1FTSA

Signal recognition particle receptor from e. coli
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
295
structure length
295
Chain Sequence
RSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FTSY
publication title Crystal structure of the NG domain from the signal-recognition particle receptor FtsY.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signal recognition particle receptor
total genus 106
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 1996-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1ftsA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ftsA02
1GWNA 2XSZD 3OIYA 3EIEA 3TUJC 1G7SA 3U61B 4MKIA 3L8ZA 1E0KA 4TT3D 4MYCA 2C98A 1XTQA 4CT5A 5BN3A 3PUXA 4MDEA 5EZ5A 2H92A 4MDFA 4TMXA 5AJVB 1NG9A 4F4JA 1UDWA 4R71A 4I81A 2QTFA 3UATA 1M7HA 4ILEA 4KBGA 2ZJ5A 1ZC3A 2YV5A 1KTVA 1XD8A 1VYUA 4X8LA 1D8TA 3WMEA 4MGZR 4RKEA 4DSTA 4Y0AA 1ZU4A 1R0XA 4CDGA 1KK1A 5LDDC 2IUUA 1H8HA 2AKAB 3TLXA 1Z22A 1GNRA 2YWFA 2DBYA 4WAUA 3GEIA 4KLZA 3HWSA 3RS7A 4P4SB 1NN3A 3QIAA 2QTVB 3THXA 4L9SA 2IS6A 2H17A 1N0WA 2FE4A 5SZJA 4DEYA 3BH0A 4QBFA 1HEIA 4HB4A 4QJ5A 5HZKA 4G5OA 2J0SA 4HEJA 2P5TB 2GVDC 1OT3A 3ZQ6A 2NOAA 4IRUB 3C15C 4LV8B 1LF5A 3N70A 3EZ7A 4FCWA 4V0OA 1JBKA 2ZRNA 1MABB 1SQ5A 1YZGA 2OZEA 3ZD6A 2OLJA 1UEJA 4FCVA 4F93B 2JLUA 1RRGA 2EW1A 3FMOB 4N1AA 2F55A 3K8YA 4M9ZA 2DFKB 5LB2A 1S8FA 1W0KD 2AR7A 3AKDA 3AVUA 2VP2A 2XJ9A 3AEZA 3GJ7A 2P67A 2XX3A 3B7GA 4QC2A 4CEHB 3TR5A 3U4QB 2DB3A 2ZM5A 1VHLA 1D2MA 1HE1C 2WOJA 1L7VC 5A0FA 4TQ9A 5L3RA 3RS0A 3O47A 1NSTA 1Z6TA 3SJCA 2C95A 3CZQA 1YZUA 3FFAA 4QG7A 1Z28A 2ODNA 4JLVA 4Q4LA 2R6GA 3QENA 5DI9A 2QAGB 1Q3HA 1L2TA 2NO6A 3C14C 1P60A 4EAQA 1E9FA 1XB2A 2RGEA 2ONJA 2IC5A 2VHCA 1G7CA 4HDCA 3VTKA 4C0LA 2I1VB 5FOTA 4B33A 2W2TA 2DWPA 3GJ5A 2ZUDA 3NHAA 1D5CA 3DM5A 3LY5A 3PEWA 1H8HD 4D4KA 3CBQA 3TK1A 1CRPA 2ZSAA 3SBDA 4HB3A 2C99A 2PL3A 2ZI7A 2GWHA 1QBKC 2VQSA 2C77A 5IRCD 3DOEA 4U5XA 5LD2C 1Z2AA 3QY0A 2BMEA 2QT1A 1SHZA 1W36D 3CIOA 1ZNWA 4C0QC 1HT1E 3CF6R 4C3ZA 1A2KC 2ZJOA 1N5KA 5HR5A 5J5CA 3K9NA 2C5LA 3KXKA 4OHYA 5JEEA 2ZUCA 1OH7A 1BIFA 3RS4A 3FMPB 2P2LA 1VTKA 2O0JA 3VR5A 3EA0A 5KNBA 4US0R 4URVR 1KI1A 1FW6A 3TJZA 2JLRA 3W5JA 1AQYA 1OW3B 1N25A 3BORA 2ZIAA 2O8CB 1SXJA 1KKLA 4FCTA 3R7WB 3WYFA 3FDIA 4DSOA 3QKUA 2A7QA 5FOSA 3U6KA 2IW3A 1KHTA 1EX6A 2J45A 1KDTA 3KFVA 2QBYA 1S9DA 1E2PA 1MT0A 1RYHA 2Q9CA 3THWB 2V9PA 3PENA 4RFSA 4D2IA 1PV4A 1W4RA 4O25A 5CM8B 4HLCA 1D6JA 3NEYA 2CDNA 2WV9A 2RMKA 3KQKA 2XB4A 3HR8A 1S3SA 2I1QA 2GBLA 3EC2A 3GFPA 2CLSA 1GILA 2HCJB 2PX0A 1UKEA 2HXSA 4XOIA 3G0HA 3MJHA 1ZAKA 1R0YA 5DN6A 1PUJA 4D4JA 1KDRA 4KSBA 1A2BA 1R4AA 1RW4A 1DG3A 1KNQA 1SVOA 5CDFA 2VA8A 4LC1A 4GZMA 1LY1A 1UBGA 4WOPA 5FUYA 2CK3A 2O5VA 2BBSA 2WICA 4B2PA 3B78A 5G53C 2RH5A 4A2WA 2D74A 3BH6A 3BB1A 3ECCA 3C5HA 1XTRA 1I4LD 1RRFA 5HPYB 3FHOA 1FUUA 5D3MB 4KCGA 5BYKA 5FBQB 5DIFA 2H8KA 1OV4A 4XIGS 4JVMA 1KKMA 1AKYA 4LX0A 3EXAA 4HAUA 1JPNA 1KOFA 3LLMA 4JLAA 4UKDA 1QHXA 4B3DA 1IN8A 4Q7MB 3LW7A 1W36B 4FMCF 5C1BA 4FWTA 2ZSDA 1W1WA 2BBOA 2QP4A 3I92A 1N2CE 4MKGA 3CPJB 1ZNXA 4YLGA 2B6HA 2XITA 4NU0A 8OHMA 2ZJYA 5FTJA 1Z3IX 3B2EA 1U0HC 4UNSA 2JJ8A 4MGYR 2R6FA 4NE2A 4URXR 4ZCIA 5FI1B 3TSOA 3K9LA 1QF9A 1SXJD 4BASA 5DSZA 2XXAB 2P6RA 2VRWA 4P4UA 4GP7A 1GM5A 2ZSEA 2BDTA 3CH5A 2QGZA 1FQKA 4JT4A 4GZLA 3U7GA 2PX3A 4U00A 1S0UA 3B9PA 4ZI2A 2QSYA 2DYKA 3AF4A 2ZI4A 5IHPA 4OI4A 1TF7A 3WHKA 3MLEA 1UKZA 1QDEA 2OUKA 5FOWA 1Z2CA 1T6NA 3GJ3A 3KJIA 1TF2A 2UVQA 3TIFA 4V03A 3EPJA 3P1JA 1IXZA 2YJTD 1S2MA 4ACAA 2D2EA 1W5TA 2ORWA 1R7RA 5DN6D 1OF1A 1SGWA 2ZRKA 4OQFA 1MH1A 1YZTA 3IQWA 2FFBA 3LH5A 3M4YA 1N3BA 2PT7A 1SVWA 2CK3D 3O8CA 3I4LA 4CEIA 2WTUA 3R8CA 4H1VA 1GVNB 4A2QA 2GXQA 2ZSBA 4OK3A 4Q4AA 1YR7A 2P0EA 5G3ZA 5JRJA 4KLNA 1NN5A 2VHUA 1VECA 1R8SA 2PT5A 4R2IA 5L3QA 1KNXA 3IIKA 3LWNA 3NTUA 3QKRA 3QF4A 3EPHA 4HUQA 1G19A 1S1MA 1KJWA 5IK2A 3KQNA 5EP4A 2HEIA 2RB4A 2WHXA 4CGZA 5DISB 2JLWA 2E87A 4NYMQ 3CZPA 3NXSA 2WSMA 1D9ZA 2JJ1A 2R6AA 4C7OA 1XMSA 4NCHA 1UADA 2REXB 4MYUA 2ZTSA 3L0SA 3C5CA 4AG6A 4B2IA 5GVSA 4M4SA 3JVUA 4BWYA 2B8WA 2OFXA 1Z6GA 2XTZA 1KI6B 3T34A 4B34A 1W48A 1BMFA 1BS1A 5CB6A 2IF2A 1KSFX 1XP8A 3CX8A 3LX8A 4LJ5A 1E2NA 2WJYA 1SXJB 1QHGA 1UKYA 2QMHA 4ZPXA 2OLKA 4LV5B 4V0LA 3K09A 1K5DA 2BJWA 4GNKA 4I1UA 3TQFA 5TXGA 1OIXA 1DEKA 4KAXA 1WMSA 5HE9A 5BN5A 2WWGA 3LVQE 1UKVY 1X8LA 1G20E 1P9RA 3TBKA 4LV6A 1GKUB 5EXTA 4D0NA 2EYUA 4RFSB 2IHYA 3RNLA 1RC8A 2IF0A 3DDCA 2C04A 2DPXA 2OT3B 2RGBA 2NO1A 2ZRIA 3PCRB 4M2LA 1KMHB 3BH7A 5H1YA 2ZS8A 4TQUS 2Q6TA 1EESA 4JSYA 1T9HA 5G41A 3T1QA 2BMDA 1ONBA 3ZYCA 1G3IA 3L0OA 4DT1A 4U7DA 3ETLA 1E79A 2ZUBA 5AR1A 1AA9A 4BEBA 3B60A 5KTYA 1Q0UA 4A9AA 1P5ZB 2HT6A 2LKDA 4BLTA 2CMKA 5H8WA 1IXSB 1UEIA 1ODFA 3NHBA 1NN0A 1NIJA 2G83A 4OI2A 5FUXA 5K8LA 4JL6A 1WBBA 5BW8A 4EDHA 4LYJA 1DVRA 4HI0E 4FN5A 1S1CA 4LGMA 5AWFC 3IPXA 2QROA 3KJGA 4BEJA 3CF0A 1SXJE 3CRVA 3CO5A 1OXXK 4KHZA 4U02A 3ZVLA 1KAGA 1Z29A 4NCNA 1OJLA 5K8IA 4L5BA 2ZRFA 1NLYA 1KO5A 5CK5A 4QGHA 3GJXC 3CX6A 5IK2D 1W49A 5FOXA 1YQTA 1CJUC 2PEYA 3AVWA 2VP6A 3HPRA 3U6BA 3JZAA 4L8GA 4HSEA 3AVQA 2EYQA 2JJ1D 4M21A 3EAQA 3KUCA 4M9SA 2ZE6A 3SR0A 3Q5EA 3REFA 3WYAA 2FJUA 1TEVA 1WGWA 1UM8A 2OAQ1 3BB4A 4B73A 4XVQA 3PJRA 2GEDA 1E9EA 1BMFD 5JJLA 2QUZA 2WBLC 3ZLJA 1NY6A 4Q7LA 4MRNA 1KSHA 1AS0A 2QMOA 2WWFA 2YNMA 1UAAA 4FMDF 3UPUA 4KI0A 2D06A 2X19A 3BE4A 2CL6X 3GFTA 2HF9A 1OH6A 4ITRC 5HCNA 2OCAA 1A1VA 4JLBA 1OH5A 2C96A 3PUVA 3UG6A 4PZLA 5EE0A 1XEWX 3UK6A 1J8YF 1XCGB 1A82A 1EFTA 1LW7A 3OZXA 1ZU5A 1OLOA 2R2AA 2Z4RA 1W4BA 4JVSB 2A5GA 3OESA 3AF0A 5DYGA 2QSZA 5JCZA 5P21A 1XJCA 3TGPA 4AURA 4DDVA 1E79D 2J87A 4NONA 2ZYTX 1ZM2A 4KFRA 1KI4A 2FZ4A 3L43A 5EUMA 3Q72A 4A0RA 5HCIA 3LAWA 5LPNA 4CEIB 5H70A 3EIHA 3T61A 1NJGA 2XTNA 2NIPA 1DELA 2UZIR 1OIWA 4Q4AB 1U99A 5FUVA 4Q9JA 4ESHA 3KQHA 4RVCA 1MO6A 1XF9A 3BRWD 2NO7A 3AKYA 4P0TA 1Z5ZA 4P32A 1P75A 2J59A 4TN1A 3QF4B 3QKRB 5L3QB 1MR3F 4DCSA 5EJEA 4HUQB 3C8UA 4A36A 1BH2A 2N42A 5AUPB 3KQUA 2YKGA 1Z0JA 3C7KA 3T5GA 2C9OA 4Q19A 3EW9A 5F2EA 1RIFA 4LHXA 4XD7A 1OB5A 3LX5A 3LQQA 5JHGB 4DUGA 4J0QA 4OQMA 4OHWA 3QE0A 4AYXA 4CIDA 1US8B 3A4MA 4YMSA 2R6CA 1RPZA 4B44A 1OXTA 3B1WA 2VP5A 1JEEA 2OBMA 4YMTA 3RHFA 1Q1ZA 3DZDA 3MFYA 1NIPA 2AN9A 4R98A 1LVGA 4JVNA 2HCBA 3LBIA 4Q01A 1S9HA 3MWYW 3QF7A 1QVAA 3OAAA 4RD4A 1ZUHA 3FKQA 3KJHA 4JZKA 3WNDA 3CRRA 3AVXA 5TB5A 4LWZA 3DHWC 5SZIA 2BJVA 4W5HA 3N5CA 4D6PA 4RJLA 5C2JB 1WBDA 1G8PA 3NEJA 3NWJA 1CJKC 4OYHA 4AY2A 4PHGA 1XTKA 1SKQA 4QJ4A 3ZD7A 1E98A 3QKTA 3ADCA 4L16A 3FKSA 4B71A 4AKGA 4MITA 2B21A 1Z8FA 3PV0A 3V9PA 3CNNA 4NCJA 4AD8A 4RZUA 4YDHB 3VR1A 4BLSA 5FOVA 4DT1B 1UF9A 1XZQA 4QGFA 3I61A 2XZLA 4BZQA 3K53A 2VP9A 2XNSA 3UWKA 3P20A 3AF3A 4D80A 2ZRJA 4TMVA 1G6OA 3C16C 3KX2A 2VBCA 2IL1A 2VYFA 4D82A 3CWQA 4RCZA 1RZ3A 3A58B 2FFHA 1QRAA 4RD6A 4W5WA 3GLGA 3I72A 1CULC 2Q9BA 1M34E 1NVVR 3BERA 4D0GA 2Z6VA 4IXNA 1CF4A 2O0HA 2FG5A 5K8UA 3Q9LA 1F6BA 4LYAA 3WMFA 1OXSC 2LWIA 1VIYA 2ZVQX 4OHVA 4ON9A 2WZQA 4W7SA 4N0DA 2ZR9A 4JLJA 4DC9A 2IYUA 5D3QA 2WKRA 3R9WA 4QM6A 4BFWA 2FFQA 5L8VA 1C1YA 1B23P 1JAIA 4XD7D 3CLVA 5EE5B 3GMTA 5CIQA 3Q3JB 4DUGD 1K5GA 3Q5DA 4RD2A 2YHSA 1JNYA 5CIWA 3I73A 2P6NA 4LOAA 1E0JA 4HLQB 3GLFB 1TEXA 3MGCA 1G291 2DFLA 5CITA 1ZNZA 2A5YB 4TMKA 1GOTA 2C9YA 2ORIA 3V4FA 2IS2A 4OBEA 5DNYB 3A37A 1VPLA 4EFLA 3I5XA 2J0UA 3KKOA 1FL9A 2I4IA 3IIMA 4XWOA 4C2UA 1ZINA 3AUXA 1LS6A 1KO1A 2C9CA 2WKPA 2ZREA 1E69A 4GT1A 3HJNA 4TTQA 3BB3A 3OAAD 3KDSE 4EJSA 5C46F 2CLDX 2FX3A 1U8YA 3IEUA 1W44A 3HP1A 2FPMA 2ZRDA 4LJ7A 4JKYA 5JECA 3CB4A 2TMKA 3D6TB 5JLJA 1ZVQA 5KNDA 3GJ8A 2KSQA 1XXHA 5E7JA 4Z8XA 1V5WA 3KTAA 4NP6A 3B8HA 4DWJA 5KPJA 2W00A 1BYIA 1TQDA 1JXMA 2RGNC 4Q18A 5JI2E 3K70B 3FKSD 1Q1QA 1UFQA 1YR6A 5ELXA 2ZYUX 721PA 1X3SA 3VNVA 2ZRLA 2F9LA 1KI7A 1CKEA 1MO5A 2ZS7A 3QXXA 4Q9LA 2IYTA 4F4CA 2J5XA 4PC3A 3M1IA 3CKLA 4EIWA 1N5IA 1P2VA 4MKHA 4Z54A 3PVSA 3GLFE 3TMKA 1W0JA 4BFYA 3AKCA 4DDWA 2QE7A 1HV8A 4DZZA 2OBNA 1N5JA 3NC0C 1CXZA 2J7KA 1LS1A 2BCJQ 5GJVC 2ERXA 3SBEA 2Z83A 4PAOA 5EXSA 5KUTA 1JPJA 2VL7A 521PA 3THYA 1TADA 1E2HA 3MUFA 4C0KA 1GZSA 3HYRA 2VSOA 2OILA 1HTWA 3HU3A 3UIEA 2CE2X 3E5HA 2FN4A 4D4LA 2ZROA 4OQXA 4V0KA 3RDPA 1OFHA 2A9KA 4HLUC 4LYHA 4Q02A 4KBFA 1VYTA 5FR1A 1N0VC 4C4PA 2NMVA 2G6BA 4TLDA 4W9MC 2V6JA 2IUSA 1XMVA 1AIPA 1N6LA 2VEDA 3CRMA 2IYYA 2IYZA 3SE0A 1JR6A 3HR7A 1RRCA 3NH9A 4XWKA 2JCSA 4URZR 5J4KA 3R8FA 4TL6A 2WMNB 5FR2A 1TQ2A 2ZRCA 2A30A 4GOJA 1X1RA 3DOFA 2W6JA 4WXRA 2O8DA 2IS1A 1EGAA 3OFNA 4ZO4A 1U0LA 2IYWA 2OEPA 2JLZA 4JJZA 3IQXA 4LY6A 4NYIQ 3UMSA 4O0MA 3IDQA 4JL8A 1U0JA 2WVJA 1NI3A 3GFOA 1Z06A 1J7KA 1P62B 5CM9C 1YZKA 2ZITA 1G7RA 3LBNA 5AJXA 4IOMA 4NYJQ 3TRFA 3QVVA 2FZLA 2Q3MA 3KUDA 4TMWA 1KI9A 2VF8A 2P3SA 2HDNB 4DSNA 2ZRHA 2J46A 2H57A 4B74A 1W0JD 1N6RA 1Q1BA 1T3SA 2QE7D 3GJ4A 3LDAA 3WHLA 4A2PA 3D7MA 4IVQA 4LJAA 2DY1A 2GRJA 1G8FA 3GLGB 5CLQA 1HUQA 2HYIC 3SHWA 4NPHA 4LUCA 1OXUA 1DO2A 3E1SA 3LFUA 3NBYC 3VU9A 1G17A 3UXMA 3X2SA 2ODWA 1G5RA 2VTKA 2WJGA 3H1TA 1L8QA 2BOVA 2FPLA 4LBVA 3EWAA 1H8EA 1OH8A 1KIMA 3AGQA 2WJHA 2BM1A 3AVVA 1ZC4A 1N6NA 4IFBA 1OFUX 1W4CA 2ZRBA 1N6HA 3RWMB 2EFEB 1CTQA 4GRAA 1Z6YA 3E70C 1V43A 3IO5A 2ODBA 2QEQA 4S2EA 3L2OB 1QG2A 2HXYA 2F1JA 1QVRA 1DARA 2GAOA 1PUIA 4C0BA 2J0UB 3IO3A 1E2IA 4I1OA 3TE6A 3A36A 3ADKA 4K46A 4G5QA 4EJSB 1KO4A 3ADDA 3ZZTA 2ZR7A 2E9SA 4DLSA 4OHXA 4PC2A 2CJWA 1P2SA 2B92A 2W6JD 4KYUA 3WNBA 2GZAA 3OFND 4TTPA 3KTAB 5KYKA 3LRPA 4NBSA 4V0MA 3DKPA 2AXNA 2YZ2A 1YHNA 4TZ6A 4TWZA 5GJCA 3IIJA 3R9XA 1FNMA 2ZVPX 2IXEA 1D2NA 5CLLA 2RHDA 2WWWA 2Z43A 3L0IB 3K0CC 3QBTA 4DIDA 4JL5A 3U3JA 3DM9B 1P3JA 2JIZA 3SJAA 1J70A 2ZU0C 2CNWA 1II8A 1PLLA 5G3YA 3QOFA 2BCGY 2OFOA 4OHZA 3DO6A 2QG6A 3SC3A 3W6OA 1CJTC 5IDVA 3EARA 2D4HA 2EQBA 1ELOA 2VHTA 3FOZA 3ZS9A 2VP0A 4Q7KA 4P31A 2ZRGA 2H5EA 4IDNA 2CLCX 4TLCA 4Z1MA 3H86A 4FIDA 3I32A 1A4RA 2PJZA 3OEEA 5EZ6B 5EXXA 3ZH9B 3THYB 2RGXA 4FMCB 2BV3A 4TYQA 3I5YA 3NBFA 3UMRA 1Z0AA 3K9GA 4DLXA 1E9AA 1H8ED 3P26A 4PPQA 4B43A 2V1XA 3CUEF 2PLFA 1CJVC 2PCLA 3GCGA 1CR0A 2IA5A 1WE2A 3E2IA 3WP0A 1G64A 1KI2A 4MGKR 3D3QA 1CEEA 4ACBA 1G4UR 1BKDR 5DE3A 4PO8A 4UNQA 2GKSA 3AVOA 1PVOA 1I4TD 1KK0A 2YWHA 2QT0A 3P27A 2XZOA 2JLYA 2PZFA 3PEVA 4M22A 4Q9HA 1KYIA 4JMPA 2EFDB 1J90A 5KDLA 3QKSA 4Z8YA 2ZE7A 3DKVA 5AJWA 1FX0A 3VX3A 5FFMA 1G7TA 1GKIA 3THOA 2IYLD 2OCYC 2OFWA 3A1WA 2JLSA 3OIUA 5EUQB 3QPWA 4WW0A 1W2GA 2RGNA 2O8DB 2IYQA 3OE7A 3SOPA 3T06B 1TU4A 5JI3E 4HB0A 2VHJA 5GJBA 2WKQA 3W90A 2GAAA 3KKQA 4EKDA 2FNAA 3P4YA 3TQCA 2YWEA 3WRXC 3THXB 4LJYA 1GIAA 2JIZD 4P3YA 4YDSA 2CNWD 1KI3A 1ZW6A 1F5NA 4HAVA 3VR6A 1R5BA 1U8AA 3Q8XB 3EX7C 4DB4A 1LTQA 2AXPA 4LHZA 3RRYA 3U7FB 2OHFA 3AP3A 3VR4A 4Z1MD 1EFHA 2RGAA 1DG1G 1FUKA 2F9MA 3VU9B 3PFIA 1T5LA 4PC7A 1A5TA 3OEED 3U2QA 1BO6A 3BWDD 3EC1A 5FOUA 1AZTA 4HLUA 4X8OA 1ZYUA 4D81A 4NYMR 1EXMA 1NL3A 2E1RA 3CNOA 1E2LA 1TQ6A 1NMZA 4HAYA 2ZE5A 4PO1A 1ZM9A 4KV9A 1CU1A 4Q1CA 4Q47A 1E3MA 1DAFA 2NO9A 3F0TA 4DLZA 4F38A 2FEOA 3CONA 4TYPA 1CBUA 3W3ZB 2O8BA 4A4DA 1NSFA 3BFKA 4KJZA 4M1KA 1YRAA 2QN6A 3Q7QA 1KJYA 2B7BA 5EP3A 3MCAA 3QSYA 2F3RA 1DE0A 1ZJ6A 4Q1EA 3T5DA 1E99A 1IN6A 2FF7A 2YOHA 3QEJA 1ZM3A 1WF3A 1GP2A 2J1LA 4IOKA 2CJWB 4M53A 3SI7A 2QRNA 2F1HA 1XCMA 4ZDIA 1U9IC 3OE7D 2RAPA 4EPWA 4B3CA 3ICQB 1R0WA 1YRBA 2VIIA 4M8NE 1E2EA 3BD9A 3RWOA 4GBMA 1AQUA 2OV2A 2VPPA 3ZQJA 4B48A 4BECA 4QNMA 2WPDA 1E4YA 2JDIA 1F2TA 1Z07A 1P6XA 2Z4SA 1NRJB 2Q0HA 5CJPA 1R10A 1GDDA 1HQCA 1II8B 5B58C 4RD3A 4HZIA 4A6PA 3QI2A 4EQ6A 1Z63A 2ZJAA 5KOYA 1XTSA 3KKPA 3ONWA 1FOEB 1EG7A 3IEVA 1G1MA 1OSNA 3VX4A 3IILA 4TTRA 2EWWA 3TVTA 4F7WA 5K8TA 1II9A 1GNPA 1W47A 1T3LA 3GQBA 5GJWC 1KI8A 3T1OA 4LDJA 4H1UA 5TMPA 2V55B 1VG8A 2CEAA 1U8ZA 3KQLA 4S35A 3O8DA 2RCNA 5B2ZA 2WMOB 3AVTA 1HH4A 2H16A 3B5JA 3QJYA 2OCBA 4PC6A 5EXPA 2AHOA 4Q21A 1TX4B 4UQOA 1K8RA 2VHQA 1T8UA 5DHAA 4Q1AA 3TKLA 5L3VA 2KBEA 3FMIA 4DDUA 4V0ME 3U3RA 4M1SA 3M0EA 1ZIPA 4PZYA 5L3SA 3B1XA 2WWIA 1E9CA 2X77A 2DR3A 2WM9B 1P73A 2QBYB 1D9XA 4LHYA 4G5RA 4E07A 3TUIC 4YONB 2GK7A 5KSOA 1IHUA 2FSIA 3SQXA 3U3OA 4RD1A 4OQNA 1EFRA 1DBSA 4MQBA 4GOKA 3WYGA 1KJZA 1ZM7A 2AWOA 1XTIA 4QBGB 4QRHA 4ZDWA 2AKYA 4HAZA 4M1YA 1SVIA 2GTPA 1EFCA 4TYYA 4C0JA 4QKQA 1T8TA 2QAGC 4PTLA 3AGPA 4C0AC 4ESVA 4DIEA 5JZVA 4FXPA 3GLIA 1OFIA 3K0CA 2ECKA 3HDTA 2QPOA 3D8BA 3A6PC 4BLRA 2WPDD 4WZ6A 1Z08A 2J41A 1LV7A 2JDID 2CCKA 1O3YA 4W5JA 1QZXA 1E2DA 2PEZA 1OYYA 4URWR 3U44A 3RRZA 4CZ2A 2BMFA 1A7JA 1IBRA 2GF0A 1R0ZA 3CR8A 2QP9X 2QU8A 1AJEA 2CBZA 3ADBA 4TYWA 4PPGA 2AD5A 4QNRA 1ETUA 2IS4A 3OF5A 4M9QA 2JGNA 1G3QA 1DS6A 1I2MA 4PAMA 4NCIA 1WCV1 2WAXA 1JECA 1PLJA 1QHYA 5LBIA 2JLVA 2O8EA 4IFEA 1XBTA 5CDFE 1ZM4A 4KYIB 3RRMA 2R9VA 4RZ2A 2IHBA 3F8TA 4QL3A 4CRWB 1JJVA 4G5GA 3MWLA 2V7QA 1CLUA 3ZZUA 4MYHA 2GESA 3TUZC 4LHWA 1GL6A 5TARA 1FFHA 2FOLA 1C9KA 1RRPA 4FINA 3ASYA 4RCYA 1Z47A 5DI3A 2O8BB 3TAHA 1EFRD 2OE2A 5JS7A 1Q3TA 4E03A 1TQ4A 2MSCB 1X8JA 4DCTA 4N3NA 2A2ZA 4IOJA 4A0FA 2D3WA 3AB3A 4JLMA 4LJ6A 2YINC 5CJ2A 4E22A 3CWZA 4WZAE 1G4AE 2KJQA 1Q21A 1T5IA 2PLRA 2J9RA 3SU8A 1E6CA 2F7SA 1CRQA 2IYRA 3W5IA 2UZ3A 3V00A 1DAKA 3VNUA 5G40A 1IY0A 2B7CA 3K0EA 4LPKA 1F2TB 1YVDA 3KXLA 2JJ2A 3JZMA 3Q7PA 1I2DA 3V4RA 1EK0A 1HA3A 5GVRA 4NCKA 2MSEB 3EZ6A 4UNRA 4EQ6B 2GJ8A 5F3WB 1HURA 1ESNA 1GUAA 3MSXA 4MRSA 4TSFA 2R6DA 4DJTA 1CIPA 1G9XA 3DL0A 4TLAA 3GD7A 5J4HA 3WBKA 3DPUA 5DHFA 1F48A 2ZXUA 3ICEA 5BXQC 4LBYA 4C7OB 4XSGA 5BYJA 4MUAA 3TH5A 1CS4C 4V0NA 3W3AA 1P72A 3A1TA 2P6UA 2XNDA 1SKYB 3UANA 3KFXA 3KB1A 3X1WA 2WJIA 4KFTA 1UJ2A 4DKXA 2R8RA 1XPOA 3CW2A 1UBFA 3U5ZB 3SYNA 2YC4C 5F9HA 5JRZA 3IKJA 1WXQA 4Q1DA 1L4UA 3BOSA 3REGA 1E1RA 3LD9A 3MD0A 4KO8A 5L3SB 2V7QD 4XVRA 4JKIA 1GL7A 3NDBB 1G3UA 2GEVA 2ZI9A 2PBRA 2XZPA 4JLDA 4OQLA 4G01B 5FBVB 3B1YA 1YE8A 4IW3B 4YMWA 3HU1A 4LCBA 2AK3A 1IJFA 3LXXA 4I4LA 5ANRB 3U7EB 4B47A 3GJ0A 1CP2A 121PA 2F6RA 3H0KA 2AL7A 5H68A 1U9IA 4CW7A 1OFTA 3H84A 4DCUA 1NG1A 3FMFA 4EPYA 4A15A 2BBWA 2GF9A 2I3BA 4I1VA 1MV5A 3RSLA 2VSXA 1CJMA 4F4IA 2PMDA 2GJSA 2JLQA 2QPAA 3PR1A 4BGDA 2D2FA 4ZDJA 2HF8A 1FP7A 1VDZA 3OEHA 4QOSA 3LBHA 4DB2A 1IY2A 1KY2A 421PA 2VO1A 4FI3C 4JSTA 2KE5A 2B8TA 5LD2B 2ZAOA 4Y0VA 3QPVA 3SDZA 4YMUA 2JJ2D 1ANKA 1T0HB 3IPYA 5DH9A 3U44B 2GHIA 3VR2A 2D7CA 5FBRB 3HU2A 4AK9A 2FSHA 4Q1FA 1S3GA 4TSFD 4JYBA 4TLEA 3W8NA 2QM8A 5KPDA 3BK7A 3J81k 2IK8A 1UBCA 5CK4A 4GOXA 4KSCA 2FFAA 3EPLA 3OIWA 1E96A 1J99A 2NQ2C 1ZD8A 3CR7A 2FGKA 5J4YA 1E9DA 4PR0A 2XNDD 2K5UA 3A1UA 4NH0A 4YXWA 4DRZA 1SVMA 1KSGA 2EFGA 1XEXA 4QBHA 2J0VA 4BFZA 1E9BA 5KNCA 4P4TA 2XOKA 3I1FA 4IDQA 2CHGA 2OBLA 4OI0A 2GXUA 4TL9A 1NKTA 1XEFA 2WIAA 2ZPTX 4PPNA 4DEXA 2JASA 1T3HA 3U7HB 2DWOA 1XPRA 4TLBA 1E1RD 2GEUA 4AYTA 4EPVA 1R6BX 3FGNA 1P9NA 5FBLB 4WBSA 1IONA 1FTSA 2FSGA 4PHTA 4XTCS 2WJJA 6Q21A 4UNPA 1II0A 2BKEA 1JAHA 1ZCAA 2C8VA 3H2YA 4GMXA 3QQ5A 4UNNA 2YYZA 3FB4A 4L15A 5DI3B 4B6EA 3U4QA 2XGJA 4AIIA 1NMYA 3L0PA 4K81B 4IEIA 4GSYA 2BM0A 2QMUA 2QAJA 2V1UA 4GI7A 4M1OA 3K0SA 2J7PA 5C4MA 4MH0R 1VCIA 3R20A 1OHHA 1NLFA 2ZAMA 4HAWA 1XWIA 4DDTA 2JA1A 3ZVRA 2GILA 2AX4A 3RLFA 1OE0A 2LKCA 1M74A 1FMJA 1N6KA 2IWRA 3AM1A 2BMJA 4GDFA 5JFGA 2ZI3A 5SZHB 3BFVA 1P7CA 1GFIA 4PQFA 1Q44A 3OEHD 2QZ4A 3BAFA 3K0AA 2NPIA 1R5OA 2OESA 4GL2A 1XRJA 5JSZA 1G3MA 4M9XA 1MO3A 4RD0A 4BFTA 4KODA 4NYJR 3CPEA 1ESMA 3RVBA 4LJ8A 2OXCA 2WWXA 2BVNA 4PXAA 4AKHA 4KFSA 4IVRA 3KXIA 4DCVA 1P61B 2R62A 3FTQA 5J40A 2ZYVX 1IN7A 1VYVA 2JLXA 2N1BA 1Z0KA 3ZJYA 3NDPA 4LSGA 1X86B 2GNOA 1AK2A 4YC7A 1RKBA 2DWQA 4BFXA 1VG9B 3AKEA 4BPBA 5KDDA 4QBIA 1IY1A 3MMPA 1U94A 2W2XA 3AUYA 5JEDA 5JJIA 2KB0A 4YXWD 4JLOA 4OJKA 1DOAA 4A8JC 3EPKA 2XOKD 1YJ5A 3DVLA 3P32A 4TYNA 2CXXA 1OB2A 4A92A 3CF2A 2REOA 4ABYA 1LF0A 1NJFA 2FWRA 2ATXA 1WB9A 5FBWB 3OHMA 2OAP1 4RZ3A 2QQEA 3TNFA 4XJXA 5AK0A 5E95A 2OXRA 4LK2A 1ZRHA 5EE9A 1LFDB 2X1VA 1E0AA 4DVGA 1IOZA 1T4GA 3KJEA 3FHTA 2WSSA 1RJ9A 1M7GA 3AH8A 3SS8A 4PHHA 5FTLA 3PEUA 3THWA 4ZCLA 1E2QA 4KVGA 2J7PD 4EPTA 3C4JA 3U3KA 4E09A 4UXHA 1OHHD 1VIAA 1XJ0A 1TUIA 4MA4A 4NKRA 3R9IA 2C78A 4DLUA 4LYFA 1KDPA 3ZIAA 1FP6A 1LB1B 2GA8A 3EG5A 4ZKDA 4C0HA 1ZNYA 1AN0A 2CL7X 4QM7A 2C03A 5J47A 1E1QA 1F2UA 3CH4B 3B1VA 1E94E 2IT1A 4B3GA 3SFVA 4RZXA 3RABA 4Q03A 3S1AA 1ZBDA 2QI9C 4WIAA 5D3MA 4HDOB 1DADA 4X8HA 1XZPA 1TU3A 4HLDA 1XNJA 3G82C 1SZPA 3QXJA 4X8MA 3TR0A 2ZI5A 1P9WA 4ASUA 621PA 1ZMXA 2CVFA 4JT2A 1UPTA 2ZRAA 1RYFA 821PA 3RS2A 2IYVA 2DFNA 4A0HA 2JEOA 1DAGA 1WA5A 3PUZA 1VHTA 1XEXB 2QL6A 2RGCA 4KU4A 1FNNA 1XMIA 1CR2A 3ND9A 4DLRA 5FPHA 4B75A 4D25A 4IKEA 1M1YE 3SN6A 4QHSA 2OSBA 2GCOA 4XTRA 4JIMA 3RC3A 4CVNA 4IEEA 1DTSA 1G8HA 1HY3A 2XXAA 1AZSC 1DPFA 3W6PA 3PEYA 1FMLA 3QG5A 3X1XA 2ZRPA 4JYCA 1RE0A 1F60A 2PZGA 3A8TA 2IXFA 2GZHA 1WP9A 3GLGE 5JMTA 1XXHB 1KK2A 1KMQA 1S96A 3K09C 5J4VA 3IGFA 5JCPA 2WSSD 1B0UA 3MG9A 4HZUA 1IJEA 4BLQA 2EFHB 5FTNA 4LZZA 5HE8A 3ASZA 4TMTA 3X1ZA 4JBWA 1QHSA 3GEEA 1PJRA 3K0FA 5FPYA 3ZIAD 4HDQB 2ORVA 4BZPA 3A4LA 5JBQA 3PXGA 5JJKA 3U60B 4QHTA 5LB4A 1E0SA 5TVKA 1E1QD 1HE8B 1M8PA 3K0AB 2F43A 4AC9A 1YZNA 1GITA 2D62A 5FPTA 4B32A 4GP6A 3L82B 5JSZB 2VP4A 4URYR 3W9YA 2BEJA 1GRNA 4OL0A 4G1UC 5SZKB 4Q00A 2ZU6A 5FH9A 2GVZC 1VG1A 3ZS8A 4IOLA 2GJAA 1FPMA 1SVKA 4ASUD 4IDOA 1Q22A 2NG1A 5FL3A 3MJRA 2YWGA 4JBYA 4M1WA 1KK3A 1XXHE 1TUEA 4GPTA 4E5UA 4BRUA 4QHYA 1OPXA 4BUJA 1XMJA 3EWSA 2HJVA 5C18A 1DAMA 5AUQA 1EFUA 1YZQA 3BS4A 1DAIA 4RKFA 4LC0A 4R9UC 2F1IA 2IEZA 1G8GA 1NN1A 1TPZA 3GLHA 4I99A 4MRVA 1KI6A 2ZJBA 5B64A 3KKNA 4Z51A 1KDOA 1DAHA 3QEOA 4IHQA 2AWNA 2IWHA 1NBMA 1TL7C 1YKSA 4HATA 4M1TA 2OO7A 5KO2A 2ZANA 4PO9A 3KB2A 4A82A 2XAUA 2HT1A 1GNQA 4YMVA 4M0LA 2A5DA 4Q1BA 4XH9B 4D0LB 5KSYA 1GRRA 1E9RA 2KWIA 1RJ9B 2O8FA 4PHFA 2IBMA 3KKMA 2Q21A 3O8BA 1E4VA 4URUR 2O52A 2GDJA 1XTJA 3W34A 2HUPA 3BIFA 2BBTA 1X6VA 4AG5A 1X1SA 1KMHA 3NVAA 2A5FA 3W8RA 3IHWA 3VKWA 3CPHA 5BQ5A 4ZIRA 5IT5A 2JATA 1OYWA 5KSZA 1EWQA 2BEKA 2W0SA 1X8KA 1XFAA 3K70C 2HLDA 3F3YA 2X8AA 4EUNA 4BFSA 3NC1C 4DSUA 1L4YA 1KY3A 1TTTA 1MO4A 1F2UB 2FSFA 3O8RA 2W58A 2BKUA 4BFUA 3T35A 4BFVA 4MYTA 3WY9A 1NVUQ 1XCPA 4V02A 3S1AB 3AP1A 5JWRA 4A1FA 2XB2A 2SHKA 2ODEA 3DMDA 1TMKA 3VFDA 5AUNB 2QMEA 4G5SA 4PQYA 5F9FA 2G3YA 2N46A 3RC8A 3N2IA 3AV0B 4MRRA 3TVDA 2DFTA 5IF9A 1M7BA 3IBYA 4UJ3A 3A4NA 1E2MA 3SJZA 1VKJA 2R44A 5FPKA 2FH5B 1QHHA 2G77B 1UBEA 4FW9A 1FQJA 1W2HA 1NF3A 2ASEA 4JBXA 4QGGA 2GXSA 3RS5A 3QXCA 3VAAA 3AVPA 2GXAA 4A8JA 2ZEJA 3DEFA 3U3MA 1AKEA 3VQTA 2EU8A 1NKSA 1JQJC 1NVXQ 3PUYA 4M1MA 2V54A 1ZUNB 4UJ5A 4AKIA 2CVHA 2ZYWX 1H65A 2GCOB 3WRYC 3EA5A 4K8OA 1Y3AA 4BLOA 2AK2A 1W7AA 4N0EA 4AI6A 1AGRA 1NBMD 1I4DD 1Q57A 4NDZA 3GPLA 2WOOA 1CR1A 4DXAA 4O3MA 2BC9A 2QGNA 4Q66C 3SZRA 4BZXA 3SEAA 2CL0X 2ZR0A 2O0KA 2EFCB 1XPUA 4WA7A 1W5SA 4NTZA 4HZUB 1AM4D 4A6XA 1AGPA 2AD1A 3RSOA 3FPAA 4AWXA 3NBXX 5KSPA 3AF1A 3K0FB 2W83A 4Q5IA 2V4ZA 4XVUA 2HLDD 3MAAC 1W46A 5M04A 5HZHA 1XD2A 5EE3A 5B30A 2DHRA 4H9GA 5DYIA 2LCFA 2PH1A 4EFMA 1ZUIA 3RAPR 2F43B 1NMXA 4MGIR 5DGXA 3UWOA 4LJ9A 3NBZC 2W2VA 2IYSA 4WZBE 4ZDKA 2F1RA 1OIVA 1SHKA 1NLZA 1T91A 2ZJZA 4FMBB 5HTKA 2KI5A 2ANCA 5KDOA 1EWRA 1Q20A 2V8OA 3X1YA 4ARZA 4NL4H 3TW4A 3CRW1 2EWVA 5FPSA 1ZCBA 1R5NA 1KAOA 3F5FA 1IM2A 4RFVA 1MKYA 2GK6A 3A1SA 3GEHA 4IJMA 2AFIE 3TAUA 4IVPA 4QFMA 1IXRC 4XWAA 5FI0B 4C2TA 2JAQA 3NH6A 2WAYA 4WXPA 3WNCA 1W4AA 1CR4A 4FMDB 2MMCA 3QVUA 1US8A 1HYQA 3GLHB 3UKDA 4TL8A 5TY0A 1G6HA 1E2FA 1NVWQ 3HYTA 4Q4HA 4A0GA 3QKSB 3PUWA 4PZZA 3OIVA 5FUWA 1KZ7B 1FX0B 2YVUA 4IDHA 3CX7A 1YR8A 221PA 4QJ3A 4JJKA 1SULA 4DLTA 4PC1A 1MRSA 4EJSC 2J0QA 3DMNA 4Q4JA 2O8FB 3P4XA 1JR3A 2WIBA 3BC1A 2A3RA 3H4MA 2G0TA 4NHOA 1WDTA 4O2LA 1KSJA 3WBJA 2YOFA 2YOGA 2CE7A 4OK6A 4PSAA 3RYTC 4EPXA 4ZIRB 1TF5A 1QHIA 4AYWA 5JWOA 2QY9A 1GSIA 2NZJA 4QGAA 3FYHA 2NPFA 3SJBA 3EZ2A 3NG1A 3CM0A 4JS0A 4RSGA 1ZIOA 4JVLA 1G21E 2IXGA 1JQLB 1OKKA 4TZ0A 4Q7JB 4CEJA 1G16A 3GLHE 2H7VA 3WMGA 4UXJA 3L8YA 3K9HA 5EQTA 5TV2A 4FWIB 3RS3A 1E32A 1TNDA 3ZDQA 1NBME 2IX3A 2RKOA 4TQAA 1G8YA 1WQ1R 3PIRA 3WP1B 4CT4B 1DAEA 3QUSA 5TDHA 1EX7A 1QHHB 1ZD1A 5E4FA 2QTHA 3Q85A 4B3FX 1VCOA 2A5JA 2R65A 4A8JB 1Q1EA 3TSZA 1JXOA 4PSVA 2FPKA 2Q3HA 3PITA 1XD9A 2QORA 2G9NA 3LQRA 4D26A 2QPTA 2QM7A 1Z6XA 3GLFA 3I3SR 1KZGB 1XEWY 3G5UA 1QG4A 3FFBA 5EE1A 3EASA 1VCNA 4DBLC 1E9SA 2IYXA 4F92B 3QNUA 3LLUA 3QPUA 4GFDA 4DLWA 1TAGA 4L4UA 5CYPA 1J2JA 1XJQA 3X1DA 3LNCA 4B2LA 2PMKA 3PQCA 5A5GA 5FL7A 2EVWX 2HJGA 1G3RA 4PAQA 3T1TA 2Y8EA 5CYOA 1P4SA 4LHVA 3BGWA 5B57C 2GETA 1JR3D 4OK5A 1NP6A 4BRWA 1GTVA 2DCUA 5GADl 1U2RA 1IAQA 2MSDB 1O87A 2NO0A 3B13B 3DZ8A 3NKVA 1VG0B 4PFSA 4BE7B 5HKKA 4OJQA 4F91B 2FDCA 2GCPA 3LA6A 2PZEA 4C0SA 3MWKA 3A1VA 3D31A 4BQSA 1U81A 3K1JA 4MKFA 2BIFA 1XD2B 1YR9A 4R2HA 1IN5A 1N6IA 2VLIA 3AVYA 1OKKD 2Q3FA 4KFUA 5F98A 2CCGA 4HYYA 4C30A 4II7A 3I62A 1Z0DA 2H18A 2P65A 4LBZA 2RGDA 1W36C 3BFXA 3AP2A 1M6NA 4QXAA 2NZ8A 5DO9A 4NZYA 1N0UA 4ARZB 2C2HA 2XTMA 5DLQC 3ZVMA 1Z6AA 2ZJ8A 2NGRA 5A4JA 4PSKA 3EZFA 4CYMA 2VH5R 3QBVA 1SVSA 1G41A 1E2KA 4PPFA 4WVFA 4B3XA 2IUTA 3KL4A 5C4GB 4ERNA 1YU9A 4Q48A 2FGJA 1WRBA 1M2OB 2FV8A 1BYUA 3FHCB 5BWMA 3B6EA 1SVLA 2QRZA 3SYKA 2W6IA 2VSFA 3QXSA 1LNZA 2RHMA 4Q4HB 2QNRA 1PZNA 2G1JA 3QXHA 3T12A 2CCJA 2NTYC 4B76A 3I8XA 4I1SA 5JHHB 4O2RA 4PQRA 1JI0A 3VKHA 3GP8A 1OXVA 3UMFA 3HPQA 5JS8A 1AS2A 1N5LA 2X2EA 4HB2A 5E7MA 5FL7D 2ZE8A 2OCPA 4LRWA 2QA5A 4CF7A 1AS3A 2G88A 2XEXA 1SKYE 1IQPA 1XX6A 1Z0IA 4B6FA 5BN4A 5J4LA 4Q4JB 4FD2A 4NMMA 2ZQ5A 2CHQA 5EP1A 3W6NA 3BXZA 5AJZA 3GLIB 3B1ZA 3SQWA 4OKSA 3VHXA 1G18A 3PG5A 4JLNA 4DCNA 1KO7A 5HKKD 1RVDA 3K70D 1NNEA 1E2GA 2HV8A 1FZQA 1Z83A 5KHOC 4P4SA 1MRNA 3VR3A 3ZZ0A 3ZGXA 4D4MA 3LVRE 1FTNA 4LPSA 1JB1A 2H1LA 1RFLA 1J8MF 4P33A 5UKDA 2X2FA 4JLKA 4RY2A 1R2QA 4CEJB 3TW8B 4B35A 1G5PA 2XJ4A 3QG1A 4Q9KA 1YZLA 2ZS9A 2QQ0A 1Z0FA 5FTMA 4US2R 1MOZA 2ZSFA 1COWA 1GRQA 3CNLA 2GJKA 1HT2E 1MABA 3MRSA 2O8EB 2W0MA 3I8SA 3VKGA 5FTKA 1U98A 4HUTA 2G0NA 3VMFA 1GKYA 2V3CC 2Z5FA 4US1R 4L9WA 3BJIC 3GLIE 1JR3E 3IBGA 1P2UA 2GZDA 1F3OA 2ANBA 3CRQA 4MRPA 3RRNA 1HQYE 1SXJC 2KBFA 4XSHA 3TSWA 4KXFB 4CEHA 5AJYA 5AUOB 3RANA 4ZI3A 2L0XA 2W6ID 2CHVA 1D2EA 2XSZA 3BBPA 1T0JB 2V6IA 4MUBA 4BLPA 2FU5C 4LJ4A 3T15A 4TT3A 4OI1A 2HYDA 2Z0MA 2ONKA 3AF2A 1KO8A 3EIQA 1C4OA 2BWJA 3B9QA 3M6AA 4GMDA 3WXMA 2QAGA 2PJRA 4KITB 4LBWA 3T1VA 3IHLA 3SHFA 5KU1A 2FEMA 1GL9B 2GBLC 1R8QA 2RGGA 3MWJA 1Y63A 2WWHA 4AKEA 1VCMA 1JEDA 4NYIR 3FE2A 4UXIA 2WJVA 2OG2A 1QHNA 1NY5A 1XU4A 1P2TA 3FWYA 1G5TA 3ZVNA 2FMXA 2D7DA 1GG2A 4ZCMA 3FVQA 2YC2C 3N2EA 1Q12A 5EP2A 1UDXA 1VMAA 4EFNA 2G1KA 3ND8A 4LI0A 1N6PA 4DLYA 1PLKA 3SNHA 4YQFA 2ATVA 1K6MA 1NVVQ 2GCNA 2OM2A 4KVAA 1E2JA 2QENA 4PANA 4C9BA 4JLPA 1GAJA 1ZP6A 4Q9IA 2UKDA 3LXRA 2VF7A 4ZKEA 4ZV4A 2QP3A 3B85A 4IDPA 2REBA 4DHEA 3C41J 3EZ9A 1KGDA 1COWD 4DLVA 1DO0A 3AQ4A 2A78A 3LV8A 4G3XA 2F3TA 3KZ1E 4TMZA 5E7IA 2Q9AA 2AFHE 1U90A 1JALA 2ZETA 4R7ZA 3LO5A 1JJ7A 4TL7A 5JWHA 2ERYA 2ZRMA 4PX9A 1XDBA 2BHRA 2P5SA 1IN4A 2IEYA 3JVVA 3R7WA 4B3BA 4POAA 5E3HA 2WWYA 1W0KA 4G0NA 1ZD9A 4HAXA 2ZJ2A 2GJ9A 1BOFA 2ZI6A 1S4QA 3SFZA 3UG7A 2PCJA 3VHLB 2O8CA 2J3EA 5CB8A 3IUYA 4IXMA 3B82A 3NIBA 4EPRA 3SYLA 3GJ6A 2FA9A 2MMGA 1N6OA 3LW8A
chains in the Genus database with same CATH superfamily
3OIYA 2ZRQA 2FI1A 2C98A 3I2HA 4CT5A 3PUXA 2Y6UA 4RNCA 1KE2A 3CSDA 2PYZA 2RAVA 1M7HA 2ZJ5A 3JATA 4YUAA 1XD8A 5FNVA 3ZBQA 5KQPA 1KK1A 2GYYA 2IUUA 3Q3GE 1XLVA 3EBOA 2AWYA 7MDHA 4JE9A 4UMEA 3PYXA 2HJ3A 3EVCA 4FLFA 3Q9UA 4DV6B 1YL5A 1CIVA 4NE7A 4ZEXA 4F3CA 4FGSA 1X80A 1MIOA 1LF5A 3N70A 1SCQA 1T0PA 3I0NA 3SMQA 4FCWA 4V0OA 4YRNA 4ICIA 2C1XA 2EW8A 1NUUA 7ADHA 1A88A 2B7LA 1AK9A 1PJBA 3ZQVA 3U4QB 2FJPA 4YRLA 1V3UA 3O47A 4NEGA 3WK7A 2IE8A 5DI9A 5IZ4A 2QAGB 1Q3HA 1GZDA 2IUYA 4LOJA 1D1SA 2X1MA 1P1RA 3U0CA 3PQ6A 4K2HA 3CCBA 1PK9A 1C3XA 2JAPA 1TQGA 3MF4A 3A1CA 4P93A 1CUSA 4U5FE 1CRPA 4K88A 5TLSA 5IANA 4EBJA 4L5YA 2D2VA 1PJAA 3O0TA 1ZNWA 1QQTA 4AQDA 1VKZA 1RKVA 1N5KA 2ZUCA 2PA0A 1LD3A 2Z3VA 3LT5A 3TJZA 2RHCA 1OW3B 1A8UA 3KR0A 1FC0A 1A2QA 4DMLA 3GHYA 2Q1SA 5LA6F 3X1MA 2HJWA 1D6JA 2D1TA 2A3NA 5JPDA 4KQIA 1V39A 4DQLA 5TT0A 3I9KA 2WICA 4GMFA 4Y9SA 4MLDA 5FBQB 4KUHA 4CNQA 1A7EA 2FVXA 1KOFA 4IQ4A 4CIXA 4K28A 3LW7A 3C3BA 1T4CA 5A02A 1X80B 1MIOB 1HE3A 1CUJA 3SHVA 4P2BA 1TZCA 1E2XA 1IPFA 1BHO1 1E5XA 4E30A 5HUJA 5IHPA 3PEFA 4GQHA 4MHSA 5AKYA 4EFKA 3U7JA 4GMKA 1R7RA 1CUDA 1OF1A 5ITZA 1WATA 1JYEA 1BX3A 3BGOS 1YR7A 2Q2WA 2OK7A 2YDYA 3I6QA 1VECA 1ZMBA 4Y6SA 3A7DA 1L3PA 2J31A 4C6TA 4EUFA 2VK1A 1GUFA 2VDQB 1EGMB 1JHUA 4G1CA 2Y0CA 2ZTSA 4W5OA 2B8WA 2UYGA 3CKKA 1OA0A 1NOIA 1XROA 1L8LA 3O2QB 2F4NA 3HFRA 4V0LA 2QLTA 4JI2B 1Q0SA 5DTJA 3BULA 1RYDA 3QTTA 3RNLA 3DDCA 2QUKA 2RGBA 2YTZA 3BF8A 3BH7A 5H1YA 4ETIA 1F3LA 3B5IA 2Q6TA 1EH5A 3T1QA 4UAUA 2ZUBA 5AR1A 3S84A 1B00A 2ID4A 1IXSB 1LQUA 2EKZA 4HDKA 4QPDA 4UTOA 1SXJE 1SB8A 4AVYA 4ZYUA 3KOZA 4R69A 4OEHA 4KBYA 1UK8A 5FYDA 1HNWB 2EYQA 1IK4A 3EAQA 3KUCA 3T7DA 1DLJA 3WHNA 3TTXA 3RK1A 1Q95A 3BTVA 4XVQA 5EUCA 3CZCA 3KEMA 1G1AA 4CDVA 4GDMA 4EGCB 3POVA 1DDGA 3UG6A 5ALPA 3HXOA 1A82A 3KLNA 4AAYA 4X0RA 3TGPA 2FK7A 4JXJA 4DDVA 5ITZB 2R84A 5IXSA 2WLTA 3A31A 5IF3A 3TSAA 1KFEB 3A3OA 5THXA 3T61A 2UZIR 4CMEA 1CY1A 1XF9A 1FFTC 4TN1A 5COQA 1X9IA 4A23A 1Z0JA 3EW9A 3K9FC 4C6TB 2C2BA 2BGRA 1XDZA 3BUSA 4OQMA 4KX5A 5FJIA 2PV0A 1RPZA 4B44A 1JEEA 5JZ9A 2ODAA 4Q01A 2WL8A 2BFEA 3HA2A 1UWKA 4JZKA 2WNSA 2C4TA 3JQ7A 3UUGA 2QE9A 3L1KA 4OYHA 4AX4A 2SKCA 1XLUA 4YV1A 3ROEA 4L16A 3PF8A 1ITZA 5JAHA 4IJ5A 4WCFA 5JCOA 1Q6ZA 5AW7A 5KU7A 5ICMA 1XZAA 3E9ZA 2ZRJA 3MQFA 1I7QB 1I0ZA 2XGOA 1ICIA 3ZKWA 4HDKB 3A58B 4FKMA 5I48A 3KHKA 2QRUA 4U1RA 2WM3A 3L18A 3RAJA 2B4YA 5C8DA 4GKVA 2JK1A 4N9WA 5D3QA 2WKRA 2E6UX 2X0IA 3B6ZA 3MTJA 2ZW9A 3OQVA 3V2GA 4LF6B 4QDKA 1RAFA 1WUIS 4G25A 1ZONA 4XWOA 2PRKA 3AUXA 1EZZA 5DNEA 4Y67A 3KDSE 1PWYE 1YTUA 1CGOA 3KR1A 4U5CE 3CB4A 2W37A 5ICGA 5ELXA 3EISA 4FYMA 3VNVA 5F78A 2G9QA 3O2JA 4WMLA 2PS0A 3RR2A 1ZZEA 1HV8A 4JB3A 3UMJA 2FWPA 1Y89A 1RSZA 1OFHA 1R6VA 1BWRA 4IV8A 2XUPA 1PBTA 3V7FA 3LSYA 1O7JA 1OCZC 1K3TA 3UOAB 1N6LA 5PGMA 2CUNA 2BFEB 3DV9A 2QJTA 3NBUA 4MPJA 4HH0A 3JQ7B 3E5NA 4GOJA 4YT5A 1K7EB 4WSOA 1N2OA 4F4HA 2CXOA 5YASA 2H7BA 2N9UA 1Y8CA 2AC2A 1SPBS 3F7OA 3VOAA 2WQ7A 3NIFB 3F2VA 3ZHQA 3TD7A 3HMQA 4OBWA 3ADPA 3GJ4A 3K05A 3VO1A 4JR2A 3LHDA 4IVQA 2V7XA 4YRBA 3ZKWB 1XP5A 5CLQA 3NBYC 2AI3A 4YBZA 1NVBA 4WQMA 1N6NA 1OFUX 2OV1A 2EFEB 2RK4A 4XB2A 1NNSA 4JGIA 3MBOA 2VDUE 1IG3A 5DYWA 2IODA 1E2IA 3PNSA 3HBMA 2YZNA 1A2OA 2XT0A 1P2SA 4KYUA 5DJ5A 1YB7A 3E4DA 5JOQA 3DKPA 4AL4A 1XZJA 2HMUA 2H7CA 2WWWA 1BN6A 4B17A 1WKVA 1IHXA 3E3AA 1CJTC 2VUUA 2VHTA 3SQOA 2H5EA 3SFTA 5EXXA 3KJNA 1O9HA 1YI1A 4UUNA 1L4HA 3D3QA 3WO0A 4ACBA 5DE3A 5F7ZA 4ML3A 1GGKA 5EJFA 1YTLA 2LE0A 3JW8A 1FX0A 5LOVB 1WM1A 4EIYA 2GN9A 3DJYA 3OIUA 3F6CA 2X0DA 3ZTMA 4UHHA 4ZK2A 2BSAA 1FP4B 1KBOA 3DH0A 3A9TA 2Q4RA 2HU7A 1KDVA 3ELUA 4H7HA 2NLOA 1R5BA 1MAAA 2RBGA 4AICA 3L1IA 4Q4CA 2Z5LA 3S4YA 1AY0A 1DG1G 2MJLA 2OQIA 3NIWA 4KBLA 2WFLB 4JU8A 1L7RA 2P2DA 4D8TA 4X8OA 3IE1A 4YWQA 3FMVA 2PGIA 4KV9A 5H9WA 1ZSVA 5EFZA 1H2RS 1A4UA 1NSFA 2R6HA 3WI7A 4V2IA 3Q7QA 3MCAA 2F3RA 5M34A 1E99A 4B9AA 5A71A 3MM4A 4D1YA 4PZ9A 3QVGA 1OVMA 2ZXRA 3WSTA 1U2GC 3VX4A 2Y39A 3KOYA 1BH6A 2I3AA 3GA0A 4O2BA 1K8YB 4YT8A 3IH5A 2RHLA 4RMJA 2RJNA 2UU9B 3LLKA 4AUEA 2X42A 5TVGA 2WWIA 3SKYA 2KYHA 1YACA 4ZT3A 2GK7A 5EY5B 3L07A 2V65A 4K2AA 4OQNA 1WDWB 4RJKA 5BW5A 1Y37A 1DOVA 4HAZA 2JAOA 2Y3HA 3MWGA 4BDTA 3I9V6 2QLFA 3EVBA 1B6RA 2QAGC 3JTMA 3K72B 2QJFA 2DUMA 1FU7A 2D1FA 3D1LA 3DP9A 2EPOA 3OETA 2ALJA 4CZ2A 1ILWA 2AD5A 1ETUA 4FYKA 1I2MA 2B94A 1RBMA 1K4MA 4DDHA 3VC1A 1JDSA 3BKXA 1MGPA 2AX3A 3IVCA 1HOXA 4MV3A 2GESA 1PVVA 3N1UA 5AVUA 4KXUA 4M0PA 3O21A 4K0RA 5C5IA 5FP0A 2TMYA 1G4AE 2VP3A 4NBKA 1YRYE 3Q9NA 4YRFA 1CHDA 2UZ3A 2JEZA 2PT6A 3A11A 2G82A 5AC5A 2XT9A 4IX1A 4YCNA 3MLAA 2B8JA 1L4BA 4G78A 3A6ZA 3MSXA 4DJTA 2NSGA 4O2BB 2AH5A 4RETA 3PDWA 4XX1A 2RHHA 2WJIA 1DG9A 5JRZA 5K6AA 3BOSA 6ADHA 1GGJA 3A4IA 2Y0PA 1G3UA 3DV2A 3ZZ1A 1ESDA 2ZCVA 5CFZA 1SM4A 4MW5A 1Z4MA 3EXFA 5ANRB 5A4KA 2Y2VA 4NDAA 1OXMA 4I1VA 1M1YA 1NJ5A 5CVTA 4F4IA 3I8OA 4QE3A 5CDGA 2LUOA 3LBHA 1KY2A 5BMVF 3VUEA 1WEKA 1ANKA 4E5PA 1S7ZA 2D7CA 3T6KA 4JYBA 1PWHA 1FZTA 1T6QA 3AG4C 1Q0GA 1ZH0A 3CR7A 1N36B 2FGKA 3T5PA 1O6ZA 2P8SA 1GUYA 1KSGA 2EFGA 2J0VA 1FTYA 1DJQA 3WGLA 5JNVA 1V35A 3D8UA 4UAVA 1AQIA 2NPUA 3QFSA 4I5DA 5FBLB 5LA6A 3LT2A 5ICCA 1Q0TA 2O59A 2H00A 2C9MA 3ILYA 4GI7A 2VF4X 3P5BA 1XWIA 1XGKA 2LKCA 1FMJA 2IWRA 2BMJA 4UCQA 1FDWA 1P39A 1DKMA 2OESA 4GL2A 3O4FA 4ILKA 2J3LA 5BSTA 4DABA 1G38A 4AKHA 4JXXA 4F5ZA 4KN6A 2R68A 4QOEA 2JKVA 3PDJA 4IIJF 3DDHA 1AK2A 5H16A 1XQVA 3NATA 1I36A 1MMDA 1U94A 3OTHA 2YMMA 4F84A 4GD3Q 1YJ5A 4K6KA 5HKOA 4TYNA 1NFFA 1WB9A 3DEZA 1UPXA 3DTVB 4XJXA 1Z2OX 3ZCTA 4U7GA 1YONA 2V58A 3AH8A 3EXFB 4DZRA 4PQGA 1M1YB 5C1IA 1J0CA 1XL1A 3NJ8A 1PIWA 2HMAA 1CVIA 2QI9C 2EZTA 1GTZA 4O4HF 3GLUA 1T6IA 2ZRAA 2Z3ZA 4RL6A 2DFNA 4IV0A 4EL0A 4FESA 1AKRA 3QELA 3U49A 1L5LA 3COWA 3GRRA 3Q7TA 5LA6B 2R4UA 2UDPA 2FSUA 3UMIA 1Q74A 2GEJA 1XVUA 3V7WA 3LEOA 2HIAA 3SEFA 1T3ZA 2YLDA 1QHSA 3VSEA 4MGHA 4AN4A 3PXGA 5TVKA 4DKJA 1M8PA 2CCYA 4AC9A 1VC2A 1YZNA 3EGEA 1ADBA 5FPTA 2CSUA 4GP6A 4M87A 2E4VA 3NKEA 3RVKA 3ZCVA 1ZHZA 2XF2A 2GN1A 4IDOA 3MJRA 1XHFA 4DNPA 2G3VA 1OPXA 4BUJA 2HJVA 4ZP1A 3SIXA 1ZA2A 1NN1A 4FTWA 2JX0A 1XF1A 4AO6A 3W3AH 1B14A 1KDOA 1KZHA 2I33A 4L8YA 3K6JA 5CT6A 3MFNA 4YMVA 2A5DA 4XH9B 4UVHA 4LF5B 1GTG1 2BEVA 4D4NA 1B8NA 3W34A 5HFAA 3QBDA 2Q7RA 3IHWA 2C0CA 1EFLA 3OOSA 2X8AA 5H3CA 3MTIA 4ER6A 3U1BA 1U5CA 2FSFA 5EPEA 3T35A 3CHYA 3AF6A 1GO2A 1T2UA 5F9FA 3ETHA 1M7BA 1NPDA 3L9WA 2W8ZA 2R7UA 2A6EF 1DBWA 4LYYA 4IM7A 2EU8A 4DXDA 3LUHA 3PWKA 3G2PA 2HHAA 3S1LA 1HXHA 3SE7A 2P9GA 1CE8A 1PYGA 2A84A 5ADHA 1XDUA 1KZYC 2EFCB 4U4AA 2ZKLA 2HRCA 2QUIA 3FPAA 4ZV9A 2I55A 3DD7A 4EBBA 1KZ4A 1C0PA 2FLVA 1NXXA 4BQPA 5LKRA 4LJ9A 2IYSA 2YL7A 5T8KA 1HOTA 2WUFA 1MZPA 4YTEA 4Q4ZF 3OKPA 3LGSA 1DCFA 3MVEA 4QATA 2JAQA 4EI9A 2OORA 4BQEA 1G2QA 1L8XA 1CS0A 1C3JA 3HYTA 4PLPA 1KYVA 5FUWA 3A9RA 4DFDA 2HQRA 5JASA 3V8RA 221PA 4RM2A 1SELA 3NDIA 2QZZA 5ENVA 4AULA 4CR8A 3RYIA 2BEVB 2HPAA 3BC1A 1FLVA 4TV8F 3BRCA 3WKBA 4EYEA 1JQLB 5ETJA 5DP1A 2H7VA 2AW3A 4WK6A 5F2OA 1TNDA 2W6NA 2QVLA 1AKNA 3B3GA 5L7TA 3FX2A 1VPDA 2R65A 1TZMA 2WG2A 2HFIA 3QK7A 2XRHA 2NVUA 3FFBA 1AZLA 2X76A 4DBLC 1CE8B 3ICOA 2QV0A 4JYAB 2W6CX 1G3RA 4EITA 2FX2A 1RWWA 2F00A 1B0AA 2BHTA 5BR4A 2AYZA 3OCVA 3RIEA 2P65A 3C6MA 4ZCPA 1E62A 3BYZA 4PCAA 2CFTA 1MQ9A 2OENG 3NHFA 3L6EA 3HUFA 4ZAFA 4X54A 1SVSA 5AESA 2FGJA 1AH2A 3FHCB 5KC9A 4RFLA 1CS0B 3T12A 4BUCA 4QJIA 2ODTX 2OC4A 4JOSA 1JLRA 3GLIB 1PL7A 2L17A 1SC9A 5HKKD 1E2GA 3I42A 3DDZX 2CLMB 1K4YA 3TD2A 2CW5A 2VDKB 4H7DA 3MRTA 5HRAA 5DFAA 4XDGA 3J81A 2WA2A 4IGEA 4OOFA 2BPOA 2Z5FA 4H6PA 3VRCA 3D6FA 1JR3E 4UHEA 5FWYA 4H3VA 2KBFA 2OXTA 4Y2PA 1U0RA 2NVUB 1T0JB 2NUPA 2WG0A 2A9QA 5CFNA 3QLUC 4ZVRA 3OC0A 1IUOA 1SFRA 2PN1A 3FWYA 5CVCA 3USCS 3FCXA 3M1YA 4ZEVA 5JS1A 4E32A 4ZVMA 1VMAA 1QU3A 1Z7YA 2XKAA 4DLYA 4YQFA 1K6MA 3IXMA 5ESXA 4C9BA 4IDPA 3SOZA 5BQIA 3HZHA 1HDXA 3LV8A 1QE0A 2FLWA 3RE1A 4NJEA 4IIVA 1GAEO 2O8CA 5E3HA 3G9UA 2P6OA 1Y4CA 1KFJB 5LQMA 1UWCA 5FXMA 1TK3A 4YUYA 4DSZA 3OJXA 4XLTA 3U61B 4OQ4A 3HXQA 2OD9A 2QTMA 4TKMA 1UDWA 2BE5F 3M9XA 5DX0A 2H54A 1M2NA 4EKNB 3II6X 4MGZR 4RKEA 1S2OA 3AFGA 3FCSB 1Z22A 4U9EA 3RS7A 3Q88A 1J22A 5SZJA 4HB4A 5IFLA 1EP1B 4C5BA 1OT3A 1D0VA 4GPIB 4X85A 1PV2A 4NMHA 3IQTA 3PHCA 1AVOB 3PCVA 1CUVA 3ZD6A 1E18A 2H1WA 5FWYB 1PCXA 3HY4A 3AEZA 3VVBA 2P67A 2XX3A 3VZBA 2HBYA 1QP0A 2NUPB 3AGUA 2JFPA 2VNHA 3FZGA 4HDCA 4C0LA 1KYWA 4BLUA 2O2IA 1SUSA 3V2IA 3V7OA 3HCDA 4YJDA 1HG0A 3BZBA 2C7OA 2OCIA 2FQYA 2EX4A 3IQGX 4MQLA 3DOEA 3WZ2A 5EJIA 3TRJA 1PJQA 1G66A 1OU4A 4BOYA 1RNLA 4ER7A 1VTKA 4YCDA 4NJEB 2O8CB 1R8JA 5A06A 3PRJA 1UBHS 2O9JA 2OZVA 5D86A 4JGBA 3VU8A 4FX5A 4HNQA 2GAFA 4D4JA 2I4TA 1RW4A 1SVOA 3L77A 4WOPA 2CK3A 3F6YA 2RH5A 1SC6A 1FRQA 1MG0A 3P9NA 5B53A 1OV4A 4J0DA 1AKYA 2RHWA 1E4EA 3LLMA 1L1RA 2ZZNA 1WUYA 2BBOA 4Q5SF 4YLGA 3EHEA 1LFAA 2YZ7A 5EWMA 1X92A 5TS3A 4LZOA 2C07A 1SXJD 1KJNA 1GM5A 2QGZA 2J8WA 2QL9A 2XODA 1E7WA 4ZC8A 3PICA 4RVSA 8GPBA 4G86A 3RSHA 4R8MA 3D4LA 1DOHA 3VZDA 1S2MA 1W5TA 5AVQA 1EEXB 4F86A 3CO0S 1WZUA 2AJDA 5LQRA 2JHPA 3RTEA 5BMVA 3KKLA 1GVNB 4ZMBA 4Q4AA 4NZ9A 1W5AA 3JTEA 4Z7NB 2ASRA 2PR7A 3ZK9A 1XMQB 2HEIA 4YJ2F 3TLAA 3OPYA 4C7OA 1XMSA 1CUWA 3DBLA 4DRJB 4NCHA 5AQ1A 2YWBA 1ZN2A 2PAAA 4BWYA 2XTZA 2YN0A 2XLEA 1UT5A 5CH8A 3ZWBA 5CGZA 5H3LA 5C1DA 3NI2A 3A14A 2I62A 4CV3A 3NONA 3G2HA 1J42A 1K5DA 3G49A 5EVCA 3UHJA 1Z5OA 1G20E 5EXTA 2FWAA 3ZQKA 1T9HA 2Q2OA 2LQGA 1F4LA 1MJGA 1MVLA 4PFQA 3FOPA 1B2LA 3UHAA 1ODFA 5K8LA 2QYSA 3CO5A 3LWDA 4TWAA 4U02A 3RYHB 4IYRA 2EINC 1E4EB 1NNUA 5E38A 4RULA 3TCNA 3NETA 4J3JA 3U6BA 2XMZA 2OA0A 3VA7A 1H2BA 1RTTA 5EWMB 4ZAVA 3I28A 2G62A 1FBNA 3OZ7A 3SVZA 2EZ8A 5FULA 1OZFA 4LXXA 3G88A 1AN9A 3SYTA 5B3IA 4WKCA 3B12A 2Z4RA 1W4BA 1ZZGA 1GRCA 3OHPA 3K73O 5P21A 1YULA 1DC3A 4ZICA 1IXKA 1ZN7A 2CD7A 2ZZMA 3LAWA 5B55A 5BMVB 2J48A 3DTYA 5TF4A 2WSIA 4GX2A 13PKA 4O4HA 4Q4AB 3IVAA 2FW6A 3G7SA 3BWXA 3GYGA 4MUIA 5C3MA 1YO6A 1GSOA 4GSLA 5IP5A 3OPYB 1RIFA 3DBLB 5JSLA 2E82A 3Q6MA 3A70A 3B1WA 4JUFA 3RGGA 1PHRA 3DZDA 1KOGA 3M6VA 1NIPA 2YNMD 3AZPA 3LQ2A 4CS7A 2YXLA 3FKQA 3WNDA 3O92A 3CRRA 1VYHA 3DAOA 3ZTWA 3RQSA 3E0QA 4ETNA 5DBEX 3GF4A 3H8WA 5IG2A 1ORIA 4L74A 5L4SA 5LIRA 5FOVA 1UF9A 5IARA 1VE6A 5JJCA 1F1JA 2OCXA 2NU9A 2QN1A 1QRAA 2A35A 2QI9F 3I72A 4EHKA 4OO3A 1QQBA 1NATA 2PWBA 1SRRA 4MYRA 4ZHQF 2CKDA 2VT6A 1PS0A 3D6JA 3GJZA 4LOAA 2IS2A 2NXCA 2VA9A 2IJGX 4I1IA 1XTTA 4GX1A 3B51X 2ZRDA 2QLNA 4L95C 5GONF 3U8PA 4JA2A 3KTAA 4UOZA 1MQ8B 2ZWMA 4MCHA 4JY7A 1N5IA 2L6GA 2PMWB 4RPGA 4MW6A 4DDWA 4O4HB 4PAOA 1SU8A 1YS9A 1G0NA 3EEYA 2CV1A 4MV8A 1UCFA 3AB7A 1JDUA 2V6GA 2O23A 3PNKA 3NALA 3ZXSA 4UTZA 4YAIA 4W1RA 4XR9A 5KNDD 2W6JA 2O8DA 1EWVA 5I9IA 3UMSA 3LRTA 2WP0A 3HLTA 4X5OA 3N07A 2NU9B 3IP5A 3EVGA 4Z0NA 5A04A 4ZVOA 1ZL0A 2P41A 5IVIA 2GHTA 3BGIA 3A2NA 1TC1A 4DR5B 2Z8YM 4C4RA 5B36A 1GG5A 1Y1PA 3FW1A 1Q7CA 1DZ3A 3BDIA 2J4CA 2GK4A 5ERYA 4BVJA 2C58A 3RWMB 4WT7A 3HVHA 4NFLA 3HCAA 3TK0A 1PUIA 2UUAB 5DM1A 2BF4A 3VPFA 1R74A 2I80A 3QVSA 2J3DA 3G4ZA 3ZZTA 3GDFA 4B4WA 4OHXA 5C7IO 5LP6C 3I0ZA 4TV8A 2B2XA 3KTAB 3DD1A 1B76A 3IHUA 1HG1A 1I1NA 2IZ7A 3A6EA 2EBHX 1QIGA 5IDVA 4BMYA 4MHTA 4Z1MA 4E12A 3V4OA 3ZH9B 5KTSA 1MPTA 4G5XA 4N48A 1NDUA 3MRXA 2IHJA 3TZ6A 1CEEA 2VPYA 1EQ1A 3AW8A 5JV5A 4M22A 4NH4A 5B58T 1CNFA 3DKVA 4I19A 1S3FA 2OMKA 1KYQA 3THOA 3P45A 3CNQS 2O8DB 4ZOBA 3OE7A 3BMXA 4BP8A 4X3OA 3M9LA 1F7UA 4R1NA 3IPRA 5I9BA 1WSBA 3BXHA 2PV7A 2D2IA 3B52X 5MDHA 4LJYA 2GBIA 1GIAA 5I51A 2I0FA 4EUKA 1Y81A 3F9IA 1C0EA 1X0XA 3NAZA 4LI3X 4IICA 4O1MA 2XE7A 5KTPA 1Y9ZA 1U2PA 1AZTA 1T9GS 4MLZA 2OO3A 3QVOA 4HAYA 2WU4A 1HT3A 2WU8A 3KFLA 4BBZA 4GICA 1C7FA 4DQKA 1FSZA 4EHDA 2I6TA 5CIVA 4NZZA 4R84A 1R16A 2F1HA 4TV8B 3HBJA 3BD9A 4GXQA 1BRTA 1ZH6A 2ZM6B 3DSRA 4G0OA 4BFCA 1VJTA 5EIEA 1A9SA 4YL1A 1Y1TA 2WF9A 1EFVA 5K8TA 3VGJA 1TRKA 3W1VA 3NOVA 2QRJA 5EJ5A 2H16A 1D1QA 2PUTA 3LUDA 5L3VA 2B30A 1V37A 3RUIA 4MVWA 1DWPA 1I24A 4L2IA 3U5SA 1XZFA 3B1XA 3WL5A 5THQA 5AM4A 4B31A 1RHUA 1GVHA 1HQKA 1QKJA 2AJBA 1E1KA 1L1EA 4JH0A 2A5LA 2GTPA 4C0JA 2BF7A 3QFCA 4XYBA 1NBHA 3MX3A 5IYZA 2AZDA 4BLRA 4DRHB 2XVYA 1TECE 1ETHA 2J41A 2PD3A 4HYEA 4FEGA 4CTMA 2C2YA 2VCYA 3RRZA 4C29A 4H1HA 4K6GA 5C3UA 3WTCA 3KPVA 4C3EA 2GHRA 2XGSA 2NUAA 4YMHA 3WS7A 4RJJA 1L3IA 4K1XA 4M37A 4GKKB 2RK6A 5CXQA 1FFAA 3HC7A 3WDLA 4YUWA 3U4IA 4YRJA 4W8KA 3RGWS 1LK7A 3MWEA 2RBEA 2GYVA 1THZA 4BEWA 2XCOA 1UPUA 1Y4ZA 5CJ2A 4HEA6 3PNPA 4WZAE 1IJKA 3PVCA 5FEMA 2R8PA 3CLTC 2YDXA 4QPJC 1CPRA 4BNKA 1L7XA 2ETVA 1FXWF 1OBFO 4UZFA 4TSFA 4YUZA 3DL0A 3EF1A 4W1QA 1EFVB 5JO0A 2OBYA 1J33A 4EGFA 1JS1X 1EB8A 1UQTA 1MNAA 1VL1A 1UBFA 1QQ7A 4L5IA 4RGQA 4L2IB 3I1IA 4JKIA 4LXHA 1C30A 2X4LA 2PBRA 1OZAA 1DKUA 4IH1A 3L7OA 2QD2A 4NBRA 4YR7A 4CX9A 4A91A 5BVGA 2C3MA 2FMKA 3FMFA 2H52A 3H5VA 5KVCA 1E77A 2BZSA 2JGRA 4BGIA 4LCEA 2AJCA 3V32A 2UZAA 5ESWA 2ZAOA 3FYTA 4Y0VA 3RUDA 4V3CA 1YA7O 4YMUA 2OAEA 4Y6OA 3IPYA 1ZH2A 3GNTA 4MW1A 2XR1A 1NQWA 1Z6QA 1XU7A 4N01A 4KSCA 2NUAB 1J99A 4PIMA 3A1UA 1H2XA 3FGPA 4BAZA 3GRYA 2AMYA 2FY8A 3T7IA 4LDRA 4AYTA 4IJUA 4KI2A 1YFLA 2FPSA 3PNYA 3MWEB 2C3OA 3IQCA 2YYZA 3U4QA 3K92A 5I7WA 3PKJA 2IHKA 2BM0A 4DLNA 2OVBA 2ZAMA 4QUJA 1SCJA 3N39C 2AX4A 4QI0A 1M74A 3AM1A 5EIBC 1GQOA 1MX3A 3IERA 2YUTA 1P9LA 5U9CA 3I4CA 3RVBA 5BQGA 3NM6B 1AUQA 1P61B 3A0UA 3NDPA 3UC9A 4BFXA 1CZUA 1L6RA 1UIRA 3BXGA 3AUYA 5EWJA 3QUCA 1GD1O 5E6RA 2VATA 1VSTA 1V7PC 1AQJA 3MBGA 1XZLA 1C30B 3NP7A 1ZRHA 1SK8A 1U4OA 4ZCLA 4YRSA 5BVGB 2FQXA 4ZALA 3SXKA 4MA4A 1TU0A 1LB1B 1O5TA 1JIVA 5EPUA 3UT5B 4XLPF 4QXMA 4K0KB 4YJ2A 5F7JA 4QQRA 1ULBA 16PKA 1ZK4A 4DMCA 3R7FA 3IHTA 1H9GA 3CLHA 2ES4A 3L8HA 1QYWA 1N92A 3HDVA 3ZU5A 4HZUA 1TZKA 2JJYA 4TMTA 4K5QA 4LF8B 3W06A 5LCXA 3A4LA 5JBQA 3VHRA 1PFUA 4Y6PA 3V5YA 1MAHA 1V7QA 1ZH4A 2FAXA 5EHQA 2FGYA 1S3IA 4DGSA 4IWXA 3UK1A 2VH2A 2JGFA 1A7AA 2GBGA 4HMQA 5JLAA 3KTFA 4RAOA 3UB4A 4BRUA 4YT2A 2BN4A 5EWJB 4KQCA 4I99A 5E6RB 4C08A 2ZJBA 4F6RA 5A5FA 3DA8A 1V4VA 3P0FA 3QEOA 2IWHA 1EA8A 3KCNA 3KRTA 3HB9A 4FGWA 5B3SC 3QEAZ 2HT1A 1XAJA 1TFOB 4ZO7A 1E9RA 2B5OA 5JDIC 2CLKB 1WP4A 3KKMA 3Q3IA 2IKSA 3PXAA 3W2VA 4CODB 3JWEA 3QUAA 2Q3BA 1R66A 2BEKA 1AURA 1SIUA 3SZMA 1ISJA 1C4XA 2W58A 3NO4A 1F4VA 4MUYA 3A1EA 1Q1NA 4R32A 4YJ2B 3TVDA 4RXTA 1O97C 3F7TA 1MH9A 1XVAA 2YQZA 2FSSA 1N3LA 3PQ3A 4QGGA 4BXOA 1A9ZA 4RIEA 2DAPA 3D3WA 4C0XA 2R4QA 3BL6A 2OCKA 1PR6A 2X3YA 5DP2A 2PSHA 1UKBA 1B15A 4ZHSA 4N0EA 1K5PA 4JNCA 3JQPA 1ADJA 4INOA 1ZMOA 4HZUB 4RTPA 1YZ3A 5LDGA 2PGXA 3TNJA 1JWLA 4RH0A 1NFQA 1K7YA 4F3NA 3P9RA 3F3MA 4ZHQA 2V0CA 4KXVA 2OFFA 4PWYA 2GZMA 1NVAA 1RAEA 2EATA 4ZREA 2HJRA 2TSYB 3OQHA 3ZE2B 4P82A 2FZGA 1SR2A 3WNCA 1XZDA 1T0IA 3U81A 4E1AA 4F6RB 1DXHA 1DKPA 3QVMA 3GZTB 4LMRA 1FNTc 1VZ2A 4E5KA 3TOZA 1WQ4A 3OHSX 2DUWA 3G1WA 4YXFA 2AWCA 3RVPA 1NQTA 1Q7RA 4QGAA 4BQNA 4HE8D 1ZIOA 2V7WA 3MGAA 2Q2NA 3C8GA 3K9HA 3TRHA 4JB0A 1UBRS 2H5JA 2RARA 5I9LA 3A7EA 1JTEA 5I5EA 1ZJZA 4ESOA 3C85A 4BXOB 3D3WB 1Q1EA 2IYOA 1LVHA 3P2EA 3LCVB 3NHPA 3L7DA 3OVMA 4GFDA 3QPUA 1RD4A 3T4EA 2PWAA 3RBZA 5A5GA 3LNCA 3F9RA 1EMDA 2O06A 3WQSB 2WHQA 5EGYA 1YSCA 4R83A 1DJOA 2C20A 3PPWA 1JR3D 5C34B 3O38A 3JD4A 4F91B 2QUAA 1DAOA 5K0BA 4KTTE 2YLGA 1YR9A 5F52A 3JAWA 4ROTA 2C1EA 4PS1A 1NM5C 2FSVA 2H18A 5A05A 2IBTA 4ZHQB 3PLNA 3HFJA 5A03A 4R1SA 1Z6PA 3AW9A 1CQXA 1YCHA 2WF6A 4BO3A 5C4GB 1WRBA 1LE4A 4GI2A 3OCXA 1VLTA 1YS1X 1Q0DA 2RI1A 3AI2A 4CJXA 3TZQA 5CDSA 4KN8A 3GFRA 4JP2A 3DFUA 5GONB 5JS8A 1NXTA 2J3HA 4UAGA 2JZCA 4FT2A 2QB5A 2DECA 2XVAA 4XM0A 2JCXA 2FQWA 2BONA 4C22A 3RSSA 4GLJA 3C8GB 1SMYF 5EJ4A 3DFIA 5C9ZA 2HUJA 1MABA 2O8EB 5A6AA 2V98A 4QOHA 4S1OA 3EGOA 3QVLA 1F3OA 2X9GA 5B7GA 2CYAA 4JUIA 1DOWA 4CN8A 2PRYA 1UKCA 4CDAA 2PJRA 4LBWA 3C8ZA 3SHFA 1UL1X 3MWJA 4F6LA 5LP6F 1ZD5A 4TN5A 1BQEA 1DFIA 2DVMA 7ABPA 2OYRA 1ZXXA 2K6GA 2PRZA 1NVVQ 3JAWB 4KVAA 2W9XA 2CYCA 3KT0A 2DQSA 4QQ8A 3EZ9A 1COWD 4G3XA 2Z1DA 5EJ6A 1Z35A 2FZCA 4FX2A 1WVMA 1EKYA 4GLBA 4TL7A 5ITSA 1IN4A 2WWYA 2HWYA 1W0KA 5KYTA 4JENA 1BOFA 3A32A 3A2KA 3K94A 2GPSA 3EVTA 3AJMA 2FA9A 1NXPA 3ZJ4A 5DLJA 1H6DA 1RWOA 4ZYZA 4F4JA 1RWMA 5LOVA 2QTFA 3EZXA 4ILEA 2XQJA 1KORA 3B9BA 3NOOA 1BNCA 4UPVA 1FP4A 2AKAB 1PQYA 3L9XA 1GNRA 3O7MA 4Z1OA 5F5HA 3EZNA 1CNEA 3OA1A 1ZJJA 2P5TB 1S2IA 5DW0A 3UKOA 5JAIA 3IEKA 3Q0IA 1JBKA 1MABB 2WFLA 1YZGA 5B7QA 1N9GA 3QP9A 4N1AA 1CT9A 2VP2A 3MJFA 3BSWA 4NF2A 1KQOA 2ZIZA 2XDYA 1LPBB 1DBQA 3EIWA 3PDIA 5L3RA 3PC4A 1H3FA 3NCTA 3QENA 1JSLA 4H1TA 4YH1A 1E9FA 2ONJA 2I1VB 3L1JA 1ORJA 3TOLA 3DM5A 1LLCA 4WE3A 4LXYA 3AM5A 3LTEA 1NLUA 2Z08A 1QBKC 2GN8A 4FJ2A 5E1MA 2D5AA 4BP3A 4LX8A 1UJMA 4RU1A 3CSKA 4YCSA 4UM5A 4C3ZA 3DLPX 1KIAA 2XUOA 1Y1QA 4NVRA 4C7BA 1OH7A 4C20A 3RS4A 3EA0A 4BVHA 4US0R 2UXDB 1SN7A 2XYHA 1G2IA 3F1KA 3OJEA 2ZJ6A 1S9DA 3QLUA 4RFSA 1W4RA 2PFDA 4ZT7A 4DJDC 4L7QA 1S3SA 1GHTA 2GEKA 2BEUA 5JNRA 1R0YA 5DN6A 1TD9A 1PUJA 4KFCA 4ECAA 4D9FA 3ORFA 4DJAA 2D74A 1FXWA 2GBPA 5HPYB 4CQLA 1CV2A 2TMVP 3ZV6A 2H8KA 4W8OA 4V1CI 2GPTA 1K06A 1QHXA 1XTBA 2YVLA 2EJBA 1V54C 3I6MA 4FMCF 2MIIA 5KQMA 5FA8A 1CDEA 4JCHA 2DWUA 1WKCA 1KVSA 5E8RA 4BDSA 5BSKA 4X63A 2DGJA 1N9GB 3TQOA 1IULA 5FCDA 3MD9A 5KTRA 3PDIB 1UKZA 2NX2A 1Z17A 3EPJA 5JLIA 2HCRA 1WG8A 1DQNA 2ORWA 4M76B 2I65A 1SGWA 3NASA 3ZUPA 3EVFA 2J85A 3ICVA 1F6DA 3G5AA 1X7WA 3RQFA 2BFBA 1VBFA 2PJUA 1J56A 4I5EA 5HXAA 5IK2A 4UTNA 5IASA 3HJHA 2JLWA 3DTNA 5L0CA 1MW9X 2REXB 2OGSA 1K63A 4NCQA 1BS1A 1Y1LA 3A25A 4LOIA 4DVJA 3FNRA 2F3PA 1IRXA 1DQZA 4V0RA 1VLQA 5A5DA 3K09A 1PD0A 5TXGA 5GP1A 2WWGA 4GZ6A 3COYA 3GNQA 1P17A 5BWLA 4LV6A 2WAMA 4RFSB 1WXIA 5T64A 3HXPA 3EMBA 2BEUB 3GFBA 2IY8A 4CTNA 3ZYCA 5LZ9A 4QT0A 3B60A 3QU5A 1ZRMA 4FN5A 5AWFC 4CQLB 3BD8A 3T3EA 1KO5A 3CX6A 5E3JA 2I87A 5FOXA 3EWIA 3UWMA 5A9TA 2JJ1D 4TRNA 5FUMA 3KYCA 2J9UA 2C2XA 5LXTF 1WGWA 1KFKB 3PJRA 4DG9A 1BMFD 3H2SA 1NY6A 3PZRA 3RFCA 4EWLA 1U3CA 3QHPA 4FMDF 4OHRA 4PWZA 3MIIA 2VDWA 4JIGA 2VHVA 2NQ8A 4W5TA 1O6BA 2CJFA 3PE4A