3ZIBA

Rap2a protein (sma2265) from serratia marcescens
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
92
Chain Sequence
TYTPEEYLKNYALSVCIAEGYSAKEVKNDAAAAARGYTEFGDYSLEAHTAVRALAKEFLAKPYDSSGEPMTMAKCIDLVHSQELQAIIKKYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAP2A SMA2265
publication title Structural Basis for Type Vi Secreted Peptidoglycan Dl-Endopeptidase Function, Specificity and Neutralization in Serratia Marcescens
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Protein binding
total genus 35
structure length 92
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3zibA00
3ZIBA 4J30B 4J32B 4HFFB 4AX2A 4B6IA 4JURI 4HFKB
chains in the Genus database with same CATH superfamily
4GEHA 4JTAB 2CNWA 1G4WR 3GWLA 1YDIA 2DI3A 2HMQA 2L81A 3RH3A 4F4BA 2R7TA 3LEVA 3Q6MA 5CI9A 5A6AA 1VYKA 4YT5A 3ZTMA 5F5HA 4YT8A 2JD3A 3AG3C 4MW8A 3K1IA 2D5RB 3UMKA 4WGZA 2PX0A 2DYSC 3EGDB 2L6HA 2P0NA 1CGOA 2G62A 4N4WA 2IOQA 1O3UA 4W8PA 4PFPA 4YWQA 1NU9C 2AP3A 3S84A 3GM1A 5EK0A 3U2LA 2XLDA 4MTGA 2WZFA 3LNMB 3B9QA 5L0IA 3V5XA 4NQFA 2XM4A 3GWNA 3ITFA 5A6KA 2A0UA 3V7OA 3NYLA 1KTMA 4A2NB 2R03A 1JMWA 4DRIB 3HNJA 2GA0A 1JAFA 3QW1A 5DVWA 3B0PA 4X0RA 2PF4E 4N6HA 1WASA 4DXWA 4PFOA 2Q00A 3VAYA 1QVXA 2Q9AA 2KC3A 1M2VB 3LEOA 3UMHA 4DRHB 4RDAA 4JKVA 1VK5A 2R7OA 1QSPA 3PCVA 1SMYF 2QNLA 1SZIA 3K33A 5DQTA 2KYHA 5L0DA 4BJTA 1Q0FA 3L8JA 2OCCC 1T5OA 3IQ5A 4M63A 2EIMC 3DAFA 3K7DA 4LERA 4MVQA 1ZVZA 2YLGA 1RJ9A 1FAPB 3JRMO 3ASNC 1YVIA 1IZMA 3DXJF 4D4NA 1OCOC 2ZXRA 1BR2A 4DOZA 2CNWD 3T6GB 2GFHA 5A6JA 3DD7A 2Q7RA 1NU7D 3RQFA 4E7ZA 1JOGA 1S7ZA 4H4KC 2XS8A 4IGGA 4IAQA 1E86A 4XQ1A 3EG9A 4U5EE 3FXHA 2LK4A 1JPNA 2AWYA 4W8KA 1OCRC 3TOMA 2P6VA 1H7IA 4LDRA 2ZXPA 4PJMA 1V4AA 2VC9A 1ZHYA 2IXPA 3K1HA 1RMVA 4NTFA 4C3BA 4CSAC 2OEXA 3JYHA 1N1CA 2J9UA 4Z9JA 2R7VA 3FAPB 4YL0A 3X2QC 4G7OF 1JRAA 1Z5ZA 2HZ8A 3M4BA 2J46A 5T3TA 3SYNA 2R7RA 4Q7CA 4LDQA 1J8YF 3DE8A 3ECSA 2NUTA 3OEOA 4EWCA 3POVA 3OA1A 2RSEB 4U5BE 2QE9A 1OR2A 1UFBA 3GM2A 3H65A 2YZSA 3NYMA 3M79A 3AGTA 1KNYA 3RF3A 4BJ6C 1YZAA 3GORA 2OJQA 1G4US 1VTMP 2MYSA 1FMVA 2HV6A 4FESA 4OD5A 4N06A 1ZW2A 5GPGB 3ZWIA 4AL0A 2H8AA 4ANJA 2CCYA 2XRHA 5L0HA 1I4ZA 1WOLA 3C8GA 4PACA 2YL1A 3EQLF 4I3MA 4I1OB 4CDYA 2R7UA 1ZYRF 3N24A 3DKAA 3LS0A 3GANA 1MQVA 1A41A 3JCUQ 3TJ5A 4MVUA 3EFOA 5B3SC 3U0CA 1F1MA 3MLGA 3S28A 1W2WA 4XWJA 4JW1A 3M15A 1ZHTA 2NG1A 3LLKA 1ST6A 2W4BA 1V54C 4E17A 3F47A 4U5DE 3ZSUA 2UUHA 2PX3A 5L3QA 256BA 2BL2A 2M64A 3DJUB 3B29A 5E2QA 3NG1A 4PK4A 3F46A 4IRUA 1T9KA 1E83A 2EIJC 2R05A 3MYIA 4JEBA 4BEMJ 3SXMA 3DMDA 3AG4C 3I4UA 1B68A 1NLXA 2LCHA 3NMKA 1OR3A 1XWJA 2AVKA 3L0IA 3S27A 2Q9CA 4MTFA 2IYLD 1QKRA 2WL8A 1NG1A 2WZLA 3LJBA 3VYWA 1FNTc 1QZXA 3EPVA 4I44A 4ULWA 3HLZA 1QPUA 4U5HA 2HKVA 1ORJA 3QVYA 3EHMA 3QMKA 1VLSA 2WVOA 3UR3C 1VYIA 3L34A 3W2WA 2EIKC 3AG1C 2YLDA 4JZAA 3HTKC 1XZQA 1TWAA 4MVMA 3C7JA 4XEKA 2EPLX 4MVOA 4HEAJ 2IXMA 1BR4A 4HFKB 2ZXWC 3G50A 3SZRA 2PNOA 1Z63A 3U9MA 2YWAA 1OXKA 1AEPA 2R7QA 3C8GD 2KQ9A 3I5PA 5T3WA 2YL7A 4CJGA 4EHPA 3S0XA 3EG9B 1BR1A 2Y3DA 3T6JA 3ZQYA 2ETSA 5KYUA 4DVZA 1OQCA 4CIPA 1RKCA 5L0GA 5KYXA 2L7AA 4J32B 1FR0A 5B3IA 1YJGA 4CIHA 1KU2A 5AGFA 4CS8C 5IY5C 3LS1A 3SXYA 1MNEA 1LKXA 5DS6A 2FFHA 1K04A 3GEEA 1HMDA 2IM8A 2Y3GA 4J7TA 1O87A 2ZXOA 4XPXA 1G5ZA 3DM9B 5COGA 2FAPB 1M57C 2XLVA 1EQ1A 3UGPA 1OXBA 4JIOA 1E84A 3C62A 2EPKX 1GM5A 2OU6A 5CIVA 4QI0A 3AGUA 4CSAA 3GEHA 4C7OA 3AOUA 4N6CA 4E0IA 5L0FA 3PDMP 2J0XA 4G7ZF 2O9XA 3LAYA 2XS1A 3CSKA 1BBHA 3G4XA 4XLNF 3ASOC 5JUAA 4YL3A 1Q0GA 4IJJA 4WJ0A 2XL4A 3OWTA 5AC5A 5D92A 2OG2A 2HSQA 4IWBA 1GQAA 4BJ5A 2KGOA 2LQGA 1Z23A 3LUTB 3U5SA 2XLHA 2Q4FA 5T1DB 2ZD9A 3DJNB 3C8GB 4YT4A 4JURI 4CBEA 2HFIA 3N0TA 3KL4A 4ZLDA 2EINC 2ICWG 1Y6DA 3JZ0A 5KYWA 1ORYA 3O55A 5F5FA 1Q0MA 1C03A 1HMOA 4CS9A 3AQCA 1CPRA 3E9VA 1L3PA 4MW3A 1LI5A 3VF0A 2B0HA 4P9FA 4KI2A 3VM6A 3SEOA 3C8ZA 1T01A 1ORSC 4D4XA 4EBKA 4EKWA 2J9WA 3EJNA 4NTBA 3S29A 4KNVA 4PJLA 3VRCA 3ZDLA 2YVKA 3FDQA 2CYDA 1RKEA 2MHRA 1D1AA 2OOCA 2YKZA 3CAXA 3MBGA 3O10A 4EBBA 3CEXA 3PMRA 4G7HF 3UMIA 1CGME 2IXNA 3U8VA 1K05A 2LFFA 3R7CA 5FCLA 4EBJA 4AK9A 1GS9A 2HJ3A 1ZHWA 2R9RB 3H2UA 3Q7GA 4PR9A 2LSEA 5JS5A 2MWQA 2A6EF 3NMJA 3NYJA 3GODA 1I4YA 5BQIA 4LLCA 4PJNA 1OW8A 2G3VA 2HMZA 5B1BC 2LFDA 2NPUA 2NUPA 2P1AA 2R7XA 2HJMA 3SXKA 2WVNA 2RD9A 4P9TA 4RD9A 1ZZPA 1FFHA 1SYQA 3EH1A 4U9DA 2YEVA 3NDBB 4JCHA 1YA7O 5COFA 1MMNA 3HNIA 3RVZA 1I5NA 1G8XA 3RFYA 4UDVA 3UNGC 2A68F 1H9GA 1ZU5A 2V26A 1LI7A 1DOVA 4YL1A 4AL1A 3GM3A 1CGNA 4GYTA 5EHHA 4G78A 3K1IC 2QY9A 1H6GA 2XLEA 3B71A 4BPMA 2J9BA 5L3VA 1CPQA 3DZAA 4MNDA 2R02A 4JTCB 2XM0A 2GDCA 5KYYA 1TFOB 4Z9HA 1TKNA 5L0CA 1C17M 1TR2A 1D0XA 1YYXA 1MMDA 4Q5SF 3KMIA 2F22A 3WODF 3AJMA 4C7OB 3C63A 3MFNA 4XTKA 4U9EA 1A7EA 3RQGA 2ZPAA 3E70C 2FGYA 3IEEA 3IQTA 5CI8A 2KW3C 4KNWA 3J06A 2J0WA 2D4UA 3C18A 4C3DA 4ONSA 2A69F 5A6BA 3O39A 4EUKB 4K7BA 4U5FE 3ZQVA 5HV9A 4E18A 5D91A 1OCZC 1A7VA 1U89A 3FOPA 1WATA 3KYIA 1AVOB 3M1CB 4U5CE 4K0DA 3T6BA 3FHDA 2V3CC 1K40A 2HS5A 5KYWB 4RBNA 3JTLO 3IPMO 1GGQA 5JP7A 1ZU4A 3ABMC 3EZIA 4MTOA 4R32A 3ZC4A 5BUOA 3DAGA 1LIHA 4JJGA 3W2VA 3FOOA 2H7BA 1V74B 3W8HA 4DVYP 1YAUO 2VB6A 2M4EA 3T9OA 2KSFA 2Q9BA 1RJ9B 2I15A 3EHNA 4JTDB 4Q4ZF 1RXQA 2BE5F 2XL8A 3QW0A 3RVYA 1IW7F 1RKEB 4AE4A 4MS2A 4LDKA 2J7PD 1WWPA 3R2PA 3TD7A 1EI7A 1FMWA 1LS1A 2L9JA 2LIGA 5B1AC 3U8PA 3BEHA 4HFFB 4KC9A 5AC4A 2Q3TA 4MVZA 2WB7A 2YL0A 1VOMA 2C03A 2H7VC 2UUIA 2DGJA 2EPNA 3TK0A 2DYRC 2WVQA 3W4YA 4J30B 1TQGA 1OW7A 1NZEA 1O5HA 1V55C 3FVYA 3HKKA 1BZ4A 3NMIA 3QTHA 4JJFA 5E33A 1EA8A 3U3FA 3X1OA 2P7VA 1NSGB 1NFNA 2XLOA 4I1MA 3ZIBA 2KNHA 3WG7C 1HE9A 2QLAA 3SXZA 5A6BD 1PD1A 1VLTA 1D1CA 2PBEA 4H54A 3V5ZA 3QZCA 2CDQA 4QDLA 2NUTB 2CW0F 1D0ZA 2Y69C 3IHUA 1OKKA 2QUPA 4PJJA 5BQGA 1C02A 2TMVP 3RIPA 3U9JA 5JSLA 4DBQA 2EILC 4CDAA 1MNDA 4Z9IA 2VCAA 4IARA 4BEJA 3EH2A 4JCZA 4O79A 5L0JA 4L6RA 2GWWA 4QI2A 4JVSA 3BRJA 1FTSA 2G3KA 3IQCA 4ULVA 1UG7A 5E3AA 2W4MA 2B0JA 1MMAA 4BJ6A 2QTVA 5KYYB 1JR8A 3L1MA 2PFDA 2ASRA 1TWHA 2Y3BA 5BQHA 4MQ9F 3V5YA 2NSFA 4BG0A 2E87A 2L6FA 2LD6A 3EFOB 2IBFA 2VCCA 4IAOA 2Y3HA 1R4TA 3LNRA 3JT1A 1T6QA 3WHNA 4FX5A 1TWGA 3SNHA 2CGEA 4OIRF 2VASA 5DLJA 1AUEA 5K0IA 2I8BA 1HW2A 1R5ID 1D0YA 2EPMX 2J8WA 2Y39A 1QQ3A 4G0HA 4O6MA 2KJGA 4O6YA 2JPUA 5A69A 1EKYA 3AQBA 1Y4CA 4GQHA 3L8IA 1A7DA 1Q0KA 1YYJA 3A9CA 3IQ6A 1JPJA 2YRFA 4JC7A 3WAQA 3T4RA 3NKEA 4OIQF 3TJ6A 2P61A 2W45A 1M6TA 4MVRA 5JLIA 3ABKC 1PCXA 1SF8A 1OKKD 3JSZA 3LESA 4E7SA 3EGXA 2L6GA 2C04A 4JRZA 4WABA 3M4CA 4WGYA 4DJ9A 4U5GA 4CDVA 1Z3IX 5DS5A 1WGWA 3CZ6A 2XLMA 3DWWA 3S9OA 2R7SA 1SR2A 3U3BA 1WTYA 1Q0DA 1M2OA 4YN0B 3TQOA 2XXAA 2H7OA 4AE4B 2YQYA 5HSWA 1T6UA 3B0UX 3Q7LA 2IXOA 3AG2C 3RW0A 1HE1A 1VB5A 2W9YA 4XEFA 5KYUB 5KYXB 3HJCA 4OD4A 4ZLCA 3RQEA 2YL3A 4DRJB 4YJWA 1Z7Qc 3TOLA 3A11A 4XEVA 4OINF 2GAQA 3K66A 5TJ5E 2J7PA 4YK5A 4ER9A 3N2ZB 4CS7A 3H2VA 4MVSA 4CS8A 3TULA 1LM3B 3S90A 3B0VC 1FFTC 3DM5A 2J45A 1DOWA 1TWCA 3CQZA 3EGDA 4O6NA 5COMA 1QLEC 1NBBA 3O6XA 5E3CA 2AU5A 1LE4A 2A1DD 4A4AA 3GEIA 2JX0A 2Z15A 4NTAA 3U2MA 4BJ5C 4C3EA 2HUJA 1YA9A 3HNLA 4XLPF 4OIOF 2YHSA 1YARO 3LLIA 1E2XA 1M56C 1OCCC 2KK1A 2X51A 3K6BA 3NKDA 4DBRA 3Q6NA 1YLMA 1TFKB 2OJED 4JEAA 1D1BA 3ZVRA 1U6HA 4HE8D 5EGYA 3PHF2 2LP4A 1LPEA 4CS9C 3FMSA 1MMGA 1M2VA 1ZHZA 2AWCA 2NSGA 3ATPA 4NC3A 3RYLA 1E85A 1Z6AA 1XZPA 2PP4A 5FZTA 4BJ1A 3JRTA 1ZHXA 3NRHA 4EIYA 3JYYA 1L7CA 1VMAA 4IB4A 2A0BA 5JVEA 1A0BA 4E0HA 4K1OA 4YT2A 2A6HF 2EPOA 4J7YA 3W8IA 1ZW3A 5DS4A 1WN0A 1OW6A 3KYJA 5DQZA 1RCPA 4NY3A 3I5QA 4FAPB 5JT4A 1U0BB 3SP1A 3RKOF 1APCA 3G4ZA 4AX2A 5JRAA 4P6IC 3ZG1A 4LACB 2XL6A 1H9TA 4OIPF 3MYFA 5KYNA 4O7GA 3JSEO 4JE9A 3ABLC 1BDJB 3ZTZA 4LLEA 1HY5A 1NFOA 1T6IA 2OKUA 4NCQA 4XPYA 5F28E 2BC5A 2XSEA 2X0CA 2R7WA 1LVKA 2NUPB 3US6A 3EGXB 1YZCA 3MX3A 2WZGA 1S05A 3KPHA 4CJOA 3HNKA 4CX9A 2OEVA 1LS4A 1HW1A 4B6IA 2VH3A 2XLWA 3DE9A 2HV7A 3DI5A 1PD0A 3EZHA 2DB4A 2R25A 3QVZA 1LE2A 2HSBA 3UGOA 1J8MF 2XXAB 4XPWA 2J9VA 1PV3A 4KBLA 2YLIA 4FWVA 2OQMA 2VCBA 3FAJA 3KKBA 3KH2A
chains in the Genus database with same CATH topology
4GEHA 2CNWA 3RH3A 2L81A 4F4BA 2R7TA 3LEVA 3Q6MA 5CI9A 1VYKA 4YT5A 5F5HA 4YT8A 2JD3A 3AG3C 2D5RB 3UMKA 2PX0A 2DYSC 3EGDB 2G62A 2IOQA 4PFPA 4YWQA 1NU9C 2WZFA 3B9QA 3ITFA 3V7OA 3NYLA 4A2NB 5DVWA 3B0PA 4X0RA 2PF4E 4PFOA 3VAYA 2Q9AA 3UMHA 1M2VB 4RDAA 1VK5A 2R7OA 1SMYF 1SZIA 3K33A 5DQTA 4BJTA 2OCCC 4M63A 2EIMC 3DAFA 3K7DA 4LERA 1RJ9A 3ASNC 3DXJF 1IZMA 1OCOC 2ZXRA 1BR2A 4DOZA 2CNWD 2GFHA 3DD7A 1NU7D 4E7ZA 1S7ZA 4H4KC 3EG9A 4U5EE 1JPNA 4W8KA 1OCRC 2P6VA 4PJMA 2ZXPA 1ZHYA 2IXPA 3K1HA 4C3BA 4CSAC 3JYHA 1N1CA 2J9UA 2R7VA 3X2QC 4G7OF 1Z5ZA 2J46A 5T3TA 3SYNA 2R7RA 4Q7CA 1J8YF 3ECSA 2NUTA 3OEOA 4EWCA 3POVA 3OA1A 4U5BE 3H65A 2YZSA 3NYMA 4BJ6C 2MYSA 1FMVA 2HV6A 4FESA 4OD5A 4N06A 4AX2A 4ANJA 2XRHA 3EQLF 4I1OB 4I3MA 2R7UA 1ZYRF 3N24A 3LS0A 3GANA 3JCUQ 3EFOA 5B3SC 3MLGA 3S28A 1W2WA 4XWJA 4JW1A 1ZHTA 3LLKA 2NG1A 1ST6A 2W4BA 1V54C 3F47A 4U5DE 3ZSUA 5L3QA 2PX3A 5E2QA 3DJUB 3NG1A 4PK4A 3F46A 4IRUA 2EIJC 3DMDA 3AG4C 3I4UA 3S27A 3L0IA 2Q9CA 2IYLD 2WL8A 3LJBA 1NG1A 2WZLA 3VYWA 1QZXA 3EPVA 4I44A 4ULWA 3HLZA 4U5HA 3EHMA 3QMKA 2WVOA 3UR3C 1VYIA 3L34A 3W2WA 2EIKC 3AG1C 4JZAA 3HTKC 1TWAA 3SZRA 4HEAJ 2IXMA 1BR4A 4HFKB 2ZXWC 1Z63A 2R7QA 2KQ9A 3I5PA 5T3WA 3S0XA 3EG9B 1BR1A 2Y3DA 3T6JA 5KYUA 4DVZA 5KYXA 4J32B 4CIHA 1KU2A 4CS8C 5IY5C 3LS1A 1MNEA 1LKXA 5DS6A 2FFHA 2Y3GA 1O87A 2ZXOA 3DM9B 1M57C 3UGPA 4QI0A 4CSAA 4C7OA 2J0XA 4G7ZF 2O9XA 3LAYA 3CSKA 4XLNF 3ASOC 4IJJA 4WJ0A 2XL4A 3OWTA 5D92A 2OG2A 4IWBA 4BJ5A 2KGOA 1Z23A 5T1DB 3DJNB 4YT4A 4JURI 4CBEA 3N0TA 3KL4A 4ZLDA 2EINC 5KYWA 5F5FA 4CS9A 3AQCA 3E9VA 4KI2A 3SEOA 2J9WA 3EJNA 3S29A 4KNVA 4PJLA 3FDQA 1D1AA 4EBBA 4G7HF 3PMRA 3UMIA 2IXNA 5FCLA 4AK9A 1ZHWA 3Q7GA 2LSEA 2MWQA 2A6EF 3NYJA 3GODA 4PJNA 2G3VA 5B1BC 2NUPA 2R7XA 2WVNA 4RD9A 1FFHA 3NDBB 3EH1A 2YEVA 4JCHA 1MMNA 1G8XA 3RFYA 3UNGC 2A68F 1ZU5A 2V26A 4GYTA 5EHHA 3K1IC 2QY9A 5L3VA 3DZAA 4MNDA 5KYYA 1TKNA 1TR2A 1D0XA 4Q5SF 1MMDA 3KMIA 3WODF 4C7OB 4XTKA 2ZPAA 3E70C 2FGYA 3IEEA 5CI8A 2KW3C 4KNWA 2J0WA 4C3DA 2A69F 3O39A 4K7BA 4U5FE 5D91A 1OCZC 3M1CB 4U5CE 4K0DA 3T6BA 3FHDA 2V3CC 5KYWB 4RBNA 1ZU4A 3ABMC 3EZIA 3ZC4A 5BUOA 3DAGA 4JJGA 3W2VA 2H7BA 3W8HA 4DVYP 2VB6A 2M4EA 2Q9BA 1RJ9B 3EHNA 4Q4ZF 2BE5F 1IW7F 4AE4A 2J7PD 3TD7A 1FMWA 1LS1A 2L9JA 5B1AC 4HFFB 4KC9A 2Q3TA 2WB7A 1VOMA 2C03A 2H7VC 2DGJA 2DYRC 2WVQA 4J30B 4LLCA 4OIQF 1NZEA 1O5HA 1V55C 3FVYA 4JJFA 5E33A 4XLPF 3X1OA 2P7VA 3ZIBA 4I1MA 2KNHA 3WG7C 1PD1A 1D1CA 3QZCA 2CDQA 4QDLA 2NUTB 2CW0F 1D0ZA 2Y69C 4PJJA 1OKKA 3RIPA 4DBQA 2EILC 1MNDA 4BEJA 3EH2A 4O79A 4QI2A 4JVSA 1FTSA 2G3KA 5E3AA 2W4MA 2B0JA 1MMAA 4BJ6A 2QTVA 5KYYB 2PFDA 1TWHA 2Y3BA 4MQ9F 4BG0A 2E87A 4IAOA 3EFOB 2Y3HA 3LNRA 3JT1A 4FX5A 1TWGA 3SNHA 2CGEA 4OIRF 2VASA 5DLJA 2I8BA 1D0YA 2Y39A 4O6MA 4G0HA 2KJGA 4O6YA 3AQBA 1JPJA 3T4RA 3NKEA 2W45A 3ABKC 1PCXA 1SF8A 1OKKD 3JSZA 3LESA 4E7SA 3EGXA 2C04A 4U5GA 5DS5A 1Z3IX 1WGWA 3CZ6A 2R7SA 1M2OA 4YN0B 2XXAA 2H7OA 4AE4B 5HSWA 3B0UX 3Q7LA 2IXOA 3AG2C 2W9YA 5KYUB 5KYXB 3HJCA 4OD4A 4ZLCA 4YJWA 4OINF 3K66A 2J7PA 3N2ZB 4CS7A 4CS8A 3B0VC 1FFTC 3DM5A 2J45A 3CQZA 1TWCA 4O6NA 3EGDA 1QLEC 5E3CA 3O6XA 2A1DD 2Z15A 4C3EA 4BJ5C 4OIOF 2YHSA 3LLIA 3NKDA 1M56C 1OCCC 2X51A 3K6BA 4DBRA 3Q6NA 1D1BA 3ZVRA 4HE8D 5EGYA 3PHF2 4CS9C 1MMGA 1M2VA 1ZHZA 3RYLA 1Z6AA 2PP4A 4BJ1A 3JRTA 1ZHXA 3NRHA 1VMAA 4YT2A 2A6HF 3W8IA 5DS4A 5DQZA 4NY3A 3I5QA 3SP1A 3RKOF 4P6IC 3ZG1A 4LACB 4OIPF 5KYNA 4O7GA 3ABLC 4LLEA 2XSEA 2R7WA 1LVKA 2NUPB 3EGXB 3MX3A 2WZGA 4B6IA 2VH3A 2HV7A 1PD0A 3EZHA 2XXAB 3UGOA 1J8MF 2J9VA 4KBLA 4FWVA 3FAJA 3KKBA 3KH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZIB A;  4J30 B;  4J32 B;  4HFF B;  4AX2 A;  4B6I A;  4JUR I;  4HFK B; 
#chains in the Genus database with same CATH topology
 4GEH A;  4JTA B;  2CNW A;  1G4W R;  3GWL A;  1YDI A;  2DI3 A;  2HMQ A;  2L81 A;  3RH3 A;  4F4B A;  2R7T A;  3LEV A;  3Q6M A;  5CI9 A;  5A6A A;  1VYK A;  4YT5 A;  3ZTM A;  5F5H A;  4YT8 A;  2JD3 A;  3AG3 C;  4MW8 A;  3K1I A;  2D5R B;  3UMK A;  4WGZ A;  2PX0 A;  2DYS C;  3EGD B;  2L6H A;  2P0N A;  1CGO A;  2G62 A;  4N4W A;  2IOQ A;  1O3U A;  4W8P A;  4PFP A;  4YWQ A;  1NU9 C;  2AP3 A;  3S84 A;  3GM1 A;  5EK0 A;  3U2L A;  2XLD A;  4MTG A;  2WZF A;  3LNM B;  3B9Q A;  5L0I A;  3V5X A;  4NQF A;  2XM4 A;  3GWN A;  3ITF A;  5A6K A;  2A0U A;  3V7O A;  3NYL A;  1KTM A;  4A2N B;  2R03 A;  1JMW A;  4DRI B;  3HNJ A;  2GA0 A;  1JAF A;  3QW1 A;  5DVW A;  3B0P A;  4X0R A;  2PF4 E;  4N6H A;  1WAS A;  4DXW A;  4PFO A;  2Q00 A;  3VAY A;  1QVX A;  2Q9A A;  2KC3 A;  1M2V B;  3LEO A;  3UMH A;  4DRH B;  4RDA A;  4JKV A;  1VK5 A;  2R7O A;  1QSP A;  3PCV A;  1SMY F;  2QNL A;  1SZI A;  3K33 A;  5DQT A;  2KYH A;  5L0D A;  4BJT A;  1Q0F A;  3L8J A;  2OCC C;  1T5O A;  3IQ5 A;  4M63 A;  2EIM C;  3DAF A;  3K7D A;  4LER A;  4MVQ A;  1ZVZ A;  2YLG A;  1RJ9 A;  1FAP B;  3JRM O;  3ASN C;  1YVI A;  1IZM A;  3DXJ F;  4D4N A;  1OCO C;  2ZXR A;  1BR2 A;  4DOZ A;  2CNW D;  3T6G B;  2GFH A;  5A6J A;  3DD7 A;  2Q7R A;  1NU7 D;  3RQF A;  4E7Z A;  1JOG A;  1S7Z A;  4H4K C;  2XS8 A;  4IGG A;  4IAQ A;  1E86 A;  4XQ1 A;  3EG9 A;  4U5E E;  3FXH A;  2LK4 A;  1JPN A;  2AWY A;  4W8K A;  1OCR C;  3TOM A;  2P6V A;  1H7I A;  4LDR A;  2ZXP A;  4PJM A;  1V4A A;  2VC9 A;  1ZHY A;  2IXP A;  3K1H A;  1RMV A;  4NTF A;  4C3B A;  4CSA C;  2OEX A;  3JYH A;  1N1C A;  2J9U A;  4Z9J A;  2R7V A;  3FAP B;  4YL0 A;  3X2Q C;  4G7O F;  1JRA A;  1Z5Z A;  2HZ8 A;  3M4B A;  2J46 A;  5T3T A;  3SYN A;  2R7R A;  4Q7C A;  4LDQ A;  1J8Y F;  3DE8 A;  3ECS A;  2NUT A;  3OEO A;  4EWC A;  3POV A;  3OA1 A;  2RSE B;  4U5B E;  2QE9 A;  1OR2 A;  1UFB A;  3GM2 A;  3H65 A;  2YZS A;  3NYM A;  3M79 A;  3AGT A;  1KNY A;  3RF3 A;  4BJ6 C;  1YZA A;  3GOR A;  2OJQ A;  1G4U S;  1VTM P;  2MYS A;  1FMV A;  2HV6 A;  4FES A;  4OD5 A;  4N06 A;  1ZW2 A;  5GPG B;  3ZWI A;  4AL0 A;  2H8A A;  4ANJ A;  2CCY A;  2XRH A;  5L0H A;  1I4Z A;  1WOL A;  3C8G A;  4PAC A;  2YL1 A;  3EQL F;  4I3M A;  4I1O B;  4CDY A;  2R7U A;  1ZYR F;  3N24 A;  3DKA A;  3LS0 A;  3GAN A;  1MQV A;  1A41 A;  3JCU Q;  3TJ5 A;  4MVU A;  3EFO A;  5B3S C;  3U0C A;  1F1M A;  3MLG A;  3S28 A;  1W2W A;  4XWJ A;  4JW1 A;  3M15 A;  1ZHT A;  2NG1 A;  3LLK A;  1ST6 A;  2W4B A;  1V54 C;  4E17 A;  3F47 A;  4U5D E;  3ZSU A;  2UUH A;  2PX3 A;  5L3Q A;  256B A;  2BL2 A;  2M64 A;  3DJU B;  3B29 A;  5E2Q A;  3NG1 A;  4PK4 A;  3F46 A;  4IRU A;  1T9K A;  1E83 A;  2EIJ C;  2R05 A;  3MYI A;  4JEB A;  4BEM J;  3SXM A;  3DMD A;  3AG4 C;  3I4U A;  1B68 A;  1NLX A;  2LCH A;  3NMK A;  1OR3 A;  1XWJ A;  2AVK A;  3L0I A;  3S27 A;  2Q9C A;  4MTF A;  2IYL D;  1QKR A;  2WL8 A;  1NG1 A;  2WZL A;  3LJB A;  3VYW A;  1FNT c;  1QZX A;  3EPV A;  4I44 A;  4ULW A;  3HLZ A;  1QPU A;  4U5H A;  2HKV A;  1ORJ A;  3QVY A;  3EHM A;  3QMK A;  1VLS A;  2WVO A;  3UR3 C;  1VYI A;  3L34 A;  3W2W A;  2EIK C;  3AG1 C;  2YLD A;  4JZA A;  3HTK C;  1XZQ A;  1TWA A;  4MVM A;  3C7J A;  4XEK A;  2EPL X;  4MVO A;  4HEA J;  2IXM A;  1BR4 A;  4HFK B;  2ZXW C;  3G50 A;  3SZR A;  2PNO A;  1Z63 A;  3U9M A;  2YWA A;  1OXK A;  1AEP A;  2R7Q A;  3C8G D;  2KQ9 A;  3I5P A;  5T3W A;  2YL7 A;  4CJG A;  4EHP A;  3S0X A;  3EG9 B;  1BR1 A;  2Y3D A;  3T6J A;  3ZQY A;  2ETS A;  5KYU A;  4DVZ A;  1OQC A;  4CIP A;  1RKC A;  5L0G A;  5KYX A;  2L7A A;  4J32 B;  1FR0 A;  5B3I A;  1YJG A;  4CIH A;  1KU2 A;  5AGF A;  4CS8 C;  5IY5 C;  3LS1 A;  3SXY A;  1MNE A;  1LKX A;  5DS6 A;  2FFH A;  1K04 A;  3GEE A;  1HMD A;  2IM8 A;  2Y3G A;  4J7T A;  1O87 A;  2ZXO A;  4XPX A;  1G5Z A;  3DM9 B;  5COG A;  2FAP B;  1M57 C;  2XLV A;  1EQ1 A;  3UGP A;  1OXB A;  4JIO A;  1E84 A;  3C62 A;  2EPK X;  1GM5 A;  2OU6 A;  5CIV A;  4QI0 A;  3AGU A;  4CSA A;  3GEH A;  4C7O A;  3AOU A;  4N6C A;  4E0I A;  5L0F A;  3PDM P;  2J0X A;  4G7Z F;  2O9X A;  3LAY A;  2XS1 A;  3CSK A;  1BBH A;  3G4X A;  4XLN F;  3ASO C;  5JUA A;  4YL3 A;  1Q0G A;  4IJJ A;  4WJ0 A;  2XL4 A;  3OWT A;  5AC5 A;  5D92 A;  2OG2 A;  2HSQ A;  4IWB A;  1GQA A;  4BJ5 A;  2KGO A;  2LQG A;  1Z23 A;  3LUT B;  3U5S A;  2XLH A;  2Q4F A;  5T1D B;  2ZD9 A;  3DJN B;  3C8G B;  4YT4 A;  4JUR I;  4CBE A;  2HFI A;  3N0T A;  3KL4 A;  4ZLD A;  2EIN C;  2ICW G;  1Y6D A;  3JZ0 A;  5KYW A;  1ORY A;  3O55 A;  5F5F A;  1Q0M A;  1C03 A;  1HMO A;  4CS9 A;  3AQC A;  1CPR A;  3E9V A;  1L3P A;  4MW3 A;  1LI5 A;  3VF0 A;  2B0H A;  4P9F A;  4KI2 A;  3VM6 A;  3SEO A;  3C8Z A;  1T01 A;  1ORS C;  4D4X A;  4EBK A;  4EKW A;  2J9W A;  3EJN A;  4NTB A;  3S29 A;  4KNV A;  4PJL A;  3VRC A;  3ZDL A;  2YVK A;  3FDQ A;  2CYD A;  1RKE A;  2MHR A;  1D1A A;  2OOC A;  2YKZ A;  3CAX A;  3MBG A;  3O10 A;  4EBB A;  3CEX A;  3PMR A;  4G7H F;  3UMI A;  1CGM E;  2IXN A;  3U8V A;  1K05 A;  2LFF A;  3R7C A;  5FCL A;  4EBJ A;  4AK9 A;  1GS9 A;  2HJ3 A;  1ZHW A;  2R9R B;  3H2U A;  3Q7G A;  4PR9 A;  2LSE A;  5JS5 A;  2MWQ A;  2A6E F;  3NMJ A;  3NYJ A;  3GOD A;  1I4Y A;  5BQI A;  4LLC A;  4PJN A;  1OW8 A;  2G3V A;  2HMZ A;  5B1B C;  2LFD A;  2NPU A;  2NUP A;  2P1A A;  2R7X A;  2HJM A;  3SXK A;  2WVN A;  2RD9 A;  4P9T A;  4RD9 A;  1ZZP A;  1FFH A;  1SYQ A;  3EH1 A;  4U9D A;  2YEV A;  3NDB B;  4JCH A;  1YA7 O;  5COF A;  1MMN A;  3HNI A;  3RVZ A;  1I5N A;  1G8X A;  3RFY A;  4UDV A;  3UNG C;  2A68 F;  1H9G A;  1ZU5 A;  2V26 A;  1LI7 A;  1DOV A;  4YL1 A;  4AL1 A;  3GM3 A;  1CGN A;  4GYT A;  5EHH A;  4G78 A;  3K1I C;  2QY9 A;  1H6G A;  2XLE A;  3B71 A;  4BPM A;  2J9B A;  5L3V A;  1CPQ A;  3DZA A;  4MND A;  2R02 A;  4JTC B;  2XM0 A;  2GDC A;  5KYY A;  1TFO B;  4Z9H A;  1TKN A;  5L0C A;  1C17 M;  1TR2 A;  1D0X A;  1YYX A;  1MMD A;  4Q5S F;  3KMI A;  2F22 A;  3WOD F;  3AJM A;  4C7O B;  3C63 A;  3MFN A;  4XTK A;  4U9E A;  1A7E A;  3RQG A;  2ZPA A;  3E70 C;  2FGY A;  3IEE A;  3IQT A;  5CI8 A;  2KW3 C;  4KNW A;  3J06 A;  2J0W A;  2D4U A;  3C18 A;  4C3D A;  4ONS A;  2A69 F;  5A6B A;  3O39 A;  4EUK B;  4K7B A;  4U5F E;  3ZQV A;  5HV9 A;  4E18 A;  5D91 A;  1OCZ C;  1A7V A;  1U89 A;  3FOP A;  1WAT A;  3KYI A;  1AVO B;  3M1C B;  4U5C E;  4K0D A;  3T6B A;  3FHD A;  2V3C C;  1K40 A;  2HS5 A;  5KYW B;  4RBN A;  3JTL O;  3IPM O;  1GGQ A;  5JP7 A;  1ZU4 A;  3ABM C;  3EZI A;  4MTO A;  4R32 A;  3ZC4 A;  5BUO A;  3DAG A;  1LIH A;  4JJG A;  3W2V A;  3FOO A;  2H7B A;  1V74 B;  3W8H A;  4DVY P;  1YAU O;  2VB6 A;  2M4E A;  3T9O A;  2KSF A;  2Q9B A;  1RJ9 B;  2I15 A;  3EHN A;  4JTD B;  4Q4Z F;  1RXQ A;  2BE5 F;  2XL8 A;  3QW0 A;  3RVY A;  1IW7 F;  1RKE B;  4AE4 A;  4MS2 A;  4LDK A;  2J7P D;  1WWP A;  3R2P A;  3TD7 A;  1EI7 A;  1FMW A;  1LS1 A;  2L9J A;  2LIG A;  5B1A C;  3U8P A;  3BEH A;  4HFF B;  4KC9 A;  5AC4 A;  2Q3T A;  4MVZ A;  2WB7 A;  2YL0 A;  1VOM A;  2C03 A;  2H7V C;  2UUI A;  2DGJ A;  2EPN A;  3TK0 A;  2DYR C;  2WVQ A;  3W4Y A;  4J30 B;  1TQG A;  1OW7 A;  1NZE A;  1O5H A;  1V55 C;  3FVY A;  3HKK A;  1BZ4 A;  3NMI A;  3QTH A;  4JJF A;  5E33 A;  1EA8 A;  3U3F A;  3X1O A;  2P7V A;  1NSG B;  1NFN A;  2XLO A;  4I1M A;  3ZIB A;  2KNH A;  3WG7 C;  1HE9 A;  2QLA A;  3SXZ A;  5A6B D;  1PD1 A;  1VLT A;  1D1C A;  2PBE A;  4H54 A;  3V5Z A;  3QZC A;  2CDQ A;  4QDL A;  2NUT B;  2CW0 F;  1D0Z A;  2Y69 C;  3IHU A;  1OKK A;  2QUP A;  4PJJ A;  5BQG A;  1C02 A;  2TMV P;  3RIP A;  3U9J A;  5JSL A;  4DBQ A;  2EIL C;  4CDA A;  1MND A;  4Z9I A;  2VCA A;  4IAR A;  4BEJ A;  3EH2 A;  4JCZ A;  4O79 A;  5L0J A;  4L6R A;  2GWW A;  4QI2 A;  4JVS A;  3BRJ A;  1FTS A;  2G3K A;  3IQC A;  4ULV A;  1UG7 A;  5E3A A;  2W4M A;  2B0J A;  1MMA A;  4BJ6 A;  2QTV A;  5KYY B;  1JR8 A;  3L1M A;  2PFD A;  2ASR A;  1TWH A;  2Y3B A;  5BQH A;  4MQ9 F;  3V5Y A;  2NSF A;  4BG0 A;  2E87 A;  2L6F A;  2LD6 A;  3EFO B;  2IBF A;  2VCC A;  4IAO A;  2Y3H A;  1R4T A;  3LNR A;  3JT1 A;  1T6Q A;  3WHN A;  4FX5 A;  1TWG A;  3SNH A;  2CGE A;  4OIR F;  2VAS A;  5DLJ A;  1AUE A;  5K0I A;  2I8B A;  1HW2 A;  1R5I D;  1D0Y A;  2EPM X;  2J8W A;  2Y39 A;  1QQ3 A;  4G0H A;  4O6M A;  2KJG A;  4O6Y A;  2JPU A;  5A69 A;  1EKY A;  3AQB A;  1Y4C A;  4GQH A;  3L8I A;  1A7D A;  1Q0K A;  1YYJ A;  3A9C A;  3IQ6 A;  1JPJ A;  2YRF A;  4JC7 A;  3WAQ A;  3T4R A;  3NKE A;  4OIQ F;  3TJ6 A;  2P61 A;  2W45 A;  1M6T A;  4MVR A;  5JLI A;  3ABK C;  1PCX A;  1SF8 A;  1OKK D;  3JSZ A;  3LES A;  4E7S A;  3EGX A;  2L6G A;  2C04 A;  4JRZ A;  4WAB A;  3M4C A;  4WGY A;  4DJ9 A;  4U5G A;  4CDV A;  1Z3I X;  5DS5 A;  1WGW A;  3CZ6 A;  2XLM A;  3DWW A;  3S9O A;  2R7S A;  1SR2 A;  3U3B A;  1WTY A;  1Q0D A;  1M2O A;  4YN0 B;  3TQO A;  2XXA A;  2H7O A;  4AE4 B;  2YQY A;  5HSW A;  1T6U A;  3B0U X;  3Q7L A;  2IXO A;  3AG2 C;  3RW0 A;  1HE1 A;  1VB5 A;  2W9Y A;  4XEF A;  5KYU B;  5KYX B;  3HJC A;  4OD4 A;  4ZLC A;  3RQE A;  2YL3 A;  4DRJ B;  4YJW A;  1Z7Q c;  3TOL A;  3A11 A;  4XEV A;  4OIN F;  2GAQ A;  3K66 A;  5TJ5 E;  2J7P A;  4YK5 A;  4ER9 A;  3N2Z B;  4CS7 A;  3H2V A;  4MVS A;  4CS8 A;  3TUL A;  1LM3 B;  3S90 A;  3B0V C;  1FFT C;  3DM5 A;  2J45 A;  1DOW A;  1TWC A;  3CQZ A;  3EGD A;  4O6N A;  5COM A;  1QLE C;  1NBB A;  3O6X A;  5E3C A;  2AU5 A;  1LE4 A;  2A1D D;  4A4A A;  3GEI A;  2JX0 A;  2Z15 A;  4NTA A;  3U2M A;  4BJ5 C;  4C3E A;  2HUJ A;  1YA9 A;  3HNL A;  4XLP F;  4OIO F;  2YHS A;  1YAR O;  3LLI A;  1E2X A;  1M56 C;  1OCC C;  2KK1 A;  2X51 A;  3K6B A;  3NKD A;  4DBR A;  3Q6N A;  1YLM A;  1TFK B;  2OJE D;  4JEA A;  1D1B A;  3ZVR A;  1U6H A;  4HE8 D;  5EGY A;  3PHF 2;  2LP4 A;  1LPE A;  4CS9 C;  3FMS A;  1MMG A;  1M2V A;  1ZHZ A;  2AWC A;  2NSG A;  3ATP A;  4NC3 A;  3RYL A;  1E85 A;  1Z6A A;  1XZP A;  2PP4 A;  5FZT A;  4BJ1 A;  3JRT A;  1ZHX A;  3NRH A;  4EIY A;  3JYY A;  1L7C A;  1VMA A;  4IB4 A;  2A0B A;  5JVE A;  1A0B A;  4E0H A;  4K1O A;  4YT2 A;  2A6H F;  2EPO A;  4J7Y A;  3W8I A;  1ZW3 A;  5DS4 A;  1WN0 A;  1OW6 A;  3KYJ A;  5DQZ A;  1RCP A;  4NY3 A;  3I5Q A;  4FAP B;  5JT4 A;  1U0B B;  3SP1 A;  3RKO F;  1APC A;  3G4Z A;  4AX2 A;  5JRA A;  4P6I C;  3ZG1 A;  4LAC B;  2XL6 A;  1H9T A;  4OIP F;  3MYF A;  5KYN A;  4O7G A;  3JSE O;  4JE9 A;  3ABL C;  1BDJ B;  3ZTZ A;  4LLE A;  1HY5 A;  1NFO A;  1T6I A;  2OKU A;  4NCQ A;  4XPY A;  5F28 E;  2BC5 A;  2XSE A;  2X0C A;  2R7W A;  1LVK A;  2NUP B;  3US6 A;  3EGX B;  1YZC A;  3MX3 A;  2WZG A;  1S05 A;  3KPH A;  4CJO A;  3HNK A;  4CX9 A;  2OEV A;  1LS4 A;  1HW1 A;  4B6I A;  2VH3 A;  2XLW A;  3DE9 A;  2HV7 A;  3DI5 A;  1PD0 A;  3EZH A;  2DB4 A;  2R25 A;  3QVZ A;  1LE2 A;  2HSB A;  3UGO A;  1J8M F;  2XXA B;  4XPW A;  2J9V A;  1PV3 A;  4KBL A;  2YLI A;  4FWV A;  2OQM A;  2VCB A;  3FAJ A;  3KKB A;  3KH2 A; 
#chains in the Genus database with same CATH homology
 4GEH A;  2CNW A;  3RH3 A;  2L81 A;  4F4B A;  2R7T A;  3LEV A;  3Q6M A;  5CI9 A;  1VYK A;  4YT5 A;  5F5H A;  4YT8 A;  2JD3 A;  3AG3 C;  2D5R B;  3UMK A;  2PX0 A;  2DYS C;  3EGD B;  2G62 A;  2IOQ A;  4PFP A;  4YWQ A;  1NU9 C;  2WZF A;  3B9Q A;  3ITF A;  3V7O A;  3NYL A;  4A2N B;  5DVW A;  3B0P A;  4X0R A;  2PF4 E;  4PFO A;  3VAY A;  2Q9A A;  3UMH A;  1M2V B;  4RDA A;  1VK5 A;  2R7O A;  1SMY F;  1SZI A;  3K33 A;  5DQT A;  4BJT A;  2OCC C;  4M63 A;  2EIM C;  3DAF A;  3K7D A;  4LER A;  1RJ9 A;  3ASN C;  3DXJ F;  1IZM A;  1OCO C;  2ZXR A;  1BR2 A;  4DOZ A;  2CNW D;  2GFH A;  3DD7 A;  1NU7 D;  4E7Z A;  1S7Z A;  4H4K C;  3EG9 A;  4U5E E;  1JPN A;  4W8K A;  1OCR C;  2P6V A;  4PJM A;  2ZXP A;  1ZHY A;  2IXP A;  3K1H A;  4C3B A;  4CSA C;  3JYH A;  1N1C A;  2J9U A;  2R7V A;  3X2Q C;  4G7O F;  1Z5Z A;  2J46 A;  5T3T A;  3SYN A;  2R7R A;  4Q7C A;  1J8Y F;  3ECS A;  2NUT A;  3OEO A;  4EWC A;  3POV A;  3OA1 A;  4U5B E;  3H65 A;  2YZS A;  3NYM A;  4BJ6 C;  2MYS A;  1FMV A;  2HV6 A;  4FES A;  4OD5 A;  4N06 A;  4AX2 A;  4ANJ A;  2XRH A;  3EQL F;  4I1O B;  4I3M A;  2R7U A;  1ZYR F;  3N24 A;  3LS0 A;  3GAN A;  3JCU Q;  3EFO A;  5B3S C;  3MLG A;  3S28 A;  1W2W A;  4XWJ A;  4JW1 A;  1ZHT A;  3LLK A;  2NG1 A;  1ST6 A;  2W4B A;  1V54 C;  3F47 A;  4U5D E;  3ZSU A;  5L3Q A;  2PX3 A;  5E2Q A;  3DJU B;  3NG1 A;  4PK4 A;  3F46 A;  4IRU A;  2EIJ C;  3DMD A;  3AG4 C;  3I4U A;  3S27 A;  3L0I A;  2Q9C A;  2IYL D;  2WL8 A;  3LJB A;  1NG1 A;  2WZL A;  3VYW A;  1QZX A;  3EPV A;  4I44 A;  4ULW A;  3HLZ A;  4U5H A;  3EHM A;  3QMK A;  2WVO A;  3UR3 C;  1VYI A;  3L34 A;  3W2W A;  2EIK C;  3AG1 C;  4JZA A;  3HTK C;  1TWA A;  3SZR A;  4HEA J;  2IXM A;  1BR4 A;  4HFK B;  2ZXW C;  1Z63 A;  2R7Q A;  2KQ9 A;  3I5P A;  5T3W A;  3S0X A;  3EG9 B;  1BR1 A;  2Y3D A;  3T6J A;  5KYU A;  4DVZ A;  5KYX A;  4J32 B;  4CIH A;  1KU2 A;  4CS8 C;  5IY5 C;  3LS1 A;  1MNE A;  1LKX A;  5DS6 A;  2FFH A;  2Y3G A;  1O87 A;  2ZXO A;  3DM9 B;  1M57 C;  3UGP A;  4QI0 A;  4CSA A;  4C7O A;  2J0X A;  4G7Z F;  2O9X A;  3LAY A;  3CSK A;  4XLN F;  3ASO C;  4IJJ A;  4WJ0 A;  2XL4 A;  3OWT A;  5D92 A;  2OG2 A;  4IWB A;  4BJ5 A;  2KGO A;  1Z23 A;  5T1D B;  3DJN B;  4YT4 A;  4JUR I;  4CBE A;  3N0T A;  3KL4 A;  4ZLD A;  2EIN C;  5KYW A;  5F5F A;  4CS9 A;  3AQC A;  3E9V A;  4KI2 A;  3SEO A;  2J9W A;  3EJN A;  3S29 A;  4KNV A;  4PJL A;  3FDQ A;  1D1A A;  4EBB A;  4G7H F;  3PMR A;  3UMI A;  2IXN A;  5FCL A;  4AK9 A;  1ZHW A;  3Q7G A;  2LSE A;  2MWQ A;  2A6E F;  3NYJ A;  3GOD A;  4PJN A;  2G3V A;  5B1B C;  2NUP A;  2R7X A;  2WVN A;  4RD9 A;  1FFH A;  3NDB B;  3EH1 A;  2YEV A;  4JCH A;  1MMN A;  1G8X A;  3RFY A;  3UNG C;  2A68 F;  1ZU5 A;  2V26 A;  4GYT A;  5EHH A;  3K1I C;  2QY9 A;  5L3V A;  3DZA A;  4MND A;  5KYY A;  1TKN A;  1TR2 A;  1D0X A;  4Q5S F;  1MMD A;  3KMI A;  3WOD F;  4C7O B;  4XTK A;  2ZPA A;  3E70 C;  2FGY A;  3IEE A;  5CI8 A;  2KW3 C;  4KNW A;  2J0W A;  4C3D A;  2A69 F;  3O39 A;  4K7B A;  4U5F E;  5D91 A;  1OCZ C;  3M1C B;  4U5C E;  4K0D A;  3T6B A;  3FHD A;  2V3C C;  5KYW B;  4RBN A;  1ZU4 A;  3ABM C;  3EZI A;  3ZC4 A;  5BUO A;  3DAG A;  4JJG A;  3W2V A;  2H7B A;  3W8H A;  4DVY P;  2VB6 A;  2M4E A;  2Q9B A;  1RJ9 B;  3EHN A;  4Q4Z F;  2BE5 F;  1IW7 F;  4AE4 A;  2J7P D;  3TD7 A;  1FMW A;  1LS1 A;  2L9J A;  5B1A C;  4HFF B;  4KC9 A;  2Q3T A;  2WB7 A;  1VOM A;  2C03 A;  2H7V C;  2DGJ A;  2DYR C;  2WVQ A;  4J30 B;  4LLC A;  4OIQ F;  1NZE A;  1O5H A;  1V55 C;  3FVY A;  4JJF A;  5E33 A;  4XLP F;  3X1O A;  2P7V A;  3ZIB A;  4I1M A;  2KNH A;  3WG7 C;  1PD1 A;  1D1C A;  3QZC A;  2CDQ A;  4QDL A;  2NUT B;  2CW0 F;  1D0Z A;  2Y69 C;  4PJJ A;  1OKK A;  3RIP A;  4DBQ A;  2EIL C;  1MND A;  4BEJ A;  3EH2 A;  4O79 A;  4QI2 A;  4JVS A;  1FTS A;  2G3K A;  5E3A A;  2W4M A;  2B0J A;  1MMA A;  4BJ6 A;  2QTV A;  5KYY B;  2PFD A;  1TWH A;  2Y3B A;  4MQ9 F;  4BG0 A;  2E87 A;  4IAO A;  3EFO B;  2Y3H A;  3LNR A;  3JT1 A;  4FX5 A;  1TWG A;  3SNH A;  2CGE A;  4OIR F;  2VAS A;  5DLJ A;  2I8B A;  1D0Y A;  2Y39 A;  4O6M A;  4G0H A;  2KJG A;  4O6Y A;  3AQB A;  1JPJ A;  3T4R A;  3NKE A;  2W45 A;  3ABK C;  1PCX A;  1SF8 A;  1OKK D;  3JSZ A;  3LES A;  4E7S A;  3EGX A;  2C04 A;  4U5G A;  5DS5 A;  1Z3I X;  1WGW A;  3CZ6 A;  2R7S A;  1M2O A;  4YN0 B;  2XXA A;  2H7O A;  4AE4 B;  5HSW A;  3B0U X;  3Q7L A;  2IXO A;  3AG2 C;  2W9Y A;  5KYU B;  5KYX B;  3HJC A;  4OD4 A;  4ZLC A;  4YJW A;  4OIN F;  3K66 A;  2J7P A;  3N2Z B;  4CS7 A;  4CS8 A;  3B0V C;  1FFT C;  3DM5 A;  2J45 A;  3CQZ A;  1TWC A;  4O6N A;  3EGD A;  1QLE C;  5E3C A;  3O6X A;  2A1D D;  2Z15 A;  4C3E A;  4BJ5 C;  4OIO F;  2YHS A;  3LLI A;  3NKD A;  1M56 C;  1OCC C;  2X51 A;  3K6B A;  4DBR A;  3Q6N A;  1D1B A;  3ZVR A;  4HE8 D;  5EGY A;  3PHF 2;  4CS9 C;  1MMG A;  1M2V A;  1ZHZ A;  3RYL A;  1Z6A A;  2PP4 A;  4BJ1 A;  3JRT A;  1ZHX A;  3NRH A;  1VMA A;  4YT2 A;  2A6H F;  3W8I A;  5DS4 A;  5DQZ A;  4NY3 A;  3I5Q A;  3SP1 A;  3RKO F;  4P6I C;  3ZG1 A;  4LAC B;  4OIP F;  5KYN A;  4O7G A;  3ABL C;  4LLE A;  2XSE A;  2R7W A;  1LVK A;  2NUP B;  3EGX B;  3MX3 A;  2WZG A;  4B6I A;  2VH3 A;  2HV7 A;  1PD0 A;  3EZH A;  2XXA B;  3UGO A;  1J8M F;  2J9V A;  4KBL A;  4FWV A;  3FAJ A;  3KKB A;  3KH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...