3T9OA

Regulatory czb domain of dgcz
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
122
structure length
108
Chain Sequence
TTEIDAILLNLNKAIDAHYQWLVSMFHSVVARDCQFGRWIDHLGPLDNDELPYVRLMDSAHQHMHNCGRELMLAIVENHWQDAHFDAFQEGLLSFTAALTDYKIYLLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and signaling mechanism of a zinc-sensory diguanylate cyclase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords Diguanylate cyclase DgcZ
total genus 43
structure length 108
sequence length 122
chains with identical sequence B
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2011-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 3t9oA00
1WATA 3ATPA 4Z9HA 3T9OA 2D4UA 1VLTA 1WASA 2LIGA 4H54A 2ASRA 1JMWA 4Z9JA 1VLSA 4Z9IA 1LIHA
chains in the Genus database with same CATH superfamily
3VF0A 1RKEA 2IXMA 3G4XA 3GM2A 3UGOA 4MW3A 4MW8A 1YYXA 2HJ3A 1G4US 3EGDA 4MTGA 4ULVA 4NC3A 1E2XA 3Q7GA 4IB4A 4P6IC 3TQOA 3JSZA 3FXHA 4O6MA 2J0WA 4CSAA 4JVSA 4O6YA 2FGYA 1GS9A 3EFOA 5T1DB 2YZSA 3CQZA 2HSQA 2KK1A 3US6A 3JCUQ 2GFHA 4BJ5C 5TJ5E 1JPJA 3AGUA 1JPNA 1SF8A 2J9VA 3L0IA 4MVOA 1WOLA 1LIHA 2RSEB 3GEIA 4PJNA 1OCOC 1JRAA 3EGXA 4U9DA 3RVYA 4MQ9F 3NMJA 5A6KA 3RIPA 4G7HF 2WVOA 4JCHA 4JJFA 3DI5A 2R7VA 1SMYF 3AQCA 4QDLA 3ZQYA 2KQ9A 5L0JA 3B9QA 1MMDA 3UR3C 3DAFA 2J9BA 3Q7LA 4RD9A 5B3IA 2XLWA 1B68A 3QW0A 2HMQA 2XS8A 1RJ9B 3HNIA 2G62A 3JRTA 4JEAA 4C3BA 3WHNA 3ABMC 4JKVA 2GDCA 3LLIA 1W2WA 2R03A 2OG2A 2ZD9A 3EH2A 5DVWA 5GPGB 2IXNA 2HV6A 3ZIBA 2PX0A 3M4BA 5KYWB 4LLCA 4H54A 4W8PA 4E18A 1HW1A 1M2OA 1V55C 1T9KA 2P7VA 2R7QA 4XLNF 4E7ZA 2LQGA 5BQHA 1Q0DA 2XLEA 3I5PA 3SP1A 3B0VC 2HKVA 3EHNA 1Y6DA 3T6JA 2XL4A 3LJBA 3L8JA 2ASRA 2HV7A 1HMDA 3JSEO 4YT4A 1R5ID 1NLXA 3AG2C 4YT2A 1TWGA 3N0TA 2XS1A 1U6HA 2A1DD 2D4UA 3M1CB 4E0IA 4C7OB 1M2VB 4YL1A 3K1IA 5AC4A 1OCRC 1S05A 1OXBA 1TWHA 2L6HA 1WTYA 2XM4A 3DE9A 5D92A 5JP7A 5L0GA 4DVZA 3L1MA 4KBLA 3J06A 4O7GA 3SXKA 3B29A 3GODA 3SYNA 1Z5ZA 1R4TA 2A68F 3FDQA 2PF4E 2VH3A 3LESA 2DYRC 2LD6A 4EIYA 3U8VA 2UUIA 3QW1A 2BC5A 2W4MA 5A69A 2QLAA 3C62A 4E7SA 1QPUA 5L0HA 1ZHYA 1EKYA 3SXZA 1G8XA 3C8GB 1YJGA 2VASA 3ITFA 1QLEC 1KNYA 4PJLA 2CNWD 5CI8A 3ZTZA 1Q0KA 2QUPA 2LCHA 3IQTA 3LUTB 2P6VA 2QTVA 3QZCA 5CIVA 3LLKA 3VRCA 4JTCB 5COFA 1YYJA 3IQCA 1VYKA 4D4NA 3R7CA 1VMAA 4B6IA 3UMKA 3K1IC 1DOVA 2EPMX 2PNOA 4FESA 4R32A 4EBBA 1PCXA 1D1BA 1HW2A 4ZLCA 2YWAA 5L0IA 1SR2A 2Q9CA 1J8MF 5F5HA 1E85A 3C8GD 3H2UA 4CS9C 4E17A 2OU6A 3S90A 2R7WA 3TULA 2L6FA 2CGEA 2YEVA 2ZXOA 4BJTA 4J7YA 256BA 4E0HA 4IARA 4CS7A 5A6JA 4DVYP 4MVUA 4MVZA 2LSEA 3GWLA 4U5CE 1D0XA 1O87A 2HMZA 3DKAA 3B0UX 2EPNA 2ETSA 4JTDB 5DLJA 1TFOB 2A0UA 3ABLC 1RMVA 3TD7A 2X51A 5B1BC 3HTKC 1HMOA 1V74B 3FAJA 4AX2A 4JE9A 4JJGA 4CBEA 2XM0A 3MFNA 2AWYA 4MVSA 2GA0A 1EQ1A 1Y4CA 3PCVA 4K0DA 4JZAA 4EBKA 3HNKA 4BEMJ 1TWCA 4ZLDA 1OW6A 2PFDA 3KYIA 1OXKA 1EA8A 2DGJA 3PMRA 3PHF2 2KW3C 3NMKA 2AU5A 4CDAA 4F4BA 2PBEA 3ZC4A 1A41A 1YZAA 2XLVA 1U0BB 2A6EF 4CJGA 4CS9A 1E86A 4KC9A 1UFBA 4BEJA 4EWCA 5CI9A 1BZ4A 1BBHA 3K33A 2NPUA 1FFHA 3EH1A 3HKKA 1MMGA 2Z15A 2L81A 1OCZC 1VK5A 2TMVP 1YLMA 4ANJA 5IY5C 1ORSC 2PP4A 2AWCA 2J46A 2Y3BA 3SNHA 4N6HA 2BL2A 3EFOB 3C18A 2F22A 3IQ5A 3KKBA 4ONSA 3KL4A 2YL7A 5KYXA 3WAQA 3DAGA 4JW1A 3E70C 2OEVA 2OJED 4LERA 4PFPA 4LDKA 1FMWA 4NY3A 4U5HA 4HFKB 4EBJA 2ICWG 2ZXWC 4LDRA 2UUHA 3FMSA 3B71A 3ZG1A 3ASOC 3AG4C 2H7OA 4I1OB 3FVYA 1D1AA 3S27A 1WATA 3HNLA 3DXJF 4JRZA 4PJJA 3AQBA 4G78A 3T4RA 4YWQA 5KYNA 4BG0A 1GM5A 4AK9A 4IWBA 3TJ5A 4Z9JA 3LEVA 2P61A 1FFTC 5FZTA 1XWJA 3E9VA 4I3MA 3UMIA 5K0IA 4HE8D 1TR2A 3T6BA 3F46A 2Y3HA 2O9XA 2XSEA 3HLZA 5DQTA 4J30B 3EJNA 3GANA 2L6GA 3RH3A 3TK0A 4A4AA 5EHHA 4CDVA 4CX9A 5JS5A 2HUJA 1ZHWA 2IOQA 1ZU4A 4WABA 1CPQA 3W4YA 4XEVA 3WODF 3ZQVA 4CDYA 1LS1A 3KYJA 2JPUA 4IAOA 3WG7C 2JD3A 1K04A 2I15A 2IYLD 3C8GA 3U2MA 1H9GA 3NRHA 2J8WA 4H4KC 2RD9A 1LPEA 3ZDLA 1PV3A 4XWJA 4P9TA 3AJMA 2WVQA 4JEBA 4U5DE 3GEHA 1WN0A 1V4AA 2W9YA 3EGDB 1UG7A 3T6GB 1YARO 4IAQA 4Z9HA 2HFIA 3ZSUA 3UMHA 4NCQA 2VCCA 2NSGA 3ZVRA 4JC7A 1LVKA 2EPKX 3PDMP 2C04A 2R7SA 4I1MA 1ZHTA 1FNTc 5KYXB 4DRJB 5EGYA 2Y3DA 3KMIA 1ORYA 3MBGA 3VYWA 4MVMA 3X1OA 2CCYA 2L7AA 2Q9AA 2MYSA 3F47A 2X0CA 3S29A 1M56C 1T6UA 2B0JA 3EQLF 3ABKC 1A7DA 5FCLA 1QVXA 2LIGA 3M15A 3QVZA 4MS2A 4PFOA 5L0FA 1K05A 3G50A 2XLHA 3V5XA 2NSFA 2YHSA 3L8IA 1TFKB 5E33A 5KYWA 2WB7A 3FHDA 3U2LA 2KC3A 1WASA 3SXMA 1RCPA 4BJ6A 1LM3B 3EG9B 3X2QC 3JZ0A 3LNRA 2A6HF 3CAXA 4EKWA 2LP4A 2YKZA 1A0BA 4JURI 4CS8C 5B1AC 4U5EE 2XL8A 4LLEA 2OJQA 1QKRA 2H7VC 2J45A 2NUTB 2R25A 4M63A 4Q5SF 1FR0A 2Q00A 4IJJA 5B3SC 2V3CC 1T01A 3JT1A 4FAPB 1J8YF 3KPHA 1OCCC 2XLMA 4OIRF 1MMNA 3ZWIA 1OKKA 1RKCA 1MNEA 3DJNB 3IPMO 4WJ0A 1F1MA 1ZHZA 4MVRA 5HV9A 3AG3C 3V5ZA 3T9OA 2XLOA 4NTAA 4EUKB 1LE2A 3NMIA 3KH2A 2HZ8A 3NKEA 3OWTA 4DRIB 2XL6A 2A0BA 3W8IA 4GQHA 4DRHB 1PD1A 5BQIA 4N06A 2QE9A 2YVKA 3UNGC 4QI2A 5BUOA 2YQYA 3K66A 3QVYA 1E83A 1Z3IX 2EIKC 3O39A 1NU9C 2CNWA 5T3WA 2WZFA 3EGXB 4YL3A 1ZU5A 4ER9A 3RF3A 5A6BA 2D5RB 5EK0A 1SYQA 4U5BE 2NUPB 2FFHA 4NTFA 4YN0B 1NFOA 1QQ3A 1FAPB 1WGWA 2IXPA 5E2QA 4UDVA 1APCA 2G3KA 4OIOF 1IW7F 4K7BA 3IHUA 1MQVA 3M4CA 4MNDA 3JYYA 2EPLX 3NYJA 1CGOA 1SZIA 4OD5A 4AL1A 3NKDA 3NYLA 3RQFA 2WZGA 2DB4A 2R7UA 1VB5A 3ASNC 3Q6NA 2KGOA 4GEHA 4WGZA 3U3BA 5AC5A 4EHPA 3UGPA 3EHMA 1OKKD 5A6BD 3N2ZB 2KSFA 4JCZA 4U5GA 5DS5A 4O6NA 4YJWA 2GWWA 1A7VA 3B0PA 4AL0A 2Y3GA 1HY5A 3DD7A 2EINC 4ULWA 2OOCA 2J9UA 2QNLA 5JRAA 3IQ6A 2XLDA 3K7DA 2NUTA 5HSWA 4Q4ZF 3S84A 1MNDA 1ST6A 3L34A 2YLIA 3N24A 3JRMO 3LS0A 2Q9BA 1OR2A 4C7OA 3EG9A 5DS4A 1M57C 4D4XA 5L0DA 4JTAB 4Z9IA 4NQFA 3RVZA 1H7IA 4FX5A 2IXOA 3NDBB 4DJ9A 2LFDA 2R7XA 1VTMP 4PJMA 1WWPA 1H9TA 4G7OF 1Z7Qc 2BE5F 5L3VA 2OEXA 2QY9A 3G4ZA 4CIHA 2JX0A 2IM8A 4MVQA 2DI3A 3K6BA 4G0HA 4KNVA 4AE4A 4BJ6C 4BJ1A 1NBBA 3H65A 2ZPAA 1NFNA 3BRJA 4L6RA 5L3QA 2EILC 4OIQF 1JOGA 2YRFA 3S0XA 1ZYRF 1GGQA 4LDQA 4P9FA 3U9JA 3SZRA 1BR1A 2Y69C 2R05A 5JSLA 3FOOA 4KNWA 1LI5A 2Q4FA 4YL0A 1N1CA 3O10A 3MX3A 4N4WA 4YT5A 3W2VA 4YT8A 2CW0F 2NG1A 2WZLA 5JT4A 1BDJB 3U0CA 3H2VA 1ORJA 3TOMA 3ZTMA 1CGME 4BPMA 4PK4A 2R02A 4PR9A 1OW8A 2CDQA 3A11A 2C03A 3RYLA 4HEAJ 3C63A 3SXYA 3RQGA 1A7EA 1G4WR 2J0XA 4OD4A 3HNJA 4U9EA 1C17M 4MTOA 1C03A 1LKXA 2OCCC 2WVNA 1E84A 3GORA 3DM9B 1TQGA 3AGTA 3O55A 4XPYA 1FMVA 3JTLO 1RJ9A 2IBFA 2VCBA 1EI7A 4MTFA 1BR4A 2YL3A 5L0CA 4HFFB 2XXAA 1D0ZA 2CYDA 4OIPF 4WGYA 3TJ6A 3I5QA 1M2VA 1Q0FA 3VAYA 1DOWA 3OEOA 1ZW2A 1G5ZA 5T3TA 2KYHA 5E3CA 4XPWA 4XEFA 1Q0MA 3ATPA 4A2NB 1L7CA 1TWAA 3AOUA 1NU7D 5D91A 4X0RA 2HJMA 2YLGA 4CJOA 1ZZPA 4O79A 2VCAA 3EPVA 2G3VA 1OR3A 1O5HA 4G7ZF 1Z63A 3R2PA 4AE4B 1OQCA 3C7JA 1K40A 5JVEA 4XEKA 5JLIA 2M4EA 2KNHA 2J9WA 2VC9A 2W4BA 3DZAA 1JMWA 3LS1A 1AEPA 3JYHA 3M79A 3S9OA 1OW7A 2E87A 3DM5A 5DQZA 3U3FA 4Q7CA 1KTMA 2EIMC 2KJGA 2MHRA 3FOPA 2XRHA 3GWNA 3EZIA 3NYMA 2R7RA 2P1AA 4CIPA 3DE8A 2MWQA 2ZXRA 3CZ6A 3SEOA 4KI2A 2XXAB 2A69F 4XQ1A 1HE1A 1XZPA 3C8ZA 3LNMB 1YVIA 2P0NA 3I4UA 3V5YA 3RKOF 3GM3A 3BEHA 3RQEA 1NG1A 2DYSC 1AUEA 3TOLA 2H7BA 2EIJC 4QI0A 3K1HA 3ECSA 4BJ5A 2R7TA 1RXQA 2R7OA 1Z6AA 5DS6A 3A9CA 4XTKA 3DMDA 2J7PD 2OQMA 2EPOA 1XZQA 1IZMA 1KU2A 1PD0A 1V54C 1T5OA 1YA9A 2AP3A 3CSKA 4YK5A 4C3DA 5COGA 3EZHA 4GYTA 3DWWA 1QSPA 4N6CA 2Q7RA 3W8HA 1Z23A 1YDIA 1I4YA 1YAUO 4DXWA 1S7ZA 1VYIA 1QZXA 3QTHA 4IRUA 4K1OA 2I8BA 4OINF 1LS4A 1C02A 1YZCA 2V26A 4IGGA 3U9MA 3FAPB 4J7TA 1NSGB 3O6XA 2OKUA 3CEXA 4J32B 1VLSA 2HSBA 1JAFA 1H6GA 4NTBA 3RW0A 3U8PA 3V7OA 1LE4A 4XPXA 1D0YA 2LFFA 2LK4A 3NG1A 4RBNA 1LI7A 4DBQA 5JUAA 3OA1A 2YL0A 3LAYA 3DJUB 3POVA 5KYUB 2M64A 5BQGA 1TKNA 4CS8A 1AVOB 2YLDA 1CPRA 3MYFA 1VOMA 2WL8A 1ZVZA 1ZW3A 4RDAA 1BR2A 4U5FE 2H8AA 4I44A 1Q0GA 1O3UA 3GM1A 4FWVA 4JIOA 3RFYA 3MLGA 2FAPB 2ZXPA 3W2WA 3VM6A 1CGNA 3S28A 2B0HA 5AGFA 5KYUA 5COMA 2Y39A 2PX3A 1M6TA 2L9JA 1HE9A 1VLTA 2AVKA 3IEEA 5F28E 5A6AA 2NUPA 4CSAC 3Q6MA 1MMAA 3MYIA 3LEOA 1JR8A 1T6QA 1ZHXA 3QMKA 4LACB 1D1CA 2R9RB 4W8KA 1U89A 4XLPF 5KYYA 2W45A 3AG1C 2YL1A 1NZEA 3U5SA 5KYYB 1GQAA 1L3PA 1I4ZA 4PACA 5E3AA 2VB6A 2GAQA 3GEEA 4C3EA 5F5FA 4DOZA 2HS5A 1FTSA 1YA7O 3HJCA 1T6IA 1I5NA 2Q3TA 1RKEB 2J7PA 4DBRA
chains in the Genus database with same CATH topology
1WATA 3ATPA 4Z9HA 3T9OA 2D4UA 1VLTA 1WASA 2LIGA 4H54A 2ASRA 1JMWA 4Z9JA 1VLSA 4Z9IA 1LIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WAT A;  3ATP A;  4Z9H A;  3T9O A;  2D4U A;  1VLT A;  1WAS A;  2LIG A;  4H54 A;  2ASR A;  1JMW A;  4Z9J A;  1VLS A;  4Z9I A;  1LIH A; 
#chains in the Genus database with same CATH topology
 3VF0 A;  1RKE A;  2IXM A;  3G4X A;  3GM2 A;  3UGO A;  4MW3 A;  4MW8 A;  1YYX A;  2HJ3 A;  1G4U S;  3EGD A;  4MTG A;  4ULV A;  4NC3 A;  1E2X A;  3Q7G A;  4IB4 A;  4P6I C;  3TQO A;  3JSZ A;  3FXH A;  4O6M A;  2J0W A;  4CSA A;  4JVS A;  4O6Y A;  2FGY A;  1GS9 A;  3EFO A;  5T1D B;  2YZS A;  3CQZ A;  2HSQ A;  2KK1 A;  3US6 A;  3JCU Q;  2GFH A;  4BJ5 C;  5TJ5 E;  1JPJ A;  3AGU A;  1JPN A;  1SF8 A;  2J9V A;  3L0I A;  4MVO A;  1WOL A;  1LIH A;  2RSE B;  3GEI A;  4PJN A;  1OCO C;  1JRA A;  3EGX A;  4U9D A;  3RVY A;  4MQ9 F;  3NMJ A;  5A6K A;  3RIP A;  4G7H F;  2WVO A;  4JCH A;  4JJF A;  3DI5 A;  2R7V A;  1SMY F;  3AQC A;  4QDL A;  3ZQY A;  2KQ9 A;  5L0J A;  3B9Q A;  1MMD A;  3UR3 C;  3DAF A;  2J9B A;  3Q7L A;  4RD9 A;  5B3I A;  2XLW A;  1B68 A;  3QW0 A;  2HMQ A;  2XS8 A;  1RJ9 B;  3HNI A;  2G62 A;  3JRT A;  4JEA A;  4C3B A;  3WHN A;  3ABM C;  4JKV A;  2GDC A;  3LLI A;  1W2W A;  2R03 A;  2OG2 A;  2ZD9 A;  3EH2 A;  5DVW A;  5GPG B;  2IXN A;  2HV6 A;  3ZIB A;  2PX0 A;  3M4B A;  5KYW B;  4LLC A;  4H54 A;  4W8P A;  4E18 A;  1HW1 A;  1M2O A;  1V55 C;  1T9K A;  2P7V A;  2R7Q A;  4XLN F;  4E7Z A;  2LQG A;  5BQH A;  1Q0D A;  2XLE A;  3I5P A;  3SP1 A;  3B0V C;  2HKV A;  3EHN A;  1Y6D A;  3T6J A;  2XL4 A;  3LJB A;  3L8J A;  2ASR A;  2HV7 A;  1HMD A;  3JSE O;  4YT4 A;  1R5I D;  1NLX A;  3AG2 C;  4YT2 A;  1TWG A;  3N0T A;  2XS1 A;  1U6H A;  2A1D D;  2D4U A;  3M1C B;  4E0I A;  4C7O B;  1M2V B;  4YL1 A;  3K1I A;  5AC4 A;  1OCR C;  1S05 A;  1OXB A;  1TWH A;  2L6H A;  1WTY A;  2XM4 A;  3DE9 A;  5D92 A;  5JP7 A;  5L0G A;  4DVZ A;  3L1M A;  4KBL A;  3J06 A;  4O7G A;  3SXK A;  3B29 A;  3GOD A;  3SYN A;  1Z5Z A;  1R4T A;  2A68 F;  3FDQ A;  2PF4 E;  2VH3 A;  3LES A;  2DYR C;  2LD6 A;  4EIY A;  3U8V A;  2UUI A;  3QW1 A;  2BC5 A;  2W4M A;  5A69 A;  2QLA A;  3C62 A;  4E7S A;  1QPU A;  5L0H A;  1ZHY A;  1EKY A;  3SXZ A;  1G8X A;  3C8G B;  1YJG A;  2VAS A;  3ITF A;  1QLE C;  1KNY A;  4PJL A;  2CNW D;  5CI8 A;  3ZTZ A;  1Q0K A;  2QUP A;  2LCH A;  3IQT A;  3LUT B;  2P6V A;  2QTV A;  3QZC A;  5CIV A;  3LLK A;  3VRC A;  4JTC B;  5COF A;  1YYJ A;  3IQC A;  1VYK A;  4D4N A;  3R7C A;  1VMA A;  4B6I A;  3UMK A;  3K1I C;  1DOV A;  2EPM X;  2PNO A;  4FES A;  4R32 A;  4EBB A;  1PCX A;  1D1B A;  1HW2 A;  4ZLC A;  2YWA A;  5L0I A;  1SR2 A;  2Q9C A;  1J8M F;  5F5H A;  1E85 A;  3C8G D;  3H2U A;  4CS9 C;  4E17 A;  2OU6 A;  3S90 A;  2R7W A;  3TUL A;  2L6F A;  2CGE A;  2YEV A;  2ZXO A;  4BJT A;  4J7Y A;  256B A;  4E0H A;  4IAR A;  4CS7 A;  5A6J A;  4DVY P;  4MVU A;  4MVZ A;  2LSE A;  3GWL A;  4U5C E;  1D0X A;  1O87 A;  2HMZ A;  3DKA A;  3B0U X;  2EPN A;  2ETS A;  4JTD B;  5DLJ A;  1TFO B;  2A0U A;  3ABL C;  1RMV A;  3TD7 A;  2X51 A;  5B1B C;  3HTK C;  1HMO A;  1V74 B;  3FAJ A;  4AX2 A;  4JE9 A;  4JJG A;  4CBE A;  2XM0 A;  3MFN A;  2AWY A;  4MVS A;  2GA0 A;  1EQ1 A;  1Y4C A;  3PCV A;  4K0D A;  4JZA A;  4EBK A;  3HNK A;  4BEM J;  1TWC A;  4ZLD A;  1OW6 A;  2PFD A;  3KYI A;  1OXK A;  1EA8 A;  2DGJ A;  3PMR A;  3PHF 2;  2KW3 C;  3NMK A;  2AU5 A;  4CDA A;  4F4B A;  2PBE A;  3ZC4 A;  1A41 A;  1YZA A;  2XLV A;  1U0B B;  2A6E F;  4CJG A;  4CS9 A;  1E86 A;  4KC9 A;  1UFB A;  4BEJ A;  4EWC A;  5CI9 A;  1BZ4 A;  1BBH A;  3K33 A;  2NPU A;  1FFH A;  3EH1 A;  3HKK A;  1MMG A;  2Z15 A;  2L81 A;  1OCZ C;  1VK5 A;  2TMV P;  1YLM A;  4ANJ A;  5IY5 C;  1ORS C;  2PP4 A;  2AWC A;  2J46 A;  2Y3B A;  3SNH A;  4N6H A;  2BL2 A;  3EFO B;  3C18 A;  2F22 A;  3IQ5 A;  3KKB A;  4ONS A;  3KL4 A;  2YL7 A;  5KYX A;  3WAQ A;  3DAG A;  4JW1 A;  3E70 C;  2OEV A;  2OJE D;  4LER A;  4PFP A;  4LDK A;  1FMW A;  4NY3 A;  4U5H A;  4HFK B;  4EBJ A;  2ICW G;  2ZXW C;  4LDR A;  2UUH A;  3FMS A;  3B71 A;  3ZG1 A;  3ASO C;  3AG4 C;  2H7O A;  4I1O B;  3FVY A;  1D1A A;  3S27 A;  1WAT A;  3HNL A;  3DXJ F;  4JRZ A;  4PJJ A;  3AQB A;  4G78 A;  3T4R A;  4YWQ A;  5KYN A;  4BG0 A;  1GM5 A;  4AK9 A;  4IWB A;  3TJ5 A;  4Z9J A;  3LEV A;  2P61 A;  1FFT C;  5FZT A;  1XWJ A;  3E9V A;  4I3M A;  3UMI A;  5K0I A;  4HE8 D;  1TR2 A;  3T6B A;  3F46 A;  2Y3H A;  2O9X A;  2XSE A;  3HLZ A;  5DQT A;  4J30 B;  3EJN A;  3GAN A;  2L6G A;  3RH3 A;  3TK0 A;  4A4A A;  5EHH A;  4CDV A;  4CX9 A;  5JS5 A;  2HUJ A;  1ZHW A;  2IOQ A;  1ZU4 A;  4WAB A;  1CPQ A;  3W4Y A;  4XEV A;  3WOD F;  3ZQV A;  4CDY A;  1LS1 A;  3KYJ A;  2JPU A;  4IAO A;  3WG7 C;  2JD3 A;  1K04 A;  2I15 A;  2IYL D;  3C8G A;  3U2M A;  1H9G A;  3NRH A;  2J8W A;  4H4K C;  2RD9 A;  1LPE A;  3ZDL A;  1PV3 A;  4XWJ A;  4P9T A;  3AJM A;  2WVQ A;  4JEB A;  4U5D E;  3GEH A;  1WN0 A;  1V4A A;  2W9Y A;  3EGD B;  1UG7 A;  3T6G B;  1YAR O;  4IAQ A;  4Z9H A;  2HFI A;  3ZSU A;  3UMH A;  4NCQ A;  2VCC A;  2NSG A;  3ZVR A;  4JC7 A;  1LVK A;  2EPK X;  3PDM P;  2C04 A;  2R7S A;  4I1M A;  1ZHT A;  1FNT c;  5KYX B;  4DRJ B;  5EGY A;  2Y3D A;  3KMI A;  1ORY A;  3MBG A;  3VYW A;  4MVM A;  3X1O A;  2CCY A;  2L7A A;  2Q9A A;  2MYS A;  3F47 A;  2X0C A;  3S29 A;  1M56 C;  1T6U A;  2B0J A;  3EQL F;  3ABK C;  1A7D A;  5FCL A;  1QVX A;  2LIG A;  3M15 A;  3QVZ A;  4MS2 A;  4PFO A;  5L0F A;  1K05 A;  3G50 A;  2XLH A;  3V5X A;  2NSF A;  2YHS A;  3L8I A;  1TFK B;  5E33 A;  5KYW A;  2WB7 A;  3FHD A;  3U2L A;  2KC3 A;  1WAS A;  3SXM A;  1RCP A;  4BJ6 A;  1LM3 B;  3EG9 B;  3X2Q C;  3JZ0 A;  3LNR A;  2A6H F;  3CAX A;  4EKW A;  2LP4 A;  2YKZ A;  1A0B A;  4JUR I;  4CS8 C;  5B1A C;  4U5E E;  2XL8 A;  4LLE A;  2OJQ A;  1QKR A;  2H7V C;  2J45 A;  2NUT B;  2R25 A;  4M63 A;  4Q5S F;  1FR0 A;  2Q00 A;  4IJJ A;  5B3S C;  2V3C C;  1T01 A;  3JT1 A;  4FAP B;  1J8Y F;  3KPH A;  1OCC C;  2XLM A;  4OIR F;  1MMN A;  3ZWI A;  1OKK A;  1RKC A;  1MNE A;  3DJN B;  3IPM O;  4WJ0 A;  1F1M A;  1ZHZ A;  4MVR A;  5HV9 A;  3AG3 C;  3V5Z A;  3T9O A;  2XLO A;  4NTA A;  4EUK B;  1LE2 A;  3NMI A;  3KH2 A;  2HZ8 A;  3NKE A;  3OWT A;  4DRI B;  2XL6 A;  2A0B A;  3W8I A;  4GQH A;  4DRH B;  1PD1 A;  5BQI A;  4N06 A;  2QE9 A;  2YVK A;  3UNG C;  4QI2 A;  5BUO A;  2YQY A;  3K66 A;  3QVY A;  1E83 A;  1Z3I X;  2EIK C;  3O39 A;  1NU9 C;  2CNW A;  5T3W A;  2WZF A;  3EGX B;  4YL3 A;  1ZU5 A;  4ER9 A;  3RF3 A;  5A6B A;  2D5R B;  5EK0 A;  1SYQ A;  4U5B E;  2NUP B;  2FFH A;  4NTF A;  4YN0 B;  1NFO A;  1QQ3 A;  1FAP B;  1WGW A;  2IXP A;  5E2Q A;  4UDV A;  1APC A;  2G3K A;  4OIO F;  1IW7 F;  4K7B A;  3IHU A;  1MQV A;  3M4C A;  4MND A;  3JYY A;  2EPL X;  3NYJ A;  1CGO A;  1SZI A;  4OD5 A;  4AL1 A;  3NKD A;  3NYL A;  3RQF A;  2WZG A;  2DB4 A;  2R7U A;  1VB5 A;  3ASN C;  3Q6N A;  2KGO A;  4GEH A;  4WGZ A;  3U3B A;  5AC5 A;  4EHP A;  3UGP A;  3EHM A;  1OKK D;  5A6B D;  3N2Z B;  2KSF A;  4JCZ A;  4U5G A;  5DS5 A;  4O6N A;  4YJW A;  2GWW A;  1A7V A;  3B0P A;  4AL0 A;  2Y3G A;  1HY5 A;  3DD7 A;  2EIN C;  4ULW A;  2OOC A;  2J9U A;  2QNL A;  5JRA A;  3IQ6 A;  2XLD A;  3K7D A;  2NUT A;  5HSW A;  4Q4Z F;  3S84 A;  1MND A;  1ST6 A;  3L34 A;  2YLI A;  3N24 A;  3JRM O;  3LS0 A;  2Q9B A;  1OR2 A;  4C7O A;  3EG9 A;  5DS4 A;  1M57 C;  4D4X A;  5L0D A;  4JTA B;  4Z9I A;  4NQF A;  3RVZ A;  1H7I A;  4FX5 A;  2IXO A;  3NDB B;  4DJ9 A;  2LFD A;  2R7X A;  1VTM P;  4PJM A;  1WWP A;  1H9T A;  4G7O F;  1Z7Q c;  2BE5 F;  5L3V A;  2OEX A;  2QY9 A;  3G4Z A;  4CIH A;  2JX0 A;  2IM8 A;  4MVQ A;  2DI3 A;  3K6B A;  4G0H A;  4KNV A;  4AE4 A;  4BJ6 C;  4BJ1 A;  1NBB A;  3H65 A;  2ZPA A;  1NFN A;  3BRJ A;  4L6R A;  5L3Q A;  2EIL C;  4OIQ F;  1JOG A;  2YRF A;  3S0X A;  1ZYR F;  1GGQ A;  4LDQ A;  4P9F A;  3U9J A;  3SZR A;  1BR1 A;  2Y69 C;  2R05 A;  5JSL A;  3FOO A;  4KNW A;  1LI5 A;  2Q4F A;  4YL0 A;  1N1C A;  3O10 A;  3MX3 A;  4N4W A;  4YT5 A;  3W2V A;  4YT8 A;  2CW0 F;  2NG1 A;  2WZL A;  5JT4 A;  1BDJ B;  3U0C A;  3H2V A;  1ORJ A;  3TOM A;  3ZTM A;  1CGM E;  4BPM A;  4PK4 A;  2R02 A;  4PR9 A;  1OW8 A;  2CDQ A;  3A11 A;  2C03 A;  3RYL A;  4HEA J;  3C63 A;  3SXY A;  3RQG A;  1A7E A;  1G4W R;  2J0X A;  4OD4 A;  3HNJ A;  4U9E A;  1C17 M;  4MTO A;  1C03 A;  1LKX A;  2OCC C;  2WVN A;  1E84 A;  3GOR A;  3DM9 B;  1TQG A;  3AGT A;  3O55 A;  4XPY A;  1FMV A;  3JTL O;  1RJ9 A;  2IBF A;  2VCB A;  1EI7 A;  4MTF A;  1BR4 A;  2YL3 A;  5L0C A;  4HFF B;  2XXA A;  1D0Z A;  2CYD A;  4OIP F;  4WGY A;  3TJ6 A;  3I5Q A;  1M2V A;  1Q0F A;  3VAY A;  1DOW A;  3OEO A;  1ZW2 A;  1G5Z A;  5T3T A;  2KYH A;  5E3C A;  4XPW A;  4XEF A;  1Q0M A;  3ATP A;  4A2N B;  1L7C A;  1TWA A;  3AOU A;  1NU7 D;  5D91 A;  4X0R A;  2HJM A;  2YLG A;  4CJO A;  1ZZP A;  4O79 A;  2VCA A;  3EPV A;  2G3V A;  1OR3 A;  1O5H A;  4G7Z F;  1Z63 A;  3R2P A;  4AE4 B;  1OQC A;  3C7J A;  1K40 A;  5JVE A;  4XEK A;  5JLI A;  2M4E A;  2KNH A;  2J9W A;  2VC9 A;  2W4B A;  3DZA A;  1JMW A;  3LS1 A;  1AEP A;  3JYH A;  3M79 A;  3S9O A;  1OW7 A;  2E87 A;  3DM5 A;  5DQZ A;  3U3F A;  4Q7C A;  1KTM A;  2EIM C;  2KJG A;  2MHR A;  3FOP A;  2XRH A;  3GWN A;  3EZI A;  3NYM A;  2R7R A;  2P1A A;  4CIP A;  3DE8 A;  2MWQ A;  2ZXR A;  3CZ6 A;  3SEO A;  4KI2 A;  2XXA B;  2A69 F;  4XQ1 A;  1HE1 A;  1XZP A;  3C8Z A;  3LNM B;  1YVI A;  2P0N A;  3I4U A;  3V5Y A;  3RKO F;  3GM3 A;  3BEH A;  3RQE A;  1NG1 A;  2DYS C;  1AUE A;  3TOL A;  2H7B A;  2EIJ C;  4QI0 A;  3K1H A;  3ECS A;  4BJ5 A;  2R7T A;  1RXQ A;  2R7O A;  1Z6A A;  5DS6 A;  3A9C A;  4XTK A;  3DMD A;  2J7P D;  2OQM A;  2EPO A;  1XZQ A;  1IZM A;  1KU2 A;  1PD0 A;  1V54 C;  1T5O A;  1YA9 A;  2AP3 A;  3CSK A;  4YK5 A;  4C3D A;  5COG A;  3EZH A;  4GYT A;  3DWW A;  1QSP A;  4N6C A;  2Q7R A;  3W8H A;  1Z23 A;  1YDI A;  1I4Y A;  1YAU O;  4DXW A;  1S7Z A;  1VYI A;  1QZX A;  3QTH A;  4IRU A;  4K1O A;  2I8B A;  4OIN F;  1LS4 A;  1C02 A;  1YZC A;  2V26 A;  4IGG A;  3U9M A;  3FAP B;  4J7T A;  1NSG B;  3O6X A;  2OKU A;  3CEX A;  4J32 B;  1VLS A;  2HSB A;  1JAF A;  1H6G A;  4NTB A;  3RW0 A;  3U8P A;  3V7O A;  1LE4 A;  4XPX A;  1D0Y A;  2LFF A;  2LK4 A;  3NG1 A;  4RBN A;  1LI7 A;  4DBQ A;  5JUA A;  3OA1 A;  2YL0 A;  3LAY A;  3DJU B;  3POV A;  5KYU B;  2M64 A;  5BQG A;  1TKN A;  4CS8 A;  1AVO B;  2YLD A;  1CPR A;  3MYF A;  1VOM A;  2WL8 A;  1ZVZ A;  1ZW3 A;  4RDA A;  1BR2 A;  4U5F E;  2H8A A;  4I44 A;  1Q0G A;  1O3U A;  3GM1 A;  4FWV A;  4JIO A;  3RFY A;  3MLG A;  2FAP B;  2ZXP A;  3W2W A;  3VM6 A;  1CGN A;  3S28 A;  2B0H A;  5AGF A;  5KYU A;  5COM A;  2Y39 A;  2PX3 A;  1M6T A;  2L9J A;  1HE9 A;  1VLT A;  2AVK A;  3IEE A;  5F28 E;  5A6A A;  2NUP A;  4CSA C;  3Q6M A;  1MMA A;  3MYI A;  3LEO A;  1JR8 A;  1T6Q A;  1ZHX A;  3QMK A;  4LAC B;  1D1C A;  2R9R B;  4W8K A;  1U89 A;  4XLP F;  5KYY A;  2W45 A;  3AG1 C;  2YL1 A;  1NZE A;  3U5S A;  5KYY B;  1GQA A;  1L3P A;  1I4Z A;  4PAC A;  5E3A A;  2VB6 A;  2GAQ A;  3GEE A;  4C3E A;  5F5F A;  4DOZ A;  2HS5 A;  1FTS A;  1YA7 O;  3HJC A;  1T6I A;  1I5N A;  2Q3T A;  1RKE B;  2J7P A;  4DBR A; 
#chains in the Genus database with same CATH homology
 1WAT A;  3ATP A;  4Z9H A;  3T9O A;  2D4U A;  1VLT A;  1WAS A;  2LIG A;  4H54 A;  2ASR A;  1JMW A;  4Z9J A;  1VLS A;  4Z9I A;  1LIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...