3T9OA

Regulatory czb domain of dgcz
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
122
structure length
108
Chain Sequence
TTEIDAILLNLNKAIDAHYQWLVSMFHSVVARDCQFGRWIDHLGPLDNDELPYVRLMDSAHQHMHNCGRELMLAIVENHWQDAHFDAFQEGLLSFTAALTDYKIYLLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diguanylate cyclase DgcZ
publication title Structure and signaling mechanism of a zinc-sensory diguanylate cyclase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 43
structure length 108
sequence length 122
chains with identical sequence B
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2011-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 3t9oA00
2ASRA 3ATPA 4H54A 4Z9HA 1VLSA 1LIHA 4Z9IA 2LIGA 3T9OA 1WASA 2D4UA 4Z9JA 1JMWA 1WATA 1VLTA
chains in the Genus database with same CATH superfamily
5JLIA 4KC9A 3LNMB 1YZAA 5CI8A 1M2VB 2NUPB 2EILC 4P6IC 4JJGA 3LS0A 3UMIA 4A2NB 2XXAA 1UG7A 4EIYA 1O5HA 1SYQA 2Y39A 1HMDA 3GEHA 1Z23A 3AJMA 5E3CA 4QI2A 2DYRC 2VH3A 1VYIA 3KMIA 3U8PA 3B0UX 1CGNA 2D5RB 4E7SA 1A41A 4LERA 3RW0A 4D4XA 2HV7A 3AQCA 2XLHA 1QLEC 4DXWA 1YJGA 3K66A 4I3MA 3AOUA 3NMJA 2XL4A 3MX3A 3UMKA 4BJ5C 3NKDA 3C63A 4NTAA 3FHDA 1Z7Qc 1ZHWA 3IPMO 3WAQA 1MNEA 1A7VA 1ZHXA 3U2LA 2R02A 2CCYA 2IXOA 2NPUA 2I8BA 3V5ZA 1NSGB 4D4NA 1O87A 4OIPF 4Q4ZF 2BC5A 4BPMA 3V7OA 3GANA 3VYWA 4N06A 2VCAA 4CSAA 3R7CA 3BRJA 3C7JA 2Q4FA 3I5PA 5F28E 3QW0A 2FFHA 4P9FA 4BEMJ 4P9TA 3L8IA 2ZXPA 1PD1A 4FWVA 5KYXA 1LKXA 3IQCA 3GEEA 1LS1A 2XXAB 1M57C 2CDQA 3G50A 3HNLA 4LDQA 5AGFA 4E17A 3W2VA 1A0BA 1J8YF 2HFIA 2R05A 3N24A 1MMGA 2RSEB 4JW1A 2R7UA 3EGXB 1IZMA 1RKEA 1C02A 4IWBA 1BDJB 3O10A 3UMHA 5E3AA 1C17M 2R7XA 1K05A 3J06A 5DVWA 5E33A 3CAXA 2P7VA 3MLGA 2L9JA 1E84A 4PJNA 1V4AA 2C04A 2IYLD 4K0DA 3ZQVA 2L6FA 1E83A 3AG3C 1XWJA 1OKKA 2P61A 3S29A 3VAYA 3WHNA 5DS5A 3NYJA 3CZ6A 3F46A 4W8PA 1WOLA 2YLIA 4E0IA 3U9MA 4PFOA 2GWWA 1OQCA 2ASRA 5COMA 2LK4A 4DVZA 1AUEA 1L7CA 3UGPA 2Y3BA 2MHRA 3L1MA 1RCPA 2UUIA 5L0FA 1V54C 1ZW3A 5GPGB 3U8VA 1EA8A 4JCZA 3N0TA 2Q3TA 1F1MA 2NSGA 3K1IC 2EPOA 2L6GA 3LEOA 3HNJA 4H54A 1MMAA 3ZTMA 1D1CA 2OCCC 4YT4A 2Y3HA 4CS9C 1ZHZA 2CNWD 3C8GA 1D0ZA 3HTKC 1GS9A 2PBEA 3ABMC 3PCVA 4GYTA 2W45A 3EGDB 3WG7C 3TJ5A 2EPNA 2AWCA 3K6BA 1T01A 5A69A 3S27A 3NKEA 1LI7A 3EHMA 1Z63A 4ULVA 2MWQA 4AL0A 1YDIA 1MMNA 3EH2A 3LLKA 2KK1A 2OEVA 3BEHA 3ITFA 1JRAA 3O6XA 1YARO 4G78A 4JC7A 3RFYA 3UNGC 4AX2A 1QZXA 1RJ9A 1VOMA 3EFOB 1K40A 4DVYP 3A9CA 4KNWA 5T1DB 4L6RA 2HS5A 5TJ5E 3S9OA 3QW1A 4AL1A 4UDVA 1XZQA 3ASNC 3U9JA 5HSWA 1FMWA 4CS7A 1LVKA 1VTMP 2YLDA 4OIRF 4JTDB 1Q0KA 4EBBA 1UFBA 2XLMA 3U3BA 4H4KC 5D91A 1T9KA 1TKNA 2YHSA 2Q9BA 4XEVA 2I15A 3EQLF 4U9DA 2IBFA 1DOWA 1G8XA 2J46A 2OOCA 1R4TA 3M4BA 4LDRA 4OD5A 2QE9A 1M2VA 2NUPA 3A11A 1KNYA 4I44A 4U5DE 3TJ6A 3AGUA 3FOPA 5L0IA 4C7OB 3DZAA 3O55A 4Q5SF 3DAFA 5L0JA 1H6GA 2RD9A 3VRCA 2A1DD 1YVIA 3F47A 4ZLDA 3GORA 3SXKA 2G3VA 5DQZA 3Q6MA 2Q9CA 2QLAA 3M4CA 4CJOA 1OR2A 2P6VA 2XS1A 4HFFB 3DJUB 4PJLA 4MVSA 1W2WA 2A0BA 2HUJA 1AVOB 4NTFA 4EKWA 4GQHA 4JE9A 4WABA 3SXZA 1L3PA 3RQEA 5KYNA 4YWQA 4YT5A 1TWCA 1YYJA 4DRIB 4JVSA 2PX0A 5AC5A 4LLCA 1KTMA 1ZHYA 4NC3A 4PACA 3T6JA 3GWNA 1G4US 1OCRC 1ZU5A 3GEIA 2B0HA 4X0RA 4M63A 2KYHA 1OR3A 4OINF 1IW7F 2A0UA 4HEAJ 3QTHA 2XLEA 3DJNB 4E0HA 3LESA 5L3VA 5IY5C 3DE9A 4ER9A 4CS8A 3GWLA 4BJ6A 1U89A 5COFA 2QTVA 2E87A 1WN0A 4J7TA 2QY9A 3LS1A 3MBGA 2R7RA 2C03A 2YLGA 1DOVA 3EGXA 1BBHA 1FTSA 2CW0F 3JYYA 3JYHA 4ONSA 4U5HA 5BQGA 2J45A 5HV9A 5L0GA 3CSKA 3S90A 2HSBA 2VCBA 2XLWA 2IOQA 3ABLC 4JZAA 1LE4A 1QVXA 4JTAB 4CDVA 4EBJA 2R7TA 3NRHA 3POVA 1LM3B 1TWGA 2IXPA 3ECSA 1TFOB 3OEOA 3UGOA 2R9RB 256BA 4J7YA 1N1CA 3SXYA 5BQIA 1EI7A 2JD3A 2AWYA 1GQAA 4LLEA 4MNDA 2XLOA 1FAPB 3RQGA 3RQFA 3M15A 2V26A 4MTFA 2PNOA 3US6A 3QZCA 1T6UA 3C62A 4WJ0A 3B0VC 4I1MA 3B9QA 3DKAA 4G7ZF 1VK5A 2FAPB 3LAYA 1KU2A 1PV3A 4C3BA 4OIOF 2H8AA 5F5HA 3K1IA 2VCCA 3SNHA 3IHUA 3VM6A 4JEBA 5F5FA 5T3WA 1Z6AA 2WVNA 2YRFA 3EGDA 4ZLCA 5KYYA 2VASA 2DYSC 1Y6DA 3GM2A 1U6HA 3HLZA 3O39A 4G0HA 1YA7O 5B3IA 3NG1A 4MVQA 1GM5A 2H7OA 2CNWA 3S0XA 2FGYA 1GGQA 1QSPA 2DB4A 1MMDA 5EGYA 4JEAA 1Q0GA 4MTOA 2KC3A 2ICWG 3EFOA 2X51A 3JZ0A 1APCA 1NU9C 1ORSC 2H7VC 4PR9A 3ZC4A 4XEKA 4LACB 2LCHA 1YAUO 2R03A 3NYMA 2HMQA 3KPHA 3OWTA 1OW7A 1YLMA 3M1CB 4DBRA 5JUAA 3LUTB 1H9TA 4YK5A 2Q00A 1SR2A 3L8JA 3ZG1A 3EJNA 5JSLA 2OQMA 2XLVA 2EPKX 5EK0A 3MFNA 4YL3A 5BUOA 4C7OA 1Q0FA 4MQ9F 4JKVA 1FR0A 4YJWA 2XM4A 2WL8A 4IARA 4U9EA 1H9GA 3GM3A 2LP4A 3SP1A 3B0PA 5DQTA 2CGEA 2A68F 3X2QC 1MNDA 2QNLA 3TOMA 1VB5A 2V3CC 1T6IA 5L3QA 3S84A 4CSAC 3L34A 2PFDA 3JSZA 3L0IA 2B0JA 3PDMP 2J7PD 2LFDA 1ST6A 3KH2A 2ETSA 2PP4A 3IQ5A 3CQZA 3T4RA 2R7VA 2WB7A 1CPRA 1FNTc 2OG2A 3FMSA 1Y4CA 4Q7CA 3LEVA 4O7GA 1FMVA 2R7QA 1LPEA 3W8IA 4BJ1A 2A6HF 3KL4A 1H7IA 2ZXWC 3K33A 1D1AA 2HMZA 2XLDA 3W8HA 1I4YA 2P1AA 4Z9JA 1O3UA 1NFNA 2G3KA 2P0NA 2EIJC 2KSFA 4K1OA 4U5EE 4CBEA 2BE5F 4IGGA 4U5GA 3DM5A 2WZLA 5T3TA 3U3FA 1QQ3A 3TULA 5A6BA 1D1BA 1SF8A 4IAQA 3TD7A 1OXBA 2DGJA 3EPVA 3M79A 4DRJB 2HJ3A 3G4ZA 2O9XA 4NQFA 2UUHA 4B6IA 5JS5A 3HJCA 2Z15A 3JTLO 1G5ZA 3H65A 1TR2A 4OD4A 1OCOC 1RKCA 1RXQA 4JIOA 4DRHB 3WODF 2OJQA 5COGA 4XPYA 3K7DA 3EZIA 4IRUA 1TFKB 2KNHA 3MYIA 5B1BC 1OXKA 2VB6A 1SMYF 1K04A 3CEXA 5CI9A 1ZHTA 1G4WR 4JRZA 4RDAA 2LD6A 3KYIA 5JT4A 1TWHA 5KYWB 4BJ5A 1TQGA 1BZ4A 3H2UA 1OCZC 1M6TA 2AU5A 4O6MA 2WZGA 3LNRA 4QDLA 4XEFA 5B1AC 4AE4A 1EKYA 2J9WA 5A6BD 4MW8A 3ZWIA 1E85A 2XM0A 2Y3DA 2AVKA 2GDCA 3HNIA 3EHNA 3NYLA 2J9UA 2ZD9A 2WVQA 4YT8A 2KQ9A 5A6JA 4LDKA 1ORYA 1I5NA 3AG2C 3RYLA 4DOZA 1ZU4A 4FAPB 4N6HA 3FDQA 3FAPB 4XWJA 2M4EA 1FFTC 3JRMO 3TQOA 1ZW2A 3SZRA 3W4YA 3U2MA 3QMKA 4ULWA 2YEVA 3RIPA 3IEEA 2CYDA 4G7HF 1J8MF 2HV6A 3T6BA 5KYUB 5A6KA 1R5ID 2XL8A 2GFHA 2YL0A 4Z9HA 4XLNF 2QUPA 1Z5ZA 2IM8A 3OA1A 3SEOA 3ZVRA 4CIPA 4F4BA 3NDBB 3LJBA 1QPUA 4RD9A 3FAJA 2NUTB 4IJJA 5JVEA 1HE1A 3W2WA 1BR1A 3ZDLA 1V74B 4MVRA 1VLSA 4XPXA 1HW1A 1JPJA 2J0XA 3R2PA 4W8KA 4YN0B 4A4AA 4CJGA 3PHF2 3B71A 4YT2A 3IQ6A 5A6AA 1ZZPA 1Q0MA 4R32A 4DBQA 2MYSA 1HE9A 1EQ1A 4U5CE 3QVZA 4EWCA 2YL3A 3RVZA 4EUKB 3AG4C 2W9YA 4U5BE 4XPWA 3KKBA 2A69F 4K7BA 2IXMA 4MVMA 3C18A 4U5FE 3K1HA 2OEXA 5L0DA 5B3SC 1YA9A 2Y69C 5K0IA 3S28A 2LSEA 1WWPA 4YL1A 4BG0A 1S05A 4E7ZA 2OKUA 2OJED 4JTCB 1NG1A 4CS9A 4CIHA 2J9VA 3ZQYA 1Z3IX 2A6EF 1NU7D 2DI3A 3EG9B 3Q7GA 2F22A 4HFKB 5D92A 4PFPA 3RVYA 3DE8A 4N4WA 1NBBA 1ORJA 2GAQA 4C3EA 4KBLA 3RF3A 1LE2A 1Q0DA 2JPUA 3PMRA 2L81A 2ZXRA 3GM1A 1I4ZA 2VC9A 3B29A 5FZTA 1VYKA 1OW8A 2AP3A 2LQGA 5CIVA 3EZHA 4CS8C 1TWAA 2W4MA 1D0YA 4NY3A 4BJ6C 3LLIA 3DXJF 3DWWA 1OCCC 2R25A 2PF4E 2EPMX 4EHPA 4MS2A 2R7WA 2R7SA 2J7PA 3AGTA 3V5XA 3ASOC 2L6HA 3HKKA 4CX9A 1FFHA 5E2QA 1WTYA 3V5YA 1JPNA 2L7AA 4Z9IA 3T9OA 3AG1C 2J9BA 1LI5A 4J32B 4OIQF 1LS4A 3VF0A 1E86A 4KI2A 4G7OF 4PJMA 1ZYRF 2PX3A 1XZPA 3EH1A 2GA0A 3DAGA 1V55C 4HE8D 4CDAA 1ZVZA 1PCXA 1WATA 2IXNA 2XS8A 2X0CA 4BEJA 4WGYA 3DD7A 3JRTA 3U0CA 4N6CA 1E2XA 1SZIA 2H7BA 2YVKA 3H2VA 3IQTA 2EIMC 5JP7A 3T6GB 4MVZA 1T5OA 1VMAA 5KYWA 1NFOA 2G62A 1JMWA 3Q7LA 2Q9AA 3G4XA 3RH3A 5KYXB 3AQBA 3TK0A 5BQHA 2HKVA 3DM9B 3ABKC 1C03A 2YL1A 3ZSUA 4XLPF 2Y3GA 4FX5A 2YKZA 4CDYA 1A7DA 2ZPAA 1RKEB 5DS6A 2OU6A 2J8WA 2TMVP 1QKRA 3E70C 2NG1A 1U0BB 4QI0A 2EIKC 1B68A 1D0XA 1OKKD 4MVOA 5JRAA 4MW3A 4MTGA 3DI5A 1A7EA 4AK9A 1BR2A 4ANJA 2Q7RA 1HY5A 1NLXA 4NTBA 4O6NA 1RMVA 2HZ8A 1M2OA 3JT1A 1T6QA 2WZFA 2BL2A 5KYUA 2J0WA 3I5QA 1CPQA 4FESA 3Q6NA 3SXMA 3ZIBA 3N2ZB 2XRHA 1YZCA 4YL0A 3ZTZA 2NUTA 3C8GD 3MYFA 2EINC 2HSQA 2LIGA 3QVYA 1JOGA 1WASA 2YWAA 4O79A 2LFFA 4PK4A 2W4BA 3NMKA 3DMDA 2NSFA 4I1OB 3FXHA 3ATPA 4JJFA 4AE4B 1CGOA 3TOLA 5EHHA 4GEHA 1S7ZA 4NCQA 2JX0A 3HNKA 2R7OA 3E9VA 1CGME 3I4UA 3C8GB 4PJJA 5L0HA 4IAOA 5AC4A 1BR4A 2YL7A 1HMOA 1WGWA 2EPLX 4JURI 1JAFA 4WGZA 3JCUQ 3KYJA 5L0CA 3FOOA 2KJGA 1M56C 1MQVA 2D4UA 2ZXOA 4RBNA 4XQ1A 3NMIA 4XTKA 4EBKA 4KNVA 3U5SA 2KW3C 1HW2A 3GODA 4MVUA 1RJ9B 1OW6A 3EG9A 4DJ9A 2YZSA 5FCLA 2KGOA 5DLJA 4BJTA 1YYXA 2XL6A 2XSEA 4IB4A 4O6YA 4C3DA 3UR3C 4E18A 3SYNA 3RKOF 1PD0A 2YQYA 1VLTA 1NZEA 3C8ZA 2WVOA 3FVYA 4J30B 1JR8A 3X1OA 1LIHA 1AEPA 4JCHA 2M64A 3JSEO 5DS4A 2HJMA 5KYYB
chains in the Genus database with same CATH topology
2ASRA 3ATPA 4H54A 4Z9HA 1VLSA 1LIHA 4Z9IA 2LIGA 3T9OA 1WASA 2D4UA 4Z9JA 1JMWA 1WATA 1VLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ASR A;  3ATP A;  4H54 A;  4Z9H A;  1VLS A;  1LIH A;  4Z9I A;  2LIG A;  3T9O A;  1WAS A;  2D4U A;  4Z9J A;  1JMW A;  1WAT A;  1VLT A; 
#chains in the Genus database with same CATH topology
 5JLI A;  4KC9 A;  3LNM B;  1YZA A;  5CI8 A;  1M2V B;  2NUP B;  2EIL C;  4P6I C;  4JJG A;  3LS0 A;  3UMI A;  4A2N B;  2XXA A;  1UG7 A;  4EIY A;  1O5H A;  1SYQ A;  2Y39 A;  1HMD A;  3GEH A;  1Z23 A;  3AJM A;  5E3C A;  4QI2 A;  2DYR C;  2VH3 A;  1VYI A;  3KMI A;  3U8P A;  3B0U X;  1CGN A;  2D5R B;  4E7S A;  1A41 A;  4LER A;  3RW0 A;  4D4X A;  2HV7 A;  3AQC A;  2XLH A;  1QLE C;  4DXW A;  1YJG A;  3K66 A;  4I3M A;  3AOU A;  3NMJ A;  2XL4 A;  3MX3 A;  3UMK A;  4BJ5 C;  3NKD A;  3C63 A;  4NTA A;  3FHD A;  1Z7Q c;  1ZHW A;  3IPM O;  3WAQ A;  1MNE A;  1A7V A;  1ZHX A;  3U2L A;  2R02 A;  2CCY A;  2IXO A;  2NPU A;  2I8B A;  3V5Z A;  1NSG B;  4D4N A;  1O87 A;  4OIP F;  4Q4Z F;  2BC5 A;  4BPM A;  3V7O A;  3GAN A;  3VYW A;  4N06 A;  2VCA A;  4CSA A;  3R7C A;  3BRJ A;  3C7J A;  2Q4F A;  3I5P A;  5F28 E;  3QW0 A;  2FFH A;  4P9F A;  4BEM J;  4P9T A;  3L8I A;  2ZXP A;  1PD1 A;  4FWV A;  5KYX A;  1LKX A;  3IQC A;  3GEE A;  1LS1 A;  2XXA B;  1M57 C;  2CDQ A;  3G50 A;  3HNL A;  4LDQ A;  5AGF A;  4E17 A;  3W2V A;  1A0B A;  1J8Y F;  2HFI A;  2R05 A;  3N24 A;  1MMG A;  2RSE B;  4JW1 A;  2R7U A;  3EGX B;  1IZM A;  1RKE A;  1C02 A;  4IWB A;  1BDJ B;  3O10 A;  3UMH A;  5E3A A;  1C17 M;  2R7X A;  1K05 A;  3J06 A;  5DVW A;  5E33 A;  3CAX A;  2P7V A;  3MLG A;  2L9J A;  1E84 A;  4PJN A;  1V4A A;  2C04 A;  2IYL D;  4K0D A;  3ZQV A;  2L6F A;  1E83 A;  3AG3 C;  1XWJ A;  1OKK A;  2P61 A;  3S29 A;  3VAY A;  3WHN A;  5DS5 A;  3NYJ A;  3CZ6 A;  3F46 A;  4W8P A;  1WOL A;  2YLI A;  4E0I A;  3U9M A;  4PFO A;  2GWW A;  1OQC A;  2ASR A;  5COM A;  2LK4 A;  4DVZ A;  1AUE A;  1L7C A;  3UGP A;  2Y3B A;  2MHR A;  3L1M A;  1RCP A;  2UUI A;  5L0F A;  1V54 C;  1ZW3 A;  5GPG B;  3U8V A;  1EA8 A;  4JCZ A;  3N0T A;  2Q3T A;  1F1M A;  2NSG A;  3K1I C;  2EPO A;  2L6G A;  3LEO A;  3HNJ A;  4H54 A;  1MMA A;  3ZTM A;  1D1C A;  2OCC C;  4YT4 A;  2Y3H A;  4CS9 C;  1ZHZ A;  2CNW D;  3C8G A;  1D0Z A;  3HTK C;  1GS9 A;  2PBE A;  3ABM C;  3PCV A;  4GYT A;  2W45 A;  3EGD B;  3WG7 C;  3TJ5 A;  2EPN A;  2AWC A;  3K6B A;  1T01 A;  5A69 A;  3S27 A;  3NKE A;  1LI7 A;  3EHM A;  1Z63 A;  4ULV A;  2MWQ A;  4AL0 A;  1YDI A;  1MMN A;  3EH2 A;  3LLK A;  2KK1 A;  2OEV A;  3BEH A;  3ITF A;  1JRA A;  3O6X A;  1YAR O;  4G78 A;  4JC7 A;  3RFY A;  3UNG C;  4AX2 A;  1QZX A;  1RJ9 A;  1VOM A;  3EFO B;  1K40 A;  4DVY P;  3A9C A;  4KNW A;  5T1D B;  4L6R A;  2HS5 A;  5TJ5 E;  3S9O A;  3QW1 A;  4AL1 A;  4UDV A;  1XZQ A;  3ASN C;  3U9J A;  5HSW A;  1FMW A;  4CS7 A;  1LVK A;  1VTM P;  2YLD A;  4OIR F;  4JTD B;  1Q0K A;  4EBB A;  1UFB A;  2XLM A;  3U3B A;  4H4K C;  5D91 A;  1T9K A;  1TKN A;  2YHS A;  2Q9B A;  4XEV A;  2I15 A;  3EQL F;  4U9D A;  2IBF A;  1DOW A;  1G8X A;  2J46 A;  2OOC A;  1R4T A;  3M4B A;  4LDR A;  4OD5 A;  2QE9 A;  1M2V A;  2NUP A;  3A11 A;  1KNY A;  4I44 A;  4U5D E;  3TJ6 A;  3AGU A;  3FOP A;  5L0I A;  4C7O B;  3DZA A;  3O55 A;  4Q5S F;  3DAF A;  5L0J A;  1H6G A;  2RD9 A;  3VRC A;  2A1D D;  1YVI A;  3F47 A;  4ZLD A;  3GOR A;  3SXK A;  2G3V A;  5DQZ A;  3Q6M A;  2Q9C A;  2QLA A;  3M4C A;  4CJO A;  1OR2 A;  2P6V A;  2XS1 A;  4HFF B;  3DJU B;  4PJL A;  4MVS A;  1W2W A;  2A0B A;  2HUJ A;  1AVO B;  4NTF A;  4EKW A;  4GQH A;  4JE9 A;  4WAB A;  3SXZ A;  1L3P A;  3RQE A;  5KYN A;  4YWQ A;  4YT5 A;  1TWC A;  1YYJ A;  4DRI B;  4JVS A;  2PX0 A;  5AC5 A;  4LLC A;  1KTM A;  1ZHY A;  4NC3 A;  4PAC A;  3T6J A;  3GWN A;  1G4U S;  1OCR C;  1ZU5 A;  3GEI A;  2B0H A;  4X0R A;  4M63 A;  2KYH A;  1OR3 A;  4OIN F;  1IW7 F;  2A0U A;  4HEA J;  3QTH A;  2XLE A;  3DJN B;  4E0H A;  3LES A;  5L3V A;  5IY5 C;  3DE9 A;  4ER9 A;  4CS8 A;  3GWL A;  4BJ6 A;  1U89 A;  5COF A;  2QTV A;  2E87 A;  1WN0 A;  4J7T A;  2QY9 A;  3LS1 A;  3MBG A;  2R7R A;  2C03 A;  2YLG A;  1DOV A;  3EGX A;  1BBH A;  1FTS A;  2CW0 F;  3JYY A;  3JYH A;  4ONS A;  4U5H A;  5BQG A;  2J45 A;  5HV9 A;  5L0G A;  3CSK A;  3S90 A;  2HSB A;  2VCB A;  2XLW A;  2IOQ A;  3ABL C;  4JZA A;  1LE4 A;  1QVX A;  4JTA B;  4CDV A;  4EBJ A;  2R7T A;  3NRH A;  3POV A;  1LM3 B;  1TWG A;  2IXP A;  3ECS A;  1TFO B;  3OEO A;  3UGO A;  2R9R B;  256B A;  4J7Y A;  1N1C A;  3SXY A;  5BQI A;  1EI7 A;  2JD3 A;  2AWY A;  1GQA A;  4LLE A;  4MND A;  2XLO A;  1FAP B;  3RQG A;  3RQF A;  3M15 A;  2V26 A;  4MTF A;  2PNO A;  3US6 A;  3QZC A;  1T6U A;  3C62 A;  4WJ0 A;  3B0V C;  4I1M A;  3B9Q A;  3DKA A;  4G7Z F;  1VK5 A;  2FAP B;  3LAY A;  1KU2 A;  1PV3 A;  4C3B A;  4OIO F;  2H8A A;  5F5H A;  3K1I A;  2VCC A;  3SNH A;  3IHU A;  3VM6 A;  4JEB A;  5F5F A;  5T3W A;  1Z6A A;  2WVN A;  2YRF A;  3EGD A;  4ZLC A;  5KYY A;  2VAS A;  2DYS C;  1Y6D A;  3GM2 A;  1U6H A;  3HLZ A;  3O39 A;  4G0H A;  1YA7 O;  5B3I A;  3NG1 A;  4MVQ A;  1GM5 A;  2H7O A;  2CNW A;  3S0X A;  2FGY A;  1GGQ A;  1QSP A;  2DB4 A;  1MMD A;  5EGY A;  4JEA A;  1Q0G A;  4MTO A;  2KC3 A;  2ICW G;  3EFO A;  2X51 A;  3JZ0 A;  1APC A;  1NU9 C;  1ORS C;  2H7V C;  4PR9 A;  3ZC4 A;  4XEK A;  4LAC B;  2LCH A;  1YAU O;  2R03 A;  3NYM A;  2HMQ A;  3KPH A;  3OWT A;  1OW7 A;  1YLM A;  3M1C B;  4DBR A;  5JUA A;  3LUT B;  1H9T A;  4YK5 A;  2Q00 A;  1SR2 A;  3L8J A;  3ZG1 A;  3EJN A;  5JSL A;  2OQM A;  2XLV A;  2EPK X;  5EK0 A;  3MFN A;  4YL3 A;  5BUO A;  4C7O A;  1Q0F A;  4MQ9 F;  4JKV A;  1FR0 A;  4YJW A;  2XM4 A;  2WL8 A;  4IAR A;  4U9E A;  1H9G A;  3GM3 A;  2LP4 A;  3SP1 A;  3B0P A;  5DQT A;  2CGE A;  2A68 F;  3X2Q C;  1MND A;  2QNL A;  3TOM A;  1VB5 A;  2V3C C;  1T6I A;  5L3Q A;  3S84 A;  4CSA C;  3L34 A;  2PFD A;  3JSZ A;  3L0I A;  2B0J A;  3PDM P;  2J7P D;  2LFD A;  1ST6 A;  3KH2 A;  2ETS A;  2PP4 A;  3IQ5 A;  3CQZ A;  3T4R A;  2R7V A;  2WB7 A;  1CPR A;  1FNT c;  2OG2 A;  3FMS A;  1Y4C A;  4Q7C A;  3LEV A;  4O7G A;  1FMV A;  2R7Q A;  1LPE A;  3W8I A;  4BJ1 A;  2A6H F;  3KL4 A;  1H7I A;  2ZXW C;  3K33 A;  1D1A A;  2HMZ A;  2XLD A;  3W8H A;  1I4Y A;  2P1A A;  4Z9J A;  1O3U A;  1NFN A;  2G3K A;  2P0N A;  2EIJ C;  2KSF A;  4K1O A;  4U5E E;  4CBE A;  2BE5 F;  4IGG A;  4U5G A;  3DM5 A;  2WZL A;  5T3T A;  3U3F A;  1QQ3 A;  3TUL A;  5A6B A;  1D1B A;  1SF8 A;  4IAQ A;  3TD7 A;  1OXB A;  2DGJ A;  3EPV A;  3M79 A;  4DRJ B;  2HJ3 A;  3G4Z A;  2O9X A;  4NQF A;  2UUH A;  4B6I A;  5JS5 A;  3HJC A;  2Z15 A;  3JTL O;  1G5Z A;  3H65 A;  1TR2 A;  4OD4 A;  1OCO C;  1RKC A;  1RXQ A;  4JIO A;  4DRH B;  3WOD F;  2OJQ A;  5COG A;  4XPY A;  3K7D A;  3EZI A;  4IRU A;  1TFK B;  2KNH A;  3MYI A;  5B1B C;  1OXK A;  2VB6 A;  1SMY F;  1K04 A;  3CEX A;  5CI9 A;  1ZHT A;  1G4W R;  4JRZ A;  4RDA A;  2LD6 A;  3KYI A;  5JT4 A;  1TWH A;  5KYW B;  4BJ5 A;  1TQG A;  1BZ4 A;  3H2U A;  1OCZ C;  1M6T A;  2AU5 A;  4O6M A;  2WZG A;  3LNR A;  4QDL A;  4XEF A;  5B1A C;  4AE4 A;  1EKY A;  2J9W A;  5A6B D;  4MW8 A;  3ZWI A;  1E85 A;  2XM0 A;  2Y3D A;  2AVK A;  2GDC A;  3HNI A;  3EHN A;  3NYL A;  2J9U A;  2ZD9 A;  2WVQ A;  4YT8 A;  2KQ9 A;  5A6J A;  4LDK A;  1ORY A;  1I5N A;  3AG2 C;  3RYL A;  4DOZ A;  1ZU4 A;  4FAP B;  4N6H A;  3FDQ A;  3FAP B;  4XWJ A;  2M4E A;  1FFT C;  3JRM O;  3TQO A;  1ZW2 A;  3SZR A;  3W4Y A;  3U2M A;  3QMK A;  4ULW A;  2YEV A;  3RIP A;  3IEE A;  2CYD A;  4G7H F;  1J8M F;  2HV6 A;  3T6B A;  5KYU B;  5A6K A;  1R5I D;  2XL8 A;  2GFH A;  2YL0 A;  4Z9H A;  4XLN F;  2QUP A;  1Z5Z A;  2IM8 A;  3OA1 A;  3SEO A;  3ZVR A;  4CIP A;  4F4B A;  3NDB B;  3LJB A;  1QPU A;  4RD9 A;  3FAJ A;  2NUT B;  4IJJ A;  5JVE A;  1HE1 A;  3W2W A;  1BR1 A;  3ZDL A;  1V74 B;  4MVR A;  1VLS A;  4XPX A;  1HW1 A;  1JPJ A;  2J0X A;  3R2P A;  4W8K A;  4YN0 B;  4A4A A;  4CJG A;  3PHF 2;  3B71 A;  4YT2 A;  3IQ6 A;  5A6A A;  1ZZP A;  1Q0M A;  4R32 A;  4DBQ A;  2MYS A;  1HE9 A;  1EQ1 A;  4U5C E;  3QVZ A;  4EWC A;  2YL3 A;  3RVZ A;  4EUK B;  3AG4 C;  2W9Y A;  4U5B E;  4XPW A;  3KKB A;  2A69 F;  4K7B A;  2IXM A;  4MVM A;  3C18 A;  4U5F E;  3K1H A;  2OEX A;  5L0D A;  5B3S C;  1YA9 A;  2Y69 C;  5K0I A;  3S28 A;  2LSE A;  1WWP A;  4YL1 A;  4BG0 A;  1S05 A;  4E7Z A;  2OKU A;  2OJE D;  4JTC B;  1NG1 A;  4CS9 A;  4CIH A;  2J9V A;  3ZQY A;  1Z3I X;  2A6E F;  1NU7 D;  2DI3 A;  3EG9 B;  3Q7G A;  2F22 A;  4HFK B;  5D92 A;  4PFP A;  3RVY A;  3DE8 A;  4N4W A;  1NBB A;  1ORJ A;  2GAQ A;  4C3E A;  4KBL A;  3RF3 A;  1LE2 A;  1Q0D A;  2JPU A;  3PMR A;  2L81 A;  2ZXR A;  3GM1 A;  1I4Z A;  2VC9 A;  3B29 A;  5FZT A;  1VYK A;  1OW8 A;  2AP3 A;  2LQG A;  5CIV A;  3EZH A;  4CS8 C;  1TWA A;  2W4M A;  1D0Y A;  4NY3 A;  4BJ6 C;  3LLI A;  3DXJ F;  3DWW A;  1OCC C;  2R25 A;  2PF4 E;  2EPM X;  4EHP A;  4MS2 A;  2R7W A;  2R7S A;  2J7P A;  3AGT A;  3V5X A;  3ASO C;  2L6H A;  3HKK A;  4CX9 A;  1FFH A;  5E2Q A;  1WTY A;  3V5Y A;  1JPN A;  2L7A A;  4Z9I A;  3T9O A;  3AG1 C;  2J9B A;  1LI5 A;  4J32 B;  4OIQ F;  1LS4 A;  3VF0 A;  1E86 A;  4KI2 A;  4G7O F;  4PJM A;  1ZYR F;  2PX3 A;  1XZP A;  3EH1 A;  2GA0 A;  3DAG A;  1V55 C;  4HE8 D;  4CDA A;  1ZVZ A;  1PCX A;  1WAT A;  2IXN A;  2XS8 A;  2X0C A;  4BEJ A;  4WGY A;  3DD7 A;  3JRT A;  3U0C A;  4N6C A;  1E2X A;  1SZI A;  2H7B A;  2YVK A;  3H2V A;  3IQT A;  2EIM C;  5JP7 A;  3T6G B;  4MVZ A;  1T5O A;  1VMA A;  5KYW A;  1NFO A;  2G62 A;  1JMW A;  3Q7L A;  2Q9A A;  3G4X A;  3RH3 A;  5KYX B;  3AQB A;  3TK0 A;  5BQH A;  2HKV A;  3DM9 B;  3ABK C;  1C03 A;  2YL1 A;  3ZSU A;  4XLP F;  2Y3G A;  4FX5 A;  2YKZ A;  4CDY A;  1A7D A;  2ZPA A;  1RKE B;  5DS6 A;  2OU6 A;  2J8W A;  2TMV P;  1QKR A;  3E70 C;  2NG1 A;  1U0B B;  4QI0 A;  2EIK C;  1B68 A;  1D0X A;  1OKK D;  4MVO A;  5JRA A;  4MW3 A;  4MTG A;  3DI5 A;  1A7E A;  4AK9 A;  1BR2 A;  4ANJ A;  2Q7R A;  1HY5 A;  1NLX A;  4NTB A;  4O6N A;  1RMV A;  2HZ8 A;  1M2O A;  3JT1 A;  1T6Q A;  2WZF A;  2BL2 A;  5KYU A;  2J0W A;  3I5Q A;  1CPQ A;  4FES A;  3Q6N A;  3SXM A;  3ZIB A;  3N2Z B;  2XRH A;  1YZC A;  4YL0 A;  3ZTZ A;  2NUT A;  3C8G D;  3MYF A;  2EIN C;  2HSQ A;  2LIG A;  3QVY A;  1JOG A;  1WAS A;  2YWA A;  4O79 A;  2LFF A;  4PK4 A;  2W4B A;  3NMK A;  3DMD A;  2NSF A;  4I1O B;  3FXH A;  3ATP A;  4JJF A;  4AE4 B;  1CGO A;  3TOL A;  5EHH A;  4GEH A;  1S7Z A;  4NCQ A;  2JX0 A;  3HNK A;  2R7O A;  3E9V A;  1CGM E;  3I4U A;  3C8G B;  4PJJ A;  5L0H A;  4IAO A;  5AC4 A;  1BR4 A;  2YL7 A;  1HMO A;  1WGW A;  2EPL X;  4JUR I;  1JAF A;  4WGZ A;  3JCU Q;  3KYJ A;  5L0C A;  3FOO A;  2KJG A;  1M56 C;  1MQV A;  2D4U A;  2ZXO A;  4RBN A;  4XQ1 A;  3NMI A;  4XTK A;  4EBK A;  4KNV A;  3U5S A;  2KW3 C;  1HW2 A;  3GOD A;  4MVU A;  1RJ9 B;  1OW6 A;  3EG9 A;  4DJ9 A;  2YZS A;  5FCL A;  2KGO A;  5DLJ A;  4BJT A;  1YYX A;  2XL6 A;  2XSE A;  4IB4 A;  4O6Y A;  4C3D A;  3UR3 C;  4E18 A;  3SYN A;  3RKO F;  1PD0 A;  2YQY A;  1VLT A;  1NZE A;  3C8Z A;  2WVO A;  3FVY A;  4J30 B;  1JR8 A;  3X1O A;  1LIH A;  1AEP A;  4JCH A;  2M64 A;  3JSE O;  5DS4 A;  2HJM A;  5KYY B; 
#chains in the Genus database with same CATH homology
 2ASR A;  3ATP A;  4H54 A;  4Z9H A;  1VLS A;  1LIH A;  4Z9I A;  2LIG A;  3T9O A;  1WAS A;  2D4U A;  4Z9J A;  1JMW A;  1WAT A;  1VLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...