1RMVA

Ribgrass mosaic virus, fiber diffraction
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
156
structure length
156
Chain Sequence
SYNITNSNQYQYFAAVWAEPTPMLNQCVSALSQSYQTQAGRDTVRQQFANLLSTIVAPNQRFPDTGFRVYVNSAVIKPLYEALMKSFDTRNRIIETEEESRPSASEVANATQRVDDATVAIRSQIQLLLNELSNGHGYMNRAEFEAILPWTTAPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBGRASS MOSAIC VIRUS RNA
publication title Molecular dynamics in refinement against fiber diffraction data.
pubmed doi rcsb
molecule tags Virus/rna
total genus 38
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 1997-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00721 TMV_coat Virus coat protein (TMV like)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.70 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Tobacco mosaic virus-like, coat protein 1rmvA00
1EI7A 3PDMP 1VTMP 4GQHA 3J06A 1RMVA 4UDVA 1CGME 2TMVP
chains in the Genus database with same CATH superfamily
3R7CA 2AP3A 3T4RA 5A6BA 1QKRA 1QSPA 1K05A 3EZIA 1K40A 1VYIA 4JJGA 1ZHXA 3LLIA 3JT1A 1DOVA 2BC5A 2ASRA 2PF4E 3EH1A 3NMJA 4BJ1A 4H4KC 2J7PA 4HEAJ 3J06A 1G8XA 2P1AA 2YEVA 1JMWA 3F47A 3LS1A 1FR0A 2J46A 2Q9AA 1YVIA 3F46A 3G4XA 1CPQA 2KGOA 3EGXB 3IEEA 1R5ID 3LNRA 4J30B 2XL8A 3A9CA 3K66A 1OCCC 3L8JA 1BR4A 3NMKA 2Y3BA 4MTFA 4CSAC 3DM9B 4JEBA 4U5EE 3N0TA 2LIGA 4R32A 2YL1A 2GFHA 2HJ3A 2XRHA 3GEHA 4I1OB 5KYUB 2Q9CA 1I4YA 4WABA 2KYHA 3FOOA 4O7GA 2PFDA 4KBLA 1AVOB 1U89A 2HFIA 2HSQA 2XM4A 5KYYB 5KYWB 1QQ3A 5L0CA 3U9JA 2QLAA 3FVYA 3V5YA 2L81A 4N4WA 2WVQA 1ST6A 2HMZA 2W4BA 3FAPB 3U0CA 3M4BA 2JD3A 2WZLA 2R7RA 4DJ9A 1MQVA 4K1OA 4IGGA 1ZHZA 2EPKX 1FMVA 1ZU5A 4FESA 1WTYA 3M1CB 1Q0MA 3GM2A 3EGDA 4IB4A 1I4ZA 4OIRF 3AGUA 2R7XA 1ZHYA 1ZYRF 4Z9HA 5F28E 3MX3A 1M2OA 5T3WA 3ZQYA 4D4XA 2J45A 3MYIA 1OKKD 1XZPA 2H7BA 1Z23A 4A2NB 4PJLA 1VOMA 4CDVA 1TWAA 2W9YA 4J7TA 4ULWA 4U5DE 1PD0A 2JX0A 2EIKC 4PK4A 1E84A 1SYQA 2AWYA 1VYKA 2IBFA 4I1MA 1WASA 4EBKA 2TMVP 3I4UA 5E3CA 3UGPA 3W8IA 1PV3A 3E70C 3TD7A 2XLOA 2XSEA 4HFFB 1OW7A 4MQ9F 4C3BA 1H6GA 5JRAA 4Q4ZF 2F22A 4PJJA 1YJGA 2WVOA 3AG1C 2CNWA 3JRTA 3LAYA 2CGEA 1MNEA 2IXNA 4K0DA 4JTAB 4RBNA 1I5NA 4KNVA 4BEMJ 3B29A 3U8PA 3AJMA 3US6A 3VAYA 3HNIA 4MTGA 3DKAA 3K7DA 1E85A 2UUIA 2L7AA 3CSKA 4JKVA 2NUTA 2XXAA 1Z7Qc 2HS5A 4JTDB 1CGNA 2ETSA 4MVZA 4DVYP 3NDBB 1M2VA 3EH2A 4BJ5A 4PFPA 4YK5A 2EPOA 4CIPA 1V55C 1ZVZA 3DJNB 1JPJA 1TQGA 2VCBA 3BEHA 3K33A 2MWQA 4CDAA 1LI5A 1RJ9A 4XTKA 3RIPA 5B3IA 4YL1A 5KYXA 3JYYA 3QMKA 1LPEA 2XLDA 2V3CC 1L3PA 3EGDB 3KMIA 5COMA 3W4YA 1NG1A 2YWAA 2ZPAA 5A6JA 2ZD9A 4YT4A 2KC3A 2NSFA 3IQ5A 4X0RA 3SXMA 1D1CA 2M4EA 1A41A 1QLEC 1Z5ZA 3EJNA 3O55A 3U5SA 1NFOA 4QI2A 3MFNA 1Z6AA 4BG0A 1AEPA 1TFKB 2W45A 3U2MA 3JCUQ 3RKOF 2PNOA 2Q4FA 3EGXA 1TR2A 3ABKC 4XPWA 1TKNA 3QW0A 1G4US 3S28A 3ZG1A 1ZZPA 1HW2A 2FAPB 4JURI 4BJ5C 2J8WA 5EGYA 1SMYF 1CPRA 2EIJC 3NYJA 1OXBA 2P6VA 4WGYA 2NG1A 2VB6A 3DI5A 2M64A 1YAUO 5K0IA 1MNDA 3ABLC 1MMNA 3QW1A 2OEXA 4LERA 5KYUA 1ZHTA 1YZCA 5KYYA 4JJFA 1E2XA 256BA 2P61A 1EQ1A 3MLGA 1LI7A 4ANJA 2R7UA 2NUTB 3VF0A 3ZTMA 3QTHA 4JIOA 1QVXA 1O87A 5B1BC 2JPUA 3DWWA 2XXAB 3C8GD 2Y3HA 5CIVA 4KC9A 4MTOA 2YKZA 5DS5A 1JPNA 2G62A 3L0IA 4CDYA 4I3MA 4P6IC 2OU6A 1M2VB 2HSBA 4IRUA 5FZTA 3RF3A 3RQEA 3WHNA 5A6KA 5L3QA 2IXMA 1OQCA 4J32B 4W8KA 2A68F 1GS9A 3KPHA 4YL3A 3MBGA 5T3TA 3NYMA 3FHDA 1YA7O 3C18A 5DS4A 3GM1A 3H2VA 1RJ9B 4DXWA 1Q0GA 1XZQA 5KYXB 2H7OA 3S29A 2WL8A 4KNWA 3DXJF 4CS9A 3V5XA 1M6TA 3S90A 1GM5A 1JRAA 1LE4A 3AGTA 2EINC 1PD1A 3FAJA 3LS0A 4N06A 4XEVA 5DVWA 3WG7C 4E7SA 1OXKA 2KW3C 4GQHA 4QI0A 2OQMA 3O39A 4PR9A 4U9EA 2R25A 4CBEA 4PACA 3DD7A 3TOLA 5JSLA 4J7YA 3OA1A 4OIOF 1WWPA 1O3UA 4GYTA 4Q7CA 2IM8A 5D92A 3KL4A 2XLHA 4FWVA 4BJTA 1OCRC 2XLWA 4MVMA 4XLNF 2FGYA 4CS8C 4XPXA 1W2WA 1B68A 1Z3IX 4NTAA 3FMSA 2R02A 4DOZA 1VLSA 3GWLA 4JC7A 3NRHA 1R4TA 3SP1A 4EIYA 1D0XA 1K04A 2HV7A 3H2UA 3N2ZB 4CS9C 4KI2A 3B71A 2CCYA 3IPMO 4U5CE 2R7WA 3KYIA 1BR2A 3VM6A 2NSGA 3UNGC 3ZSUA 2A0UA 4D4NA 5BQHA 2OEVA 1CGME 3PHF2 4E7ZA 4JTCB 4CIHA 1T01A 2J9BA 2XS8A 4DRJB 3HNLA 1BDJB 3UMHA 1OR3A 4U5FE 1RKEA 5FCLA 2KSFA 2XLEA 4I44A 2R05A 2R7OA 3ZTZA 2NPUA 4C3EA 4C3DA 4F4BA 2J9UA 4N6HA 1M56C 4LDRA 2I15A 2L9JA 2CDQA 3RFYA 3RVZA 4YWQA 1LE2A 3Q7GA 5L0IA 3CQZA 2A6HF 2C04A 2VH3A 3KH2A 4CJOA 3M15A 2P7VA 1J8MF 2VCAA 3RQFA 3IHUA 2YLDA 4ONSA 3AQBA 5E3AA 2HV6A 2AWCA 1UFBA 4O79A 4DBRA 1KTMA 2IOQA 1L7CA 4MVSA 1GQAA 1TWGA 2NUPA 3IQCA 1RCPA 3A11A 3ZIBA 3W8HA 1HE1A 1QPUA 1TWHA 3C8ZA 4MVOA 4NTFA 2Q3TA 1C17M 2DYRC 3AQCA 3JTLO 4NCQA 3L1MA 4YT5A 3T9OA 1TWCA 1E86A 1A0BA 1RMVA 1G5ZA 1NFNA 2LFFA 1T9KA 4XLPF 4G0HA 5A69A 4EWCA 4G7ZF 4JVSA 3GANA 1BBHA 1RXQA 4PFOA 5BQIA 4IAOA 2XS1A 4EBJA 3TQOA 2A0BA 1YYXA 5TJ5E 4FAPB 1MMAA 3GWNA 2PP4A 5A6BD 2QTVA 5F5HA 4LLCA 3AG3C 4O6YA 3POVA 2R7SA 2WZGA 1NU9C 3AG4C 1ZU4A 1M57C 2J0XA 5DS6A 2R9RB 4E0HA 3HJCA 2LFDA 2VC9A 2J7PD 4MVQA 4YL0A 1RKEB 5JP7A 1F1MA 2QNLA 3LEVA 3SEOA 1FTSA 5JS5A 2Q7RA 1SF8A 3UGOA 2LSEA 4N6CA 3ZC4A 4ZLDA 4B6IA 2DI3A 3LUTB 2X0CA 2AVKA 3T6JA 2YHSA 4Z9IA 1OW8A 2O9XA 1D0YA 4E0IA 1H9GA 2H8AA 1TFOB 3KKBA 3RYLA 1YARO 2WVNA 1LM3B 5D91A 2LQGA 5IY5C 5L3VA 1H9TA 3X2QC 4NTBA 2DGJA 5CI8A 1ZW3A 2ICWG 2YQYA 2Q00A 5EHHA 1UG7A 3MYFA 5JUAA 4CX9A 1BZ4A 2J0WA 3CZ6A 5AC4A 3R2PA 3RH3A 2NUPB 3U9MA 4M63A 4OIQF 1VB5A 3FDQA 1WATA 5B1AC 4Q5SF 4H54A 5AGFA 5JVEA 3BRJA 1LS4A 4NY3A 1OR2A 2RSEB 1NLXA 2HUJA 1OCOC 3X1OA 1GGQA 3SXYA 3O10A 3EZHA 2H7VC 3Q6MA 5DQTA 2YRFA 4K7BA 2LCHA 3SYNA 3S27A 1EA8A 4WJ0A 1T6UA 3DZAA 4E18A 3T6GB 3S84A 5HV9A 3ZWIA 1OKKA 3DAFA 4RDAA 2W4MA 2Q9BA 4CS8A 2EIMC 2IYLD 3H65A 2BE5F 4YJWA 1U6HA 3NKDA 3W2WA 3QVYA 4MW8A 3K1IA 2YLIA 4JCHA 3TOMA 5COFA 3B0VC 2UUHA 1Q0FA 2MHRA 2KNHA 4P9TA 4U9DA 3ZQVA 1ORSC 3U8VA 3ATPA 3G50A 1T6IA 5GPGB 2KQ9A 3GEEA 4BEJA 4A4AA 4IJJA 3EG9A 2R03A 2RD9A 3HLZA 4YN0B 2CNWD 2EILC 4IAQA 4AL1A 2YL3A 3T6BA 4MNDA 3N24A 3NMIA 5DQZA 3HNJA 2LK4A 1S7ZA 2A1DD 3JSEO 1APCA 3VYWA 4E17A 3U3BA 1NU7D 2J9WA 3DE8A 4XQ1A 2P0NA 2C03A 3Q6NA 2BL2A 4LDKA 3EFOA 4MW3A 2PX3A 2XLMA 3EPVA 3QZCA 3AOUA 5L0FA 3K1IC 4GEHA 3CAXA 3PDMP 5L0JA 3B0UX 1C02A 1KNYA 1MMGA 4AK9A 3E9VA 2XLVA 2ZXRA 4Z9JA 1Y4CA 4IWBA 4DRHB 4DVZA 2HZ8A 4ULVA 3RQGA 1JOGA 2G3KA 4XEFA 2G3VA 3FXHA 1JR8A 4U5HA 2PX0A 2R7VA 5A6AA 1KU2A 5BQGA 1T6QA 2E87A 1A7EA 1D1AA 5B3SC 2QY9A 3G4ZA 4MS2A 3V7OA 4YT8A 4OD4A 3ZDLA 2QE9A 3DE9A 1VMAA 5AC5A 1BR1A 3M4CA 3WODF 1D1BA 3B9QA 1HE9A 1Q0KA 4HE8D 4PJNA 2OJED 2CYDA 3GORA 1IZMA 4AE4A 4PJMA 1YDIA 1NSGB 2PBEA 3C63A 3I5PA 3O6XA 3RVYA 2L6HA 3AG2C 3ASOC 3TJ5A 3SZRA 2ZXWC 3EG9B 2GWWA 2YVKA 3OEOA 1WN0A 3PMRA 2B0JA 4OD5A 3UMKA 4AL0A 1S05A 3LEOA 4QDLA 5EK0A 1HY5A 3GODA 1VK5A 3JRMO 5BUOA 1YZAA 4XEKA 2VCCA 1ORYA 2OKUA 3DJUB 2OG2A 1N1CA 4C7OA 1EKYA 2Y3DA 1FNTc 2R7TA 3C8GA 4IARA 3HTKC 1QZXA 1XWJA 3L34A 1NZEA 1OW6A 2YL0A 4L6RA 3EFOB 3L8IA 4XWJA 1ZHWA 1Y6DA 3QVZA 2XL6A 3KYJA 4LDQA 4OINF 2OJQA 2Y69C 1FFTC 1Z63A 3U3FA 3LESA 2YZSA 3ASNC 3SXZA 4FX5A 1WOLA 5DLJA 4JEAA 2WB7A 3SNHA 4EHPA 3TJ6A 1J8YF 1V74B 5CI9A 1H7IA 1VLTA 2LP4A 3LNMB 4DBQA 4G78A 4YT2A 2B0HA 2XL4A 1T5OA 3FOPA 3K6BA 2VASA 4O6MA 3ZVRA 3HKKA 4OIPF 2GA0A 1WGWA 1YYJA 4EKWA 2D5RB 4U5BE 4P9FA 1O5HA 3UR3C 2J9VA 3M79A 4NQFA 5L0GA 3ECSA 2A6EF 4W8PA 3RW0A 3JYHA 3VRCA 3I5QA 2GDCA 2GAQA 2DYSC 1G4WR 3W2VA 4JCZA 3S0XA 5F5FA 3C7JA 4AE4B 2V26A 3K1HA 4G7HF 1YA9A 3IQ6A 3DMDA 3EQLF 4BPMA 1ORJA 4LACB 2YLGA 1FFHA 3JSZA 5JT4A 2ZXOA 1C03A 3ABMC 3CEXA 3GEIA 5JLIA 1VTMP 3NG1A 4JRZA 1OCZC 1V4AA 2AU5A 4CJGA 1YLMA 2A69F 1CGOA 1HMDA 4NC3A 5L0HA 2KJGA 4U5GA 4C7OB 1JAFA 1EI7A 3C8GB 5T1DB 3OWTA 3PCVA 5E33A 3U2LA 2X51A 2EPNA 3UMIA 1MMDA 4XPYA 1LKXA 2L6FA 3C62A 1E83A 4MVRA 4LLEA 3V5ZA 2KK1A 1LS1A 4EBBA 2IXOA 3TULA 2QUPA 5E2QA 3NKEA 2WZFA 1NBBA 3EHNA 3S9OA 3TK0A 1U0BB 1SZIA 3DAGA 3LJBA 4JW1A 4WGZA 1HW1A 4G7OF 2OOCA 4BJ6A 2OCCC 2IXPA 3DM5A 1IW7F 5L0DA 2DB4A 1PCXA 1Q0DA 1HMOA 2Y3GA 3NYLA 2D4UA 2FFHA 1FMWA 2CW0F 1FAPB 2EPMX 2Y39A 5HSWA 2LD6A 3EHMA 5KYWA 4JE9A 1RKCA 2XM0A 1AUEA 2HMQA 3HNKA 2I8BA 3B0PA 1V54C 3SXKA 4AX2A 3ITFA 3JZ0A 2HJMA 2YL7A 1A7DA 2HKVA 3LLKA 1D0ZA 1LVKA 5COGA 1ZW2A 4HFKB 4RD9A 1A7VA 5KYNA 4CSAA 3WAQA 4DRIB 3Q7LA 4MVUA 1DOWA 2Z15A 3IQTA 1LIHA 2MYSA 3GM3A 4BJ6C 4ZLCA 4ER9A 4EUKB 4O6NA 4UDVA 2L6GA 1SR2A 2EPLX 2ZXPA 4CS7A 2R7QA 4JZAA
chains in the Genus database with same CATH topology
1EI7A 3PDMP 1VTMP 4GQHA 3J06A 1RMVA 4UDVA 1CGME 2TMVP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EI7 A;  3PDM P;  1VTM P;  4GQH A;  3J06 A;  1RMV A;  4UDV A;  1CGM E;  2TMV P; 
#chains in the Genus database with same CATH topology
 3R7C A;  2AP3 A;  3T4R A;  5A6B A;  1QKR A;  1QSP A;  1K05 A;  3EZI A;  1K40 A;  1VYI A;  4JJG A;  1ZHX A;  3LLI A;  3JT1 A;  1DOV A;  2BC5 A;  2ASR A;  2PF4 E;  3EH1 A;  3NMJ A;  4BJ1 A;  4H4K C;  2J7P A;  4HEA J;  3J06 A;  1G8X A;  2P1A A;  2YEV A;  1JMW A;  3F47 A;  3LS1 A;  1FR0 A;  2J46 A;  2Q9A A;  1YVI A;  3F46 A;  3G4X A;  1CPQ A;  2KGO A;  3EGX B;  3IEE A;  1R5I D;  3LNR A;  4J30 B;  2XL8 A;  3A9C A;  3K66 A;  1OCC C;  3L8J A;  1BR4 A;  3NMK A;  2Y3B A;  4MTF A;  4CSA C;  3DM9 B;  4JEB A;  4U5E E;  3N0T A;  2LIG A;  4R32 A;  2YL1 A;  2GFH A;  2HJ3 A;  2XRH A;  3GEH A;  4I1O B;  5KYU B;  2Q9C A;  1I4Y A;  4WAB A;  2KYH A;  3FOO A;  4O7G A;  2PFD A;  4KBL A;  1AVO B;  1U89 A;  2HFI A;  2HSQ A;  2XM4 A;  5KYY B;  5KYW B;  1QQ3 A;  5L0C A;  3U9J A;  2QLA A;  3FVY A;  3V5Y A;  2L81 A;  4N4W A;  2WVQ A;  1ST6 A;  2HMZ A;  2W4B A;  3FAP B;  3U0C A;  3M4B A;  2JD3 A;  2WZL A;  2R7R A;  4DJ9 A;  1MQV A;  4K1O A;  4IGG A;  1ZHZ A;  2EPK X;  1FMV A;  1ZU5 A;  4FES A;  1WTY A;  3M1C B;  1Q0M A;  3GM2 A;  3EGD A;  4IB4 A;  1I4Z A;  4OIR F;  3AGU A;  2R7X A;  1ZHY A;  1ZYR F;  4Z9H A;  5F28 E;  3MX3 A;  1M2O A;  5T3W A;  3ZQY A;  4D4X A;  2J45 A;  3MYI A;  1OKK D;  1XZP A;  2H7B A;  1Z23 A;  4A2N B;  4PJL A;  1VOM A;  4CDV A;  1TWA A;  2W9Y A;  4J7T A;  4ULW A;  4U5D E;  1PD0 A;  2JX0 A;  2EIK C;  4PK4 A;  1E84 A;  1SYQ A;  2AWY A;  1VYK A;  2IBF A;  4I1M A;  1WAS A;  4EBK A;  2TMV P;  3I4U A;  5E3C A;  3UGP A;  3W8I A;  1PV3 A;  3E70 C;  3TD7 A;  2XLO A;  2XSE A;  4HFF B;  1OW7 A;  4MQ9 F;  4C3B A;  1H6G A;  5JRA A;  4Q4Z F;  2F22 A;  4PJJ A;  1YJG A;  2WVO A;  3AG1 C;  2CNW A;  3JRT A;  3LAY A;  2CGE A;  1MNE A;  2IXN A;  4K0D A;  4JTA B;  4RBN A;  1I5N A;  4KNV A;  4BEM J;  3B29 A;  3U8P A;  3AJM A;  3US6 A;  3VAY A;  3HNI A;  4MTG A;  3DKA A;  3K7D A;  1E85 A;  2UUI A;  2L7A A;  3CSK A;  4JKV A;  2NUT A;  2XXA A;  1Z7Q c;  2HS5 A;  4JTD B;  1CGN A;  2ETS A;  4MVZ A;  4DVY P;  3NDB B;  1M2V A;  3EH2 A;  4BJ5 A;  4PFP A;  4YK5 A;  2EPO A;  4CIP A;  1V55 C;  1ZVZ A;  3DJN B;  1JPJ A;  1TQG A;  2VCB A;  3BEH A;  3K33 A;  2MWQ A;  4CDA A;  1LI5 A;  1RJ9 A;  4XTK A;  3RIP A;  5B3I A;  4YL1 A;  5KYX A;  3JYY A;  3QMK A;  1LPE A;  2XLD A;  2V3C C;  1L3P A;  3EGD B;  3KMI A;  5COM A;  3W4Y A;  1NG1 A;  2YWA A;  2ZPA A;  5A6J A;  2ZD9 A;  4YT4 A;  2KC3 A;  2NSF A;  3IQ5 A;  4X0R A;  3SXM A;  1D1C A;  2M4E A;  1A41 A;  1QLE C;  1Z5Z A;  3EJN A;  3O55 A;  3U5S A;  1NFO A;  4QI2 A;  3MFN A;  1Z6A A;  4BG0 A;  1AEP A;  1TFK B;  2W45 A;  3U2M A;  3JCU Q;  3RKO F;  2PNO A;  2Q4F A;  3EGX A;  1TR2 A;  3ABK C;  4XPW A;  1TKN A;  3QW0 A;  1G4U S;  3S28 A;  3ZG1 A;  1ZZP A;  1HW2 A;  2FAP B;  4JUR I;  4BJ5 C;  2J8W A;  5EGY A;  1SMY F;  1CPR A;  2EIJ C;  3NYJ A;  1OXB A;  2P6V A;  4WGY A;  2NG1 A;  2VB6 A;  3DI5 A;  2M64 A;  1YAU O;  5K0I A;  1MND A;  3ABL C;  1MMN A;  3QW1 A;  2OEX A;  4LER A;  5KYU A;  1ZHT A;  1YZC A;  5KYY A;  4JJF A;  1E2X A;  256B A;  2P61 A;  1EQ1 A;  3MLG A;  1LI7 A;  4ANJ A;  2R7U A;  2NUT B;  3VF0 A;  3ZTM A;  3QTH A;  4JIO A;  1QVX A;  1O87 A;  5B1B C;  2JPU A;  3DWW A;  2XXA B;  3C8G D;  2Y3H A;  5CIV A;  4KC9 A;  4MTO A;  2YKZ A;  5DS5 A;  1JPN A;  2G62 A;  3L0I A;  4CDY A;  4I3M A;  4P6I C;  2OU6 A;  1M2V B;  2HSB A;  4IRU A;  5FZT A;  3RF3 A;  3RQE A;  3WHN A;  5A6K A;  5L3Q A;  2IXM A;  1OQC A;  4J32 B;  4W8K A;  2A68 F;  1GS9 A;  3KPH A;  4YL3 A;  3MBG A;  5T3T A;  3NYM A;  3FHD A;  1YA7 O;  3C18 A;  5DS4 A;  3GM1 A;  3H2V A;  1RJ9 B;  4DXW A;  1Q0G A;  1XZQ A;  5KYX B;  2H7O A;  3S29 A;  2WL8 A;  4KNW A;  3DXJ F;  4CS9 A;  3V5X A;  1M6T A;  3S90 A;  1GM5 A;  1JRA A;  1LE4 A;  3AGT A;  2EIN C;  1PD1 A;  3FAJ A;  3LS0 A;  4N06 A;  4XEV A;  5DVW A;  3WG7 C;  4E7S A;  1OXK A;  2KW3 C;  4GQH A;  4QI0 A;  2OQM A;  3O39 A;  4PR9 A;  4U9E A;  2R25 A;  4CBE A;  4PAC A;  3DD7 A;  3TOL A;  5JSL A;  4J7Y A;  3OA1 A;  4OIO F;  1WWP A;  1O3U A;  4GYT A;  4Q7C A;  2IM8 A;  5D92 A;  3KL4 A;  2XLH A;  4FWV A;  4BJT A;  1OCR C;  2XLW A;  4MVM A;  4XLN F;  2FGY A;  4CS8 C;  4XPX A;  1W2W A;  1B68 A;  1Z3I X;  4NTA A;  3FMS A;  2R02 A;  4DOZ A;  1VLS A;  3GWL A;  4JC7 A;  3NRH A;  1R4T A;  3SP1 A;  4EIY A;  1D0X A;  1K04 A;  2HV7 A;  3H2U A;  3N2Z B;  4CS9 C;  4KI2 A;  3B71 A;  2CCY A;  3IPM O;  4U5C E;  2R7W A;  3KYI A;  1BR2 A;  3VM6 A;  2NSG A;  3UNG C;  3ZSU A;  2A0U A;  4D4N A;  5BQH A;  2OEV A;  1CGM E;  3PHF 2;  4E7Z A;  4JTC B;  4CIH A;  1T01 A;  2J9B A;  2XS8 A;  4DRJ B;  3HNL A;  1BDJ B;  3UMH A;  1OR3 A;  4U5F E;  1RKE A;  5FCL A;  2KSF A;  2XLE A;  4I44 A;  2R05 A;  2R7O A;  3ZTZ A;  2NPU A;  4C3E A;  4C3D A;  4F4B A;  2J9U A;  4N6H A;  1M56 C;  4LDR A;  2I15 A;  2L9J A;  2CDQ A;  3RFY A;  3RVZ A;  4YWQ A;  1LE2 A;  3Q7G A;  5L0I A;  3CQZ A;  2A6H F;  2C04 A;  2VH3 A;  3KH2 A;  4CJO A;  3M15 A;  2P7V A;  1J8M F;  2VCA A;  3RQF A;  3IHU A;  2YLD A;  4ONS A;  3AQB A;  5E3A A;  2HV6 A;  2AWC A;  1UFB A;  4O79 A;  4DBR A;  1KTM A;  2IOQ A;  1L7C A;  4MVS A;  1GQA A;  1TWG A;  2NUP A;  3IQC A;  1RCP A;  3A11 A;  3ZIB A;  3W8H A;  1HE1 A;  1QPU A;  1TWH A;  3C8Z A;  4MVO A;  4NTF A;  2Q3T A;  1C17 M;  2DYR C;  3AQC A;  3JTL O;  4NCQ A;  3L1M A;  4YT5 A;  3T9O A;  1TWC A;  1E86 A;  1A0B A;  1RMV A;  1G5Z A;  1NFN A;  2LFF A;  1T9K A;  4XLP F;  4G0H A;  5A69 A;  4EWC A;  4G7Z F;  4JVS A;  3GAN A;  1BBH A;  1RXQ A;  4PFO A;  5BQI A;  4IAO A;  2XS1 A;  4EBJ A;  3TQO A;  2A0B A;  1YYX A;  5TJ5 E;  4FAP B;  1MMA A;  3GWN A;  2PP4 A;  5A6B D;  2QTV A;  5F5H A;  4LLC A;  3AG3 C;  4O6Y A;  3POV A;  2R7S A;  2WZG A;  1NU9 C;  3AG4 C;  1ZU4 A;  1M57 C;  2J0X A;  5DS6 A;  2R9R B;  4E0H A;  3HJC A;  2LFD A;  2VC9 A;  2J7P D;  4MVQ A;  4YL0 A;  1RKE B;  5JP7 A;  1F1M A;  2QNL A;  3LEV A;  3SEO A;  1FTS A;  5JS5 A;  2Q7R A;  1SF8 A;  3UGO A;  2LSE A;  4N6C A;  3ZC4 A;  4ZLD A;  4B6I A;  2DI3 A;  3LUT B;  2X0C A;  2AVK A;  3T6J A;  2YHS A;  4Z9I A;  1OW8 A;  2O9X A;  1D0Y A;  4E0I A;  1H9G A;  2H8A A;  1TFO B;  3KKB A;  3RYL A;  1YAR O;  2WVN A;  1LM3 B;  5D91 A;  2LQG A;  5IY5 C;  5L3V A;  1H9T A;  3X2Q C;  4NTB A;  2DGJ A;  5CI8 A;  1ZW3 A;  2ICW G;  2YQY A;  2Q00 A;  5EHH A;  1UG7 A;  3MYF A;  5JUA A;  4CX9 A;  1BZ4 A;  2J0W A;  3CZ6 A;  5AC4 A;  3R2P A;  3RH3 A;  2NUP B;  3U9M A;  4M63 A;  4OIQ F;  1VB5 A;  3FDQ A;  1WAT A;  5B1A C;  4Q5S F;  4H54 A;  5AGF A;  5JVE A;  3BRJ A;  1LS4 A;  4NY3 A;  1OR2 A;  2RSE B;  1NLX A;  2HUJ A;  1OCO C;  3X1O A;  1GGQ A;  3SXY A;  3O10 A;  3EZH A;  2H7V C;  3Q6M A;  5DQT A;  2YRF A;  4K7B A;  2LCH A;  3SYN A;  3S27 A;  1EA8 A;  4WJ0 A;  1T6U A;  3DZA A;  4E18 A;  3T6G B;  3S84 A;  5HV9 A;  3ZWI A;  1OKK A;  3DAF A;  4RDA A;  2W4M A;  2Q9B A;  4CS8 A;  2EIM C;  2IYL D;  3H65 A;  2BE5 F;  4YJW A;  1U6H A;  3NKD A;  3W2W A;  3QVY A;  4MW8 A;  3K1I A;  2YLI A;  4JCH A;  3TOM A;  5COF A;  3B0V C;  2UUH A;  1Q0F A;  2MHR A;  2KNH A;  4P9T A;  4U9D A;  3ZQV A;  1ORS C;  3U8V A;  3ATP A;  3G50 A;  1T6I A;  5GPG B;  2KQ9 A;  3GEE A;  4BEJ A;  4A4A A;  4IJJ A;  3EG9 A;  2R03 A;  2RD9 A;  3HLZ A;  4YN0 B;  2CNW D;  2EIL C;  4IAQ A;  4AL1 A;  2YL3 A;  3T6B A;  4MND A;  3N24 A;  3NMI A;  5DQZ A;  3HNJ A;  2LK4 A;  1S7Z A;  2A1D D;  3JSE O;  1APC A;  3VYW A;  4E17 A;  3U3B A;  1NU7 D;  2J9W A;  3DE8 A;  4XQ1 A;  2P0N A;  2C03 A;  3Q6N A;  2BL2 A;  4LDK A;  3EFO A;  4MW3 A;  2PX3 A;  2XLM A;  3EPV A;  3QZC A;  3AOU A;  5L0F A;  3K1I C;  4GEH A;  3CAX A;  3PDM P;  5L0J A;  3B0U X;  1C02 A;  1KNY A;  1MMG A;  4AK9 A;  3E9V A;  2XLV A;  2ZXR A;  4Z9J A;  1Y4C A;  4IWB A;  4DRH B;  4DVZ A;  2HZ8 A;  4ULV A;  3RQG A;  1JOG A;  2G3K A;  4XEF A;  2G3V A;  3FXH A;  1JR8 A;  4U5H A;  2PX0 A;  2R7V A;  5A6A A;  1KU2 A;  5BQG A;  1T6Q A;  2E87 A;  1A7E A;  1D1A A;  5B3S C;  2QY9 A;  3G4Z A;  4MS2 A;  3V7O A;  4YT8 A;  4OD4 A;  3ZDL A;  2QE9 A;  3DE9 A;  1VMA A;  5AC5 A;  1BR1 A;  3M4C A;  3WOD F;  1D1B A;  3B9Q A;  1HE9 A;  1Q0K A;  4HE8 D;  4PJN A;  2OJE D;  2CYD A;  3GOR A;  1IZM A;  4AE4 A;  4PJM A;  1YDI A;  1NSG B;  2PBE A;  3C63 A;  3I5P A;  3O6X A;  3RVY A;  2L6H A;  3AG2 C;  3ASO C;  3TJ5 A;  3SZR A;  2ZXW C;  3EG9 B;  2GWW A;  2YVK A;  3OEO A;  1WN0 A;  3PMR A;  2B0J A;  4OD5 A;  3UMK A;  4AL0 A;  1S05 A;  3LEO A;  4QDL A;  5EK0 A;  1HY5 A;  3GOD A;  1VK5 A;  3JRM O;  5BUO A;  1YZA A;  4XEK A;  2VCC A;  1ORY A;  2OKU A;  3DJU B;  2OG2 A;  1N1C A;  4C7O A;  1EKY A;  2Y3D A;  1FNT c;  2R7T A;  3C8G A;  4IAR A;  3HTK C;  1QZX A;  1XWJ A;  3L34 A;  1NZE A;  1OW6 A;  2YL0 A;  4L6R A;  3EFO B;  3L8I A;  4XWJ A;  1ZHW A;  1Y6D A;  3QVZ A;  2XL6 A;  3KYJ A;  4LDQ A;  4OIN F;  2OJQ A;  2Y69 C;  1FFT C;  1Z63 A;  3U3F A;  3LES A;  2YZS A;  3ASN C;  3SXZ A;  4FX5 A;  1WOL A;  5DLJ A;  4JEA A;  2WB7 A;  3SNH A;  4EHP A;  3TJ6 A;  1J8Y F;  1V74 B;  5CI9 A;  1H7I A;  1VLT A;  2LP4 A;  3LNM B;  4DBQ A;  4G78 A;  4YT2 A;  2B0H A;  2XL4 A;  1T5O A;  3FOP A;  3K6B A;  2VAS A;  4O6M A;  3ZVR A;  3HKK A;  4OIP F;  2GA0 A;  1WGW A;  1YYJ A;  4EKW A;  2D5R B;  4U5B E;  4P9F A;  1O5H A;  3UR3 C;  2J9V A;  3M79 A;  4NQF A;  5L0G A;  3ECS A;  2A6E F;  4W8P A;  3RW0 A;  3JYH A;  3VRC A;  3I5Q A;  2GDC A;  2GAQ A;  2DYS C;  1G4W R;  3W2V A;  4JCZ A;  3S0X A;  5F5F A;  3C7J A;  4AE4 B;  2V26 A;  3K1H A;  4G7H F;  1YA9 A;  3IQ6 A;  3DMD A;  3EQL F;  4BPM A;  1ORJ A;  4LAC B;  2YLG A;  1FFH A;  3JSZ A;  5JT4 A;  2ZXO A;  1C03 A;  3ABM C;  3CEX A;  3GEI A;  5JLI A;  1VTM P;  3NG1 A;  4JRZ A;  1OCZ C;  1V4A A;  2AU5 A;  4CJG A;  1YLM A;  2A69 F;  1CGO A;  1HMD A;  4NC3 A;  5L0H A;  2KJG A;  4U5G A;  4C7O B;  1JAF A;  1EI7 A;  3C8G B;  5T1D B;  3OWT A;  3PCV A;  5E33 A;  3U2L A;  2X51 A;  2EPN A;  3UMI A;  1MMD A;  4XPY A;  1LKX A;  2L6F A;  3C62 A;  1E83 A;  4MVR A;  4LLE A;  3V5Z A;  2KK1 A;  1LS1 A;  4EBB A;  2IXO A;  3TUL A;  2QUP A;  5E2Q A;  3NKE A;  2WZF A;  1NBB A;  3EHN A;  3S9O A;  3TK0 A;  1U0B B;  1SZI A;  3DAG A;  3LJB A;  4JW1 A;  4WGZ A;  1HW1 A;  4G7O F;  2OOC A;  4BJ6 A;  2OCC C;  2IXP A;  3DM5 A;  1IW7 F;  5L0D A;  2DB4 A;  1PCX A;  1Q0D A;  1HMO A;  2Y3G A;  3NYL A;  2D4U A;  2FFH A;  1FMW A;  2CW0 F;  1FAP B;  2EPM X;  2Y39 A;  5HSW A;  2LD6 A;  3EHM A;  5KYW A;  4JE9 A;  1RKC A;  2XM0 A;  1AUE A;  2HMQ A;  3HNK A;  2I8B A;  3B0P A;  1V54 C;  3SXK A;  4AX2 A;  3ITF A;  3JZ0 A;  2HJM A;  2YL7 A;  1A7D A;  2HKV A;  3LLK A;  1D0Z A;  1LVK A;  5COG A;  1ZW2 A;  4HFK B;  4RD9 A;  1A7V A;  5KYN A;  4CSA A;  3WAQ A;  4DRI B;  3Q7L A;  4MVU A;  1DOW A;  2Z15 A;  3IQT A;  1LIH A;  2MYS A;  3GM3 A;  4BJ6 C;  4ZLC A;  4ER9 A;  4EUK B;  4O6N A;  4UDV A;  2L6G A;  1SR2 A;  2EPL X;  2ZXP A;  4CS7 A;  2R7Q A;  4JZA A; 
#chains in the Genus database with same CATH homology
 1EI7 A;  3PDM P;  1VTM P;  4GQH A;  3J06 A;  1RMV A;  4UDV A;  1CGM E;  2TMV P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...