA 5CDSA 1OZGA 2DJIA 3CLKA 5EZYA 3PGJA 2J0EA 3VYVA 3AFNA 1A7DA 4F3RA 4Q34A 1D4OA 1ZUWA 1OWNA 3X2QC 3FVYA 3U2LA 1ZW1A 1NF8A 1CKEA 2PEYA 4F2DA 2UAGA 3Q0IA 3URKA 1OTYA 2XYQA 3CH6A 2I4MA 4BQOA 1D8TA 1RI1A 3WIUA 4Y2YA 7GPBA 2CXSA 1VKRA 2ATVA 3IQXA 4DBZA 4YJFA 1X92A 4QO7A 2IH2A 2BE7A 1ZIPA 1SAYA 4AJHA 3GCXA 3H8JA 4ZMBA 4Z4IA 1UWLA 3DJFA 1LNSA 4PQRA 3IELA 4B45A 1TK9A 1AHPA 3EVEA 1KQPA 5J43A 4NCXA 3OQVA 3CCFA 3L1VA 2RE8A 4YXFA 4Q4JA 2IYYA 4EHIA 3PSHA 4NNJA 3EXEB 2QLMA 4LV6A 4C4YA 1XDBA 4E21A 2UUPA 3R7WA 1HE4A 4IP0A 3VNSA 2HA6A 1M1NB 3L6UA 5FYQA 2ZLBA 3H5LA 1DGQA 3PQ2A 2XRYA 1E1MA 2PKXA 1QZUA 3M70A 4B3TB 4DMFA 1FUUA 5FAXA 3RT7A 1E9FA 1L7AA 3HKBA 1NMZA 5TVGA 3LNMB 3BSWA 5JMWA 5EA2A 2C5HA 1T6BY 3RUIA 3IOMA 3KT8A 1G8JA 1BYUA 3QW0A 2BYTA 2JHGA 1SMYF 2D1SA 3K9CA 5KVAA 4MX8A 2QVYX 4RVHA 1VIMA 2NSDA 5CA0B 5AICA 3RRJA 4C3UA 1OA0A 2BF4A 5FR2A 5EIHA 4KUEA 1STOA 3HY6A 1O6GA 4ZRNA 4D46A 5FNVB 1T9DA 1ADFA 5ESDA 3FIUA 1E2NA 3I3SR 4MZXA 2J0UA 3ASNC 1BWQA 3JYHA 2ZIZA 1DX4A 3L1KA 4ZD6A 1T4CB 5ED4A 4LRQA 4AJPA 2YL7A 3BCUA 1AKQA 3HO6A 3FNIA 3WBFA 2FE1A 2J4CA 4AX4A 1NTRA 1E61A 1T1IA 3W7BA 2ZI6A 1WXHA 1Z7GA 5LOVA 2UU9B 2ZJ8A 3WWCA 3LUTB 1EFLA 4J32B 2VPIA 3ETEA 4HDRA 2I54A 2HRBA 1C81A 1R6AA 5A05A 1O58A 2O8FB 2D7DA 4E32A 3PEYA 5KI6A 2JVJA 3CN9A 3KKEA 1F51E 3GUUA 4ZC8A 3MJVA 3KTAA 4AI6A 4NONA 3FAPB 3CH5A 1RQ2A 3HHEA 4US2R 4L2IB 5L7TA 1F0PA 1OROA 1XLTA 1SCBA 3UCEA 4NBLA 5AKLA 2WBLC 3KXLA 2LSEA 3DZ8A 2B1QA 1IYZA 1JJ7A 2VRBA 3RADC 5KQMA 5G3YA 1NVMB 2ETXA 4E5VA 2G1PA 3MZ0A 2O3JA 1VSTA 2MSDB 3NO4A 3KV3O 2E9SA 1EUDA 3DQZA 2WVHA 4FLMA 3BEDA 4HKTA 1NX9A 4GEGA 4IY1A 1P5FA 1E5LA 2KK1A 1EBUA 4WZBA 2G72A 1TE2A 1Y6ZA 2HSBA 4FIDA 4JP1A 5I9SA 1CEYA 2BD0A 3H4MA 5ECWA 4IJMA 5EWJA 4LI3X 1PJ4A 3O8QB 1XAGA 4ZMRA 4B3BA 4CF6A 2YOGA 5ILOA 2Y77A 3D3NA 2AFIB 1F2TB 1CUZA 1FMJA 3BXGA 5E3CA 2QYHA 1BR1A 3R7CA 1UEJA 2WHRA 2OBBA 3MT9A 2ANBA 1VG9B 4D79A 1R5OA 4GNKA 4LKRA 2E4WA 3PQEA 1AD2A 4P3KA 1U1IA 1URPA 4GZLA 4QLBA 4HZIA 2BPOA 2JH8A 2M64A 4EUHA 3WG9A 3L0OA 3I2FA 4LNUB 5BMVA 4AZ3A 1UJ5A 4N03A 2OAGA 3BXXA 2K4MA 5AI9A 4C3ZA 4RPLA 3F98A 1ORTA 1ZJZA 2C3UA 1G5RA 2Q7XA 1SHLA 1Q7GA 3MCTA 2AP3A 2B34A 5TEWA 4KPYA 1EXWA 3S70A 1H2BA 5CB8A 1MRSA 1KZHA 4FT4A 1ULBA 2C92A 2ZYWX 3I1JA 3NU1A 3KEQA 2X41A 2Y1KA 3VR6D 3GJZA 1ORJA 3K6RA 5LP6B 1E4VA 4JKYA 4F2HA 1JIUA 2WOOA 5JXIA 3CPHA 2QAJA 1QHNA 1JWLA 1MLDA 1UPBA 3LUKA 2WE7A 4MLCA 3D7LA 2WAXA 5G0WA 3ABOB 1CPQA 1QR6A 1FFEA 1J22A 1RXQA 1WU7A 1QF9A 4ZTZB 1NLMA 5AJTA 4N6CA 2DFLA 5TMDA 4URXR 4JUDX 4YONB 3FJOA 5I3ZA 3ZDEA 3ZVMA 4TXNA 3IHUA 4FFBB 4OHMA 1A2KC 3KYDA 3TNLA 2I4TA 2CLHB 2GFHA 4HSEA 1TVCA 1LB1B 1SQ6A 2B20A 3ZD9A 4EYSA 1RHUA 3K4HA 2Q1UA 3RT9A 1WXXA 4BX3A 2AG0A 3K1AA 4QXAA 2I2FA 2VDMB 3KXPA 3VOBA 3RRBA 1ODKA 1PAUA 3DLAA 1KI4A 1UXHA 1XWIA 1KYZA 2A7XA 2VXOA 3TW0A 3IP9A 1Q1GA 4RVUA 3V1KA 3FGPA 2QL9A 3ABMC 1E9AA 1GRCA 1U3GA 2HY7A 2EC5A 1TUEA 4XWKA 3G2IA 4I08A 3HA5A 3EIQA 4RK4A 4Y3UA 3N58A 3GF4A 3CVYA 3X2FA 3ND8A 4A3SA 3PE4A 5CM2Z 4AW9A 1Y8RA 1RP1A 2SICE 3GFOA 4UPEA 4OK5A 2C5LA 4JQZA 3JWJA 3EVGA 1P29A 1YE3A 4Z7OB 3EHNA 3H0CA 3V1LA 3KYJA 2OE2A 3K72B 4LZLA 4MW1A 2M1XA 2C0PA 2VTVA 4B35A 1BBHA 1TO6A 3LVRE 3N24A 3WRXA 2W90A 2O48X 5HOQA 2PLAA 3LXXA 1E85A 4US1R 3US6A 2I55A 3PU6A 4BMCA 4MV0A 2WHYA 1SXJA 1Z25A 4DRJB 2VAMA 2WB2A 3M6LA 3NDIA 1TKBA 3JQEA 1MVNA 2CXRA 1V54C 3BWEA 3U44A 2RAVA 5HF6A 2OXIA 4IJJA 1OBVA 2E21A 4RH1A 1KI3A 2NU8B 1OR8A 3OOEA 4M36A 4TUYB 3O4VA 3K7DA 2D62A 5FLKA 3TJ6A 4ZOQI 4P84A 4DQDA 4NE2A 1XTPA 4XZ3A 5EJMA 1YSCA 5JXJA 5ALEA 3AJRA 2Q29A 1BD4A 1LC0A 4BP9A 1SB8A 3OQMA 2XECA 2VSNA 3BXHA 5DLYA 4XLNF 4L0QA 4CEHB 4Z4EA 1K4KA 3DEJA 4D56A 4BVKA 4M9CA 1TU3A 3NEAA 3EDQA 3OFVA 3QQPA 3B6KA 4HJXA 5SZHB 3O8OB 2D4HA 2HF2A 4ZI7F 1D6JA 3FGZA 1P72A 1K8YB 4KWHA 2Q8PA 1DQYA 1RQPA 2B1IA 3RU7A 3IEIA 1ML4A 4QZVA 1ADGA 4FFMA 3T6JA 3VPSA 1L3IA 1EFKA 2YOFA 3GUZA 5H7XA 3OEYA 5EIEA 5ALRA 1FRNA 1OH5A 2BDEA 3KQWA 3EXFA 4MA4A 2RHOA 2HNBA 4DMGA 4ZZ0A 1EJ2A 2PS9A 1W87A 3AF2A 3BXZA 2V9ZA 3WRVA 4N7BA 5BRNA 3LZ6A 3MAJA 4O2AB 3RWMB 1V8PA 2HCBA 1SR8A 1SZCA 1FFBA 1NE2A 2OC4A 2FJPA 4DV3B 4F92B 1H0KA 1L7RA 3ESCA 5LQDA 3ZC4A 1RTKA 4A82A 4KBGA 5M3BA 4BZPA 3FWPA 4BFLA 4UDVA 3DAPA 4AMZA 1Y4SA 2R68A 2LCIA 4UHJA 3HKEB 5F5LA 2OGUA 4R6XA 4W9NC 1I6LA 5HJ5A 1BVRA 1K6IA 1GDHA 1VIAA 2YXEA 2FHPA 1XAJA 1M0TA 1Z0IA 3KQQA 3EPPA 1X94A 2Z8XA 1ORRA 3KYCA 1E4OA 3AI2A 4ESEA 4FOTA 2XEDA 3X1WA 4RD0A 4YLYA 1MC5A 4QBHA 3SEFA 4EFNA 5CH3A 1O6BA 4TTPA 1U7OA 1FAPB 1AK9A 3DG9A 3IR5A 4MUKA 5FOUA 5K20A 3HRIA 3V42A 1VSBA 2PBRA 5IDXA 3BL6A 1XVUA 4K9LA 2O07A 3TQQA 1DX9A 4BFYA 3F3YA 3R6WA 4A0QA 2XDQB 3E2PA 2AVNA 3GHHA 1QSPA 3SIPA 3VNQA 2AI2A 4BO7A 2OKCA 2CMFA 1T1SA 2O7RA 1GUDA 2AC2A 4QICA 2GDJA 1QFXA 2ATIA 2LZ0A 1WEKA 1WPGA 2Y2VA 3B7GA 1KQGA 3FSEA 3Q6IA 3DMRA 4D6YA 5B7GA 4MS1B 2VPYA 4C2TA 4BU0A 1DWPA 3X1JA 1UJNA 1ZAYA 4YI5A 2BRUC 5JFGA 1WZIA 3BF8A 2ZJAA 1Q17A 5AT1A 3AUFA 3CNOA 1J2JA 4W8HA 3DZBA 2YFQA 2P5SA 1ND6A 2VA8A 5IJ0A 1QP4A 3KB8A 3JQ8B 1AE1A 2FQWA 4H4EA 3AM1A 5A5GA 4X85A 5CDFA 4LVUA 4NH0A 2NAPA 3KM0A 1HDCA 3PFCA 1ETHA 1XLVA 4DDHA 4L3WA 2FNAA 4D4JA 3ON5A 2Z2JA 2C1XA 1GGFA 4QASA 5E3HA 2YLDA 3EOAI 4C78A 1BH2A 3GQBA 4L8WB 1JWAB 1ZONA 2GA9A 4HUQB 1O0BA 5JVDA 4C3VA 3U3MA 3LT5A 2V7TA 2R11A 4DWOA 5IT0A 3GELA 1EWQA 3U2MA 5C7OO 2H8GA 4KPEC 2Y92A 2IYRA 4G0YA 4OLBA 4C14A 1E32A 4Q3OA 2BEKA 1N6HA 2QSZA 1KIMA 3KQOA 1JIIA 3T1TA 4H1UA 3GLHE 3Q9LA 3OIWA 1TA9A 2HLDA 3NVMB 2WK1A 4ZGWA 4GIBA 1JR3E 3SQNA 1DC8A 4R9SA 4LVCA 3PITA 1MG0A 5GIPE 5CVTA 2ZROA 1VIVA 1UMKA 4D9NA 3DOOA 1T2CA 1C8BA 5D2CA 2PH3A 2JJ1A 2MR6A 1ONPA 5DHQA 2BTQB 2QDXA 3EFEA 4CLOA 5J2UF 3GFSA 2MHCA 3U37A 1BW9A 1IHYA 1HNZB 3FPCA 3MBOA 5E95A 4Z9YA 2B5WA 5EUBA 4MYUA 3VRCA 3C39A 4GP7A 1JQAA 3R74A 5SZKB 2O2HA 3SYMA 3G13A 4EEZA 1O77A 5DBOA 3NCHA 3KUCA 2B8EA 4X8OA 3KKZA 3ADKA 3Q5EA 1JLRA 2G9RA 4MA0A 3EVDA 4LFAB 2YN2A 3HJCA 1U8ZA 3VUEA 4M22A 3N3AC 1GGMA 2ASEA 4K3UA 3QVSA 3Q11A 4N5NA 3PWKA 3EYWA 4E5YA 1N0WA 1XTBA 4E4YA 4ZXFA 3OFJA 1VLTA 2ZATA 1A7VA 4HEAJ 1JPJA 1VLMA 2JPUA 4ALMA 2JX0A 4XUGB 3WO1A 2M6LA 2I8BA 2C7PA 3QJGA 3ASUA 1JFTA 2JJYA 4DA4A 3ENZA 5T3TA 3CUKA 3P0IA 3G5LA 2A8YA 3KSBC 3LAWA 2FAPB 3CQ9A 3M1LA 4B17A 3OURA 1RXYA 4LJKA 3NMIA 5TY0A 5F1OA 1VQ1A 4IHQA 5E6UB 5FTNA 1OCRC 1HLFA 4BNGA 4MUNA 4YS6A 1IM5A 1TNDA 3TGPA 2ESRA 1XMIA 4N82A 2Q3HA 3QELA 2J5RA 4UEJA 1UQRA 4NYMQ 3TLKA 1E86A 1ECPA 1T8YA 3WNDA 3D8NA 3QU4A 1NMQA 2PMBA 4BG0A 2WUFA 1TKCA 3GU3A 3ML1A 2ZFUA 2JK1A 4MJLA 4R51A 1FYVA 3Q72A 4AN0A 4J1TA 1XZIA 5FH9A 3TOMA 4RTJA 3B3GA 1DEAA 1F9AA 2R9RB 4MP3A 3TX6A 4WKPA 3RS5A 5CXXA 4DKJA 4G5YA 4KC9A 4ECEA 4JWTA 3E8SA 1BH6A 2IYXA 3ZDZB 1W47A 3IKLA 1OWLA 1IQRA 4YJ2F 1QLWA 5I01A 1PNVA 4HWOA 4KEAA 5EXDA 1O97D 1MAUA 1JT2A 1WPRA 3NUGA 1J6UA 2FFJA 3DL4A 3LY9A 5K3BA 3TQSA 1FQJA 4Q93A 3VDMA 1YB4A 1TCAA 1II8B 5JJKA 1O95D 5HXAA 1WA5A 4HRAA 5I8WA 3LKVA 2QTTA 4PIPA 3HXTA 3KVYA 1JKXA 4NOKA 1N8KA 1KK3A 1P2TA 2P9GA 2PH5A 2WP8J 3SIRA 3U4MA 4G0WA 5AM3A 1S9HA 2QUIA 5EQFA 1BN7A 5DB4A 5LA6A 1XROA 1HDXA 1ADCA 3OCWA 3OOWA 1U8TA 2C82A 1H0SA 3ZDCA 4KQ1A 1RJGA 2QRVB 2EP8A 3QHAA 4HMQA 5K0GA 2DBZA 3QXGA 4BUZA 3UAGA 2CFSA 4W5JA 2JRCA 4M89A 4CLRB 3A1CA 5CAEB 3W6OA 2XQVA 4LC1A 3L92A 3EHDA 3P9ZA 5JS5A 3ZU5A 4AP5A 4H3KB 2ZBQA 1IULA 4LV5B 4PVCA 4BUJA 1J9EA 1MORA 3DE6X 3RRXA 1I36A 4D41A 5ARBA 2IUYA 1LQ2A 1A5TA 4WVLA 2C4HA 4F3NA 3RUFA 5FA6A 2PGDA 1S3SA 4HNTA 1S7GA 5KU7A 3CEAA 3UOAB 3EGOA 3QEOA 2XMQA 4UHEA 2JFFA 5ESWA 4LMPA 1BSVA 1RQGA 4M1YA 2WZGA 1SBTA 3ZBTA 3NIFB 4H18A 3EDRA 4DA0A 3TW6A 5B3JA 3Q88A 3DDWA 4DS3A 1XZLA 4KR3A 1Z5GA 4QEZA 1QS0B 4PWYA 4W82A 3WK6A 1PNRA 1K40A 1PIWA 1YVIA 1XZAA 4S12A 2PYZA 3FBWA 1ATIA 1Y8QA 4DY4A 5LPNA 4F60A 1O7JA 4YDQA 3ZPXA 1NQUA 4MMZB 1RMQA 3UG6A 3DBVO 4I5EA 4H7JA 3KL4A 1R66A 1QO0A 1KC3A 4Y1RB 2X4IA 1KI9A 1A1SA 1D2GA 2ZT7A 4YIHA 1IK4A 2J31A 3ZYCA 2HWKA 1AF7A 4RHYA 1IY0A 3U6BA 1VL1A 4OK3A 1KKMA 3TSWA 4FXOA 3T5AA 1S6YA 3L4SO 4JBWA 5HA5A 4J3NA 3UUEA 4D8TA 3SKXA 4X54A 5AJVB 2NYAA 2YS6A 3RYIB 3PFKA 4F9GA 3MYRA 3ZE2B 3VRHA 4X91A 3FRIA 3L4BC 4DPKA 1Y8CA 5KAPA 5HIJA 4K6KA 2WIJA 3AUSA 4A91A 4CDGA 1DKOA 3ASYA 3H11A 5C8YF 4JYZA 2W45A 2QUPA 4GT1A 4NICA 1O89A 1L7XA 4G5FA 2WV9A 1QKRA 1YULA 1LX6A 1YS4A 1T3HA 4KR9A 5BMOA 4I8IA 1HYGA 4OHUA 2AH5A 2X0EA 3DTVD 3EEQA 1UDRA 1TB4A 1KORA 1GZ7A 3R7FA 1JEEA 2WHPA 3BTOA 2Q5LA 3I2KA 4G0ZA 1E99A 5J4KA 1XTVA 1CWUA 3SZOA 2W4MA 4MDYA 4V0SA 3P97A 2JCVA 4YVFA 1DC3A 4C7OA 3PZRA 3P9PA 1FP7A 5F1PA 4NWIA 4OQYA 4S1NA 1W0CA 2X8BA 2BFBB 1H2YA 1JJFA 5FUMA 4DLZA 2WU4A 2JLRA 3TTXA 5JVEA 2OLKA 3TIFA 3EIOA 4N3CA 4BNMA 2Y3IA 1AGYA 4G89A 4HZGA 4EHJA 1XPUA 2IPAB 4TYYA 3IAFA 3PHIA 2GASA 2ZI9A 4JGBA 2HMVA 3V5YA 3T9OA 2HIAA 4KWTA 2QTFA 3HSKA 3T35A 3VKHA 3KDAA 3TZQA 3P5BA 4P3YA 3F4LA 3LCRA 3ET4A 1VPTA 4DCGA 1P7ZA 1D2MA 2XZPA 4XQ0A 4RTKA 2SHKA 2VT2A 3ASVA 3I4CA 3VZSA 3CSKA 4UHDA 1SCKA 1RMVA 1Q95A 1TECE 3UJDA 1H9GA 2ISSD 4A8JA 1IHPA 3AKYA 4ZVMA 1JFLA 3PD0A 5EFOA 2O1EA 1U0FA 1Y9JA 1YOBA 4TSRA 2GYVA 1SBCA 3C7JA 2P3SA 1YIOA 1ZHYA 3E6AA 3QX3A 4W9RA 4K9SA 3QF4B 4OHOA 2RK6A 4EQZA 4IVNA 2XXAA 4PSKA 3O21A 3E2IA 4JLKA 1QCYA 1T2AA 2XLMA 1QFMA 4NENB 3WJ7A 2XD4A 4A27A 1NVAA 1N5RA 4D98A 3A9SA 2O19A 5CT9A 3FKSA 1KSJA 2DPYA 2OXRA 4MHOA 1DZIA 2NSHA 3ESYA 3O38A 5LB2A 1DT3A 5ARCA 3PHLA 1GTMA 4O4HF 3MINA 4LYYA 4B7XA 2ASVA 2QN2A 5G02A 3DMGA 4LDPA 1CJMA 2V55B 1GTVA 1KJYA 2ZXEA 3D02A 1T6IA 5M04A 3BRJA 5ILGA 4Q48A 1UH5A 5J2TF 1Y5RA 4C29A 1YR9A 1M75A 5KWEA 1SY7A 4URYR 3E1KA 1YFLA 2QJRA 5FBHA 2CDNA 3DWGA 4ZODA 3ZEAA 5KTRA 3LLCA 1NFOA 1PV3A 2CEAA 2QE6A 3ZWXA 1I4OA 1LY1A 4J1NA 2YC4C 1M10A 1SA0A 2VYVD 1GPAA 1IDOA 2GZMA 4PPNA 3DAOA 1CQPA 2FWMX 3G0OA 1OXBB 2GCOB 4YRGA 2H5LA 4DQ0A 1C9JA 3PJEA 1S05A 1P7VA 4ZI5A 1JFFA 1THGA 2VC9A 1KS9A 3CM0A 3QLTA 3A6EA 4LJ8A 2J9ZB 4LPSA 1KK0A 4JI4B 3CKKA 2UKDA 2REQA 4P2GA 3JZDA 4J0GA 4BPMA 5DW0A 2UZ0A 2F9MA 3G1WA 4MVJD 4YCSA 5TR9A 3WK7A 4E5KA 1SHUX 1JJBA 5JMPA 1YA9A 4RYLA 4MIOA 1GS9A 1RT9A 2ZXRA 2ZSDA 2R4TA 3F2VA 3CZ9A 3EGCA 4FEAA 3KBOA 3P8ZA 1SM4A 2IZOA 1BHSA 4Y0VA 3PR2B 4TWIA 2VP2A 3PYMA 4FX2A 3IPYA 1QQ6A 2PY6A 3CNQS 1XQYA 4ND7A 1PL7A 3PD7A 2JLQA 1THMA 4LYAA 4WMLA 3WHLA 2ZRBA 2BH2A 3VSEA 4Q03A 2HFJA 4YAUA 5F2OA 2Q5CA 1MAWA 3AUXA 2QJWA 1GV0A 5HDQA 3ZTMA 3LL4A 2VDWA 2BEVA 3RIGA 2P5TB 1MEEA 4EUFA 2AHOA 3HKDB 3T3PB 3EPLA 1M7HA 4P4SA 4BV8A 1MTOA 3V4ZA 4D4LA 3AR2A 4IH1A 4DC0A 3RIPA 2CSXA 3ADCA 2QX9A 2VK2A 1U8CB 1YK1A 4Z9HA 2YJZA 2IXOA 4JFRA 1NZEA 2Y3GA 2O8NA 3FUWA 1EP3B 1KU0A 4YMVA 2ZWPA 3SK0A 2NO9A 2YWFA 1OZ0A 3DV2A 4D7AA 2JGKA 1JHRA 2PXAA 4AULA 3IMGA 4PY2A 5DGXA 4PR9A 4QAJA 4FWVA 1EWRA 5AW0A 5MGBA 3Q7EA 4O08A 4Z54A 4AFNA 1V5WA 3TD2A 3A1TA 2ZYUX 2WJ4A 4M1WA 1EMDA 2B7CA 3G1UA 3P52A 3PDJA 2Y3BA 3R3HA 3CYFA 3WL5A 2F3RA 3F8WA 3CNLA 4RHXA 4UUMA 3RYFB 2YMMA 4PXYA 3E3MA 4ZOEA 3Q41A 1MN6A 4QDOA 2CXHA 3SQOA 1NQ5A 2MSNA 2O4CA 1S8FA 4PAGA 2I7CA 1I7DA 1EX6A 2BP7B 4OXYA 3T7AA 1IM8A 2WD9A 4F96A 1TU0A 1Q19A 5H3CA 3WNBA 5JECA 2QLJA 4QDJA 4JX8A 3M6AA 2VHZA 5JISA 1M5UA 1DRVA 1TTPB 3Q12A 4KXFB 2BGRA 1KE1A 5IVIA 4KSYA 1AT1A 1T1EA 2H0AA 4I6JA 2JIZA 3EIXA 5FV7A 4PZDA 4CR7A 4NP6A 1RE1A 4ER3A 1BOFA 4AMVA 3B5JA 4CS9C 3G9UA 2GN1A 2CY0A 2Q1WA 4MV4A 4H0NA 1O96B 4P58A 2Y4NA 1X7HA 1FFDA 4B09A 5J9FA 2V6FA 1Q7TA 3VSAA 2W8BA 3G17A 3CWQA 4X6UA 3DV0B 3PX3A 2G09A 1AZWA 1EA8A 4EYEA 3FWZA 2OUIA 5EUCA 2FVYA 1EVIA 3NAGA 1JHZA 3A7EA 4EJSC 3RB8A 5K4HA 1EFVB 3LZCA 3MMPA 4BCCA 3R09A 4JAVC 3N8NA 3L7BA 2B8JA 1JDZA 1SYQA 4DVJA 1TKNA 1A7KA 2AWYA 1NFNA 2NPUA 3COPA 1HL7A 4GSKA 3NT2A 4LRUA 5IYZF 2VSFA 3NVDA 2ZYHA 3U5SA 2JAXA 3AF6A 1HG1A 3O83A 5L4NA 4KL8S 1XO1A 5IZCA 2W9XA 3NC1C 5KIAA 3EFOB 1QANA 4AICA 4X6XA 3VYRB 1G0NA 3DGFC 3GROA 3KOXA 3OH8A 4ENUA 1N6PA 4OHVA 2DFVA 1IU9A 1U9ZA 2VQ3A 3FGNA 1KL7A 3FHCB 5HUQA 1U0EA 1N2BA 4IDBA 1CXZA 1DU4A 4BNXA 3KOZA 4I9GA 2X58A 3PC4A 1VRVA 4PE5B 2ORVA 3ZKAA 6REQB 3JVIA 2J87A 4EECA 1FSZA 4P35A 1C7QA 3IBYA 2XITA 1E1NA 2XLDA 3CJQA 4D82A 1M56C 2FPPA 5FPKA 4HH1A 2C57A 2AR9A 5LC1A 1F8FA 4DC9A 3QWFA 4G5HA 3K09C 3UGOA 4M53A 1V5IA 2IU6A 5BV8A 1SU4A 4A15A 2ZJYA 4ZTBA 5EOVA 3U31A 1P74A 3I5AA 2A1IA 4P82A 2IDMA 2I6SA 4R8MA 1S02A 3DBRA 4FKBA 5ALJA 1SKAA 4DLLA 2FR1A 1A9QA 1FRZA 3V8PA 2BM9A 3B3AA 3V55A 2EXXA 2D2FA 4HNAB 2PUTA 4MVZA 3PCTA 1MG5A 1CR2A 1BVYF 5ULLA 2ANCA 4U2KA 2NO6A 4CKEA 4XUCA 1PK9A 1MO2A 1M8FA 4EJ0A 4UCQA 4MULA 3AB8A 3KKKA 4CSAC 2Q9AA 3IFSA 5AQ1A 3UGQA 2NV0A 4YWJA 2IXFA 2WA1A 3W9YA 3FPSA 1RWMA 1NMYA 2D5IA 4U7PB 5TMEA 1IZ7A 1TUIA 4IARA 2YW2A 3RAEC 4PRLA 4JI5B 1M7BA 1C4WA 4P80A 3QBEA 1Z5OA 4FTWA 1OX4B 4Y6LA 3NMKA 1IPEA 1KOGA 3WG7C 1OMOA 4FR5A 3V4LA 4KGZA 4JLWA 2Z8YM 5DLDA 1ESNA 4M0KA 1I1QB 1BTOA 3DJUB 3MJEA 3LLKA 4TV9A 2D00A 3A1VA 3H9EO 3M8KA 5I7HA 1S96A 4CCWA 1N1CA 4IL5A 2UYCA 3MGAA 4WXHA 3VVBA 4OGGA 2AJ8A 3HZRA 4XE5A 3L7DA 2WTBA 4CL8A 4K0RA 4ZCTA 3R6GA 4MJ7A 3HA7A