3IQ6A

Crystal structure of a tetrameric zn-bound cytochrome cb562 complex with covalently and non-covalently stabilized interfaces
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKCTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
publication title Evolution of metal selectivity in templated protein interfaces.
pubmed doi rcsb
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3iq6A00
2J8WA 1E86A 1EKYA 2YKZA 2YL3A 3QW1A 4CDYA 1E83A 4JEBA 2XLMA 5JP7A 3HNLA 1YYXA 1QPUA 1M6TA 1A7VA 1APCA 3ZQYA 1S05A 3C62A 4CJGA 2CCYA 256BA 3FOPA 3HNKA 1CPRA 3M4BA 5JSLA 4IARA 3NMJA 2YL1A 3IQ5A 4N6HA 1GQAA 2YL0A 3L1MA 3FOOA 1YZCA 2XL8A 3IQ6A 1RCPA 3DE8A 1LM3B 1E85A 5B3IA 3QVZA 4ER9A 2XLOA 3HNJA 4CDVA 1E84A 2QLAA 4D4XA 1CGNA 5JT4A 3ZWIA 4CIPA 4IAQA 2YL7A 3M15A 1MQVA 2XM4A 1CGOA 4JEAA 2J9BA 4ULVA 4WGYA 3U8PA 4D4NA 5JUAA 1BBHA 3TOMA 1YZAA 3QW0A 2XLVA 2XL6A 3ZTMA 3ZTZA 4EIYA 4JKVA 2YLIA 3C63A 4U9EA 5AGFA 4L6RA 5JLIA 2XM0A 2XLWA 3ZQVA 5JRAA 4NC3A 1NBBA 3HNIA 2XLEA 4N4WA 5JVEA 1JAFA 1QQ3A 2XLHA 3TOLA 5JS5A 1YYJA 3VRCA 3NMKA 4CX9A 4CDAA 4IB4A 4CJOA 3QVYA 1CPQA 4JE9A 2XLDA 2YLDA 3M79A 2YLGA 3M4CA 4U9DA 2BC5A 3DE9A 3NMIA 4WGZA
chains in the Genus database with same CATH superfamily
4K0DA 1KTMA 1HW2A 2Y3BA 3PCVA 4NTFA 3SZRA 2J45A 3K1HA 4IJJA 1NU7D 3HKKA 3MX3A 2WVOA 2EIKC 3OEOA 2QY9A 2HV6A 3FXHA 2QTVA 3ITFA 3K1IA 4YN0B 1NSGB 2LSEA 3EFOB 1A0BA 4N6CA 1TWCA 2Q7RA 3ZG1A 2XLMA 3NRHA 5DS5A 3SXYA 5KYXB 2EPKX 3V5YA 1A7DA 3L8IA 3TD7A 3O6XA 3EZHA 1M6TA 1PCXA 5K0IA 4U5BE 2OEVA 2WZGA 1S05A 2X0CA 3B0PA 5B3SC 1BDJB 2CCYA 2L6GA 3RKOF 3HNKA 4PACA 3QTHA 1AEPA 1YAUO 1ORSC 2XS1A 4CS7A 1Z6AA 2H7BA 2YEVA 4WABA 4PJMA 5KYUB 2KC3A 3FAPB 4YT8A 2AVKA 4E17A 3W8IA 4MQ9F 4PR9A 3SXMA 1RCPA 1JMWA 4BEJA 1J8MF 1E85A 1A7EA 4XWJA 2L81A 3EHMA 4OD5A 4JIOA 4I1OB 4AE4A 3I5PA 4CDVA 1G4WR 4NQFA 3K1IC 4AX2A 4IAOA 3O55A 2IXOA 1T6IA 4HE8D 3ZC4A 1ZVZA 2HJMA 2OEXA 1SR2A 1LKXA 1LPEA 4ANJA 3AQCA 3JSZA 3M15A 2ICWG 1MQVA 1HY5A 2HFIA 1BR4A 1MMDA 2KJGA 1CGOA 2XM4A 2ZXOA 2KK1A 2XL4A 4CBEA 4N06A 1NU9C 3FDQA 3GM2A 3Q7GA 1VB5A 3C7JA 2VCAA 4D4NA 3DM5A 1TR2A 2V26A 1YZAA 3S0XA 3LNMB 4C7OB 3ATPA 2KQ9A 3AQBA 4BG0A 2G62A 3NDBB 3UMKA 4EIYA 1U0BB 4JKVA 2W4MA 3UNGC 5DQTA 4YWQA 5E3AA 2UUHA 5IY5C 2V3CC 4BJ6A 3S28A 3LJBA 3MFNA 4EWCA 3GEHA 3NYJA 1H6GA 2GAQA 3KL4A 4PFPA 2IXMA 5L0GA 3JSEO 3TULA 2WZFA 4N4WA 2A1DD 2A68F 3LNRA 3TQOA 4AK9A 3MYFA 1WATA 5JVEA 4QDLA 2NUTB 1JR8A 2A6HF 2GWWA 2XLHA 4JVSA 1T01A 4QI0A 4OIRF 4C3BA 1VYKA 1OCZC 3IEEA 4JTCB 3BEHA 3JYHA 2NUPA 2PF4E 1OW6A 2WB7A 2IM8A 3KYJA 3TK0A 1FMWA 1E2XA 1J8YF 2PP4A 1M57C 3NYLA 4OIPF 5DS6A 4PK4A 3B71A 3CZ6A 3VRCA 2LCHA 3LLIA 1R5ID 2P0NA 4DRJB 4YT2A 2L6HA 1ZHZA 4CDAA 1YA7O 4MVRA 3CAXA 2OQMA 1SF8A 2VCCA 3G4XA 4U5DE 3H65A 3DD7A 2NPUA 5T3TA 4CJOA 1IZMA 3QVYA 1YA9A 1QVXA 1WN0A 2OOCA 2ETSA 2GDCA 2OCCC 2KGOA 1T6UA 3JTLO 3M79A 4U9DA 2R7VA 4LDKA 4RD9A 5HV9A 4NY3A 4G7OF 4JURI 4Q7CA 4IWBA 3NKDA 2MHRA 3EFOA 5B1AC 3U3FA 4MVUA 1MNEA 2J8WA 2W9YA 3A11A 1E86A 3C18A 1JPJA 3HTKC 4E0HA 2GFHA 4BJ5A 1EA8A 2YL3A 3KPHA 3NYMA 1JRAA 3QW1A 3U3BA 5KYXA 1Y4CA 2KYHA 1TWHA 1MNDA 3CEXA 4J7YA 1ORYA 5T1DB 2LQGA 3E9VA 1M2OA 2Y3GA 3DJNB 2M4EA 5L0CA 2VB6A 5JP7A 3US6A 4XQ1A 3S29A 4AL0A 4XPXA 3S84A 3LEOA 3SXKA 5KYUA 3ZQYA 5A69A 4WJ0A 3WODF 3T4RA 4CJGA 1YVIA 4MVZA 256BA 3FOPA 3WHNA 4W8KA 1OQCA 3M4BA 1NFOA 2R03A 1Q0KA 4I1MA 2WL8A 1OCCC 1UG7A 2EPMX 2EPNA 3F46A 3C8GD 1D1CA 3DI5A 2FAPB 3IQ5A 1GQAA 4N6HA 3G4ZA 3FOOA 1YARO 1YZCA 3IHUA 4BEMJ 1CGME 3NG1A 2VASA 1K05A 4EHPA 2CNWD 4R32A 4DOZA 3LEVA 4LLEA 3R7CA 1ZZPA 2W4BA 4CS8A 1L7CA 5B3IA 3DM9B 3R2PA 3QVZA 4EBJA 4ER9A 3U9JA 2XLOA 3LUTB 4BJ5C 1SYQA 3GWLA 3VF0A 1H7IA 4MTFA 5CI8A 2QLAA 1BR1A 3JZ0A 1CGNA 2CGEA 2LFFA 4OIQF 2IBFA 1YDIA 4MVOA 3T9OA 4O6YA 4E0IA 1SMYF 5FCLA 4CIPA 2R7OA 3B0VC 3AG3C 4DRHB 2OKUA 3FAJA 2YL7A 1LIHA 1RKEB 4C7OA 2EIMC 3IQTA 1TFKB 1VOMA 3OWTA 4JEAA 4BJTA 5F28E 3C8ZA 3W8HA 4ULVA 4WGYA 3RQFA 1OW7A 2J9WA 3WAQA 1ST6A 3ZIBA 1TWAA 1BBHA 2BL2A 2MWQA 2O9XA 3L34A 5A6AA 4YL1A 3TOMA 4DXWA 1XWJA 2R7UA 2KSFA 1Z7Qc 2R7WA 5L3QA 3ABMC 3VYWA 4O7GA 4I3MA 4MW8A 3W2WA 4Q5SF 2OG2A 4FWVA 1T9KA 2ZXPA 3VAYA 4GYTA 2YLIA 2PX3A 3EG9B 3GEIA 2NUTA 2IOQA 3K6BA 1FNTc 1JPNA 5D91A 4U9EA 1VMAA 5AGFA 1K04A 4L6RA 4DVYP 2XLWA 3I4UA 2IXPA 3JT1A 4CS8C 4W8PA 3ZQVA 2Q00A 2ZD9A 1NBBA 3BRJA 3UGPA 3HNIA 4MVQA 2ASRA 5E33A 3C8GB 2Q9BA 4G7HF 2EINC 3EH1A 1JAFA 3RVYA 1F1MA 1OKKD 1VTMP 1NFNA 2JPUA 2R7QA 1OR2A 5L0IA 1JOGA 2OJED 4RDAA 3WG7C 2J9VA 1D1AA 1D0YA 2EILC 3Q6MA 4QI2A 5JS5A 4HFKB 4P6IC 1KNYA 1YYJA 1O3UA 4U5EE 2F22A 3W2VA 1VYIA 1WOLA 2XS8A 3DJUB 3U2LA 4E7SA 3QZCA 5COMA 3GM1A 3KMIA 1OXKA 5A6JA 5L0JA 1BR2A 2A0BA 1O87A 1IW7F 1T6QA 4MTGA 4P9TA 4DVZA 5BUOA 2M64A 2P7VA 1S7ZA 2W45A 4U5GA 3W4YA 2XLDA 2PFDA 3AJMA 5KYNA 2YLGA 1ZU5A 1OXBA 3AOUA 3FMSA 5A6BD 5CIVA 3JCUQ 1VLSA 2P61A 3K7DA 3POVA 1HMOA 2BC5A 3FHDA 3HLZA 3RVZA 4YT5A 3NMIA 4EUKB 3N2ZB 4WGZA 2HMQA 4JRZA 1LS1A 2XXAB 1Q0MA 3N24A 1WGWA 3JRTA 3EHNA 4H54A 2B0JA 2NG1A 2HSBA 4JCHA 2YKZA 2R05A 3JYYA 3H2VA 5GPGB 4CDYA 3EJNA 1DOVA 1LS4A 2H8AA 4RBNA 3SEOA 5DVWA 4JEBA 2TMVP 4IRUA 3Q7LA 1EQ1A 2EPOA 4JC7A 3PMRA 3U0CA 2NSFA 4FESA 2Q4FA 4U5HA 2B0HA 1D0ZA 3HNLA 3IQCA 2EIJC 1YYXA 3SXZA 1EI7A 2R02A 3V5XA 2IXNA 3CSKA 5KYYB 1UFBA 4XLPF 1A7VA 1HMDA 3F47A 4NCQA 3IPMO 1ZHWA 3AG4C 1QSPA 2D5RB 4J30B 2Y3HA 3ASOC 1N1CA 4P9FA 2OJQA 1V4AA 2H7VC 2LFDA 4U5CE 3RF3A 5DLJA 2R7SA 3HJCA 5JSLA 5COGA 4IARA 2YWAA 2HKVA 3SYNA 2J46A 3RIPA 1AUEA 3S27A 3TJ6A 2QE9A 2JD3A 3SNHA 1O5HA 1Q0DA 2WVQA 3GANA 1RMVA 2Z15A 1ZU4A 5EK0A 1RJ9B 2Q9AA 5L3VA 4XTKA 1RKEA 3G50A 3OA1A 1E84A 3EQLF 5JT4A 3DMDA 3U2MA 3DKAA 4YK5A 4I44A 4C3EA 1NZEA 2MYSA 3ZWIA 3GORA 4JJGA 1HE9A 1WTYA 3JRMO 3S9OA 3T6GB 4C3DA 5DS4A 4UDVA 3KYIA 4MS2A 2AWYA 4M63A 5D92A 4G0HA 4JZAA 5BQGA 2J0WA 3PDMP 1OCRC 2Y39A 1LVKA 4U5FE 1W2WA 4XEKA 2A69F 2R7XA 1Z5ZA 2HMZA 5JUAA 1I5NA 4FX5A 4GQHA 2KNHA 4O79A 1SZIA 1AVOB 2HJ3A 3QW0A 4CS9C 2XL6A 1KU2A 2L7AA 3GEEA 2PNOA 4ZLCA 1PD0A 2J7PD 3I5QA 3C8GA 3ABKC 3DAFA 1ZW2A 2QUPA 3E70C 1ZHXA 3EGXB 1VK5A 3C63A 5KYWB 1FR0A 3V7OA 3EH2A 2ZXRA 1LI7A 2CNWA 3MBGA 1OR3A 3ZDLA 2IYLD 2R7TA 1XZQA 3LAYA 4K7BA 2XLEA 1LE2A 2RSEB 4Q4ZF 1QLEC 2Q9CA 2XRHA 2EPLX 2D4UA 1D1BA 3TJ5A 1D0XA 4XPYA 3U8VA 2CYDA 4EBKA 4DBQA 1A41A 4KNVA 4LERA 2I8BA 3M1CB 2Y69C 4KBLA 2QNLA 3K66A 2R25A 3QMKA 4E18A 3AGUA 2YHSA 1M2VB 2DGJA 4G78A 5AC5A 3O39A 1Q0FA 2PX0A 5F5HA 4BPMA 3EGDB 4LACB 4ZLDA 3NMKA 4X0RA 3L8JA 5BQIA 1YLMA 2G3VA 2L6FA 2PBEA 4PJLA 4PJNA 1G4US 3J06A 3O10A 1BZ4A 3B0UX 2XXAA 4CS9A 4PJJA 1OW8A 4NTAA 3LLKA 4O6MA 1HW1A 2LIGA 3K33A 1VLTA 4Z9HA 4XLNF 5AC4A 2A0UA 3DE9A 5DQZA 2P6VA 3RFYA 1FMVA 1PV3A 3UMHA 1Z63A 4E7ZA 4LLCA 2BE5F 2YVKA 3UGOA 3DWWA 1EKYA 3EZIA 1B68A 2VCBA 4MVSA 3B9QA 2C04A 4J7TA 3RQEA 1E83A 5COFA 1GS9A 4AL1A 4EKWA 5KYYA 2DYSC 3LS0A 2H7OA 5F5FA 4JCZA 1ZW3A 4LDRA 1FFTC 1OKKA 4OD4A 3DXJF 4A4AA 3U5SA 4G7ZF 3RW0A 1GGQA 1Z3IX 1C03A 2VC9A 1MMGA 1TKNA 1V54C 1QKRA 3KH2A 4YL3A 1QPUA 3GM3A 2DB4A 4FAPB 2LP4A 3B29A 1APCA 1V55C 4JTAB 4NTBA 5EGYA 3AG1C 3C62A 1FFHA 1U6HA 1U89A 1WWPA 2G3KA 3RYLA 3RQGA 3FVYA 2UUIA 1CPRA 2YQYA 1PD1A 3DZAA 4KNWA 5CI9A 1RJ9A 5FZTA 1LI5A 3NMJA 1RXQA 2WZLA 2YL1A 1GM5A 4DRIB 2OU6A 3TOLA 2YL0A 4YL0A 4B6IA 4Z9JA 1ZHTA 2FFHA 3L1MA 1V74B 3LS1A 2WVNA 5T3WA 1FTSA 3H2UA 5A6BA 2XL8A 4KI2A 2CDQA 3IQ6A 4H4KC 4XPWA 2CW0F 3DE8A 1LM3B 3L0IA 5L0DA 4HFFB 4PFOA 3UMIA 1H9GA 4ULWA 2JX0A 2Q3TA 1C17M 2I15A 3HNJA 1NLXA 4YJWA 2R7RA 4CSAA 1OCOC 2AP3A 3SP1A 4D4XA 2P1AA 3S90A 1QZXA 4IGGA 5HSWA 1TFOB 4KC9A 3Q6NA 3X2QC 3ECSA 4MVMA 1TQGA 4A2NB 3PHF2 4J32B 1I4ZA 3T6BA 5EHHA 2XSEA 3RH3A 4AE4B 3ZVRA 2Y3DA 4IAQA 2DYRC 4GEHA 1HE1A 3UR3C 3MYIA 4OINF 3X1OA 2J9BA 5L0HA 1DOWA 2ZPAA 3T6JA 4EBBA 3U8PA 1MMNA 1RKCA 3DAGA 3LESA 4JTDB 1YJGA 5A6KA 3EGXA 2E87A 4YT4A 4DBRA 5KYWA 1LE4A 3AG2C 2XLVA 2FGYA 3EPVA 2GA0A 2LK4A 4K1OA 4ONSA 2YZSA 3ZTMA 4LDQA 3ZTZA 1FAPB 3AGTA 2HV7A 3ABLC 4O6NA 1TWGA 3VM6A 2ZXWC 3CQZA 5TJ5E 1K40A 3V5ZA 2XM0A 5JLIA 3GODA 4XEFA 1I4YA 5JRAA 1ORJA 4NC3A 2J9UA 4MNDA 4OIOF 2A6EF 1H9TA 4BJ1A 1M2VA 4CSAC 2AU5A 2AWCA 1QQ3A 1R4TA 2HS5A 3U9MA 2KW3C 3EGDA 1L3PA 1XZPA 3N0TA 4HEAJ 2L9JA 4JW1A 1ZYRF 2DI3A 4CIHA 5E2QA 1Z23A 3EG9A 3ASNC 1C02A 4Z9IA 1ZHYA 1NG1A 1M56C 3NKEA 4DJ9A 4MW3A 1Q0GA 2NSGA 4CX9A 2RD9A 2R9RB 2HSQA 3MLGA 4IB4A 2LD6A 4F4BA 2NUPB 3A9CA 4XEVA 2HZ8A 3GWNA 1CPQA 5E3CA 4JE9A 2HUJA 1G8XA 2VH3A 1WASA 4BJ6C 1T5OA 2X51A 2YLDA 1Y6DA 2YRFA 1G5ZA 3M4CA 4JJFA 2J7PA 2C03A 5B1BC 1MMAA 3ZSUA 5BQHA 2J0XA 5L0FA 4MTOA 3KKBA
chains in the Genus database with same CATH topology
2J8WA 1E86A 1EKYA 2YKZA 2YL3A 3QW1A 4CDYA 1E83A 4JEBA 2XLMA 5JP7A 3HNLA 1YYXA 1QPUA 1M6TA 1A7VA 1APCA 3ZQYA 1S05A 3C62A 4CJGA 2CCYA 256BA 3FOPA 3HNKA 1CPRA 3M4BA 5JSLA 4IARA 3NMJA 2YL1A 3IQ5A 4N6HA 1GQAA 2YL0A 3L1MA 3FOOA 1YZCA 2XL8A 3IQ6A 1RCPA 3DE8A 1LM3B 1E85A 5B3IA 3QVZA 4ER9A 2XLOA 3HNJA 4CDVA 1E84A 2QLAA 4D4XA 1CGNA 5JT4A 3ZWIA 4CIPA 4IAQA 2YL7A 3M15A 1MQVA 2XM4A 1CGOA 4JEAA 2J9BA 4ULVA 4WGYA 3U8PA 4D4NA 5JUAA 1BBHA 3TOMA 1YZAA 3QW0A 2XLVA 2XL6A 3ZTMA 3ZTZA 4EIYA 4JKVA 2YLIA 3C63A 4U9EA 5AGFA 4L6RA 5JLIA 2XM0A 2XLWA 3ZQVA 5JRAA 4NC3A 1NBBA 3HNIA 2XLEA 4N4WA 5JVEA 1JAFA 1QQ3A 2XLHA 3TOLA 5JS5A 1YYJA 3VRCA 3NMKA 4CX9A 4CDAA 4IB4A 4CJOA 3QVYA 1CPQA 4JE9A 2XLDA 2YLDA 3M79A 2YLGA 3M4CA 4U9DA 2BC5A 3DE9A 3NMIA 4WGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8W A;  1E86 A;  1EKY A;  2YKZ A;  2YL3 A;  3QW1 A;  4CDY A;  1E83 A;  4JEB A;  2XLM A;  5JP7 A;  3HNL A;  1YYX A;  1QPU A;  1M6T A;  1A7V A;  1APC A;  3ZQY A;  1S05 A;  3C62 A;  4CJG A;  2CCY A;  256B A;  3FOP A;  3HNK A;  1CPR A;  3M4B A;  5JSL A;  4IAR A;  3NMJ A;  2YL1 A;  3IQ5 A;  4N6H A;  1GQA A;  2YL0 A;  3L1M A;  3FOO A;  1YZC A;  2XL8 A;  3IQ6 A;  1RCP A;  3DE8 A;  1LM3 B;  1E85 A;  5B3I A;  3QVZ A;  4ER9 A;  2XLO A;  3HNJ A;  4CDV A;  1E84 A;  2QLA A;  4D4X A;  1CGN A;  5JT4 A;  3ZWI A;  4CIP A;  4IAQ A;  2YL7 A;  3M15 A;  1MQV A;  2XM4 A;  1CGO A;  4JEA A;  2J9B A;  4ULV A;  4WGY A;  3U8P A;  4D4N A;  5JUA A;  1BBH A;  3TOM A;  1YZA A;  3QW0 A;  2XLV A;  2XL6 A;  3ZTM A;  3ZTZ A;  4EIY A;  4JKV A;  2YLI A;  3C63 A;  4U9E A;  5AGF A;  4L6R A;  5JLI A;  2XM0 A;  2XLW A;  3ZQV A;  5JRA A;  4NC3 A;  1NBB A;  3HNI A;  2XLE A;  4N4W A;  5JVE A;  1JAF A;  1QQ3 A;  2XLH A;  3TOL A;  5JS5 A;  1YYJ A;  3VRC A;  3NMK A;  4CX9 A;  4CDA A;  4IB4 A;  4CJO A;  3QVY A;  1CPQ A;  4JE9 A;  2XLD A;  2YLD A;  3M79 A;  2YLG A;  3M4C A;  4U9D A;  2BC5 A;  3DE9 A;  3NMI A;  4WGZ A; 
#chains in the Genus database with same CATH topology
 4K0D A;  1KTM A;  1HW2 A;  2Y3B A;  3PCV A;  4NTF A;  3SZR A;  2J45 A;  3K1H A;  4IJJ A;  1NU7 D;  3HKK A;  3MX3 A;  2WVO A;  2EIK C;  3OEO A;  2QY9 A;  2HV6 A;  3FXH A;  2QTV A;  3ITF A;  3K1I A;  4YN0 B;  1NSG B;  2LSE A;  3EFO B;  1A0B A;  4N6C A;  1TWC A;  2Q7R A;  3ZG1 A;  2XLM A;  3NRH A;  5DS5 A;  3SXY A;  5KYX B;  2EPK X;  3V5Y A;  1A7D A;  3L8I A;  3TD7 A;  3O6X A;  3EZH A;  1M6T A;  1PCX A;  5K0I A;  4U5B E;  2OEV A;  2WZG A;  1S05 A;  2X0C A;  3B0P A;  5B3S C;  1BDJ B;  2CCY A;  2L6G A;  3RKO F;  3HNK A;  4PAC A;  3QTH A;  1AEP A;  1YAU O;  1ORS C;  2XS1 A;  4CS7 A;  1Z6A A;  2H7B A;  2YEV A;  4WAB A;  4PJM A;  5KYU B;  2KC3 A;  3FAP B;  4YT8 A;  2AVK A;  4E17 A;  3W8I A;  4MQ9 F;  4PR9 A;  3SXM A;  1RCP A;  1JMW A;  4BEJ A;  1J8M F;  1E85 A;  1A7E A;  4XWJ A;  2L81 A;  3EHM A;  4OD5 A;  4JIO A;  4I1O B;  4AE4 A;  3I5P A;  4CDV A;  1G4W R;  4NQF A;  3K1I C;  4AX2 A;  4IAO A;  3O55 A;  2IXO A;  1T6I A;  4HE8 D;  3ZC4 A;  1ZVZ A;  2HJM A;  2OEX A;  1SR2 A;  1LKX A;  1LPE A;  4ANJ A;  3AQC A;  3JSZ A;  3M15 A;  2ICW G;  1MQV A;  1HY5 A;  2HFI A;  1BR4 A;  1MMD A;  2KJG A;  1CGO A;  2XM4 A;  2ZXO A;  2KK1 A;  2XL4 A;  4CBE A;  4N06 A;  1NU9 C;  3FDQ A;  3GM2 A;  3Q7G A;  1VB5 A;  3C7J A;  2VCA A;  4D4N A;  3DM5 A;  1TR2 A;  2V26 A;  1YZA A;  3S0X A;  3LNM B;  4C7O B;  3ATP A;  2KQ9 A;  3AQB A;  4BG0 A;  2G62 A;  3NDB B;  3UMK A;  4EIY A;  1U0B B;  4JKV A;  2W4M A;  3UNG C;  5DQT A;  4YWQ A;  5E3A A;  2UUH A;  5IY5 C;  2V3C C;  4BJ6 A;  3S28 A;  3LJB A;  3MFN A;  4EWC A;  3GEH A;  3NYJ A;  1H6G A;  2GAQ A;  3KL4 A;  4PFP A;  2IXM A;  5L0G A;  3JSE O;  3TUL A;  2WZF A;  4N4W A;  2A1D D;  2A68 F;  3LNR A;  3TQO A;  4AK9 A;  3MYF A;  1WAT A;  5JVE A;  4QDL A;  2NUT B;  1JR8 A;  2A6H F;  2GWW A;  2XLH A;  4JVS A;  1T01 A;  4QI0 A;  4OIR F;  4C3B A;  1VYK A;  1OCZ C;  3IEE A;  4JTC B;  3BEH A;  3JYH A;  2NUP A;  2PF4 E;  1OW6 A;  2WB7 A;  2IM8 A;  3KYJ A;  3TK0 A;  1FMW A;  1E2X A;  1J8Y F;  2PP4 A;  1M57 C;  3NYL A;  4OIP F;  5DS6 A;  4PK4 A;  3B71 A;  3CZ6 A;  3VRC A;  2LCH A;  3LLI A;  1R5I D;  2P0N A;  4DRJ B;  4YT2 A;  2L6H A;  1ZHZ A;  4CDA A;  1YA7 O;  4MVR A;  3CAX A;  2OQM A;  1SF8 A;  2VCC A;  3G4X A;  4U5D E;  3H65 A;  3DD7 A;  2NPU A;  5T3T A;  4CJO A;  1IZM A;  3QVY A;  1YA9 A;  1QVX A;  1WN0 A;  2OOC A;  2ETS A;  2GDC A;  2OCC C;  2KGO A;  1T6U A;  3JTL O;  3M79 A;  4U9D A;  2R7V A;  4LDK A;  4RD9 A;  5HV9 A;  4NY3 A;  4G7O F;  4JUR I;  4Q7C A;  4IWB A;  3NKD A;  2MHR A;  3EFO A;  5B1A C;  3U3F A;  4MVU A;  1MNE A;  2J8W A;  2W9Y A;  3A11 A;  1E86 A;  3C18 A;  1JPJ A;  3HTK C;  4E0H A;  2GFH A;  4BJ5 A;  1EA8 A;  2YL3 A;  3KPH A;  3NYM A;  1JRA A;  3QW1 A;  3U3B A;  5KYX A;  1Y4C A;  2KYH A;  1TWH A;  1MND A;  3CEX A;  4J7Y A;  1ORY A;  5T1D B;  2LQG A;  3E9V A;  1M2O A;  2Y3G A;  3DJN B;  2M4E A;  5L0C A;  2VB6 A;  5JP7 A;  3US6 A;  4XQ1 A;  3S29 A;  4AL0 A;  4XPX A;  3S84 A;  3LEO A;  3SXK A;  5KYU A;  3ZQY A;  5A69 A;  4WJ0 A;  3WOD F;  3T4R A;  4CJG A;  1YVI A;  4MVZ A;  256B A;  3FOP A;  3WHN A;  4W8K A;  1OQC A;  3M4B A;  1NFO A;  2R03 A;  1Q0K A;  4I1M A;  2WL8 A;  1OCC C;  1UG7 A;  2EPM X;  2EPN A;  3F46 A;  3C8G D;  1D1C A;  3DI5 A;  2FAP B;  3IQ5 A;  1GQA A;  4N6H A;  3G4Z A;  3FOO A;  1YAR O;  1YZC A;  3IHU A;  4BEM J;  1CGM E;  3NG1 A;  2VAS A;  1K05 A;  4EHP A;  2CNW D;  4R32 A;  4DOZ A;  3LEV A;  4LLE A;  3R7C A;  1ZZP A;  2W4B A;  4CS8 A;  1L7C A;  5B3I A;  3DM9 B;  3R2P A;  3QVZ A;  4EBJ A;  4ER9 A;  3U9J A;  2XLO A;  3LUT B;  4BJ5 C;  1SYQ A;  3GWL A;  3VF0 A;  1H7I A;  4MTF A;  5CI8 A;  2QLA A;  1BR1 A;  3JZ0 A;  1CGN A;  2CGE A;  2LFF A;  4OIQ F;  2IBF A;  1YDI A;  4MVO A;  3T9O A;  4O6Y A;  4E0I A;  1SMY F;  5FCL A;  4CIP A;  2R7O A;  3B0V C;  3AG3 C;  4DRH B;  2OKU A;  3FAJ A;  2YL7 A;  1LIH A;  1RKE B;  4C7O A;  2EIM C;  3IQT A;  1TFK B;  1VOM A;  3OWT A;  4JEA A;  4BJT A;  5F28 E;  3C8Z A;  3W8H A;  4ULV A;  4WGY A;  3RQF A;  1OW7 A;  2J9W A;  3WAQ A;  1ST6 A;  3ZIB A;  1TWA A;  1BBH A;  2BL2 A;  2MWQ A;  2O9X A;  3L34 A;  5A6A A;  4YL1 A;  3TOM A;  4DXW A;  1XWJ A;  2R7U A;  2KSF A;  1Z7Q c;  2R7W A;  5L3Q A;  3ABM C;  3VYW A;  4O7G A;  4I3M A;  4MW8 A;  3W2W A;  4Q5S F;  2OG2 A;  4FWV A;  1T9K A;  2ZXP A;  3VAY A;  4GYT A;  2YLI A;  2PX3 A;  3EG9 B;  3GEI A;  2NUT A;  2IOQ A;  3K6B A;  1FNT c;  1JPN A;  5D91 A;  4U9E A;  1VMA A;  5AGF A;  1K04 A;  4L6R A;  4DVY P;  2XLW A;  3I4U A;  2IXP A;  3JT1 A;  4CS8 C;  4W8P A;  3ZQV A;  2Q00 A;  2ZD9 A;  1NBB A;  3BRJ A;  3UGP A;  3HNI A;  4MVQ A;  2ASR A;  5E33 A;  3C8G B;  2Q9B A;  4G7H F;  2EIN C;  3EH1 A;  1JAF A;  3RVY A;  1F1M A;  1OKK D;  1VTM P;  1NFN A;  2JPU A;  2R7Q A;  1OR2 A;  5L0I A;  1JOG A;  2OJE D;  4RDA A;  3WG7 C;  2J9V A;  1D1A A;  1D0Y A;  2EIL C;  3Q6M A;  4QI2 A;  5JS5 A;  4HFK B;  4P6I C;  1KNY A;  1YYJ A;  1O3U A;  4U5E E;  2F22 A;  3W2V A;  1VYI A;  1WOL A;  2XS8 A;  3DJU B;  3U2L A;  4E7S A;  3QZC A;  5COM A;  3GM1 A;  3KMI A;  1OXK A;  5A6J A;  5L0J A;  1BR2 A;  2A0B A;  1O87 A;  1IW7 F;  1T6Q A;  4MTG A;  4P9T A;  4DVZ A;  5BUO A;  2M64 A;  2P7V A;  1S7Z A;  2W45 A;  4U5G A;  3W4Y A;  2XLD A;  2PFD A;  3AJM A;  5KYN A;  2YLG A;  1ZU5 A;  1OXB A;  3AOU A;  3FMS A;  5A6B D;  5CIV A;  3JCU Q;  1VLS A;  2P61 A;  3K7D A;  3POV A;  1HMO A;  2BC5 A;  3FHD A;  3HLZ A;  3RVZ A;  4YT5 A;  3NMI A;  4EUK B;  3N2Z B;  4WGZ A;  2HMQ A;  4JRZ A;  1LS1 A;  2XXA B;  1Q0M A;  3N24 A;  1WGW A;  3JRT A;  3EHN A;  4H54 A;  2B0J A;  2NG1 A;  2HSB A;  4JCH A;  2YKZ A;  2R05 A;  3JYY A;  3H2V A;  5GPG B;  4CDY A;  3EJN A;  1DOV A;  1LS4 A;  2H8A A;  4RBN A;  3SEO A;  5DVW A;  4JEB A;  2TMV P;  4IRU A;  3Q7L A;  1EQ1 A;  2EPO A;  4JC7 A;  3PMR A;  3U0C A;  2NSF A;  4FES A;  2Q4F A;  4U5H A;  2B0H A;  1D0Z A;  3HNL A;  3IQC A;  2EIJ C;  1YYX A;  3SXZ A;  1EI7 A;  2R02 A;  3V5X A;  2IXN A;  3CSK A;  5KYY B;  1UFB A;  4XLP F;  1A7V A;  1HMD A;  3F47 A;  4NCQ A;  3IPM O;  1ZHW A;  3AG4 C;  1QSP A;  2D5R B;  4J30 B;  2Y3H A;  3ASO C;  1N1C A;  4P9F A;  2OJQ A;  1V4A A;  2H7V C;  2LFD A;  4U5C E;  3RF3 A;  5DLJ A;  2R7S A;  3HJC A;  5JSL A;  5COG A;  4IAR A;  2YWA A;  2HKV A;  3SYN A;  2J46 A;  3RIP A;  1AUE A;  3S27 A;  3TJ6 A;  2QE9 A;  2JD3 A;  3SNH A;  1O5H A;  1Q0D A;  2WVQ A;  3GAN A;  1RMV A;  2Z15 A;  1ZU4 A;  5EK0 A;  1RJ9 B;  2Q9A A;  5L3V A;  4XTK A;  1RKE A;  3G50 A;  3OA1 A;  1E84 A;  3EQL F;  5JT4 A;  3DMD A;  3U2M A;  3DKA A;  4YK5 A;  4I44 A;  4C3E A;  1NZE A;  2MYS A;  3ZWI A;  3GOR A;  4JJG A;  1HE9 A;  1WTY A;  3JRM O;  3S9O A;  3T6G B;  4C3D A;  5DS4 A;  4UDV A;  3KYI A;  4MS2 A;  2AWY A;  4M63 A;  5D92 A;  4G0H A;  4JZA A;  5BQG A;  2J0W A;  3PDM P;  1OCR C;  2Y39 A;  1LVK A;  4U5F E;  1W2W A;  4XEK A;  2A69 F;  2R7X A;  1Z5Z A;  2HMZ A;  5JUA A;  1I5N A;  4FX5 A;  4GQH A;  2KNH A;  4O79 A;  1SZI A;  1AVO B;  2HJ3 A;  3QW0 A;  4CS9 C;  2XL6 A;  1KU2 A;  2L7A A;  3GEE A;  2PNO A;  4ZLC A;  1PD0 A;  2J7P D;  3I5Q A;  3C8G A;  3ABK C;  3DAF A;  1ZW2 A;  2QUP A;  3E70 C;  1ZHX A;  3EGX B;  1VK5 A;  3C63 A;  5KYW B;  1FR0 A;  3V7O A;  3EH2 A;  2ZXR A;  1LI7 A;  2CNW A;  3MBG A;  1OR3 A;  3ZDL A;  2IYL D;  2R7T A;  1XZQ A;  3LAY A;  4K7B A;  2XLE A;  1LE2 A;  2RSE B;  4Q4Z F;  1QLE C;  2Q9C A;  2XRH A;  2EPL X;  2D4U A;  1D1B A;  3TJ5 A;  1D0X A;  4XPY A;  3U8V A;  2CYD A;  4EBK A;  4DBQ A;  1A41 A;  4KNV A;  4LER A;  2I8B A;  3M1C B;  2Y69 C;  4KBL A;  2QNL A;  3K66 A;  2R25 A;  3QMK A;  4E18 A;  3AGU A;  2YHS A;  1M2V B;  2DGJ A;  4G78 A;  5AC5 A;  3O39 A;  1Q0F A;  2PX0 A;  5F5H A;  4BPM A;  3EGD B;  4LAC B;  4ZLD A;  3NMK A;  4X0R A;  3L8J A;  5BQI A;  1YLM A;  2G3V A;  2L6F A;  2PBE A;  4PJL A;  4PJN A;  1G4U S;  3J06 A;  3O10 A;  1BZ4 A;  3B0U X;  2XXA A;  4CS9 A;  4PJJ A;  1OW8 A;  4NTA A;  3LLK A;  4O6M A;  1HW1 A;  2LIG A;  3K33 A;  1VLT A;  4Z9H A;  4XLN F;  5AC4 A;  2A0U A;  3DE9 A;  5DQZ A;  2P6V A;  3RFY A;  1FMV A;  1PV3 A;  3UMH A;  1Z63 A;  4E7Z A;  4LLC A;  2BE5 F;  2YVK A;  3UGO A;  3DWW A;  1EKY A;  3EZI A;  1B68 A;  2VCB A;  4MVS A;  3B9Q A;  2C04 A;  4J7T A;  3RQE A;  1E83 A;  5COF A;  1GS9 A;  4AL1 A;  4EKW A;  5KYY A;  2DYS C;  3LS0 A;  2H7O A;  5F5F A;  4JCZ A;  1ZW3 A;  4LDR A;  1FFT C;  1OKK A;  4OD4 A;  3DXJ F;  4A4A A;  3U5S A;  4G7Z F;  3RW0 A;  1GGQ A;  1Z3I X;  1C03 A;  2VC9 A;  1MMG A;  1TKN A;  1V54 C;  1QKR A;  3KH2 A;  4YL3 A;  1QPU A;  3GM3 A;  2DB4 A;  4FAP B;  2LP4 A;  3B29 A;  1APC A;  1V55 C;  4JTA B;  4NTB A;  5EGY A;  3AG1 C;  3C62 A;  1FFH A;  1U6H A;  1U89 A;  1WWP A;  2G3K A;  3RYL A;  3RQG A;  3FVY A;  2UUI A;  1CPR A;  2YQY A;  1PD1 A;  3DZA A;  4KNW A;  5CI9 A;  1RJ9 A;  5FZT A;  1LI5 A;  3NMJ A;  1RXQ A;  2WZL A;  2YL1 A;  1GM5 A;  4DRI B;  2OU6 A;  3TOL A;  2YL0 A;  4YL0 A;  4B6I A;  4Z9J A;  1ZHT A;  2FFH A;  3L1M A;  1V74 B;  3LS1 A;  2WVN A;  5T3W A;  1FTS A;  3H2U A;  5A6B A;  2XL8 A;  4KI2 A;  2CDQ A;  3IQ6 A;  4H4K C;  4XPW A;  2CW0 F;  3DE8 A;  1LM3 B;  3L0I A;  5L0D A;  4HFF B;  4PFO A;  3UMI A;  1H9G A;  4ULW A;  2JX0 A;  2Q3T A;  1C17 M;  2I15 A;  3HNJ A;  1NLX A;  4YJW A;  2R7R A;  4CSA A;  1OCO C;  2AP3 A;  3SP1 A;  4D4X A;  2P1A A;  3S90 A;  1QZX A;  4IGG A;  5HSW A;  1TFO B;  4KC9 A;  3Q6N A;  3X2Q C;  3ECS A;  4MVM A;  1TQG A;  4A2N B;  3PHF 2;  4J32 B;  1I4Z A;  3T6B A;  5EHH A;  2XSE A;  3RH3 A;  4AE4 B;  3ZVR A;  2Y3D A;  4IAQ A;  2DYR C;  4GEH A;  1HE1 A;  3UR3 C;  3MYI A;  4OIN F;  3X1O A;  2J9B A;  5L0H A;  1DOW A;  2ZPA A;  3T6J A;  4EBB A;  3U8P A;  1MMN A;  1RKC A;  3DAG A;  3LES A;  4JTD B;  1YJG A;  5A6K A;  3EGX A;  2E87 A;  4YT4 A;  4DBR A;  5KYW A;  1LE4 A;  3AG2 C;  2XLV A;  2FGY A;  3EPV A;  2GA0 A;  2LK4 A;  4K1O A;  4ONS A;  2YZS A;  3ZTM A;  4LDQ A;  3ZTZ A;  1FAP B;  3AGT A;  2HV7 A;  3ABL C;  4O6N A;  1TWG A;  3VM6 A;  2ZXW C;  3CQZ A;  5TJ5 E;  1K40 A;  3V5Z A;  2XM0 A;  5JLI A;  3GOD A;  4XEF A;  1I4Y A;  5JRA A;  1ORJ A;  4NC3 A;  2J9U A;  4MND A;  4OIO F;  2A6E F;  1H9T A;  4BJ1 A;  1M2V A;  4CSA C;  2AU5 A;  2AWC A;  1QQ3 A;  1R4T A;  2HS5 A;  3U9M A;  2KW3 C;  3EGD A;  1L3P A;  1XZP A;  3N0T A;  4HEA J;  2L9J A;  4JW1 A;  1ZYR F;  2DI3 A;  4CIH A;  5E2Q A;  1Z23 A;  3EG9 A;  3ASN C;  1C02 A;  4Z9I A;  1ZHY A;  1NG1 A;  1M56 C;  3NKE A;  4DJ9 A;  4MW3 A;  1Q0G A;  2NSG A;  4CX9 A;  2RD9 A;  2R9R B;  2HSQ A;  3MLG A;  4IB4 A;  2LD6 A;  4F4B A;  2NUP B;  3A9C A;  4XEV A;  2HZ8 A;  3GWN A;  1CPQ A;  5E3C A;  4JE9 A;  2HUJ A;  1G8X A;  2VH3 A;  1WAS A;  4BJ6 C;  1T5O A;  2X51 A;  2YLD A;  1Y6D A;  2YRF A;  1G5Z A;  3M4C A;  4JJF A;  2J7P A;  2C03 A;  5B1B C;  1MMA A;  3ZSU A;  5BQH A;  2J0X A;  5L0F A;  4MTO A;  3KKB A; 
#chains in the Genus database with same CATH homology
 2J8W A;  1E86 A;  1EKY A;  2YKZ A;  2YL3 A;  3QW1 A;  4CDY A;  1E83 A;  4JEB A;  2XLM A;  5JP7 A;  3HNL A;  1YYX A;  1QPU A;  1M6T A;  1A7V A;  1APC A;  3ZQY A;  1S05 A;  3C62 A;  4CJG A;  2CCY A;  256B A;  3FOP A;  3HNK A;  1CPR A;  3M4B A;  5JSL A;  4IAR A;  3NMJ A;  2YL1 A;  3IQ5 A;  4N6H A;  1GQA A;  2YL0 A;  3L1M A;  3FOO A;  1YZC A;  2XL8 A;  3IQ6 A;  1RCP A;  3DE8 A;  1LM3 B;  1E85 A;  5B3I A;  3QVZ A;  4ER9 A;  2XLO A;  3HNJ A;  4CDV A;  1E84 A;  2QLA A;  4D4X A;  1CGN A;  5JT4 A;  3ZWI A;  4CIP A;  4IAQ A;  2YL7 A;  3M15 A;  1MQV A;  2XM4 A;  1CGO A;  4JEA A;  2J9B A;  4ULV A;  4WGY A;  3U8P A;  4D4N A;  5JUA A;  1BBH A;  3TOM A;  1YZA A;  3QW0 A;  2XLV A;  2XL6 A;  3ZTM A;  3ZTZ A;  4EIY A;  4JKV A;  2YLI A;  3C63 A;  4U9E A;  5AGF A;  4L6R A;  5JLI A;  2XM0 A;  2XLW A;  3ZQV A;  5JRA A;  4NC3 A;  1NBB A;  3HNI A;  2XLE A;  4N4W A;  5JVE A;  1JAF A;  1QQ3 A;  2XLH A;  3TOL A;  5JS5 A;  1YYJ A;  3VRC A;  3NMK A;  4CX9 A;  4CDA A;  4IB4 A;  4CJO A;  3QVY A;  1CPQ A;  4JE9 A;  2XLD A;  2YLD A;  3M79 A;  2YLG A;  3M4C A;  4U9D A;  2BC5 A;  3DE9 A;  3NMI A;  4WGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...