3IQ6A

Crystal structure of a tetrameric zn-bound cytochrome cb562 complex with covalently and non-covalently stabilized interfaces
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKCTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble cytochrome b562
publication title Evolution of metal selectivity in templated protein interfaces.
pubmed doi rcsb
molecule tags Electron transport
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3iq6A00
2YL7A 1LM3B 1RCPA 3TOLA 1E85A 1S05A 4CJGA 1YZCA 3IQ5A 2XM4A 3QVYA 2J8WA 2XL8A 4N4WA 2BC5A 1E83A 4JE9A 2XLDA 4JEBA 256BA 3M79A 1CGNA 2J9BA 4CDVA 3ZQYA 2XLHA 1QQ3A 4N6HA 2XLOA 3C62A 4CDYA 2XLVA 3L1MA 2YKZA 1E86A 5JP7A 5JSLA 3C63A 3HNJA 3QW1A 5JUAA 2CCYA 1CGOA 4IAQA 1JAFA 3ZTZA 1APCA 2YL3A 4IB4A 4JKVA 4IARA 3ZTMA 1EKYA 3ZWIA 3HNKA 3QW0A 3HNLA 1CPRA 3FOPA 2YL1A 5B3IA 3FOOA 2XM0A 3NMIA 5JVEA 4ULVA 1QPUA 1BBHA 5JLIA 4D4NA 1CPQA 3M4BA 5JRAA 1YYJA 1M6TA 2QLAA 3ZQVA 4CJOA 2XLEA 3M15A 3QVZA 3DE9A 1YYXA 2XL6A 1E84A 1A7VA 4WGYA 5JS5A 1YZAA 2XLMA 1MQVA 4L6RA 3NMJA 3U8PA 4CX9A 3VRCA 3HNIA 4ER9A 3M4CA 4U9EA 3TOMA 2YLIA 3NMKA 4CDAA 1GQAA 5AGFA 2YLGA 2YLDA 3DE8A 3IQ6A 4CIPA 4EIYA 4U9DA 4NC3A 1NBBA 2XLWA 5JT4A 4D4XA 4WGZA 4JEAA 2YL0A
chains in the Genus database with same CATH superfamily
1PD0A 2EPKX 3KYJA 3NYMA 4XQ1A 1LM3B 3SXMA 3C8GA 2QNLA 1FTSA 3ATPA 1WN0A 3GODA 3Q6NA 4MNDA 3L8IA 4JTAB 2QY9A 4CBEA 4LLEA 2J8WA 1KTMA 1PCXA 3BRJA 5HSWA 3ZC4A 2VCCA 3LLKA 4R32A 1NU7D 1G8XA 2KC3A 1LI5A 4JW1A 4X0RA 3TK0A 4JURI 3U5SA 3G4ZA 4AE4B 3AG2C 3M79A 1O5HA 1OCZC 1VMAA 3GM3A 2A6HF 2J9BA 2CW0F 2G62A 4O6MA 3G4XA 4PR9A 2VB6A 2XLHA 3DAGA 3J06A 1QQ3A 1TWCA 2KK1A 2CYDA 3JYYA 3L1MA 4XEVA 3O6XA 2YKZA 1E86A 1LIHA 3QMKA 2DYSC 3HNJA 4IAOA 2J7PA 1M2OA 3EH1A 1MMGA 2H8AA 3QW1A 3V7OA 2RSEB 2IXOA 2Y69C 2IXNA 5JUAA 1K40A 3S84A 5EGYA 3RVYA 1JAFA 3PMRA 5B1BC 2GA0A 2F22A 2YL3A 3RW0A 5L0JA 3N24A 4XEFA 5FCLA 4ONSA 2X0CA 3ZG1A 5DLJA 3CEXA 3T6BA 4LACB 3LUTB 3W2WA 3ZTMA 4DVYP 3GORA 4HFKB 5K0IA 1Z6AA 4K0DA 4JRZA 1D1BA 1H9GA 1EKYA 2VCAA 3DXJF 3LNMB 3QTHA 2ZXOA 5BQGA 4B6IA 2R7OA 3AGUA 3Q6MA 2LFFA 4RD9A 4KNWA 4C3EA 1IZMA 3ABKC 4I1OB 2R7RA 2UUHA 1TR2A 3B29A 1O87A 2O9XA 1KU2A 5JLIA 1RMVA 1CPQA 3M4BA 4AE4A 4P9TA 5D92A 4OIOF 1TWAA 3H2VA 1T6IA 4N06A 1M6TA 3K66A 2CGEA 3M1CB 3RQFA 1I4YA 2Q3TA 2WZGA 3M15A 2LD6A 3DE9A 3JSEO 4XLNF 1XWJA 3HTKC 4PACA 3TULA 2HV7A 1W2WA 1M2VB 2HJ3A 2JPUA 1YJGA 5GPGB 5A6KA 2QUPA 1YVIA 3MFNA 3N0TA 3NMJA 4L6RA 2OKUA 3U8PA 4I1MA 5D91A 2QTVA 1Y6DA 2HV6A 2NUPB 2PFDA 3WHNA 2W9YA 3ASOC 4LLCA 3VRCA 4U5HA 2EILC 3HNIA 3DM9B 3MLGA 1JRAA 3M4CA 1I5NA 3AG3C 3R7CA 4J32B 3O55A 3OEOA 3IHUA 4YN0B 2Z15A 5E3AA 1B68A 2HMQA 1GQAA 5AGFA 2YLGA 5E3CA 1MMAA 2PBEA 3UNGC 2YWAA 1QVXA 4G7HF 1O3UA 3RIPA 1NSGB 2H7OA 1EI7A 2J45A 3A11A 3CZ6A 4H4KC 4JJGA 4XWJA 4CS8C 4EUKB 2EIMC 3FDQA 1YDIA 3MYFA 3EZIA 4XTKA 3C8GD 4DRIB 1D1CA 1Q0GA 4GQHA 3KPHA 1LS4A 4JZAA 2HZ8A 4KNVA 4U5GA 3LESA 2XLMA 2QLAA 4JEAA 3FAPB 3SEOA 2OJQA 2YL7A 2HJMA 3NYJA 4YL1A 3U0CA 1RJ9B 5T1DB 3TOLA 1E85A 4YL3A 1WWPA 1ZU5A 2DI3A 1HE1A 1QSPA 5B3SC 2D4UA 4K7BA 2R7XA 3T6GB 2XM4A 4MTOA 3QVYA 3KMIA 1I4ZA 3HLZA 1RKEB 2XL8A 4N4WA 5DQZA 1OKKA 4NY3A 5CI9A 1QLEC 4JE9A 4BPMA 1ORJA 2KYHA 5KYXB 4JEBA 3X1OA 256BA 2FFHA 1ZW3A 4KI2A 3RQEA 5L0GA 4MQ9F 4U5BE 3DAFA 1M2VA 3ZQYA 4BEMJ 1NFNA 2KQ9A 1LPEA 2HSBA 1OR2A 4JIOA 4N6HA 2XLOA 3U9JA 2L6FA 1OXKA 3FVYA 2IXMA 2XLVA 3B9QA 1G4WR 2NUPA 5E33A 4C3BA 3B0UX 2R05A 3JTLO 4IJJA 2KSFA 3TD7A 1G5ZA 2C04A 2NSGA 3C63A 1YLMA 5COMA 5L0CA 3NG1A 2PP4A 1L3PA 1CGOA 1FAPB 4E17A 2BL2A 3OWTA 3ABMC 5AC4A 2YEVA 4CIHA 1QZXA 2R25A 4EKWA 2OQMA 4JCZA 5L0HA 4CSAC 4YT8A 3SXKA 1MNEA 4P9FA 2W45A 4JC7A 2QE9A 1ZW2A 1CGME 3ECSA 2ASRA 2H7VC 2A6EF 2M64A 4AK9A 4AL1A 2B0JA 2CDQA 4JJFA 1RJ9A 2DYRC 3EPVA 3SYNA 1LKXA 1UG7A 4YWQA 2R7TA 2ZXPA 5B3IA 4OIQF 1LI7A 1A41A 5CIVA 2L6GA 3EGXB 1Q0FA 3B0PA 1RKEA 1YAUO 2AU5A 4G7OF 4BJ5A 2XM0A 1ST6A 3K6BA 3NMIA 4J30B 5JVEA 1QPUA 2KJGA 1BBHA 4CS9A 5KYXA 4EHPA 3VM6A 1VTMP 1K05A 3CAXA 3ASNC 5A6BD 2P7VA 5CI8A 2XS8A 3VYWA 4G0HA 3KYIA 4YT4A 1RXQA 2NUTB 5KYWB 3WG7C 4BJ1A 2EINC 5E2QA 3F46A 3U3BA 1H7IA 3MYIA 4NCQA 4W8PA 2Q4FA 3E9VA 1TKNA 2Q7RA 4E0HA 1AUEA 1SZIA 4PJJA 1YZAA 4E0IA 1VYKA 2EPOA 1C17M 2OOCA 3DZAA 2WL8A 2MWQA 3LAYA 2CNWA 4GYTA 1FNTc 2J0XA 3EQLF 1D0XA 1E2XA 4XPYA 5IY5C 3DM5A 3JYHA 1D0YA 3AG1C 3RH3A 1NLXA 4E7SA 2GAQA 4XPWA 2E87A 3TOMA 5L0DA 4DOZA 2FAPB 2GDCA 4O79A 3NMKA 1H6GA 4HEAJ 1WATA 5BQIA 4CDAA 2EPMX 3DKAA 3DWWA 4Q7CA 1Q0MA 1WGWA 2LIGA 2PNOA 3VF0A 1VLTA 4I3MA 2VASA 1LS1A 4IRUA 4JVSA 3NDBB 1ORSC 1C02A 2LK4A 1NFOA 2R02A 4CIPA 1HMOA 1OCOC 2XS1A 3C7JA 3EFOB 4NC3A 2WB7A 2XLWA 1TWHA 4FWVA 4DBRA 3WODF 4A2NB 2A1DD 3R2PA 1UFBA 4MW8A 5DS6A 3EGXA 1SR2A 1FMVA 1T5OA 3B71A 3NYLA 5DQTA 3W4YA 3NRHA 1RCPA 4RBNA 1OKKD 1ZHWA 1JOGA 2ZPAA 4CJGA 3DD7A 3LLIA 1HW1A 4U5CE 3IQ5A 1T01A 1WOLA 4PJNA 3SP1A 3U9MA 4XLPF 2R7UA 4MVMA 3V5YA 1VB5A 2ZD9A 3CSKA 3O10A 2LFDA 4DBQA 2NUTA 5KYWA 1JMWA 2WVOA 2ICWG 3I5QA 3V5XA 1RKCA 1XZPA 3EZHA 2VCBA 1M56C 3PCVA 4AL0A 1J8YF 4GEHA 5KYYB 2Y3DA 4Z9JA 4PFOA 2HSQA 3S0XA 3BEHA 2A68F 4MW3A 1V54C 4C7OB 4QI2A 3C62A 4FESA 3KL4A 1IW7F 1G4US 1LE2A 3TJ6A 5EHHA 5EK0A 5JP7A 2X51A 3S29A 1H9TA 3SXZA 2RD9A 2Y39A 4AX2A 3US6A 3IPMO 2AWCA 4LERA 1DOWA 4BEJA 3K1IA 2CCYA 1FMWA 3AG4C 3IQTA 4O6YA 4DRHB 2WZLA 1ZHZA 1OW8A 2Q9BA 2W4MA 3VAYA 3DJNB 4H54A 2Y3GA 3MX3A 4DVZA 1V74B 3RVZA 3EFOA 2Q9AA 1WTYA 1TFKB 2C03A 1AVOB 3U2MA 3S27A 3JT1A 4IARA 4CS7A 4G78A 4O7GA 3G50A 3U8VA 4NTFA 2YQYA 1R4TA 2J7PD 1T6UA 2MHRA 3HNKA 2OEXA 2R7QA 3GM2A 1CPRA 1TWGA 3AQCA 3FOPA 3HNLA 4NTAA 4E7ZA 1GM5A 1OCCC 2J9VA 4MS2A 1AEPA 4LDKA 3ZIBA 4DXWA 3DMDA 3HJCA 2HUJA 2KW3C 2G3VA 1MMNA 1A7EA 2J0WA 3RF3A 4MTFA 2B0HA 3PDMP 4OIRF 2L6HA 5JRAA 4ANJA 4D4NA 2Q00A 4YK5A 2R7WA 2HS5A 3O39A 2J9WA 3ABLC 5KYYA 4N6CA 5KYUB 4QDLA 2GFHA 1YYJA 4LDRA 2P1AA 2D5RB 4EBKA 4JTDB 2M4EA 1BDJB 1Z3IX 3POVA 3U3FA 1FR0A 3QVZA 2EPLX 3GWLA 1DOVA 2XL6A 2A0BA 4XPXA 4E18A 2G3KA 2CNWD 5DVWA 3C8ZA 2J46A 2J9UA 1E84A 2V26A 2ZXWC 1MNDA 1V4AA 2VC9A 5JS5A 3SNHA 2JD3A 2HMZA 2R9RB 1VK5A 4EBBA 2LSEA 2UUIA 1JR8A 4HFFB 3AGTA 1OW7A 1OXBA 1VLSA 2LP4A 1HMDA 1U89A 5AC5A 1Z7Qc 3GEIA 1OW6A 1ZHXA 4ER9A 4U9EA 1YARO 1BR2A 2IOQA 2R7SA 1SYQA 3FHDA 3EG9B 3NKDA 4XEKA 3W2VA 5L0IA 1T9KA 2I8BA 1D1AA 2JX0A 4MVOA 1E83A 3TJ5A 3EHMA 3GM1A 4Z9IA 1OR3A 1T6QA 5L0FA 2V3CC 3V5ZA 5BQHA 1VYIA 2EIJC 2KGOA 3IQ6A 3N2ZB 3AJMA 3JCUQ 2P0NA 4K1OA 4MVQA 4PJLA 4PK4A 5T3TA 2W4BA 4EIYA 2NG1A 2OEVA 3K7DA 2XL4A 1PV3A 3C18A 3LS1A 4FX5A 4PFPA 1WASA 3SZRA 5JT4A 5BUOA 2DB4A 1EA8A 2Y3BA 4M63A 4O6NA 4U5DE 1BZ4A 2Y3HA 3QZCA 2OG2A 5L3VA 3KH2A 4U5FE 4YT2A 2XSEA 1ZYRF 3S9OA 3KKBA 1K04A 5F5FA 3Q7GA 1S05A 3RFYA 4DRJB 5KYUA 2HKVA 1YZCA 2NSFA 2VH3A 3LJBA 5COFA 3OA1A 2EPNA 2OCCC 3X2QC 2FGYA 4BJ5C 4OD4A 3FXHA 3UMIA 1LVKA 1JPJA 2BC5A 4LDQA 4YJWA 4CS9C 2XLDA 1C03A 1MMDA 2WZFA 1ZU4A 1OQCA 3K1HA 4J7YA 4PJMA 4C3DA 1VOMA 4MVZA 1ZHYA 1CGNA 2ZXRA 3AQBA 3L8JA 3WAQA 1Z23A 3L0IA 4CDVA 2TMVP 2WVQA 2XXAB 4MVRA 2YRFA 3DI5A 3ZDLA 3W8HA 4CDYA 1Y4CA 2A69F 4ULWA 3T6JA 1ZZPA 3JRMO 1Q0DA 2L81A 1F1MA 4WABA 4IGGA 5JSLA 3UGOA 1BR4A 3I4UA 4MVSA 1ORYA 5T3WA 3EG9A 4JCHA 4HE8D 4BG0A 1ZHTA 1QKRA 3LNRA 3LS0A 4UDVA 4IAQA 5F5HA 1Z5ZA 1HY5A 1V55C 2IM8A 3EHNA 3EGDB 3EJNA 1U6HA 3ZTZA 1APCA 2AVKA 2H7BA 3HKKA 2MYSA 4IB4A 4OD5A 4KC9A 3MBGA 4QI0A 3UR3C 2KNHA 4JKVA 1J8MF 1SF8A 1R5ID 3CQZA 4F4BA 4J7TA 2YHSA 2P61A 2IXPA 2OJED 3RQGA 1XZQA 3GANA 4CS8A 1YA7O 3LEOA 5FZTA 5A6BA 2A0UA 3FMSA 3GEEA 2P6VA 4A4AA 3IQCA 3ZWIA 1Z63A 3QW0A 1KNYA 4U5EE 5HV9A 2LCHA 1TFOB 4YL0A 2YL1A 2ETSA 4ZLDA 2EIKC 3H65A 3FOOA 5COGA 3JZ0A 3RYLA 2YVKA 3SXYA 5F28E 1NZEA 3S28A 2R03A 2BE5F 2NPUA 2OU6A 4DJ9A 2L7AA 1SMYF 3NKEA 4ULVA 3C8GB 4MVUA 2GWWA 2Q9CA 2IYLD 1D0ZA 1N1CA 3AOUA 1M57C 2L9JA 3ZQVA 1GS9A 4BJ6A 2I15A 3K33A 2R7VA 3L34A 4Z9HA 4CJOA 2XXAA 2XLEA 1Q0KA 1EQ1A 5TJ5E 2DGJA 4RDAA 1YYXA 3IEEA 3LEVA 4NTBA 1A0BA 1L7CA 3UMKA 4FAPB 5A6AA 1A7VA 3E70C 5DS4A 1LE4A 4WGYA 3ZSUA 4YT5A 1HW2A 1MQVA 3Q7LA 3F47A 5KYNA 4Q4ZF 4ZLCA 4EBJA 5A6JA 3S90A 1GGQA 3GWNA 4C7OA 2YZSA 3EGDA 1NG1A 2AWYA 4CX9A 2WVNA 4OIPF 2XRHA 1BR1A 1PD1A 2PF4E 2PX0A 1TQGA 1HE9A 3K1IC 3FAJA 3TQOA 3H2UA 2YLIA 3ITFA 3PHF2 2HFIA 3T9OA 4EWCA 4CSAA 3A9CA 3GEHA 1FFHA 1FFTC 1JPNA 1S7ZA 4MTGA 5B1AC 3ZVRA 4BJ6C 1A7DA 4IWBA 4G7ZF 1NU9C 3EH2A 1OCRC 2YLDA 4P6IC 3DJUB 2PX3A 4OINF 3I5PA 4JTCB 3UGPA 3DE8A 1U0BB 4NQFA 1YA9A 3U2LA 5A69A 4W8KA 4WJ0A 3T4RA 5L3QA 4U9DA 5DS5A 3RKOF 1NBBA 3JSZA 4I44A 3JRTA 3B0VC 2IBFA 3UMHA 1ZVZA 4Q5SF 4BJTA 4KBLA 2LQGA 3W8IA 4D4XA 4WGZA 2AP3A 2YL0A
chains in the Genus database with same CATH topology
2YL7A 1LM3B 1RCPA 3TOLA 1E85A 1S05A 4CJGA 1YZCA 3IQ5A 2XM4A 3QVYA 2J8WA 2XL8A 4N4WA 2BC5A 1E83A 4JE9A 2XLDA 4JEBA 256BA 3M79A 1CGNA 2J9BA 4CDVA 3ZQYA 2XLHA 1QQ3A 4N6HA 2XLOA 3C62A 4CDYA 2XLVA 3L1MA 2YKZA 1E86A 5JP7A 5JSLA 3C63A 3HNJA 3QW1A 5JUAA 2CCYA 1CGOA 4IAQA 1JAFA 3ZTZA 1APCA 2YL3A 4IB4A 4JKVA 4IARA 3ZTMA 1EKYA 3ZWIA 3HNKA 3QW0A 3HNLA 1CPRA 3FOPA 2YL1A 5B3IA 3FOOA 2XM0A 3NMIA 5JVEA 4ULVA 1QPUA 1BBHA 5JLIA 4D4NA 1CPQA 3M4BA 5JRAA 1YYJA 1M6TA 2QLAA 3ZQVA 4CJOA 2XLEA 3M15A 3QVZA 3DE9A 1YYXA 2XL6A 1E84A 1A7VA 4WGYA 5JS5A 1YZAA 2XLMA 1MQVA 4L6RA 3NMJA 3U8PA 4CX9A 3VRCA 3HNIA 4ER9A 3M4CA 4U9EA 3TOMA 2YLIA 3NMKA 4CDAA 1GQAA 5AGFA 2YLGA 2YLDA 3DE8A 3IQ6A 4CIPA 4EIYA 4U9DA 4NC3A 1NBBA 2XLWA 5JT4A 4D4XA 4WGZA 4JEAA 2YL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YL7 A;  1LM3 B;  1RCP A;  3TOL A;  1E85 A;  1S05 A;  4CJG A;  1YZC A;  3IQ5 A;  2XM4 A;  3QVY A;  2J8W A;  2XL8 A;  4N4W A;  2BC5 A;  1E83 A;  4JE9 A;  2XLD A;  4JEB A;  256B A;  3M79 A;  1CGN A;  2J9B A;  4CDV A;  3ZQY A;  2XLH A;  1QQ3 A;  4N6H A;  2XLO A;  3C62 A;  4CDY A;  2XLV A;  3L1M A;  2YKZ A;  1E86 A;  5JP7 A;  5JSL A;  3C63 A;  3HNJ A;  3QW1 A;  5JUA A;  2CCY A;  1CGO A;  4IAQ A;  1JAF A;  3ZTZ A;  1APC A;  2YL3 A;  4IB4 A;  4JKV A;  4IAR A;  3ZTM A;  1EKY A;  3ZWI A;  3HNK A;  3QW0 A;  3HNL A;  1CPR A;  3FOP A;  2YL1 A;  5B3I A;  3FOO A;  2XM0 A;  3NMI A;  5JVE A;  4ULV A;  1QPU A;  1BBH A;  5JLI A;  4D4N A;  1CPQ A;  3M4B A;  5JRA A;  1YYJ A;  1M6T A;  2QLA A;  3ZQV A;  4CJO A;  2XLE A;  3M15 A;  3QVZ A;  3DE9 A;  1YYX A;  2XL6 A;  1E84 A;  1A7V A;  4WGY A;  5JS5 A;  1YZA A;  2XLM A;  1MQV A;  4L6R A;  3NMJ A;  3U8P A;  4CX9 A;  3VRC A;  3HNI A;  4ER9 A;  3M4C A;  4U9E A;  3TOM A;  2YLI A;  3NMK A;  4CDA A;  1GQA A;  5AGF A;  2YLG A;  2YLD A;  3DE8 A;  3IQ6 A;  4CIP A;  4EIY A;  4U9D A;  4NC3 A;  1NBB A;  2XLW A;  5JT4 A;  4D4X A;  4WGZ A;  4JEA A;  2YL0 A; 
#chains in the Genus database with same CATH topology
 1PD0 A;  2EPK X;  3KYJ A;  3NYM A;  4XQ1 A;  1LM3 B;  3SXM A;  3C8G A;  2QNL A;  1FTS A;  3ATP A;  1WN0 A;  3GOD A;  3Q6N A;  4MND A;  3L8I A;  4JTA B;  2QY9 A;  4CBE A;  4LLE A;  2J8W A;  1KTM A;  1PCX A;  3BRJ A;  5HSW A;  3ZC4 A;  2VCC A;  3LLK A;  4R32 A;  1NU7 D;  1G8X A;  2KC3 A;  1LI5 A;  4JW1 A;  4X0R A;  3TK0 A;  4JUR I;  3U5S A;  3G4Z A;  4AE4 B;  3AG2 C;  3M79 A;  1O5H A;  1OCZ C;  1VMA A;  3GM3 A;  2A6H F;  2J9B A;  2CW0 F;  2G62 A;  4O6M A;  3G4X A;  4PR9 A;  2VB6 A;  2XLH A;  3DAG A;  3J06 A;  1QQ3 A;  1TWC A;  2KK1 A;  2CYD A;  3JYY A;  3L1M A;  4XEV A;  3O6X A;  2YKZ A;  1E86 A;  1LIH A;  3QMK A;  2DYS C;  3HNJ A;  4IAO A;  2J7P A;  1M2O A;  3EH1 A;  1MMG A;  2H8A A;  3QW1 A;  3V7O A;  2RSE B;  2IXO A;  2Y69 C;  2IXN A;  5JUA A;  1K40 A;  3S84 A;  5EGY A;  3RVY A;  1JAF A;  3PMR A;  5B1B C;  2GA0 A;  2F22 A;  2YL3 A;  3RW0 A;  5L0J A;  3N24 A;  4XEF A;  5FCL A;  4ONS A;  2X0C A;  3ZG1 A;  5DLJ A;  3CEX A;  3T6B A;  4LAC B;  3LUT B;  3W2W A;  3ZTM A;  4DVY P;  3GOR A;  4HFK B;  5K0I A;  1Z6A A;  4K0D A;  4JRZ A;  1D1B A;  1H9G A;  1EKY A;  2VCA A;  3DXJ F;  3LNM B;  3QTH A;  2ZXO A;  5BQG A;  4B6I A;  2R7O A;  3AGU A;  3Q6M A;  2LFF A;  4RD9 A;  4KNW A;  4C3E A;  1IZM A;  3ABK C;  4I1O B;  2R7R A;  2UUH A;  1TR2 A;  3B29 A;  1O87 A;  2O9X A;  1KU2 A;  5JLI A;  1RMV A;  1CPQ A;  3M4B A;  4AE4 A;  4P9T A;  5D92 A;  4OIO F;  1TWA A;  3H2V A;  1T6I A;  4N06 A;  1M6T A;  3K66 A;  2CGE A;  3M1C B;  3RQF A;  1I4Y A;  2Q3T A;  2WZG A;  3M15 A;  2LD6 A;  3DE9 A;  3JSE O;  4XLN F;  1XWJ A;  3HTK C;  4PAC A;  3TUL A;  2HV7 A;  1W2W A;  1M2V B;  2HJ3 A;  2JPU A;  1YJG A;  5GPG B;  5A6K A;  2QUP A;  1YVI A;  3MFN A;  3N0T A;  3NMJ A;  4L6R A;  2OKU A;  3U8P A;  4I1M A;  5D91 A;  2QTV A;  1Y6D A;  2HV6 A;  2NUP B;  2PFD A;  3WHN A;  2W9Y A;  3ASO C;  4LLC A;  3VRC A;  4U5H A;  2EIL C;  3HNI A;  3DM9 B;  3MLG A;  1JRA A;  3M4C A;  1I5N A;  3AG3 C;  3R7C A;  4J32 B;  3O55 A;  3OEO A;  3IHU A;  4YN0 B;  2Z15 A;  5E3A A;  1B68 A;  2HMQ A;  1GQA A;  5AGF A;  2YLG A;  5E3C A;  1MMA A;  2PBE A;  3UNG C;  2YWA A;  1QVX A;  4G7H F;  1O3U A;  3RIP A;  1NSG B;  2H7O A;  1EI7 A;  2J45 A;  3A11 A;  3CZ6 A;  4H4K C;  4JJG A;  4XWJ A;  4CS8 C;  4EUK B;  2EIM C;  3FDQ A;  1YDI A;  3MYF A;  3EZI A;  4XTK A;  3C8G D;  4DRI B;  1D1C A;  1Q0G A;  4GQH A;  3KPH A;  1LS4 A;  4JZA A;  2HZ8 A;  4KNV A;  4U5G A;  3LES A;  2XLM A;  2QLA A;  4JEA A;  3FAP B;  3SEO A;  2OJQ A;  2YL7 A;  2HJM A;  3NYJ A;  4YL1 A;  3U0C A;  1RJ9 B;  5T1D B;  3TOL A;  1E85 A;  4YL3 A;  1WWP A;  1ZU5 A;  2DI3 A;  1HE1 A;  1QSP A;  5B3S C;  2D4U A;  4K7B A;  2R7X A;  3T6G B;  2XM4 A;  4MTO A;  3QVY A;  3KMI A;  1I4Z A;  3HLZ A;  1RKE B;  2XL8 A;  4N4W A;  5DQZ A;  1OKK A;  4NY3 A;  5CI9 A;  1QLE C;  4JE9 A;  4BPM A;  1ORJ A;  2KYH A;  5KYX B;  4JEB A;  3X1O A;  256B A;  2FFH A;  1ZW3 A;  4KI2 A;  3RQE A;  5L0G A;  4MQ9 F;  4U5B E;  3DAF A;  1M2V A;  3ZQY A;  4BEM J;  1NFN A;  2KQ9 A;  1LPE A;  2HSB A;  1OR2 A;  4JIO A;  4N6H A;  2XLO A;  3U9J A;  2L6F A;  1OXK A;  3FVY A;  2IXM A;  2XLV A;  3B9Q A;  1G4W R;  2NUP A;  5E33 A;  4C3B A;  3B0U X;  2R05 A;  3JTL O;  4IJJ A;  2KSF A;  3TD7 A;  1G5Z A;  2C04 A;  2NSG A;  3C63 A;  1YLM A;  5COM A;  5L0C A;  3NG1 A;  2PP4 A;  1L3P A;  1CGO A;  1FAP B;  4E17 A;  2BL2 A;  3OWT A;  3ABM C;  5AC4 A;  2YEV A;  4CIH A;  1QZX A;  2R25 A;  4EKW A;  2OQM A;  4JCZ A;  5L0H A;  4CSA C;  4YT8 A;  3SXK A;  1MNE A;  4P9F A;  2W45 A;  4JC7 A;  2QE9 A;  1ZW2 A;  1CGM E;  3ECS A;  2ASR A;  2H7V C;  2A6E F;  2M64 A;  4AK9 A;  4AL1 A;  2B0J A;  2CDQ A;  4JJF A;  1RJ9 A;  2DYR C;  3EPV A;  3SYN A;  1LKX A;  1UG7 A;  4YWQ A;  2R7T A;  2ZXP A;  5B3I A;  4OIQ F;  1LI7 A;  1A41 A;  5CIV A;  2L6G A;  3EGX B;  1Q0F A;  3B0P A;  1RKE A;  1YAU O;  2AU5 A;  4G7O F;  4BJ5 A;  2XM0 A;  1ST6 A;  3K6B A;  3NMI A;  4J30 B;  5JVE A;  1QPU A;  2KJG A;  1BBH A;  4CS9 A;  5KYX A;  4EHP A;  3VM6 A;  1VTM P;  1K05 A;  3CAX A;  3ASN C;  5A6B D;  2P7V A;  5CI8 A;  2XS8 A;  3VYW A;  4G0H A;  3KYI A;  4YT4 A;  1RXQ A;  2NUT B;  5KYW B;  3WG7 C;  4BJ1 A;  2EIN C;  5E2Q A;  3F46 A;  3U3B A;  1H7I A;  3MYI A;  4NCQ A;  4W8P A;  2Q4F A;  3E9V A;  1TKN A;  2Q7R A;  4E0H A;  1AUE A;  1SZI A;  4PJJ A;  1YZA A;  4E0I A;  1VYK A;  2EPO A;  1C17 M;  2OOC A;  3DZA A;  2WL8 A;  2MWQ A;  3LAY A;  2CNW A;  4GYT A;  1FNT c;  2J0X A;  3EQL F;  1D0X A;  1E2X A;  4XPY A;  5IY5 C;  3DM5 A;  3JYH A;  1D0Y A;  3AG1 C;  3RH3 A;  1NLX A;  4E7S A;  2GAQ A;  4XPW A;  2E87 A;  3TOM A;  5L0D A;  4DOZ A;  2FAP B;  2GDC A;  4O79 A;  3NMK A;  1H6G A;  4HEA J;  1WAT A;  5BQI A;  4CDA A;  2EPM X;  3DKA A;  3DWW A;  4Q7C A;  1Q0M A;  1WGW A;  2LIG A;  2PNO A;  3VF0 A;  1VLT A;  4I3M A;  2VAS A;  1LS1 A;  4IRU A;  4JVS A;  3NDB B;  1ORS C;  1C02 A;  2LK4 A;  1NFO A;  2R02 A;  4CIP A;  1HMO A;  1OCO C;  2XS1 A;  3C7J A;  3EFO B;  4NC3 A;  2WB7 A;  2XLW A;  1TWH A;  4FWV A;  4DBR A;  3WOD F;  4A2N B;  2A1D D;  3R2P A;  1UFB A;  4MW8 A;  5DS6 A;  3EGX A;  1SR2 A;  1FMV A;  1T5O A;  3B71 A;  3NYL A;  5DQT A;  3W4Y A;  3NRH A;  1RCP A;  4RBN A;  1OKK D;  1ZHW A;  1JOG A;  2ZPA A;  4CJG A;  3DD7 A;  3LLI A;  1HW1 A;  4U5C E;  3IQ5 A;  1T01 A;  1WOL A;  4PJN A;  3SP1 A;  3U9M A;  4XLP F;  2R7U A;  4MVM A;  3V5Y A;  1VB5 A;  2ZD9 A;  3CSK A;  3O10 A;  2LFD A;  4DBQ A;  2NUT A;  5KYW A;  1JMW A;  2WVO A;  2ICW G;  3I5Q A;  3V5X A;  1RKC A;  1XZP A;  3EZH A;  2VCB A;  1M56 C;  3PCV A;  4AL0 A;  1J8Y F;  4GEH A;  5KYY B;  2Y3D A;  4Z9J A;  4PFO A;  2HSQ A;  3S0X A;  3BEH A;  2A68 F;  4MW3 A;  1V54 C;  4C7O B;  4QI2 A;  3C62 A;  4FES A;  3KL4 A;  1IW7 F;  1G4U S;  1LE2 A;  3TJ6 A;  5EHH A;  5EK0 A;  5JP7 A;  2X51 A;  3S29 A;  1H9T A;  3SXZ A;  2RD9 A;  2Y39 A;  4AX2 A;  3US6 A;  3IPM O;  2AWC A;  4LER A;  1DOW A;  4BEJ A;  3K1I A;  2CCY A;  1FMW A;  3AG4 C;  3IQT A;  4O6Y A;  4DRH B;  2WZL A;  1ZHZ A;  1OW8 A;  2Q9B A;  2W4M A;  3VAY A;  3DJN B;  4H54 A;  2Y3G A;  3MX3 A;  4DVZ A;  1V74 B;  3RVZ A;  3EFO A;  2Q9A A;  1WTY A;  1TFK B;  2C03 A;  1AVO B;  3U2M A;  3S27 A;  3JT1 A;  4IAR A;  4CS7 A;  4G78 A;  4O7G A;  3G50 A;  3U8V A;  4NTF A;  2YQY A;  1R4T A;  2J7P D;  1T6U A;  2MHR A;  3HNK A;  2OEX A;  2R7Q A;  3GM2 A;  1CPR A;  1TWG A;  3AQC A;  3FOP A;  3HNL A;  4NTA A;  4E7Z A;  1GM5 A;  1OCC C;  2J9V A;  4MS2 A;  1AEP A;  4LDK A;  3ZIB A;  4DXW A;  3DMD A;  3HJC A;  2HUJ A;  2KW3 C;  2G3V A;  1MMN A;  1A7E A;  2J0W A;  3RF3 A;  4MTF A;  2B0H A;  3PDM P;  4OIR F;  2L6H A;  5JRA A;  4ANJ A;  4D4N A;  2Q00 A;  4YK5 A;  2R7W A;  2HS5 A;  3O39 A;  2J9W A;  3ABL C;  5KYY A;  4N6C A;  5KYU B;  4QDL A;  2GFH A;  1YYJ A;  4LDR A;  2P1A A;  2D5R B;  4EBK A;  4JTD B;  2M4E A;  1BDJ B;  1Z3I X;  3POV A;  3U3F A;  1FR0 A;  3QVZ A;  2EPL X;  3GWL A;  1DOV A;  2XL6 A;  2A0B A;  4XPX A;  4E18 A;  2G3K A;  2CNW D;  5DVW A;  3C8Z A;  2J46 A;  2J9U A;  1E84 A;  2V26 A;  2ZXW C;  1MND A;  1V4A A;  2VC9 A;  5JS5 A;  3SNH A;  2JD3 A;  2HMZ A;  2R9R B;  1VK5 A;  4EBB A;  2LSE A;  2UUI A;  1JR8 A;  4HFF B;  3AGT A;  1OW7 A;  1OXB A;  1VLS A;  2LP4 A;  1HMD A;  1U89 A;  5AC5 A;  1Z7Q c;  3GEI A;  1OW6 A;  1ZHX A;  4ER9 A;  4U9E A;  1YAR O;  1BR2 A;  2IOQ A;  2R7S A;  1SYQ A;  3FHD A;  3EG9 B;  3NKD A;  4XEK A;  3W2V A;  5L0I A;  1T9K A;  2I8B A;  1D1A A;  2JX0 A;  4MVO A;  1E83 A;  3TJ5 A;  3EHM A;  3GM1 A;  4Z9I A;  1OR3 A;  1T6Q A;  5L0F A;  2V3C C;  3V5Z A;  5BQH A;  1VYI A;  2EIJ C;  2KGO A;  3IQ6 A;  3N2Z B;  3AJM A;  3JCU Q;  2P0N A;  4K1O A;  4MVQ A;  4PJL A;  4PK4 A;  5T3T A;  2W4B A;  4EIY A;  2NG1 A;  2OEV A;  3K7D A;  2XL4 A;  1PV3 A;  3C18 A;  3LS1 A;  4FX5 A;  4PFP A;  1WAS A;  3SZR A;  5JT4 A;  5BUO A;  2DB4 A;  1EA8 A;  2Y3B A;  4M63 A;  4O6N A;  4U5D E;  1BZ4 A;  2Y3H A;  3QZC A;  2OG2 A;  5L3V A;  3KH2 A;  4U5F E;  4YT2 A;  2XSE A;  1ZYR F;  3S9O A;  3KKB A;  1K04 A;  5F5F A;  3Q7G A;  1S05 A;  3RFY A;  4DRJ B;  5KYU A;  2HKV A;  1YZC A;  2NSF A;  2VH3 A;  3LJB A;  5COF A;  3OA1 A;  2EPN A;  2OCC C;  3X2Q C;  2FGY A;  4BJ5 C;  4OD4 A;  3FXH A;  3UMI A;  1LVK A;  1JPJ A;  2BC5 A;  4LDQ A;  4YJW A;  4CS9 C;  2XLD A;  1C03 A;  1MMD A;  2WZF A;  1ZU4 A;  1OQC A;  3K1H A;  4J7Y A;  4PJM A;  4C3D A;  1VOM A;  4MVZ A;  1ZHY A;  1CGN A;  2ZXR A;  3AQB A;  3L8J A;  3WAQ A;  1Z23 A;  3L0I A;  4CDV A;  2TMV P;  2WVQ A;  2XXA B;  4MVR A;  2YRF A;  3DI5 A;  3ZDL A;  3W8H A;  4CDY A;  1Y4C A;  2A69 F;  4ULW A;  3T6J A;  1ZZP A;  3JRM O;  1Q0D A;  2L81 A;  1F1M A;  4WAB A;  4IGG A;  5JSL A;  3UGO A;  1BR4 A;  3I4U A;  4MVS A;  1ORY A;  5T3W A;  3EG9 A;  4JCH A;  4HE8 D;  4BG0 A;  1ZHT A;  1QKR A;  3LNR A;  3LS0 A;  4UDV A;  4IAQ A;  5F5H A;  1Z5Z A;  1HY5 A;  1V55 C;  2IM8 A;  3EHN A;  3EGD B;  3EJN A;  1U6H A;  3ZTZ A;  1APC A;  2AVK A;  2H7B A;  3HKK A;  2MYS A;  4IB4 A;  4OD5 A;  4KC9 A;  3MBG A;  4QI0 A;  3UR3 C;  2KNH A;  4JKV A;  1J8M F;  1SF8 A;  1R5I D;  3CQZ A;  4F4B A;  4J7T A;  2YHS A;  2P61 A;  2IXP A;  2OJE D;  3RQG A;  1XZQ A;  3GAN A;  4CS8 A;  1YA7 O;  3LEO A;  5FZT A;  5A6B A;  2A0U A;  3FMS A;  3GEE A;  2P6V A;  4A4A A;  3IQC A;  3ZWI A;  1Z63 A;  3QW0 A;  1KNY A;  4U5E E;  5HV9 A;  2LCH A;  1TFO B;  4YL0 A;  2YL1 A;  2ETS A;  4ZLD A;  2EIK C;  3H65 A;  3FOO A;  5COG A;  3JZ0 A;  3RYL A;  2YVK A;  3SXY A;  5F28 E;  1NZE A;  3S28 A;  2R03 A;  2BE5 F;  2NPU A;  2OU6 A;  4DJ9 A;  2L7A A;  1SMY F;  3NKE A;  4ULV A;  3C8G B;  4MVU A;  2GWW A;  2Q9C A;  2IYL D;  1D0Z A;  1N1C A;  3AOU A;  1M57 C;  2L9J A;  3ZQV A;  1GS9 A;  4BJ6 A;  2I15 A;  3K33 A;  2R7V A;  3L34 A;  4Z9H A;  4CJO A;  2XXA A;  2XLE A;  1Q0K A;  1EQ1 A;  5TJ5 E;  2DGJ A;  4RDA A;  1YYX A;  3IEE A;  3LEV A;  4NTB A;  1A0B A;  1L7C A;  3UMK A;  4FAP B;  5A6A A;  1A7V A;  3E70 C;  5DS4 A;  1LE4 A;  4WGY A;  3ZSU A;  4YT5 A;  1HW2 A;  1MQV A;  3Q7L A;  3F47 A;  5KYN A;  4Q4Z F;  4ZLC A;  4EBJ A;  5A6J A;  3S90 A;  1GGQ A;  3GWN A;  4C7O A;  2YZS A;  3EGD A;  1NG1 A;  2AWY A;  4CX9 A;  2WVN A;  4OIP F;  2XRH A;  1BR1 A;  1PD1 A;  2PF4 E;  2PX0 A;  1TQG A;  1HE9 A;  3K1I C;  3FAJ A;  3TQO A;  3H2U A;  2YLI A;  3ITF A;  3PHF 2;  2HFI A;  3T9O A;  4EWC A;  4CSA A;  3A9C A;  3GEH A;  1FFH A;  1FFT C;  1JPN A;  1S7Z A;  4MTG A;  5B1A C;  3ZVR A;  4BJ6 C;  1A7D A;  4IWB A;  4G7Z F;  1NU9 C;  3EH2 A;  1OCR C;  2YLD A;  4P6I C;  3DJU B;  2PX3 A;  4OIN F;  3I5P A;  4JTC B;  3UGP A;  3DE8 A;  1U0B B;  4NQF A;  1YA9 A;  3U2L A;  5A69 A;  4W8K A;  4WJ0 A;  3T4R A;  5L3Q A;  4U9D A;  5DS5 A;  3RKO F;  1NBB A;  3JSZ A;  4I44 A;  3JRT A;  3B0V C;  2IBF A;  3UMH A;  1ZVZ A;  4Q5S F;  4BJT A;  4KBL A;  2LQG A;  3W8I A;  4D4X A;  4WGZ A;  2AP3 A;  2YL0 A; 
#chains in the Genus database with same CATH homology
 2YL7 A;  1LM3 B;  1RCP A;  3TOL A;  1E85 A;  1S05 A;  4CJG A;  1YZC A;  3IQ5 A;  2XM4 A;  3QVY A;  2J8W A;  2XL8 A;  4N4W A;  2BC5 A;  1E83 A;  4JE9 A;  2XLD A;  4JEB A;  256B A;  3M79 A;  1CGN A;  2J9B A;  4CDV A;  3ZQY A;  2XLH A;  1QQ3 A;  4N6H A;  2XLO A;  3C62 A;  4CDY A;  2XLV A;  3L1M A;  2YKZ A;  1E86 A;  5JP7 A;  5JSL A;  3C63 A;  3HNJ A;  3QW1 A;  5JUA A;  2CCY A;  1CGO A;  4IAQ A;  1JAF A;  3ZTZ A;  1APC A;  2YL3 A;  4IB4 A;  4JKV A;  4IAR A;  3ZTM A;  1EKY A;  3ZWI A;  3HNK A;  3QW0 A;  3HNL A;  1CPR A;  3FOP A;  2YL1 A;  5B3I A;  3FOO A;  2XM0 A;  3NMI A;  5JVE A;  4ULV A;  1QPU A;  1BBH A;  5JLI A;  4D4N A;  1CPQ A;  3M4B A;  5JRA A;  1YYJ A;  1M6T A;  2QLA A;  3ZQV A;  4CJO A;  2XLE A;  3M15 A;  3QVZ A;  3DE9 A;  1YYX A;  2XL6 A;  1E84 A;  1A7V A;  4WGY A;  5JS5 A;  1YZA A;  2XLM A;  1MQV A;  4L6R A;  3NMJ A;  3U8P A;  4CX9 A;  3VRC A;  3HNI A;  4ER9 A;  3M4C A;  4U9E A;  3TOM A;  2YLI A;  3NMK A;  4CDA A;  1GQA A;  5AGF A;  2YLG A;  2YLD A;  3DE8 A;  3IQ6 A;  4CIP A;  4EIY A;  4U9D A;  4NC3 A;  1NBB A;  2XLW A;  5JT4 A;  4D4X A;  4WGZ A;  4JEA A;  2YL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...