3T9OA

Regulatory czb domain of dgcz
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
122
structure length
108
Chain Sequence
TTEIDAILLNLNKAIDAHYQWLVSMFHSVVARDCQFGRWIDHLGPLDNDELPYVRLMDSAHQHMHNCGRELMLAIVENHWQDAHFDAFQEGLLSFTAALTDYKIYLLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Diguanylate cyclase DgcZ
publication title Structure and signaling mechanism of a zinc-sensory diguanylate cyclase.
pubmed doi rcsb
source organism Escherichia coli
total genus 43
structure length 108
sequence length 122
chains with identical sequence B
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2011-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.30 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Aspartate receptor, ligand-binding domain 3t9oA00
1VLTA 4Z9IA 4Z9JA 1WATA 1WASA 3T9OA 4H54A 1LIHA 2LIGA 4Z9HA 3ATPA 2ASRA 1VLSA 2D4UA 1JMWA
chains in the Genus database with same CATH superfamily
1VLTA 2G3VA 3GODA 3LS0A 4NC3A 3MBGA 2KNHA 4H4KC 3GANA 3IQ6A 5AC5A 2LSEA 1YVIA 4KNWA 4CDAA 1W2WA 3N0TA 1VTMP 5AC4A 2XLEA 3L8IA 3K6BA 5L0FA 1BR1A 1UG7A 3FAPB 4NCQA 5CI8A 3RF3A 1O87A 1OCOC 4WGZA 2VASA 2G62A 3EQLF 2JX0A 4O6NA 1VOMA 4QI2A 2WVOA 3PMRA 2LIGA 4CS7A 4YWQA 1Z5ZA 1TR2A 1FMVA 2IXPA 2XL6A 3RIPA 2DGJA 2HSBA 2QUPA 1JMWA 4JTCB 2R7WA 4OINF 3LESA 5GPGB 3U3BA 3UNGC 4PACA 4CS9A 3C63A 4UDVA 5HSWA 2IXNA 1PCXA 5COFA 4G78A 3HNIA 4DRHB 2R05A 4IGGA 3M4CA 1K40A 3RFYA 3E70C 2XL4A 3X2QC 1Q0GA 2KYHA 3EGDB 1AUEA 1OW6A 3EFOB 2GWWA 1B68A 5EHHA 2BC5A 3HTKC 5JLIA 5F5HA 3M4BA 3WAQA 2YRFA 1UFBA 1I4YA 3DJNB 4EKWA 2XRHA 3RQGA 2FGYA 4FESA 2OOCA 2CNWA 3KYJA 2Q00A 2Q7RA 1R5ID 4AE4A 4LERA 2ZXRA 1Z23A 3X1OA 2XM4A 4N6CA 3TOLA 1Z3IX 2MYSA 3K33A 4YN0B 2CDQA 2D5RB 4OIPF 4CSAA 2R7SA 3G4XA 1D1CA 1HMOA 4U9DA 4XTKA 5B1AC 1QKRA 4U5DE 5T3TA 2H8AA 1DOWA 1HY5A 2NPUA 2VCAA 3IPMO 2DI3A 4FWVA 4CBEA 1FMWA 2HV7A 4U5HA 3LJBA 4Z9IA 3IQ5A 1RKEB 2XXAB 1YLMA 1NFNA 4IARA 3S0XA 3CQZA 4EWCA 2XSEA 4K7BA 2IXMA 5DS6A 3LEVA 2VB6A 1ZW3A 3DM5A 1HE9A 3RW0A 1IZMA 4E7ZA 2Y3HA 2ZXPA 4GEHA 4JIOA 4KNVA 2XLDA 1SYQA 3EHMA 3NDBB 1HMDA 2WZLA 4E7SA 4XEKA 4E18A 3W2WA 4PJNA 3TD7A 1XZPA 1A7DA 3L8JA 2DYRC 1OQCA 3S84A 2XLVA 1CPRA 3S28A 2V26A 5E2QA 3KKBA 4ZLDA 4Q7CA 2Q4FA 3LS1A 2A0BA 4O6MA 1OXKA 3OWTA 2X51A 1I4ZA 1GM5A 2HFIA 4CDYA 4AL0A 3S27A 5L3VA 3OA1A 2ZPAA 5KYXB 2YVKA 3GWLA 2P6VA 3LEOA 4MVRA 2QY9A 3R7CA 3BRJA 4C7OB 4Z9JA 3EFOA 4I44A 2CCYA 3KMIA 3ASNC 4YT4A 3B0PA 1Z7Qc 2IM8A 4MS2A 2EINC 3CSKA 3PCVA 4HEAJ 4D4XA 1LM3B 1O3UA 1YYJA 2R7TA 2R7XA 3DZAA 2W4BA 1H7IA 3JZ0A 3SXMA 4CX9A 5A6KA 3UGOA 3EPVA 4PFPA 2YL1A 3CEXA 4P6IC 4G7ZF 1CGME 2OKUA 5JRAA 2VCBA 3AQBA 4FAPB 3NMJA 4MNDA 3JSZA 2I15A 2PNOA 2L6GA 2XLHA 1AVOB 1IW7F 1V54C 1LI5A 4MW8A 1U0BB 4JVSA 2XXAA 1RKEA 4PJLA 3EH1A 4G0HA 3V5ZA 1QQ3A 1QSPA 3L0IA 2OG2A 3L34A 3JSEO 1JRAA 3NMKA 4U5BE 2QNLA 5B1BC 3U9MA 4YT5A 5L0HA 1GQAA 3DJUB 4MQ9F 2YLIA 5COGA 4DRIB 1HE1A 4PJMA 3K1IA 5F5FA 2KQ9A 3LUTB 2Q9CA 5IY5C 1ZHTA 4IAQA 2J46A 1YDIA 2J0XA 1M2VA 3N2ZB 2DYSC 2JD3A 4DOZA 3V7OA 1BR2A 1JPJA 5DVWA 3QW1A 1MMNA 2EILC 2KGOA 2VCCA 3ATPA 3TULA 2EPKX 4BJ5C 2V3CC 4EHPA 4WJ0A 1OW7A 3H2UA 3DI5A 3NKEA 3ECSA 1T01A 4DRJB 2LK4A 3DMDA 4MVUA 1SR2A 2AP3A 2LD6A 1YZAA 1J8YF 5A6BA 3ABKC 3S90A 1OR2A 1HW2A 1Q0DA 1YAUO 1ZHWA 3UMKA 2WVQA 4C3DA 3FVYA 5KYWA 3FMSA 3HJCA 3C62A 3RQFA 3U8VA 1AEPA 1OCRC 4I3MA 4CS8A 4DJ9A 2I8BA 5HV9A 5JUAA 4A2NB 4C3BA 2XS8A 3PHF2 4DVZA 2FFHA 2PX0A 3FHDA 3SNHA 3BEHA 2J9BA 3SXYA 3TQOA 1Q0KA 1D1BA 4JKVA 4QI0A 2XLMA 4N6HA 2EPLX 4MW3A 2LCHA 2R9RB 3VAYA 3ZG1A 4NY3A 4ULVA 5A6AA 1E2XA 4BJ6A 3WODF 3U2LA 2CYDA 3JCUQ 2RD9A 3GEEA 1E85A 2QTVA 2A1DD 2WVNA 1FAPB 4CIPA 1G4WR 2X0CA 4NTAA 1KNYA 5EK0A 2Q9AA 4O79A 5TJ5E 5L0DA 4N06A 1L3PA 3C7JA 3EZIA 3MX3A 4XEFA 2AWYA 1YZCA 3GM2A 1ZYRF 4CS9C 2PFDA 1OCZC 4ULWA 3DD7A 3I4UA 3LLIA 2J7PA 2L6HA 5T3WA 5K0IA 1ORYA 1RXQA 1G5ZA 3NRHA 3B9QA 2CNWD 3C8GA 3RVYA 1OKKD 3U2MA 1EKYA 2HS5A 3M1CB 4J32B 4YL1A 4ER9A 3S9OA 3U8PA 4MVZA 4LACB 3NMIA 4DBRA 4MVQA 1M2OA 4JTAB 1CGNA 2A6HF 5KYUA 1BR4A 2CW0F 4BJ1A 3FDQA 2KSFA 2RSEB 4CSAC 1D0YA 4YL0A 2GFHA 4U5CE 5EGYA 2G3KA 4P9TA 1J8MF 3U5SA 2UUHA 1OR3A 4M63A 4CJOA 2LFDA 1D1AA 5E33A 3EJNA 2NUTA 1I5NA 2FAPB 4ZLCA 3E9VA 4MTGA 3L1MA 3N24A 4Z9HA 4XLPF 3K66A 4F4BA 4G7OF 3EG9B 1YA9A 4W8PA 2GAQA 4W8KA 3VRCA 4J7TA 2WB7A 2YL7A 4JW1A 4C3EA 2IXOA 3AG2C 5DQTA 2YEVA 2ASRA 4XPYA 1APCA 1H9GA 2HUJA 2YKZA 4LDRA 3DE8A 4HE8D 4J30B 1ZVZA 4LDQA 1WGWA 4YT2A 2C03A 3V5XA 4AL1A 3B0UX 4NTBA 4Q4ZF 1EI7A 3SYNA 3PDMP 1E83A 3VF0A 3EGDA 1BBHA 1DOVA 3G4ZA 4IWBA 4PK4A 3W4YA 1D0ZA 2OQMA 3NKDA 3O55A 1QZXA 5L0CA 2L81A 2A68F 2LFFA 1ST6A 2WL8A 2XS1A 3F47A 3G50A 3LNMB 5JSLA 1U6HA 3B71A 4GYTA 2AU5A 4U9EA 4IRUA 4RDAA 2PBEA 3MLGA 1JPNA 4B6IA 3JTLO 2HKVA 1LE2A 4E17A 3Q7LA 5BQHA 3TK0A 4MVSA 4DBQA 1FNTc 1RJ9B 3H65A 4N4WA 4PJJA 1TKNA 3CAXA 3ZQYA 2Y3GA 3FXHA 1Z6AA 3A9CA 1YYXA 3JYHA 2EIKC 5JS5A 2F22A 3QTHA 3J06A 1C02A 3DAGA 3AJMA 3T4RA 2A0UA 1M57C 2XM0A 1S7ZA 3KYIA 4YK5A 3ZWIA 5BQIA 3ABMC 4KI2A 2VH3A 3K1HA 1FTSA 2R02A 2XL8A 5COMA 3HLZA 3T9OA 2P61A 2TMVP 1ZHXA 4OD4A 2OU6A 1FFTC 1NZEA 1T6IA 2J8WA 1LVKA 2NUPB 3RKOF 4U5EE 2EIMC 2OCCC 5JVEA 3UGPA 1BDJB 4CDVA 3U3FA 3KPHA 3RYLA 1V4AA 2OJED 4BPMA 2A69F 2D4UA 1WWPA 4HFFB 3RVZA 3ZTMA 1H9TA 1G4US 1RKCA 2KK1A 5E3AA 1MNDA 1ZHYA 3HNKA 4P9FA 4XWJA 3S29A 4JEBA 5KYXA 2JPUA 1NFOA 5A6BD 3TJ6A 2IOQA 4XLNF 3FOOA 2LQGA 4C7OA 1YA7O 4EBJA 3KH2A 3AGTA 4A4AA 1CPQA 4EUKB 4MVOA 2OEXA 1Z63A 3OEOA 1ZZPA 5L3QA 5KYYB 4AX2A 2XLOA 2PF4E 3EZHA 1SMYF 4IJJA 1MNEA 2ZXOA 1TWGA 3U0CA 2OEVA 2YQYA 4JRZA 1WTYA 4AE4B 3ZVRA 2C04A 1PD1A 2E87A 1YARO 4I1OB 4CS8C 2W4MA 1H6GA 1MMGA 2J9UA 5JT4A 3M15A 4GQHA 1LPEA 4X0RA 3T6JA 3TOMA 1MQVA 1T6UA 4JZAA 1MMDA 2EPMX 4JJGA 2YLDA 1WASA 3M79A 1LS4A 4CJGA 2P1AA 4G7HF 2A6EF 2IBFA 3QMKA 5DS5A 3I5QA 2WZFA 1ZHZA 1ZW2A 2R7UA 4BJTA 4K0DA 3SXZA 2PP4A 1K05A 4MVMA 3EHNA 4IB4A 2ICWG 4BJ6C 1E84A 1ORJA 2Z15A 3IQCA 3B29A 2ZXWC 3UMHA 4DVYP 1TFKB 4WABA 2QLAA 1V74B 1N1CA 2M64A 1A7EA 4RD9A 4BEJA 2ETSA 2NUPA 4FX5A 1KTMA 2J7PD 4CIHA 3NYMA 5A69A 5B3SC 1RCPA 2PX3A 3T6BA 3ZSUA 2BL2A 4OIOF 4HFKB 2BE5F 3C8GD 2OJQA 3LAYA 3Q6MA 3ZDLA 2Y3DA 1M56C 2HMQA 2YWAA 3IHUA 4PR9A 1C17M 2XLWA 3NYLA 1OXBA 4E0IA 4XPXA 2R7VA 2YL0A 2L9JA 1EA8A 1JR8A 3ITFA 4J7YA 5L0JA 1NU7D 2MHRA 4WGYA 3POVA 2J9VA 4QDLA 4U5FE 2LP4A 2R03A 3AOUA 3LNRA 3DWWA 5A6JA 1GGQA 4OIQF 2W45A 5KYYA 1Y6DA 3MYIA 3Q6NA 2HJ3A 3QVZA 1SF8A 2GA0A 4LDKA 4YL3A 4I1MA 5D91A 1EQ1A 1OKKA 1LKXA 3F46A 3FOPA 3H2VA 2P0NA 3GM3A 1VMAA 5KYNA 1O5HA 4O6YA 3IQTA 3I5PA 3C18A 4JCHA 1SZIA 1WATA 4LLCA 4AK9A 3JRTA 1S05A 2Q9BA 3AQCA 4XEVA 4Q5SF 3SZRA 1T6QA 1Y4CA 4JC7A 2GDCA 2R25A 4DXWA 1A7VA 2J45A 2HJMA 2NSGA 3VYWA 3FAJA 3CZ6A 2R7RA 4KBLA 5BQGA 1ZU5A 4IAOA 4KC9A 3T6GB 1TWAA 3AGUA 1VB5A 3GM1A 5DLJA 1A41A 4D4NA 1Q0FA 1VLSA 1QPUA 5L0IA 3AG3C 5D92A 2HV6A 3RH3A 1PV3A 5FZTA 3WHNA 3SEOA 1TFOB 2O9XA 3UMIA 1M6TA 4JTDB 1VYIA 4MTFA 4BEMJ 1OW8A 1ORSC 1XWJA 2KJGA 2VC9A 3EGXB 2IYLD 3TJ5A 2HSQA 2MWQA 3DXJF 2R7QA 1OCCC 4U5GA 4K1OA 1M2VB 1E86A 2NG1A 1VK5A 1WOLA 1WN0A 2B0JA 3O39A 3C8ZA 1V55C 4NQFA 5CIVA 2UUIA 1JAFA 5F28E 1C03A 5L0GA 1QVXA 4H54A 1LIHA 2HMZA 3DAFA 4OD5A 2H7BA 1PD0A 4MTOA 3JYYA 3ABLC 1LS1A 4O7GA 3MYFA 4OIRF 1NLXA 1NG1A 1FFHA 3LLKA 4R32A 1CGOA 3RQEA 2Q3TA 2EPOA 3ASOC 3O6XA 3DE9A 1LE4A 2HZ8A 3A11A 4RBNA 2YZSA 4EBKA 1BZ4A 3MFNA 2NSFA 4NTFA 1T9KA 3HNJA 3KL4A 2J0WA 5AGFA 4XQ1A 5JP7A 3U9JA 5KYWB 2Y39A 3HKKA 4JJFA 2Y69C 3GEIA 3Q7GA 3ZQVA 3JRMO 1T5OA 4JEAA 1A0BA 3EG9A 1D0XA 1XZQA 3R2PA 2AVKA 2P7VA 4JCZA 4EBBA 3AG1C 2QE9A 5DQZA 3K1IC 4YT8A 1L7CA 2H7VC 2R7OA 5B3IA 2L7AA 3GWNA 4PFOA 2J9WA 2M4EA 4XPWA 2KW3C 3WG7C 4L6RA 3ZIBA 3SP1A 3SXKA 5FCLA 1U89A 1MMAA 4LLEA 2DB4A 3NG1A 4JURI 3HNLA 2EIJC 2H7OA 3QZCA 3AG4C 2ZD9A 1VYKA 3GORA 3VM6A 1NSGB 1LI7A 3EH2A 3EGXA 3QW0A 5E3CA 3W8IA 2B0HA 3B0VC 4BJ5A 1QLEC 1TQGA 2WZGA 1TWHA 2L6FA 2YL3A 3W8HA 5BUOA 3QVYA 256BA 2YLGA 3NYJA 1Q0MA 1JOGA 3DM9B 4ONSA 4E0HA 2Y3BA 3W2VA 3UR3C 1HW1A 3C8GB 5T1DB 4EIYA 1G8XA 1K04A 1TWCA 3JT1A 1KU2A 1NU9C 1RJ9A 3K7DA 1FR0A 1GS9A 4YJWA 3US6A 3ZTZA 2KC3A 2NUTB 1YJGA 1R4TA 5DS4A 3GEHA 3V5YA 3O10A 2W9YA 4BG0A 1RMVA 3IEEA 2EPNA 2YHSA 1F1MA 5CI9A 2CGEA 3DKAA 1NBBA 3ZC4A 5KYUB 4ANJA 1ZU4A 4JE9A 2AWCA
chains in the Genus database with same CATH topology
1VLTA 4Z9IA 4Z9JA 1WATA 1WASA 3T9OA 4H54A 1LIHA 2LIGA 4Z9HA 3ATPA 2ASRA 1VLSA 2D4UA 1JMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VLT A;  4Z9I A;  4Z9J A;  1WAT A;  1WAS A;  3T9O A;  4H54 A;  1LIH A;  2LIG A;  4Z9H A;  3ATP A;  2ASR A;  1VLS A;  2D4U A;  1JMW A; 
#chains in the Genus database with same CATH topology
 1VLT A;  2G3V A;  3GOD A;  3LS0 A;  4NC3 A;  3MBG A;  2KNH A;  4H4K C;  3GAN A;  3IQ6 A;  5AC5 A;  2LSE A;  1YVI A;  4KNW A;  4CDA A;  1W2W A;  3N0T A;  1VTM P;  5AC4 A;  2XLE A;  3L8I A;  3K6B A;  5L0F A;  1BR1 A;  1UG7 A;  3FAP B;  4NCQ A;  5CI8 A;  3RF3 A;  1O87 A;  1OCO C;  4WGZ A;  2VAS A;  2G62 A;  3EQL F;  2JX0 A;  4O6N A;  1VOM A;  4QI2 A;  2WVO A;  3PMR A;  2LIG A;  4CS7 A;  4YWQ A;  1Z5Z A;  1TR2 A;  1FMV A;  2IXP A;  2XL6 A;  3RIP A;  2DGJ A;  2HSB A;  2QUP A;  1JMW A;  4JTC B;  2R7W A;  4OIN F;  3LES A;  5GPG B;  3U3B A;  3UNG C;  4PAC A;  4CS9 A;  3C63 A;  4UDV A;  5HSW A;  2IXN A;  1PCX A;  5COF A;  4G78 A;  3HNI A;  4DRH B;  2R05 A;  4IGG A;  3M4C A;  1K40 A;  3RFY A;  3E70 C;  2XL4 A;  3X2Q C;  1Q0G A;  2KYH A;  3EGD B;  1AUE A;  1OW6 A;  3EFO B;  2GWW A;  1B68 A;  5EHH A;  2BC5 A;  3HTK C;  5JLI A;  5F5H A;  3M4B A;  3WAQ A;  2YRF A;  1UFB A;  1I4Y A;  3DJN B;  4EKW A;  2XRH A;  3RQG A;  2FGY A;  4FES A;  2OOC A;  2CNW A;  3KYJ A;  2Q00 A;  2Q7R A;  1R5I D;  4AE4 A;  4LER A;  2ZXR A;  1Z23 A;  3X1O A;  2XM4 A;  4N6C A;  3TOL A;  1Z3I X;  2MYS A;  3K33 A;  4YN0 B;  2CDQ A;  2D5R B;  4OIP F;  4CSA A;  2R7S A;  3G4X A;  1D1C A;  1HMO A;  4U9D A;  4XTK A;  5B1A C;  1QKR A;  4U5D E;  5T3T A;  2H8A A;  1DOW A;  1HY5 A;  2NPU A;  2VCA A;  3IPM O;  2DI3 A;  4FWV A;  4CBE A;  1FMW A;  2HV7 A;  4U5H A;  3LJB A;  4Z9I A;  3IQ5 A;  1RKE B;  2XXA B;  1YLM A;  1NFN A;  4IAR A;  3S0X A;  3CQZ A;  4EWC A;  2XSE A;  4K7B A;  2IXM A;  5DS6 A;  3LEV A;  2VB6 A;  1ZW3 A;  3DM5 A;  1HE9 A;  3RW0 A;  1IZM A;  4E7Z A;  2Y3H A;  2ZXP A;  4GEH A;  4JIO A;  4KNV A;  2XLD A;  1SYQ A;  3EHM A;  3NDB B;  1HMD A;  2WZL A;  4E7S A;  4XEK A;  4E18 A;  3W2W A;  4PJN A;  3TD7 A;  1XZP A;  1A7D A;  3L8J A;  2DYR C;  1OQC A;  3S84 A;  2XLV A;  1CPR A;  3S28 A;  2V26 A;  5E2Q A;  3KKB A;  4ZLD A;  4Q7C A;  2Q4F A;  3LS1 A;  2A0B A;  4O6M A;  1OXK A;  3OWT A;  2X51 A;  1I4Z A;  1GM5 A;  2HFI A;  4CDY A;  4AL0 A;  3S27 A;  5L3V A;  3OA1 A;  2ZPA A;  5KYX B;  2YVK A;  3GWL A;  2P6V A;  3LEO A;  4MVR A;  2QY9 A;  3R7C A;  3BRJ A;  4C7O B;  4Z9J A;  3EFO A;  4I44 A;  2CCY A;  3KMI A;  3ASN C;  4YT4 A;  3B0P A;  1Z7Q c;  2IM8 A;  4MS2 A;  2EIN C;  3CSK A;  3PCV A;  4HEA J;  4D4X A;  1LM3 B;  1O3U A;  1YYJ A;  2R7T A;  2R7X A;  3DZA A;  2W4B A;  1H7I A;  3JZ0 A;  3SXM A;  4CX9 A;  5A6K A;  3UGO A;  3EPV A;  4PFP A;  2YL1 A;  3CEX A;  4P6I C;  4G7Z F;  1CGM E;  2OKU A;  5JRA A;  2VCB A;  3AQB A;  4FAP B;  3NMJ A;  4MND A;  3JSZ A;  2I15 A;  2PNO A;  2L6G A;  2XLH A;  1AVO B;  1IW7 F;  1V54 C;  1LI5 A;  4MW8 A;  1U0B B;  4JVS A;  2XXA A;  1RKE A;  4PJL A;  3EH1 A;  4G0H A;  3V5Z A;  1QQ3 A;  1QSP A;  3L0I A;  2OG2 A;  3L34 A;  3JSE O;  1JRA A;  3NMK A;  4U5B E;  2QNL A;  5B1B C;  3U9M A;  4YT5 A;  5L0H A;  1GQA A;  3DJU B;  4MQ9 F;  2YLI A;  5COG A;  4DRI B;  1HE1 A;  4PJM A;  3K1I A;  5F5F A;  2KQ9 A;  3LUT B;  2Q9C A;  5IY5 C;  1ZHT A;  4IAQ A;  2J46 A;  1YDI A;  2J0X A;  1M2V A;  3N2Z B;  2DYS C;  2JD3 A;  4DOZ A;  3V7O A;  1BR2 A;  1JPJ A;  5DVW A;  3QW1 A;  1MMN A;  2EIL C;  2KGO A;  2VCC A;  3ATP A;  3TUL A;  2EPK X;  4BJ5 C;  2V3C C;  4EHP A;  4WJ0 A;  1OW7 A;  3H2U A;  3DI5 A;  3NKE A;  3ECS A;  1T01 A;  4DRJ B;  2LK4 A;  3DMD A;  4MVU A;  1SR2 A;  2AP3 A;  2LD6 A;  1YZA A;  1J8Y F;  5A6B A;  3ABK C;  3S90 A;  1OR2 A;  1HW2 A;  1Q0D A;  1YAU O;  1ZHW A;  3UMK A;  2WVQ A;  4C3D A;  3FVY A;  5KYW A;  3FMS A;  3HJC A;  3C62 A;  3RQF A;  3U8V A;  1AEP A;  1OCR C;  4I3M A;  4CS8 A;  4DJ9 A;  2I8B A;  5HV9 A;  5JUA A;  4A2N B;  4C3B A;  2XS8 A;  3PHF 2;  4DVZ A;  2FFH A;  2PX0 A;  3FHD A;  3SNH A;  3BEH A;  2J9B A;  3SXY A;  3TQO A;  1Q0K A;  1D1B A;  4JKV A;  4QI0 A;  2XLM A;  4N6H A;  2EPL X;  4MW3 A;  2LCH A;  2R9R B;  3VAY A;  3ZG1 A;  4NY3 A;  4ULV A;  5A6A A;  1E2X A;  4BJ6 A;  3WOD F;  3U2L A;  2CYD A;  3JCU Q;  2RD9 A;  3GEE A;  1E85 A;  2QTV A;  2A1D D;  2WVN A;  1FAP B;  4CIP A;  1G4W R;  2X0C A;  4NTA A;  1KNY A;  5EK0 A;  2Q9A A;  4O79 A;  5TJ5 E;  5L0D A;  4N06 A;  1L3P A;  3C7J A;  3EZI A;  3MX3 A;  4XEF A;  2AWY A;  1YZC A;  3GM2 A;  1ZYR F;  4CS9 C;  2PFD A;  1OCZ C;  4ULW A;  3DD7 A;  3I4U A;  3LLI A;  2J7P A;  2L6H A;  5T3W A;  5K0I A;  1ORY A;  1RXQ A;  1G5Z A;  3NRH A;  3B9Q A;  2CNW D;  3C8G A;  3RVY A;  1OKK D;  3U2M A;  1EKY A;  2HS5 A;  3M1C B;  4J32 B;  4YL1 A;  4ER9 A;  3S9O A;  3U8P A;  4MVZ A;  4LAC B;  3NMI A;  4DBR A;  4MVQ A;  1M2O A;  4JTA B;  1CGN A;  2A6H F;  5KYU A;  1BR4 A;  2CW0 F;  4BJ1 A;  3FDQ A;  2KSF A;  2RSE B;  4CSA C;  1D0Y A;  4YL0 A;  2GFH A;  4U5C E;  5EGY A;  2G3K A;  4P9T A;  1J8M F;  3U5S A;  2UUH A;  1OR3 A;  4M63 A;  4CJO A;  2LFD A;  1D1A A;  5E33 A;  3EJN A;  2NUT A;  1I5N A;  2FAP B;  4ZLC A;  3E9V A;  4MTG A;  3L1M A;  3N24 A;  4Z9H A;  4XLP F;  3K66 A;  4F4B A;  4G7O F;  3EG9 B;  1YA9 A;  4W8P A;  2GAQ A;  4W8K A;  3VRC A;  4J7T A;  2WB7 A;  2YL7 A;  4JW1 A;  4C3E A;  2IXO A;  3AG2 C;  5DQT A;  2YEV A;  2ASR A;  4XPY A;  1APC A;  1H9G A;  2HUJ A;  2YKZ A;  4LDR A;  3DE8 A;  4HE8 D;  4J30 B;  1ZVZ A;  4LDQ A;  1WGW A;  4YT2 A;  2C03 A;  3V5X A;  4AL1 A;  3B0U X;  4NTB A;  4Q4Z F;  1EI7 A;  3SYN A;  3PDM P;  1E83 A;  3VF0 A;  3EGD A;  1BBH A;  1DOV A;  3G4Z A;  4IWB A;  4PK4 A;  3W4Y A;  1D0Z A;  2OQM A;  3NKD A;  3O55 A;  1QZX A;  5L0C A;  2L81 A;  2A68 F;  2LFF A;  1ST6 A;  2WL8 A;  2XS1 A;  3F47 A;  3G50 A;  3LNM B;  5JSL A;  1U6H A;  3B71 A;  4GYT A;  2AU5 A;  4U9E A;  4IRU A;  4RDA A;  2PBE A;  3MLG A;  1JPN A;  4B6I A;  3JTL O;  2HKV A;  1LE2 A;  4E17 A;  3Q7L A;  5BQH A;  3TK0 A;  4MVS A;  4DBQ A;  1FNT c;  1RJ9 B;  3H65 A;  4N4W A;  4PJJ A;  1TKN A;  3CAX A;  3ZQY A;  2Y3G A;  3FXH A;  1Z6A A;  3A9C A;  1YYX A;  3JYH A;  2EIK C;  5JS5 A;  2F22 A;  3QTH A;  3J06 A;  1C02 A;  3DAG A;  3AJM A;  3T4R A;  2A0U A;  1M57 C;  2XM0 A;  1S7Z A;  3KYI A;  4YK5 A;  3ZWI A;  5BQI A;  3ABM C;  4KI2 A;  2VH3 A;  3K1H A;  1FTS A;  2R02 A;  2XL8 A;  5COM A;  3HLZ A;  3T9O A;  2P61 A;  2TMV P;  1ZHX A;  4OD4 A;  2OU6 A;  1FFT C;  1NZE A;  1T6I A;  2J8W A;  1LVK A;  2NUP B;  3RKO F;  4U5E E;  2EIM C;  2OCC C;  5JVE A;  3UGP A;  1BDJ B;  4CDV A;  3U3F A;  3KPH A;  3RYL A;  1V4A A;  2OJE D;  4BPM A;  2A69 F;  2D4U A;  1WWP A;  4HFF B;  3RVZ A;  3ZTM A;  1H9T A;  1G4U S;  1RKC A;  2KK1 A;  5E3A A;  1MND A;  1ZHY A;  3HNK A;  4P9F A;  4XWJ A;  3S29 A;  4JEB A;  5KYX A;  2JPU A;  1NFO A;  5A6B D;  3TJ6 A;  2IOQ A;  4XLN F;  3FOO A;  2LQG A;  4C7O A;  1YA7 O;  4EBJ A;  3KH2 A;  3AGT A;  4A4A A;  1CPQ A;  4EUK B;  4MVO A;  2OEX A;  1Z63 A;  3OEO A;  1ZZP A;  5L3Q A;  5KYY B;  4AX2 A;  2XLO A;  2PF4 E;  3EZH A;  1SMY F;  4IJJ A;  1MNE A;  2ZXO A;  1TWG A;  3U0C A;  2OEV A;  2YQY A;  4JRZ A;  1WTY A;  4AE4 B;  3ZVR A;  2C04 A;  1PD1 A;  2E87 A;  1YAR O;  4I1O B;  4CS8 C;  2W4M A;  1H6G A;  1MMG A;  2J9U A;  5JT4 A;  3M15 A;  4GQH A;  1LPE A;  4X0R A;  3T6J A;  3TOM A;  1MQV A;  1T6U A;  4JZA A;  1MMD A;  2EPM X;  4JJG A;  2YLD A;  1WAS A;  3M79 A;  1LS4 A;  4CJG A;  2P1A A;  4G7H F;  2A6E F;  2IBF A;  3QMK A;  5DS5 A;  3I5Q A;  2WZF A;  1ZHZ A;  1ZW2 A;  2R7U A;  4BJT A;  4K0D A;  3SXZ A;  2PP4 A;  1K05 A;  4MVM A;  3EHN A;  4IB4 A;  2ICW G;  4BJ6 C;  1E84 A;  1ORJ A;  2Z15 A;  3IQC A;  3B29 A;  2ZXW C;  3UMH A;  4DVY P;  1TFK B;  4WAB A;  2QLA A;  1V74 B;  1N1C A;  2M64 A;  1A7E A;  4RD9 A;  4BEJ A;  2ETS A;  2NUP A;  4FX5 A;  1KTM A;  2J7P D;  4CIH A;  3NYM A;  5A69 A;  5B3S C;  1RCP A;  2PX3 A;  3T6B A;  3ZSU A;  2BL2 A;  4OIO F;  4HFK B;  2BE5 F;  3C8G D;  2OJQ A;  3LAY A;  3Q6M A;  3ZDL A;  2Y3D A;  1M56 C;  2HMQ A;  2YWA A;  3IHU A;  4PR9 A;  1C17 M;  2XLW A;  3NYL A;  1OXB A;  4E0I A;  4XPX A;  2R7V A;  2YL0 A;  2L9J A;  1EA8 A;  1JR8 A;  3ITF A;  4J7Y A;  5L0J A;  1NU7 D;  2MHR A;  4WGY A;  3POV A;  2J9V A;  4QDL A;  4U5F E;  2LP4 A;  2R03 A;  3AOU A;  3LNR A;  3DWW A;  5A6J A;  1GGQ A;  4OIQ F;  2W45 A;  5KYY A;  1Y6D A;  3MYI A;  3Q6N A;  2HJ3 A;  3QVZ A;  1SF8 A;  2GA0 A;  4LDK A;  4YL3 A;  4I1M A;  5D91 A;  1EQ1 A;  1OKK A;  1LKX A;  3F46 A;  3FOP A;  3H2V A;  2P0N A;  3GM3 A;  1VMA A;  5KYN A;  1O5H A;  4O6Y A;  3IQT A;  3I5P A;  3C18 A;  4JCH A;  1SZI A;  1WAT A;  4LLC A;  4AK9 A;  3JRT A;  1S05 A;  2Q9B A;  3AQC A;  4XEV A;  4Q5S F;  3SZR A;  1T6Q A;  1Y4C A;  4JC7 A;  2GDC A;  2R25 A;  4DXW A;  1A7V A;  2J45 A;  2HJM A;  2NSG A;  3VYW A;  3FAJ A;  3CZ6 A;  2R7R A;  4KBL A;  5BQG A;  1ZU5 A;  4IAO A;  4KC9 A;  3T6G B;  1TWA A;  3AGU A;  1VB5 A;  3GM1 A;  5DLJ A;  1A41 A;  4D4N A;  1Q0F A;  1VLS A;  1QPU A;  5L0I A;  3AG3 C;  5D92 A;  2HV6 A;  3RH3 A;  1PV3 A;  5FZT A;  3WHN A;  3SEO A;  1TFO B;  2O9X A;  3UMI A;  1M6T A;  4JTD B;  1VYI A;  4MTF A;  4BEM J;  1OW8 A;  1ORS C;  1XWJ A;  2KJG A;  2VC9 A;  3EGX B;  2IYL D;  3TJ5 A;  2HSQ A;  2MWQ A;  3DXJ F;  2R7Q A;  1OCC C;  4U5G A;  4K1O A;  1M2V B;  1E86 A;  2NG1 A;  1VK5 A;  1WOL A;  1WN0 A;  2B0J A;  3O39 A;  3C8Z A;  1V55 C;  4NQF A;  5CIV A;  2UUI A;  1JAF A;  5F28 E;  1C03 A;  5L0G A;  1QVX A;  4H54 A;  1LIH A;  2HMZ A;  3DAF A;  4OD5 A;  2H7B A;  1PD0 A;  4MTO A;  3JYY A;  3ABL C;  1LS1 A;  4O7G A;  3MYF A;  4OIR F;  1NLX A;  1NG1 A;  1FFH A;  3LLK A;  4R32 A;  1CGO A;  3RQE A;  2Q3T A;  2EPO A;  3ASO C;  3O6X A;  3DE9 A;  1LE4 A;  2HZ8 A;  3A11 A;  4RBN A;  2YZS A;  4EBK A;  1BZ4 A;  3MFN A;  2NSF A;  4NTF A;  1T9K A;  3HNJ A;  3KL4 A;  2J0W A;  5AGF A;  4XQ1 A;  5JP7 A;  3U9J A;  5KYW B;  2Y39 A;  3HKK A;  4JJF A;  2Y69 C;  3GEI A;  3Q7G A;  3ZQV A;  3JRM O;  1T5O A;  4JEA A;  1A0B A;  3EG9 A;  1D0X A;  1XZQ A;  3R2P A;  2AVK A;  2P7V A;  4JCZ A;  4EBB A;  3AG1 C;  2QE9 A;  5DQZ A;  3K1I C;  4YT8 A;  1L7C A;  2H7V C;  2R7O A;  5B3I A;  2L7A A;  3GWN A;  4PFO A;  2J9W A;  2M4E A;  4XPW A;  2KW3 C;  3WG7 C;  4L6R A;  3ZIB A;  3SP1 A;  3SXK A;  5FCL A;  1U89 A;  1MMA A;  4LLE A;  2DB4 A;  3NG1 A;  4JUR I;  3HNL A;  2EIJ C;  2H7O A;  3QZC A;  3AG4 C;  2ZD9 A;  1VYK A;  3GOR A;  3VM6 A;  1NSG B;  1LI7 A;  3EH2 A;  3EGX A;  3QW0 A;  5E3C A;  3W8I A;  2B0H A;  3B0V C;  4BJ5 A;  1QLE C;  1TQG A;  2WZG A;  1TWH A;  2L6F A;  2YL3 A;  3W8H A;  5BUO A;  3QVY A;  256B A;  2YLG A;  3NYJ A;  1Q0M A;  1JOG A;  3DM9 B;  4ONS A;  4E0H A;  2Y3B A;  3W2V A;  3UR3 C;  1HW1 A;  3C8G B;  5T1D B;  4EIY A;  1G8X A;  1K04 A;  1TWC A;  3JT1 A;  1KU2 A;  1NU9 C;  1RJ9 A;  3K7D A;  1FR0 A;  1GS9 A;  4YJW A;  3US6 A;  3ZTZ A;  2KC3 A;  2NUT B;  1YJG A;  1R4T A;  5DS4 A;  3GEH A;  3V5Y A;  3O10 A;  2W9Y A;  4BG0 A;  1RMV A;  3IEE A;  2EPN A;  2YHS A;  1F1M A;  5CI9 A;  2CGE A;  3DKA A;  1NBB A;  3ZC4 A;  5KYU B;  4ANJ A;  1ZU4 A;  4JE9 A;  2AWC A; 
#chains in the Genus database with same CATH homology
 1VLT A;  4Z9I A;  4Z9J A;  1WAT A;  1WAS A;  3T9O A;  4H54 A;  1LIH A;  2LIG A;  4Z9H A;  3ATP A;  2ASR A;  1VLS A;  2D4U A;  1JMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...