3IQ6A

Crystal structure of a tetrameric zn-bound cytochrome cb562 complex with covalently and non-covalently stabilized interfaces
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKCTCNACHQKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Evolution of metal selectivity in templated protein interfaces.
pubmed doi rcsb
molecule tags Electron transport
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3iq6A00
1RCPA 3QVYA 4WGZA 5JP7A 3QVZA 1A7VA 4N6HA 2XLOA 4CX9A 5JUAA 2XM4A 3M4CA 1YYXA 4IARA 4WGYA 3ZTMA 1S05A 2XLMA 1YYJA 2XLDA 3ZWIA 4IB4A 3ZQYA 2YLIA 3NMIA 3FOPA 1YZAA 2QLAA 1EKYA 3HNJA 1BBHA 2YL3A 2YLDA 3C62A 3HNKA 5JLIA 4CJOA 4EIYA 3NMKA 4JKVA 5B3IA 3QW1A 2J9BA 1CGOA 4CIPA 5JS5A 2XL8A 1QQ3A 4U9EA 256BA 4JEBA 3ZQVA 1LM3B 4CJGA 4N4WA 3TOLA 2XLWA 2YL7A 1E84A 2YL1A 2BC5A 3ZTZA 4NC3A 2YLGA 3HNIA 3TOMA 3NMJA 4CDVA 1CGNA 1GQAA 3IQ6A 1MQVA 1E83A 4JEAA 4D4NA 3M15A 4IAQA 3IQ5A 4L6RA 4D4XA 4CDYA 2XLVA 3QW0A 3HNLA 3M4BA 3M79A 1APCA 2XLEA 3DE9A 4CDAA 1YZCA 2CCYA 1NBBA 2XLHA 1M6TA 3U8PA 3FOOA 1E86A 4JE9A 2XL6A 1CPRA 1QPUA 1E85A 3DE8A 2J8WA 2YKZA 4ER9A 5JRAA 5JSLA 5JVEA 2YL0A 4U9DA 1JAFA 5AGFA 3VRCA 4ULVA 1CPQA 3C63A 3L1MA 2XM0A 5JT4A
chains in the Genus database with same CATH superfamily
2P61A 1JR8A 1E2XA 1HE9A 5JP7A 1I5NA 2Q00A 4RD9A 3DM9B 5L3QA 4N6HA 1M2VA 3GEIA 5F5FA 5JUAA 2L7AA 4J7TA 2PP4A 4AK9A 2PX3A 1YYXA 1ZHWA 3GWLA 1ORYA 3DAGA 2R02A 4IARA 3T9OA 2IBFA 4E7SA 2G62A 2JX0A 2R25A 4WGYA 1PCXA 2W4BA 2H8AA 3DJNB 1QLEC 3ZTMA 4J7YA 3ITFA 2XLMA 1ZHTA 1YYJA 2EILC 2QNLA 2J0WA 3SXYA 1KNYA 2XLDA 1ORSC 3NYJA 3QTHA 4LACB 1SF8A 2B0HA 4ULWA 2A0UA 3E9VA 1O87A 3HNKA 2HJMA 1T6QA 4U5BE 3RF3A 2LCHA 1RKCA 1YJGA 4XTKA 2LFFA 5AC5A 2IXNA 1NZEA 1D1BA 3NMKA 3RH3A 4ANJA 3TK0A 1VB5A 2RSEB 2R7OA 3EG9A 2B0JA 3A11A 3UMIA 3ABKC 3IPMO 2UUIA 4CS9C 1G8XA 1S7ZA 4JC7A 1G5ZA 4JTAB 1V55C 4PJNA 3MYIA 3JCUQ 3JRTA 4G0HA 5COFA 3ZQVA 4YT4A 2AU5A 3ZIBA 3RQEA 3BEHA 3TOLA 3U9JA 1L3PA 1YAUO 3N0TA 2KSFA 3TQOA 2IOQA 3ZDLA 1BR4A 2BC5A 2Q9AA 3B0UX 3HNIA 2M4EA 3AOUA 4MTFA 4MTGA 1DOWA 2R05A 2ZXOA 3ABLC 3S29A 4OIRF 4N06A 3W4YA 2YRFA 1CGNA 2WZLA 2YVKA 4O6YA 3EJNA 1NU9C 4YK5A 5GPGB 1WGWA 2OG2A 4C3EA 5L0DA 3HLZA 3S90A 4KI2A 3K66A 4RBNA 2CGEA 2VH3A 5BQHA 5KYXB 2CNWA 1NLXA 1AEPA 2H7VC 3G50A 1B68A 1TQGA 2L81A 4RDAA 4U5GA 3EHNA 3SNHA 3NDBB 2HZ8A 3K1HA 3VYWA 4PK4A 3DD7A 3EZHA 1Y4CA 3M4BA 4PJLA 5L0JA 3C8GA 3AG1C 3M79A 3M1CB 3C7JA 3CAXA 4LDRA 3WAQA 5E33A 1BDJB 3NYLA 2G3KA 3TD7A 4G7OF 4LLEA 1RKEB 2PFDA 3RVYA 1ORJA 1Q0KA 1RMVA 2NUPB 2BE5F 2MYSA 4I44A 5KYXA 4CDAA 3EFOB 3NG1A 2FFHA 5D91A 3I4UA 2LK4A 4MW3A 1JRAA 4XEFA 4I3MA 2XLHA 3SP1A 2J7PD 1E86A 4FWVA 4PJJA 4BJ5A 3Q6NA 1QPUA 4NY3A 3FHDA 3IEEA 4E18A 4ER9A 3UGOA 5BQIA 5JRAA 5JSLA 5HSWA 2EPOA 3AQBA 3GORA 2L9JA 4BEMJ 2A0BA 5AGFA 5KYYA 3JT1A 4HE8D 4MVMA 4J30B 1OXKA 1LKXA 1AUEA 1K04A 4LDQA 3FDQA 3QZCA 1JMWA 4DBQA 1RCPA 1VMAA 2UUHA 3QVYA 2OJED 4MTOA 4JVSA 4PACA 3QVZA 3RQGA 3UR3C 1A7VA 1OR2A 3W8IA 2X0CA 3Q6MA 3LEVA 1LE4A 4I1OB 4XWJA 4MVZA 3TJ6A 2KC3A 4XEVA 2ETSA 2IM8A 4BEJA 2C04A 2P1AA 3O6XA 2QTVA 1JPNA 2F22A 2X51A 3W8HA 1FTSA 2W4MA 3DWWA 2LSEA 3ABMC 4B6IA 2EINC 1RJ9B 3O10A 1A7DA 2EIJC 2EPKX 1J8YF 2Y39A 2OKUA 3EH1A 2AVKA 3HJCA 4PR9A 3JRMO 3V5XA 4E0HA 2KNHA 1T01A 1HE1A 2Y3BA 3I5PA 5E3CA 5F28E 2A68F 1FNTc 1HW1A 4Q7CA 4JJFA 3LNRA 1YZAA 1PD1A 2QLAA 4JZAA 4MVOA 4XEKA 2AP3A 3HNJA 2LQGA 1F1MA 1KU2A 3C62A 3PCVA 4IRUA 4YJWA 4MNDA 4IWBA 1OCZC 4G78A 5CIVA 1H9GA 3SEOA 4CS8C 2QUPA 1ZU4A 3GM1A 4F4BA 5JLIA 2YHSA 1RJ9A 1VK5A 4JKVA 4Z9JA 3U0CA 2RD9A 2ZXPA 3QW1A 3DM5A 2J9BA 4U5EE 2Y3GA 3POVA 1WOLA 2DYRC 1CGOA 2Q9CA 5A6BD 4CIPA 4CS8A 4YT2A 2NSGA 2Q4FA 5CI8A 3PDMP 1AVOB 5TJ5E 3N2ZB 2HMZA 4A4AA 3DZAA 1TWAA 2HV6A 4Z9HA 2AWCA 3EG9B 1D0ZA 1VLSA 256BA 3EH2A 1NG1A 1SZIA 3EZIA 4JCHA 2J9WA 3DXJF 4P9FA 3V5ZA 3T6BA 2DYSC 3KYJA 1QVXA 3OA1A 1C02A 3SZRA 1WTYA 2TMVP 1YVIA 1IZMA 1Y6DA 3HTKC 3K1IC 4XPXA 5DS6A 1FAPB 2R7QA 4E7ZA 1LE2A 2YLGA 4LLCA 3C18A 1BZ4A 4N6CA 5A6KA 4IJJA 1QSPA 4CDVA 1FFTC 1D0XA 2HS5A 4GQHA 3K1IA 2J46A 4FAPB 3LESA 1FR0A 1R4TA 2P6VA 1ZHZA 1BR2A 3ASOC 3SYNA 1LIHA 1N1CA 4I1MA 2PNOA 1YLMA 4JIOA 1G4WR 3KMIA 4CIHA 3PMRA 4A2NB 2NPUA 2XLVA 4E17A 3QW0A 4WABA 1GM5A 2IXOA 3HNLA 1MMAA 3NKEA 2HFIA 1Z7Qc 1A41A 4W8KA 5FZTA 2HJ3A 1BR1A 2EIMC 3K7DA 1TWHA 1FFHA 2L6FA 2P7VA 1MNDA 2Y69C 1VYKA 1ZHYA 2GWWA 5KYUB 5E3AA 2ZD9A 1SMYF 2XLEA 2KYHA 1TKNA 2I8BA 3S84A 1K05A 3B9QA 2W45A 3KH2A 3C8GB 5A6AA 2CCYA 1LI7A 1O3UA 2XL4A 4P6IC 4R32A 2CDQA 1EA8A 3UMKA 5IY5C 3T4RA 4LDKA 1YA7O 4C3DA 2XXAA 4EBJA 2PBEA 3FOOA 1IW7F 2JD3A 3JSZA 3ZVRA 5B1BC 1CPRA 3S9OA 2QY9A 1UG7A 1HMOA 3DMDA 3DE8A 1Q0DA 2J8WA 2CYDA 4XLNF 3LEOA 2IXPA 5JVEA 1XWJA 2ASRA 2D4UA 3A9CA 2CW0F 1G4US 3LAYA 2YWAA 5KYUA 4BJ1A 2WVOA 1JAFA 3OWTA 4XLPF 2OEVA 1J8MF 3RIPA 3FVYA 1ZU5A 4ULVA 2E87A 2LFDA 2C03A 3CQZA 3C63A 1TWGA 2PX0A 2ICWG 2XM0A 1OQCA 4Z9IA 2V3CC 2IYLD 4EHPA 4JCZA 3B0PA 3EQLF 3W2VA 2VCCA 2OJQA 3VM6A 4H54A 4BJ5C 5KYYB 2OU6A 3CEXA 4NTBA 1VOMA 1NFOA 2NG1A 1QKRA 5L0CA 1ZHXA 1S05A 3WHNA 1VLTA 2Y3HA 3Q7LA 3X2QC 2GFHA 4DRJB 4EWCA 4JURI 3GWNA 4CSAC 3CZ6A 3TJ5A 3ZQYA 4JW1A 2YLIA 2G3VA 4JRZA 4PFPA 1U0BB 4NTFA 1EKYA 2YL3A 1OKKA 2YLDA 2ZXRA 4OD4A 1HW2A 5B1AC 4NQFA 4CSAA 1I4YA 4CJOA 4CBEA 1ZVZA 1EI7A 3S0XA 1YDIA 2CNWD 3JTLO 5EK0A 3RW0A 4BG0A 4FESA 5A6BA 3V5YA 2R7TA 3SXKA 3MBGA 4X0RA 4DBRA 4DRHB 3LUTB 4K0DA 3U5SA 1VYIA 5EHHA 3T6JA 3LJBA 1XZPA 3C8GD 1WASA 2J45A 4OIOF 5JS5A 2KW3C 1OCRC 2A6EF 1WWPA 1QQ3A 3B0VC 1W2WA 2V26A 3SXMA 2OQMA 3PHF2 3H2VA 3R2PA 4JEBA 5E2QA 2J0XA 2LIGA 4MW8A 1LM3B 3ZSUA 4EKWA 2R7XA 3ZG1A 4EBKA 4IGGA 1C17M 1D0YA 2XLWA 2YL7A 3JZ0A 2R7VA 4J32B 4OIQF 5A69A 2YL1A 4NTAA 3ZTZA 4IAOA 5DQZA 1OR3A 1ST6A 3B71A 4Q4ZF 1U89A 3L0IA 1V4AA 4HEAJ 2GDCA 3NMJA 4C3BA 4MVQA 4O7GA 1MMNA 1XZQA 3ATPA 1GQAA 1Z5ZA 3IQ6A 4YL0A 4QI0A 1SYQA 2LP4A 1Z63A 2KK1A 1ZYRF 4K1OA 4JEAA 4D4NA 4E0IA 2YEVA 4W8PA 3E70C 3IQ5A 4IAQA 3GODA 5F5HA 4CDYA 4D4XA 5EGYA 3RYLA 3KYIA 4H4KC 2FAPB 3U3FA 5BQGA 2Z15A 5DS4A 5BUOA 4WJ0A 1M2OA 1VTMP 3B29A 1LI5A 1T9KA 1GS9A 3WODF 4NCQA 3EGDB 4YL1A 5T3WA 2OEXA 3NRHA 4OD5A 3SXZA 5KYNA 1L7CA 3IHUA 3KPHA 3HKKA 1KTMA 5AC4A 1M56C 4DVZA 1V74B 5L0IA 3DKAA 3LLIA 4YL3A 3GM3A 5DS5A 1ZZPA 3ECSA 2R03A 4GEHA 1YZCA 2GA0A 3AG3C 3UMHA 1NBBA 1NSGB 2LD6A 3O39A 2HMQA 3EPVA 1M6TA 1SR2A 4LERA 5A6JA 1HY5A 1OXBA 2HKVA 2XL6A 1EQ1A 3EGDA 1E85A 2EPMX 3EGXA 1DOVA 2VASA 2YKZA 4JTCB 5L3VA 4XQ1A 4BJTA 3DJUB 1H9TA 2WB7A 4MS2A 1MMGA 4G7HF 2XXAB 1Q0MA 5HV9A 4UDVA 2R7WA 3DAFA 2R9RB 1UFBA 2WZGA 3GEEA 3I5QA 3VRCA 4AX2A 3L8IA 1CPQA 1NU7D 3T6GB 2KJGA 1OW8A 3L1MA 2DGJA 2VCAA 1OW7A 2VCBA 3Q7GA 5JT4A 1ZW2A 4MQ9F 1R5ID 4QDLA 3V7OA 4WGZA 3EHMA 4YT8A 2A69F 2EIKC 2M64A 2XLOA 4CX9A 1U6HA 2XM4A 2VB6A 3M4CA 3CSKA 3S27A 1H7IA 1PD0A 1LPEA 3VF0A 4DXWA 1T5OA 4MVUA 4XPWA 3VAYA 2QE9A 3NKDA 2WVNA 1O5HA 1OCOC 3WG7C 4U5DE 4HFFB 3ZWIA 4IB4A 2YQYA 3NMIA 2PF4E 4CS7A 1MNEA 3GANA 1QZXA 3FOPA 2Q7RA 3ZC4A 2XS1A 4CS9A 1C03A 2DI3A 1BBHA 2ZPAA 3F46A 3LNMB 3LS0A 4BPMA 3W2WA 4OIPF 3DI5A 2J7PA 2NUTB 2WL8A 4U5CE 1I4ZA 1WN0A 4OINF 2XRHA 3MLGA 3U2LA 5KYWB 3G4XA 3KL4A 2OCCC 3U8VA 2AWYA 2H7BA 4EIYA 3FAPB 1MMDA 2P0NA 3S28A 1A7EA 3MX3A 5B3IA 1LS1A 3X1OA 1Z23A 3H65A 3N24A 2OOCA 2FGYA 4FX5A 3TULA 3J06A 5B3SC 2W9YA 3AQCA 2YZSA 1D1AA 3LLKA 4K7BA 4KNVA 3MFNA 3UNGC 3LS1A 4KBLA 4O79A 2XS8A 4AE4B 1T6UA 3IQTA 1CGME 2R7SA 1WATA 2XL8A 1D1CA 4U5HA 2MWQA 3GEHA 4U5FE 2Q3TA 2NUTA 4U9EA 4ZLCA 2Q9BA 3U9MA 2A6HF 5KYWA 3UGPA 1TR2A 5K0IA 5L0FA 4CJGA 3AG4C 1A0BA 4N4WA 4EUKB 1E84A 3FMSA 5FCLA 1TFOB 3AG2C 1NFNA 3U2MA 1FMWA 2J9VA 2R7UA 1TFKB 1K40A 3C8ZA 3IQCA 4NC3A 1JOGA 3R7CA 3TOMA 1LS4A 1OCCC 1YA9A 3OEOA 1OW6A 2JPUA 3H2UA 4AE4A 5T1DB 3FXHA 3O55A 4PFOA 5CI9A 4JTDB 3KKBA 3RKOF 1GGQA 2O9XA 2R7RA 1Q0GA 5COGA 3F47A 1MQVA 1E83A 1T6IA 2WZFA 3M15A 3GM2A 4L6RA 4M63A 4O6NA 3RQFA 3U3BA 5T3TA 1RXQA 3JYYA 1RKEA 4Q5SF 2DB4A 2L6HA 2NUPA 2GAQA 2J9UA 1M57C 3FAJA 4XPYA 4YT5A 5D92A 2ZXWC 3L34A 2A1DD 4YN0B 1TWCA 2BL2A 3EFOA 4AL0A 4DRIB 3QMKA 2HSQA 2EPNA 3K6BA 1APCA 2IXMA 2HV7A 1LVKA 2MHRA 3RVZA 4JJGA 4KC9A 3JYHA 3G4ZA 3K33A 4GYTA 1Q0FA 4DOZA 4ZLDA 2WVQA 2D5RB 3US6A 5DQTA 3DE9A 2NSFA 4YWQA 3AJMA 2L6GA 4C7OB 1YARO 4MVRA 1FMVA 4ONSA 3AGUA 1JPJA 4MVSA 1OKKD 4P9TA 4BJ6C 3U8PA 1V54C 2HUJA 1HMDA 5L0GA 1ZW3A 5DLJA 4JE9A 5COMA 1M2VB 4QI2A 2EPLX 2HSBA 4HFKB 3NYMA 4G7ZF 2XSEA 4DVYP 3AGTA 1H6GA 2H7OA 1Z3IX 2YL0A 4BJ6A 2VC9A 3L8JA 4KNWA 3JSEO 5L0HA 4PJMA 1Z6AA 4U9DA 5DVWA 2KQ9A 3MYFA 4AL1A 1PV3A 4O6MA 2I15A 3RFYA 3ASNC 2Y3DA 4EBBA 4DJ9A 4C7OA 3BRJA 2KGOA 3EGXB
chains in the Genus database with same CATH topology
1RCPA 3QVYA 4WGZA 5JP7A 3QVZA 1A7VA 4N6HA 2XLOA 4CX9A 5JUAA 2XM4A 3M4CA 1YYXA 4IARA 4WGYA 3ZTMA 1S05A 2XLMA 1YYJA 2XLDA 3ZWIA 4IB4A 3ZQYA 2YLIA 3NMIA 3FOPA 1YZAA 2QLAA 1EKYA 3HNJA 1BBHA 2YL3A 2YLDA 3C62A 3HNKA 5JLIA 4CJOA 4EIYA 3NMKA 4JKVA 5B3IA 3QW1A 2J9BA 1CGOA 4CIPA 5JS5A 2XL8A 1QQ3A 4U9EA 256BA 4JEBA 3ZQVA 1LM3B 4CJGA 4N4WA 3TOLA 2XLWA 2YL7A 1E84A 2YL1A 2BC5A 3ZTZA 4NC3A 2YLGA 3HNIA 3TOMA 3NMJA 4CDVA 1CGNA 1GQAA 3IQ6A 1MQVA 1E83A 4JEAA 4D4NA 3M15A 4IAQA 3IQ5A 4L6RA 4D4XA 4CDYA 2XLVA 3QW0A 3HNLA 3M4BA 3M79A 1APCA 2XLEA 3DE9A 4CDAA 1YZCA 2CCYA 1NBBA 2XLHA 1M6TA 3U8PA 3FOOA 1E86A 4JE9A 2XL6A 1CPRA 1QPUA 1E85A 3DE8A 2J8WA 2YKZA 4ER9A 5JRAA 5JSLA 5JVEA 2YL0A 4U9DA 1JAFA 5AGFA 3VRCA 4ULVA 1CPQA 3C63A 3L1MA 2XM0A 5JT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RCP A;  3QVY A;  4WGZ A;  5JP7 A;  3QVZ A;  1A7V A;  4N6H A;  2XLO A;  4CX9 A;  5JUA A;  2XM4 A;  3M4C A;  1YYX A;  4IAR A;  4WGY A;  3ZTM A;  1S05 A;  2XLM A;  1YYJ A;  2XLD A;  3ZWI A;  4IB4 A;  3ZQY A;  2YLI A;  3NMI A;  3FOP A;  1YZA A;  2QLA A;  1EKY A;  3HNJ A;  1BBH A;  2YL3 A;  2YLD A;  3C62 A;  3HNK A;  5JLI A;  4CJO A;  4EIY A;  3NMK A;  4JKV A;  5B3I A;  3QW1 A;  2J9B A;  1CGO A;  4CIP A;  5JS5 A;  2XL8 A;  1QQ3 A;  4U9E A;  256B A;  4JEB A;  3ZQV A;  1LM3 B;  4CJG A;  4N4W A;  3TOL A;  2XLW A;  2YL7 A;  1E84 A;  2YL1 A;  2BC5 A;  3ZTZ A;  4NC3 A;  2YLG A;  3HNI A;  3TOM A;  3NMJ A;  4CDV A;  1CGN A;  1GQA A;  3IQ6 A;  1MQV A;  1E83 A;  4JEA A;  4D4N A;  3M15 A;  4IAQ A;  3IQ5 A;  4L6R A;  4D4X A;  4CDY A;  2XLV A;  3QW0 A;  3HNL A;  3M4B A;  3M79 A;  1APC A;  2XLE A;  3DE9 A;  4CDA A;  1YZC A;  2CCY A;  1NBB A;  2XLH A;  1M6T A;  3U8P A;  3FOO A;  1E86 A;  4JE9 A;  2XL6 A;  1CPR A;  1QPU A;  1E85 A;  3DE8 A;  2J8W A;  2YKZ A;  4ER9 A;  5JRA A;  5JSL A;  5JVE A;  2YL0 A;  4U9D A;  1JAF A;  5AGF A;  3VRC A;  4ULV A;  1CPQ A;  3C63 A;  3L1M A;  2XM0 A;  5JT4 A; 
#chains in the Genus database with same CATH topology
 2P61 A;  1JR8 A;  1E2X A;  1HE9 A;  5JP7 A;  1I5N A;  2Q00 A;  4RD9 A;  3DM9 B;  5L3Q A;  4N6H A;  1M2V A;  3GEI A;  5F5F A;  5JUA A;  2L7A A;  4J7T A;  2PP4 A;  4AK9 A;  2PX3 A;  1YYX A;  1ZHW A;  3GWL A;  1ORY A;  3DAG A;  2R02 A;  4IAR A;  3T9O A;  2IBF A;  4E7S A;  2G62 A;  2JX0 A;  2R25 A;  4WGY A;  1PCX A;  2W4B A;  2H8A A;  3DJN B;  1QLE C;  3ZTM A;  4J7Y A;  3ITF A;  2XLM A;  1ZHT A;  1YYJ A;  2EIL C;  2QNL A;  2J0W A;  3SXY A;  1KNY A;  2XLD A;  1ORS C;  3NYJ A;  3QTH A;  4LAC B;  1SF8 A;  2B0H A;  4ULW A;  2A0U A;  3E9V A;  1O87 A;  3HNK A;  2HJM A;  1T6Q A;  4U5B E;  3RF3 A;  2LCH A;  1RKC A;  1YJG A;  4XTK A;  2LFF A;  5AC5 A;  2IXN A;  1NZE A;  1D1B A;  3NMK A;  3RH3 A;  4ANJ A;  3TK0 A;  1VB5 A;  2RSE B;  2R7O A;  3EG9 A;  2B0J A;  3A11 A;  3UMI A;  3ABK C;  3IPM O;  2UUI A;  4CS9 C;  1G8X A;  1S7Z A;  4JC7 A;  1G5Z A;  4JTA B;  1V55 C;  4PJN A;  3MYI A;  3JCU Q;  3JRT A;  4G0H A;  5COF A;  3ZQV A;  4YT4 A;  2AU5 A;  3ZIB A;  3RQE A;  3BEH A;  3TOL A;  3U9J A;  1L3P A;  1YAU O;  3N0T A;  2KSF A;  3TQO A;  2IOQ A;  3ZDL A;  1BR4 A;  2BC5 A;  2Q9A A;  3B0U X;  3HNI A;  2M4E A;  3AOU A;  4MTF A;  4MTG A;  1DOW A;  2R05 A;  2ZXO A;  3ABL C;  3S29 A;  4OIR F;  4N06 A;  3W4Y A;  2YRF A;  1CGN A;  2WZL A;  2YVK A;  4O6Y A;  3EJN A;  1NU9 C;  4YK5 A;  5GPG B;  1WGW A;  2OG2 A;  4C3E A;  5L0D A;  3HLZ A;  3S90 A;  4KI2 A;  3K66 A;  4RBN A;  2CGE A;  2VH3 A;  5BQH A;  5KYX B;  2CNW A;  1NLX A;  1AEP A;  2H7V C;  3G50 A;  1B68 A;  1TQG A;  2L81 A;  4RDA A;  4U5G A;  3EHN A;  3SNH A;  3NDB B;  2HZ8 A;  3K1H A;  3VYW A;  4PK4 A;  3DD7 A;  3EZH A;  1Y4C A;  3M4B A;  4PJL A;  5L0J A;  3C8G A;  3AG1 C;  3M79 A;  3M1C B;  3C7J A;  3CAX A;  4LDR A;  3WAQ A;  5E33 A;  1BDJ B;  3NYL A;  2G3K A;  3TD7 A;  4G7O F;  4LLE A;  1RKE B;  2PFD A;  3RVY A;  1ORJ A;  1Q0K A;  1RMV A;  2NUP B;  2BE5 F;  2MYS A;  4I44 A;  5KYX A;  4CDA A;  3EFO B;  3NG1 A;  2FFH A;  5D91 A;  3I4U A;  2LK4 A;  4MW3 A;  1JRA A;  4XEF A;  4I3M A;  2XLH A;  3SP1 A;  2J7P D;  1E86 A;  4FWV A;  4PJJ A;  4BJ5 A;  3Q6N A;  1QPU A;  4NY3 A;  3FHD A;  3IEE A;  4E18 A;  4ER9 A;  3UGO A;  5BQI A;  5JRA A;  5JSL A;  5HSW A;  2EPO A;  3AQB A;  3GOR A;  2L9J A;  4BEM J;  2A0B A;  5AGF A;  5KYY A;  3JT1 A;  4HE8 D;  4MVM A;  4J30 B;  1OXK A;  1LKX A;  1AUE A;  1K04 A;  4LDQ A;  3FDQ A;  3QZC A;  1JMW A;  4DBQ A;  1RCP A;  1VMA A;  2UUH A;  3QVY A;  2OJE D;  4MTO A;  4JVS A;  4PAC A;  3QVZ A;  3RQG A;  3UR3 C;  1A7V A;  1OR2 A;  3W8I A;  2X0C A;  3Q6M A;  3LEV A;  1LE4 A;  4I1O B;  4XWJ A;  4MVZ A;  3TJ6 A;  2KC3 A;  4XEV A;  2ETS A;  2IM8 A;  4BEJ A;  2C04 A;  2P1A A;  3O6X A;  2QTV A;  1JPN A;  2F22 A;  2X51 A;  3W8H A;  1FTS A;  2W4M A;  3DWW A;  2LSE A;  3ABM C;  4B6I A;  2EIN C;  1RJ9 B;  3O10 A;  1A7D A;  2EIJ C;  2EPK X;  1J8Y F;  2Y39 A;  2OKU A;  3EH1 A;  2AVK A;  3HJC A;  4PR9 A;  3JRM O;  3V5X A;  4E0H A;  2KNH A;  1T01 A;  1HE1 A;  2Y3B A;  3I5P A;  5E3C A;  5F28 E;  2A68 F;  1FNT c;  1HW1 A;  4Q7C A;  4JJF A;  3LNR A;  1YZA A;  1PD1 A;  2QLA A;  4JZA A;  4MVO A;  4XEK A;  2AP3 A;  3HNJ A;  2LQG A;  1F1M A;  1KU2 A;  3C62 A;  3PCV A;  4IRU A;  4YJW A;  4MND A;  4IWB A;  1OCZ C;  4G78 A;  5CIV A;  1H9G A;  3SEO A;  4CS8 C;  2QUP A;  1ZU4 A;  3GM1 A;  4F4B A;  5JLI A;  2YHS A;  1RJ9 A;  1VK5 A;  4JKV A;  4Z9J A;  3U0C A;  2RD9 A;  2ZXP A;  3QW1 A;  3DM5 A;  2J9B A;  4U5E E;  2Y3G A;  3POV A;  1WOL A;  2DYR C;  1CGO A;  2Q9C A;  5A6B D;  4CIP A;  4CS8 A;  4YT2 A;  2NSG A;  2Q4F A;  5CI8 A;  3PDM P;  1AVO B;  5TJ5 E;  3N2Z B;  2HMZ A;  4A4A A;  3DZA A;  1TWA A;  2HV6 A;  4Z9H A;  2AWC A;  3EG9 B;  1D0Z A;  1VLS A;  256B A;  3EH2 A;  1NG1 A;  1SZI A;  3EZI A;  4JCH A;  2J9W A;  3DXJ F;  4P9F A;  3V5Z A;  3T6B A;  2DYS C;  3KYJ A;  1QVX A;  3OA1 A;  1C02 A;  3SZR A;  1WTY A;  2TMV P;  1YVI A;  1IZM A;  1Y6D A;  3HTK C;  3K1I C;  4XPX A;  5DS6 A;  1FAP B;  2R7Q A;  4E7Z A;  1LE2 A;  2YLG A;  4LLC A;  3C18 A;  1BZ4 A;  4N6C A;  5A6K A;  4IJJ A;  1QSP A;  4CDV A;  1FFT C;  1D0X A;  2HS5 A;  4GQH A;  3K1I A;  2J46 A;  4FAP B;  3LES A;  1FR0 A;  1R4T A;  2P6V A;  1ZHZ A;  1BR2 A;  3ASO C;  3SYN A;  1LIH A;  1N1C A;  4I1M A;  2PNO A;  1YLM A;  4JIO A;  1G4W R;  3KMI A;  4CIH A;  3PMR A;  4A2N B;  2NPU A;  2XLV A;  4E17 A;  3QW0 A;  4WAB A;  1GM5 A;  2IXO A;  3HNL A;  1MMA A;  3NKE A;  2HFI A;  1Z7Q c;  1A41 A;  4W8K A;  5FZT A;  2HJ3 A;  1BR1 A;  2EIM C;  3K7D A;  1TWH A;  1FFH A;  2L6F A;  2P7V A;  1MND A;  2Y69 C;  1VYK A;  1ZHY A;  2GWW A;  5KYU B;  5E3A A;  2ZD9 A;  1SMY F;  2XLE A;  2KYH A;  1TKN A;  2I8B A;  3S84 A;  1K05 A;  3B9Q A;  2W45 A;  3KH2 A;  3C8G B;  5A6A A;  2CCY A;  1LI7 A;  1O3U A;  2XL4 A;  4P6I C;  4R32 A;  2CDQ A;  1EA8 A;  3UMK A;  5IY5 C;  3T4R A;  4LDK A;  1YA7 O;  4C3D A;  2XXA A;  4EBJ A;  2PBE A;  3FOO A;  1IW7 F;  2JD3 A;  3JSZ A;  3ZVR A;  5B1B C;  1CPR A;  3S9O A;  2QY9 A;  1UG7 A;  1HMO A;  3DMD A;  3DE8 A;  1Q0D A;  2J8W A;  2CYD A;  4XLN F;  3LEO A;  2IXP A;  5JVE A;  1XWJ A;  2ASR A;  2D4U A;  3A9C A;  2CW0 F;  1G4U S;  3LAY A;  2YWA A;  5KYU A;  4BJ1 A;  2WVO A;  1JAF A;  3OWT A;  4XLP F;  2OEV A;  1J8M F;  3RIP A;  3FVY A;  1ZU5 A;  4ULV A;  2E87 A;  2LFD A;  2C03 A;  3CQZ A;  3C63 A;  1TWG A;  2PX0 A;  2ICW G;  2XM0 A;  1OQC A;  4Z9I A;  2V3C C;  2IYL D;  4EHP A;  4JCZ A;  3B0P A;  3EQL F;  3W2V A;  2VCC A;  2OJQ A;  3VM6 A;  4H54 A;  4BJ5 C;  5KYY B;  2OU6 A;  3CEX A;  4NTB A;  1VOM A;  1NFO A;  2NG1 A;  1QKR A;  5L0C A;  1ZHX A;  1S05 A;  3WHN A;  1VLT A;  2Y3H A;  3Q7L A;  3X2Q C;  2GFH A;  4DRJ B;  4EWC A;  4JUR I;  3GWN A;  4CSA C;  3CZ6 A;  3TJ5 A;  3ZQY A;  4JW1 A;  2YLI A;  2G3V A;  4JRZ A;  4PFP A;  1U0B B;  4NTF A;  1EKY A;  2YL3 A;  1OKK A;  2YLD A;  2ZXR A;  4OD4 A;  1HW2 A;  5B1A C;  4NQF A;  4CSA A;  1I4Y A;  4CJO A;  4CBE A;  1ZVZ A;  1EI7 A;  3S0X A;  1YDI A;  2CNW D;  3JTL O;  5EK0 A;  3RW0 A;  4BG0 A;  4FES A;  5A6B A;  3V5Y A;  2R7T A;  3SXK A;  3MBG A;  4X0R A;  4DBR A;  4DRH B;  3LUT B;  4K0D A;  3U5S A;  1VYI A;  5EHH A;  3T6J A;  3LJB A;  1XZP A;  3C8G D;  1WAS A;  2J45 A;  4OIO F;  5JS5 A;  2KW3 C;  1OCR C;  2A6E F;  1WWP A;  1QQ3 A;  3B0V C;  1W2W A;  2V26 A;  3SXM A;  2OQM A;  3PHF 2;  3H2V A;  3R2P A;  4JEB A;  5E2Q A;  2J0X A;  2LIG A;  4MW8 A;  1LM3 B;  3ZSU A;  4EKW A;  2R7X A;  3ZG1 A;  4EBK A;  4IGG A;  1C17 M;  1D0Y A;  2XLW A;  2YL7 A;  3JZ0 A;  2R7V A;  4J32 B;  4OIQ F;  5A69 A;  2YL1 A;  4NTA A;  3ZTZ A;  4IAO A;  5DQZ A;  1OR3 A;  1ST6 A;  3B71 A;  4Q4Z F;  1U89 A;  3L0I A;  1V4A A;  4HEA J;  2GDC A;  3NMJ A;  4C3B A;  4MVQ A;  4O7G A;  1MMN A;  1XZQ A;  3ATP A;  1GQA A;  1Z5Z A;  3IQ6 A;  4YL0 A;  4QI0 A;  1SYQ A;  2LP4 A;  1Z63 A;  2KK1 A;  1ZYR F;  4K1O A;  4JEA A;  4D4N A;  4E0I A;  2YEV A;  4W8P A;  3E70 C;  3IQ5 A;  4IAQ A;  3GOD A;  5F5H A;  4CDY A;  4D4X A;  5EGY A;  3RYL A;  3KYI A;  4H4K C;  2FAP B;  3U3F A;  5BQG A;  2Z15 A;  5DS4 A;  5BUO A;  4WJ0 A;  1M2O A;  1VTM P;  3B29 A;  1LI5 A;  1T9K A;  1GS9 A;  3WOD F;  4NCQ A;  3EGD B;  4YL1 A;  5T3W A;  2OEX A;  3NRH A;  4OD5 A;  3SXZ A;  5KYN A;  1L7C A;  3IHU A;  3KPH A;  3HKK A;  1KTM A;  5AC4 A;  1M56 C;  4DVZ A;  1V74 B;  5L0I A;  3DKA A;  3LLI A;  4YL3 A;  3GM3 A;  5DS5 A;  1ZZP A;  3ECS A;  2R03 A;  4GEH A;  1YZC A;  2GA0 A;  3AG3 C;  3UMH A;  1NBB A;  1NSG B;  2LD6 A;  3O39 A;  2HMQ A;  3EPV A;  1M6T A;  1SR2 A;  4LER A;  5A6J A;  1HY5 A;  1OXB A;  2HKV A;  2XL6 A;  1EQ1 A;  3EGD A;  1E85 A;  2EPM X;  3EGX A;  1DOV A;  2VAS A;  2YKZ A;  4JTC B;  5L3V A;  4XQ1 A;  4BJT A;  3DJU B;  1H9T A;  2WB7 A;  4MS2 A;  1MMG A;  4G7H F;  2XXA B;  1Q0M A;  5HV9 A;  4UDV A;  2R7W A;  3DAF A;  2R9R B;  1UFB A;  2WZG A;  3GEE A;  3I5Q A;  3VRC A;  4AX2 A;  3L8I A;  1CPQ A;  1NU7 D;  3T6G B;  2KJG A;  1OW8 A;  3L1M A;  2DGJ A;  2VCA A;  1OW7 A;  2VCB A;  3Q7G A;  5JT4 A;  1ZW2 A;  4MQ9 F;  1R5I D;  4QDL A;  3V7O A;  4WGZ A;  3EHM A;  4YT8 A;  2A69 F;  2EIK C;  2M64 A;  2XLO A;  4CX9 A;  1U6H A;  2XM4 A;  2VB6 A;  3M4C A;  3CSK A;  3S27 A;  1H7I A;  1PD0 A;  1LPE A;  3VF0 A;  4DXW A;  1T5O A;  4MVU A;  4XPW A;  3VAY A;  2QE9 A;  3NKD A;  2WVN A;  1O5H A;  1OCO C;  3WG7 C;  4U5D E;  4HFF B;  3ZWI A;  4IB4 A;  2YQY A;  3NMI A;  2PF4 E;  4CS7 A;  1MNE A;  3GAN A;  1QZX A;  3FOP A;  2Q7R A;  3ZC4 A;  2XS1 A;  4CS9 A;  1C03 A;  2DI3 A;  1BBH A;  2ZPA A;  3F46 A;  3LNM B;  3LS0 A;  4BPM A;  3W2W A;  4OIP F;  3DI5 A;  2J7P A;  2NUT B;  2WL8 A;  4U5C E;  1I4Z A;  1WN0 A;  4OIN F;  2XRH A;  3MLG A;  3U2L A;  5KYW B;  3G4X A;  3KL4 A;  2OCC C;  3U8V A;  2AWY A;  2H7B A;  4EIY A;  3FAP B;  1MMD A;  2P0N A;  3S28 A;  1A7E A;  3MX3 A;  5B3I A;  1LS1 A;  3X1O A;  1Z23 A;  3H65 A;  3N24 A;  2OOC A;  2FGY A;  4FX5 A;  3TUL A;  3J06 A;  5B3S C;  2W9Y A;  3AQC A;  2YZS A;  1D1A A;  3LLK A;  4K7B A;  4KNV A;  3MFN A;  3UNG C;  3LS1 A;  4KBL A;  4O79 A;  2XS8 A;  4AE4 B;  1T6U A;  3IQT A;  1CGM E;  2R7S A;  1WAT A;  2XL8 A;  1D1C A;  4U5H A;  2MWQ A;  3GEH A;  4U5F E;  2Q3T A;  2NUT A;  4U9E A;  4ZLC A;  2Q9B A;  3U9M A;  2A6H F;  5KYW A;  3UGP A;  1TR2 A;  5K0I A;  5L0F A;  4CJG A;  3AG4 C;  1A0B A;  4N4W A;  4EUK B;  1E84 A;  3FMS A;  5FCL A;  1TFO B;  3AG2 C;  1NFN A;  3U2M A;  1FMW A;  2J9V A;  2R7U A;  1TFK B;  1K40 A;  3C8Z A;  3IQC A;  4NC3 A;  1JOG A;  3R7C A;  3TOM A;  1LS4 A;  1OCC C;  1YA9 A;  3OEO A;  1OW6 A;  2JPU A;  3H2U A;  4AE4 A;  5T1D B;  3FXH A;  3O55 A;  4PFO A;  5CI9 A;  4JTD B;  3KKB A;  3RKO F;  1GGQ A;  2O9X A;  2R7R A;  1Q0G A;  5COG A;  3F47 A;  1MQV A;  1E83 A;  1T6I A;  2WZF A;  3M15 A;  3GM2 A;  4L6R A;  4M63 A;  4O6N A;  3RQF A;  3U3B A;  5T3T A;  1RXQ A;  3JYY A;  1RKE A;  4Q5S F;  2DB4 A;  2L6H A;  2NUP A;  2GAQ A;  2J9U A;  1M57 C;  3FAJ A;  4XPY A;  4YT5 A;  5D92 A;  2ZXW C;  3L34 A;  2A1D D;  4YN0 B;  1TWC A;  2BL2 A;  3EFO A;  4AL0 A;  4DRI B;  3QMK A;  2HSQ A;  2EPN A;  3K6B A;  1APC A;  2IXM A;  2HV7 A;  1LVK A;  2MHR A;  3RVZ A;  4JJG A;  4KC9 A;  3JYH A;  3G4Z A;  3K33 A;  4GYT A;  1Q0F A;  4DOZ A;  4ZLD A;  2WVQ A;  2D5R B;  3US6 A;  5DQT A;  3DE9 A;  2NSF A;  4YWQ A;  3AJM A;  2L6G A;  4C7O B;  1YAR O;  4MVR A;  1FMV A;  4ONS A;  3AGU A;  1JPJ A;  4MVS A;  1OKK D;  4P9T A;  4BJ6 C;  3U8P A;  1V54 C;  2HUJ A;  1HMD A;  5L0G A;  1ZW3 A;  5DLJ A;  4JE9 A;  5COM A;  1M2V B;  4QI2 A;  2EPL X;  2HSB A;  4HFK B;  3NYM A;  4G7Z F;  2XSE A;  4DVY P;  3AGT A;  1H6G A;  2H7O A;  1Z3I X;  2YL0 A;  4BJ6 A;  2VC9 A;  3L8J A;  4KNW A;  3JSE O;  5L0H A;  4PJM A;  1Z6A A;  4U9D A;  5DVW A;  2KQ9 A;  3MYF A;  4AL1 A;  1PV3 A;  4O6M A;  2I15 A;  3RFY A;  3ASN C;  2Y3D A;  4EBB A;  4DJ9 A;  4C7O A;  3BRJ A;  2KGO A;  3EGX B; 
#chains in the Genus database with same CATH homology
 1RCP A;  3QVY A;  4WGZ A;  5JP7 A;  3QVZ A;  1A7V A;  4N6H A;  2XLO A;  4CX9 A;  5JUA A;  2XM4 A;  3M4C A;  1YYX A;  4IAR A;  4WGY A;  3ZTM A;  1S05 A;  2XLM A;  1YYJ A;  2XLD A;  3ZWI A;  4IB4 A;  3ZQY A;  2YLI A;  3NMI A;  3FOP A;  1YZA A;  2QLA A;  1EKY A;  3HNJ A;  1BBH A;  2YL3 A;  2YLD A;  3C62 A;  3HNK A;  5JLI A;  4CJO A;  4EIY A;  3NMK A;  4JKV A;  5B3I A;  3QW1 A;  2J9B A;  1CGO A;  4CIP A;  5JS5 A;  2XL8 A;  1QQ3 A;  4U9E A;  256B A;  4JEB A;  3ZQV A;  1LM3 B;  4CJG A;  4N4W A;  3TOL A;  2XLW A;  2YL7 A;  1E84 A;  2YL1 A;  2BC5 A;  3ZTZ A;  4NC3 A;  2YLG A;  3HNI A;  3TOM A;  3NMJ A;  4CDV A;  1CGN A;  1GQA A;  3IQ6 A;  1MQV A;  1E83 A;  4JEA A;  4D4N A;  3M15 A;  4IAQ A;  3IQ5 A;  4L6R A;  4D4X A;  4CDY A;  2XLV A;  3QW0 A;  3HNL A;  3M4B A;  3M79 A;  1APC A;  2XLE A;  3DE9 A;  4CDA A;  1YZC A;  2CCY A;  1NBB A;  2XLH A;  1M6T A;  3U8P A;  3FOO A;  1E86 A;  4JE9 A;  2XL6 A;  1CPR A;  1QPU A;  1E85 A;  3DE8 A;  2J8W A;  2YKZ A;  4ER9 A;  5JRA A;  5JSL A;  5JVE A;  2YL0 A;  4U9D A;  1JAF A;  5AGF A;  3VRC A;  4ULV A;  1CPQ A;  3C63 A;  3L1M A;  2XM0 A;  5JT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...