3T9OA

Regulatory czb domain of dgcz
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
122
structure length
108
Chain Sequence
b'TTEIDAILLNLNKAIDAHYQWLVSMFHSVVARDCQFGRWIDHLGPLDNDELPYVRLMDSAHQHMHNCGRELMLAIVENHWQDAHFDAFQEGLLSFTAALTDYKIYLLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diguanylate cyclase DgcZ
publication title Structure and signaling mechanism of a zinc-sensory diguanylate cyclase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 43
structure length 108
sequence length 122
chains with identical sequence B
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2011-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 3t9oA00
2LIGA 4Z9HA 2D4UA 1LIHA 2ASRA 1VLTA 1VLSA 3ATPA 1WASA 1WATA 4Z9IA 1JMWA 4Z9JA 3T9OA 4H54A
chains in the Genus database with same CATH superfamily
4O7GA 3EH1A 2MHRA 1G4US 2RD9A 2BE5F 2QY9A 2WB7A 3KL4A 5T3WA 1VMAA 2G3KA 2HMQA 3EHNA 3UNGC 5L0IA 1LKXA 3N24A 3FHDA 1TWGA 3F47A 2VCBA 4MVZA 1G4WR 2QUPA 4JC7A 1JAFA 5T3TA 1EA8A 3B0VC 4CS8A 4ZLDA 1OXKA 2A1DD 1A0BA 3GM2A 1O87A 3NYLA 2HMZA 4K7BA 3TD7A 3L8IA 4EBBA 5AGFA 3U0CA 4AX2A 3IHUA 3K66A 4JCHA 5JVEA 3U8VA 4JTCB 5B1AC 3EGDB 1Z7Qc 4YL0A 2R7QA 2QNLA 1ZHTA 1ZHZA 2NSFA 3A9CA 1Q0MA 2G62A 3DM9B 3LUTB 1KNYA 4MS2A 3LAYA 2VB6A 1BBHA 4KC9A 3V5XA 1NU7D 4R32A 5A6KA 5A6BA 3NYMA 2A6EF 2HV7A 2XM0A 3JSZA 3VM6A 3CSKA 3OEOA 4JEAA 2FFHA 2XS1A 4DRIB 2I15A 1HE9A 2VASA 3G4ZA 4CS7A 4XLPF 4CX9A 3H65A 3M4CA 1H9TA 5E3AA 2CNWA 3BRJA 1T5OA 2XL8A 2EPKX 5HSWA 3ZG1A 1VK5A 3RYLA 1VYKA 2AWCA 1YAUO 2YQYA 5COMA 2HSBA 1C03A 1DOVA 1NG1A 4CS9A 3E70C 3EFOA 4JCZA 2ICWG 5A6AA 4IARA 1Q0FA 1RJ9A 3JRTA 1EI7A 1Z6AA 2QE9A 4L6RA 5FCLA 4IGGA 4GQHA 3W8IA 3VRCA 4K0DA 4EIYA 2Y3BA 4IAQA 4FESA 3DMDA 4M63A 2J7PD 1YLMA 4PR9A 3US6A 1D1AA 2EIMC 3WHNA 3H2VA 2LK4A 2P6VA 1CPQA 4J30B 3UGOA 1D0ZA 2NPUA 2WVNA 4QDLA 2PX0A 1XWJA 4PJLA 1S7ZA 5B3SC 3O10A 5JT4A 1RMVA 2ZD9A 3S28A 2Q3TA 256BA 1A7VA 1WGWA 2IYLD 2V26A 4LDKA 5CI9A 1OQCA 4O6YA 1Y4CA 3B71A 4U5BE 3JZ0A 1PCXA 2EPLX 2J46A 3HLZA 3G50A 4LDRA 1TWCA 3C8GD 4U5EE 5FZTA 3CAXA 1FFTC 1PD1A 3HJCA 1RKEB 1JOGA 1QZXA 3ECSA 4XWJA 2OCCC 5EK0A 3EJNA 3U2MA 1TWAA 2HJMA 3QW0A 4JJGA 4NCQA 1V55C 4IWBA 3GM3A 4BEMJ 3KYIA 4D4XA 2LP4A 1Y6DA 2VCCA 3F46A 4KNWA 3B0PA 5L3QA 3EG9A 4OIPF 3Q6NA 3LNRA 5EGYA 1JMWA 2W4BA 4KNVA 3W2VA 1T6QA 2OU6A 3DKAA 2AWYA 3MX3A 4NC3A 3ZTZA 3N0TA 3FVYA 4IB4A 4J7YA 3TOMA 4CS8C 3IQTA 1OXBA 1PD0A 3AG2C 3KYJA 3M15A 3QW1A 1HE1A 4A2NB 3L8JA 4MVQA 4BEJA 1JPJA 1VB5A 1Z5ZA 4JVSA 2J0WA 4XEVA 2Y39A 3UMIA 2OQMA 1XZPA 1RXQA 4XEKA 3J06A 1YZCA 4Q5SF 4ONSA 2OOCA 3M4BA 2OJED 4C3EA 1OW6A 3M1CB 3S90A 4Z9HA 2NSGA 2XL4A 5JS5A 2EINC 3UGPA 1I4ZA 1TKNA 1N1CA 2HZ8A 4JTDB 5L0FA 1DOWA 4QI2A 4EKWA 2H7VC 3EQLF 1WWPA 2ZXPA 5BUOA 1M2VA 1SMYF 3IQ6A 3QZCA 4EBKA 2XLEA 4JEBA 3V5ZA 5A6BD 4AE4A 5HV9A 2H8AA 4Q7CA 4J32B 4CS9C 1SF8A 1T01A 2R7TA 4WGZA 3O55A 4U5CE 2LSEA 1LPEA 2QTVA 1Z3IX 3RFYA 5KYUB 5KYYA 1Q0GA 2CNWD 1OKKD 2OJQA 1VYIA 4HFKB 3HKKA 4CIPA 1E85A 1QPUA 2XL6A 1OCCC 2PF4E 3C8GB 2NUTA 2PBEA 4OD5A 4CBEA 3TQOA 2R7XA 4ZLCA 5BQIA 3T6BA 2HSQA 5L3VA 3FAPB 2GWWA 3K1IA 2IXMA 5KYXA 4N4WA 2GDCA 4GEHA 1Z23A 3LS1A 4XPXA 3ZQYA 4MVUA 5E3CA 3RVYA 2FGYA 2ZXRA 1ZHWA 3GORA 2Q7RA 2B0JA 4EHPA 1VLSA 1V54C 2EILC 2KYHA 3ZIBA 1TFKB 2EPNA 1SZIA 1H6GA 3GEEA 2R7OA 2Y69C 5AC5A 2NUPA 5KYWA 1LS4A 1MMGA 4A4AA 1IW7F 2OKUA 1I5NA 1WATA 4UDVA 2PFDA 2HUJA 3PDMP 1NFOA 2Q9BA 5B3IA 2W4MA 2TMVP 2WL8A 1AEPA 1E83A 1M57C 4I1MA 4U9DA 3NMJA 4JJFA 1NZEA 3X1OA 1QKRA 2D5RB 3RIPA 1E2XA 1CPRA 1LI7A 2L7AA 1Q0KA 3CEXA 4I3MA 3S29A 1YDIA 4MVSA 2JX0A 5TJ5E 5JRAA 4KI2A 2B0HA 3S27A 1YA9A 1ORSC 2R7VA 3ZWIA 2OG2A 3IPMO 1KTMA 1F1MA 1V4AA 2XM4A 4N06A 2ZXWC 2KGOA 1U6HA 3C18A 2A0UA 4OD4A 4PK4A 1FTSA 1ORJA 3O39A 4WJ0A 3V7OA 3MYIA 3LNMB 2Q00A 1V74B 3DAGA 2MWQA 2JD3A 1D1CA 1T9KA 5JLIA 3C7JA 3HNLA 4NTBA 3W4YA 1T6IA 1JR8A 1QQ3A 1ZHYA 3IQCA 2CDQA 4P9FA 2KC3A 3ZC4A 2LQGA 2J9UA 2XS8A 4MVRA 1D0XA 4MVOA 1KU2A 3U5SA 2Y3GA 1C02A 1LI5A 4O6NA 2EPOA 2J0XA 4YT5A 2VC9A 2PNOA 2LCHA 3B9QA 2R9RB 4U5HA 4G7HF 2LFDA 3FMSA 4MW8A 1MNEA 1RJ9B 4YWQA 3VAYA 5COFA 2M64A 1UFBA 1YZAA 2IBFA 2Y3HA 1WN0A 2YLIA 3S9OA 3SXZA 4NTAA 3UMKA 2XXAA 1MQVA 1GM5A 3LJBA 4PFPA 1ZHXA 3QVZA 3HNIA 4RDAA 1YJGA 3IEEA 3T6GB 2L9JA 2WZGA 3EPVA 1CGNA 3NKDA 3GEHA 3K6BA 5JP7A 2ZXOA 3LEVA 3L0IA 1O5HA 4BJ5A 3W8HA 5D91A 3EZHA 2YL0A 2YHSA 3Q7GA 4K1OA 4C3DA 3AOUA 3GWLA 1U89A 4EWCA 3K1HA 3RVZA 1LE4A 3DWWA 2GA0A 4XPYA 4F4BA 4CIHA 3RQEA 2DYSC 2CGEA 3FDQA 3FAJA 3MLGA 3RH3A 2YL1A 2HJ3A 4QI0A 1NU9C 4D4NA 2Q9CA 1APCA 3AGTA 3QMKA 1BR1A 3QTHA 4JTAB 2M4EA 4E0HA 4G0HA 1C17M 3JTLO 5A69A 2I8BA 1MMAA 4HFFB 4I1OB 4DOZA 2OEVA 3S0XA 1E86A 4G7ZF 3FOPA 4XQ1A 3SYNA 3NMIA 1OW8A 3E9VA 3NDBB 4C3BA 2R7WA 3AG1C 3NMKA 2ZPAA 4PFOA 1QVXA 2L6HA 1MMDA 3N2ZB 4CDYA 4CJGA 1T6UA 2J9BA 4W8PA 3NKEA 3RKOF 4E18A 3ABLC 5DQZA 2XLWA 4C7OB 4CSAA 3NYJA 1O3UA 4MTOA 4Z9JA 5DQTA 1HW2A 2LIGA 3LESA 5F5FA 3AQCA 2Q4FA 3GWNA 1LS1A 3LS0A 2W9YA 2YLGA 1HMOA 5L0GA 1G8XA 5B1BC 2IOQA 1YARO 3FOOA 1G5ZA 2E87A 2YL3A 1H9GA 3LLIA 4OIOF 2C04A 1ZVZA 3R2PA 4JIOA 2MYSA 2BL2A 1D0YA 4J7TA 4JZAA 4AL1A 3SXKA 1FMVA 2A6HF 3U9MA 1QSPA 1ZU4A 2HKVA 2IXNA 2LFFA 3AG3C 3EGXB 1LVKA 2P0NA 2RSEB 2A0BA 2KQ9A 4XTKA 4DRHB 2IM8A 2KJGA 2KW3C 2R05A 2YWAA 3RF3A 5E33A 2FAPB 3MFNA 3RQGA 5DVWA 1L3PA 3RW0A 4DVYP 2UUHA 3U2LA 3UR3C 3POVA 1MMNA 2Z15A 3DM5A 1LE2A 4LERA 4PJNA 1A7DA 3JT1A 1GQAA 3UMHA 2HS5A 4X0RA 1FAPB 3WG7C 3HNJA 5AC4A 1EKYA 4DRJB 2XLMA 3DZAA 2IXPA 1LIHA 4EUKB 4E7SA 3M79A 5CI8A 3W2WA 1YVIA 3DJUB 5KYUA 3JYHA 1PV3A 5L0CA 2XSEA 3AQBA 3V5YA 1GGQA 2L81A 4JE9A 4DXWA 1MNDA 1TR2A 1JRAA 3T6JA 1RCPA 3CZ6A 5L0DA 5KYXB 2WVOA 3DD7A 4IAOA 1R5ID 3HTKC 1U0BB 3X2QC 1ZZPA 1I4YA 4G78A 4BJ5C 1FR0A 2CYDA 2J45A 2F22A 3DAFA 5GPGB 4BG0A 3DI5A 1HMDA 3SXYA 3OA1A 4HE8D 3GODA 1TQGA 3KH2A 1ST6A 3OWTA 4XPWA 5EHHA 3B0UX 4O79A 3KMIA 4DBQA 2H7BA 3R7CA 2YVKA 2NUPB 3FXHA 3ZDLA 5KYWB 1LM3B 1SYQA 4JRZA 1VTMP 3I5PA 3EGDA 2X51A 1J8MF 4G7OF 3U3BA 1YA7O 1FNTc 1RKCA 2O9XA 3ASNC 3JSEO 4JURI 4LLCA 2KNHA 3RQFA 4CDVA 1M2OA 5DLJA 2WVQA 3TULA 1QLEC 2W45A 1CGOA 2YRFA 1S05A 4BJ6A 4YL3A 1OCOC 2NG1A 1K40A 4P9TA 1JPNA 4XLNF 1J8YF 3O6XA 2L6GA 3EH2A 3Q6MA 4MW3A 1TWHA 2GAQA 4U9EA 3AGUA 2J9VA 3GANA 3MBGA 2R03A 3GEIA 2WZLA 2JPUA 4W8KA 1UG7A 4YJWA 1W2WA 2X0CA 3T4RA 2Y3DA 1CGME 4CSAC 2H7OA 3AJMA 3L34A 5BQHA 4RD9A 1AUEA 1H7IA 2AU5A 1WASA 2HFIA 4U5DE 2VH3A 5F28E 1ZU5A 2GFHA 1YYXA 2R25A 1BR4A 3EFOB 4NY3A 2UUIA 4MVMA 4HEAJ 4WGYA 4XEFA 4BPMA 5DS6A 2ASRA 4WABA 2DI3A 1OKKA 4ULWA 1B68A 4MQ9F 4AK9A 3C62A 4IJJA 4CDAA 5CIVA 2DB4A 3PHF2 2XRHA 3DE9A 2J8WA 4DBRA 2R7RA 1YYJA 2L6FA 1VLTA 3A11A 4I44A 4MNDA 3TK0A 3ASOC 4IRUA 1NBBA 1FFHA 1SR2A 2ETSA 3I5QA 3KKBA 4YK5A 4B6IA 5E2QA 3TJ6A 3S84A 1M56C 5JSLA 1K04A 3K33A 2DYRC 1M6TA 2AP3A 1AVOB 2G3VA 2VCAA 2XLDA 2YEVA 2XXAB 2J9WA 3JRMO 1VOMA 4PJMA 3I4UA 1Z63A 4PACA 3IQ5A 3LLKA 2XLHA 4FX5A 1A7EA 1A41A 2KK1A 2PX3A 3K1IC 3K7DA 1EQ1A 1OCZC 2YLDA 2EIKC 1RKEA 2EPMX 5IY5C 1ZYRF 3SNHA 3SZRA 5L0HA 5KYNA 4H4KC 2DGJA 1D1BA 1HY5A 1WTYA 3HNKA 4FWVA 3KPHA 4LACB 4LDQA 3ZTMA 1OR2A 3ZVRA 4BJTA 4E0IA 3L1MA 4E7ZA 4U5FE 2P1AA 3B29A 5K0IA 4CJOA 3DXJF 4ANJA 3AG4C 3QVYA 2CCYA 4YN0B 3G4XA 5D92A 2HV6A 1NFNA 2LD6A 4KBLA 3TOLA 3ZQVA 3DJNB 5JUAA 2P61A 4BJ1A 4EBJA 5COGA 3LEOA 3DE8A 3EG9B 2R02A 2OEXA 3PMRA 5A6JA 4NTFA 4N6CA 3EZIA 4YT2A 3NRHA 3JCUQ 4NQFA 4DJ9A 3NG1A 4Q4ZF 2P7VA 4GYTA 1XZQA 1L7CA 3ABMC 2YKZA 2YZSA 4JW1A 4RBNA 3ZSUA 4AL0A 1E84A 2CW0F 1GS9A 5BQGA 1K05A 1OCRC 4OINF 4C7OA 4O6MA 3SEOA 2BC5A 3U8PA 4DVZA 5F5HA 3C8ZA 3H2UA 4ER9A 2C03A 4H54A 5T1DB 4YT4A 3WODF 1TFOB 2A69F 3VYWA 1OR3A 2EIJC 4MTFA 5L0JA 1Q0DA 1BR2A 2J7PA 4BJ6C 1HW1A 4E17A 3WAQA 3SXMA 4FAPB 4OIQF 1IZMA 2R7UA 3U9JA 1OW7A 3PCVA 4LLEA 1FMWA 3EHMA 3GM1A 3EGXA 1R4TA 3ABKC 2XLOA 3BEHA 3JYYA 4JKVA 2D4UA 1M2VB 2R7SA 3ATPA 2XLVA 4YL1A 3MYFA 4AE4B 3T9OA 3CQZA 4P6IC 3SP1A 1ZW3A 5KYYB 3C8GA 4Z9IA 3U3FA 2QLAA 2AVKA 3ITFA 4YT8A 3TJ5A 1NLXA 1ORYA 4U5GA 2A68F 2NUTB 2WZFA 1NSGB 3C63A 4MTGA 3VF0A 3Q7LA 4N6HA 4OIRF 2KSFA 5DS5A 2PP4A 2V3CC 1ZW2A 2Q9AA 1WOLA 2IXOA 4ULVA 5DS4A 4PJJA 2YL7A 1BZ4A 1BDJB
chains in the Genus database with same CATH topology
2LIGA 4Z9HA 2D4UA 1LIHA 2ASRA 1VLTA 1VLSA 3ATPA 1WASA 1WATA 4Z9IA 1JMWA 4Z9JA 3T9OA 4H54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LIG A;  4Z9H A;  2D4U A;  1LIH A;  2ASR A;  1VLT A;  1VLS A;  3ATP A;  1WAS A;  1WAT A;  4Z9I A;  1JMW A;  4Z9J A;  3T9O A;  4H54 A; 
#chains in the Genus database with same CATH topology
 4O7G A;  3EH1 A;  2MHR A;  1G4U S;  2RD9 A;  2BE5 F;  2QY9 A;  2WB7 A;  3KL4 A;  5T3W A;  1VMA A;  2G3K A;  2HMQ A;  3EHN A;  3UNG C;  5L0I A;  1LKX A;  3N24 A;  3FHD A;  1TWG A;  3F47 A;  2VCB A;  4MVZ A;  1G4W R;  2QUP A;  4JC7 A;  1JAF A;  5T3T A;  1EA8 A;  3B0V C;  4CS8 A;  4ZLD A;  1OXK A;  2A1D D;  1A0B A;  3GM2 A;  1O87 A;  3NYL A;  2HMZ A;  4K7B A;  3TD7 A;  3L8I A;  4EBB A;  5AGF A;  3U0C A;  4AX2 A;  3IHU A;  3K66 A;  4JCH A;  5JVE A;  3U8V A;  4JTC B;  5B1A C;  3EGD B;  1Z7Q c;  4YL0 A;  2R7Q A;  2QNL A;  1ZHT A;  1ZHZ A;  2NSF A;  3A9C A;  1Q0M A;  2G62 A;  3DM9 B;  3LUT B;  1KNY A;  4MS2 A;  3LAY A;  2VB6 A;  1BBH A;  4KC9 A;  3V5X A;  1NU7 D;  4R32 A;  5A6K A;  5A6B A;  3NYM A;  2A6E F;  2HV7 A;  2XM0 A;  3JSZ A;  3VM6 A;  3CSK A;  3OEO A;  4JEA A;  2FFH A;  2XS1 A;  4DRI B;  2I15 A;  1HE9 A;  2VAS A;  3G4Z A;  4CS7 A;  4XLP F;  4CX9 A;  3H65 A;  3M4C A;  1H9T A;  5E3A A;  2CNW A;  3BRJ A;  1T5O A;  2XL8 A;  2EPK X;  5HSW A;  3ZG1 A;  1VK5 A;  3RYL A;  1VYK A;  2AWC A;  1YAU O;  2YQY A;  5COM A;  2HSB A;  1C03 A;  1DOV A;  1NG1 A;  4CS9 A;  3E70 C;  3EFO A;  4JCZ A;  2ICW G;  5A6A A;  4IAR A;  1Q0F A;  1RJ9 A;  3JRT A;  1EI7 A;  1Z6A A;  2QE9 A;  4L6R A;  5FCL A;  4IGG A;  4GQH A;  3W8I A;  3VRC A;  4K0D A;  4EIY A;  2Y3B A;  4IAQ A;  4FES A;  3DMD A;  4M63 A;  2J7P D;  1YLM A;  4PR9 A;  3US6 A;  1D1A A;  2EIM C;  3WHN A;  3H2V A;  2LK4 A;  2P6V A;  1CPQ A;  4J30 B;  3UGO A;  1D0Z A;  2NPU A;  2WVN A;  4QDL A;  2PX0 A;  1XWJ A;  4PJL A;  1S7Z A;  5B3S C;  3O10 A;  5JT4 A;  1RMV A;  2ZD9 A;  3S28 A;  2Q3T A;  256B A;  1A7V A;  1WGW A;  2IYL D;  2V26 A;  4LDK A;  5CI9 A;  1OQC A;  4O6Y A;  1Y4C A;  3B71 A;  4U5B E;  3JZ0 A;  1PCX A;  2EPL X;  2J46 A;  3HLZ A;  3G50 A;  4LDR A;  1TWC A;  3C8G D;  4U5E E;  5FZT A;  3CAX A;  1FFT C;  1PD1 A;  3HJC A;  1RKE B;  1JOG A;  1QZX A;  3ECS A;  4XWJ A;  2OCC C;  5EK0 A;  3EJN A;  3U2M A;  1TWA A;  2HJM A;  3QW0 A;  4JJG A;  4NCQ A;  1V55 C;  4IWB A;  3GM3 A;  4BEM J;  3KYI A;  4D4X A;  2LP4 A;  1Y6D A;  2VCC A;  3F46 A;  4KNW A;  3B0P A;  5L3Q A;  3EG9 A;  4OIP F;  3Q6N A;  3LNR A;  5EGY A;  1JMW A;  2W4B A;  4KNV A;  3W2V A;  1T6Q A;  2OU6 A;  3DKA A;  2AWY A;  3MX3 A;  4NC3 A;  3ZTZ A;  3N0T A;  3FVY A;  4IB4 A;  4J7Y A;  3TOM A;  4CS8 C;  3IQT A;  1OXB A;  1PD0 A;  3AG2 C;  3KYJ A;  3M15 A;  3QW1 A;  1HE1 A;  4A2N B;  3L8J A;  4MVQ A;  4BEJ A;  1JPJ A;  1VB5 A;  1Z5Z A;  4JVS A;  2J0W A;  4XEV A;  2Y39 A;  3UMI A;  2OQM A;  1XZP A;  1RXQ A;  4XEK A;  3J06 A;  1YZC A;  4Q5S F;  4ONS A;  2OOC A;  3M4B A;  2OJE D;  4C3E A;  1OW6 A;  3M1C B;  3S90 A;  4Z9H A;  2NSG A;  2XL4 A;  5JS5 A;  2EIN C;  3UGP A;  1I4Z A;  1TKN A;  1N1C A;  2HZ8 A;  4JTD B;  5L0F A;  1DOW A;  4QI2 A;  4EKW A;  2H7V C;  3EQL F;  1WWP A;  2ZXP A;  5BUO A;  1M2V A;  1SMY F;  3IQ6 A;  3QZC A;  4EBK A;  2XLE A;  4JEB A;  3V5Z A;  5A6B D;  4AE4 A;  5HV9 A;  2H8A A;  4Q7C A;  4J32 B;  4CS9 C;  1SF8 A;  1T01 A;  2R7T A;  4WGZ A;  3O55 A;  4U5C E;  2LSE A;  1LPE A;  2QTV A;  1Z3I X;  3RFY A;  5KYU B;  5KYY A;  1Q0G A;  2CNW D;  1OKK D;  2OJQ A;  1VYI A;  4HFK B;  3HKK A;  4CIP A;  1E85 A;  1QPU A;  2XL6 A;  1OCC C;  2PF4 E;  3C8G B;  2NUT A;  2PBE A;  4OD5 A;  4CBE A;  3TQO A;  2R7X A;  4ZLC A;  5BQI A;  3T6B A;  2HSQ A;  5L3V A;  3FAP B;  2GWW A;  3K1I A;  2IXM A;  5KYX A;  4N4W A;  2GDC A;  4GEH A;  1Z23 A;  3LS1 A;  4XPX A;  3ZQY A;  4MVU A;  5E3C A;  3RVY A;  2FGY A;  2ZXR A;  1ZHW A;  3GOR A;  2Q7R A;  2B0J A;  4EHP A;  1VLS A;  1V54 C;  2EIL C;  2KYH A;  3ZIB A;  1TFK B;  2EPN A;  1SZI A;  1H6G A;  3GEE A;  2R7O A;  2Y69 C;  5AC5 A;  2NUP A;  5KYW A;  1LS4 A;  1MMG A;  4A4A A;  1IW7 F;  2OKU A;  1I5N A;  1WAT A;  4UDV A;  2PFD A;  2HUJ A;  3PDM P;  1NFO A;  2Q9B A;  5B3I A;  2W4M A;  2TMV P;  2WL8 A;  1AEP A;  1E83 A;  1M57 C;  4I1M A;  4U9D A;  3NMJ A;  4JJF A;  1NZE A;  3X1O A;  1QKR A;  2D5R B;  3RIP A;  1E2X A;  1CPR A;  1LI7 A;  2L7A A;  1Q0K A;  3CEX A;  4I3M A;  3S29 A;  1YDI A;  4MVS A;  2JX0 A;  5TJ5 E;  5JRA A;  4KI2 A;  2B0H A;  3S27 A;  1YA9 A;  1ORS C;  2R7V A;  3ZWI A;  2OG2 A;  3IPM O;  1KTM A;  1F1M A;  1V4A A;  2XM4 A;  4N06 A;  2ZXW C;  2KGO A;  1U6H A;  3C18 A;  2A0U A;  4OD4 A;  4PK4 A;  1FTS A;  1ORJ A;  3O39 A;  4WJ0 A;  3V7O A;  3MYI A;  3LNM B;  2Q00 A;  1V74 B;  3DAG A;  2MWQ A;  2JD3 A;  1D1C A;  1T9K A;  5JLI A;  3C7J A;  3HNL A;  4NTB A;  3W4Y A;  1T6I A;  1JR8 A;  1QQ3 A;  1ZHY A;  3IQC A;  2CDQ A;  4P9F A;  2KC3 A;  3ZC4 A;  2LQG A;  2J9U A;  2XS8 A;  4MVR A;  1D0X A;  4MVO A;  1KU2 A;  3U5S A;  2Y3G A;  1C02 A;  1LI5 A;  4O6N A;  2EPO A;  2J0X A;  4YT5 A;  2VC9 A;  2PNO A;  2LCH A;  3B9Q A;  2R9R B;  4U5H A;  4G7H F;  2LFD A;  3FMS A;  4MW8 A;  1MNE A;  1RJ9 B;  4YWQ A;  3VAY A;  5COF A;  2M64 A;  1UFB A;  1YZA A;  2IBF A;  2Y3H A;  1WN0 A;  2YLI A;  3S9O A;  3SXZ A;  4NTA A;  3UMK A;  2XXA A;  1MQV A;  1GM5 A;  3LJB A;  4PFP A;  1ZHX A;  3QVZ A;  3HNI A;  4RDA A;  1YJG A;  3IEE A;  3T6G B;  2L9J A;  2WZG A;  3EPV A;  1CGN A;  3NKD A;  3GEH A;  3K6B A;  5JP7 A;  2ZXO A;  3LEV A;  3L0I A;  1O5H A;  4BJ5 A;  3W8H A;  5D91 A;  3EZH A;  2YL0 A;  2YHS A;  3Q7G A;  4K1O A;  4C3D A;  3AOU A;  3GWL A;  1U89 A;  4EWC A;  3K1H A;  3RVZ A;  1LE4 A;  3DWW A;  2GA0 A;  4XPY A;  4F4B A;  4CIH A;  3RQE A;  2DYS C;  2CGE A;  3FDQ A;  3FAJ A;  3MLG A;  3RH3 A;  2YL1 A;  2HJ3 A;  4QI0 A;  1NU9 C;  4D4N A;  2Q9C A;  1APC A;  3AGT A;  3QMK A;  1BR1 A;  3QTH A;  4JTA B;  2M4E A;  4E0H A;  4G0H A;  1C17 M;  3JTL O;  5A69 A;  2I8B A;  1MMA A;  4HFF B;  4I1O B;  4DOZ A;  2OEV A;  3S0X A;  1E86 A;  4G7Z F;  3FOP A;  4XQ1 A;  3SYN A;  3NMI A;  1OW8 A;  3E9V A;  3NDB B;  4C3B A;  2R7W A;  3AG1 C;  3NMK A;  2ZPA A;  4PFO A;  1QVX A;  2L6H A;  1MMD A;  3N2Z B;  4CDY A;  4CJG A;  1T6U A;  2J9B A;  4W8P A;  3NKE A;  3RKO F;  4E18 A;  3ABL C;  5DQZ A;  2XLW A;  4C7O B;  4CSA A;  3NYJ A;  1O3U A;  4MTO A;  4Z9J A;  5DQT A;  1HW2 A;  2LIG A;  3LES A;  5F5F A;  3AQC A;  2Q4F A;  3GWN A;  1LS1 A;  3LS0 A;  2W9Y A;  2YLG A;  1HMO A;  5L0G A;  1G8X A;  5B1B C;  2IOQ A;  1YAR O;  3FOO A;  1G5Z A;  2E87 A;  2YL3 A;  1H9G A;  3LLI A;  4OIO F;  2C04 A;  1ZVZ A;  3R2P A;  4JIO A;  2MYS A;  2BL2 A;  1D0Y A;  4J7T A;  4JZA A;  4AL1 A;  3SXK A;  1FMV A;  2A6H F;  3U9M A;  1QSP A;  1ZU4 A;  2HKV A;  2IXN A;  2LFF A;  3AG3 C;  3EGX B;  1LVK A;  2P0N A;  2RSE B;  2A0B A;  2KQ9 A;  4XTK A;  4DRH B;  2IM8 A;  2KJG A;  2KW3 C;  2R05 A;  2YWA A;  3RF3 A;  5E33 A;  2FAP B;  3MFN A;  3RQG A;  5DVW A;  1L3P A;  3RW0 A;  4DVY P;  2UUH A;  3U2L A;  3UR3 C;  3POV A;  1MMN A;  2Z15 A;  3DM5 A;  1LE2 A;  4LER A;  4PJN A;  1A7D A;  3JT1 A;  1GQA A;  3UMH A;  2HS5 A;  4X0R A;  1FAP B;  3WG7 C;  3HNJ A;  5AC4 A;  1EKY A;  4DRJ B;  2XLM A;  3DZA A;  2IXP A;  1LIH A;  4EUK B;  4E7S A;  3M79 A;  5CI8 A;  3W2W A;  1YVI A;  3DJU B;  5KYU A;  3JYH A;  1PV3 A;  5L0C A;  2XSE A;  3AQB A;  3V5Y A;  1GGQ A;  2L81 A;  4JE9 A;  4DXW A;  1MND A;  1TR2 A;  1JRA A;  3T6J A;  1RCP A;  3CZ6 A;  5L0D A;  5KYX B;  2WVO A;  3DD7 A;  4IAO A;  1R5I D;  3HTK C;  1U0B B;  3X2Q C;  1ZZP A;  1I4Y A;  4G78 A;  4BJ5 C;  1FR0 A;  2CYD A;  2J45 A;  2F22 A;  3DAF A;  5GPG B;  4BG0 A;  3DI5 A;  1HMD A;  3SXY A;  3OA1 A;  4HE8 D;  3GOD A;  1TQG A;  3KH2 A;  1ST6 A;  3OWT A;  4XPW A;  5EHH A;  3B0U X;  4O79 A;  3KMI A;  4DBQ A;  2H7B A;  3R7C A;  2YVK A;  2NUP B;  3FXH A;  3ZDL A;  5KYW B;  1LM3 B;  1SYQ A;  4JRZ A;  1VTM P;  3I5P A;  3EGD A;  2X51 A;  1J8M F;  4G7O F;  3U3B A;  1YA7 O;  1FNT c;  1RKC A;  2O9X A;  3ASN C;  3JSE O;  4JUR I;  4LLC A;  2KNH A;  3RQF A;  4CDV A;  1M2O A;  5DLJ A;  2WVQ A;  3TUL A;  1QLE C;  2W45 A;  1CGO A;  2YRF A;  1S05 A;  4BJ6 A;  4YL3 A;  1OCO C;  2NG1 A;  1K40 A;  4P9T A;  1JPN A;  4XLN F;  1J8Y F;  3O6X A;  2L6G A;  3EH2 A;  3Q6M A;  4MW3 A;  1TWH A;  2GAQ A;  4U9E A;  3AGU A;  2J9V A;  3GAN A;  3MBG A;  2R03 A;  3GEI A;  2WZL A;  2JPU A;  4W8K A;  1UG7 A;  4YJW A;  1W2W A;  2X0C A;  3T4R A;  2Y3D A;  1CGM E;  4CSA C;  2H7O A;  3AJM A;  3L34 A;  5BQH A;  4RD9 A;  1AUE A;  1H7I A;  2AU5 A;  1WAS A;  2HFI A;  4U5D E;  2VH3 A;  5F28 E;  1ZU5 A;  2GFH A;  1YYX A;  2R25 A;  1BR4 A;  3EFO B;  4NY3 A;  2UUI A;  4MVM A;  4HEA J;  4WGY A;  4XEF A;  4BPM A;  5DS6 A;  2ASR A;  4WAB A;  2DI3 A;  1OKK A;  4ULW A;  1B68 A;  4MQ9 F;  4AK9 A;  3C62 A;  4IJJ A;  4CDA A;  5CIV A;  2DB4 A;  3PHF 2;  2XRH A;  3DE9 A;  2J8W A;  4DBR A;  2R7R A;  1YYJ A;  2L6F A;  1VLT A;  3A11 A;  4I44 A;  4MND A;  3TK0 A;  3ASO C;  4IRU A;  1NBB A;  1FFH A;  1SR2 A;  2ETS A;  3I5Q A;  3KKB A;  4YK5 A;  4B6I A;  5E2Q A;  3TJ6 A;  3S84 A;  1M56 C;  5JSL A;  1K04 A;  3K33 A;  2DYR C;  1M6T A;  2AP3 A;  1AVO B;  2G3V A;  2VCA A;  2XLD A;  2YEV A;  2XXA B;  2J9W A;  3JRM O;  1VOM A;  4PJM A;  3I4U A;  1Z63 A;  4PAC A;  3IQ5 A;  3LLK A;  2XLH A;  4FX5 A;  1A7E A;  1A41 A;  2KK1 A;  2PX3 A;  3K1I C;  3K7D A;  1EQ1 A;  1OCZ C;  2YLD A;  2EIK C;  1RKE A;  2EPM X;  5IY5 C;  1ZYR F;  3SNH A;  3SZR A;  5L0H A;  5KYN A;  4H4K C;  2DGJ A;  1D1B A;  1HY5 A;  1WTY A;  3HNK A;  4FWV A;  3KPH A;  4LAC B;  4LDQ A;  3ZTM A;  1OR2 A;  3ZVR A;  4BJT A;  4E0I A;  3L1M A;  4E7Z A;  4U5F E;  2P1A A;  3B29 A;  5K0I A;  4CJO A;  3DXJ F;  4ANJ A;  3AG4 C;  3QVY A;  2CCY A;  4YN0 B;  3G4X A;  5D92 A;  2HV6 A;  1NFN A;  2LD6 A;  4KBL A;  3TOL A;  3ZQV A;  3DJN B;  5JUA A;  2P61 A;  4BJ1 A;  4EBJ A;  5COG A;  3LEO A;  3DE8 A;  3EG9 B;  2R02 A;  2OEX A;  3PMR A;  5A6J A;  4NTF A;  4N6C A;  3EZI A;  4YT2 A;  3NRH A;  3JCU Q;  4NQF A;  4DJ9 A;  3NG1 A;  4Q4Z F;  2P7V A;  4GYT A;  1XZQ A;  1L7C A;  3ABM C;  2YKZ A;  2YZS A;  4JW1 A;  4RBN A;  3ZSU A;  4AL0 A;  1E84 A;  2CW0 F;  1GS9 A;  5BQG A;  1K05 A;  1OCR C;  4OIN F;  4C7O A;  4O6M A;  3SEO A;  2BC5 A;  3U8P A;  4DVZ A;  5F5H A;  3C8Z A;  3H2U A;  4ER9 A;  2C03 A;  4H54 A;  5T1D B;  4YT4 A;  3WOD F;  1TFO B;  2A69 F;  3VYW A;  1OR3 A;  2EIJ C;  4MTF A;  5L0J A;  1Q0D A;  1BR2 A;  2J7P A;  4BJ6 C;  1HW1 A;  4E17 A;  3WAQ A;  3SXM A;  4FAP B;  4OIQ F;  1IZM A;  2R7U A;  3U9J A;  1OW7 A;  3PCV A;  4LLE A;  1FMW A;  3EHM A;  3GM1 A;  3EGX A;  1R4T A;  3ABK C;  2XLO A;  3BEH A;  3JYY A;  4JKV A;  2D4U A;  1M2V B;  2R7S A;  3ATP A;  2XLV A;  4YL1 A;  3MYF A;  4AE4 B;  3T9O A;  3CQZ A;  4P6I C;  3SP1 A;  1ZW3 A;  5KYY B;  3C8G A;  4Z9I A;  3U3F A;  2QLA A;  2AVK A;  3ITF A;  4YT8 A;  3TJ5 A;  1NLX A;  1ORY A;  4U5G A;  2A68 F;  2NUT B;  2WZF A;  1NSG B;  3C63 A;  4MTG A;  3VF0 A;  3Q7L A;  4N6H A;  4OIR F;  2KSF A;  5DS5 A;  2PP4 A;  2V3C C;  1ZW2 A;  2Q9A A;  1WOL A;  2IXO A;  4ULV A;  5DS4 A;  4PJJ A;  2YL7 A;  1BZ4 A;  1BDJ B; 
#chains in the Genus database with same CATH homology
 2LIG A;  4Z9H A;  2D4U A;  1LIH A;  2ASR A;  1VLT A;  1VLS A;  3ATP A;  1WAS A;  1WAT A;  4Z9I A;  1JMW A;  4Z9J A;  3T9O A;  4H54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...