3IQ6A

Crystal structure of a tetrameric zn-bound cytochrome cb562 complex with covalently and non-covalently stabilized interfaces
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKCTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of metal selectivity in templated protein interfaces.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
total genus 42
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3iq6A00
1NBBA 4JEAA 1MQVA 3M4CA 3QVZA 1BBHA 2XLDA 4EIYA 4D4XA 1JAFA 3HNLA 5JRAA 3HNJA 3VRCA 5JVEA 4CDYA 1CGNA 3L1MA 3M15A 1EKYA 4WGZA 5JUAA 2J8WA 3ZWIA 1CPRA 3DE8A 4JEBA 3ZTMA 1E86A 256BA 4D4NA 1YYXA 2J9BA 5AGFA 3HNKA 3QW0A 5JSLA 3FOPA 1RCPA 5JP7A 2XLMA 2XM4A 4IARA 2YLGA 2YL1A 2YLDA 4CX9A 1E85A 3NMIA 3C62A 4JKVA 1CPQA 4ER9A 1QQ3A 1LM3B 3NMJA 5JS5A 3DE9A 1M6TA 3ZQYA 2XLHA 4IB4A 3QW1A 4CIPA 4WGYA 2YLIA 4N6HA 4CJOA 5JT4A 3TOMA 3C63A 3M79A 2YKZA 4N4WA 1A7VA 2XLVA 3U8PA 3IQ5A 3IQ6A 4CJGA 3QVYA 3NMKA 3FOOA 4ULVA 4U9DA 1S05A 2CCYA 2XLOA 1E84A 3HNIA 4JE9A 4CDAA 1E83A 4CDVA 1GQAA 3TOLA 1YZAA 2XL6A 2BC5A 2XLEA 4U9EA 5B3IA 1APCA 2YL7A 1YZCA 2XLWA 2YL0A 3M4BA 2QLAA 4L6RA 1QPUA 2XL8A 2YL3A 1CGOA 4IAQA 3ZQVA 4NC3A 5JLIA 1YYJA 2XM0A 3ZTZA
chains in the Genus database with same CATH superfamily
3S0XA 4U5BE 1NBBA 1K40A 3EZIA 1MNDA 3MBGA 5KYWB 3MYFA 1BBHA 4AL0A 1AEPA 3DJUB 4MW3A 2MWQA 2WZGA 4DBQA 1C17M 4GEHA 1D0ZA 2O9XA 1TWAA 4EIYA 3OA1A 3GEHA 3EHMA 3HNLA 5B1AC 4E17A 1O3UA 3WG7C 4BJ1A 3DMDA 2NUTB 4O6YA 1LS4A 1YVIA 2XL4A 4JVSA 1NU9C 2L6GA 1T6QA 3K1IC 1HW2A 1LI5A 4EBJA 4JC7A 5F5FA 1CGNA 3L1MA 4YL3A 4LDRA 3EQLF 5L0FA 1BR2A 3T6GB 4YT8A 1TFKB 3UMHA 2OKUA 3LNRA 5L0HA 1M57C 1OW7A 3C8ZA 3HLZA 2R7QA 1M2OA 2EPNA 1NLXA 4N06A 4ULWA 3A9CA 4E7ZA 1H9TA 2H7OA 2Y69C 5K0IA 1IW7F 5KYUA 1FMVA 4JEBA 3Q7LA 2R25A 1LE4A 5L0IA 4U5CE 4K7BA 4MS2A 1OW6A 4D4NA 4KC9A 3GEIA 1YYXA 2LFFA 4BJTA 1XWJA 5A69A 3E70C 3QW0A 5KYWA 2RSEB 4FWVA 4F4BA 3L0IA 5KYYB 2J45A 1OW8A 4MTFA 3B0UX 1HMOA 1ZHZA 1OXKA 2W9YA 1FFHA 3VAYA 3DM9B 4CX9A 1B68A 3C62A 5B1BC 2XS8A 4PFPA 3RQFA 1VMAA 2G62A 2LK4A 2KYHA 1ZZPA 3GM2A 2EPOA 3ZG1A 4C3EA 3B0PA 4CS8C 4E18A 1J8MF 3DAGA 3ZQYA 2VCBA 1WASA 4CIPA 2IXNA 3LESA 4B6IA 3H2VA 4ANJA 2B0HA 5AC5A 3AG4C 3AG1C 1M2VB 3BEHA 4MTOA 3W8HA 3TD7A 3M79A 2DYSC 3L8IA 1EQ1A 4EWCA 3EFOB 1RJ9B 5T3WA 5A6BD 3IQ5A 4QDLA 3JTLO 4NTFA 4WABA 3SP1A 3U3FA 4JIOA 1R4TA 2CW0F 4O7GA 3ZDLA 4JZAA 1CGME 4LLEA 3GWNA 3AOUA 4U5EE 3KPHA 3FAPB 4LACB 3ABKC 5KYNA 3DXJF 3FOOA 3UMKA 1S05A 1H6GA 1E84A 3B0VC 1ZHYA 1PV3A 2CNWD 1Q0DA 3OEOA 4JE9A 4CDAA 2TMVP 1E83A 2Y39A 1T6IA 2AVKA 2LSEA 2PX3A 3AJMA 3DI5A 2GWWA 4Z9HA 4OIRF 4G78A 4C3BA 2BC5A 2LFDA 4AX2A 2HMZA 1Q0FA 4MTGA 1D1CA 1RKEB 5DLJA 4DOZA 4IGGA 5HV9A 2NPUA 3LS1A 2EPMX 3EHNA 5DQZA 2QUPA 4DJ9A 4JRZA 1G5ZA 2L7AA 3S29A 1ZHXA 1ZHWA 1ZYRF 1H7IA 1LE2A 1J8YF 2YL0A 2ZXRA 3I5PA 4H4KC 4XEFA 3VYWA 1YJGA 1LVKA 1D1AA 3KL4A 3MLGA 4YWQA 1W2WA 2J9VA 1CGOA 4J30B 5KYYA 4NC3A 3S90A 1OCOC 2A69F 2R9RB 1ZVZA 4GQHA 4YN0B 5BQHA 4I44A 2LP4A 3J06A 1WATA 2VB6A 4KNVA 3RIPA 5T3TA 4CIHA 1YYJA 3RVZA 4YL0A 1TKNA 3RF3A 4EHPA 4OD4A 3DWWA 1VLSA 1OKKD 2ZXOA 4MNDA 2MHRA 1Z5ZA 1JAFA 2OEVA 3UNGC 3DKAA 1ZW3A 3G4ZA 4YL1A 4BJ5C 4DRHB 4EBBA 5L0CA 3DZAA 2L81A 3O10A 3PCVA 3LEOA 4PACA 3U3BA 2ZXWC 1JPNA 1LIHA 2KJGA 2YVKA 3RH3A 2Q4FA 4IAOA 3AG3C 3EG9B 1XZPA 3Q6MA 1A41A 3M1CB 3NYLA 2YWAA 4I3MA 2ETSA 5L0GA 3POVA 4WGZA 1K05A 1SF8A 4ONSA 4UDVA 1HMDA 3EGXA 2YEVA 4PK4A 2WZFA 3C8GB 5JUAA 3ZWIA 2CYDA 3DE8A 2NSFA 4BEJA 3WHNA 1E86A 4IRUA 3SXKA 256BA 2EPKX 2D4UA 3KYIA 2UUIA 4JURI 3UGOA 1Y4CA 1VK5A 3HNKA 4W8KA 4XPYA 4BEMJ 1ORSC 1WN0A 1FTSA 4LLCA 2FFHA 4XLNF 4YT2A 1WTYA 5JP7A 4XEVA 1LI7A 3ZTZA 2EIMC 2X0CA 4IARA 3S28A 3SXYA 2YHSA 1YARO 1A0BA 2Q3TA 3NMIA 4JKVA 1CPQA 1GM5A 1OCCC 1OXBA 1YAUO 3ZVRA 1ZU5A 1LM3B 2QNLA 4I1MA 1PD1A 1QZXA 4M63A 2EIJC 2W4MA 2HZ8A 2XLHA 1V54C 5CIVA 4IB4A 2IOQA 3ZSUA 2AP3A 3UMIA 1Y6DA 1D0YA 4WGYA 2YLIA 2R7RA 4PJMA 2HV6A 3KMIA 2EPLX 3NKDA 2QTVA 3SNHA 5E3AA 2QE9A 3C63A 3S9OA 2IXPA 3K66A 2EILC 4W8PA 4YJWA 2WVQA 3JRTA 4CS9C 4N4WA 3U8PA 1ST6A 2CNWA 2D5RB 2H7VC 3WAQA 1VB5A 1TWCA 2LIGA 4P9FA 2IM8A 4H54A 1ORJA 5DVWA 4CS8A 2VH3A 4JJFA 5DQTA 4MVZA 3ZIBA 4AL1A 1ZHTA 4XTKA 4YK5A 2W45A 2Y3GA 1D1BA 1JRAA 2CDQA 2L6FA 4ZLDA 3LLIA 2CCYA 3E9VA 4PR9A 2X51A 2MYSA 4MVUA 5A6BA 4DBRA 3K33A 2HFIA 2JD3A 1OQCA 2CGEA 3RQGA 3TOLA 1YZAA 4KBLA 4MVOA 3AGTA 2HV7A 2KC3A 3LS0A 3QMKA 3FMSA 4JJGA 1FMWA 1FNTc 4U9EA 3V5XA 1BR1A 2PX0A 4EKWA 2YZSA 3FXHA 4CSAC 3ABMC 1Z6AA 1FAPB 3RKOF 3PHF2 1AVOB 2YL7A 4HFKB 2KQ9A 1EA8A 2OJQA 3O6XA 3W2WA 4BPMA 1MNEA 3SXMA 1YLMA 1LPEA 4OIOF 2Q9CA 5DS5A 5L3VA 3ITFA 3G50A 4L6RA 1PD0A 2R7SA 4RDAA 3B71A 3Q6NA 4Z9JA 4G7HF 4XWJA 5COFA 2H7BA 3ZQVA 3JT1A 2OU6A 1NG1A 2OJED 4ZLCA 2ZXPA 4BJ6C 3A11A 1Q0MA 2NSGA 1E2XA 2VCAA 4U5DE 5T1DB 2A1DD 2HSBA 1L7CA 4QI0A 3U5SA 3AG2C 1OKKA 1HY5A 3K6BA 3Q7GA 4GYTA 2Z15A 1OR2A 4X0RA 4N6CA 3QVZA 4O6MA 3EJNA 3NG1A 4A2NB 2LCHA 3IQTA 5D91A 5E33A 4Q5SF 2XLDA 1DOWA 4LDKA 3U9MA 2FGYA 1GS9A 4PFOA 2G3VA 3SYNA 5A6KA 1D0XA 4DRJB 5JRAA 3HNJA 5EGYA 3HTKC 3TULA 2KNHA 3VRCA 3U0CA 2WL8A 3GANA 4HEAJ 2ZD9A 5BQGA 1JR8A 4CDYA 4CS9A 4DXWA 3F46A 5L0JA 2WB7A 3AQCA 2GAQA 3U8VA 3U2MA 2BE5F 1FFTC 2VC9A 2J8WA 1A7DA 1CPRA 3EGDA 2KGOA 5CI9A 1MMDA 3O55A 3RW0A 2XXAA 2J9BA 4HFFB 3U9JA 1R5ID 2OEXA 2NUPB 3G4XA 3JYHA 3NYMA 3MFNA 2A0BA 1JMWA 4JTAB 4Z9IA 3HKKA 4NTAA 3FOPA 3IEEA 1RCPA 4G7ZF 2R7VA 1KTMA 1JOGA 2XM4A 4OINF 3B29A 3VM6A 4DVZA 3PDMP 2YLGA 2R03A 2YL1A 2YLDA 4O6NA 4PJLA 5KYXA 1E85A 1IZMA 3LJBA 4C7OA 5KYUB 3LAYA 2VASA 1QQ3A 5JS5A 1QSPA 2EIKC 3GWLA 3GORA 3RQEA 3R2PA 5F5HA 4XPXA 2E87A 2FAPB 3V7OA 4J7YA 2YQYA 3H65A 2HMQA 3PMRA 3U2LA 2YRFA 2A68F 4CJOA 2J7PD 3FVYA 5DS6A 1S7ZA 2OQMA 3JCUQ 3AGUA 3LNMB 1VTMP 1YA9A 2W4BA 2XS1A 2YKZA 3DAFA 3KYJA 2R7XA 2HS5A 2XXAB 4FAPB 2NUPA 1T9KA 2G3KA 3DD7A 3EGDB 3GM3A 4XLPF 3HJCA 2JPUA 4JTDB 3SXZA 2R7TA 1VOMA 2AWYA 2IXMA 4CJGA 4AK9A 1RKEA 3CSKA 4J32B 3TJ6A 3QVYA 2HJMA 1H9GA 1A7EA 1VLTA 2AWCA 2UUHA 3UGPA 3IPMO 4DVYP 4U5GA 3KH2A 2WZLA 4C3DA 2Q7RA 1RJ9A 1LS1A 1M2VA 4LDQA 1SZIA 2XLOA 4CBEA 4RBNA 4JCZA 3S84A 1RMVA 2V3CC 2KK1A 4NQFA 4MVMA 1HE9A 4CS7A 2P7VA 1GQAA 2XL6A 4O79A 3W4YA 3NKEA 3EPVA 4YT4A 4IWBA 5B3IA 2R7WA 1BZ4A 3OWTA 4FX5A 1G8XA 4LERA 2IBFA 2ICWG 1SYQA 2P1AA 1RKCA 1ZW2A 4BG0A 1FR0A 2WVOA 3EZHA 1NFNA 2Y3HA 1TQGA 2XLWA 4JW1A 4MW8A 2A6EF 3MYIA 2A0UA 2Q00A 2BL2A 2P6VA 3L8JA 1YDIA 3M4BA 3R7CA 3FAJA 5HSWA 2ASRA 2DGJA 1QPUA 3C7JA 4XPWA 1F1MA 3S27A 3ABLC 2YL3A 4P9TA 1NZEA 3LEVA 1Z63A 5IY5C 3B9QA 5JLIA 3GM1A 2C04A 3W2VA 4PJNA 2XM0A 2I8BA 2KSFA 1MMNA 1Z23A 3TQOA 3US6A 2XRHA 1WWPA 4AE4B 2HUJA 4JTCB 4OIPF 2RD9A 4JEAA 4BJ5A 1MQVA 3M4CA 4NY3A 4K1OA 4C7OB 2PNOA 1QKRA 1AUEA 3EGXB 3ZC4A 1VYIA 3BRJA 4Q4ZF 4D4XA 5BUOA 3FDQA 3EH1A 5FCLA 3C8GA 5L3QA 2J0XA 4EBKA 1EI7A 3N2ZB 2OOCA 2XSEA 3N24A 4YT5A 2R7UA 5JVEA 5TJ5E 4NTBA 5AC4A 2R05A 3X2QC 1K04A 1DOVA 3QTHA 1LKXA 1MMAA 5DS4A 3CZ6A 3M15A 3O39A 3JZ0A 3RYLA 3AQBA 3SZRA 3X1OA 2J9WA 1N1CA 5L0DA 2M4EA 1NFOA 1EKYA 1T01A 1Q0KA 3C8GD 3JRMO 1ZU4A 1WGWA 1C02A 1OR3A 1UFBA 2LD6A 2PBEA 2OG2A 1L3PA 3T6BA 2ZPAA 4J7TA 2IXOA 3LUTB 3UR3C 2C03A 3ZTMA 3ASNC 3I5QA 1SMYF 5B3SC 3IHUA 4KI2A 3EG9A 5AGFA 2J9UA 3K7DA 3L34A 2R7OA 2HSQA 3NRHA 2L9JA 4FESA 5JSLA 2H8AA 4JCHA 4AE4A 1KNYA 1T6UA 1YA7O 2DB4A 1O5HA 1TWGA 2Y3DA 2XLMA 3JYYA 4WJ0A 3RVYA 3V5YA 5BQIA 1I4ZA 1OCZC 1I5NA 1G4US 2I15A 1XZQA 2GDCA 3DM5A 5COMA 3SEOA 4P6IC 4I1OB 3KKBA 2VCCA 3TK0A 4ER9A 3JSEO 1BDJB 1HE1A 3NMJA 1WOLA 5GPGB 2IYLD 2P0NA 3DE9A 5FZTA 1O87A 1M6TA 3ECSA 5E2QA 5F28E 4G7OF 1NSGB 2P61A 3JSZA 3QW1A 1ORYA 1U89A 4U5HA 2KW3C 1MMGA 1G4WR 2V26A 2Q9AA 3LLKA 3CEXA 4N6HA 3TOMA 5JT4A 1TR2A 3H2UA 2OCCC 4PJJA 1M56C 5D92A 4OIQF 2L6HA 3DJNB 4QI2A 3I4UA 3K1IA 1A7VA 3EH2A 2XLVA 3VF0A 3W8IA 4DRIB 1BR4A 3T4RA 4A4AA 3IQ6A 1TFOB 1SR2A 1OCRC 1U6HA 1V55C 1Z7Qc 2R02A 5A6JA 2DI3A 4E0IA 3TJ5A 1I4YA 2A6HF 2LQGA 2PP4A 4E7SA 5KYXB 2AU5A 4HE8D 3NMKA 5E3CA 1QLEC 1GGQA 1RXQA 2EINC 2HKVA 3GEEA 3K1HA 5CI8A 1HW1A 2NG1A 4R32A 4U9DA 4ULVA 5EK0A 3HNIA 2QY9A 4IJJA 4EUKB 4K0DA 1PCXA 1C03A 1JPJA 4CDVA 4OD5A 2PF4E 3CAXA 4KNWA 2NUTA 1TWHA 3V5ZA 2J7PA 1QVXA 2J0WA 3MX3A 2XLEA 3QZCA 1U0BB 1V4AA 1T5OA 4Q7CA 2DYRC 3N0TA 3IQCA 4U5FE 4NCQA 2GA0A 1APCA 3T9OA 5EHHA 2PFDA 2Q9BA 4MQ9F 1Q0GA 3ASOC 1VYKA 1YZCA 3NYJA 3RFYA 4MVSA 3NDBB 1Z3IX 4MVQA 4CSAA 2QLAA 3GODA 2Y3BA 2WVNA 2F22A 1NU7D 3CQZA 3WODF 4BJ6A 3FHDA 3C18A 2XL8A 4XEKA 3EFOA 2HJ3A 4IAQA 4RD9A 3T6JA 2B0JA 3ATPA 4G0HA 1KU2A 3F47A 2M64A 1V74B 4E0HA 1UG7A 2GFHA 2JX0A 4MVRA 5A6AA 2J46A 5COGA 4XQ1A
chains in the Genus database with same CATH topology
1NBBA 4JEAA 1MQVA 3M4CA 3QVZA 1BBHA 2XLDA 4EIYA 4D4XA 1JAFA 3HNLA 5JRAA 3HNJA 3VRCA 5JVEA 4CDYA 1CGNA 3L1MA 3M15A 1EKYA 4WGZA 5JUAA 2J8WA 3ZWIA 1CPRA 3DE8A 4JEBA 3ZTMA 1E86A 256BA 4D4NA 1YYXA 2J9BA 5AGFA 3HNKA 3QW0A 5JSLA 3FOPA 1RCPA 5JP7A 2XLMA 2XM4A 4IARA 2YLGA 2YL1A 2YLDA 4CX9A 1E85A 3NMIA 3C62A 4JKVA 1CPQA 4ER9A 1QQ3A 1LM3B 3NMJA 5JS5A 3DE9A 1M6TA 3ZQYA 2XLHA 4IB4A 3QW1A 4CIPA 4WGYA 2YLIA 4N6HA 4CJOA 5JT4A 3TOMA 3C63A 3M79A 2YKZA 4N4WA 1A7VA 2XLVA 3U8PA 3IQ5A 3IQ6A 4CJGA 3QVYA 3NMKA 3FOOA 4ULVA 4U9DA 1S05A 2CCYA 2XLOA 1E84A 3HNIA 4JE9A 4CDAA 1E83A 4CDVA 1GQAA 3TOLA 1YZAA 2XL6A 2BC5A 2XLEA 4U9EA 5B3IA 1APCA 2YL7A 1YZCA 2XLWA 2YL0A 3M4BA 2QLAA 4L6RA 1QPUA 2XL8A 2YL3A 1CGOA 4IAQA 3ZQVA 4NC3A 5JLIA 1YYJA 2XM0A 3ZTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NBB A;  4JEA A;  1MQV A;  3M4C A;  3QVZ A;  1BBH A;  2XLD A;  4EIY A;  4D4X A;  1JAF A;  3HNL A;  5JRA A;  3HNJ A;  3VRC A;  5JVE A;  4CDY A;  1CGN A;  3L1M A;  3M15 A;  1EKY A;  4WGZ A;  5JUA A;  2J8W A;  3ZWI A;  1CPR A;  3DE8 A;  4JEB A;  3ZTM A;  1E86 A;  256B A;  4D4N A;  1YYX A;  2J9B A;  5AGF A;  3HNK A;  3QW0 A;  5JSL A;  3FOP A;  1RCP A;  5JP7 A;  2XLM A;  2XM4 A;  4IAR A;  2YLG A;  2YL1 A;  2YLD A;  4CX9 A;  1E85 A;  3NMI A;  3C62 A;  4JKV A;  1CPQ A;  4ER9 A;  1QQ3 A;  1LM3 B;  3NMJ A;  5JS5 A;  3DE9 A;  1M6T A;  3ZQY A;  2XLH A;  4IB4 A;  3QW1 A;  4CIP A;  4WGY A;  2YLI A;  4N6H A;  4CJO A;  5JT4 A;  3TOM A;  3C63 A;  3M79 A;  2YKZ A;  4N4W A;  1A7V A;  2XLV A;  3U8P A;  3IQ5 A;  3IQ6 A;  4CJG A;  3QVY A;  3NMK A;  3FOO A;  4ULV A;  4U9D A;  1S05 A;  2CCY A;  2XLO A;  1E84 A;  3HNI A;  4JE9 A;  4CDA A;  1E83 A;  4CDV A;  1GQA A;  3TOL A;  1YZA A;  2XL6 A;  2BC5 A;  2XLE A;  4U9E A;  5B3I A;  1APC A;  2YL7 A;  1YZC A;  2XLW A;  2YL0 A;  3M4B A;  2QLA A;  4L6R A;  1QPU A;  2XL8 A;  2YL3 A;  1CGO A;  4IAQ A;  3ZQV A;  4NC3 A;  5JLI A;  1YYJ A;  2XM0 A;  3ZTZ A; 
#chains in the Genus database with same CATH topology
 3S0X A;  4U5B E;  1NBB A;  1K40 A;  3EZI A;  1MND A;  3MBG A;  5KYW B;  3MYF A;  1BBH A;  4AL0 A;  1AEP A;  3DJU B;  4MW3 A;  2MWQ A;  2WZG A;  4DBQ A;  1C17 M;  4GEH A;  1D0Z A;  2O9X A;  1TWA A;  4EIY A;  3OA1 A;  3GEH A;  3EHM A;  3HNL A;  5B1A C;  4E17 A;  1O3U A;  3WG7 C;  4BJ1 A;  3DMD A;  2NUT B;  4O6Y A;  1LS4 A;  1YVI A;  2XL4 A;  4JVS A;  1NU9 C;  2L6G A;  1T6Q A;  3K1I C;  1HW2 A;  1LI5 A;  4EBJ A;  4JC7 A;  5F5F A;  1CGN A;  3L1M A;  4YL3 A;  4LDR A;  3EQL F;  5L0F A;  1BR2 A;  3T6G B;  4YT8 A;  1TFK B;  3UMH A;  2OKU A;  3LNR A;  5L0H A;  1M57 C;  1OW7 A;  3C8Z A;  3HLZ A;  2R7Q A;  1M2O A;  2EPN A;  1NLX A;  4N06 A;  4ULW A;  3A9C A;  4E7Z A;  1H9T A;  2H7O A;  2Y69 C;  5K0I A;  1IW7 F;  5KYU A;  1FMV A;  4JEB A;  3Q7L A;  2R25 A;  1LE4 A;  5L0I A;  4U5C E;  4K7B A;  4MS2 A;  1OW6 A;  4D4N A;  4KC9 A;  3GEI A;  1YYX A;  2LFF A;  4BJT A;  1XWJ A;  5A69 A;  3E70 C;  3QW0 A;  5KYW A;  2RSE B;  4FWV A;  4F4B A;  3L0I A;  5KYY B;  2J45 A;  1OW8 A;  4MTF A;  3B0U X;  1HMO A;  1ZHZ A;  1OXK A;  2W9Y A;  1FFH A;  3VAY A;  3DM9 B;  4CX9 A;  1B68 A;  3C62 A;  5B1B C;  2XS8 A;  4PFP A;  3RQF A;  1VMA A;  2G62 A;  2LK4 A;  2KYH A;  1ZZP A;  3GM2 A;  2EPO A;  3ZG1 A;  4C3E A;  3B0P A;  4CS8 C;  4E18 A;  1J8M F;  3DAG A;  3ZQY A;  2VCB A;  1WAS A;  4CIP A;  2IXN A;  3LES A;  4B6I A;  3H2V A;  4ANJ A;  2B0H A;  5AC5 A;  3AG4 C;  3AG1 C;  1M2V B;  3BEH A;  4MTO A;  3W8H A;  3TD7 A;  3M79 A;  2DYS C;  3L8I A;  1EQ1 A;  4EWC A;  3EFO B;  1RJ9 B;  5T3W A;  5A6B D;  3IQ5 A;  4QDL A;  3JTL O;  4NTF A;  4WAB A;  3SP1 A;  3U3F A;  4JIO A;  1R4T A;  2CW0 F;  4O7G A;  3ZDL A;  4JZA A;  1CGM E;  4LLE A;  3GWN A;  3AOU A;  4U5E E;  3KPH A;  3FAP B;  4LAC B;  3ABK C;  5KYN A;  3DXJ F;  3FOO A;  3UMK A;  1S05 A;  1H6G A;  1E84 A;  3B0V C;  1ZHY A;  1PV3 A;  2CNW D;  1Q0D A;  3OEO A;  4JE9 A;  4CDA A;  2TMV P;  1E83 A;  2Y39 A;  1T6I A;  2AVK A;  2LSE A;  2PX3 A;  3AJM A;  3DI5 A;  2GWW A;  4Z9H A;  4OIR F;  4G78 A;  4C3B A;  2BC5 A;  2LFD A;  4AX2 A;  2HMZ A;  1Q0F A;  4MTG A;  1D1C A;  1RKE B;  5DLJ A;  4DOZ A;  4IGG A;  5HV9 A;  2NPU A;  3LS1 A;  2EPM X;  3EHN A;  5DQZ A;  2QUP A;  4DJ9 A;  4JRZ A;  1G5Z A;  2L7A A;  3S29 A;  1ZHX A;  1ZHW A;  1ZYR F;  1H7I A;  1LE2 A;  1J8Y F;  2YL0 A;  2ZXR A;  3I5P A;  4H4K C;  4XEF A;  3VYW A;  1YJG A;  1LVK A;  1D1A A;  3KL4 A;  3MLG A;  4YWQ A;  1W2W A;  2J9V A;  1CGO A;  4J30 B;  5KYY A;  4NC3 A;  3S90 A;  1OCO C;  2A69 F;  2R9R B;  1ZVZ A;  4GQH A;  4YN0 B;  5BQH A;  4I44 A;  2LP4 A;  3J06 A;  1WAT A;  2VB6 A;  4KNV A;  3RIP A;  5T3T A;  4CIH A;  1YYJ A;  3RVZ A;  4YL0 A;  1TKN A;  3RF3 A;  4EHP A;  4OD4 A;  3DWW A;  1VLS A;  1OKK D;  2ZXO A;  4MND A;  2MHR A;  1Z5Z A;  1JAF A;  2OEV A;  3UNG C;  3DKA A;  1ZW3 A;  3G4Z A;  4YL1 A;  4BJ5 C;  4DRH B;  4EBB A;  5L0C A;  3DZA A;  2L81 A;  3O10 A;  3PCV A;  3LEO A;  4PAC A;  3U3B A;  2ZXW C;  1JPN A;  1LIH A;  2KJG A;  2YVK A;  3RH3 A;  2Q4F A;  4IAO A;  3AG3 C;  3EG9 B;  1XZP A;  3Q6M A;  1A41 A;  3M1C B;  3NYL A;  2YWA A;  4I3M A;  2ETS A;  5L0G A;  3POV A;  4WGZ A;  1K05 A;  1SF8 A;  4ONS A;  4UDV A;  1HMD A;  3EGX A;  2YEV A;  4PK4 A;  2WZF A;  3C8G B;  5JUA A;  3ZWI A;  2CYD A;  3DE8 A;  2NSF A;  4BEJ A;  3WHN A;  1E86 A;  4IRU A;  3SXK A;  256B A;  2EPK X;  2D4U A;  3KYI A;  2UUI A;  4JUR I;  3UGO A;  1Y4C A;  1VK5 A;  3HNK A;  4W8K A;  4XPY A;  4BEM J;  1ORS C;  1WN0 A;  1FTS A;  4LLC A;  2FFH A;  4XLN F;  4YT2 A;  1WTY A;  5JP7 A;  4XEV A;  1LI7 A;  3ZTZ A;  2EIM C;  2X0C A;  4IAR A;  3S28 A;  3SXY A;  2YHS A;  1YAR O;  1A0B A;  2Q3T A;  3NMI A;  4JKV A;  1CPQ A;  1GM5 A;  1OCC C;  1OXB A;  1YAU O;  3ZVR A;  1ZU5 A;  1LM3 B;  2QNL A;  4I1M A;  1PD1 A;  1QZX A;  4M63 A;  2EIJ C;  2W4M A;  2HZ8 A;  2XLH A;  1V54 C;  5CIV A;  4IB4 A;  2IOQ A;  3ZSU A;  2AP3 A;  3UMI A;  1Y6D A;  1D0Y A;  4WGY A;  2YLI A;  2R7R A;  4PJM A;  2HV6 A;  3KMI A;  2EPL X;  3NKD A;  2QTV A;  3SNH A;  5E3A A;  2QE9 A;  3C63 A;  3S9O A;  2IXP A;  3K66 A;  2EIL C;  4W8P A;  4YJW A;  2WVQ A;  3JRT A;  4CS9 C;  4N4W A;  3U8P A;  1ST6 A;  2CNW A;  2D5R B;  2H7V C;  3WAQ A;  1VB5 A;  1TWC A;  2LIG A;  4P9F A;  2IM8 A;  4H54 A;  1ORJ A;  5DVW A;  4CS8 A;  2VH3 A;  4JJF A;  5DQT A;  4MVZ A;  3ZIB A;  4AL1 A;  1ZHT A;  4XTK A;  4YK5 A;  2W45 A;  2Y3G A;  1D1B A;  1JRA A;  2CDQ A;  2L6F A;  4ZLD A;  3LLI A;  2CCY A;  3E9V A;  4PR9 A;  2X51 A;  2MYS A;  4MVU A;  5A6B A;  4DBR A;  3K33 A;  2HFI A;  2JD3 A;  1OQC A;  2CGE A;  3RQG A;  3TOL A;  1YZA A;  4KBL A;  4MVO A;  3AGT A;  2HV7 A;  2KC3 A;  3LS0 A;  3QMK A;  3FMS A;  4JJG A;  1FMW A;  1FNT c;  4U9E A;  3V5X A;  1BR1 A;  2PX0 A;  4EKW A;  2YZS A;  3FXH A;  4CSA C;  3ABM C;  1Z6A A;  1FAP B;  3RKO F;  3PHF 2;  1AVO B;  2YL7 A;  4HFK B;  2KQ9 A;  1EA8 A;  2OJQ A;  3O6X A;  3W2W A;  4BPM A;  1MNE A;  3SXM A;  1YLM A;  1LPE A;  4OIO F;  2Q9C A;  5DS5 A;  5L3V A;  3ITF A;  3G50 A;  4L6R A;  1PD0 A;  2R7S A;  4RDA A;  3B71 A;  3Q6N A;  4Z9J A;  4G7H F;  4XWJ A;  5COF A;  2H7B A;  3ZQV A;  3JT1 A;  2OU6 A;  1NG1 A;  2OJE D;  4ZLC A;  2ZXP A;  4BJ6 C;  3A11 A;  1Q0M A;  2NSG A;  1E2X A;  2VCA A;  4U5D E;  5T1D B;  2A1D D;  2HSB A;  1L7C A;  4QI0 A;  3U5S A;  3AG2 C;  1OKK A;  1HY5 A;  3K6B A;  3Q7G A;  4GYT A;  2Z15 A;  1OR2 A;  4X0R A;  4N6C A;  3QVZ A;  4O6M A;  3EJN A;  3NG1 A;  4A2N B;  2LCH A;  3IQT A;  5D91 A;  5E33 A;  4Q5S F;  2XLD A;  1DOW A;  4LDK A;  3U9M A;  2FGY A;  1GS9 A;  4PFO A;  2G3V A;  3SYN A;  5A6K A;  1D0X A;  4DRJ B;  5JRA A;  3HNJ A;  5EGY A;  3HTK C;  3TUL A;  2KNH A;  3VRC A;  3U0C A;  2WL8 A;  3GAN A;  4HEA J;  2ZD9 A;  5BQG A;  1JR8 A;  4CDY A;  4CS9 A;  4DXW A;  3F46 A;  5L0J A;  2WB7 A;  3AQC A;  2GAQ A;  3U8V A;  3U2M A;  2BE5 F;  1FFT C;  2VC9 A;  2J8W A;  1A7D A;  1CPR A;  3EGD A;  2KGO A;  5CI9 A;  1MMD A;  3O55 A;  3RW0 A;  2XXA A;  2J9B A;  4HFF B;  3U9J A;  1R5I D;  2OEX A;  2NUP B;  3G4X A;  3JYH A;  3NYM A;  3MFN A;  2A0B A;  1JMW A;  4JTA B;  4Z9I A;  3HKK A;  4NTA A;  3FOP A;  3IEE A;  1RCP A;  4G7Z F;  2R7V A;  1KTM A;  1JOG A;  2XM4 A;  4OIN F;  3B29 A;  3VM6 A;  4DVZ A;  3PDM P;  2YLG A;  2R03 A;  2YL1 A;  2YLD A;  4O6N A;  4PJL A;  5KYX A;  1E85 A;  1IZM A;  3LJB A;  4C7O A;  5KYU B;  3LAY A;  2VAS A;  1QQ3 A;  5JS5 A;  1QSP A;  2EIK C;  3GWL A;  3GOR A;  3RQE A;  3R2P A;  5F5H A;  4XPX A;  2E87 A;  2FAP B;  3V7O A;  4J7Y A;  2YQY A;  3H65 A;  2HMQ A;  3PMR A;  3U2L A;  2YRF A;  2A68 F;  4CJO A;  2J7P D;  3FVY A;  5DS6 A;  1S7Z A;  2OQM A;  3JCU Q;  3AGU A;  3LNM B;  1VTM P;  1YA9 A;  2W4B A;  2XS1 A;  2YKZ A;  3DAF A;  3KYJ A;  2R7X A;  2HS5 A;  2XXA B;  4FAP B;  2NUP A;  1T9K A;  2G3K A;  3DD7 A;  3EGD B;  3GM3 A;  4XLP F;  3HJC A;  2JPU A;  4JTD B;  3SXZ A;  2R7T A;  1VOM A;  2AWY A;  2IXM A;  4CJG A;  4AK9 A;  1RKE A;  3CSK A;  4J32 B;  3TJ6 A;  3QVY A;  2HJM A;  1H9G A;  1A7E A;  1VLT A;  2AWC A;  2UUH A;  3UGP A;  3IPM O;  4DVY P;  4U5G A;  3KH2 A;  2WZL A;  4C3D A;  2Q7R A;  1RJ9 A;  1LS1 A;  1M2V A;  4LDQ A;  1SZI A;  2XLO A;  4CBE A;  4RBN A;  4JCZ A;  3S84 A;  1RMV A;  2V3C C;  2KK1 A;  4NQF A;  4MVM A;  1HE9 A;  4CS7 A;  2P7V A;  1GQA A;  2XL6 A;  4O79 A;  3W4Y A;  3NKE A;  3EPV A;  4YT4 A;  4IWB A;  5B3I A;  2R7W A;  1BZ4 A;  3OWT A;  4FX5 A;  1G8X A;  4LER A;  2IBF A;  2ICW G;  1SYQ A;  2P1A A;  1RKC A;  1ZW2 A;  4BG0 A;  1FR0 A;  2WVO A;  3EZH A;  1NFN A;  2Y3H A;  1TQG A;  2XLW A;  4JW1 A;  4MW8 A;  2A6E F;  3MYI A;  2A0U A;  2Q00 A;  2BL2 A;  2P6V A;  3L8J A;  1YDI A;  3M4B A;  3R7C A;  3FAJ A;  5HSW A;  2ASR A;  2DGJ A;  1QPU A;  3C7J A;  4XPW A;  1F1M A;  3S27 A;  3ABL C;  2YL3 A;  4P9T A;  1NZE A;  3LEV A;  1Z63 A;  5IY5 C;  3B9Q A;  5JLI A;  3GM1 A;  2C04 A;  3W2V A;  4PJN A;  2XM0 A;  2I8B A;  2KSF A;  1MMN A;  1Z23 A;  3TQO A;  3US6 A;  2XRH A;  1WWP A;  4AE4 B;  2HUJ A;  4JTC B;  4OIP F;  2RD9 A;  4JEA A;  4BJ5 A;  1MQV A;  3M4C A;  4NY3 A;  4K1O A;  4C7O B;  2PNO A;  1QKR A;  1AUE A;  3EGX B;  3ZC4 A;  1VYI A;  3BRJ A;  4Q4Z F;  4D4X A;  5BUO A;  3FDQ A;  3EH1 A;  5FCL A;  3C8G A;  5L3Q A;  2J0X A;  4EBK A;  1EI7 A;  3N2Z B;  2OOC A;  2XSE A;  3N24 A;  4YT5 A;  2R7U A;  5JVE A;  5TJ5 E;  4NTB A;  5AC4 A;  2R05 A;  3X2Q C;  1K04 A;  1DOV A;  3QTH A;  1LKX A;  1MMA A;  5DS4 A;  3CZ6 A;  3M15 A;  3O39 A;  3JZ0 A;  3RYL A;  3AQB A;  3SZR A;  3X1O A;  2J9W A;  1N1C A;  5L0D A;  2M4E A;  1NFO A;  1EKY A;  1T01 A;  1Q0K A;  3C8G D;  3JRM O;  1ZU4 A;  1WGW A;  1C02 A;  1OR3 A;  1UFB A;  2LD6 A;  2PBE A;  2OG2 A;  1L3P A;  3T6B A;  2ZPA A;  4J7T A;  2IXO A;  3LUT B;  3UR3 C;  2C03 A;  3ZTM A;  3ASN C;  3I5Q A;  1SMY F;  5B3S C;  3IHU A;  4KI2 A;  3EG9 A;  5AGF A;  2J9U A;  3K7D A;  3L34 A;  2R7O A;  2HSQ A;  3NRH A;  2L9J A;  4FES A;  5JSL A;  2H8A A;  4JCH A;  4AE4 A;  1KNY A;  1T6U A;  1YA7 O;  2DB4 A;  1O5H A;  1TWG A;  2Y3D A;  2XLM A;  3JYY A;  4WJ0 A;  3RVY A;  3V5Y A;  5BQI A;  1I4Z A;  1OCZ C;  1I5N A;  1G4U S;  2I15 A;  1XZQ A;  2GDC A;  3DM5 A;  5COM A;  3SEO A;  4P6I C;  4I1O B;  3KKB A;  2VCC A;  3TK0 A;  4ER9 A;  3JSE O;  1BDJ B;  1HE1 A;  3NMJ A;  1WOL A;  5GPG B;  2IYL D;  2P0N A;  3DE9 A;  5FZT A;  1O87 A;  1M6T A;  3ECS A;  5E2Q A;  5F28 E;  4G7O F;  1NSG B;  2P61 A;  3JSZ A;  3QW1 A;  1ORY A;  1U89 A;  4U5H A;  2KW3 C;  1MMG A;  1G4W R;  2V26 A;  2Q9A A;  3LLK A;  3CEX A;  4N6H A;  3TOM A;  5JT4 A;  1TR2 A;  3H2U A;  2OCC C;  4PJJ A;  1M56 C;  5D92 A;  4OIQ F;  2L6H A;  3DJN B;  4QI2 A;  3I4U A;  3K1I A;  1A7V A;  3EH2 A;  2XLV A;  3VF0 A;  3W8I A;  4DRI B;  1BR4 A;  3T4R A;  4A4A A;  3IQ6 A;  1TFO B;  1SR2 A;  1OCR C;  1U6H A;  1V55 C;  1Z7Q c;  2R02 A;  5A6J A;  2DI3 A;  4E0I A;  3TJ5 A;  1I4Y A;  2A6H F;  2LQG A;  2PP4 A;  4E7S A;  5KYX B;  2AU5 A;  4HE8 D;  3NMK A;  5E3C A;  1QLE C;  1GGQ A;  1RXQ A;  2EIN C;  2HKV A;  3GEE A;  3K1H A;  5CI8 A;  1HW1 A;  2NG1 A;  4R32 A;  4U9D A;  4ULV A;  5EK0 A;  3HNI A;  2QY9 A;  4IJJ A;  4EUK B;  4K0D A;  1PCX A;  1C03 A;  1JPJ A;  4CDV A;  4OD5 A;  2PF4 E;  3CAX A;  4KNW A;  2NUT A;  1TWH A;  3V5Z A;  2J7P A;  1QVX A;  2J0W A;  3MX3 A;  2XLE A;  3QZC A;  1U0B B;  1V4A A;  1T5O A;  4Q7C A;  2DYR C;  3N0T A;  3IQC A;  4U5F E;  4NCQ A;  2GA0 A;  1APC A;  3T9O A;  5EHH A;  2PFD A;  2Q9B A;  4MQ9 F;  1Q0G A;  3ASO C;  1VYK A;  1YZC A;  3NYJ A;  3RFY A;  4MVS A;  3NDB B;  1Z3I X;  4MVQ A;  4CSA A;  2QLA A;  3GOD A;  2Y3B A;  2WVN A;  2F22 A;  1NU7 D;  3CQZ A;  3WOD F;  4BJ6 A;  3FHD A;  3C18 A;  2XL8 A;  4XEK A;  3EFO A;  2HJ3 A;  4IAQ A;  4RD9 A;  3T6J A;  2B0J A;  3ATP A;  4G0H A;  1KU2 A;  3F47 A;  2M64 A;  1V74 B;  4E0H A;  1UG7 A;  2GFH A;  2JX0 A;  4MVR A;  5A6A A;  2J46 A;  5COG A;  4XQ1 A; 
#chains in the Genus database with same CATH homology
 1NBB A;  4JEA A;  1MQV A;  3M4C A;  3QVZ A;  1BBH A;  2XLD A;  4EIY A;  4D4X A;  1JAF A;  3HNL A;  5JRA A;  3HNJ A;  3VRC A;  5JVE A;  4CDY A;  1CGN A;  3L1M A;  3M15 A;  1EKY A;  4WGZ A;  5JUA A;  2J8W A;  3ZWI A;  1CPR A;  3DE8 A;  4JEB A;  3ZTM A;  1E86 A;  256B A;  4D4N A;  1YYX A;  2J9B A;  5AGF A;  3HNK A;  3QW0 A;  5JSL A;  3FOP A;  1RCP A;  5JP7 A;  2XLM A;  2XM4 A;  4IAR A;  2YLG A;  2YL1 A;  2YLD A;  4CX9 A;  1E85 A;  3NMI A;  3C62 A;  4JKV A;  1CPQ A;  4ER9 A;  1QQ3 A;  1LM3 B;  3NMJ A;  5JS5 A;  3DE9 A;  1M6T A;  3ZQY A;  2XLH A;  4IB4 A;  3QW1 A;  4CIP A;  4WGY A;  2YLI A;  4N6H A;  4CJO A;  5JT4 A;  3TOM A;  3C63 A;  3M79 A;  2YKZ A;  4N4W A;  1A7V A;  2XLV A;  3U8P A;  3IQ5 A;  3IQ6 A;  4CJG A;  3QVY A;  3NMK A;  3FOO A;  4ULV A;  4U9D A;  1S05 A;  2CCY A;  2XLO A;  1E84 A;  3HNI A;  4JE9 A;  4CDA A;  1E83 A;  4CDV A;  1GQA A;  3TOL A;  1YZA A;  2XL6 A;  2BC5 A;  2XLE A;  4U9E A;  5B3I A;  1APC A;  2YL7 A;  1YZC A;  2XLW A;  2YL0 A;  3M4B A;  2QLA A;  4L6R A;  1QPU A;  2XL8 A;  2YL3 A;  1CGO A;  4IAQ A;  3ZQV A;  4NC3 A;  5JLI A;  1YYJ A;  2XM0 A;  3ZTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...