1RMVA

Ribgrass mosaic virus, fiber diffraction
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
156
structure length
156
Chain Sequence
SYNITNSNQYQYFAAVWAEPTPMLNQCVSALSQSYQTQAGRDTVRQQFANLLSTIVAPNQRFPDTGFRVYVNSAVIKPLYEALMKSFDTRNRIIETEEESRPSASEVANATQRVDDATVAIRSQIQLLLNELSNGHGYMNRAEFEAILPWTTAPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/rna
molecule keywords RIBGRASS MOSAIC VIRUS RNA
publication title Molecular dynamics in refinement against fiber diffraction data.
pubmed doi rcsb
total genus 38
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 1997-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00721 TMV_coat Virus coat protein (TMV like)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.70 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Tobacco mosaic virus-like, coat protein 1rmvA00
3PDMP 1VTMP 3J06A 2TMVP 1RMVA 4GQHA 4UDVA 1EI7A 1CGME
chains in the Genus database with same CATH superfamily
1YZCA 4NQFA 1TWAA 4QI0A 2J0XA 256BA 1Q0FA 1VLSA 2H8AA 4PJLA 1ZW2A 2R05A 3U2LA 3MX3A 1OW6A 2E87A 5L0HA 4JRZA 5AGFA 3RVYA 3ZTZA 2IXOA 2MHRA 2VH3A 3ZQYA 3AJMA 3PCVA 3ASOC 1YZAA 3WG7C 1TWCA 1G8XA 4PJMA 3SXMA 3H2VA 3SXKA 2XLVA 5DS6A 5L0CA 1SF8A 3X2QC 4IRUA 1NLXA 3O55A 3ZTMA 3G4XA 1ZW3A 2BL2A 1A0BA 2AU5A 2A69F 3W2WA 4AL0A 2HSBA 5KYYA 2Y3BA 4EBJA 2R9RB 4DBRA 2A0UA 1MNDA 2J9VA 3SEOA 3HJCA 2YL3A 3LNRA 1BR2A 2AVKA 3DKAA 3C8GB 1GM5A 4BJ6C 2VCBA 1LS1A 3CQZA 3R2PA 5COFA 4IARA 5E3CA 4OIRF 3S9OA 1PD1A 3LEVA 4MW3A 3U0CA 1UG7A 4HFFB 5DQZA 3C7JA 2J9WA 1HE1A 3AG3C 3L8JA 4C3BA 3DI5A 4EUKB 4JJGA 5HSWA 4GYTA 2MYSA 2XSEA 1OXKA 2WZLA 3EH2A 2WVNA 1MMGA 3BRJA 4IGGA 3FOOA 3U5SA 2NUPB 2I15A 3B9QA 4XLPF 1ST6A 2B0HA 2Q9CA 5EHHA 3UGOA 2NPUA 2VASA 5JT4A 4U5EE 2HSQA 2HMZA 1H9TA 3A9CA 4PK4A 2QE9A 1OR2A 4U9EA 2XL8A 3C62A 5L0DA 1MMNA 3ABLC 4DBQA 5TJ5E 2OU6A 3FXHA 5IY5C 3K33A 2ZXOA 3LLIA 2XLOA 4YT4A 5KYWB 3DMDA 2NUTB 4MVOA 4J30B 3UMIA 4ULVA 1XWJA 4I1MA 3S90A 3AGUA 1LE4A 1HW2A 4EWCA 4BJ6A 4YN0B 2XS1A 1VMAA 3DWWA 4HEAJ 3HTKC 2GDCA 5DVWA 1A7VA 4C3EA 1MMDA 4RBNA 3N24A 3QVZA 4A2NB 1C02A 1E86A 3TJ6A 1J8MF 3HNIA 1TWGA 2PX0A 3AGTA 3ATPA 1ORSC 3ZVRA 3GEHA 5KYUB 4XEVA 3EGXB 3IPMO 4FWVA 4JZAA 3JYHA 1Z7Qc 2ZXRA 2WVOA 2Y39A 1TR2A 3EZIA 3E70C 4UDVA 2R7WA 4C7OA 2C04A 2QTVA 4NTFA 2JX0A 1BR4A 2XLWA 2QUPA 1D0XA 1LE2A 2W4BA 1WOLA 4CS9C 4ZLDA 4CDAA 3B0VC 1VYIA 2IOQA 2Q9AA 4U5CE 4U5FE 2JD3A 2VB6A 4KI2A 2KGOA 2XL4A 3JZ0A 3MBGA 2PF4E 3NDBB 4Q5SF 5T3TA 3KYIA 1LI7A 1Z6AA 4Z9IA 3RQFA 3JCUQ 3JRTA 4H4KC 2NSFA 3M1CB 3U8VA 3H65A 3U8PA 3ZQVA 5L0JA 1OCZC 4MTFA 3AG4C 3L0IA 5A6BD 2L7AA 4MTGA 4Z9HA 3UR3C 1IW7F 2RSEB 1JRAA 3FOPA 4LLEA 4PJJA 1EI7A 1WGWA 1K05A 3E9VA 2YVKA 4CJOA 3GWLA 1JR8A 1PD0A 2Z15A 3SZRA 1AUEA 3GANA 1RKEB 3T9OA 3UMKA 4F4BA 2CNWA 3TULA 3R7CA 5E33A 2AWCA 1D1CA 3IQCA 2IXNA 1DOWA 4Z9JA 1E84A 1G5ZA 3C8GA 1TFOB 2AP3A 3RF3A 4H54A 3V5XA 1RKCA 1GQAA 4JEAA 4M63A 3DZAA 1YAUO 2LIGA 1U89A 3JRMO 2YZSA 1ZHWA 5D91A 1XZPA 1RJ9A 1A7EA 1CPQA 3KKBA 1OCCC 2KC3A 4PFOA 3VAYA 4EBKA 2H7OA 1ZVZA 5JP7A 4QI2A 1VK5A 2Y3GA 1B68A 4GEHA 4O79A 4YJWA 3VM6A 1PCXA 2A6HF 3FAPB 1NU7D 2BC5A 3O6XA 4U5BE 3U9JA 5BUOA 3S84A 1SMYF 2P61A 1LPEA 4JEBA 3GEIA 2QY9A 2FAPB 4R32A 1T6UA 3G50A 1FMVA 3MYFA 2A1DD 4KC9A 5CIVA 2ASRA 1Z3IX 1H6GA 3Q7LA 1JAFA 3N2ZB 4MVZA 1T5OA 3ZC4A 5KYWA 2NUTA 3C18A 3UMHA 2R25A 4LACB 1OCRC 4CBEA 4CS8A 1SYQA 3FAJA 4NCQA 4AE4A 3VYWA 2XS8A 5KYXB 4XPWA 3Q6MA 4I3MA 2Q7RA 1WTYA 1YYJA 5FCLA 5B1BC 2RD9A 2LSEA 1HMDA 1DOVA 1WWPA 2HFIA 4I1OB 2R7UA 2J9BA 2H7VC 5KYUA 3EGXA 1WATA 3JTLO 4JJFA 1BDJB 1ZZPA 4B6IA 4IAOA 4JVSA 4DRHB 4G78A 3J06A 2R7QA 2KYHA 4EKWA 1BZ4A 2YLIA 1GS9A 1TWHA 1QKRA 4XPXA 3Q6NA 4E18A 3RYLA 1QVXA 3SNHA 1YLMA 4AX2A 2YL7A 3IQTA 5B1AC 5B3IA 3US6A 1LM3B 2X51A 4MVQA 1ZYRF 3GWNA 4O6NA 4O6MA 4NTBA 4J32B 1R4TA 2O9XA 2A6EF 3FMSA 5E3AA 3GEEA 5JS5A 4YL3A 2LCHA 3SXYA 4CDYA 2CGEA 4NY3A 3KYJA 1ORJA 2XL6A 4YK5A 1WN0A 2VC9A 2I8BA 3EHMA 4MTOA 3AG1C 2L6GA 2L9JA 2TMVP 4W8KA 1RJ9B 1FAPB 1VOMA 3UNGC 1QPUA 1VLTA 2YQYA 4CSAC 2J8WA 1YVIA 2KJGA 3GM2A 1RKEA 2EIJC 4JTDB 4U5DE 3EHNA 4BEJA 1OW7A 4BG0A 5JRAA 2WZGA 5A6KA 3GM3A 2R7XA 3L8IA 4MNDA 2J0WA 4JTAB 4BJTA 2XXAA 1TFKB 2LQGA 1RCPA 2Q4FA 3HNKA 4LERA 1OKKD 4Q4ZF 4LLCA 3V7OA 4DRJB 3B29A 4CIHA 3AQCA 3FDQA 2IM8A 1Y6DA 2J9UA 3N0TA 3NMKA 5GPGB 1EKYA 3W2VA 2BE5F 5DQTA 4W8PA 2HMQA 1RXQA 4PACA 2M64A 3NG1A 4AE4B 2HV7A 4G7ZF 4XTKA 5L0IA 2KSFA 2EIKC 1V74B 3ZSUA 2R02A 4YWQA 1MMAA 2G62A 4YL1A 3TK0A 1T9KA 1WASA 3GM1A 5T1DB 1J8YF 4XLNF 5D92A 3DD7A 4CSAA 4DVZA 3WODF 3GODA 1OW8A 2IBFA 3PMRA 2EPMX 1JPJA 1AEPA 2OQMA 1L7CA 5CI8A 3LJBA 2J7PD 3ZG1A 3ZDLA 3EGDB 1BR1A 3HNLA 1PV3A 4G7HF 2OOCA 3U2MA 2KK1A 4RD9A 2J46A 4KNVA 5KYXA 1LIHA 2L6FA 5BQGA 3RIPA 2L81A 1E85A 1SR2A 5T3WA 1I5NA 4LDQA 3DJNB 5FZTA 3EPVA 5JSLA 2G3VA 1FTSA 2YKZA 3MLGA 4XQ1A 1EA8A 1Z23A 1V4AA 1FFTC 1T01A 2PX3A 4ER9A 3EH1A 3V5YA 1YARO 4U9DA 1EQ1A 2NSGA 3QMKA 1U0BB 1YYXA 1JPNA 4GQHA 2HS5A 4KBLA 3W4YA 1ZU4A 4OIOF 2QNLA 3DM9B 1NG1A 2P6VA 2CYDA 2DI3A 2FGYA 2NG1A 5HV9A 2Q3TA 1C17M 2XXAB 1OXBA 2EPKX 3HNJA 4OD5A 2JPUA 1HMOA 2XLMA 4CDVA 4CS9A 5DS5A 4K1OA 4RDAA 3OEOA 2ZD9A 3KPHA 3TJ5A 4N6CA 4YL0A 2PP4A 5DS4A 1Z5ZA 1R5ID 3K1IC 4OIQF 3JYYA 1HY5A 3I5PA 4DVYP 5K0IA 3CAXA 1RMVA 5F5FA 2Y3HA 1MQVA 4MVRA 5BQHA 3LUTB 5JLIA 4BPMA 3ZWIA 1O3UA 1S7ZA 3IQ5A 1ZHTA 1ZHXA 2HV6A 2VCCA 4X0RA 3QW0A 3RH3A 1T6IA 3DAFA 1Q0KA 3NYMA 3QVYA 3M79A 3DXJF 4OINF 1M56C 1O87A 3W8IA 2A68F 2X0CA 3L34A 1W2WA 3B71A 3TQOA 2OJQA 1KNYA 2WB7A 3IQ6A 3DM5A 1V55C 1F1MA 1M6TA 2W4MA 4FESA 4HE8D 3HKKA 3RW0A 4ULWA 1GGQA 1N1CA 3AOUA 3NMJA 4WGZA 3OA1A 2MWQA 4XEKA 2R7SA 3K1HA 2YLGA 2WZFA 4E7SA 2AWYA 1LVKA 1IZMA 1FR0A 1HE9A 5COMA 3I5QA 3LNMB 1SZIA 1S05A 2OEXA 2P7VA 2GA0A 2HUJA 3T4RA 5AC5A 2OG2A 5EK0A 5L3VA 3U9MA 4MS2A 4WGYA 3S27A 3O10A 3TOMA 1CGOA 1I4YA 4BEMJ 1OQCA 3NRHA 3LS1A 4FX5A 3EGDA 3IEEA 4MVUA 2XLHA 2EPNA 3EQLF 4YT5A 3W8HA 4ONSA 4PJNA 2HKVA 3O39A 4OIPF 1K04A 4Q7CA 2LD6A 1HW1A 1L3PA 5KYNA 4E0HA 2EILC 5DLJA 4CIPA 2IYLD 2WVQA 3RKOF 1O5HA 2PBEA 2XM4A 3K66A 1CGME 1LS4A 1G4US 3A11A 3C8ZA 3VF0A 5A6BA 1VTMP 3JSEO 4U5HA 3ASNC 5A6AA 3BEHA 3KL4A 1Z63A 1XZQA 2M4EA 2YWAA 4I44A 3EJNA 4CS7A 2DB4A 4IJJA 5B3SC 3CSKA 3PDMP 2GFHA 4IWBA 3B0PA 2V26A 3WHNA 4D4NA 4P9FA 4DXWA 1APCA 3DE9A 4DRIB 1KU2A 2CNWD 3LAYA 5F28E 2XLEA 3LEOA 2ZPAA 3SYNA 1JMWA 2XRHA 3NYLA 2OJED 4MVMA 4DOZA 1TKNA 2GWWA 3M4BA 1ZHZA 4JKVA 5AC4A 3RQEA 1FFHA 3EFOA 1VYKA 4FAPB 1D1AA 3C8GD 2A0BA 1M2VB 4WABA 3SP1A 3ECSA 3QW1A 3TD7A 1A7DA 4HFKB 1QLEC 4LDRA 4XWJA 3QZCA 3POVA 5EGYA 5JVEA 1AVOB 2FFHA 3Q7GA 2OEVA 3RFYA 3V5ZA 1YJGA 3F47A 4U5GA 3U3BA 2UUIA 3DAGA 3S28A 3C63A 2F22A 5L0FA 2EINC 2LFFA 3F46A 1CPRA 3EG9B 4KNWA 3RQGA 4BJ5C 3ABKC 3FVYA 2EPLX 2QLAA 1QZXA 2ZXPA 3M4CA 3WAQA 3NKEA 3NMIA 1Q0GA 4EBBA 4P6IC 4JCZA 2PFDA 3X1OA 4NTAA 3OWTA 1Y4CA 2DGJA 2Y69C 3K7DA 1NFNA 1M57C 1OCOC 1T6QA 2Y3DA 1JOGA 3KH2A 4JC7A 3TOLA 5L3QA 3QTHA 3NKDA 2IXPA 1K40A 2HZ8A 2LK4A 2CW0F 1VB5A 4JE9A 2R7VA 1YA7O 5F5HA 4YT2A 2OCCC 1YA9A 4MVSA 2HJMA 1LI5A 3ZIBA 4DJ9A 1QQ3A 5L0GA 4PR9A 4MW8A 1UFBA 3H2UA 4D4XA 2GAQA 1ZHYA 1ORYA 1LKXA 1YDIA 4MQ9F 4N06A 2CCYA 4EIYA 4G7OF 2EPOA 2YEVA 1OR3A 3DE8A 1Q0DA 4E7ZA 2B0JA 2KW3C 1E2XA 2P1AA 3T6JA 4JW1A 4BJ5A 1QSPA 1NSGB 3NYJA 2DYSC 4IB4A 4N4WA 3HLZA 3DJUB 3VRCA 1NU9C 3B0UX 4LDKA 4IAQA 4A4AA 3CEXA 3AG2C 2R7OA 3LLKA 4NC3A 1H7IA 5COGA 4AK9A 1FMWA 2G3KA 2YHSA 2P0NA 3G4ZA 4J7TA 2Q00A 2ZXWC 1A41A 5KYYB 3PHF2 2D4UA 1BBHA 1I4ZA 1C03A 3MFNA 3GORA 1V54C 2KNHA 2IXMA 3UGPA 2HJ3A 1CGNA 3EFOB 4P9TA 2CDQA 4K7BA 3K6BA 2YRFA 2YLDA 4BJ1A 2D5RB 3S0XA 3LESA 1KTMA 3IHUA 3SXZA 3JT1A 4C3DA 4CX9A 1D1BA 1FNTc 1Q0MA 2W9YA 4E0IA 2W45A 5A69A 2UUHA 3LS0A 4ANJA 2DYRC 2EIMC 4JTCB 4CJGA 4E17A 4XEFA 2R7TA 3T6GB 2LFDA 3RVZA 4YT8A 2ETSA 3FHDA 5E2QA 3L1MA 4ZLCA 1ZU5A 5BQIA 2V3CC 1H9GA 1NZEA 4CS8C 1OKKA 4N6HA 2YL1A 3S29A 1MNEA 3ABMC 1M2VA 5A6JA 4XPYA 2R03A 3T6BA 5CI9A 3EZHA 4JCHA 2XM0A 4J7YA 2ICWG 2H7BA 1NBBA 4EHPA 3ITFA 4JURI 3EG9A 4K0DA 1D0ZA 4O6YA 1U6HA 2NUPA 3AQBA 3CZ6A 1TQGA 3U3FA 1E83A 4O7GA 4QDLA 4JIOA 1G4WR 2J45A 2L6HA 4PFPA 1D0YA 3K1IA 2Q9BA 2XLDA 3JSZA 2R7RA 1M2OA 2C03A 2YL0A 5JUAA 3I4UA 2J7PA 1NFOA 3MYIA 4C7OB 2OKUA 3KMIA 3M15A 2KQ9A 2VCAA 2WL8A 4OD4A 4L6RA 2PNOA 4WJ0A 4G0HA 4AL1A 2LP4A
chains in the Genus database with same CATH topology
3PDMP 1VTMP 3J06A 2TMVP 1RMVA 4GQHA 4UDVA 1EI7A 1CGME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PDM P;  1VTM P;  3J06 A;  2TMV P;  1RMV A;  4GQH A;  4UDV A;  1EI7 A;  1CGM E; 
#chains in the Genus database with same CATH topology
 1YZC A;  4NQF A;  1TWA A;  4QI0 A;  2J0X A;  256B A;  1Q0F A;  1VLS A;  2H8A A;  4PJL A;  1ZW2 A;  2R05 A;  3U2L A;  3MX3 A;  1OW6 A;  2E87 A;  5L0H A;  4JRZ A;  5AGF A;  3RVY A;  3ZTZ A;  2IXO A;  2MHR A;  2VH3 A;  3ZQY A;  3AJM A;  3PCV A;  3ASO C;  1YZA A;  3WG7 C;  1TWC A;  1G8X A;  4PJM A;  3SXM A;  3H2V A;  3SXK A;  2XLV A;  5DS6 A;  5L0C A;  1SF8 A;  3X2Q C;  4IRU A;  1NLX A;  3O55 A;  3ZTM A;  3G4X A;  1ZW3 A;  2BL2 A;  1A0B A;  2AU5 A;  2A69 F;  3W2W A;  4AL0 A;  2HSB A;  5KYY A;  2Y3B A;  4EBJ A;  2R9R B;  4DBR A;  2A0U A;  1MND A;  2J9V A;  3SEO A;  3HJC A;  2YL3 A;  3LNR A;  1BR2 A;  2AVK A;  3DKA A;  3C8G B;  1GM5 A;  4BJ6 C;  2VCB A;  1LS1 A;  3CQZ A;  3R2P A;  5COF A;  4IAR A;  5E3C A;  4OIR F;  3S9O A;  1PD1 A;  3LEV A;  4MW3 A;  3U0C A;  1UG7 A;  4HFF B;  5DQZ A;  3C7J A;  2J9W A;  1HE1 A;  3AG3 C;  3L8J A;  4C3B A;  3DI5 A;  4EUK B;  4JJG A;  5HSW A;  4GYT A;  2MYS A;  2XSE A;  1OXK A;  2WZL A;  3EH2 A;  2WVN A;  1MMG A;  3BRJ A;  4IGG A;  3FOO A;  3U5S A;  2NUP B;  2I15 A;  3B9Q A;  4XLP F;  1ST6 A;  2B0H A;  2Q9C A;  5EHH A;  3UGO A;  2NPU A;  2VAS A;  5JT4 A;  4U5E E;  2HSQ A;  2HMZ A;  1H9T A;  3A9C A;  4PK4 A;  2QE9 A;  1OR2 A;  4U9E A;  2XL8 A;  3C62 A;  5L0D A;  1MMN A;  3ABL C;  4DBQ A;  5TJ5 E;  2OU6 A;  3FXH A;  5IY5 C;  3K33 A;  2ZXO A;  3LLI A;  2XLO A;  4YT4 A;  5KYW B;  3DMD A;  2NUT B;  4MVO A;  4J30 B;  3UMI A;  4ULV A;  1XWJ A;  4I1M A;  3S90 A;  3AGU A;  1LE4 A;  1HW2 A;  4EWC A;  4BJ6 A;  4YN0 B;  2XS1 A;  1VMA A;  3DWW A;  4HEA J;  3HTK C;  2GDC A;  5DVW A;  1A7V A;  4C3E A;  1MMD A;  4RBN A;  3N24 A;  3QVZ A;  4A2N B;  1C02 A;  1E86 A;  3TJ6 A;  1J8M F;  3HNI A;  1TWG A;  2PX0 A;  3AGT A;  3ATP A;  1ORS C;  3ZVR A;  3GEH A;  5KYU B;  4XEV A;  3EGX B;  3IPM O;  4FWV A;  4JZA A;  3JYH A;  1Z7Q c;  2ZXR A;  2WVO A;  2Y39 A;  1TR2 A;  3EZI A;  3E70 C;  4UDV A;  2R7W A;  4C7O A;  2C04 A;  2QTV A;  4NTF A;  2JX0 A;  1BR4 A;  2XLW A;  2QUP A;  1D0X A;  1LE2 A;  2W4B A;  1WOL A;  4CS9 C;  4ZLD A;  4CDA A;  3B0V C;  1VYI A;  2IOQ A;  2Q9A A;  4U5C E;  4U5F E;  2JD3 A;  2VB6 A;  4KI2 A;  2KGO A;  2XL4 A;  3JZ0 A;  3MBG A;  2PF4 E;  3NDB B;  4Q5S F;  5T3T A;  3KYI A;  1LI7 A;  1Z6A A;  4Z9I A;  3RQF A;  3JCU Q;  3JRT A;  4H4K C;  2NSF A;  3M1C B;  3U8V A;  3H65 A;  3U8P A;  3ZQV A;  5L0J A;  1OCZ C;  4MTF A;  3AG4 C;  3L0I A;  5A6B D;  2L7A A;  4MTG A;  4Z9H A;  3UR3 C;  1IW7 F;  2RSE B;  1JRA A;  3FOP A;  4LLE A;  4PJJ A;  1EI7 A;  1WGW A;  1K05 A;  3E9V A;  2YVK A;  4CJO A;  3GWL A;  1JR8 A;  1PD0 A;  2Z15 A;  3SZR A;  1AUE A;  3GAN A;  1RKE B;  3T9O A;  3UMK A;  4F4B A;  2CNW A;  3TUL A;  3R7C A;  5E33 A;  2AWC A;  1D1C A;  3IQC A;  2IXN A;  1DOW A;  4Z9J A;  1E84 A;  1G5Z A;  3C8G A;  1TFO B;  2AP3 A;  3RF3 A;  4H54 A;  3V5X A;  1RKC A;  1GQA A;  4JEA A;  4M63 A;  3DZA A;  1YAU O;  2LIG A;  1U89 A;  3JRM O;  2YZS A;  1ZHW A;  5D91 A;  1XZP A;  1RJ9 A;  1A7E A;  1CPQ A;  3KKB A;  1OCC C;  2KC3 A;  4PFO A;  3VAY A;  4EBK A;  2H7O A;  1ZVZ A;  5JP7 A;  4QI2 A;  1VK5 A;  2Y3G A;  1B68 A;  4GEH A;  4O79 A;  4YJW A;  3VM6 A;  1PCX A;  2A6H F;  3FAP B;  1NU7 D;  2BC5 A;  3O6X A;  4U5B E;  3U9J A;  5BUO A;  3S84 A;  1SMY F;  2P61 A;  1LPE A;  4JEB A;  3GEI A;  2QY9 A;  2FAP B;  4R32 A;  1T6U A;  3G50 A;  1FMV A;  3MYF A;  2A1D D;  4KC9 A;  5CIV A;  2ASR A;  1Z3I X;  1H6G A;  3Q7L A;  1JAF A;  3N2Z B;  4MVZ A;  1T5O A;  3ZC4 A;  5KYW A;  2NUT A;  3C18 A;  3UMH A;  2R25 A;  4LAC B;  1OCR C;  4CBE A;  4CS8 A;  1SYQ A;  3FAJ A;  4NCQ A;  4AE4 A;  3VYW A;  2XS8 A;  5KYX B;  4XPW A;  3Q6M A;  4I3M A;  2Q7R A;  1WTY A;  1YYJ A;  5FCL A;  5B1B C;  2RD9 A;  2LSE A;  1HMD A;  1DOV A;  1WWP A;  2HFI A;  4I1O B;  2R7U A;  2J9B A;  2H7V C;  5KYU A;  3EGX A;  1WAT A;  3JTL O;  4JJF A;  1BDJ B;  1ZZP A;  4B6I A;  4IAO A;  4JVS A;  4DRH B;  4G78 A;  3J06 A;  2R7Q A;  2KYH A;  4EKW A;  1BZ4 A;  2YLI A;  1GS9 A;  1TWH A;  1QKR A;  4XPX A;  3Q6N A;  4E18 A;  3RYL A;  1QVX A;  3SNH A;  1YLM A;  4AX2 A;  2YL7 A;  3IQT A;  5B1A C;  5B3I A;  3US6 A;  1LM3 B;  2X51 A;  4MVQ A;  1ZYR F;  3GWN A;  4O6N A;  4O6M A;  4NTB A;  4J32 B;  1R4T A;  2O9X A;  2A6E F;  3FMS A;  5E3A A;  3GEE A;  5JS5 A;  4YL3 A;  2LCH A;  3SXY A;  4CDY A;  2CGE A;  4NY3 A;  3KYJ A;  1ORJ A;  2XL6 A;  4YK5 A;  1WN0 A;  2VC9 A;  2I8B A;  3EHM A;  4MTO A;  3AG1 C;  2L6G A;  2L9J A;  2TMV P;  4W8K A;  1RJ9 B;  1FAP B;  1VOM A;  3UNG C;  1QPU A;  1VLT A;  2YQY A;  4CSA C;  2J8W A;  1YVI A;  2KJG A;  3GM2 A;  1RKE A;  2EIJ C;  4JTD B;  4U5D E;  3EHN A;  4BEJ A;  1OW7 A;  4BG0 A;  5JRA A;  2WZG A;  5A6K A;  3GM3 A;  2R7X A;  3L8I A;  4MND A;  2J0W A;  4JTA B;  4BJT A;  2XXA A;  1TFK B;  2LQG A;  1RCP A;  2Q4F A;  3HNK A;  4LER A;  1OKK D;  4Q4Z F;  4LLC A;  3V7O A;  4DRJ B;  3B29 A;  4CIH A;  3AQC A;  3FDQ A;  2IM8 A;  1Y6D A;  2J9U A;  3N0T A;  3NMK A;  5GPG B;  1EKY A;  3W2V A;  2BE5 F;  5DQT A;  4W8P A;  2HMQ A;  1RXQ A;  4PAC A;  2M64 A;  3NG1 A;  4AE4 B;  2HV7 A;  4G7Z F;  4XTK A;  5L0I A;  2KSF A;  2EIK C;  1V74 B;  3ZSU A;  2R02 A;  4YWQ A;  1MMA A;  2G62 A;  4YL1 A;  3TK0 A;  1T9K A;  1WAS A;  3GM1 A;  5T1D B;  1J8Y F;  4XLN F;  5D92 A;  3DD7 A;  4CSA A;  4DVZ A;  3WOD F;  3GOD A;  1OW8 A;  2IBF A;  3PMR A;  2EPM X;  1JPJ A;  1AEP A;  2OQM A;  1L7C A;  5CI8 A;  3LJB A;  2J7P D;  3ZG1 A;  3ZDL A;  3EGD B;  1BR1 A;  3HNL A;  1PV3 A;  4G7H F;  2OOC A;  3U2M A;  2KK1 A;  4RD9 A;  2J46 A;  4KNV A;  5KYX A;  1LIH A;  2L6F A;  5BQG A;  3RIP A;  2L81 A;  1E85 A;  1SR2 A;  5T3W A;  1I5N A;  4LDQ A;  3DJN B;  5FZT A;  3EPV A;  5JSL A;  2G3V A;  1FTS A;  2YKZ A;  3MLG A;  4XQ1 A;  1EA8 A;  1Z23 A;  1V4A A;  1FFT C;  1T01 A;  2PX3 A;  4ER9 A;  3EH1 A;  3V5Y A;  1YAR O;  4U9D A;  1EQ1 A;  2NSG A;  3QMK A;  1U0B B;  1YYX A;  1JPN A;  4GQH A;  2HS5 A;  4KBL A;  3W4Y A;  1ZU4 A;  4OIO F;  2QNL A;  3DM9 B;  1NG1 A;  2P6V A;  2CYD A;  2DI3 A;  2FGY A;  2NG1 A;  5HV9 A;  2Q3T A;  1C17 M;  2XXA B;  1OXB A;  2EPK X;  3HNJ A;  4OD5 A;  2JPU A;  1HMO A;  2XLM A;  4CDV A;  4CS9 A;  5DS5 A;  4K1O A;  4RDA A;  3OEO A;  2ZD9 A;  3KPH A;  3TJ5 A;  4N6C A;  4YL0 A;  2PP4 A;  5DS4 A;  1Z5Z A;  1R5I D;  3K1I C;  4OIQ F;  3JYY A;  1HY5 A;  3I5P A;  4DVY P;  5K0I A;  3CAX A;  1RMV A;  5F5F A;  2Y3H A;  1MQV A;  4MVR A;  5BQH A;  3LUT B;  5JLI A;  4BPM A;  3ZWI A;  1O3U A;  1S7Z A;  3IQ5 A;  1ZHT A;  1ZHX A;  2HV6 A;  2VCC A;  4X0R A;  3QW0 A;  3RH3 A;  1T6I A;  3DAF A;  1Q0K A;  3NYM A;  3QVY A;  3M79 A;  3DXJ F;  4OIN F;  1M56 C;  1O87 A;  3W8I A;  2A68 F;  2X0C A;  3L34 A;  1W2W A;  3B71 A;  3TQO A;  2OJQ A;  1KNY A;  2WB7 A;  3IQ6 A;  3DM5 A;  1V55 C;  1F1M A;  1M6T A;  2W4M A;  4FES A;  4HE8 D;  3HKK A;  3RW0 A;  4ULW A;  1GGQ A;  1N1C A;  3AOU A;  3NMJ A;  4WGZ A;  3OA1 A;  2MWQ A;  4XEK A;  2R7S A;  3K1H A;  2YLG A;  2WZF A;  4E7S A;  2AWY A;  1LVK A;  1IZM A;  1FR0 A;  1HE9 A;  5COM A;  3I5Q A;  3LNM B;  1SZI A;  1S05 A;  2OEX A;  2P7V A;  2GA0 A;  2HUJ A;  3T4R A;  5AC5 A;  2OG2 A;  5EK0 A;  5L3V A;  3U9M A;  4MS2 A;  4WGY A;  3S27 A;  3O10 A;  3TOM A;  1CGO A;  1I4Y A;  4BEM J;  1OQC A;  3NRH A;  3LS1 A;  4FX5 A;  3EGD A;  3IEE A;  4MVU A;  2XLH A;  2EPN A;  3EQL F;  4YT5 A;  3W8H A;  4ONS A;  4PJN A;  2HKV A;  3O39 A;  4OIP F;  1K04 A;  4Q7C A;  2LD6 A;  1HW1 A;  1L3P A;  5KYN A;  4E0H A;  2EIL C;  5DLJ A;  4CIP A;  2IYL D;  2WVQ A;  3RKO F;  1O5H A;  2PBE A;  2XM4 A;  3K66 A;  1CGM E;  1LS4 A;  1G4U S;  3A11 A;  3C8Z A;  3VF0 A;  5A6B A;  1VTM P;  3JSE O;  4U5H A;  3ASN C;  5A6A A;  3BEH A;  3KL4 A;  1Z63 A;  1XZQ A;  2M4E A;  2YWA A;  4I44 A;  3EJN A;  4CS7 A;  2DB4 A;  4IJJ A;  5B3S C;  3CSK A;  3PDM P;  2GFH A;  4IWB A;  3B0P A;  2V26 A;  3WHN A;  4D4N A;  4P9F A;  4DXW A;  1APC A;  3DE9 A;  4DRI B;  1KU2 A;  2CNW D;  3LAY A;  5F28 E;  2XLE A;  3LEO A;  2ZPA A;  3SYN A;  1JMW A;  2XRH A;  3NYL A;  2OJE D;  4MVM A;  4DOZ A;  1TKN A;  2GWW A;  3M4B A;  1ZHZ A;  4JKV A;  5AC4 A;  3RQE A;  1FFH A;  3EFO A;  1VYK A;  4FAP B;  1D1A A;  3C8G D;  2A0B A;  1M2V B;  4WAB A;  3SP1 A;  3ECS A;  3QW1 A;  3TD7 A;  1A7D A;  4HFK B;  1QLE C;  4LDR A;  4XWJ A;  3QZC A;  3POV A;  5EGY A;  5JVE A;  1AVO B;  2FFH A;  3Q7G A;  2OEV A;  3RFY A;  3V5Z A;  1YJG A;  3F47 A;  4U5G A;  3U3B A;  2UUI A;  3DAG A;  3S28 A;  3C63 A;  2F22 A;  5L0F A;  2EIN C;  2LFF A;  3F46 A;  1CPR A;  3EG9 B;  4KNW A;  3RQG A;  4BJ5 C;  3ABK C;  3FVY A;  2EPL X;  2QLA A;  1QZX A;  2ZXP A;  3M4C A;  3WAQ A;  3NKE A;  3NMI A;  1Q0G A;  4EBB A;  4P6I C;  4JCZ A;  2PFD A;  3X1O A;  4NTA A;  3OWT A;  1Y4C A;  2DGJ A;  2Y69 C;  3K7D A;  1NFN A;  1M57 C;  1OCO C;  1T6Q A;  2Y3D A;  1JOG A;  3KH2 A;  4JC7 A;  3TOL A;  5L3Q A;  3QTH A;  3NKD A;  2IXP A;  1K40 A;  2HZ8 A;  2LK4 A;  2CW0 F;  1VB5 A;  4JE9 A;  2R7V A;  1YA7 O;  5F5H A;  4YT2 A;  2OCC C;  1YA9 A;  4MVS A;  2HJM A;  1LI5 A;  3ZIB A;  4DJ9 A;  1QQ3 A;  5L0G A;  4PR9 A;  4MW8 A;  1UFB A;  3H2U A;  4D4X A;  2GAQ A;  1ZHY A;  1ORY A;  1LKX A;  1YDI A;  4MQ9 F;  4N06 A;  2CCY A;  4EIY A;  4G7O F;  2EPO A;  2YEV A;  1OR3 A;  3DE8 A;  1Q0D A;  4E7Z A;  2B0J A;  2KW3 C;  1E2X A;  2P1A A;  3T6J A;  4JW1 A;  4BJ5 A;  1QSP A;  1NSG B;  3NYJ A;  2DYS C;  4IB4 A;  4N4W A;  3HLZ A;  3DJU B;  3VRC A;  1NU9 C;  3B0U X;  4LDK A;  4IAQ A;  4A4A A;  3CEX A;  3AG2 C;  2R7O A;  3LLK A;  4NC3 A;  1H7I A;  5COG A;  4AK9 A;  1FMW A;  2G3K A;  2YHS A;  2P0N A;  3G4Z A;  4J7T A;  2Q00 A;  2ZXW C;  1A41 A;  5KYY B;  3PHF 2;  2D4U A;  1BBH A;  1I4Z A;  1C03 A;  3MFN A;  3GOR A;  1V54 C;  2KNH A;  2IXM A;  3UGP A;  2HJ3 A;  1CGN A;  3EFO B;  4P9T A;  2CDQ A;  4K7B A;  3K6B A;  2YRF A;  2YLD A;  4BJ1 A;  2D5R B;  3S0X A;  3LES A;  1KTM A;  3IHU A;  3SXZ A;  3JT1 A;  4C3D A;  4CX9 A;  1D1B A;  1FNT c;  1Q0M A;  2W9Y A;  4E0I A;  2W45 A;  5A69 A;  2UUH A;  3LS0 A;  4ANJ A;  2DYR C;  2EIM C;  4JTC B;  4CJG A;  4E17 A;  4XEF A;  2R7T A;  3T6G B;  2LFD A;  3RVZ A;  4YT8 A;  2ETS A;  3FHD A;  5E2Q A;  3L1M A;  4ZLC A;  1ZU5 A;  5BQI A;  2V3C C;  1H9G A;  1NZE A;  4CS8 C;  1OKK A;  4N6H A;  2YL1 A;  3S29 A;  1MNE A;  3ABM C;  1M2V A;  5A6J A;  4XPY A;  2R03 A;  3T6B A;  5CI9 A;  3EZH A;  4JCH A;  2XM0 A;  4J7Y A;  2ICW G;  2H7B A;  1NBB A;  4EHP A;  3ITF A;  4JUR I;  3EG9 A;  4K0D A;  1D0Z A;  4O6Y A;  1U6H A;  2NUP A;  3AQB A;  3CZ6 A;  1TQG A;  3U3F A;  1E83 A;  4O7G A;  4QDL A;  4JIO A;  1G4W R;  2J45 A;  2L6H A;  4PFP A;  1D0Y A;  3K1I A;  2Q9B A;  2XLD A;  3JSZ A;  2R7R A;  1M2O A;  2C03 A;  2YL0 A;  5JUA A;  3I4U A;  2J7P A;  1NFO A;  3MYI A;  4C7O B;  2OKU A;  3KMI A;  3M15 A;  2KQ9 A;  2VCA A;  2WL8 A;  4OD4 A;  4L6R A;  2PNO A;  4WJ0 A;  4G0H A;  4AL1 A;  2LP4 A; 
#chains in the Genus database with same CATH homology
 3PDM P;  1VTM P;  3J06 A;  2TMV P;  1RMV A;  4GQH A;  4UDV A;  1EI7 A;  1CGM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...