3ECSA

Crystal structure of human eif2b alpha
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
307
structure length
279
Chain Sequence
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor eIF-2B subunit alpha
publication title Crystal structure of the alpha subunit of human translation initiation factor 2B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 86
structure length 279
sequence length 307
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01008 IF-2B Initiation factor 2 subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1070 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3ecsA01
3.40.50.10470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Translation initiation factor eif-2b; domain 2 3ecsA02
4LDQA 1T5OA 3VM6A 2YRFA 4ZEMA 2YVKA 3A9CA 3A11A 1T9KA 5DBOA 4ZEOA 4LDRA 1VB5A 1W2WB 3ECSA 2A0UA
chains in the Genus database with same CATH superfamily
3NT5A 1EE1A 3W8EA 2AHRA 3MELA 2I3DA 4Y18A 4CDYA 3NBXX 2NW6A 5C1DA 3CLTC 1YE3A 5IDWA 1P7PA 3W7VA 1XALA 3TO5A 2OGUA 2BELA 1MW9X 4DNOA 2GA8A 2ID9A 2BF7A 4DIFA 4PZCA 3JQGA 2HPZA 3BZUA 3V48A 1H9AA 4EHPA 1QYRA 3PFFA 5WRFA 2RMKA 4H08A 1SUBA 4DIBA 3GH3A 3DOCA 3H8VA 4IWBA 3OIUA 3RIPA 2IHBA 3IQEA 2YOGA 5EFOA 1FDSA 2KWIA 2F3SA 5AJYA 1I32A 3FPKA 1T5HX 4JA0A 1TW3A 3NIWA 3ZD9A 3TS1A 4IUYA 2XM0A 5AQ1A 4UUQA 1Y1PA 5FBRB 3G1WA 3DE8A 4MGIR 1JS1X 5BSMA 1OW3B 2QN2A 3F8SA 4MQ9F 1Y1LA 3S84A 1QJCA 4QTYA 5CJPA 2NPUA 4U2DA 4BGVA 3IL2A 1P0MA 1YVUA 3E8SA 3T5CA 1TZ2A 3FSJX 5ALKA 5FYQA 1GPDG 1YQWA 2X3FA 4K9MA 2KLHA 4FUTA 1UF9A 1T2UA 1ZW6A 1VLHA 2Q4TA 2VNJA 1H2YA 2FWNA 1NJFA 5F5NA 4JLSA 4NU5A 5BORA 1Q6YA 1NI5A 2WAMA 1OH7A 5FHRA 4DXDA 1NV9A 2EEZA 3HCPA 1FNMA 4JW1A 3B2EA 2O2IA 2QTGA 3EZNA 3EZ9A 2A33A 3QW0A 4MX8A 4XKJA 1I5EA 3POVA 3AF2A 3EG9B 3BPSA 1PJ3A 4K9PA 2COEA 2YV1A 4EYSA 3KQHA 4DLWA 4U9UA 4BYGA 2EIHA 4HB2A 4FDAA 2H9IA 1T6XA 3A7DA 2L17A 4IVRA 1CP2A 2ZE8A 1GFIA 5I7UA 4AD8A 5IZCA 2D00A 2R7MA 2ZPTX 3HBAA 1U9IC 4C21A 2Y1EA 1SXQA 4AG6A 1IK4A 1J6UA 3ABRB 4C2UA 2BGRA 2YWHA 3A2NA 1ZM9A 1A97A 3NHYA 3QRWA 3KR9A 4CBEA 3H99A 4MW3A 1QM5A 2JK0A 1BJRE 4EEZA 4BRWA 3LWNA 3EVGA 1SAYA 1Q1GA 5IULC 1NW5A 4YWHA 5JQGF 4AY6A 3JQPA 3L34A 1Z39A 1XPJA 2GEKA 4A3SA 2GHQA 3B6MA 1M34E 1D5CA 2EILC 2AEJA 3K31A 2YIDA 1A8UA 5BSGA 4TKMA 1MH9A 4CMEC 4QXQA 4MW8A 1QX3A 1MC5A 4NV0A 5HJ2A 1U9JA 3GFSA 3CGGA 3PT9A 3R8CA 2C95A 1U5CA 2W2LD 5DN6D 2HKVA 4FNGA 4ZJZA 2QMZA 3B85A 2ZUBA 2QYHA 3QZUA 2ZRMA 4UNQA 1H22A 2ROQA 2X4IA 4A16A 3Q7TA 4FOTA 3NYLA 3ELYA 5I8WA 4YAEA 1VCNA 3BCSA 3LX5A 4DV4B 3MJDA 1Z47A 1SWWA 2XZTA 5BWLA 3GRVA 4RVNA 3CF0A 2J6CA 2G72A 1QG4A 2X22A 2BM9A 3IHKA 1A9XB 2OTCA 5H59A 4QHYA 2OFWA 2I7DA 1M7HA 3H2ZA 2A9JA 1BWRA 4XCXA 3A9RA 4NPCA 5LUAA 1U1CA 1VKRA 4R41A 3IQXA 4EMTA 3VHRA 1OB2A 4OX9B 3S4YA 4B17A 2ZS8A 2CY0A 4CM9A 4R7GA 2JHFA 3PP8A 2DZDA 2DF8A 4UM7A 2PNOA 1YHNA 3DBIA 5ELXA 3U6BA 3QQPA 5CVJA 4E31A 3P9QA 4DMUB 2AZDA 3OOEA 4WFKA 2C4WA 4CNQA 3R3JA 3BQMB 1VGRA 5KYVA 2JRCA 4X3OA 1O4WA 3BMQB 3LRXA 2PZFA 5ILQA 2EP5A 1D0SA 4BZWA 2AW3A 2Q5FA 1KK3A 4QELA 1UT5A 4Q7LA 3HJHA 4IHKA 5JV5A 2VZLA 4PLPA 4GR4A 2CGEA 5AKZA 3LPMA 3ZDXB 1MENA 3HWWA 3G5MA 1PZMA 4JC0A 1NQOA 3UHFA 1XD2B 3VYUB 4NTAA 5J63A 4IQ0A 3PD0A 2VPTA 3RO7A 2OEPA 5A7HA 4BVHA 3TQRA 4QDOA 5I9LA 2BI7A 4AXBA 3U7GA 2QVLA 1K05A 2WJYA 1RXSA 1G38A 5LZ5A 2AFHE 3RTBA 2O59A 2I76A 2HU2A 3AI7A 2CFOA 4K2HA 5JWOA 1DTWA 3NHMA 3IKMB 2JGMA 3EQLF 4Q6WA 2NGRA 4QDTA 3NHAA 3A37A 1QHHB 2FSSA 5YASA 2KYRA 1XZ8A 1UBFA 1UKZA 4H6XA 1R50A 4YH1A 2GN4A 3QUTA 4WDQA 1GG5A 4NZMA 3AM5A 1N4AA 3BIFA 4QPPA 1RKVA 4GLFA 2IYVA 2G1JA 3T3MB 4MCHA 4KXLA 1LK0A 3VKGA 3WIBA 4ZYYA 1MT0A 3R5TA 5EMLA 3Q5GA 2PIAA 1ZD2P 2QVYX 2NU7A 1XGKA 3LTEA 3O4JA 3T9BA 3R40A 1OROA 2RAUA 2WG0A 2NO6A 3DKKA 2INGX 2ETVA 3ODPA 4FLFA 3RVSA 1WY5A 4Q47A 3X0DA 2CLLB 4DWJA 4BXOA 1PL7A 3ZV4A 2ESRA 1UWLA 3KQMA 1VHWA 4FE7A 1MNAA 3BDAA 1NL3A 2AOTB 4JKIA 1JZTA 4CEIA 3GGGA 1AV7A 3FNEA 1YACA 4KXYA 2ODWA 1FQKA 1Q50A 3ZDYB 4W1QA 4WCFA 3THXA 2O50A 4KAAA 4MQEA 1QK3A 2PMWB 1E9EA 1OOEA 4FFPA 4JWTA 2QXUA 3UOWA 5JPIA 4JB3A 4URFA 1XMXA 1Z68A 2CYCA 2IXGA 4IY1A 1SOWA 3S99A 2I62A 3JAKA 4CIPA 3QF4B 5GGXA 5EKTA 1QDEA 1LWNA 4MPTA 3B48A 1EWQA 4O4IB 2QQGA 4Q3LA 4RTKA 4NU8X 2HFJA 3O9ZA 3BIXA 1ZGCA 1J21A 2MT9A 4HLQB 3CONA 3C43A 2I7CA 1AHHA 4WZBE 1A7UA 3O39A 2PN1A 4Q5IA 1LJLA 5KTTA 4N5DA 2BEKA 1T6ZA 2YFQA 2C29D 1XZFA 1M2FA 4MS1B 3TWOA 1UWCA 1ODCA 2ZPUA 1XKLA 1GPJA 2CE2X 3FMVA 4EF4A 3JS5A 4C4PA 3AMVA 3W3AH 2BONA 4GI1A 521PA 1MIOA 4DRZA 3KVNA 3REGA 2HWUA 1T4CB 3FZNA 3KELA 1R6UA 1SBZA 2REOA 4PZPA 3PHIA 1MABB 1Y1RA 2XTZA 3GGDA 1J49A 4NBWA 3CV3A 4LMAA 1KAHA 5E2IA 5LFAA 3FOBA 3CWQA 1W6RA 3GMSA 2FSHA 4KH0A 4Q4JA 3IRVA 3DZJA 5IH7A 2YYAA 1P6XA 1KYYA 4NBNA 1CR2A 3WXBA 2GYWA 5DS5A 4MJ7A 4AZVA 3SXKA 2D8MA 1TC2A 1TT5B 2QTBA 1J9ZA 4Z3KA 4DQDA 1WP4A 1THTA 4P1ZA 3IP1A 4YONB 4UXHA 4W9RA 4YAKA 2OCCC 1QCDA 4BFCA 5DT9A 3B3QA 3EQZA 3QX8A 1Q7CA 1AD2A 5IBCA 1FTNA 1T6UA 1JQBA 4PG4A 1ISFA 3J7TA 5F73A 5KWEA 2C0QA 3OZCA 2IV2X 4JY7A 4F2PA 4M0MA 4B2PA 2QRZA 2VNIA 3OM1A 5BYBA 3LO8A 4AJ4A 4Z4QA 5JSUA 1N2IA 1OREA 4CMHA 1MOPA 4Y3UA 4AO6A 1TADA 3ELBA 2J5RA 2GCIA 4O6NA 3CN7A 5FTNA 3KOXA 1M6NA 3U7FB 4BMZA 2DU8A 4FFOA 1TUBA 1G8GA 3GUZA 3K7DA 3TSCA 3S29A 3H1BA 2H5LA 4L02A 4RAOA 4K40A 2QX4A 3BL8A 3R7NA 5B37A 3MBOA 2HV6A 1NOIA 3FDIA 5LCXA 3LKVA 1WHSA 1L4GA 3M4YA 1A8QA 2E49A 2Q6KA 4BC0A 4TV9B 1H1TA 3IAFA 4ESOA 1J1UA 1LBEA 5A5GA 1RI3A 3HFJA 3WL3A 3ZWMA 5AJZA 4IQ8A 3IPXA 3KS9A 2RD9A 1SHLA 2X86A 1QBKC 1BFKA 2AN5A 1RPAA 2GZHA 5F9HA 4G0PA 1VKHA 3V2HA 3LPNA 3S1SA 2QM3A 2BUBA 1BMTA 4BX2A 4FWTA 1THMA 5KJFA 3T5MA 5D5PA 1UODA 4P22A 4MROA 3D6MA 3E84A 2DFNA 1KVRA 5JSLA 1QQ3A 2H0RA 2IXDA 4GNKA 3R9XA 3GCXA 2H2AA 1P5JA 4IDHA 5HF8A 5BXYA 3K0AA 4X44A 4PICA 3E9QA 2O8CA 3L6CA 3ZIBA 4CEHB 1IXZA 2BEVA 2AZMA 4MWOA 1WUHS 2B69A 4B46A 3CF6R 4HDNB 2HIMA 1M5TA 1U31A 4PU0A 1FMJA 3G0DA 3UEOA 2NZVG 4MTGA 3PQ2A 4BMOB 4EYGA 4B87A 4GR5A 2IEZA 2H59A 3DYIA 1OF1A 3EFOB 2KJGA 5BUSA 3U6KA 1GZVA 4UU7A 4EYOA 1OTYA 4HC4A 2DBRA 5EJIA 4L0CA 5FXMA 3DXFA 2O7RA 4PGMA 4L72A 5IKPA 4YMIA 1QO0A 5B1BC 5LQJA 4G1FA 1NWHA 2AQKA 3OT1A 4QI0A 5SICE 4IX1A 4N5LA 4K6OA 1O9BA 4Y2GA 1A4IA 3L06A 3KU1A 5EI5A 4UTRA 1QFZA 2VUHB 4LRSB 3GJYA 5CX1B 1WPGA 3SBDA 3SI7A 2GJ4A 2ZJYA 1USKA 3NBUA 1LBQA 4B6JA 5K8LA 5A4DA 2ZTLA 2ZTVA 1JMYA 2R7OA 2NXWA 2WOOA 3FKJA 1MVLA 4Q66C 2H1RA 3ZCVA 1I7LA 2XLCA 2X6TA 1VJRA 1ZJJA 3ADBA 2CC2A 2ZUTA 2XY4A 2NSJA 4UATA 3P4UA 4YS6A 4AURA 2DC1A 3M81A 4U8HA 1U0LA 2W58A 5ECDA 4KRGA 1E1LA 5JHGB 3H0EA 2K6GA 4BO0A 1HFJA 1ZK4A 3ZPXA 3TLBA 3IVAA 4H4EA 4PBTA 5D3MA 1ZD5A 2OXTA 4FFNA 3TBKA 4JENA 4X97A 1YFZA 2JPDA 4O4IF 3JAWA 4TXMA 5L7YA 5DLEA 1V6AA 1UMCB 4ITVA 4BQNA 4J8PA 3TXXA 3O4GA 4QDUA 1YIDA 3NM6B 421PA 3RFUA 4FHCA 4WFQA 1XXLA 3BGOS 2XVXA 4AZTA 4KWTA 3OY2A 1P18A 1L5WA 5EQDA 3KSBC 1FXWF 3B53X 5KJEA 4MWDA 3KQLA 1U0EA 3NWBA 1A04A 3VU9A 1WD5A 4V02A 1KZ6A 4PC3A 5DNVA 3HG7A 4A5OA 1D0IA 2FX3A 2VPPA 3CZQA 3UK7A 4C87A 2UZ1B 5CYOA 1WUTA 3JVUA 1EWYA 4Y6RA 5DK4A 4DA6A 3CX7A 3OJWA 3KEGA 2CFSA 3MOSA 3KAQA 4KQFA 2J46A 2IPOA 2G0AA 1VMAA 4A0SA 1J70A 1POWA 3KFLA 4HADA 4L9RA 9LDTA 4B84A 1I4LD 1XOIA 2OHVA 3HXOA 4YCNA 5FUBA 5IJWA 4LK3A 3AVQA 4F72A 3MCWA 3RYCB 4R9RA 1BCRA 3I72A 3T4EA 2AOXA 4ZI2A 5FYDA 4PFKA 4BO4A 1LM3B 1T1RA 3JYNA 3RTGA 5FBHA 3D64A 3NDRA 3DE1X 4PR0A 4ARZA 4ZI7B 4PSDA 4IHJA 2X51A 2VXBA 4ENVA 1LGYA 3ZI0A 4LVCA 1EFAA 3QWHA 5JALA 4HNTA 1F3OA 2VDMB 3LCVB 3WSVA 3IUEA 5I47A 2B99A 4BRUA 5JG7A 1JIUA 4BMSA 3F9IA 3LUPA 3SC6A 3UA4A 4MQFB 4CTKA 3WWOA 3PEWA 1FQOA 3RANA 5ALIA 2DFLA 1N36B 5CT8A 3BH0A 1VJ5A 4M9XA 4NVRA 5CJJA 1GCIA 3DWIA 4KLZA 2PCJA 3AUSA 3DOFA 4C4YA 1HETA 1ZK3A 3TINA 3SE7A 2Y1GA 3UUWA 3W6OA 1G5ZA 4J16C 4LE0A 2XSZD 3BXGA 4FFSA 4K3UA 4ULVA 4R1SA 2HY7A 2XT0A 4BGIA 4TV9F 5HF9A 4WEQA 4LJ6A 5DNAA 4XQ1A 3D8HA 1Y5LA 1Q19A 5LQSA 2PGJA 1P5HA 1URPA 1T5DX 1LC3A 1I3MA 2JVKA 3GEGA 1CRPA 1MO3A 3CAXA 4MR8B 3OM0A 2W2KB 1DAEA 3KAPA 2W8BB 3QE2A 4IOKA 3H5RA 4KQMA 4Y1EA 1GN8A 4QT0A 3KB6A 2ZXOA 5C9ZA 4IV5A 2MINA 3IAEA 1PT8A 4OHKA 3SFZA 1XMJA 1O6BA 3H9JA 1U0BB 1XFAA 3DFIA 4WOBA 4B79A 3NVMB 5I7RA 2G5CA 1ZH8A 2FZ5A 5LLSA 2P9YA 1OWNA 4D8YA 3E9DA 4Q1BA 5LXTB 2XXAA 1ZC3A 3OD1A 2VRCA 1HDIA 2Z4RA 3O8LA 3BQNB 2DEUA 5CAEB 3VGPA 4X8LA 2G1AA 2QENA 3EIHA 4TS4A 3VR4A 4IV0A 4G0MA 1QP8A 2YJ6A 1C7IA 3FOOA 2AC4A 4OVKA 1T3ZA 5BR1A 1WW8A 3SEZA 3H9GA 1DQNA 1GP2A 5F4ZA 3AXSA 1WM1A 1O57A 3K0HA 5CM2Z 2BGGA 4DDUA 5F2NA 2HHHB 4DM3A 1KDPA 2Q27A 1X87A 4D46A 1XCOA 3OI7A 2AN3A 1WWPA 5ED0A 4PN3A 1RCTE 4XWGA 2OHJA 4H7FA 2XBLA 4G97A 4KIFA 2ZATA 3PPYA 1JIXA 2IU6A 2WJAA 1PSWA 3UGJA 4Z4IA 1PJSA 4MVJH 3TCXB 5JW6A 3UFXB 2W71A 2H4ZA 3O8QA 3UG7A 3PNBA 4N01A 4ISBA 4X1IB 3QFSA 5BN1A 2QTVB 4XGIA 3L7JA 2H11A 2JAUA 1ZHWA 3CURA 3T7RA 5C5DA 2MYSA 4ALIA 4NCJA 1QIEA 4FS8A 4CKEA 1JEQB 4A27A 2KI5A 2FFBA 1XR3A 5DCYA 4DLXA 5FWYA 4E18A 4PEVA 5T3TA 4C76A 3AEQB 3GJ3A 3N6XA 4ZQHA 3GLIB 1LBTA 4X1YA 5FI0B 3ZV7A 5J9FA 3X2SA 4JX8A 1D0VA 2NLOA 3Q0IA 4OMUA 4KO2S 4X45A 4WLEA 4PYRA 3WA7A 1HSOA 4ML3A 2RHRA 3U3XA 2UVDA 1XZGA 1G17A 1V96A 1VPDA 1H2HA 3I30X 4RU1A 1HSZA 3LH5A 1QTRA 1JAYA 1NV8A 3GRFA 3WTBA 4HGOA 4XPWA 1E0DA 4YJ2B 1SXJE 2CHGA 3ZWCA 3G2QA 4XLLA 1DAFA 4LA4A 1IBLB 4RVHA 1M1YA 4GWKA 5HIIA 5IKOA 4V0NA 3CT4A 4FEYA 3WNBA 3RYFA 1KKMA 4K6KA 4AVYA 1GO2A 4Y6LA 1Q0QA 4EG5A 2IXBA 4X66B 2DY0A 3B36A 1NUQA 1YDFA 1D2HA 4Q39A 3T5PA 3ZLVA 3S55A 2HX1A 3RH3A 2LFFA 2P2YA 1N0HA 3DBRB 3QWAA 4PAMA 1A9TA 2XMPA 1W0CA 1PJZA 3ENKA 2RE8A 1TMOA 2OYCA 3GOQA 3PNYA 2PT7A 4G1BA 3QYFA 3SHVA 4QT4A 2L19A 5HR5A 4J0FA 5AOCA 4JZAA 2R7TA 1GZDA 3OPVA 1XFDA 4H27A 1MAVA 2OB1A 2DVMA 3N59A 1W5BA 1EVKA 4P92A 4GMXA 1X42A 2J33A 1LB1B 5CHEA 2JVIA 3ZJYA 4IEFB 4FFDA 5TXGA 3KKQA 3FCEA 4R40A 4C0SA 2G77B 5FOUA 4DV7B 4ZI7F 3VM6A 4BTEA 2ZRIA 4X41A 1ZM3A 3TNYA 1I2MA 2XNHA 3WHPA 4XZ3A 2EFEB 4A6DA 1M6HA 5JUWA 1E5TA 3GHHA 2J7KA 3HACA 4ER0A 5KU1A 2ZYWX 3DEJA 3O26A 4F6LA 3U5TA 2ZSIA 3LCRA 4X0EA 4UE2A 5BURA 3G88A 3PRKE 4C07A 3T7KA 3RF7A 5FBKA 5DO9A 3NALA 3ECCA 3PG5A 5BUOA 4F4IA 3BL5A 1VK5A 2BKAA 1A3CA 1EFUA 3CU5A 2PKYX 1DUVG 5F7JA 4CIDA 1XL1A 4U8GA 2QBYB 2R7XA 3OMLA 5EXPA 3BTOA 1FIUA 1BN6A 5ES4B 4V0OA 4I50A 5GWXA 3OQJA 4CTOA 3ZU4A 3A3PA 2FMIA 3DDOA 4E94A 4R8MA 4PYJA 4NKRA 1EH5A 3LCUA 1YL5A 1NURA 2B9VA 1WSBA 1W47A 4TRRA 3N2KA 2B8NA 1NJ6A 2CF6A 5KYWB 5HKBA 2QYTA 4ZV7A 3HN6A 1DKNA 3M82A 1ISGA 1UK6A 4YAUA 1T4MA 1ULZA 3ZJUA 2VA8A 3ACDA 3C3BA 5L8VA 4M0CA 2WHYA 4R3UC 3RG8A 3R9WA 5IDYA 2IHJA 1NXOA 5EZ6B 3O8OA 1GU7A 2PP4A 4R2MA 4XOIA 1W44A 1TD9A 2GFHA 3TUIC 3UJ9A 4LJRA 3ABMC 4YCDA 3GEMA 2NO7A 3LM8A 3L1VA 1OA1A 5MN4A 4PG6A 3JYPA 1GWNA 4NOKA 4RS3A 1M57C 3ZE1B 1U5BA 3PUWA 2ZI4A 4PAQA 5LXTF 3UPUA 2WSSA 3ND6A 1LNZA 3NH9A 4UNRA 1ZD9A 1TGVA 1C7EA 4ZANA 4D8TA 3E1GA 4YUVA 2PS3A 3FSGA 1LPBB 4CHGA 1Z5OA 3QK7A 5NLLA 3GT3A 2HBQA 4E21A 3HK2A 5LYYA 1E2QA 4G5XA 4ZGGA 1VG1A 5IJ9A 3WAJA 2GKGA 1SVLA 3AJAA 5ALNA 4J6EA 3I34X 3REQA 3QLTA 4MRAA 1DZ3A 4NQFA 5TPWB 3KB8A 1CDOA 3TSZA 5ALHA 9ABPA 3ILVA 1GNSA 3H2IA 2C9CA 3M8KA 5EJAA 2O5CA 4KLAA 1L7CA 4QUEA 5I4CA 3PWKA 1L7MA 4M0LA 4R2XA 3LUJA 1E9BA 4JCZA 1WVMA 1M72A 2KX7A 4RIEA 2KE5A 4MRMA 4NAVA 2P9CA 2GBPA 4NCAA 1FRVA 2M4EA 4YXWD 3D6JA 2F3UA 4LJ9A 3GJSA 4CMIA 3PSHA 3FHTA 5DMXA 4HT3B 3GN2A 3O82A 1ZVQA 4JSRA 1Z7GA 4ETWA 8ATCA 4NMHA 5KVVA 3LECA 3LBHA 2MWMA 2XYVA 3PUKA 4RZSA 2FDXA 4B40A 4QQFA 3V4RA 2ZM6B 3AQ4A 5DBGA 2AJBA 2A5YB 4LYJA 2HU8A 4R6WA 4YRFA 4MGEA 3LGXA 4GKBA 4E5KA 1I2AA 1MT3A 3OFKA 1LLUA 3I0MA 1N3YA 5L40A 3UWPA 2CMFA 4B4KA 2DHQA 1V35A 1TKCA 2ZVDA 4EMSA 4LXQA 2Q7XA 4MHSA 3ETHA 2YKGA 2GM5A 4XYGA 1ZD4A 3I5MA 4AMGA 3LXXA 2QM8A 1E7MA 3D6NB 2LCIA 2W2TA 4YJ2F 2EDAA 4IOJA 1H2WA 3HUTA 1KMHA 2QHXA 5B12A 2HCTA 1DX9A 4HNSA 1HX7A 1X8KA 4RNCA 4MHOA 3TOSA 4EZBA 4TYNA 2CN1A 1WXHA 4M46A 1ZVVA 1PO7A 3CKYA 5BWNA 1Y3DE 1KS2A 3LWZA 2GUGA 5AKXA 3PHJA 2GKOA 3J81A 4JH0A 1KI4A 3TZQA 5JI3E 1Q3HA 1CEEA 2ZJBA 4P32A 1VLTA 1G59A 3PIRA 4BWVA 5TNXA 3GZ4A 4WA8A 3IQ6A 2A30A 2N1MA 5FRDA 4B74A 3MXOA 4CL2A 1PQUA 5HF6A 1HEYA 1R4NB 4Q9HA 1FZQA 1N5DA 2N75A 3CZ6A 1NPDA 1TF5A 2V5AA 3BE4A 2L0XA 3CUEF 1JSXA 3FROA 3A58B 5DWDA 4PJNA 3BRCA 2HTEA 3IXLA 1WDMA 2HSBA 4LUCA 3R74A 3IDSA 2F1IA 2M6RA 2WHPB 4DA9A 4S1VA 4HLDA 3F4BA 3W4YA 4H60A 3O10A 3RYIB 4FSXA 5KTMA 4ZJPA 1U2RA 3NUZA 1ZD1A 1K7FB 1J0EA 2IHTA 5DASA 1U7ZA 3ABIA 3PCRB 5H3CA 1THZA 3FOAA 3VR2A 3P2MA 1F9EA 3HWRA 4ZGWA 4C3BA 3LNRA 3SD7A 3B1FA 3EXG1 4NDAA 3DCNA 2I2WA 4I55F 4R3WA 1DBVO 2C8VA 3RVMA 1G98A 3K8ZA 2DWCA 3U49A 3G9ZA 1YK0A 4NPHA 3A4IA 1RRFA 4E5DA 4FT2A 3AHDA 4RCYA 1UL1X 4U2FA 4HNAA 1EK2A 2H1CA 5FI5A 2WAYA 1ZCBA 3QXJA 3AVWA 2VS1A 4ZEWA 2HLDD 4M54A 1GNQA 4YL1A 3W8FA 1G60A 3KETA 4XPZA 4KO1S 3ROQA 4TTSA 3LIIA 2M6SA 4A26A 4N3AA 1KH1A 2EYUA 1P1BA 2BZGA 1HO3A 4XIFA 2A88A 4CE6A 2YFKA 1D07A 1EFHA 3H87A 2J7PA 4TMXA 1ZQ1A 1I7NA 1IIBA 2VWHA 4D45A 3OP4A 4PR3A 3EXHC 4AL0A 1KFEB 3QPWA 1HDEA 1C8KA 4DPLA 3TSYA 1EHIA 4IJWA 5LA6A 3TK1A 2WAOA 4IILA 3DHEA 1NF3A 1H9BA 4D0GA 4LKOA 1KYZA 1JIIA 4D9JA 5JCJA 3N75A 1M6TA 4LCJA 1FLNA 4EB8A 3VH2A 5JOQA 1T9AA 2XD9A 2Z58A 2GZ2A 4WDRA 2GZSA 5ELMA 1IB0A 1HMYA 4BV2A 1ZCZA 4MKHA 3X2FA 3ZG6A 4DR4B 4LISA 4QSHA 3HDHA 1DFHA 4J9UE 1VOTA 4QFDA 1ABBA 1PYGA 1SG6A 1US8A 1DAKA 2ZSAA 4OXKA 2DR3A 3I37X 3KB2A 4TT8A 1QWOA 1NG1A 2NZYA 1IPEA 1UZLA 3JD1A 4RA6B 4ZCPA 1C5KA 1S02A 2VAPA 2ZBDA 4YMUA 3PHCA 1K8QA 4H6VA 1CUDA 3WLEA 3O47A 4KR6A 3E9NA 4HTFA 4TL9A 5JAUA 4BFUA 5H68A 2VBCA 2GFIA 4OHCA 3PICA 1Z0DA 4LOJA 3ECAA 3FVRA 5IUNC 3ROPA 2GAJA 4HGQA 1ZEJA 3OZWA 2XNCA 3W4IA 4TYQA 1KJ8A 3G0OA 1LI7A 1G8FA 1QHEA 1UBHS 1U0SY 3E7WA 2IHYA 4PSKA 1UFRA 1QGDA 1A7AA 4ZT5A 2C7BA 4BFYA 1XF9A 3GFPA 3QSGA 3EXFA 2BC9A 5K3OA 5T4FA 1R6BX 1TK9A 3HJGA 2Q9UA 4P0TA 2H5JA 1TGYA 4BTLA 3CB4A 1N6PA 5B64A 4WK4B 1IWOA 2D0DA 1R88A 4IHQA 5JNTA 4QGGA 3LCMA 4UUBA 1KKLA 1O96B 4D4IA 1AB6A 5KSPA 4EHNA 2ERYA 3MJ4A 7REQB 4DV1B 5JYBA 3EAQA 1K3FA 2QIPA 4BE9A 2GA0A 3FPCA 1HT0A 5DYNA 4UVHA 3AR6A 4QYIB 4TRJA 5FI3A 3TXAA 1HL3A 2AKYA 2ETSA 1V26A 1GN9A 3W5SA 1DRUA 3LC1O 2YUIA 4U5EE 4QNNA 1XRPA 3MZ0A 4GG1A 1ZJ5A 2Z4TA 1XTTA 3FCUB 3V4LA 3V4OA 5TGDA 1JILA 4B47A 2JLCA 1IUOA 2X40A 5I7FA 4J7AA 1Y8QB 1OBHA 1NT2A 2WJJA 4XWJA 4P38A 3O55A 3A6DA 3RUFA 2EIXA 4MB0A 1PJCA 2R7QA 2X8LA 4DUYB 1M2GA 1X19A 4ZVPA 3KT6A 3SJ7A 3GYBA 1VSBA 3DDSA 5C8ZA 3U3OA 3N2ZB 3ZDQA 3EXEA 2XQFA 2BGNA 4DWWA 4X6UA 4KTVE 4IVNA 5JSZA 4PGGA 3ZYCA 2P4QA 3PRHA 4QDXA 2O8EB 3KTOA 4BMVA 2TMGA 2QE9A 2BUAA 4I6EA 1WDKA 4MPPA 3DKIA 3ONWA 2NT4A 1XYYA 4BNUA 3EPPA 2J9YB 3TECE 2F8SA 4KDCA 3DMDA 2P77A 3HNLA 1K89A 2HQSA 3KEMA 1YRHA 4GVXA 1NJ8A 2JFVA 1IM2A 5E6UB 2NP7A 3FFWA 2NYRA 1IQPA 5G1NA 1H93A 4MYHA 5HK9A 4WJZA 1V16A 4BAGA 4Q12A 3QBJA 2ZJ6A 2JLSA 3PS9A 5KNDA 3SE0A 3CSSA 4NSNA 4K1XA 4NBVA 1N75A 1AV6A 5IVDA 1U8FO 4UHDA 4HH4A 3IMEA 5HEKA 4HRYA 4YJHB 3MYIA 3K7EA 2XOXA 4GX1A 3ZWXA 5REQB 3HB9A 2PWAA 2RJ3A 3RAEC 4FDLA 3V9PA 2Y99A 4PCAA 3MD0A 4FDTA 2C5GA 3FCYA 3MMSA 1JKIA 3UV6A 4B3IA 3VTZA 1FBNA 2R8PA 2EHJA 2DJIA 3WVNA 3M2TA 1ZY2A 4NV3A 3JQGB 1QU2A 1D09A 4YRCA 4ZCMA 1YVIA 1XHLA 4BPMA 4R68A 2IY9A 4C9BA 3PCTA 4N40A 4DSZA 4MICA 4DCTA 1Q5PA 4H0FA 3PEFA 4MIOA 3VHQA 4B33A 5JXJA 3BHMA 3A26A 2C2WA 2F4VB 4RSHA 4PZ9A 4F4FA 4BP3A 3PJEA 3L04A 4GSLA 5JZOA 2FV8A 2VCBA 1PHPA 3SQOA 3Q7GA 4RX1A 1EFTA 1E3SA 1EFVA 1OT5A 4QBFA 4RFLA 4FE3A 2DWQA 5IABA 5JARA 2PZBA 1N6KA 1BHO1 1GRNA 5EP1A 2PV7A 4OQDA 1GQSA 1W0JA 5K3AA 3N2GB 1G8SA 3M9WA 1R74A 3ZX4A 3U26A 1PIWA 3EF3A 3AW8A 2PPLA 1GTSA 3QVXA 4NY3A 5CA1A 5M29A 5COAA 2FE1A 2PS9A 2WT9A 5DLPA 2WIDA 3LUCA 2YVQA 4TYPA 5GIOE 2H06A 2X3YA 5B1YA 3DZ8A 4KJXA 4EYKA 2HA5A 1RAAA 5I5GA 4MYTA 3KT8A 4XR4A 3SX4A 4XM1A 1ZFNA 3AJEA 4FC7A 2VXOA 5L95A 2WPDA 1RLTA 4Z2AA 1FRFS 3RI3A 3LE8A 2NO0A 4B7CA 1IZ7A 3A6EA 3M1LA 4EEKA 4ETNA 1UPAA 4DLNA 4ND8A 2HF9A 4EG4A 4X1KA 5CW2A 2WYUA 3FCSB 5ITVA 4ZAFA 4DW8A 4JLNA 1T5SA 3WK8A 1P81A 4D74A 5BV8A 3BGDA 4DNQA 1TAQA 3EIFA 3VISA 1DC5A 4UHFA 5SY9A 1I0IA 4J1QA 2A5FA 2Q4FA 5ALLA 2QXTA 1EE9A 1D2GA 2XMSA 1DKLA 4F9GA 1QCYA 3CH7A 5FDFA 3BRJA 2YOHA 1COWA 2X4GA 5ICGA 3N0XA 1U3GA 1FFGA 4ZREA 3TN7A 1S4QA 4YJGA 2XUJA 4JYAB 5AP9A 3PFKA 5IANA 2MHCA 3OURA 1ADFA 4BWFB 2WA2A 2JDID 4R8LA 1P91A 3DCIA 3AB8A 5BUQA 1JDBB 2C9MA 4IARA 4DXWA 3W2TA 3ITNA 3JWGA 3KVVA 2GHIA 1SPBS 3OKAA 5BSRA 1DBPA 5D92A 5BYJA 2VT3A 1QU3A 4QXOA 1FFDA 2R84A 1GKLA 3WY9A 2CVZA 4HX5A 4EPYA 5E38A 5EIOA 4ZDJA 1OMOA 3FETA 2HDWA 4R16A 5AH0A 4CBVA 3B5EA 4W8GA 2J08A 3BMXA 4OLBA 1BFUA 3E5HA 1V4AA 1Z5NA 3E9MA 4MWBA 2C97A 4DGQA 4EB6A 1VJDA 3CF2A 3OFND 2P3OA 4HUQA 2OAP1 4GP6A 4N4AA 2OV2A 3AF1A 4YMVA 5FOWA 5L7TA 3R8FA 4HNRA 1JTEA 1T43A 2HGSA 2WF8A 4IX9A 1ZQ9A 2E89A 1GL7A 3IP5A 4G5GA 1FS4A 1T2EA 4LXYA 1PF7E 3VXKA 3MCTA 3K5IA 3FNHA 3RGWS 4DILA 3AR9A 4MI1A 5SYMA 1OH5A 3VDQA 1NOJA 5JRZA 1TMKA 5HPYB 4K28A 1JQEA 4IBOA 4OATA 1ZCFA 4YQZA 3V6MA 2O8VA 3PUHA 4LJ8A 2WYVA 1VJ1A 3UC5A 1GGKA 2VP4A 2VT6A 1ENZA 2GN1A 2Q1WA 4QFBA 4ZDKA 3MEQA 1NFNA 4E4TA 2QGFA 2FZWA 2GYUA 4U7FA 1DTWB 1XZKA 1PR5A 4IDGA 2PFKA 3SYMA 5GPGB 1UEXC 3W9UA 4DV5B 1JI3A 1YR7A 2QE6A 4UOZA 3MJHA 4Q01A 3KNZA 4EF6A 1TFKB 2CKDA 1PT7A 3ETLA 2ODQA 1G7CA 2X77A 3GB9A 3I1YA 4CF6A 3E9RA 5AW9A 3O4VA 5FLXA 4NCNA 4XYBA 2EFYA 4NG4A 4KXXA 3WFJA 2IOHA 3Q2KA 3FHOA 2DH6A 3AM4A 3KTDA 2QJOA 4U3JA 2FEOA 4KXMA 3C45A 4LZOA 4ZU6X 5CEFA 4OIQF 1NNI1 3PQCA 4J0IA 4JBIA 3FX2A 4R83A 1KJ9A 2NU7B 2VPXA 4BO3A 2NYVA 2C84A 2NZ8A 2OSVA 5LIPA 3LGAA 1YB5A 3OPQA 4EW2A 2VTVA 2NAFA 1C0KA 2TMDA 4BXOB 4CYMA 3B6KA 2W93A 2PZLA 4R8RA 1YB1A 4CEIB 3C3PA 3BM5A 2WSLA 4Q48A 5JEDA 2DRIA 1HA3A 3KKEA 4WCFB 3SNKA 3T7IA 3THXB 3RC9A 2YBDA 4MQEB 4HAWA 2WF7A 4D3SA 2NVUB 3GJQA 4A92A 3QEAZ 1ADBA 3G89A 3JAKB 4KVZA 2IC5A 1CIPA 3UVEA 2Q3CA 5FAKA 2O57A 1MH1A 2JI9A 2WG1A 4DBQA 4TXNA 1P1HA 2VYVD 4JUCA 3G2KA 5CBPA 3P32A 3COYA 5CDFA 4GPZA 2ZD9A 2JLBA 1W76A 1ECJA 1TZMA 5H7XA 2MSKA 4MLDA 4ZDWA 1JEAA 2ZSDA 4L51A 5KUTA 5IUKC 4WLUA 3MWKA 5DYTA 2YMLA 5JYEA 5I3CA 1TYBE 4Z1MA 2YZGA 2FOLA 4JLAA 4L75A 4QBKA 1E6WA 4J7TA 4P4GA 4HAZA 1QIJA 3LLIA 1UJBA 1K1EA 2CNKA 2JCXA 3F8WA 4HBZA 3JVIA 1KDVA 1MAWA 5K0IA 1IQUA 2GLXA 2FPWA 2WWXA 4B7AA 3KE8A 2KB0A 1KQ3A 1GILA 1HE1A 1GRCA 3KUUA 2R6HA 1MP0A 3TGWA 1N9GA 3BJEA 3QU4A 3I1FA 1MHPA 5BN4A 3HMKA 1QFYA 2XZDA 5BNFA 2ZSUA 4O1HA 1EB9A 4MVWA 1XSEA 4XEVA 4POAA 4Q4JB 5KJCA 1G20E 3IP8A 1ND6A 5FQNA 5FTKA 4FGJA 4HXFB 4OFWA 3ZLBA 4UHKA 2VUUA 3VR6D 2X58A 1RS0A 5EG5A 1HRDA 1E98A 1RI5A 1AGRA 2IS4A 3RUCA 2JLVA 4GEKA 3V3TA 2Z5FA 1O5HA 3W5DA 1B68A 4NATA 5M3BA 3N28A 4M83A 4YCBA 1U8XX 3ORYA 4UXIA 2ZYDA 5DYIA 4IGIA 4U9HS 2YXNA 2NYUA 1FFXA 3KVRA 2GAIA 1YBVA 1D4OA 3VC7A 4JKOA 4YROA 3VR3D 4UNSA 1O5OA 1TFOB 1G6Q1 2P62A 1OPXA 4OFBA 4FXOA 1PG2A 5MFZA 1RMTA 3D02A 1ZL0A 4TL7A 1NQXA 3D6HA 3LBIA 3IX7A 3WADA 4N8SA 1Y3HA 2PBEA 1TUBB 3MMNA 2BYTA 3WLOA 4LX8A 4AQ7A 5DNUA 4KXFB 1I7SB 3PGA1 2LDBA 4MPRA 4EJ0A 4LF5B 4RKQA 2FCAA 2GZMA 4ZOCA 2EFDB 3OC0A 3GA7A 3D4IA 4P58A 1GKUB 1VC2A 1T5BA 2D1QA 4LERA 3LOUA 2G76A 1H3NA 4PE5B 1TB4A 3ZTYA 3KD3A 3PGMA 3KOUA 4NYJR 5GTDA 4TTTS 1RWMA 4CF5A 3FGPA 4P3PA 1G2IA 2GPTA 3INTA 1ZJZA 2XVYA 3VTAA 2EWWA 4G26A 1AX9A 5H9VA 3ZX5A 3EG5A 2F3PA 4DCMA 1MIHA 1J06A 5GONA 3BK2A 1IRIA 1YZNA 3GQVA 4ETIA 5A04A 4RGVA 1R27A 3IUQA 2G9VA 2Y4NA 4HN4B 2C7PA 1QXSA 2HFKA 4FFBB 1SCJA 4QTUB 3IOCA 4W5WA 2QW1A 3AT1A 3D4NA 5CJ2A 1RADA 4C3OB 4BLSA 3CXUA 2OYRA 4EENA 1JA1A 1EA7A 1I4EB 4GLJA 5EUMA 2I6GA 1AGPA 2D59A 4PZUA 2M2IA 5K20A 4MQ6A 4NMMA 1ODJA 3HXQA 1DL5A 4LKRA 1MJ5A 1ZGGA 3K5HA 4MV3A 3R4CA 1SBCA 2XKJE 4XEKA 2BEVB 1SIBE 5TE9A 3ZHQA 2CFTA 3UMYA 4YREA 4AJPA 1QWSA 3A3OA 5ADVA 1G8KA 1XQYA 1NLMA 5HVNA 3JQ8A 2WF6A 4F5DA 4MW1A 2JJ2A 1NW9B 1SUFA 2I4NA 4ZAGA 1EK6A 121PA 2FX5A 4GKAA 3H2KA 5EL0A 4QYWA 2BLLA 2VJBA 4S05A 2AJTA 2I2XB 3V4SA 3UB4A 2JPUA 1RJ9A 3QMPA 5EESA 1DT5A 1XLUA 3SJZA 3RRNA 2OVFA 1CY6A 4R05A 3BMCA 3GN1A 4B31A 4K0RA 2YV3A 3E1SA 1YZ3A 4FBLA 3CW9A 2HUPA 5DT2A 1MDFA 1GARA 5BQFA 2R7LA 4ID9A 1VKJA 4PZ0A 1H05A 2K87A 1U2DC 1YB6A 6YASA 2LKDA 1M0SA 1D0XA 4F0JA 3GJ8A 3QUSA 3UMMA 2BJHA 1GTJ1 4BUCA 1ZW1A 2NZXA 1GEEA 1GKIA 3N2YA 3S68A 1Z0KA 4AKHA 1NU6A 3SJAA 2B35A 3ULKA 2FZEA 4RF2A 3DGFC 2F8MA 4ZMBA 1XZLA 2IYSA 1LU9A 2GJ9A 2A7XA 3IV7A 4PYKA 2OV1A 4X5OA 3L0BA 4BVAA 2RGWA 4HWTA 5A4AA 1TU4A 3H9EO 5HUJA 2LGJA 3G0GA 3HB4X 3L0OA 3AHGA 1CR4A 4ZCQA 3ZNQA 1NDQA 3HU1A 5D3MB 1LBHA 4GZMA 3W2FA 1G6OA 1B0AA 4IWXA 1YJXA 4HNVA 1BTOA 2XE8A 3R23A 4EA7A 2AMFA 5DLQC 3IA2A 4JS0A 3JAWB 4Q3AA 5ELLA 2P1RA 3KOOA 3VKFA 3IIMA 2GO7A 1SM4A 4DCJA 3PXXA 1R6VA 2EGUA 1IZYA 2GZ3A 4RACA 1BMFA 1R0SA 4G0XA 3FTFA 2WDPA 4OAOA 3WYDA 5LQRA 6LDHA 3RWBA 4MVZA 5BN5A 3PIDA 3P0IA 1OE0A 2BEWA 1QG2A 2WLTA 3GJRA 4PCVA 3TDKA 3UWKA 3EGVA 1Y7LA 4CV3A 1SUIA 1SU6A 1PFGA 3FUTA 3MCVA 3MLEA 3VU9B 2Y1XA 2LZ0A 4Y1RA 3V2IA 3B8HA 3T4UA 5C1OA 2Q6VA 3K33A 3MUOA 1I3OA 2VNSA 1OFIA 1JWBB 4X3PA 3VDXA 4Z9JA 5I4BA 3WX0A 4ZOEA 1Z22A 5HTOA 2X8WA 3UH0A 1OXUA 3VA7A 3WOHA 3WDSA 3AHIA 2DOKA 2W6OA 4D9MA 4EAAA 2HD4A 4E6EA 5TMPA 3ZXYA 2EG9A 4EGFA 3Q3GE 4TZ0A 3VZCA 2PEZA 5IFKA 1CBUA 4B7XA 1KVUA 4DIMA 3S27A 5C8YA 1E6LA 2OKCA 3ZJVA 1TTPB 1PV4A 5JEEA 3FVQA 3TGLA 3RVJA 2QIOA 4TSRA 1BCRB 3HB5X 4YI5A 3WQRA 4E3WA 1Z25A 2DH5A 3ITDA 3DZBA 1GQFA 4YRMA 3GGSA 2P9HA 4ARZB 4M8NE 1WBJB 5JAIA 4IHJB 2C31A 1VI6A 3GLGE 4N3GA 2VSFA 2XAAA 1R0KA 1XJWA 5FR1A 3PC8C 1E2IA 1FTWA 5ARBA 1GPMA 4ZVNA 2YMPA 1VRCA 2ZJAA 3LHDA 4WL0A 5DZSA 3FUVA 4GGMX 5TEWA 2W4IA 3A04A 2K7FA 1QH0A 2XKKA 1PFVA 1BE6A 5TB5A 4JC7A 4C0JA 2O9XA 1N6NA 1X8JA 1LE2A 2BHLA 4IEEA 1YR2A 4S2EA 3LBAA 4G63A 4O4HA 4Y9DA 3KO8A 4PLVA 4E08A 4DV6B 3O74A 4V2IA 4DMKA 3N0VA 3NKFA 5TLSA 4B75A 5K6RA 3WDKA 5GZ3A 3UMSA 8ADHA 4PBSA 1ICEA 4NNJA 2VDWA 3EY9A 4MVQA 2XKBA 4HYEA 2VP2A 2R86A 4EGCB 1TT7A 2IYEA 2X1HA 4DDVA 2H1VA 3D8SA 2IZ1A 1Y1TA 3P9ZA 4GUAA 3CMCO 3ELUA 2H0QA 1R3DA 1HQCA 1PWZA 1YR8A 1LVKA 2EGHA 2OGTA 2BTQA 4B6RA 1L9KA 3PJDA 2MINB 2JCVA 1W85A 1CVIA 5IVHA 1NQTA 1OAOA 1GR0A 3LO5A 1B73A 5F64A 3MTJA 1FSGA 2HWXA 1Y7TA 2ZBVA 3C0KA 3GK3A 2Y0PA 1TX4B 1XJQA 5C80A 2XXAB 3PD1A 3DXJF 3QEBZ 4KIWA 1Q15A 1Z2AA 4JP3A 1NSGB 2AC7A 1HYQA 4CI9A 3L4EA 1S7ZA 4XVUA 10MHA 4OG2A 1W8DA 4UNPA 2OU6A 1G5FA 3RK0A 4UFOA 2PVPA 1ZMOA 2K7ZA 2IU4A 5C52B 1DJNA 1SWVA 3E82A 3E3NA 5L51A 4H54A 4KXNA 1OC4A 3UF0A 2R4TA 3EYAA 4ZGBA 2YL2A 3ID6C 5K8IA 1L5SA 1ZH0A 1XQXA 2P9JA 1SVUA 3ZBUA 1KEWA 3LOPA 2P0AA 4QJ5A 2XRZA 2AXQA 4G81A 3FPBA 5EZSA 1ZUWA 3QLJA 4E1AA 5DBHX 2VHTA 3HY3A 2QDKA 4KQCA 1T3SA 2X5JO 3CLKA 1Q0KA 4TGLA 1L4MA 4N03A 1P19A 4OGLA 3T7AA 1FFYA 4PX9A 3OCVA 1C30A 4LYAA 1PR4A 3AIIA 5JLJA 5JT1A 5BYAA 3ONNA 5AMXA 1Z3IX 3EWIA 4TMVA 2IW3A 3LPCA 4OMDA 7MDHA 2RIPA 5CB6A 1JR4A 4FJ1A 3INGA 2LPMA 1RPZA 4NXMB 1H9CA 4R54A 2FSVC 2JA2A 4DSUA 1RQLA 1ZMRA 2GJSA 2ID8A 4ODIA 3RV4A 4TN1A 3ZWDA 4CIWA 3PZBA 4A91A 5FWYB 5GZ6A 5JZMA 3W2HA 1YZGA 4EIWA 4LY6A 1L4KA 3SIPA 3CIOA 3AQIA 4CFZA 5AHOA 5DI9A 4X1YB 2B5OA 1IEQA 1P3JA 4I5GA 1TR2A 2PUTA 1YF3A 3PE3A 1RM5A 1PVDA 3IKTA 4OI1A 3RM3A 2O8DA 4YP6A 1AF7A 1P6UA 1VQ1A 4P7FA 3N2LA 2W2OA 4XGRA 3ZWVA 1UMBA 3B51X 3MINB 3R2PA 3ESRA 2D5IA 3U39A 3CLUC 1K88A 4MULA 3OZAA 3DAPA 1QG6A 3KYJB 1M1YB 2FW6A 1M6YA 2F22A 3UV7A 1YR3A 1IOLA 3RU7A 1GG2A 3HVJA 2QL5A 4RV4A 3RYFB 4I1PA 1FP6A 3C3KA 4V1CI 1B7GO 3QPBA 3L8GA 2EF1A 5JC1A 2VJKA 3CPEA 2E18A 1FSZA 3UKOA 2ORIA 1FR0A 5LL6P 3K53A 4G0NA 4BV8A 1U3DA 2YZKA 3IB6A 1V8OA 2Q50A 3ASVA 2H8KA 1KY4A 1CEYA 3DE9A 2IXEA 4XX0A 2RD2A 3ABOB 3B6JA 1PK8A 3P5SA 1K9VF 4I55B 2CKMA 2FRXA 3VUEA 4KPGA 2P68A 5JDCC 5FLYA 1P33A 2FLKA 3C3EA 2I7TA 2QY6A 3EVEA 5HIJA 3KJIA 1T8SA 3KJFA 1DWQA 4FC6A 2O5VA 4Q9AA 3M5PA 5F28E 2H0AA 1KZ1A 1BZ4A 3WGLA 1Z2PX 4YA6A 3N7AA 3I39X 1DIHA 3TLMA 5ALQA 1GPH1 1LVGA 1W4BA 2H4YA 1IUNA 1EM8A 1WHTA 3X1OA 4EH1A 4XM2A 3RT7A 3ER9A 4DLRA 3I4CA 2V9PA 3HJFA 5AI8A 3LPLA 3S7TA 5KNBH 5KTYA 1NFOA 1NBAA 1ZOOA 4AO7A 3N8GA 1B0UA 2VEDA 3ND9A 2LR0A 3DLHA 4ZO9A 1C9EA 3LESA 4AG5A 4MMXB 4IHJF 3AY3A 4RD0A 3FCXA 1SFRA 3MWDA 3PKIA 2PUEA 1E1QA 1C8LA 3A1NA 3PXCX 4FQ8A 5BQHA 4UOEA 4WECA 3ABKC 1UFKA 2BFCB 1PVOA 3HLYA 4A82A 1KVQA 1AGXA 1OQCA 4OM7A 2VAMA 2ACKA 2P1AA 4FPXA 1B6TA 2KBFA 4RD1A 2DPMA 2XMGA 3FZYA 1JHAA 3ANXA 1KPHA 5KAMA 3GCWA 4J0DA 4CRWB 5TMBA 3HY6A 2P1DA 3H6KA 5EPEA 5MF6A 5GGYA 3OWXA 3EMVA 2BHRA 4QICA 4TM7A 4WOKA 3R8XA 4I99A 5EGNA 4Z4HA 5K0SA 1H66A 3LT2A 1L4HA 2HSZA 2ICAA 2ZI7A 1DQSA 5F23A 1E8NA 4CM4B 3K9HA 2D8AA 1HZZA 3PGKA 3EEOA 2ZWPA 3N2KB 1PR2A 1D2CA 1T5TA 3GFTA 3GV0A 4MW2A 3OU6A 3X1KA 2BI4A 3I0ZA 5LZ9A 1N7IA 4BNHA 1EQUA 3G8CA 3PYMA 1QZXA 2ATXA 4MUKA 3TVTA 5K8UA 4C1BA 1N5KA 2M64A 1EXVA 2V26A 3K1YA 4MA5A 3O8OB 3EMDA 721PA 4RK1A 4G4JA 5CFQA 2JJ1A 1JPUA 2R00C 3VZSA 2I6UA 4DEYA 3DT8A 1ZLXA 2L2QA 3ZI4A 3QE9Y 2G9NA 1LV7A 3RYHA 1U5BB 3NC1C 1WXIA 1OV6A 4E7OA 1SY7A 4CV0A 2FN7A 4D26A 4V0RA 3VHLB 1E5QA 1NYTA 3U62A 5KNCH 3AESA 4F3RA 1WOMA 4OHUA 1GGNA 4G8DA 2GN6A 5T3WA 4QOSA 1KEZA 3RUPA 4UW9A 1XVLA 2J0WA 3NUGA 5IJ9B 2Y71A 1PZHA 4WLFA 4TL8A 2O3TA 2NZ2A 1XMVA 3K9CA 2GDCA 2WU8A 4BFSA 1Z0UA 1APBA 3WKEA 4Q3CA 3I1JA 4QFMA 4FE4A 3R41A 4ID3A 2G40A 1Q7GA 3OEHD 2RGRA 1FPMA 4B32A 1XZHA 3ZC4A 3GMIA 1SIWA 3LG2A 5KWSA 4QE3A 1Y3AA 5AW4A 5DTJA 1ATZA 5LPNA 4GXRA 2XL8A 3PPWA 4MYSA 2HO5A 1VE9A 3MILA 3ISVA 1GGVA 3IR6A 3A9VA 2VBFA 1JA9A 2XUGA 5ECWA 2DCMA 2PJRA 1W8IA 3P4XA 3PX3A 3VPCA 1RWBA 2H6EA 5L4SA 1JA0A 5FL7A 1ISPA 1V7ZA 2WD9A 3R20A 4PSCA 4TT3A 3BFVA 2IGBA 1E9DA 4MOWA 2LP4A 3M4BA 1SC9A 4Z9IA 1PZNA 1D1PA 3WG9A 3VKVA 4BZZA 1QE3A 4S0ZA 4L4YA 3L1KA 3V8BA 4ASUA 3HA2A 3NGLA 4N0QA 3EY4A 4J7CA 3S0XA 4B3DA 3PA8A 4WT7A 2UZ4A 3AP3A 3VFDA 1MDBA 4CNBA 4P08A 4H7IA 4F96A 1AXEA 4CMAA 5FF9A 1Q57A 2V6IA 1L9XA 3DVLA 2BGWA 1GDTA 5G0VA 1PQYA 4JV5B 2ZJ2A 3HB0A 2EL9A 3SLRA 4R9VA 1ODSA 2V1XA 1YONA 3IUSA 1CPQA 3CVUA 5FFNA 2HPAA 4M87A 3KOYA 3IUNA 4QJBA 5BV0A 2ZUUA 3GWGA 4NECA 2AN1A 1V1MA 3IE2A 1M2JA 4NLLA 2OBFA 1P2FA 3IQDB 5E3HA 4GVLA 5DM70 4HVTA 2EJVA 2XLWA 1B2LA 2NN3C 4Y0NA 1UKCA 1RQPA 4COKA 1J24A 1QO9A 2GETA 2O4CA 4RDCA 2GA9A 4K9DA 4QULA 1L2TA 5ADWA 3EGCA 5BUCA 1LTHR 3C7DB 1G8JA 1EA5A 4ZXPA 3PFWO 3SN6A 4MA4A 3FUXA 3IQFA 4FJ2A 3AVUA 3GT4A 1YE8A 4UVDA 3RIGA 4BLVA 2QR3A 1N8KA 4N6GA 2WKSA 4E51A 1IM5A 2AUTA 3OPYI 3AI1A 3E8MA 3BEDA 3GJ5A 4OOFA 5FCLA 4MQ5A 4MARA 1JFLA 4GBMA 3UN1A 4CLEA 4UVEA 3CE6A 1P73A 4C2TA 5ALEA 4C7XA 4WY8A 2F2TA 2ZWIA 2AI1A 1OCRC 2C4UA 4OXNA 1E63A 2L81A 3WLQA 4FXPA 4MVJG 2GPBA 3GEDA 1KTVA 5HBRA 1IHYA 4Y6OA 1S7GA 3RHZA 1I6KA 3W2IA 1IN6A 4OKNA 1U9IA 2Z6AA 1OFHA 3KKZA 2NTJA 3DUWA 4RTPA 1KO5A 1HDYA 2QN3A 2XLHA 3U16A 4Q4DA 4QLOA 2HJSA 3HI4A 4RSGA 1NBIA 2X5XA 1BZYA 4R9NA 1ZL2A 2GLUA 3HXTA 1OLXA 4NC3A 2EKQA 2QLFA 4CMEA 4DMGA 4HNAB 3DT9A 4JMPA 1BD4A 3C15C 3E70C 1Y5MA 4NULA 4MTOA 3CVOA 3FWKA 1XAJA 4NFHA 4AZ0A 3SJBA 2IYNA 1CSEE 3EUFA 4H35A 3DWWA 1EX1A 3N7UA 4QGBA 4G56A 2EIMC 1SQ6A 2CB9A 3DC7A 5CHYA 4OMCA 2VEOA 2RGYA 5DBFA 2J1LA 4I50F 2FZKA 3MJVA 4RPKA 4LWQA 3HTKC 4MUBA 2H4XA 2HCRA 1PCXA 3PTLA 1PJ8A 3SC4A 3DYVA 3KQOA 1C9JA 3ER6A 4ZALA 3PLRA 5LA6B 4TTPA 4XUDA 3FPFA 1H0KA 2HJMA 3H7AA 1F06A 1XRMA 5DGIA 4BNDA 1UXGA 5COBA 4CLXA 1G0NA 1ZIDA 5T57A 2OBLA 4LRYA 3UCFA 5I7OA 5K8JB 5JXIA 2V5VA 3G2PA 4QJ4A 2WYIA 4EG7A 3B20A 5DW3A 4B76A 1PV3A 4F2DA 4RE6A 1VDMA 1US8B 4YN3A 4ZZ0A 2PXAA 3N3AC 4DARA 3DMFA 3KKOA 4WOJA 3E5NA 2NSDA 2ZXRA 3K0EA 3IVXA 3UGPA 1P9OA 5SYNA 2J0UA 1IATA 3UMBA 3D7KA 1VPTA 5CYGA 1X1DA 2ZW9A 1XTRA 4GM4A 4UNNA 3RB8A 2GNPA 2PDAA 4U63A 4QSMA 1M2VA 4QQNA 3HJRA 1YZQA 3DLCA 3O75A 2YJTD 4BC1A 3EIUA 3AZQA 4R0VA 5JVEA 1F12A 3V80A 4DVYP 2W2NA 5IN4A 1XDDA 3F3MA 2VJOA 5C81A 5DXFA 3TOLA 3KXKA 1UZAA 1S6YA 3EXFB 2I2BA 1YKSA 4QXRA 3AJMA 3LCJA 2B2XA 1F0YA 1X7GA 1Q0ZA 3QTHA 4BNIA 3UK0A 4EGJA 5ESRA 4BECA 2P8SA 3DKVA 4JLJA 2CDNA 3X2EA 3ML1A 4FFRA 1MXHA 1ZIYA 1M2WA 1YJBA 4TV8A 2GTPA 1J8DA 3NXSA 1ACMA 4RPIA 1KSFX 1X77A 3S44A 1N9ZA 3EUEA 2FETA 2G7ZA 3F97A 3FDJA 3GAMA 3K70C 2O1XA 4MS4B 2NU6A 3JZIA 4D41A 4TQ9A 1XZNA 3A25A 2YL0A 4BKRA 4XUEA 4A4AA 1FYFA 1GPKA 4YI3A 3A2KA 5AVYA 1PSDA 2Q0SA 4N5HX 1H3FA 3DQZA 4GXQA 2FZGA 3CJRA 2FHPA 4M1QA 4A9AA 3CBQA 2BMVA 1C3JA 3DR3A 3OEWA 2TMVP 4CM9D 2RAPA 1KGSA 1PGNA 3O8BA 3D3QA 5J4YA 1W0KA 4JI3B 3T7TA 4N0EA 3UAGA 5CFLA 2JHGA 3EA0A 4YP1A 2JAPA 2Y1WA 1DC4A 2JD3A 5JI2E 3EXEB 4K9OA 4IWYA 4AC9A 3G1TA 5JSZB 2AFIE 1UKYA 3ER8A 3ZN2A 1Q16A 3U81A 1BWSA 4NBTA 4I4TA 3I1IA 1KMCA 1I6MA 3L5OA 5F5FA 4PIPA 4PX5A 5G0SA 4YDQA 3IUMA 3B71A 5KMGA 5AKEA 2XZPA 4ZQCB 3H04A 4PLYA 3R3HA 1MO6A 4HGNA 4EFMA 4I1YA 3TDMA 1Z9BA 3PC2A 4JZKA 5IW8A 2B8EA 1L4BA 1JQJC 1MMDA 1NWCA 5AW1A 1ODIA 3BXFA 3VKHA 4TMYA 1ADCA 1XN4A 2C7GA 1CJSA 3RABA 1E1DA 3WIUA 1YS9A 5FPKA 3BMNA 2JFGA 5FUQA 2LKCA 3D1JA 1V16B 1E69A 4RKFA 3W1WA 3KSUA 2PZGA 3AOGA 4J4BA 1IG3A 3RRXA 3N2NA 3WJAA 4BQOA 2XYRA 4IXWA 1RXQA 3KTFA 4MUAA 2WSIA 1GPUA 2FPUA 2B1QA 3USES 2V54A 3BE5A 2R9VA 2Q7RA 1BVUA 4WK2B 5JUAA 1U9ZA 4MQ4A 5HZHA 4NBRA 5LQMA 3OLCX 1ZSYA 1R0LA 2XA2A 1NP6A 1X1BA 4N82A 4ALMA 4QARA 4U5CE 3MTIA 4TLEA 3DONA 2IP2A 2R8YA 5AIBA 3F9RA 3UM9A 3A4YA 1BMQA 3FDQA 4JB0A 4H0CA 3QVMA 2CZGA 2WZGA 3QYAA 2CMHA 4EGQA 4HMQA 2WB2A 2ZB2A 1OKKA 2DTDA 4KLNA 1C9NA 2PNJA 4TMWA 2XLMA 1H6AA 4CL0A 1OFUA 2ZUVA 4WD3A 3IP6A 1TJYA 2MYPA 5E7MA 1QYVA 3REFA 3HCBA 3KL2A 3THOA 1XQ9A 2EHDA 1WJGA 2MR5A 2JX0A 2HIGA 1TI7A 2KC3A 1OJLA 2BGUA 3K0CC 1T15A 5F5LA 5MDHA 3FVTA 4QM6A 2PRIA 1EFVB 2DQKA 1AKNA 1DIGA 3L8DA 3DAOA 3T9EA 2J45A 5LA6F 1Z17A 2WIKA 1QHNA 3OLYA 4JR1A 5FWNA 1ZHZA 2F1HA 2OXFA 4DLKA 2H4FA 3Q3CA 1VYIA 1AXRA 3SNHA 4XWAA 3R7DA 1DQYA 4JXJA 4MVRA 3OFVA 5CA1B 5LU8A 4KDRA 2XQVA 3PDJA 1HW1A 5BSKA 3ZHYA 5K03A 3JRNA 2JFQA 1DKUA 1N8SA 2G36A 4N3CA 1ABFA 3OQ1A 2Y3BA 3ONDA 3DBLA 4MDYA 2X41A 2GBLA 2X15A 4IIBA 5L0IA 1I4DD 5DH9A 1L7VC 5TJ9A 4RZUA 3OZ7A 2O2YA 1FYDA 3G3EA 5IK2A 2JGAA 4E1BA 4DVJA 2CJPA 4QU0A 3LU1A 2PUVA 3T1NA 1ZXLA 2JAOA 1DEOA 1I2CA 5TT0A 3H5VA 1BXRA 5IEBA 4B8WA 1OVMA 5KKCA 2IKSA 1AQUA 1M1UA 4E5VA 3EWSA 2AHOA 2EDCA 4ILEA 2R68A 1ULAA 5ILGA 3ZD6A 5EIEA 4J4TA 1U7HA 1Y33E 2XTNA 3KHKA 4MNTA 2P78A 4XLTA 1V5FA 3VR5A 3CEPB 4M36A 3M2PA 2ZSBA 4LDAA 2DPXA 1L1EA 2B2CA 3LHKA 4RK6A 4YJGB 3H4IA 1NHWA 1ZHYA 2I99A 1XTVA 3BA1A 5AVQA 2J8ZA 3LFTA 1D1SA 2HRCA 4QEDA 4RIIA 3H0KA 3PDUA 2J30A 5HP4A 3WR5A 3M49A 3S2UA 4E6PA 4FWBA 4Q4CA 4EB3A 1T1JA 1F38A 3V8EA 3I5PA 1DAPA 4XWKA 3C24A 4ENQA 1YK1A 1VIDA 2MSEB 2VYQA 1TFUA 3EHEA 3ACBA 3MGAA 1HUQA 1S9HA 3PGVA 2WG2A 4ND7A 4YUXA 1JT9A 1HYGA 2BD0A 5ES3A 5B30A 3TE7A 2QQFA 5JANA 2I7XA 3HM9A 1TIBA 2X0JA 4OHVA 1W96A 3A9SA 4QLBA 2MYNA 4NHEA 4EB6B 4HUQB 3C6XA 2XTJA 1E1NA 2XDWA 2QX6A 2FQ1A 2AG1A 3PNMA 4G4IA 1ISHA 1BDIA 2ZU0C 3NHFA 1ZNXA 3FGNA 4UM9B 1WKVA 2IPNA 1NE2A 3HFRA 1QMPA 1YU6A 4UDXX 4LDKA 1U28C 2XUPA 1AVOB 3TFOA 1N0IA 2M9MA 1F20A 3INRA 1RQGA 1TM1E 1XROA 4Y1GA 2GSDA 1GSIA 2W48A 3RYTC 4I6GA 1LS4A 3FMFA 3TR6A 1IXRC 1ZGHA 1V3VA 3H13A 3WGIA 2VLIA 5JS1A 3WSTA 3CZ4A 3GGPA 2R5NA 4HD8A 3UXYA 1E5XA 5ER9A 1NFFA 3ECSA 3IT2A 4HDKA 1C0EA 3O83A 3F49S 4OHXA 3C4QA 3HNKA 4MUHA 2WFZA 3G2JA 2Q3TA 2HIHA 3GJTA 2WWRA 1SZPA 4JROA 1ZJ4A 2VCYA 4K6CA 2QMYA 5BSVA 3BICA 4QTXA 1EFPA 3ZW9A 1QO0D 5KX5A 2J0SA 3ZH9B 4R5MA 2PUGA 3H6HA 1JDTA 2EJCA 3U7QA 2IS2A 1YZVA 2BMAA 1K2VN 4M6WA 4WK6A 3WRWA 2H48A 1YGPA 4U3JB 5JXGA 3EGXA 5GZ1A 5KPJA 1RM3A 3D3JA 2Y68A 3QKTA 4Z9AA 5EJ8A 1CTQA 4X64B 5M2QA 4MVOA 3FMGA 4AECA 2PD6A 1VYVA 3TUJC 3D0QA 4CR8A 1C3LA 5B1SA 1GLGA 4N7JA 4KPUA 3A6GA 2IXPA 2IWHA 4F93B 1DAIA 1PKXA 3A9WA 2MSDB 4C89A 3QVYA 3AR5A 3AUAA 3X1MA 3C8UA 3CNQS 1MIOB 3G17A 4F2WA 1H8HA 4MNDA 3RE1A 2B4QA 4MCIA 4Z0NA 2Q5LA 3BX1A 4J16A 1XC7A 3SS9X 4QPJC 3AIKA 3I9V1 4DPMA 3X1JA 3G13A 3WL7A 1A1SA 5FPYA 3M5WA 3TIIA 1RRVA 2PLNA 2IT1A 2QTTA 1Y82A 3OUTA 2ZRBA 2WSMA 1NW7A 4F2GA 5CA1F 4B85A 3QVSA 5IH3A 4CDRA 1CV2A 2XJ4A 2C8LA 2CXQA 1HQYE 4GWGA 4RPJA 2YINC 2IXNA 5KINB 4IIEA 2XVAA 2BGMA 1TJ4A 4R1QA 4HDOB 1ZBDA 3T4RA 2CL0X 3V32A 2D6FA 1N9GB 2IS1A 5BN4B 3LY8A 4PX2A 2XB6A 4HFJA 3IBYA 1CC1S 4IDBA 1D1TA 3A1CA 2CXUA 1S05A 2IYXA 5IVIA 2BGLA 3VDNB 3QM1A 2HCJB 5AKKA 3D0OA 4TSFA 5EPOA 1JHUA 3U4MA 3I4LA 2OCPA 1BYUA 2CDRA 4O3FA 2Z09A 5DCWA 3BJMA 3DDNA 2PKCA 1FPQA 2AMYA 4B4DA 3PUJA 1W2WA 5T4EA 2FW9A 2P9BA 1G5RA 1WHSB 2C9ZA 2EPLX 2B4KA 2HMTA 1J22A 2NU9A 1T1IA 1E3EA 1AEPA 2FGKA 4RJIA 3UTCA 2NZJA 1KEEA 1FFXB 1L6IA 1JRLA 5JNRA 4LAFA 1OWPA 1WTYA 3MW8A 3QOWA 1EUDA 3ZKWA 4NHOA 5CLHA 3GMTA 3CIFA 1NE7A 2J6BA 4MAAA 3GL9A 5K0GA 2C1ZA 1RYZA 3H11A 1YNOA 5ILOA 1U2GC 4EHFA 5D91A 4Z7QB 2AQIA 5IT4A 2WAXA 3A8TA 3UJ3X 1EDBA 2FKAA 5EZYA 1HQDA 1QIKA 1G5QA 1KI6A 1A7EA 3U8VA 5FORA 2P9FA 4MUFA 1V3UA 1OXMA 4UZFA 2H2DA 3GUVA 2ZUWA 4LWZA 4X8OA 3CSUA 2D4HA 1ZICA 3R9XB 4OXYA 3SBEA 1QIFA 1ENPA 3SLGA 5AVZA 2QTRA 5T4HA 3LNTA 3K0AB 4GMHA 3T1OA 2O8CB 3ZHCA 2A0FA 5A9RA 1HY5A 2JHCA 2KGOA 5CNJA 2RFLA 5A0VA 1IHOA 4DRJB 5IWCA 1VIAA 3RS9A 8AT1A 4KUGA 1NJ5A 3KQPA 1V6SA 2TRSB 5I3ZA 2QI9F 2FPPA 1FQJA 4JTCB 1MMAA 2IDKA 4GOOD 3FOEC 4FOOA 1KI7A 1FUEA 1IEWA 2ZE6A 5FI1B 5GONB 2H08A 2D5LA 5IDXA 2AOUA 3IB3A 2R7NA 2PA0A 1QOQB 2G08A 1KZGB 2IYZA 5CPFA 1M5RA 3F6EX 1GU1A 1AQYA 1NN5A 3C3DA 2A4MA 1IMJA 3H19A 4NBLA 1TA4A 3B9PA 5IZ4A 4BWGA 2H2FA 3OT1B 3SXZA 1P4AA 4LBVA 5JMPA 4JBNA 3HKCA 3OZIA 3P26A 5LNK1 3IPMO 4FGWA 1II9A 6ABPA 5ALVA 2WC1A 3H97A 1BE8A 3N5KA 1KETA 2ADOA 1YYXA 1GS9A 4Z3DA 2VPQA 2VRCD 2CXPA 3ZUGA 1QO7A 3G2MA 1YZUA 4KK3A 4KNYA 1FRQA 4LYYA 1RWOA 2AX4A 3TMYA 1BG6A 3LQQA 1SOUA 4CTJA 2YN4A 2PS0A 3AHHA 3JQ8B 3NYMA 4AS2A 1MRZA 3VR4D 5EWMA 1X1QA 1U2PA 3DTYA 3GP5A 5FOXA 4XSVA 2XMRA 4TLBA 2RI0A 3MC1A 5LWQA 2AMLA 1QGYA 3COZA 3SSMA 4RLFA 3F7MA 2CLOB 3O84A 1DKRA 4M9SA 1ENOA 2ZBEA 5AM2A 4WKNA 1FDIA 4HFFB 3ZDLA 3VR1A 2WYOA 4ZK2A 1ID1A 1MXFA 2JZOA 3BH7A 5KSYA 4IIVA 3BMCB 4KREA 3WRXC 2XEDA 3LGSA 4JJEA 1Y1QA 2FGJA 2IUYA 3RKOF 2WYWA 1F4LA 3MGBA 4RZQA 1NUUA 1M2KA 4MJLA 1H7IA 3HXMA 2JA1A 2EZTA 4BBZA 4BNFA 2HJHA 4RENA 5JS2A 3DW3X 3WLJA 3WZMA 3EAGA 4OH7A 2WRZA 4RGYA 4EI8A 4W4TA 2YFHA 3T9AA 1E2BA 1O97D 1Y3IA 3M6AA 1FB5A 4QOHA 1FFCA 4ZU3A 1JSZA 3KM0A 1CG6A 3L4BC 1LKXA 1ODFA 1NG9A 1E83A 3B89A 3O4HA 1WULS 4OHFA 3KLBA 3LHSA 4YRIA 5B6IA 1LKZA 1NVXQ 2C3UA 4JELA 3EDQA 3V1NA 4MQLA 3CY6A 2H7YA 4FONA 3SLKA 4MZDA 1L7BA 4WBXC 1EJ2A 4U7HA 3NOVA 1H2AS 2AR0A 3GNSA 2QMHA 2Z04A 1OXXK 4UAUA 3HQ4O 1KKUA 3ME5A 4B8ZA 3M33A 1IE3A 3TJ6A 2PRSA 3PNQA 4A15A 5TDHA 4J2HA 1GQYA 3JT1A 1LXCA 1NASA 2FUG6 4HGZA 1L5KA 2I5PO 1Z0AA 3L82B 4LOIA 2WOJA 4DV3B 1TFRA 1QK5A 5BN5B 1P1IA 4ITRC 2BEWB 1RDFA 4N4WA 3SG0A 4YLYA 2IKQA 3JPYA 4WWHA 5BQOA 2GBCA 4LGCA 2HNAA 4JEAA 3EDYA 3A11A 2GK3A 4Y1RB 3K2QA 4OYYA 1GYQA 2QN6A 2R1TA 2I91A 1TEZA 4D4KA 3WB9A 3BFJA 1TK2A 2D0IA 1QH8A 5CDHA 4GSYA 1GSAA 4MR9A 1TJPB 4BRSA 3ANLA 1VTKA 3ZD8A 5J23A 3OH8A 3EMKA 4BIIA 4EPXA 2D2VA 1MA3A 1J8MF 2IIQA 1CUYA 5ARCA 2ZR0A 2P69A 3TTYA 1VECA 5C8YB 1YRBA 5D3QA 1WWKA 3EDRA 3I2YX 1CDDA 1EVLA 3UJHA 1WCIA 4U7PB 1X15A 5JRAA 3OTHA 3IKJA 4G5HA 4N41A 1UC4B 1OASA 3VC3A 5I4IA 1UG7A 3D1LA 3GU3A 1CPRA 1A7KA 2OQMA 2FWAA 1SELA 5F78A 1XELA 3A1EA 3ROZA 3V8PA 2MMGA 1E89A 5TC4A 4W5HA 4B4VA 4E12A 2O1EA 2VBIA 4TTIA 4YRTA 3P5BA 4N47A 4ZCTA 3PDMP 2B9EA 3PNPA 1AZLA 3WIOA 3OZEA 1JL3A 3IPAA 3C87A 2D5RB 3FAPB 3ZLUA 4PC2A 5F1YA 1PJLA 3ZIAA 4D8XA 1FNBA 3U3KA 1P9LA 4OHWA 4BU0A 3U31A 2EIKC 4RTJA 3IGFA 3FBGA 4JCCA 2X76A 1S89A 4YO8A 1MO2A 4DUZB 2JCSA 1UQRA 2ZWVA 2FSUA 1NMZA 4E2YA 2QUHA 1PWEA 1UT6A 2KM1A 2VDWB 1R10A 1WCYA 2XWSA 1L7EA 4YP9A 2JARA 2FSPA 4IINA 4OJNA 4QTTB 2FEKA 2WB7A 4F2HA 4PFJA 1T6QA 2R7WA 2J9BA 1Z2DA 1XD8A 1QRAA 4D4MA 4K5QA 5JDIC 1NYLA 5GONF 4EHHA 3F74A 4M1MA 4ZVQA 3A1TA 2BTQB 4JDPA 2Z08A 1KOJA 1W85B 2YR0A 1OA0A 4L8YA 4DLZA 1UKEA 2BRUC 1GG8A 2GD1O 3FBTA 1OTXA 2L42A 2CL6X 1K5GA 1NMEA 1SOMA 5C5EA 2J9UA 2UYYA 1HMDA 3HZOA 4KOEC 2AG0A 4TOIA 3MTQA 3D0KA 2IY7A 3MYYA 3H9BA 3MRVA 1MZVA 4QHTA 2Q00A 3KV1A 2WSSD 3O8QB 3GNTA 1JKJA 4K8RB 3NJ8A 3FPEA 1M10A 1DQRA 4EZIA 3LHFA 3E9VA 4NK5A 3PFCA 1PNQA 3Q0EA 2ZIWB 4ZCIA 3VJKA 2VUIB 3N5CA 1ZA2A 3FSGD 1JEYA 5KSZA 2EKDA 2GCNA 4ZT7A 3KEQA 2XZOA 4EHJA 3WJ2A 4KFSA 2IELA 3DJYA 3H6GA 4CKEB 2ONZA 3QNWA 4BKOA 3H86A 2JAHA 1QG0A 1X1SA 4QDKA 3JZDA 5IJAA 4A03A 1IONA 1AOXA 4P7JA 1KRWA 1JSCA 2Q1SA 4X63A 5B4TA 2EZ4A 2V0NA 5BNIA 4YP7A 2DHCA 2F4NA 1W36C 3PDIA 3K30A 1X8XA 4BN4A 4CKBA 1Y4UA 3DOIA 4LF8B 5EINA 4DC0A 4LW8A 4BO7A 4H59A 2ACWA 4RE5A 1VL1A 3ZEIA 4IGKA 2WTEA 1C30B 4Z0TA 2ZIAA 4P3NA 3DDWA 4UU0A 5JD5A 2MCFA 4FILA 4Q19A 1YVEI 5F2KA 4EPVA 3NGXA 1O95A 1X7DA 1VIMA 2OQIA 4RKWA 1HNNA 2XYHA 1QH1A 1WP9A 4IDOA 3KKKA 3EBLA 5JMWA 1WUJS 1UM8A 1Y5NA 4Y2YA 3U7HB 2GPYA 3U8PA 3OCCA 1P3Y1 1ZM2A 1N1DA 4AMYA 2JAWA 2OXEA 3C3JA 3CRMA 4BKPA 2JLXA 5KQMA 4I3HA 2Q2NA 3VJMA 3OE5A 1GPAA 2P2CA 5DHTA 4KN5A 1K5PA 1OU0A 3ZQKA 2V9CA 4V0KA 4WLOA 1G4WR 2WM8A 4NEQA 1IBMB 2YUTA 2WQZA 2CNOA 1N2HA 1AHPA 1OGYA 4Z86A 1YLMA 3RF6A 2O8DB 1JVBA 4ERNA 1YO6A 2IXFA 2PUAA 1CEQA 4D44A 3HKBA 1OYOA 5G40A 3U1VA 1I94B 1M3SA 1SXJC 2O7NA 2PGIA 1UMBB 7ADHA 2I1WA 4ALKA 3EXHA 5DS4A 4KI0A 1DBSA 1P1KA 1Y81A 1KI9A 4UBOA 1PDOA 3EZFA 5JECA 2Q4OA 1EU1A 4OFZA 2IEIA 5JSKA 1AUEA 2J3DA 3ORHA 1AMUA 3T15A 3QXHA 2VDKB 4X65B 4IICA 2CUTA 1BN7A 3V7YA 3WWCA 2P9EA 4AUEA 2G3KA 4XLZA 3DNPA 3QA3E 1S7CA 3KVYA 4LFBB 3W3ZB 3HGMA 1OXKA 3LP6A 3GEPA 2H9YA 4XX0B 4WLNA 1VLLA 3G7NA 1ORDA 4X93A 3D7RA 3L7LA 1BJKA 4CLRA 1P9WA 2R02A 2W83A 3TRIA 4MV4A 5GJVC 1L7RA 3HCCA 3GC6A 1KJIA 4C0QC 2QUJA 4H6PA 3PPXA 5C8YF 4EJSC 5AUQA 1BXZA 4F3TA 2FXVA 1E84A 2QNIA 1T8WA 1EM8B 1WHTB 2VJAA 5CVTA 1SCAA 1FAPB 3HCFA 3LY7A 1DJOA 1DRJA 3G50A 4AUNA 3BIJA 1PEKE 1Z26A 4I50B 3PNKA 2IYPA 5EGSA 1XWFA 1QV7A 1G18A 4YPVA 1X7XA 4LZLA 3MWDB 2WVJA 4YRDA 3VR2D 3PQ8A 3HA7A 3HCWA 2IV7A 2ZI5A 4BP8A 1LBIA 4R5HA 4DOMA 2PVCA 5ECYA 3FRJA 2VQ3A 3FYUC 1UBJS 2VPYA 3QWFA 4IQ4A 4KEAA 4D7AA 1SA0A 1J4AA 2V6GA 3FGOA 2JEYA 1EFKA 4WZAE 1LPAB 4XPIA 1XQ1A 2RHOA 5DNYB 1LSSA 4PR9A 5JQWA 4O4HF 4EVIA 2ADMA 3CEAA 2JBHA 1G4AE 4RVSA 5EZ5A 5E0KB 4D3DA 3D7LA 2J3IA 1ZS9A 4ENWA 5B6JA 5CVUA 1Q95A 4FKBA 2J7PD 2J4DA 4CCSA 4GUDA 5LC1A 1B23P 1DIRA 4ARCA 4FCVA 4FN5A 5H3LA 3QKIA 2G62A 5C4MA 5ARDA 1ID8A 4RULA 3AFMA 4GPEA 2FX2A 1X7YA 1QYDA 1IXSB 3MERA 4ZDIA 3L4SO 3REQB 5JCJD 4DGSA 4IGFA 1UJMA 4PO1A 3I9MA 5EE0A 3QKSA 3DC2A 4GGPA 1PWXA 1XIVA 3GA5A 1GFWA 3AJRA 4ND3A 1VB3A 5AI9A 3ENZA 2GZDA 2GEJA 2HMAA 3A6HA 3RYHB 4AZWA 5DRTA 5JBQA 1R8QA 2AWYA 2L6HA 1R6AA 5AJWA 2WT8A 3TK0A 2YWXA 3SIRA 5IJ0A 1JPNA 2PSDA 4A2QA 1SN7A 4Q1VA 1V8BA 5BNZA 1YJ8A 1XF1A 4MRMB 4E17A 1R0BA 2DE0X 3KIPA 3D54D 2JFYA 4DDMA 4OL0A 3WZLA 4CMIB 3RC3A 3TAHA 4JT4A 1VE6A 3KPYA 1XXHE 3TD6A 2VPZA 3M79A 1LCIA 4BN5A 1CUAA 1AKQA 4PBRA 1R5NA 1YA6A 4DRXA 1BA2A 4YAWA 4ENTA 4EG8A 3B1WA 2QW0X 2VQFB 4L0QA 4RUKA 1R0CA 2WP0A 1ZPDA 2L6GA 3CG4A 3TRJA 4EA9A 4JGBA 3AJDA 1MX1A 2Q4RA 3RUDA 2DUNA 1CNEA 5EHHA 3H5LA 4LNHA 4QREA 2NUBA 1CF4A 4LYGA 2B2NA 4AP5A 3OLWA 1VLQA 3GPDG 5EVJA 2YWEA 4W9MC 1XKTA 2JKVA 4EHDA 3ZWWA 3JZ0A 1VHLA 3TZCA 1L3BA 4R32A 3H4TA 4ND5A 3QUBA 2HF7A 1KMHB 4G0WA 2EVWX 2Q4DA 3TW8A 2X4LA 2ZG6A 2FLVA 2H1FA 4MW7A 4MKGA 1E92A 4P84A 1NC3A 2YDXA 5IMBA 2ZWMA 2K4MA 1IN4A 4QRDA 4YUAA 2E6KA 2HK7A 3D5EA 3I8SA 4BO5A 4GU5A 1UK9A 3UGQA 4I1MA 4GE0A 4IH9A 4FYYA 4HRVA 1SURA 5CTAA 1Y1KE 3OWTA 3RU3A 2H18A 4EVRA 3RS0A 4WNYA 1W581 5E1BA 2W6NA 2IIVA 1G8PA 4F4JA 5A5FA 1DRWA 1PK9A 3GDOA 4ZODA 4U5XA 4K6FA 5TV2A 3FSRA 5HILA 1HH4A 1V1MB 4LQDA 3JU3A 5F7ZA 5HDQA 1K68A 3RIYA 3TSOA 4YRRA 2ZTSA 3G2IA 3VSAA 3UJ8A 3BJZA 4YCJA 1KH3A 1HE9A 1LNQA 4B3XA 3IPYA 4IXMA 2ODPA 2XT6A 3GPIA 1J1ZA 2C5FA 3IAHA 2PK3A 2WIBA 1TW2A 2X0KA 1I30A 1SB9A 2JRLA 4YTEA 1WXGA 5FP0A 5BQIA 1GZ6A 3PUXA 1CQJA 1J09A 5FTJA 4UHJA 2E85A 2Z2KA 3GNLA 4XVCA 4OXXA 3RRFA 1BR1A 2M32A 3MWGA 2O05A 3S5JA 2C5BA 2QRQA 3FAKA 4J91A 3LZCA 4Y2RA 3BHJA 3ZXSA 1P5FA 1J7JA 1Y6DA 1FYXA 3IAS1 1A2BA 1AQJA 4LBYA 4QZVA 2SHKA 2PKRA 3JD4A 3K2EA 4BGUA 1U4SA 2BZ0A 5B53A 3GLHA 5AFSA 1ZR2A 5KNDD 1L5NA 1D7OA 5B7GA 4RZXA 5ITSA 3AB3A 4W5OA 3HJCA 1MKYA 2EQAA 1NW8A 3JCZA 4ISCA 1SULA 4LSMA 1MOZA 1KDYA 3G82C 4F92B 3UW3A 2WF5A 1FNNA 5AW6A 2VQEB 3A6JA 5DW0A 1ZHHA 3HDJA 4I19A 3CRW1 4D8UA 3ZHXA 3AFNA 2ABWA 1A4RA 4Y9SA 1EBUA 4EKYA 1QP4A 3HKEA 1OLXB 3OG9A 3L1MA 3CUWA 2IIBA 3BTVA 3RFFA 2P30A 1XAGA 1WXWA 5ALZA 4IL5A 3EWAA 2E4WA 3K6KA 1FP2A 4FCCA 4HBGA 2PA3A 2R3SA 4AZ0B 4RXTA 3FMIA 1JPJA 1A7DA 1Q1ZA 3NRJA 3SQXA 4P0QB 1NKVA 1BA3A 5ENZA 1KSHA 2M6LA 1JFTA 2VHZA 4MLZA 3W90A 2AE2A 3OEOA 2X3UA 1GV1A 3DZAA 1SBNE 3MWJA 4CJGA 3RAGA 1K8ZB 5FA8A 1QZUA 1OXVA 4PCLA 1VJ0A 3TZEA 3W8NA 4DSTA 1KY5A 3CLRC 1DB3A 1SCDA 2KYHA 2J3KA 4ZARA 3GLRA 2HREA 3W34A 4KPYA 3H1FA 3EZ2A 1YDEA 5KO2A 1HT3A 1Z2CA 1KYWA 4HTFB 5IM4A 3QLVC 5DQTA 2X9LA 3NANA 1NKTA 3KHTA 2IEGA 1BHJA 4BNDB 5JHHB 3HYLA 2QRPA 1KI2A 4BNXA 1W0JD 5FUXA 1MV5A 2AW5A 2GZ1A 2BSXA 4P98A 4BO6A 4NOLA 1Z2OX 3JD3A 5IAJA 1BS1A 1SHUX 4DS3A 1U6HA 4TVSA 2FDCA 1SRRA 4FMCF 4BX0A 3CLSC 3K05A 1O9HA 1S2MA 5C5IA 4ZVUA 3K8YA 3THRA 3ZVMA 4MCJA 4MWEA 4BNLA 1GTZA 3AYXB 2HV8A 3UENA 4EAQA 4FK8A 2Q28A 3IVMA 1ZNQO 5TX7A 1SIUA 3TKLA 2WPDD 2QS9A 1RXCA 3O90A 2J0UB 4F06A 1QF6A 4G36A 1C81A 3F67A 3V5XA 4N1AA 3DO6A 4OP1A 1KERA 1MJGM 2YCBA 1M2VB 4MKFA 1O5IA 3FKQA 4O59O 3DMPA 1TVKA 3EVAA 5HZGA 1NUAA 4YRJA 4HRAA 4MMZB 3MT0A 4RF4A 5KYUA 4C7KA 3AHJA 3V8RA 2KQUA 4G4SO 2FOXA 3CE9A 4Q93A 1LDGA 2ZCUA 2P2DA 4HV4A 3NBZC 4MUEA 3BWMA 1M6VA 3EIWA 2Y69C 2IYLD 4OGKA 5KOHA 1COWD 3PHLA 1S5PA 3M5DA