3ZIBA

Rap2a protein (sma2265) from serratia marcescens
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
92
Chain Sequence
b'TYTPEEYLKNYALSVCIAEGYSAKEVKNDAAAAARGYTEFGDYSLEAHTAVRALAKEFLAKPYDSSGEPMTMAKCIDLVHSQELQAIIKKYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAP2A SMA2265
publication title Structural Basis for Type Vi Secreted Peptidoglycan Dl-Endopeptidase Function, Specificity and Neutralization in Serratia Marcescens
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Protein binding
total genus 35
structure length 92
sequence length 93
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1620 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3zibA00
4J30B 4HFFB 3ZIBA 4B6IA 4JURI 4AX2A 4J32B 4HFKB
chains in the Genus database with same CATH superfamily
1OCCC 5FCLA 2P7VA 4AL1A 4IGGA 1BDJB 3U9JA 2XLWA 3U8VA 3T4RA 1S05A 3ZDLA 1Z63A 1U6HA 3K66A 2RSEB 4MW3A 1AVOB 4XTKA 5COFA 4MVMA 2G62A 3ZQYA 2J9VA 3RVYA 2IXPA 4PJMA 2LP4A 3B9QA 1Q0GA 4JKVA 2XSEA 3RIPA 3DAGA 3EFOA 3N0TA 2HV7A 1D0YA 4YJWA 3VM6A 4YL3A 3LNMB 5GPGB 4CS9C 4JCHA 5BQHA 4N6HA 4O7GA 1LS4A 1VLTA 4JTCB 2J0XA 1IZMA 2VCCA 3DMDA 5COGA 5DLJA 1RKCA 1VK5A 2WVNA 2ETSA 3CSKA 3FOOA 3K1IC 3NYLA 1PV3A 4JJFA 3KYJA 1OR2A 2J9BA 4HFFB 4CDVA 4ZLCA 5L0HA 4G7ZF 2QTVA 5A6BA 4IWBA 2AWCA 3B71A 4U5GA 5COMA 4EHPA 5HV9A 3B0VC 3UMHA 3AG3C 3ZSUA 3POVA 4NY3A 4P9TA 2CGEA 1T6UA 4CSAA 2X51A 1DOWA 1YARO 2XM0A 4OD5A 3U5SA 4NCQA 2EIJC 3FAPB 1ZHXA 4O6MA 3MLGA 5CI8A 5TJ5E 4EKWA 1JOGA 1GQAA 2FGYA 3DM9B 4CDAA 3S28A 3S84A 1A0BA 3IQ5A 3ABKC 4PJLA 2R03A 2GFHA 3RFYA 3WAQA 3EQLF 1YJGA 3EGXA 2A1DD 3W2WA 5F28E 3RYLA 3ZC4A 4C7OA 4K0DA 1ZVZA 3U9MA 2L81A 2UUIA 3LEOA 3T6BA 1G4WR 2J8WA 5BQGA 2A0UA 3GODA 4CDYA 2VH3A 3QZCA 1TWAA 2EIMC 3SXMA 1CGNA 2EPLX 2OQMA 2LFFA 2PNOA 4LLEA 3U3FA 3RW0A 4IAQA 1Z23A 1RKEA 3S0XA 2EIKC 4E7SA 1Q0MA 2XLEA 1T9KA 2HS5A 1FNTc 3SXYA 1NZEA 2KYHA 3L8IA 4LDQA 2ZXRA 3TULA 2R7WA 3IQTA 3IPMO 4JVSA 2OCCC 1TKNA 3VAYA 2BE5F 5L0DA 3UR3C 5AC4A 2H7OA 1Z6AA 4JTAB 4E7ZA 1LE2A 4YWQA 3G50A 2NUTA 3RQEA 5DQTA 2L6HA 2JD3A 3SP1A 3N24A 1WTYA 1TWHA 3T6JA 1TR2A 3LNRA 3GM1A 4PR9A 1E86A 1OKKD 1OXBA 3RF3A 2WZFA 2IM8A 1VYIA 2Q3TA 3MYFA 5DS4A 1ZHTA 5KYXB 2GAQA 4MVSA 5FZTA 3UGPA 1MNDA 4QI2A 4DRHB 4G0HA 2R02A 1RCPA 4DVYP 3L1MA 1OW6A 3KMIA 1SZIA 1NFNA 3RVZA 4DVZA 4KNWA 1T01A 3TJ6A 4MTGA 4HFKB 2OU6A 3EPVA 2EPNA 1E84A 5DS6A 2LSEA 3NMKA 4PFPA 1YZAA 3ZIBA 2H7BA 2IXNA 4NQFA 1UG7A 3TD7A 3U3BA 1WWPA 2HMQA 4U9DA 2KNHA 2R7RA 3K6BA 2DGJA 2J7PA 4XPYA 1WOLA 1V74B 3C8GA 3E70C 4O6YA 3J06A 2OJED 1OCZC 4J7TA 2WL8A 3L0IA 1QZXA 1NG1A 2A6HF 2KW3C 2PX3A 3T6GB 4I1OB 3JYHA 2R25A 2NPUA 1C03A 1BR4A 1YYJA 2I8BA 1YLMA 4CS7A 3GWNA 2YZSA 3H2VA 2WZLA 5B1AC 4JCZA 4CS9A 3NKEA 3KPHA 2OOCA 4DXWA 2Q7RA 3CZ6A 3TQOA 5HSWA 3LEVA 3O55A 4MTOA 2HJMA 5E3AA 3F46A 3N2ZB 2IOQA 2R05A 2CCYA 2R7TA 1NSGB 1FMVA 3K1IA 1A41A 2R7XA 1APCA 4AX2A 2NSFA 1YYXA 4XLPF 4ER9A 3EGDA 1Z3IX 3JSZA 4E18A 1G8XA 1SYQA 2ZXOA 4N4WA 3EJNA 1HE1A 2IBFA 4MTFA 2Q00A 4J32B 3NMIA 4Z9HA 1EKYA 3AQBA 2J9UA 1F1MA 1LIHA 3GM2A 3ITFA 2XLMA 3SXKA 2H8AA 2R7OA 3V5ZA 1A7VA 1YZCA 5K0IA 2XLHA 5JT4A 3PDMP 3O6XA 2LQGA 4I44A 1Z5ZA 4PACA 3UMKA 5A6AA 3H65A 4LLCA 2EPKX 5KYWA 3LLIA 4UDVA 2L9JA 4ULWA 4U9EA 1HMOA 1N1CA 1G5ZA 4GYTA 4AE4B 1QPUA 1K40A 3TJ5A 1Y4CA 2W45A 4L6RA 3GORA 2L6FA 2KK1A 5JLIA 2AWYA 4X0RA 4EBJA 3IQCA 1JPJA 1H7IA 1D0XA 5L0IA 1UFBA 1H6GA 1ZU4A 3CAXA 4IJJA 5JP7A 3VRCA 2YLIA 3S90A 1M2VB 2ICWG 3NKDA 5T3TA 3BEHA 3C62A 4A4AA 4MS2A 2YL7A 2HUJA 2Y3GA 1MMDA 1SR2A 2G3VA 2G3KA 2KQ9A 3SNHA 3G4XA 4NC3A 1BBHA 1NFOA 1I5NA 2O9XA 1TWGA 2ZPAA 3DJUB 2MYSA 2QE9A 4FWVA 4LERA 4MW8A 4BEMJ 5F5FA 3Q7LA 2LD6A 4A2NB 3RQFA 1E83A 3NMJA 2HFIA 5KYNA 3U2MA 1H9TA 4DJ9A 4XQ1A 4JE9A 2VASA 2UUHA 2XLOA 3TOMA 4ZLDA 1QQ3A 1U89A 5KYUB 2V26A 2Q9AA 2H7VC 4OIQF 3IHUA 2PFDA 2YL0A 4PJNA 3O39A 4BJ5C 3PHF2 2D5RB 1NLXA 4J7YA 2TMVP 3X1OA 2F22A 1VOMA 2VCAA 3AJMA 3AOUA 3K7DA 4RDAA 4BJ6C 3DWWA 1C02A 4B6IA 2IXMA 2LFDA 4KI2A 4R32A 1LS1A 4PFOA 4YL1A 2YEVA 3O10A 3GEHA 1I4YA 3FXHA 4K1OA 4AL0A 1T5OA 3AGTA 4EUKB 3EFOB 3E9VA 3LJBA 3MX3A 2Q4FA 2AU5A 3HNJA 1QLEC 1XWJA 4Q5SF 3ECSA 3NG1A 1D1CA 1GGQA 4ULVA 3ASOC 5A6BD 1ZU5A 3GANA 3B0PA 4YT2A 4XLNF 1BZ4A 4U5HA 3C18A 2ASRA 4XEFA 5EK0A 4Q4ZF 1HW2A 2R7UA 4XPXA 2NUPA 4QI0A 2L6GA 1NU9C 4YL0A 1OXKA 1RJ9A 3JT1A 4JZAA 5D92A 3GM3A 5T1DB 2WVOA 2WB7A 4IB4A 4MVRA 4DBRA 2KSFA 3V7OA 2JX0A 3LLKA 3QW0A 3DE9A 4BJTA 1W2WA 2EPOA 4K7BA 4G7OF 4D4NA 2M64A 1FMWA 3MFNA 4N6CA 2AVKA 2R7QA 4CJGA 1WN0A 1LI5A 3UMIA 3EGXB 1TFOB 3LS0A 3GEEA 3LUTB 4C7OB 1QVXA 2KJGA 3M1CB 3I5PA 4JEAA 1LE4A 2XL6A 1CGOA 3C7JA 3B29A 5DVWA 3ABLC 4G78A 2Q9BA 1GM5A 2GDCA 3FVYA 3MYIA 1OW8A 1M6TA 1ORSC 3H2UA 4EBBA 3NDBB 4YN0B 5JS5A 3G4ZA 5BUOA 1GS9A 4U5EE 5CI9A 5L0GA 4F4BA 2XXAA 3U0CA 2OG2A 5EHHA 1RKEB 4MVQA 1OCRC 1L3PA 4XPWA 2HZ8A 2PBEA 2XRHA 5A69A 2KC3A 1R5ID 4DOZA 1V55C 1YAUO 2I15A 3NYJA 1YDIA 3EH2A 4DBQA 2W4MA 1V4AA 3QVYA 3NRHA 1DOVA 1E2XA 1JR8A 4GQHA 3TK0A 4BPMA 2DYSC 1M57C 4E17A 3UNGC 2OKUA 2Y69C 2NUTB 1QSPA 2W4BA 3ZQVA 1ORYA 1S7ZA 2W9YA 4FX5A 2EPMX 4KNVA 1L7CA 3V5YA 3RKOF 3LS1A 3WG7C 3RQGA 5L3VA 4E0IA 2PF4E 4H54A 5L0CA 2VC9A 2Y3HA 4CIHA 3KKBA 1LVKA 4HE8D 3JYYA 3US6A 2V3CC 4YK5A 2LIGA 1A7DA 1Q0DA 2XS8A 3HNLA 3A9CA 1OQCA 1JRAA 1ORJA 2J7PD 4IARA 4PJJA 4JEBA 3C8GD 3ZTZA 3IEEA 5E2QA 1OR3A 1EA8A 2XL4A 1XZQA 1LKXA 1MMNA 1Y6DA 2J45A 4RBNA 4XEVA 1TWCA 5E3CA 2C04A 3C8GB 4IAOA 4YT5A 4OINF 5F5HA 4IRUA 4BJ5A 4LACB 2A68F 3QTHA 4Q7CA 3EZIA 3VYWA 4BJ6A 3KH2A 5JSLA 1D1BA 1CPQA 4C3EA 4DRJB 5L0FA 2YL3A 4U5BE 4NTBA 1LM3B 1MMAA 2FFHA 5BQIA 4EWCA 2EILC 3EG9A 4O79A 3HKKA 3M79A 3U2LA 2B0HA 1G4US 1C17M 1XZPA 1ZW2A 2VCBA 4XEKA 3A11A 4D4XA 5EGYA 3U8PA 2WZGA 2GA0A 4RD9A 3CEXA 3SYNA 1YA7O 3DD7A 2XL8A 1JMWA 1VLSA 1TQGA 1LI7A 2RD9A 2CDQA 1YA9A 3L34A 2XLDA 2YL1A 1J8MF 3W8HA 1QKRA 3HNIA 2QY9A 1PD0A 5T3WA 3CQZA 2HSBA 2CNWA 3V5XA 3EGDB 3Q6NA 3QMKA 4GEHA 1EQ1A 1NBBA 2R9RB 2M4EA 1FFHA 4HEAJ 4OIPF 1FAPB 2ZXPA 3UGOA 1TFKB 1HW1A 2BC5A 2HKVA 4WJ0A 3ZTMA 3C8ZA 4FAPB 1Q0KA 4CS8C 3QW1A 3DKAA 4P6IC 3R7CA 5KYWB 4N06A 4W8PA 5AC5A 5JVEA 4JRZA 2IYLD 3EH1A 3JRTA 2NG1A 2Y3DA 3M15A 5JUAA 1T6QA 2R7VA 4O6NA 2ZD9A 4WABA 2KGOA 1VB5A 2Z15A 3ABMC 4KBLA 4LDKA 1O3UA 3AG2C 3GWLA 1FFTC 2XS1A 3ZWIA 3PMRA 3X2QC 3EG9B 1WASA 2DB4A 3W2VA 1PD1A 3FDQA 2XLVA 3F47A 1MMGA 1O5HA 2HSQA 3AQCA 4I3MA 3SZRA 1CPRA 4EIYA 3AG4C 1KNYA 2D4UA 3AGUA 4PK4A 4CJOA 1NU7D 2JPUA 3RH3A 4E0HA 1JPNA 2CNWD 1K04A 1VMAA 2HMZA 1BR1A 3OEOA 4JJGA 3W4YA 5A6KA 3ATPA 5KYXA 1D1AA 3DXJF 3Q6MA 4Z9JA 1J8YF 3MBGA 1ZHZA 1OKKA 5CIVA 1HY5A 4P9FA 5B3SC 2YHSA 2YQYA 5AGFA 5KYYA 4U5CE 4CBEA 1HMDA 5D91A 2NSGA 4YT4A 3FHDA 1PCXA 2C03A 1M2OA 3OA1A 3VF0A 1T6IA 4MVZA 2HV6A 1AUEA 2EINC 3HNKA 4JURI 3ZVRA 4KC9A 1ZZPA 2OJQA 4I1MA 4ONSA 4OIRF 1BR2A 3JCUQ 3JRMO 4QDLA 4DRIB 4MNDA 2HJ3A 1WGWA 4WGZA 5DQZA 1JAFA 2FAPB 2P6VA 3FMSA 2DYRC 3HJCA 3C63A 2J46A 2YVKA 3L8JA 4W8KA 1V54C 3SEOA 1K05A 3LESA 3K1HA 4Z9IA 2LCHA 5DS5A 2P1AA 2A69F 3ZG1A 4CSAC 4JC7A 3LAYA 3BRJA 2WVQA 3ASNC 4J30B 4MVOA 2IXOA 1ZHWA 4G7HF 4WGYA 1KU2A 1SMYF 3K33A 3KL4A 4XWJA 3SXZA 1KTMA 4JIOA 1LPEA 4U5DE 2X0CA 5E33A 3B0UX 4C3BA 3EZHA 2NUPB 2YLDA 3FOPA 1FTSA 3DM5A 3GEIA 1ZYRF 1SF8A 2L7AA 4ANJA 1R4TA 2Q9CA 1IW7F 1RJ9B 5KYYB 3HLZA 1Q0FA 1RMVA 2Y39A 3NYMA 1MQVA 2QLAA 1WATA 4NTFA 1MNEA 1EI7A 3IQ6A 3KYIA 3S9OA 3M4BA 3Q7GA 2A0BA 2E87A 2MWQA 3R2PA 2AP3A 4C3DA 4NTAA 2ZXWC 4M63A 2PP4A 1M56C 3EHMA 3OWTA 2J0WA 3PCVA 2R7SA 3DE8A 1AEPA 2XM4A 1H9GA 5B1BC 5B3IA 1O87A 1VYKA 3JZ0A 4MQ9F 4AE4A 2QUPA 5L3QA 3DI5A 1Z7Qc 1OW7A 1E85A 2CW0F 4MVUA 4OIOF 1U0BB 1FR0A 4FESA 2J9WA 2YWAA 3I4UA 3WODF 3I5QA 2LK4A 1YVIA 4CX9A 3JSEO 4JW1A 3HTKC 1ST6A 3S27A 1CGME 1M2VA 2YKZA 4BG0A 3W8IA 2MHRA 256BA 2QNLA 3QVZA 1HE9A 1A7EA 3T9OA 2XXAB 2GWWA 4U5FE 5A6JA 2BL2A 4CS8A 3TOLA 4LDRA 1ZHYA 2YRFA 3M4CA 4CIPA 3DZAA 2YLGA 3DAFA 5L0JA 1VTMP 4YT8A 1RXQA 4H4KC 3S29A 5IY5C 2P0NA 1B68A 1ZW3A 4BJ1A 1OCOC 2CYDA 3FAJA 1D0ZA 5JRAA 2P61A 2VB6A 4JTDB 2B0JA 2PX0A 2OEXA 4OD4A 3WHNA 3AG1C 4AK9A 3EHNA 2OEVA 3JTLO 2A6EF 2Y3BA 4BEJA 4EBKA 3DJNB 2DI3A 5KYUA 1I4ZA
chains in the Genus database with same CATH topology
1OCCC 5FCLA 2P7VA 1Z63A 3K66A 4XTKA 2G62A 2J9VA 2IXPA 4PJMA 3B9QA 2XSEA 3RIPA 3DAGA 3EFOA 3N0TA 2HV7A 1D0YA 4YJWA 4CS9C 4JCHA 4O7GA 2J0XA 1IZMA 3DMDA 5DLJA 2WVNA 1VK5A 4JJFA 3CSKA 3K1IC 3NYLA 4G7ZF 4HFFB 4ZLCA 2QTVA 4IWBA 4U5GA 3B0VC 3UMHA 3AG3C 3ZSUA 3POVA 4NY3A 2CGEA 4CSAA 2X51A 4OD5A 2EIJC 4O6MA 1ZHXA 3MLGA 5CI8A 2FGYA 3DM9B 3S28A 3RFYA 3ABKC 4PJLA 2GFHA 3EQLF 3EGXA 2A1DD 3W2WA 3RYLA 3ZC4A 4C7OA 4K0DA 2L81A 3T6BA 3GODA 2VH3A 3QZCA 1TWAA 2EIMC 4LLEA 1Z23A 3S0XA 2EIKC 4E7SA 1NZEA 2ZXRA 2R7WA 4JVSA 2OCCC 1TKNA 3VAYA 2BE5F 3UR3C 2H7OA 1Z6AA 4E7ZA 4YWQA 2NUTA 5DQTA 3SP1A 2JD3A 3N24A 1TWHA 3T6JA 1TR2A 3LNRA 1OKKD 2WZFA 2Q3TA 1VYIA 5DS4A 1ZHTA 5KYXB 4QI2A 3UGPA 1MNDA 4G0HA 4DVYP 3KMIA 1SZIA 4DVZA 4KNWA 4HFKB 3EPVA 5DS6A 2LSEA 4PFPA 3ZIBA 2H7BA 2IXNA 3TD7A 2R7RA 2KNHA 3K6BA 2DGJA 2J7PA 3E70C 4O6YA 1OCZC 2WL8A 3L0IA 1QZXA 1NG1A 2A6HF 2KW3C 2PX3A 4I1OB 3JYHA 1BR4A 2I8BA 4CS7A 2YZSA 2WZLA 5B1AC 4CS9A 3NKEA 3CZ6A 5HSWA 3LEVA 5E3AA 3F46A 3N2ZB 2IOQA 2R7TA 1FMVA 2R7XA 4AX2A 4XLPF 3EGDA 1Z3IX 3JSZA 1G8XA 2ZXOA 3EJNA 4J32B 3AQBA 2J9UA 3ITFA 2R7OA 3O6XA 4I44A 1Z5ZA 3UMKA 3H65A 4LLCA 5KYWA 3LLIA 2L9JA 4ULWA 1N1CA 4GYTA 4AE4B 2W45A 4X0RA 1JPJA 1D0XA 4IJJA 1ZU4A 1M2VB 3NKDA 5T3TA 2Y3GA 1MMDA 2G3VA 2G3KA 2KQ9A 3SNHA 2O9XA 3DJUB 4FWVA 1TWGA 2ZPAA 4LERA 2MYSA 3T4RA 5F5FA 3Q7LA 4A2NB 5KYNA 2VASA 4ZLDA 5KYUB 2V26A 2Q9AA 2H7VC 4OIQF 2PFDA 4PJNA 3O39A 4BJ5C 3PHF2 2D5RB 3X1OA 1VOMA 4RDAA 3K7DA 4BJ6C 4KI2A 4B6IA 2IXMA 1LS1A 4PFOA 2YEVA 3EFOB 3E9VA 3LJBA 3MX3A 1QLEC 4Q5SF 3ECSA 3NG1A 1D1CA 3ASOC 1ZU5A 3GANA 3B0PA 4YT2A 4XLNF 4Q4ZF 4U5HA 2R7UA 2NUPA 4QI0A 1NU9C 1RJ9A 3JT1A 4JZAA 5D92A 5T1DB 2WVOA 2WB7A 4DBRA 3V7OA 3LLKA 4BJTA 1W2WA 4K7BA 4G7OF 1FMWA 2R7QA 3UMIA 3EGXB 3LS0A 4C7OB 2KJGA 3M1CB 3I5PA 5DVWA 3ABLC 2Q9BA 3FVYA 3NDBB 4EBBA 4YN0B 5BUOA 4U5EE 5CI9A 4F4BA 2XXAA 2OG2A 5EHHA 1OCRC 2XRHA 4DOZA 1V55C 3NYJA 3EH2A 4DBQA 2W4MA 3NRHA 2DYSC 1M57C 3UNGC 2Y69C 2NUTB 2W4BA 1S7ZA 2W9YA 4FX5A 4KNVA 3RKOF 3LS1A 3WG7C 5L3VA 2PF4E 2Y3HA 4CIHA 3KKBA 1LVKA 4HE8D 2V3CC 4PJJA 2J7PD 3IEEA 5E2QA 2XL4A 1LKXA 1MMNA 4RBNA 2J45A 1TWCA 5E3CA 2C04A 4IAOA 4YT5A 4OINF 5F5HA 4IRUA 4BJ5A 4LACB 2A68F 4Q7CA 3EZIA 3VYWA 4BJ6A 3KH2A 4C3EA 1D1BA 4U5BE 1MMAA 2FFHA 4EWCA 2EILC 3EG9A 4O79A 5EGYA 2WZGA 4RD9A 3SYNA 3DD7A 2CDQA 3L34A 3W8HA 1J8MF 2QY9A 1PD0A 5T3WA 3CQZA 2CNWA 3EGDB 3Q6NA 3QMKA 4GEHA 2M4EA 1FFHA 4HEAJ 4OIPF 2ZXPA 3UGOA 4WJ0A 4CS8C 4P6IC 5KYWB 4N06A 3FDQA 2IYLD 3EH1A 3JRTA 2NG1A 2Y3DA 2R7VA 4O6NA 2KGOA 2Z15A 3ABMC 4KBLA 3AG2C 1FFTC 3PMRA 3X2QC 3EG9B 3W2VA 1PD1A 3F47A 1MMGA 1O5HA 3AQCA 4I3MA 3SZRA 3AG4C 4PK4A 1NU7D 3RH3A 1JPNA 2CNWD 1VMAA 3OEOA 1BR1A 4JJGA 5KYXA 1D1AA 3DXJF 3Q6MA 1J8YF 1ZHZA 1OKKA 5B3SC 2YHSA 5KYYA 4U5CE 4CBEA 5D91A 4YT4A 3FHDA 1PCXA 2C03A 1M2OA 3OA1A 2HV6A 3ZVRA 2EINC 4JURI 4KC9A 4OIRF 4I1MA 1BR2A 3JCUQ 4MNDA 1WGWA 5DQZA 2P6VA 2DYRC 3HJCA 2J46A 4W8KA 3SEOA 1V54C 3LESA 3K1HA 5DS5A 2A69F 3ZG1A 4CSAC 3LAYA 2WVQA 3ASNC 4J30B 2IXOA 1ZHWA 4G7HF 1KU2A 1SMYF 3K33A 3KL4A 4XWJA 4U5DE 3B0UX 5E33A 4C3BA 3EZHA 2NUPB 1FTSA 3DM5A 1ZYRF 1SF8A 4ANJA 2Q9CA 1IW7F 1RJ9B 5KYYB 3HLZA 2Y39A 3NYMA 1MNEA 4C3DA 3Q7GA 2E87A 2MWQA 2ZXWC 4M63A 2PP4A 1M56C 3EHMA 3OWTA 2J0WA 2R7SA 5B1BC 1O87A 1VYKA 4MQ9F 4AE4A 5L3QA 4OIOF 2CW0F 4FESA 2J9WA 3I4UA 3WODF 3I5QA 4JW1A 3HTKC 1ST6A 3S27A 1M2VA 4BG0A 3W8IA 2XXAB 4U5FE 4CS8A 1ZHYA 3DZAA 3DAFA 4YT8A 4H4KC 3S29A 5IY5C 4BJ1A 1OCOC 3FAJA 1D0ZA 2VB6A 4OD4A 2B0JA 2PX0A 3AG1C 4AK9A 3EHNA 2A6EF 2Y3BA 4BEJA 3DJNB 4QDLA 5KYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J30 B;  4HFF B;  3ZIB A;  4B6I A;  4JUR I;  4AX2 A;  4J32 B;  4HFK B; 
#chains in the Genus database with same CATH topology
 1OCC C;  5FCL A;  2P7V A;  4AL1 A;  4IGG A;  1BDJ B;  3U9J A;  2XLW A;  3U8V A;  3T4R A;  1S05 A;  3ZDL A;  1Z63 A;  1U6H A;  3K66 A;  2RSE B;  4MW3 A;  1AVO B;  4XTK A;  5COF A;  4MVM A;  2G62 A;  3ZQY A;  2J9V A;  3RVY A;  2IXP A;  4PJM A;  2LP4 A;  3B9Q A;  1Q0G A;  4JKV A;  2XSE A;  3RIP A;  3DAG A;  3EFO A;  3N0T A;  2HV7 A;  1D0Y A;  4YJW A;  3VM6 A;  4YL3 A;  3LNM B;  5GPG B;  4CS9 C;  4JCH A;  5BQH A;  4N6H A;  4O7G A;  1LS4 A;  1VLT A;  4JTC B;  2J0X A;  1IZM A;  2VCC A;  3DMD A;  5COG A;  5DLJ A;  1RKC A;  1VK5 A;  2WVN A;  2ETS A;  3CSK A;  3FOO A;  3K1I C;  3NYL A;  1PV3 A;  4JJF A;  3KYJ A;  1OR2 A;  2J9B A;  4HFF B;  4CDV A;  4ZLC A;  5L0H A;  4G7Z F;  2QTV A;  5A6B A;  4IWB A;  2AWC A;  3B71 A;  4U5G A;  5COM A;  4EHP A;  5HV9 A;  3B0V C;  3UMH A;  3AG3 C;  3ZSU A;  3POV A;  4NY3 A;  4P9T A;  2CGE A;  1T6U A;  4CSA A;  2X51 A;  1DOW A;  1YAR O;  2XM0 A;  4OD5 A;  3U5S A;  4NCQ A;  2EIJ C;  3FAP B;  1ZHX A;  4O6M A;  3MLG A;  5CI8 A;  5TJ5 E;  4EKW A;  1JOG A;  1GQA A;  2FGY A;  3DM9 B;  4CDA A;  3S28 A;  3S84 A;  1A0B A;  3IQ5 A;  3ABK C;  4PJL A;  2R03 A;  2GFH A;  3RFY A;  3WAQ A;  3EQL F;  1YJG A;  3EGX A;  2A1D D;  3W2W A;  5F28 E;  3RYL A;  3ZC4 A;  4C7O A;  4K0D A;  1ZVZ A;  3U9M A;  2L81 A;  2UUI A;  3LEO A;  3T6B A;  1G4W R;  2J8W A;  5BQG A;  2A0U A;  3GOD A;  4CDY A;  2VH3 A;  3QZC A;  1TWA A;  2EIM C;  3SXM A;  1CGN A;  2EPL X;  2OQM A;  2LFF A;  2PNO A;  4LLE A;  3U3F A;  3RW0 A;  4IAQ A;  1Z23 A;  1RKE A;  3S0X A;  2EIK C;  4E7S A;  1Q0M A;  2XLE A;  1T9K A;  2HS5 A;  1FNT c;  3SXY A;  1NZE A;  2KYH A;  3L8I A;  4LDQ A;  2ZXR A;  3TUL A;  2R7W A;  3IQT A;  3IPM O;  4JVS A;  2OCC C;  1TKN A;  3VAY A;  2BE5 F;  5L0D A;  3UR3 C;  5AC4 A;  2H7O A;  1Z6A A;  4JTA B;  4E7Z A;  1LE2 A;  4YWQ A;  3G50 A;  2NUT A;  3RQE A;  5DQT A;  2L6H A;  2JD3 A;  3SP1 A;  3N24 A;  1WTY A;  1TWH A;  3T6J A;  1TR2 A;  3LNR A;  3GM1 A;  4PR9 A;  1E86 A;  1OKK D;  1OXB A;  3RF3 A;  2WZF A;  2IM8 A;  1VYI A;  2Q3T A;  3MYF A;  5DS4 A;  1ZHT A;  5KYX B;  2GAQ A;  4MVS A;  5FZT A;  3UGP A;  1MND A;  4QI2 A;  4DRH B;  4G0H A;  2R02 A;  1RCP A;  4DVY P;  3L1M A;  1OW6 A;  3KMI A;  1SZI A;  1NFN A;  3RVZ A;  4DVZ A;  4KNW A;  1T01 A;  3TJ6 A;  4MTG A;  4HFK B;  2OU6 A;  3EPV A;  2EPN A;  1E84 A;  5DS6 A;  2LSE A;  3NMK A;  4PFP A;  1YZA A;  3ZIB A;  2H7B A;  2IXN A;  4NQF A;  1UG7 A;  3TD7 A;  3U3B A;  1WWP A;  2HMQ A;  4U9D A;  2KNH A;  2R7R A;  3K6B A;  2DGJ A;  2J7P A;  4XPY A;  1WOL A;  1V74 B;  3C8G A;  3E70 C;  4O6Y A;  3J06 A;  2OJE D;  1OCZ C;  4J7T A;  2WL8 A;  3L0I A;  1QZX A;  1NG1 A;  2A6H F;  2KW3 C;  2PX3 A;  3T6G B;  4I1O B;  3JYH A;  2R25 A;  2NPU A;  1C03 A;  1BR4 A;  1YYJ A;  2I8B A;  1YLM A;  4CS7 A;  3GWN A;  2YZS A;  3H2V A;  2WZL A;  5B1A C;  4JCZ A;  4CS9 A;  3NKE A;  3KPH A;  2OOC A;  4DXW A;  2Q7R A;  3CZ6 A;  3TQO A;  5HSW A;  3LEV A;  3O55 A;  4MTO A;  2HJM A;  5E3A A;  3F46 A;  3N2Z B;  2IOQ A;  2R05 A;  2CCY A;  2R7T A;  1NSG B;  1FMV A;  3K1I A;  1A41 A;  2R7X A;  1APC A;  4AX2 A;  2NSF A;  1YYX A;  4XLP F;  4ER9 A;  3EGD A;  1Z3I X;  3JSZ A;  4E18 A;  1G8X A;  1SYQ A;  2ZXO A;  4N4W A;  3EJN A;  1HE1 A;  2IBF A;  4MTF A;  2Q00 A;  4J32 B;  3NMI A;  4Z9H A;  1EKY A;  3AQB A;  2J9U A;  1F1M A;  1LIH A;  3GM2 A;  3ITF A;  2XLM A;  3SXK A;  2H8A A;  2R7O A;  3V5Z A;  1A7V A;  1YZC A;  5K0I A;  2XLH A;  5JT4 A;  3PDM P;  3O6X A;  2LQG A;  4I44 A;  1Z5Z A;  4PAC A;  3UMK A;  5A6A A;  3H65 A;  4LLC A;  2EPK X;  5KYW A;  3LLI A;  4UDV A;  2L9J A;  4ULW A;  4U9E A;  1HMO A;  1N1C A;  1G5Z A;  4GYT A;  4AE4 B;  1QPU A;  1K40 A;  3TJ5 A;  1Y4C A;  2W45 A;  4L6R A;  3GOR A;  2L6F A;  2KK1 A;  5JLI A;  2AWY A;  4X0R A;  4EBJ A;  3IQC A;  1JPJ A;  1H7I A;  1D0X A;  5L0I A;  1UFB A;  1H6G A;  1ZU4 A;  3CAX A;  4IJJ A;  5JP7 A;  3VRC A;  2YLI A;  3S90 A;  1M2V B;  2ICW G;  3NKD A;  5T3T A;  3BEH A;  3C62 A;  4A4A A;  4MS2 A;  2YL7 A;  2HUJ A;  2Y3G A;  1MMD A;  1SR2 A;  2G3V A;  2G3K A;  2KQ9 A;  3SNH A;  3G4X A;  4NC3 A;  1BBH A;  1NFO A;  1I5N A;  2O9X A;  1TWG A;  2ZPA A;  3DJU B;  2MYS A;  2QE9 A;  4FWV A;  4LER A;  4MW8 A;  4BEM J;  5F5F A;  3Q7L A;  2LD6 A;  4A2N B;  3RQF A;  1E83 A;  3NMJ A;  2HFI A;  5KYN A;  3U2M A;  1H9T A;  4DJ9 A;  4XQ1 A;  4JE9 A;  2VAS A;  2UUH A;  2XLO A;  3TOM A;  4ZLD A;  1QQ3 A;  1U89 A;  5KYU B;  2V26 A;  2Q9A A;  2H7V C;  4OIQ F;  3IHU A;  2PFD A;  2YL0 A;  4PJN A;  3O39 A;  4BJ5 C;  3PHF 2;  2D5R B;  1NLX A;  4J7Y A;  2TMV P;  3X1O A;  2F22 A;  1VOM A;  2VCA A;  3AJM A;  3AOU A;  3K7D A;  4RDA A;  4BJ6 C;  3DWW A;  1C02 A;  4B6I A;  2IXM A;  2LFD A;  4KI2 A;  4R32 A;  1LS1 A;  4PFO A;  4YL1 A;  2YEV A;  3O10 A;  3GEH A;  1I4Y A;  3FXH A;  4K1O A;  4AL0 A;  1T5O A;  3AGT A;  4EUK B;  3EFO B;  3E9V A;  3LJB A;  3MX3 A;  2Q4F A;  2AU5 A;  3HNJ A;  1QLE C;  1XWJ A;  4Q5S F;  3ECS A;  3NG1 A;  1D1C A;  1GGQ A;  4ULV A;  3ASO C;  5A6B D;  1ZU5 A;  3GAN A;  3B0P A;  4YT2 A;  4XLN F;  1BZ4 A;  4U5H A;  3C18 A;  2ASR A;  4XEF A;  5EK0 A;  4Q4Z F;  1HW2 A;  2R7U A;  4XPX A;  2NUP A;  4QI0 A;  2L6G A;  1NU9 C;  4YL0 A;  1OXK A;  1RJ9 A;  3JT1 A;  4JZA A;  5D92 A;  3GM3 A;  5T1D B;  2WVO A;  2WB7 A;  4IB4 A;  4MVR A;  4DBR A;  2KSF A;  3V7O A;  2JX0 A;  3LLK A;  3QW0 A;  3DE9 A;  4BJT A;  1W2W A;  2EPO A;  4K7B A;  4G7O F;  4D4N A;  2M64 A;  1FMW A;  3MFN A;  4N6C A;  2AVK A;  2R7Q A;  4CJG A;  1WN0 A;  1LI5 A;  3UMI A;  3EGX B;  1TFO B;  3LS0 A;  3GEE A;  3LUT B;  4C7O B;  1QVX A;  2KJG A;  3M1C B;  3I5P A;  4JEA A;  1LE4 A;  2XL6 A;  1CGO A;  3C7J A;  3B29 A;  5DVW A;  3ABL C;  4G78 A;  2Q9B A;  1GM5 A;  2GDC A;  3FVY A;  3MYI A;  1OW8 A;  1M6T A;  1ORS C;  3H2U A;  4EBB A;  3NDB B;  4YN0 B;  5JS5 A;  3G4Z A;  5BUO A;  1GS9 A;  4U5E E;  5CI9 A;  5L0G A;  4F4B A;  2XXA A;  3U0C A;  2OG2 A;  5EHH A;  1RKE B;  4MVQ A;  1OCR C;  1L3P A;  4XPW A;  2HZ8 A;  2PBE A;  2XRH A;  5A69 A;  2KC3 A;  1R5I D;  4DOZ A;  1V55 C;  1YAU O;  2I15 A;  3NYJ A;  1YDI A;  3EH2 A;  4DBQ A;  2W4M A;  1V4A A;  3QVY A;  3NRH A;  1DOV A;  1E2X A;  1JR8 A;  4GQH A;  3TK0 A;  4BPM A;  2DYS C;  1M57 C;  4E17 A;  3UNG C;  2OKU A;  2Y69 C;  2NUT B;  1QSP A;  2W4B A;  3ZQV A;  1ORY A;  1S7Z A;  2W9Y A;  4FX5 A;  2EPM X;  4KNV A;  1L7C A;  3V5Y A;  3RKO F;  3LS1 A;  3WG7 C;  3RQG A;  5L3V A;  4E0I A;  2PF4 E;  4H54 A;  5L0C A;  2VC9 A;  2Y3H A;  4CIH A;  3KKB A;  1LVK A;  4HE8 D;  3JYY A;  3US6 A;  2V3C C;  4YK5 A;  2LIG A;  1A7D A;  1Q0D A;  2XS8 A;  3HNL A;  3A9C A;  1OQC A;  1JRA A;  1ORJ A;  2J7P D;  4IAR A;  4PJJ A;  4JEB A;  3C8G D;  3ZTZ A;  3IEE A;  5E2Q A;  1OR3 A;  1EA8 A;  2XL4 A;  1XZQ A;  1LKX A;  1MMN A;  1Y6D A;  2J45 A;  4RBN A;  4XEV A;  1TWC A;  5E3C A;  2C04 A;  3C8G B;  4IAO A;  4YT5 A;  4OIN F;  5F5H A;  4IRU A;  4BJ5 A;  4LAC B;  2A68 F;  3QTH A;  4Q7C A;  3EZI A;  3VYW A;  4BJ6 A;  3KH2 A;  5JSL A;  1D1B A;  1CPQ A;  4C3E A;  4DRJ B;  5L0F A;  2YL3 A;  4U5B E;  4NTB A;  1LM3 B;  1MMA A;  2FFH A;  5BQI A;  4EWC A;  2EIL C;  3EG9 A;  4O79 A;  3HKK A;  3M79 A;  3U2L A;  2B0H A;  1G4U S;  1C17 M;  1XZP A;  1ZW2 A;  2VCB A;  4XEK A;  3A11 A;  4D4X A;  5EGY A;  3U8P A;  2WZG A;  2GA0 A;  4RD9 A;  3CEX A;  3SYN A;  1YA7 O;  3DD7 A;  2XL8 A;  1JMW A;  1VLS A;  1TQG A;  1LI7 A;  2RD9 A;  2CDQ A;  1YA9 A;  3L34 A;  2XLD A;  2YL1 A;  1J8M F;  3W8H A;  1QKR A;  3HNI A;  2QY9 A;  1PD0 A;  5T3W A;  3CQZ A;  2HSB A;  2CNW A;  3V5X A;  3EGD B;  3Q6N A;  3QMK A;  4GEH A;  1EQ1 A;  1NBB A;  2R9R B;  2M4E A;  1FFH A;  4HEA J;  4OIP F;  1FAP B;  2ZXP A;  3UGO A;  1TFK B;  1HW1 A;  2BC5 A;  2HKV A;  4WJ0 A;  3ZTM A;  3C8Z A;  4FAP B;  1Q0K A;  4CS8 C;  3QW1 A;  3DKA A;  4P6I C;  3R7C A;  5KYW B;  4N06 A;  4W8P A;  5AC5 A;  5JVE A;  4JRZ A;  2IYL D;  3EH1 A;  3JRT A;  2NG1 A;  2Y3D A;  3M15 A;  5JUA A;  1T6Q A;  2R7V A;  4O6N A;  2ZD9 A;  4WAB A;  2KGO A;  1VB5 A;  2Z15 A;  3ABM C;  4KBL A;  4LDK A;  1O3U A;  3AG2 C;  3GWL A;  1FFT C;  2XS1 A;  3ZWI A;  3PMR A;  3X2Q C;  3EG9 B;  1WAS A;  2DB4 A;  3W2V A;  1PD1 A;  3FDQ A;  2XLV A;  3F47 A;  1MMG A;  1O5H A;  2HSQ A;  3AQC A;  4I3M A;  3SZR A;  1CPR A;  4EIY A;  3AG4 C;  1KNY A;  2D4U A;  3AGU A;  4PK4 A;  4CJO A;  1NU7 D;  2JPU A;  3RH3 A;  4E0H A;  1JPN A;  2CNW D;  1K04 A;  1VMA A;  2HMZ A;  1BR1 A;  3OEO A;  4JJG A;  3W4Y A;  5A6K A;  3ATP A;  5KYX A;  1D1A A;  3DXJ F;  3Q6M A;  4Z9J A;  1J8Y F;  3MBG A;  1ZHZ A;  1OKK A;  5CIV A;  1HY5 A;  4P9F A;  5B3S C;  2YHS A;  2YQY A;  5AGF A;  5KYY A;  4U5C E;  4CBE A;  1HMD A;  5D91 A;  2NSG A;  4YT4 A;  3FHD A;  1PCX A;  2C03 A;  1M2O A;  3OA1 A;  3VF0 A;  1T6I A;  4MVZ A;  2HV6 A;  1AUE A;  2EIN C;  3HNK A;  4JUR I;  3ZVR A;  4KC9 A;  1ZZP A;  2OJQ A;  4I1M A;  4ONS A;  4OIR F;  1BR2 A;  3JCU Q;  3JRM O;  4QDL A;  4DRI B;  4MND A;  2HJ3 A;  1WGW A;  4WGZ A;  5DQZ A;  1JAF A;  2FAP B;  2P6V A;  3FMS A;  2DYR C;  3HJC A;  3C63 A;  2J46 A;  2YVK A;  3L8J A;  4W8K A;  1V54 C;  3SEO A;  1K05 A;  3LES A;  3K1H A;  4Z9I A;  2LCH A;  5DS5 A;  2P1A A;  2A69 F;  3ZG1 A;  4CSA C;  4JC7 A;  3LAY A;  3BRJ A;  2WVQ A;  3ASN C;  4J30 B;  4MVO A;  2IXO A;  1ZHW A;  4G7H F;  4WGY A;  1KU2 A;  1SMY F;  3K33 A;  3KL4 A;  4XWJ A;  3SXZ A;  1KTM A;  4JIO A;  1LPE A;  4U5D E;  2X0C A;  5E33 A;  3B0U X;  4C3B A;  3EZH A;  2NUP B;  2YLD A;  3FOP A;  1FTS A;  3DM5 A;  3GEI A;  1ZYR F;  1SF8 A;  2L7A A;  4ANJ A;  1R4T A;  2Q9C A;  1IW7 F;  1RJ9 B;  5KYY B;  3HLZ A;  1Q0F A;  1RMV A;  2Y39 A;  3NYM A;  1MQV A;  2QLA A;  1WAT A;  4NTF A;  1MNE A;  1EI7 A;  3IQ6 A;  3KYI A;  3S9O A;  3M4B A;  3Q7G A;  2A0B A;  2E87 A;  2MWQ A;  3R2P A;  2AP3 A;  4C3D A;  4NTA A;  2ZXW C;  4M63 A;  2PP4 A;  1M56 C;  3EHM A;  3OWT A;  2J0W A;  3PCV A;  2R7S A;  3DE8 A;  1AEP A;  2XM4 A;  1H9G A;  5B1B C;  5B3I A;  1O87 A;  1VYK A;  3JZ0 A;  4MQ9 F;  4AE4 A;  2QUP A;  5L3Q A;  3DI5 A;  1Z7Q c;  1OW7 A;  1E85 A;  2CW0 F;  4MVU A;  4OIO F;  1U0B B;  1FR0 A;  4FES A;  2J9W A;  2YWA A;  3I4U A;  3WOD F;  3I5Q A;  2LK4 A;  1YVI A;  4CX9 A;  3JSE O;  4JW1 A;  3HTK C;  1ST6 A;  3S27 A;  1CGM E;  1M2V A;  2YKZ A;  4BG0 A;  3W8I A;  2MHR A;  256B A;  2QNL A;  3QVZ A;  1HE9 A;  1A7E A;  3T9O A;  2XXA B;  2GWW A;  4U5F E;  5A6J A;  2BL2 A;  4CS8 A;  3TOL A;  4LDR A;  1ZHY A;  2YRF A;  3M4C A;  4CIP A;  3DZA A;  2YLG A;  3DAF A;  5L0J A;  1VTM P;  4YT8 A;  1RXQ A;  4H4K C;  3S29 A;  5IY5 C;  2P0N A;  1B68 A;  1ZW3 A;  4BJ1 A;  1OCO C;  2CYD A;  3FAJ A;  1D0Z A;  5JRA A;  2P61 A;  2VB6 A;  4JTD B;  2B0J A;  2PX0 A;  2OEX A;  4OD4 A;  3WHN A;  3AG1 C;  4AK9 A;  3EHN A;  2OEV A;  3JTL O;  2A6E F;  2Y3B A;  4BEJ A;  4EBK A;  3DJN B;  2DI3 A;  5KYU A;  1I4Z A; 
#chains in the Genus database with same CATH homology
 1OCC C;  5FCL A;  2P7V A;  1Z63 A;  3K66 A;  4XTK A;  2G62 A;  2J9V A;  2IXP A;  4PJM A;  3B9Q A;  2XSE A;  3RIP A;  3DAG A;  3EFO A;  3N0T A;  2HV7 A;  1D0Y A;  4YJW A;  4CS9 C;  4JCH A;  4O7G A;  2J0X A;  1IZM A;  3DMD A;  5DLJ A;  2WVN A;  1VK5 A;  4JJF A;  3CSK A;  3K1I C;  3NYL A;  4G7Z F;  4HFF B;  4ZLC A;  2QTV A;  4IWB A;  4U5G A;  3B0V C;  3UMH A;  3AG3 C;  3ZSU A;  3POV A;  4NY3 A;  2CGE A;  4CSA A;  2X51 A;  4OD5 A;  2EIJ C;  4O6M A;  1ZHX A;  3MLG A;  5CI8 A;  2FGY A;  3DM9 B;  3S28 A;  3RFY A;  3ABK C;  4PJL A;  2GFH A;  3EQL F;  3EGX A;  2A1D D;  3W2W A;  3RYL A;  3ZC4 A;  4C7O A;  4K0D A;  2L81 A;  3T6B A;  3GOD A;  2VH3 A;  3QZC A;  1TWA A;  2EIM C;  4LLE A;  1Z23 A;  3S0X A;  2EIK C;  4E7S A;  1NZE A;  2ZXR A;  2R7W A;  4JVS A;  2OCC C;  1TKN A;  3VAY A;  2BE5 F;  3UR3 C;  2H7O A;  1Z6A A;  4E7Z A;  4YWQ A;  2NUT A;  5DQT A;  3SP1 A;  2JD3 A;  3N24 A;  1TWH A;  3T6J A;  1TR2 A;  3LNR A;  1OKK D;  2WZF A;  2Q3T A;  1VYI A;  5DS4 A;  1ZHT A;  5KYX B;  4QI2 A;  3UGP A;  1MND A;  4G0H A;  4DVY P;  3KMI A;  1SZI A;  4DVZ A;  4KNW A;  4HFK B;  3EPV A;  5DS6 A;  2LSE A;  4PFP A;  3ZIB A;  2H7B A;  2IXN A;  3TD7 A;  2R7R A;  2KNH A;  3K6B A;  2DGJ A;  2J7P A;  3E70 C;  4O6Y A;  1OCZ C;  2WL8 A;  3L0I A;  1QZX A;  1NG1 A;  2A6H F;  2KW3 C;  2PX3 A;  4I1O B;  3JYH A;  1BR4 A;  2I8B A;  4CS7 A;  2YZS A;  2WZL A;  5B1A C;  4CS9 A;  3NKE A;  3CZ6 A;  5HSW A;  3LEV A;  5E3A A;  3F46 A;  3N2Z B;  2IOQ A;  2R7T A;  1FMV A;  2R7X A;  4AX2 A;  4XLP F;  3EGD A;  1Z3I X;  3JSZ A;  1G8X A;  2ZXO A;  3EJN A;  4J32 B;  3AQB A;  2J9U A;  3ITF A;  2R7O A;  3O6X A;  4I44 A;  1Z5Z A;  3UMK A;  3H65 A;  4LLC A;  5KYW A;  3LLI A;  2L9J A;  4ULW A;  1N1C A;  4GYT A;  4AE4 B;  2W45 A;  4X0R A;  1JPJ A;  1D0X A;  4IJJ A;  1ZU4 A;  1M2V B;  3NKD A;  5T3T A;  2Y3G A;  1MMD A;  2G3V A;  2G3K A;  2KQ9 A;  3SNH A;  2O9X A;  3DJU B;  4FWV A;  1TWG A;  2ZPA A;  4LER A;  2MYS A;  3T4R A;  5F5F A;  3Q7L A;  4A2N B;  5KYN A;  2VAS A;  4ZLD A;  5KYU B;  2V26 A;  2Q9A A;  2H7V C;  4OIQ F;  2PFD A;  4PJN A;  3O39 A;  4BJ5 C;  3PHF 2;  2D5R B;  3X1O A;  1VOM A;  4RDA A;  3K7D A;  4BJ6 C;  4KI2 A;  4B6I A;  2IXM A;  1LS1 A;  4PFO A;  2YEV A;  3EFO B;  3E9V A;  3LJB A;  3MX3 A;  1QLE C;  4Q5S F;  3ECS A;  3NG1 A;  1D1C A;  3ASO C;  1ZU5 A;  3GAN A;  3B0P A;  4YT2 A;  4XLN F;  4Q4Z F;  4U5H A;  2R7U A;  2NUP A;  4QI0 A;  1NU9 C;  1RJ9 A;  3JT1 A;  4JZA A;  5D92 A;  5T1D B;  2WVO A;  2WB7 A;  4DBR A;  3V7O A;  3LLK A;  4BJT A;  1W2W A;  4K7B A;  4G7O F;  1FMW A;  2R7Q A;  3UMI A;  3EGX B;  3LS0 A;  4C7O B;  2KJG A;  3M1C B;  3I5P A;  5DVW A;  3ABL C;  2Q9B A;  3FVY A;  3NDB B;  4EBB A;  4YN0 B;  5BUO A;  4U5E E;  5CI9 A;  4F4B A;  2XXA A;  2OG2 A;  5EHH A;  1OCR C;  2XRH A;  4DOZ A;  1V55 C;  3NYJ A;  3EH2 A;  4DBQ A;  2W4M A;  3NRH A;  2DYS C;  1M57 C;  3UNG C;  2Y69 C;  2NUT B;  2W4B A;  1S7Z A;  2W9Y A;  4FX5 A;  4KNV A;  3RKO F;  3LS1 A;  3WG7 C;  5L3V A;  2PF4 E;  2Y3H A;  4CIH A;  3KKB A;  1LVK A;  4HE8 D;  2V3C C;  4PJJ A;  2J7P D;  3IEE A;  5E2Q A;  2XL4 A;  1LKX A;  1MMN A;  4RBN A;  2J45 A;  1TWC A;  5E3C A;  2C04 A;  4IAO A;  4YT5 A;  4OIN F;  5F5H A;  4IRU A;  4BJ5 A;  4LAC B;  2A68 F;  4Q7C A;  3EZI A;  3VYW A;  4BJ6 A;  3KH2 A;  4C3E A;  1D1B A;  4U5B E;  1MMA A;  2FFH A;  4EWC A;  2EIL C;  3EG9 A;  4O79 A;  5EGY A;  2WZG A;  4RD9 A;  3SYN A;  3DD7 A;  2CDQ A;  3L34 A;  3W8H A;  1J8M F;  2QY9 A;  1PD0 A;  5T3W A;  3CQZ A;  2CNW A;  3EGD B;  3Q6N A;  3QMK A;  4GEH A;  2M4E A;  1FFH A;  4HEA J;  4OIP F;  2ZXP A;  3UGO A;  4WJ0 A;  4CS8 C;  4P6I C;  5KYW B;  4N06 A;  3FDQ A;  2IYL D;  3EH1 A;  3JRT A;  2NG1 A;  2Y3D A;  2R7V A;  4O6N A;  2KGO A;  2Z15 A;  3ABM C;  4KBL A;  3AG2 C;  1FFT C;  3PMR A;  3X2Q C;  3EG9 B;  3W2V A;  1PD1 A;  3F47 A;  1MMG A;  1O5H A;  3AQC A;  4I3M A;  3SZR A;  3AG4 C;  4PK4 A;  1NU7 D;  3RH3 A;  1JPN A;  2CNW D;  1VMA A;  3OEO A;  1BR1 A;  4JJG A;  5KYX A;  1D1A A;  3DXJ F;  3Q6M A;  1J8Y F;  1ZHZ A;  1OKK A;  5B3S C;  2YHS A;  5KYY A;  4U5C E;  4CBE A;  5D91 A;  4YT4 A;  3FHD A;  1PCX A;  2C03 A;  1M2O A;  3OA1 A;  2HV6 A;  3ZVR A;  2EIN C;  4JUR I;  4KC9 A;  4OIR F;  4I1M A;  1BR2 A;  3JCU Q;  4MND A;  1WGW A;  5DQZ A;  2P6V A;  2DYR C;  3HJC A;  2J46 A;  4W8K A;  3SEO A;  1V54 C;  3LES A;  3K1H A;  5DS5 A;  2A69 F;  3ZG1 A;  4CSA C;  3LAY A;  2WVQ A;  3ASN C;  4J30 B;  2IXO A;  1ZHW A;  4G7H F;  1KU2 A;  1SMY F;  3K33 A;  3KL4 A;  4XWJ A;  4U5D E;  3B0U X;  5E33 A;  4C3B A;  3EZH A;  2NUP B;  1FTS A;  3DM5 A;  1ZYR F;  1SF8 A;  4ANJ A;  2Q9C A;  1IW7 F;  1RJ9 B;  5KYY B;  3HLZ A;  2Y39 A;  3NYM A;  1MNE A;  4C3D A;  3Q7G A;  2E87 A;  2MWQ A;  2ZXW C;  4M63 A;  2PP4 A;  1M56 C;  3EHM A;  3OWT A;  2J0W A;  2R7S A;  5B1B C;  1O87 A;  1VYK A;  4MQ9 F;  4AE4 A;  5L3Q A;  4OIO F;  2CW0 F;  4FES A;  2J9W A;  3I4U A;  3WOD F;  3I5Q A;  4JW1 A;  3HTK C;  1ST6 A;  3S27 A;  1M2V A;  4BG0 A;  3W8I A;  2XXA B;  4U5F E;  4CS8 A;  1ZHY A;  3DZA A;  3DAF A;  4YT8 A;  4H4K C;  3S29 A;  5IY5 C;  4BJ1 A;  1OCO C;  3FAJ A;  1D0Z A;  2VB6 A;  4OD4 A;  2B0J A;  2PX0 A;  3AG1 C;  4AK9 A;  3EHN A;  2A6E F;  2Y3B A;  4BEJ A;  3DJN B;  4QDL A;  5KYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...