1FTSA

Signal recognition particle receptor from e. coli
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
295
structure length
295
Chain Sequence
RSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FTSY
publication title Crystal structure of the NG domain from the signal-recognition particle receptor FtsY.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signal recognition particle receptor
total genus 106
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 1996-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1ftsA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ftsA02
3TQCA 1QF9A 1KI6A 1GSIA 4O25A 2ZS9A 3FHTA 1SVWA 2VP0A 1FUUA 4NMMA 3HP1A 4C0HA 5EZ5A 5CB8A 2J0UA 3R8CA 2O0JA 4NYJQ 1GNPA 1M1YE 4BFTA 4RZXA 2O5VA 5HKKD 1OH6A 1F2TB 4IEIA 3WNDA 1Q0UA 4B3XA 3FPAA 3QKSA 1Z07A 1YHNA 2E9SA 1KI8A 1G6OA 1W5SA 1Z0IA 3K0FB 5J4YA 4HB0A 3DZDA 1S4QA 3AVQA 3F8TA 3U2QA 1U0LA 4JT2A 3W8RA 3MJRA 1CJUC 5C46F 4FWTA 1G18A 3NKVA 5JS8A 1F48A 4CT5A 3QBTA 1G3UA 1R4AA 2WOOA 4LDJA 2R6CA 3SHFA 4JVNA 3L43A 1W44A 1XDBA 2XZOA 3EC1A 1JPJA 3WRYC 2C8VA 2IK8A 2ZPTX 1JR3E 3AVPA 1DAIA 3GJXC 4EKDA 4J0QA 3IQWA 3OEEA 3PR1A 3WP1B 3FFBA 2I1VB 2ZRNA 4U00A 4X8HA 3P20A 1ZD9A 4F91B 2QTFA 4C0LA 4Z54A 1D9XA 1S0UA 2B7BA 1E1RD 1J7KA 3U44B 2P5SA 2YWGA 1GVNB 2R65A 3LBNA 4HAUA 1FTSA 3AF0A 4S2EA 3EXAA 3DM9B 1BMFA 2WSSD 1E2PA 2ZRKA 3E2IA 2GK6A 3Q3JB 4NZYA 1JPNA 3PQCA 2JGNA 2A5GA 1R6BX 1SKYB 1RRPA 2AN9A 3C5CA 1Z2AA 1J8MF 1XJCA 4RD4A 3VU9A 4KITB 1SHKA 1GG2A 2X8AA 2JLWA 1GTVA 2HJGA 4IVQA 3DZ8A 4FINA 1E2FA 2KI5A 3NG1A 1I4LD 1VYVA 1KJWA 3E5HA 1MO4A 1JQJC 1NNEA 1A2KC 3BERA 3NIBA 1X8LA 4MKHA 4TYPA 4UXIA 4LJ4A 5E7JA 4L9SA 4P3YA 3U3RA 1ZM4A 1WA5A 1WXQA 2XXAA 1N6LA 4A82A 1ZP6A 1G4AE 1P5ZB 1Z06A 2QSZA 3ADKA 3GLFE 3VHLB 4IDOA 2C5LA 1XU4A 4IVPA 2ZJBA 3W34A 1I4DD 2NO1A 3NH6A 2Q3FA 2QG6A 4TLEA 5SZHB 4OHZA 1NVWQ 4LPSA 2WWFA 4Q4JB 1Q1ZA 4DCSA 3PG5A 1W4CA 1Z0FA 3ZZ0A 2REXB 4O0MA 1CJKC 1GL7A 2GF0A 4WA7A 2RCNA 3FMIA 1T5IA 2OBNA 4ZIRB 2EU8A 1LS1A 3ZVMA 1KI1A 5FPTA 1O87A 5EP2A 5FR2A 1NY5A 3EPLA 4IKEA 5FFMA 1IY1A 3K9HA 1FX0B 1WQ1R 1S2MA 3K70B 2Q6TA 4KHZA 2UZ3A 4JLOA 1WBBA 5DI9A 2BMFA 3GLHA 4DIEA 1KK0A 4B2IA 2OM2A 1E2GA 4R7ZA 5DSZA 2F1IA 3BB1A 2IWRA 4BWYA 3SR0A 5KO2A 2R2AA 1N5JA 2R9VA 2ZUBA 2OBMA 3X1ZA 1W0JD 4MKIA 1IN6A 8OHMA 3TMKA 4DLXA 4R2HA 1TU4A 1Z22A 2VP6A 3DDCA 3NH9A 4ZI3A 1P2SA 1FQKA 1XMSA 4NH0A 4NONA 2FFAA 3R9XA 3IPXA 1NN1A 2WMNB 1XJ0A 3D31A 2AXPA 1H8EA 3N5CA 1I4TD 2IL1A 4B3CA 3I61A 3RC8A 2P65A 4HB2A 2XTMA 4DSUA 4B6FA 3BS4A 4LJ8A 1U2RA 1GFIA 3MMPA 4PQRA 4P4SA 1G1MA 1W2HA 3LX5A 2EQBA 3W3AA 4IDPA 1E4VA 1N5IA 3WRXC 4QM6A 1FNNA 3O47A 1IQPA 4UKDA 2ZI3A 4OHVA 2QPOA 2F55A 1ZCAA 4Q19A 2IF0A 3D6TB 5KSPA 4AY2A 2BV3A 4PAOA 2QPAA 3KQLA 1BIFA 4IDHA 1TF5A 5FBWB 1FPMA 5LB2A 1F6BA 4B6EA 3RWOA 4LYFA 4ARZA 3EPKA 1OIWA 4ZPXA 4ZCIA 3KQUA 4CEIB 4ZKEA 4OI1A 3MWLA 2OFOA 2QAGC 3AP2A 1HH4A 4L9WA 2GCOA 3KKPA 4AC9A 4KYUA 1L7VC 1JR3A 3R7WB 3QI2A 4C0SA 5FOTA 3GFOA 4ACBA 1XMJA 2CXXA 3HJNA 3TVDA 4XD7D 4EJSC 3EWSA 2B8TA 1S9HA 2Q3MA 4MRPA 5CK5A 4M2LA 3VFDA 3GLGB 2VF8A 2WWYA 4UNNA 1ZU5A 4Q7KA 3H1TA 4ZV4A 5DIFA 1Z0DA 1A7JA 2I1QA 3IIJA 2X1VA 4OHWA 1UADA 4OQLA 3WMFA 3ZDQA 5CK4A 1E3MA 1PUJA 2FPLA 1WB9A 1TNDA 4PPQA 1DAFA 1L8QA 2D74A 1G7SA 3LO5A 1KMQA 2RGNC 2JDIA 3BXZA 1M7BA 1NMZA 1W2GA 1Z28A 3CPEA 1E9CA 1P3JA 4A0RA 1OXUA 3KFVA 2CCGA 3D8BA 3B1XA 4FMDF 2PJZA 4JLMA 4PAMA 2F1JA 1ZD8A 4PC7A 4RSGA 1EX7A 4HLQB 3THOA 4BPBA 3P4XA 1ESNA 1YRAA 3ZQJA 2Y8EA 3MRSA 3ZIAA 1R0ZA 5J4VA 1E1QD 1BKDR 1DOAA 2DPXA 4XH9B 2WKPA 2FF7A 3IO5A 3PCRB 4KFUA 2JEOA 4TSFD 1W4BA 2OXRA 4BZXA 4URXR 1R5BA 4PPNA 4WIAA 3W8NA 2UKDA 2QMHA 1AKEA 1UEIA 1AN0A 4KLZA 4CYMA 5DN6D 1X8JA 3MUFA 5HKKA 3SYLA 5DLQC 5FUXA 2B8WA 1Z47A 4K46A 2R6FA 3KJGA 3FMFA 2NG1A 2XB4A 1Z63A 1RIFA 4I1UA 4M1TA 3C4JA 2GJKA 2RGGA 2W0MA 1TQDA 2IXFA 3EZFA 5FUYA 1E2DA 1CU1A 1TF2A 3QXXA 1W36B 1RYFA 1N6IA 2FDCA 2DCUA 2D06A 4Q1FA 4URYR 4MKGA 2PLRA 2Q9CA 1KY2A 2AR7A 2OCYC 4TN1A 1IAQA 5CJPA 4JBXA 4CEJB 4BFXA 2FNAA 3OAAA 3FWYA 4W5HA 4RFSA 2G9NA 3UK6A 2CJWB 5KU1A 1CEEA 3TUZC 1UJ2A 1RW4A 1VHTA 2FX3A 4DSTA 1KJYA 1M7GA 4PXAA 1Z6TA 4EUNA 5EQTA 1VTKA 1OW3B 2QAJA 1E1RA 1IJFA 3SBEA 4B34A 5LD2B 2ZUCA 5KDDA 1FOEB 2VQSA 3U4QA 2WSSA 3K1JA 3HWSA 4DHEA 5BN4A 3T06B 1PJRA 4Q03A 5GJBA 5F9HA 4B32A 5GVSA 1P4SA 3E1SA 4PTLA 2LWIA 3I73A 5CYPA 3WHKA 3K70D 4W7SA 4BFUA 4HUTA 5LDDC 2BC9A 4TLAA 5G41A 3RWMB 1W0KD 2YKGA 4BASA 1HTWA 3IO3A 1XF9A 1NJFA 2MMGA 4A6PA 4OHYA 1LVGA 1MR3F 3GJ0A 3REGA 4GFDA 5FBLB 2J0SA 1E2JA 2OFWA 2J1LA 4DLZA 1NN5A 2O8EA 3IUYA 1G7CA 3QY0A 2HCBA 4A15A 2JJ1D 1OFIA 1ZNWA 1R7RA 3QXHA 3THWA 2WPDD 1KI2A 1SKYE 3EIEA 1U8YA 1EG7A 4RZ3A 3GFPA 5J47A 4TL7A 4URUR 4Q1CA 4EFMA 3UMSA 1KSJA 4LV8B 1D8TA 4II7A 1ZNYA 2NGRA 2O8BA 2GVZC 3B1VA 4Y0VA 1DO2A 3K53A 3X1XA 2IX3A 4TQAA 5LB4A 2JLXA 2IS4A 4HAYA 4NYJR 5K8TA 3KXKA 4CF7A 3NBYC 5FBQB 3RC3A 4CGZA 2ZTSA 1OKKD 1FUKA 4CDGA 1HURA 3OIUA 5DGXA 3DKPA 4LRWA 4BEJA 4H9GA 4JLVA 3RSLA 3VR2A 5DO9A 3QUSA 5JLJA 4LHWA 2ANBA 1TQ2A 4A4DA 4HB4A 2LKDA 2PL3A 2YWEA 4I1SA 3U61B 1XB2A 1SXJA 1W49A 2YOHA 3AP1A 1GL6A 4LWZA 2PT7A 3ASYA 5B64A 3LD9A 3DOEA 2J5XA 3CB4A 1ONBA 2L0XA 2B21A 3QVUA 4POAA 5IRCD 2A9KA 4LJ7A 4Q7MB 4R2IA 4BUJA 1C1YA 4JJZA 2YV5A 2RGDA 2IYZA 2GF9A 3QXSA 4DEXA 4D4JA 3S1AA 4DCVA 1XD2A 5L3QA 1XEWY 4Q4AB 2ZJAA 5FI1B 1W7AA 2MMCA 3OF5A 4QRHA 3WBJA 1PLJA 1JAHA 2GCPA 3NC1C 3KTAB 4QOSA 3WNCA 1XTQA 1JJ7A 2F1RA 1GOTA 1HT2E 2W0SA 4C0BA 3AKCA 1G6HA 2C9OA 2D3WA 2CLCX 1BH2A 2OT3B 1QDEA 5BN3A 1YZKA 1E2NA 3VR5A 1K8RA 4JLKA 4Q66C 2V1UA 1XTIA 2BMJA 4D0NA 1KI3A 2EFCB 3O8RA 1HE8B 1XNJA 1W4AA 1X8KA 2F3TA 3AF1A 1P73A 4XVUA 3NC0C 4GT1A 4NKRA 2IUSA 2FSHA 3QVVA 2PH1A 3CM0A 2H5EA 4XWOA 4TYWA 2D2EA 3KB1A 3AGPA 3NHBA 2ZSBA 1DADA 2EVWX 1QHNA 2GEVA 2J3EA 3DKVA 2REBA 3AVUA 4OK6A 2KJQA 1F2TA 3PIRA 4MRNA 4TMVA 1FNMA 3VKWA 1XZPA 2JLUA 5H70A 1OFTA 1KZGB 2DR3A 2YZ2A 3CF2A 2QRNA 1R8QA 3CNNA 1S1CA 2YNMA 3K0FA 4XD7A 4LHXA 1EESA 3DMNA 4PHHA 5JI2E 1NY6A 5K8IA 3EC2A 1XXHB 2HUPA 2VP5A 3TR5A 1NSTA 3A1VA 3CONA 4WZAE 2O8DB 1W36D 2QTVB 3SS8A 1OH8A 2KBFA 2IBMA 4L5BA 4OQMA 4ZKDA 2ODWA 4OJKA 5E4FA 5HCIA 1G8HA 2ZAMA 3BB4A 2F7SA 2EFEB 3CO5A 3P32A 4MGYR 3REFA 5JHGB 2RHMA 4YMUA 2VA8A 4ZCMA 1XEXB 3RDPA 2CVFA 2W00A 3IEVA 1D5CA 1CJVC 2GTPA 1G4UR 3B5JA 1KDTA 4Z8XA 4ZCLA 1AS2A 4XWAA 1CIPA 4E09A 2A78A 1RPZA 4GL2A 5AUQA 2A30A 1AIPA 3EZ9A 5FTJA 1XJQA 3LLMA 3U44A 1HA3A 1MO3A 3K0AB 4P4UA 4DDTA 1E1QA 4PQFA 4DSOA 3JZAA 1IHUA 3DPUA 4DZZA 5EJEA 2FSFA 3K0CC 5GJWC 1NN0A 2JIZD 2AHOA 1XPRA 4XSGA 5FTKA 3V00A 2PX0A 2ZVPX 3CH5A 3VQTA 4B71A 2JLZA 1V5WA 5DN6A 5FOUA 1KY3A 4TLDA 1GDDA 4WXRA 2R6GA 1QVAA 1WRBA 3QPVA 4Z8YA 5FOSA 2ZI7A 1KGDA 2Z4RA 3AVTA 4KVGA 1LV7A 4MRVA 4AKHA 1ESMA 4JLJA 3SI7A 4B3DA 4Q21A 3PV0A 4OQXA 3NWJA 1N5LA 4G3XA 1VCNA 3IDQA 3T15A 2IYQA 1DO0A 1V43A 4AYTA 3X1DA 2QMUA 2QZ4A 4EPTA 2CHVA 2GZDA 4GP7A 3E70C 3B1ZA 2P67A 2SHKA 4PHFA 4C0QC 1U90A 2IYXA 1C4OA 4NTZA 1L4UA 2N1BA 3I1FA 4Q00A 4Z1MA 5JSZB 1ODFA 5B57C 3RAPR 4BECA 1VG0B 3BWDD 4TMZA 5DHAA 4Q4JA 5H68A 2FEOA 1E79D 2ZQ5A 3MFYA 5JWRA 4LYHA 3A6PC 2OFXA 2WJVA 4GSYA 3DVLA 2F43B 4PZZA 3RRNA 3WYAA 4FMBB 1E32A 3GJ4A 3U6KA 4LHZA 1IN5A 2XB2A 4ZIRA 2N42A 3X2SA 1E94E 3B60A 2CHQA 4DKXA 5JFGA 3KDSE 2CDNA 2NO0A 2XZPA 4FCWA 3QF7A 3FKSD 5ANRB 3DOFA 3WXMA 5GADl 1QG2A 4Q1AA 2ZI4A 1JEDA 3MWKA 2CLDX 4Q4HB 1AZSC 3AVYA 4LBWA 4DCTA 5HE8A 3G5UA 4MKFA 4OYHA 1B23P 821PA 2WIBA 4JT4A 1W0KA 3L0OA 1ZNZA 1JNYA 2ZR0A 1XMIA 4KODA 2ZRBA 3Q8XB 5L3SB 1EX6A 2AD1A 5HPYB 1UFQA 4A0FA 2QGNA 2ZJOA 4XTCS 2FN4A 5AJYA 2W2XA 4KBFA 1CBUA 3TQFA 4Q7JB 2REOA 1US8B 2F1HA 4MYCA 2JLVA 2ZRIA 1CS4C 3ND9A 1VYTA 1GKIA 2WZQA 1NVVQ 1WP9A 2PCJA 2WPDA 3RS7A 4MYHA 2C9CA 3U7EB 4F4IA 4BFVA 2IEYA 4JVMA 1BYIA 1G3MA 4MDEA 1R2QA 4IOLA 2QT0A 1D2MA 1R8SA 2ZAOA 3MGCA 3QEOA 2C04A 5DHFA 3IHLA 1N5KA 3GLHE 3T35A 4KLNA 1M34E 1KTVA 2GWHA 1P62B 2AKAB 3TUIC 5FPKA 4BQSA 3ICEA 2RGEA 3B82A 1X3SA 3SEAA 3I5YA 1FW6A 3H86A 3QENA 3IILA 1PUIA 1OKKA 3K9LA 3L0SA 3QQ5A 4RD6A 3NEJA 1BS1A 4JJKA 5G53C 2BKEA 4R71A 5FL3A 2D62A 2J59A 4A8JC 4DLVA 2V55B 2ZR7A 3FDIA 3MG9A 1Q3HA 2ZE7A 3GPLA 3ZIAD 1AS0A 3BIFA 1OHHA 4CEIA 1P9WA 1M2OB 5TY0A 4F93B 5F3WB 4JSYA 4P33A 1PLLA 1TADA 1ZINA 4M1OA 3TH5A 5KNDA 1XPOA 2HYIC 4A0HA 5JJLA 2ZI9A 4JIMA 4V0OA 3L0PA 2NPFA 3R7WA 4UNRA 5KPDA 3A1TA 2ZYWX 4X8LA 3OFND 1QG4A 1G16A 1E0SA 1F2UB 2GEUA 3AF3A 1TX4B 3FHOA 4GP6A 4FN5A 2JLRA 4R9UC 2ORVA 4QHTA 1E9FA 1KSGA 2HF8A 3GLGA 2IS1A 2EW1A 2XAUA 3CUEF 2Z4SA 2B7CA 2OUKA 3KJIA 1ZM3A 4LSGA 4UNQA 4HYYA 4O2RA 2D2FA 2NIPA 3KUDA 3HPRA 5JCZA 2AXNA 1YZGA 1N6OA 2IYUA 1G8PA 5EP4A 3TAHA 2PX3A 1RFLA 3HR7A 1Z2CA 3VKHA 4URVR 1ETUA 1FZQA 1CLUA 1S3GA 4RD2A 1KO8A 3EZ2A 3CRMA 1HE1C 1ZUHA 3MSXA 5SZJA 1NLZA 1TUIA 4GDFA 3ONWA 5AJZA 4C0KA 1ZC4A 1W1WA 3PEYA 3OAAD 4PO1A 4QBIA 1E99A 1N2CE 1K5GA 1R0XA 1EFRD 2A7QA 1RJ9B 4YMVA 4TYQA 4D26A 4JVLA 2FGKA 1N6PA 3TVTA 1Z8FA 3MAAC 1JR6A 3AF4A 3EZ6A 1IONA 1Y3AA 4TQUS 2VHTA 2QE7A 3Q7PA 2ZU6A 2DBYA 1N3BA 2ZU0C 4DLYA 2ZSEA 3VTKA 5KNCA 1ZJ6A 4O2LA 2ZRCA 3SJZA 2BJVA 4LBZA 1OB2A 2YWFA 2ZJ5A 4C7OB 4LC0A 3SNHA 2ZANA 2WWHA 1TPZA 3DHWC 3RS2A 3V4RA 2CE2X 3ZS9A 3BH7A 3T5GA 1Z6AA 2FJUA 1ZD1A 4QNMA 2FOLA 1YR8A 5KTYA 1Z5ZA 1G5TA 4NCKA 3H0KA 2ZITA 3Q5EA 2Z0MA 3LWNA 4DIDA 2BCJQ 2VP4A 2FPKA 4M1MA 5FI0B 4ZO4A 5JS7A 4CEJA 1U8AA 2WJJA 2ANCA 4JS0A 3CLVA 2GBLC 2VP9A 4ESVA 4KVAA 4FWIB 2CJWA 2QQ0A 4XTRA 4A2WA 3BAFA 4Q47A 3O8BA 4Q1EA 3U7FB 4OQFA 4FMDB 4DXAA 1KI9A 4EQ6B 2ZSDA 2EWVA 3BC1A 3I92A 2JIZA 4TTPA 4N0DA 4PC2A 4XVQA 3B7GA 4C2TA 5KSYA 3BE4A 1KIMA 4B73A 3ZH9B 2F3RA 3P26A 1GRNA 2GXQA 3VR3A 3PUVA 5A4JA 1T8TA 2QU8A 3QE0A 4HZIA 1RYHA 2E87A 2IYVA 3PFIA 4Q5IA 1NG9A 4FCTA 1GAJA 1KMHB 3CF0A 4QBHA 2IYSA 4LPKA 3SHWA 3T1TA 1T3LA 1WF3A 1SXJD 2HCJB 4QBGB 2ZJ8A 1MABB 1XTKA 5SZKB 1KO7A 3ND8A 4NE2A 3RS0A 4DLUA 1HT1E 3W3ZB 1JAIA 2HYDA 4CIDA 4L15A 1NMXA 2HXSA 1CTQA 4UXHA 5TARA 4RVCA 4YDSA 2ZE6A 2AKYA 2OEPA 2JLQA 3F3YA 3SN6A 3MJHA 1D9ZA 1E79A 4K8OA 4B3BA 1SGWA 2WKRA 1PZNA 3CIOA 5EP1A 5A5GA 3FMPB 3AGQA 2QN6A 5HTKA 3VNUA 2PLFA 3K9GA 4IVRA 4FW9A 2J9RA 3A58B 3MWYW 2NTYC 2PZFA 2V7QD 4M1KA 4MA4A 4A36A 1VCMA 2P5TB 1NG1A 2QROA 1R5OA 3Q7QA 4ABYA 2CL7X 4A9AA 4BEBA 3ICQB 1OXSC 1I2DA 1XWIA 4LHVA 1EXMA 1VIYA 2GXUA 3FKSA 1U99A 4EPRA 5KYKA 2FMXA 2IUTA 2MSCB 3CWZA 5FOVA 3OE7D 1KDOA 2C77A 1E9BA 2GJ8A 1LFDB 3KKQA 4G5SA 4XSHA 2R6DA 2RGAA 5B58C 3U7GA 2GEDA 3AF2A 5D3MB 3CWQA 2XX3A 1X86B 1W4RA 2GCNA 1G21E 4LJ5A 2CEAA 4MITA 3SQWA 4AI6A 5FOWA 2ZJYA 1WE2A 2GESA 2J7KA 5BQ5A 1KO1A 3EPHA 1EGAA 1DAEA 1SVKA 4DVGA 4AIIA 2VHQA 3ASZA 4XOIA 2NZJA 1F3OA 5JWOA 3D3QA 3LRPA 1VG9B 1QHSA 1XTJA 1A1VA 3TSOA 2IW3A 4Q4AA 1E9AA 4KFTA 2V9PA 4BRWA 2ZRPA 3HYRA 1HUQA 1KSFX 1Z0KA 2ZRAA 5A0FA 1JEEA 1NBMD 3TW4A 3VX3A 4B76A 4F7WA 3IEUA 4KFSA 4LJ9A 1II8B 3KTAA 4FD2A 2AFHE 1J2JA 3CNOA 4LYAA 1SXJE 3VR4A 3W5IA 5JWHA 4JVSB 2WJHA 2YHSA 4IFEA 3NTUA 2B92A 3EG5A 4GRAA 3I72A 4PZYA 2CL0X 3SJAA 1TL7C 2W83A 3AKDA 4LC1A 1HYQA 4ON9A 2G77B 3LAWA 3QJYA 2CHGA 2VBCA 3EX7C 1QHYA 3TJZA 2ZUDA 4HAWA 2RAPA 4LZZA 2OO7A 4XIGS 1GILA 2ODBA 1T3SA 1EK0A 3KJHA 4KSBA 2TMKA 2ODNA 1T0JB 2BVNA 5EE1A 3C15C 3OFNA 2Z83A 2QRZA 3SDZA 1VKJA 5EXPA 4M9XA 4B75A 3LVRE 3LY5A 4LJ6A 2ZYTX 4NYMQ 1SVIA 1XXHA 1Q12A 5EXXA 5CLLA 2O8DA 2QENA 3EAQA 2VO1A 3RABA 3NBFA 2BBWA 4YONB 4PR0A 2WM9B 3CRVA 4OL0A 2D7DA 1G3RA 1SQ5A 2WAXA 3FTQA 4C30A 4YXWD 2FSGA 5H1YA 4ERNA 2PCLA 1E0AA 1BO6A 2EFDB 3GJ3A 3M0EA 1E2HA 2WWGA 5JCPA 2QAGB 1YKSA 1OXTA 4Z1MD 3LLUA 4DWJA 2ZS7A 3PXGA 5TMPA 5E95A 3IIKA 3K0AA 3BH0A 2EYQA 1VYUA 5EE3A 3CPHA 4ITRC 3B1WA 1EFRA 4D4LA 4JBYA 2W6ID 2V6JA 1GZSA 4EJSB 1NBME 1SVMA 3A4MA 3EW9A 5DISB 5FPYA 2J87A 1IN7A 2CCKA 2ZRDA 2P0EA 4DDWA 2VSOA 2X77A 2XSZD 1KKLA 2NO9A 4GNKA 1KO5A 5IF9A 4JL5A 1NVUQ 2QQEA 2ATXA 4JYBA 4BLPA 1EFCA 1GRQA 1U9IA 2HT1A 1ELOA 4QGAA 4QGGA 1NVVR 2WAYA 3EZ7A 5L3VA 4U5XA 1OT3A 4CW7A 3U5ZB 1E2EA 5E7MA 4OI4A 4YDHB 4PC1A 4M9QA 2JJ8A 1FFHA 1JQLB 5DNYB 4Q9HA 1OFHA 5CLQA 2IS6A 1COWD 5BYKA 2ZEJA 4AKIA 2BBSA 3RRMA 5J4HA 1IOZA 2ERXA 4LHYA 3VAAA 1UDWA 3L82B 2WJIA 3EA5A 1MRSA 2PMDA 4F4JA 2CL6X 4PAQA 2DWPA 4NYIQ 5JSZA 4M0LA 1P9RA 1VG1A 3U3OA 4US1R 3UMFA 1AGRA 2OCBA 3PUYA 2F43A 1UM8A 4IOJA 5FTNA 4LYJA 3TNFA 4IOKA 1DAHA 3ADBA 1OIVA 1T8UA 3PEUA 4BRUA 1S96A 4ILEA 1SULA 4QXAA 1RRGA 1S1MA 1KHTA 4BFSA 4X8OA 1RRCA 2G83A 4PC6A 2HJVA 3RYTC 1KDRA 4XWKA 3QOFA 4JLPA 5B2ZA 3X1WA 3RNLA 5J4LA 1J90A 4Q4HA 3MWJA 4WXPA 2PEYA 4H1VA 1TTTA 1KKMA 4UQOA 4BFZA 1VG8A 1MT0A 5AUOB 4M53A 1XFAA 2C99A 3LH5A 4QGFA 5L3SA 1G19A 3AUYA 1E4YA 1C9KA 1YZNA 1Q1EA 1LF5A 1OHHD 5EE9A 2LKCA 2W6JA 3I4LA 1US8A 2WOJA 1E6CA 5KSOA 4JBWA 1OF1A 3HYTA 4QFMA 2XGJA 2O8FB 2Z43A 1TMKA 3L0IB 3ZS8A 4GBMA 2NO7A 5CM9C 4LCBA 1E2LA 4DUGD 4NDZA 5JRZA 4S35A 4B2PA 4KFRA 1D2NA 2VYFA 3VR1A 5FBVB 3M4YA 1IN4A 4L16A 2C96A 4RKEA 3TSWA 3GJ7A 5C4MA 2HT6A 1JXMA 3T1OA 1M6NA 2H18A 4HUQB 2OSBA 4HLCA 1KYIA 2V7QA 3UMRA 4HLDA 5IK2D 4PANA 5AUNB 1SKQA 1U0HC 1UKEA 3EPJA 4KCGA 2EFGA 4QM7A 5C4GB 3K09A 1E9RA 3KKNA 2BKUA 2K5UA 4BLSA 4QJ4A 4TYNA 4G5QA 2WMOB 1E9SA 1XEFA 5BXQC 1CKEA 2BMEA 2WWIA 3OE7A 2ZS8A 3EIHA 3AVXA 5DI3A 1MKYA 4F92B 1WMSA 1YZTA 1T3HA 4PC3A 1N25A 1XEWX 3TSZA 1QHHB 4DCUA 4U7DA 3WNBA 3LDAA 3A1SA 4AK9A 1UKYA 1KDPA 1W47A 1Z0JA 2QNRA 3GEHA 2IS2A 1XRJA 3H84A 4M1WA 2QM7A 3LA6A 1XCPA 1E2MA 4HLUA 3FGNA 2H57A 3RS3A 2QA5A 2QE7D 4M21A 2HF9A 1ZRHA 1HV8A 1F2UA 3AB3A 4LK2A 4Q9IA 3SYKA 4PO9A 1NRJB 1LW7A 2CK3A 4DDVA 1BYUA 3GP8A 2EYUA 3OIYA 3TR0A 4MYUA 5FPHA 3B9PA 1UF9A 1NBMA 1G7RA 3QBVA 3QPWA 3SBDA 1GITA 5EZ6B 2QSYA 4MUBA 1ZM2A 3FVQA 4M1SA 3AVWA 1G3IA 4M9ZA 4B47A 1ZCBA 3BK7A 1YR9A 4HI0E 5ELXA 4PSVA 4NCNA 4F38A 4A2QA 4QHSA 4CZ2A 4LBVA 1G17A 1QHIA 1DS6A 3GLFB 3O8CA 3KJEA 2GK7A 4G1UC 5BW8A 2KE5A 4JL6A 4I4LA 3ZQ6A 4MRSA 3QKRB 2GA8A 1RJ9A 2Q9BA 1JALA 4HDCA 1A4RA 2FPMA 3GQBA 4JL8A 4P4TA 4E07A 2VL7A 3GLGE 2P2LA 5JI3E 2OAP1 1XTSA 3U3JA 3W90A 5JRJA 4B43A 1OB5A 3LW7A 1MO6A 1IY2A 2PT5A 1R0WA 3ECCA 4HDOB 1GUAA 5FR1A 1KK3A 5FTMA 2ZRGA 2IHBA 1TQ6A 4JLNA 2VEDA 1U98A 2RGCA 2H92A 4M22A 2J0QA 3QG1A 1K6MA 4QKQA 3U3MA 3PVSA 4C7OA 4TTRA 2Z5FA 1M7HA 5B30A 1VHLA 2AK3A 1OJLA 1RZ3A 4RFSB 1SXJC 1ZIPA 3CPJB 5E7IA 4YMTA 1CP2A 2PEZA 4V02A 4ZDWA 2B6HA 4HZUB 4D81A 1YZQA 4JZKA 5HCNA 5C1BA 1TU3A 4OI2A 4YXWA 3ADCA 2A3RA 1U94A 4OBEA 2HV8A 2ZSFA 2G0TA 1IJEA 3AKYA 1OSNA 2ZI5A 1CRPA 4TL9A 2ZRLA 4LI0A 4QJ5A 2I4IA 1RVDA 1DAGA 1G8YA 1A5TA 2X19A 4EQ6A 2OLJA 2FE4A 2JATA 2QL6A 3BRWD 1SHZA 3A4NA 5GJCA 5AUPB 2W6IA 1CF4A 4GPTA 4JLAA 4DB2A 2R62A 1Q20A 5FBRB 3V4FA 4B3FX 3QKTA 1L2TA 3PEWA 3K09C 3ZJYA 1R10A 2XSZA 1VCIA 3QKUA 4B35A 4B33A 3GJ6A 2GILA 1Z08A 2ZRJA 2IT1A 3NBZC 1FX0A 5FUVA 4BLRA 2OE2A 3FHCB 4RD1A 4V0KA 2PZEA 5G3ZA 3W6OA 2VTKA 1KMHA 3KKOA 1MRNA 2V54A 3LBHA 3SOPA 1E9EA 1COWA 2D7CA 1U8ZA 2VHCA 4YMSA 1MABA 2W2VA 1OE0A 2PJRA 3FE2A 1GL9B 1DG3A 4TZ0A 3PITA 4OK3A 2ORIA 3SJCA 5AWFC 4TZ6A 3RRZA 3AM1A 1P9NA 3H2YA 3P1JA 1FP7A 4QC2A 5CIQA 3SE0A 1AQYA 4EPVA 1WDTA 2ZIAA 2IYLD 3KXLA 4B48A 3RVBA 2FEMA 4GZLA 4HB3A 4A1FA 1G291 3K0EA 1R5NA 1E2IA 4GMXA 4DB4A 1Q44A 5IHPA 4WOPA 4HATA 1AA9A 1E9DA 5DYIA 3TRFA 1FQJA 2DB3A 4G5GA 2AK2A 2BDTA 2BIFA 2GJSA 2BWJA 2J0VA 2RH5A 3QSYA 1T5LA 2QBYB 1TQ4A 2XNSA 3I8SA 1QZXA 3FFAA 5JECA 4TL6A 1UPTA 4FMCF 4UJ5A 1FL9A 3A4LA 1M8PA 3KQNA 1ZW6A 1WBDA 2WJYA 2P6RA 2JASA 4D80A 1X6VA 5FUWA 3PEVA 2CLSA 4HSEA 5D3MA 1D2EA 3X1YA 3NXSA 3C5HA 1KK1A 4Y0AA 3EIQA 1UBEA 3FKQA 4NYMR 3VR6A 3S1AB 3WBKA 4ESHA 4NBSA 3L2OB 3OIVA 4C3ZA 4US2R 4E5UA 5AR1A 1OXVA 5TVKA 5TXGA 2VP2A 1LY1A 1DTSA 3F5FA 3LXXA 4Q01A 3QPUA 4O3MA 1GKYA 1E0KA 2WIAA 3CKLA 4C2UA 4OKSA 2FFQA 3GCGA 4Q4LA 3LW8A 4M9SA 2HLDA 1N0VC 3SU8A 4V0LA 2XJ4A 1UDXA 4DUGA 4NP6A 2NOAA 3IKJA 3CX8A 3QXJA 4I1OA 2AX4A 2KB0A 3ZVNA 1VMAA 4RKFA 2OCAA 5IDVA 3ZGXA 2JA1A 3U3KA 2ASEA 1X1RA 4QNRA 5CIWA 1Z83A 4PX9A 1IXRC 1II8A 4TWZA 4OI0A 2FSIA 4PSKA 4JMPA 1XTRA 4Q1DA 3KQHA 3SQXA 5IK2A 1TF7A 4D25A 4GI7A 2OG2A 1AQUA 4M1YA 1JI0A 2OZEA 3NEYA 4KU4A 1QBKC 5H8WA 5KUTA 2F9LA 2J46A 4KSCA 2BCGY 3JVVA 4W9MC 2V3CC 1ZUNB 3Q9LA 1XCMA 4CT4B 4I1VA 4QL3A 2XITA 3UPUA 3PJRA 4B74A 2DHRA 3CX6A 1YE8A 1GNQA 1NN3A 2A2ZA 2UVQA 4RD3A 3PUZA 4GMDA 2GXSA 5DYGA 4H1UA 3AV0B 2PZGA 2VHUA 3ZD6A 3CRRA 1T9HA 5CDFE 3KUCA 3OZXA 5C18A 4WBSA 2WJGA 3B85A 2C98A 1J99A 3G82C 4AKEA 2ZE8A 1E96A 4NYIR 3WYFA 4BZPA 4LOAA 3K70C 2OLKA 3Q72A 1KI7A 3THXB 5TB5A 2J7PA 2RGBA 4KBGA 2JLYA 1J70A 2DFNA 2MSEB 2X2FA 2FH5B 2FWRA 4FXPA 4IW3B 1BOFA 4BLOA 3WHLA 4AG6A 5JEDA 2V8OA 3T34A 4A8JB 4TT3A 2JCSA 5JMTA 4D4KA 4PHTA 4P31A 3R9IA 1OFUX 4G5OA 3K8YA 4HAXA 2QY9A 2QAGA 3DL0A 5E3HA 2QTHA 3C14C 1ANKA 3R8FA 2CCJA 2WTUA 4DT1B 1P7CA 1IXSB 1NL3A 3NBXX 2GAOA 4D6PA 1VPLA 4DLWA 4C0AC 1KOFA 4EJSA 3THYB 2BBTA 3BJIC 3A36A 1DARA 2XNDD 1XXHE 2WKQA 3TIFA 4RZ2A 1G64A 3L8YA 4CRWB 3FYHA 1NI3A 3LFUA 1SVSA 1Q21A 4D0LB 3OESA 5CB6A 4IFBA 1NVXQ 4UJ3A 5EE0A 1PVOA 2ZI6A 5FPSA 1JBKA 2YVUA 3CR8A 1CJTC 1Z0AA 4KXFB 2ATVA 4DCNA 4WW0A 5AJXA 2RGNA 2QT1A 3ZVLA 1S3SA 1TUEA 3TW8B 3ZZTA 2RKOA 4BE7B 4EPWA 1NLFA 4C9BA 2IYWA 4LJAA 4URWR 1ZAKA 5KPJA 3B1YA 2VIIA 4RZUA 4AYXA 1P72A 4W5WA 3M1IA 4U02A 4XVRA 2JJ2A 3N70A 4A2PA 2ECKA 4MRRA 4BZQA 5JJIA 2QI9C 3IHWA 3QF4B 4MYTA 3RRYA 3QNUA 3SFZA 1Z29A 621PA 3ZD7A 2OBLA 2FU5C 2W6JD 3WY9A 5IT5A 2DYKA 2GJAA 3LNCA 1II9A 3RANA 3TBKA 3W6PA 3UKDA 4TMWA 1XD9A 3A1WA 2PBRA 4G0NA 4LBYA 3Q85A 3WMEA 5L8VA 4JYCA 5D3QA 2CMKA 1Q22A 1YU9A 2YWHA 2XJ9A 2J45A 2EWWA 5G3YA 4AURA 2N46A 5HR5A 2ZVQX 4ASUD 5JJKA 3UWOA 1U0JA 3JZMA 4AYWA 3RS4A 3GLIB 5J5CA 1NLYA 3FOZA 3G0HA 4AG5A 1L4YA 2HDNB 2OXCA 5EP3A 2YOFA 4PSAA 4DSNA 2ONKA 1AGPA 1M74A 5K8UA 5F9FA 4EDHA 1N6RA 1Z6XA 5EE5B 4E03A 2ERYA 3CH4B 1QHXA 4RD0A 1SZPA 4PPGA 4D2IA 1ZNXA 4MQBA 1XMVA 3ZVRA 1NF3A 2A5DA 2ZREA 2QP3A 1XBTA 4CEHB 3SZRA 2O8CB 2HEIA 3IBYA 1UBFA 5JBQA 2XZLA 3IIMA 2A5FA 3CW2A 2XOKD 2VSXA 3BFXA 4OQNA 3Q5DA 2ORWA 3FMOB 2W58A 2O8FA 3JVUA 1ZM9A 1IY0A 2OAQ1 3HU1A 4K81B 2C9YA 1HY3A 3GEIA 3B9QA 1UBCA 4YQFA 1OV4A 2NO6A 4GZMA 2CK3D 4L8GA 4YMWA 3GMTA 4NU0A 2ONJA 5CITA 3T61A 1JB1A 3CRQA 4HUQA 2RMKA 2WSMA 2IA5A 5L3RA 4RCZA 2CNWD 5CDFA 3KFXA 1KAGA 4LUCA 1P60A 3KL4A 2FZ4A 4WZ6A 1W36C 3VNVA 4TQ9A 3CBQA 1KI6B 2E1RA 4CVNA 721PA 3IBGA 1X1SA 1E0JA 2QORA 1J8YF 1NMYA 3CR7A 1B0UA 5EXSA 1WCV1 3C16C 4LV6A 4B2LA 4NHOA 1T4GA 2J0UB 1W48A 1TAGA 2QEQA 4P32A 5J4KA 3NDBB 1H65A 2QP4A 3AH8A 2AFIE 4G5RA 4LJYA 1QHHA 4BLQA 1S8FA 3CZPA 3TLXA 3T5DA 4QBFA 1DAMA 3AQ4A 3QKSB 2C2HA 4R98A 2DFTA 5LD2C 3PUWA 4IOMA 4TYYA 3ZYCA 5EUMA 1GP2A 3UG6A 1AM4D 2WBLC 2MSDB 1EFHA 1QHGA 5HZKA 4MGZR 1KNQA 2FGJA 3RLFA 2ZR9A 2QMEA 3C7KA 1WGWA 1OXXK 2P6NA 2C78A 4US0R 2GZHA 2FA9A 1QRAA 4PPFA 1AJEA 1LNZA 5UKDA 3HPQA 2CE7A 2OILA 2G3YA 3BH6A 2BJWA 4JLBA 1KI4A 2ODEA 4E22A 2Q3HA 5JEEA 2H7VA 4HEJA 3T12A 2BHRA 1II0A 1G7TA 3MLEA 5DE3A 5KDLA 1RE0A 4EFNA 2H16A 2RGXA 2XEXA 1N6NA 3R20A 4X8MA 2NQ2C 4IHQA 1G8FA 1VECA 4IXMA 3CZQA 3LX8A 2GZAA 3WYGA 1JJVA 1XX6A 221PA 3EA0A 3GLFA 1UEJA 1XEXA 4RY2A 4KO8A 5KSZA 5KOYA 1VCOA 2KWIA 2GXAA 1D6JA 4BLTA 4DRZA 2WWXA 3AUXA 1EWRA 3QKRA 1LB1B 4YC7A 1HQYE 3EWAA 3TE6A 2LCFA 4TMTA 2IYRA 4IXNA 2C95A 2HXYA 2AWNA 3VU9B 3C41J 5AK0A 1PLKA 1H8HD 3GJ5A 1MV5A 4PO8A 1P75A 1Q1BA 4V0ME 2QPTA 1W5TA 3IGFA 1K5DA 2G6BA 1IN8A 3OEHD 2J41A 2C03A 3UWKA 4ZI2A 1P2VA 4NPHA 1O3YA 2XTNA 3TK1A 3UIEA 2V6IA 3GD7A 1E69A 4QHYA 2W2TA 2Q0HA 5CM8B 4D82A 3F0TA 2XXAB 1Z6GA 4GOJA 3W9YA 1N6KA 4MH0R 5LBIA 1KO4A 1KK2A 4P0TA 3D7MA 2IYYA 3R9WA 4ZDIA 1F5NA 2WV9A 3T1QA 3NHAA 3RSOA 4HZUA 4ZDJA 1FTNA 2FG5A 4BGDA 1ZC3A 2UZIR 2VRWA 1ZU4A 3BOSA 3U60B 1IBRA 4BFYA 2H17A 5CJ2A 1Q1QA 3QXCA 2FFHA 2AWOA 1UAAA 4AKGA 1FMLA 4FCVA 3UANA 3B2EA 4KJZA 4RFVA 4LGMA 1MO5A 3C8UA 3I3SR 2P6UA 2VSFA 3I5XA 1YRBA 3GLHB 2G0NA 2ZETA 2XNDA 2BEJA 3W6NA 3VKGA 3O8DA 1I2MA 1YZUA 1DBSA 4HAVA 4IRUB 5FL7D 4AD8A 2YOGA 1Y63A 3N2IA 3UG7A 1LTQA 2R44A 2VH5R 3T1VA 4NL4H 1E98A 4IJMA 1SVOA 4A92A 4MGIR 3W5JA 3U7HB 2V1XA 2GJ9A 1GRRA 3SFVA 3AP3A 4NCHA 4B44A 4QGHA 1RKBA 4V0NA 2GNOA 4FI3C 1DAKA 1GIAA 4WAUA 2DFLA 421PA 4XJXA 3LXRA 2ZRFA 1R0YA 2IYTA 4TL8A 4UNPA 4DJTA 3AVVA 3K0CA 4P4SB 3V9PA 1EFUA 2Z6VA 1OYWA 3U6BA 2HLDD 1P2UA 3TAUA 3DEFA 2ZYUX 2I3BA 3ETLA 3B8HA 4Q1BA 3H4MA 1RRFA 2IXEA 3HU2A 1DPFA 1FMJA 4HDQB 5AJWA 4ASUA 3IPYA 3ZLJA 1NSFA 1NIJA 1OPXA 3QG5A 1XZQA 2QBYA 4IDNA 5F2EA 1S9DA 4ARZB 1IXZA 3GEEA 4IDQA 3SYNA 2JAQA 2YC2C 1W0JA 2OHFA 2P3SA 3TGPA 4A0GA 2GCOB 3PENA 3QEJA 1CXZA 4A6XA 1T0HB 4I81A 3VX4A 3SJBA 2IHYA 3BGWA 1G8GA 4ACAA 1Z3IX 4KV9A 4Q9KA 1AZTA 1G3QA 3GLIE 1P61B 4NCIA 1XPUA 2ZJ2A 2ZXUA 2XOKA 5C2JB 1ZVQA 1YQTA 3I62A 2RHDA 2F6RA 3CRW1 3I32A 3LVQE 4Q7LA 4FIDA 5AJVB 1RC8A 3MD0A 2IUUA 3RS5A 3K0SA 1U9IC 3LQQA 4Q48A 4MDFA 2VLIA 3SC3A 2WVJA 1AS3A 4EPYA 3P27A 4KYIB 3UXMA 2J7PD 2YYZA 3CF6R 4RCYA 2V4ZA 2ZROA 3OEED 3HR8A 4ZDKA 4DBLC 1NKSA 4TLCA 4RJLA 2ZJZA 4QJ3A 4DLRA 2A5YB 3TKLA 4M8NE 2CNWA 4V0MA 5JHHB 3M6AA 1HEIA 4OHXA 2YINC 3HU3A 1PV4A 3B78A 1CJMA 3KZ1E 3B6EA 4GOKA 1U81A 4JKYA 4TT3D 4WVFA 5HZHA 2IC5A 3RHFA 521PA 1KAOA 2OCPA 1BMFD 3B13B 1KJZA 3N2EA 5SZIA 5TDHA 4F4CA 1N0WA 5GJVC 3PUXA 4DC9A 4DLSA 1YZLA 5F98A 5EXTA 5TV2A 1Z6YA 4Q02A 5M04A 5K8LA 1N6HA 4FMCB 1GWNA 5LPNA 2VPPA 2FZLA 1Q3TA 3A8TA 3GFTA 3LV8A 4N3NA 4EIWA 3LQRA 2QM8A 2DY1A 4G01B 5DH9A 1OLOA 4BFWA 4AWXA 2BM1A 1XD8A 4C4PA 3AVOA 1F60A 3NDPA 2D4HA 2IWHA 1CR2A 3IQXA 3CNLA 2H1LA 2ZSAA 3BFKA 2O0KA 2G1KA 4PFSA 121PA 5BYJA 2GVDC 2QGZA 3QIAA 4TMKA 3DMDA 4M4SA 1LS6A 4JSTA 3THXA 1E2QA 1ZIOA 2YC4C 3BFVA 4MUAA 4UNSA 2DFKB 2FV8A 3AEZA 4IEEA 5CYOA 2ZRHA 4A8JA 4D0GA 2GAAA 2ZYVX 2JJ2D 1IM2A 1G41A 2CVHA 1DELA 4EAQA 3ADDA 1W46A 4PQYA 1MH1A 4OJQA 1MOZA 2O52A 4TSFA 3WMGA 5HE9A 4QG7A 1VIAA 1AKYA 3KKMA 1A82A 2Q9AA 1YR6A 1CULC 2BBOA 2X2EA 3U4QB 5P21A 2BMDA 1JECA 3LBIA 4DT1A 3BORA 4V03A 4KAXA 1T6NA 3KXIA 1TEXA 4MGKR 1VDZA 2YJTD 3BB3A 4JKIA 3BBPA 1Q57A 3THYA 3OIWA 3KB2A 5BN5A 2GKSA 1H8HA 4W5JA 1DG1G 4Q9JA 2AD5A 2H8KA 1XP8A 3A37A 4C0JA 3OEHA 2OV2A 1QVRA 2QP9X 3UATA 2DWOA 1G9XA 3DO6A 4TMXA 4WZBE 2NPIA 3VMFA 4LX0A 2ZM5A 2O8EB 5KNBA 3MCAA 4LY6A 4N0EA 1ZYUA 3BD9A 4D4MA 5FTLA 3I8XA 4PHGA 3THWB 1DEKA 4DLTA 4JLDA 5J40A 1UKVY 2WICA 1H8ED 4EPXA 3QF4A 3KX2A 3EASA 2IF2A 4Q18A 2Q21A 4TLBA 4PZLA 4URZR 2KSQA 2WHXA 1UKZA 4HLUC 2XTZA 1GKUB 3AKEA 4N1AA 4UXJA 1CR1A 4EFLA 2O8BB 2IXGA 2IEZA 1FP6A 1G5RA 2BOVA 2BM0A 2GRJA 1YVDA 1ZBDA 5GVRA 1A2BA 1KSHA 4L4UA 1TEVA 4LV5B 1CR0A 2EFHB 2KBEA 1E2KA 1NIPA 1NJGA 2CBZA 2GETA 1YR7A 1GNRA 4KI0A 2R8RA 4DDUA 3GLIA 1OYYA 4Z51A 5KHOC 1AK2A 2FFBA 4TTQA 5JZVA 3FB4A 3VHXA 1SVLA 2R6AA 2F9MA 1G20E 3HDTA 2PMKA 5FH9A 1ZM7A 4NCJA 4B3GA 1SXJB 1XCGB 5FL7A 2VF7A 1ZUIA 1KNXA 4HAZA 1UBGA 3OHMA 1EWQA 3A1UA 2GHIA 2ZRMA 2JJ1A 2A5JA 2RB4A 1GM5A 2NMVA 1JR3D 1NP6A 2WWWA 5BWMA 1NKTA 4OK5A 1CRQA 2OESA 4YLGA 1DE0A 1OIXA 2GBLA 2NZ8A 4CEHA 2G1JA 2O8CA 1YJ5A 3TUJC 4DEYA 4GOXA 3L8ZA 1XD2B 5L3QB 3GJ8A 2GDJA 2AL7A 2JLSA 1HQCA 3P4YA 1G5PA 3ZZUA 3J81k 3WP0A 1P6XA 3DM5A 2ZE5A 4I99A 4Q9LA 1JXOA 1KZ7B 5G40A 5KDOA 2DWQA 3KQKA 1EFTA 2VHJA 3CX7A 6Q21A 2G88A 1OH5A 2JDID 3K9NA 2QUZA 1OH7A 3NVAA 3EARA 1P2TA 2O0HA 2QMOA 1DVRA 5EUQB 5DI3B 1LF0A 1N0UA 1ZMXA 1CR4A 1T91A 5FOXA 2BEKA
chains in the Genus database with same CATH superfamily
1H9AA 4KO2S 4NZZA 3UJHA 4QLOA 4O4LA 1K7CA 4N7BA 2YCBA 1PNQA 3O10A 2CHUA 5EZQA 5HF9A 4F3CA 4ZTUB 4IEIA 4QUHA 4REQA 3L02A 2EGGA 5EFZA 1YHNA 4O4JB 5J4YA 3HDYA 3TXYA 2XS8A 1WPRA 3C1TA 3A3PA 2ASRA 3I42A 5C46F 4YHHB 5JS8A 3FOPA 1CJSA 4I9FA 3WRYC 3GJXC 1A72A 4ZI7A 1I24A 4X7RA 5CBPA 3MWDA 2P5SA 2XYGA 1MG0A 2EARA 3PXEA 3QVGB 4NZYA 1JPNA 2A5GA 1XJCA 1I9GA 3BD7A 3T3IA 2H0RA 4PAGA 2JZNA 4CLEA 3NG1A 1MB0A 4B40A 3W5VA 3HFSA 1TYBE 5TQ0B 5G1PA 1ECBA 2FOIA 4OHZA 4Q4JB 3ZLTA 4YPFA 4I50B 1MX3A 4QEZA 1B2LA 2PRKA 4QVKA 2NTVA 1IY1A 4DA9A 4QG3A 3I04A 2BMFA 3R5SA 4AMGA 4B2IA 1IBSA 4KE8A 4UTOA 2LVBA 2PGJA 4GBJA 3TMKA 4WNAA 3OKCA 2M32A 1XMSA 5ECWA 4FYPA 1N8NA 1H8EA 2IL1A 1H66A 2HEGA 1IXYA 3MMPA 4MV6A 5K4AA 3PDUA 1XU9A 3ZI4A 4G2NA 3LT0A 2Q6LA 3DMTA 3O0TA 3JPYA 1XQ6A 5IAEA 2VJBA 3ORFA 1N2CA 1WV0A 2B8TA 3DNMA 2R7WA 2WWYA 2CLIB 2X1VA 1VL6A 5HSWA 1OXUA 4ZVLA 4RIIA 1C3XA 2AYYA 4R68A 3QX9A 4XH9B 4EY6A 3PLNA 4QTYA 2PUTA 1R5BA 3II6X 2Q2NA 3NTRA 3DZIA 3L4BC 4EFKA 3SYLA 2CNDA 2JGFA 4HDRA 1I5NA 4I4NA 3DBOB 1Z6QA 1CDEA 2IIPA 5HX7A 2FW9A 3FWYA 3M9WA 4FW8A 2I65A 4LJSA 3TUZC 1UJ2A 4ZOBA 4KRFA 4LHSA 3D8HA 1E1RA 3W9BA 4J03A 3DMYA 2VNAA 3PQ6A 4PTLA 3WHKA 2LWIA 1USGA 1RWOA 4GRDA 2BC9A 5ALJA 4NOMA 1XZFA 1UBHS 3FPJA 4JJFA 4QPDA 1V4AA 3JWEA 2YFKA 1Q1GA 5JBIA 3OT1B 4M3NA 3P9ZA 4IGFA 1Z4QA 1U8YA 1M1ZA 3JYQA 3ED1A 4II7A 3ETNA 4OHOA 1SU6A 1U2EA 3R6LA 3N8DA 4DQVA 5CCXA 3NBYC 3IMEA 4LXUA 4KQFA 3BBLA 3C3KA 3N2YA 4LHWA 4PZPA 3G2NA 2LPMA 1E7QA 4G0YA 3DWFA 2RGDA 5A0VA 2V74B 1WHSB 1PG2A 3VVBA 2R1UA 4EF6A 1QC5B 1NXXA 1PLJA 2HAEA 3DVQX 1GOTA 1ZITA 2EXXA 2C9OA 5FHRA 4MJLA 1QDEA 2IEBA 2I22A 3SSAA 2C4HA 2YMPA 1X8KA 1C8KA 2QUKA 2VF4X 4BNMA 5TEWA 4JEUA 3DKVA 2K7FA 3MYIA 1O0BA 5H70A 2PVCA 2QLAA 1PWZA 3DTVB 3HJCA 4UD2A 1QDLB 4EHHA 4U7GA 4QZVA 3PDIB 2B4RO 1C9YA 4JR2A 3V7FA 4ZO6A 4QXMA 4BTLA 1AUXA 1P29A 3RDPA 1WF6A 1E5DA 5A6VA 5EYPB 2OV1A 2PMCA 3P0RA 2J5KA 3V9AA 4B3JA 3K0CC 3DBLA 3A27A 5FTKA 2YZSA 4JIGA 3ABQB 1ICIA 5FOUA 4L73A 4E6EA 4JLJA 5ARDA 5F5FA 5JD4A 3M79A 1M83A 1Z4LA 1DC3A 4RY8A 4BGUA 3QOYA 1ILWA 4O2BF 1U11A 1ZSVA 4U39A 5EJAA 4PWYA 4PLTA 3I1FA 4EIYA 4DMUB 1X70A 1VZ2A 2FEOA 4FQ5A 4FAPB 1L0BA 3TB6A 4CUKA 1NF8A 5EXDA 2VZ0A 1KWKA 3O3MB 2AU5A 4MUYA 3EZHA 1DUSA 3HGQA 3L6CA 2ZI4A 2ZJ3A 3G5UA 3ORSA 2PPVA 4CV3A 3L0ZA 3UK7A 4EQZA 4U2KA 5HPYB 4NU5A 3NIDB 2ZJOA 4BIMA 1L3BA 2POQX 2GPTA 2B36A 4HHEA 4ZK6A 5MGNA 1R8SA 1EVQA 3I9KA 1NONA 5FCDA 4KREA 2V0NA 3B48A 3QENA 3DLAA 2UAGA 2KLHA 1X0VA 4YT8A 2G4VA 1R6UA 3FDIA 2BDUA 4MV1A 1AS0A 1JT9A 5HQ3A 4FXOA 1C2YA 5JJLA 2K6GA 2XGOA 1VPTA 5KPDA 3TSYA 4CS9A 3OFND 2IV3A 1F2UB 4FN5A 4F85A 1IQ0A 3DTVD 1PT6A 3F2IA 3CUEF 2VNSA 3O4JA 4G37A 3EGWA 4DCOA 1J07A 1CLUA 3HXPA 4E7SA 3ZDZB 3HY6A 4QBIA 3BSFA 4BG0A 2V7GA 4JVLA 1WIWA 1W35A 3E3OA 3H1PA 3FYTA 1M5TA 1N3BA 3RC7A 5KNCA 2ZRCA 1NJ5A 4AUEA 2ID8A 4IIBA 4LC0A 4JU8A 5EZYB 4FUTA 4F86A 4LYEA 5E8JA 3NQ41 1KEWA 3HM9A 3L7CA 5JS7A 1EM6A 1A9ZA 4KVAA 1TO1E 2AEEA 1T1GA 3HVUA 2YQZA 4TTPA 2EPNA 4HQRA 4QTZA 2P0YA 3ZWDA 2CJYA 1ZKMA 4P7GA 3T3GA 4KACA 4HNAB 2HCJB 5SZKB 3ND8A 4I9UA 2YX1A 1WY7A 3WNVA 1CTQA 4JKVA 3KOYA 1OBFO 5AKGA 3ZG6A 3A6KA 4L22A 5BQXA 3IQGX 2NU8A 4BNUA 5AIBA 1CD5A 2XRYA 3NNDA 3RUHA 3EVZA 3KEFA 3M1LA 1PK7A 3Q7QA 3DT9A 4X20B 4LHVA 1CZUA 3BEOA 4LMRA 4E3ZA 1AURA 2C7QA 3L7AA 1YDEA 3NHZA 3CWQA 1R16A 5DZSA 1D1SA 3WWPA 3HFGA 4GC9A 3ILYA 4IB4A 2GESA 1IE3A 5BQ5A 4BQQA 3N9IA 4V1CA 4K7BA 4N3CA 1VRVA 1QHSA 4Q4AA 3NJRA 4J49A 2M6LA 4B76A 3N0WA 4X84A 1YE5A 4XVCA 3OHPA 2PUVA 1GNVA 2NU7A 1HGXA 4JVSB 1Q1NA 4IFEA 4GBGA 3I72A 3K7DA 2JIRA 3FOWA 4NEHB 3QJYA 3O75A 2X7JA 1HE4A 2FPXA 3L34A 4WADA 2H5IA 4PIPA 1AUEA 4OQQA 2ZSJA 2BTQA 4XIGS 2AOVA 2VWGA 1T3SA 3RNOA 2DUNA 2JCYA 2BVNA 5EXEA 5EXPA 2XQIA 1BDJA 4TV8A 1JQ5A 5CLLA 2JH9A 4OA5A 2VO1A 3RVKA 3AGTA 2DUMA 2WAXA 3DL7A 4YXWD 5K09A 1BO6A 3ROMA 3M0EA 3V1KA 3PI6A 3RW9A 1JLHA 2GK4A 1QV7A 1OWLA 2AOXA 3BH0A 4RU1A 1SQSA 3B1WA 4BO0A 4BO4A 3ONNA 3O4GA 1SZDA 4GX2A 3KYBA 4GNKA 3VHRA 2ATXA 3QELB 1UMCB 1RVV1 2FHPA 3U5ZB 3EFOA 2BSAA 3HO6A 1QORA 3L1HA 1COWD 2B4QA 3DMTC 4IMIB 3L82B 2WJIA 3T3NA 3SIXA 3F49S 2YZ7A 4YP9A 4IIEA 1O2DA 3VVLA 1CZLA 3T1YB 5FX2A 1Q0KA 3R3XA 2TS1A 1L5FA 2IIQA 5EHNA 3IUBA 3X1WA 3AEXA 1QWOA 3IDOA 3NKEA 4Z0HO 2BT4A 3W77A 3GHHA 3WLQA 1LX7A 1US8A 2Z43A 2V7UA 4CGYA 2O6HA 4LCBA 2XLDA 4GR5A 3PGJA 4MVQA 4I8DA 2JHCA 5AUNB 5BV1A 3ZNNA 5HVNA 1Q6YA 4JYZA 4OCZA 3DAYA 2F3UA 3ZOKA 1RXYA 1XEFA 5MHTA 1OGJA 5DI3A 1MKYA 3P9YA 1M2OA 1SA0B 3LQYA 2BR4A 3TZBA 4Z0NA 2B8JA 3LP6A 1C4KA 1VLTA 3CE9A 1Y5MA 2H65A 1JLSA 2ZTVA 3V8NA 3TG8A 2D13A 2CK3A 3GP8A 3ZU6A 1JEOA 4G1BA 1N7IA 2AQ8A 1ZM2A 2R11A 4E1BA 5LWHA 4QECA 3BIOA 5KYNA 4BNJA 2FP4A 2TMVP 4CIHA 3ZZ1A 2PDAA 4CZ2A 3OPMA 1JB9A 1RM5A 4G1UC 1HC7A 1OASA 5J2TA 3OX1A 1XL0A 3GQBA 4D3ZA 1HYHA 1Z5UA 2PLAA 5KZMB 3MJFA 1LQTA 3IDZA 3O1IC 2B3TA 4UOZA 4AJ9A 5IBQA 5E38A 3QG1A 3WGNA 1K6MA 4GOOD 4C03A 4EVIA 1JI3A 4DM7A 2P77A 4GHWA 3DV9A 1NQAO 5KYTA 3LHSA 2PRZA 3O4RA 2H2AA 3I2HA 4LY3A 4EL0A 1F8GA 1Z5GA 5AJUA 3TQIA 1RVDA 3BRWD 1VE3A 2OCKA 4QXPA 4JQOA 5JTTA 3K0BA 2INGX 2ZB3A 1EVZA 1TQGA 2X8WA 1WNFA 2VTKA 2IYFA 3KKOA 4L50A 4XRRA 3FPBA 5AVUA 1VPDA 4PSUA 3WOVA 2W6OA 3Q8MA 4I1YA 3DMPA 2EP5A 4MPJA 1DJLA 1WDTA 5AKJA 3MBGA 4PN7A 3RVBA 3IPMO 4GZLA 1E2IA 4GMXA 1Z4IA 3QSYA 2XNSA 3KQYA 3LI2A 5JECA 3COVA 3IP3A 3JRXA 1QSPA 2IM8A 1JHYA 1X6VA 2PE5A 1SUWA 1D2EA 2ORYA 4G0UA 5A3QA 3GVHA 5IBCA 3RUIA 4QEKA 1WXIA 2C5FA 5TVKA 1JGTA 6REQB 1YQ9A 2BI7A 3UXHA 3RHSA 1RKXA 2G63A 1B8PA 2OCLA 4TT8A 1MBZA 1MJHA 3CX8A 3U3KA 1Z83A 2WMDA 4BMXA 3V7WA 4K1XA 1TF7A 4KBLA 1IY9A 4RSHA 3JVVA 2LQGA 4JI1B 2XITA 3SC2A 4B74A 2VCYA 2E6KA 2WTNA 2JGLA 4M63A 1ORDA 2JNWA 3LUBA 4EJFA 3H6GA 4K9OA 3B85A 4MWTA 3EPPA 1XHLA 2J6CA 4NTBA 5JQGF 3PNYA 4PF1A 4R54A 2JIOA 2WTMA 1W85B 2HO5A 3ZK8A 1C41A 2CXRA 3P45A 4Y1RB 1GAQA 2FPRA 1JIIA 1USVA 5I4BA 4LZAA 1Y7PA 4IR7A 3C14C 2J3QA 5ALVA 4OA8A 1GGMA 4CU2A 4UFPA 4C0AC 1SCUB 3DMFA 1LSJA 3OFSA 3FY4A 5FPSA 1E59A 1SH7A 3ZVLA 4QPPA 1XRSB 3JALA 3SGLA 4MQMA 4OLFA 3W4JA 4BZQA 4MYTA 2P6MA 2W6JD 5IT5A 4LNAA 4Q4ZF 4ZOLA 4CS9C 1XD9A 2RHLA 1RHJA 3OTOB 3H1FA 5JJKA 3N2ZB 1GVHA 4GC5A 4TKVB 2VZLA 3GR6A 4DAEA 3K73O 4E03A 3OJCA 5DM0A 1M2HA 3I2JA 5LCXA 2I2DA 1F1BA 1VHJA 2XOKD 2O2CA 2EPLX 1Y5RA 1L8OA 1IY0A 1ZR4A 2Z2IA 4K81B 1EAMA 5LMZA 5FA5A 1B8OA 2TYSB 4DTIA 3F3SA 1U8TA 2XRFA 4R8LA 1V3QE 3GC6A 3PVZA 2QORA 4IO1A 1BDBA 3KVVA 1T10A 4FUQA 1KOLA 4TZKA 3IDFA 3V7NA 5FJIA 5I45A 5CXSA 1JEYB 3KSAC 2I2WA 1JWBB 4R7TA 4X61A 2F1KA 1HL7A 3IPLA 1M2VA 1R12A 3DD7A 2OILA 4NFYA 3Q7RA 1PNOA 2H16A 1N6NA 1JJVA 3WKBA 1DEXA 2BELA 4TVOA 2IPOA 4JYAB 5FWXB 4L1KA 1OI3A 5GIOE 3D5TA 2XKKA 1NHGA 2X1LA 4C43A 3RD5A 1J1IA 2EJTA 2X41A 2L6HA 1XNQB 3C45A 2PX4A 3RBVA 4RVNA 1APCA 3CBGA 1NVKA 4RDHA 1MJNA 1XKQA 1F5NA 1NUHA 3KQMA 2Z6QA 4Q3KA 4GD3Q 2FUG6 3UB3A 4P35A 1ZICA 4I66A 4KJZA 2P6UA 4Y3UA 5SY6A 5JS5A 5EL0A 4IIJF 1Y63A 2CYAA 1YJQA 3QLEA 5IJXA 3W5JA 1MNDA 4IQGA 3GD5A 1A8IA 4HS4A 2QNLA 2P2NA 3SS9X 1XMXA 4HFJA 4BEMJ 4JLUA 4DJ5X 3U0BA 5FPQA 2AFRA 4YRPA 1XHFA 2ID9A 3DEFA 4KB5A 5D5PA 2L18A 4L07A 1ZCFA 1I94B 4YASA 1JIVA 5DHPA 1K7FB 1RIIA 1C30B 3VKFA 1JQ3A 1RCPA 5JSQA 3PENA 3P9KA 3VX4A 3ESBA 1ZGZA 1I7PA 4KV9A 1YZAA 4EGQA 2HPVA 4GX5A 4F8EA 4BU0A 5FBHA 2ZXUA 2VH1A 3AUAA 3NHYA 2IHNA 2RI6A 4S1WA 4DCPA 3E9ZA 4L8FA 3K0SA 1W25A 3O82A 4ZVRA 3OE4A 2IYEA 2R6R1 1U3UA 1GTG1 2A5YB 3JQAA 3RHFA 2V96A 5TDHA 5H82A 4DA8A 3P19A 3QVXA 3PC3A 1KFJB 2ZIXB 3P0IA 4G01B 2ZIVB 4UD6A 1S02A 2AE1A 4DQXA 4M4SA 4J2OA 2RHHA 1FFWA 5K7SA 2CHFA 4DV6B 4X62B 2FV8A 3QEAZ 3UOWA 3WMGA 3KKMA 3WDKA 1ZQ9A 4R1MA 4DT1A 4V03A 2R86A 2G5PA 1ZJ4A 3UMGA 2XOXA 4W5JA 4ZQFA 2X6TA 4LY6A 4BP9A 3S5JA 4DYDA 1EEXB 3SF8A 3DE3X 4MS1B 2QUIA 4PZLA 3PPVA 4H1TA 2HO4A 4GX1A 2PO7A 1ZBDA 5AM0A 2W2QA 2XE8A 3VC7A 3T7RA 1U7PA 3N24A 2YHIB 1VIVA 1P7WA 3CLKA 1SXJB 2KHZA 3LDFA 4QOJA 1FYWA 3H9GA 4HWKA 1EWQA 2PSSA 1AN9A 2WWWA 4JGGA 1QFSA 1GPUA 1NTRA 1CVLA 1I33A 4YWJA 3HKKA 5ESXA 3WP0A 1A69A 4EJ0A 4UMVA 1X7DA 5K8VA 3HB1A 2I66A 4JB0A 4GDMA 1VL5A 2ASVA 3HB9A 4M60A 3JD2A 1YB5A 2XLOA 4XUCA 5CDHA 5JPCA 5EZ5A 2JFFA 4UE6A 1L5RA 3M34A 1RAGA 3AEYA 5CHEA 1GPDG 5L3ZA 4DZTA 3EYWA 4I4TA 2J3HA 2BEUB 1UJ4A 1CJUC 2YIJA 1GZ5A 4B87A 1F48A 1YQDA 5KNDH 1R4AA 5HW0A 5I47A 4MW7A 5LUAA 3FOAA 2XZOA 3EC7A 5T57A 4NNOA 2PFKA 3AVPA 2QE6A 3U26A 5TQ2B 2Y69C 3FFBA 1YDIA 4JEMA 4U00A 4TXLA 1WASA 4PJNA 4GZ5A 2E21A 4J1SA 1JDTA 3IB3A 2ZWAA 4MJ3A 3DM9B 5CD1A 1E2PA 1P7YA 5DTEA 1F8YA 1YBHA 2WP0A 3CEPB 1R6BX 4M9CA 1IHXA 3VU1A 1UMKA 4BEWA 1LWNA 1JDJA 5DFAA 1X8LA 2EINC 1WXQA 1N6LA 4A82A 4HQKA 4P3XA 3SJ7A 4H6WA 2UUBB 5H81A 3G8BA 4LPSA 2L9JA 2Q1SA 4KXUA 1GL7A 4WA7A 4QT0A 4W5TA 5REQA 2PSJA 4Y18A 3VPSA 1VA4A 3WHNA 3AUTA 1S2MA 2RI0A 2O2IA 4YI3A 2R4TA 2J0XA 3IX7A 3R44A 3QMPA 2NV6A 4MX8A 1REQB 2NSLA 3G49A 3OCZA 2P7HA 2OBMA 2WHPA 5ITVA 1Z22A 1U31A 5HKLA 2GYYA 1XJ0A 3QQPA 3H17A 2FG6C 3BTSA 3LX5A 1VCHA 3R1IA 4MQ9F 1E4VA 4N49A 4AX2A 3L07A 1NW5A 2YZGA 4OGKA 1FEZA 5AO9A 1A88A 4IO0A 3WFIA 2XBMA 1M8FA 4L5AA 4WH0A 1ZI9A 1D0SA 5HM6A 3RCBA 2W2MA 4OM8A 4PFJA 4B6EA 3OQIB 3MWLA 3ZY3A 2WZGA 1OREA 3KKPA 3B53X 4LTNA 1GGVA 4LDQA 3MPUA 3MRXA 5DGDA 1ONPA 3GLGB 2HCTA 2X8JA 1TGVA 4ZV4A 3KETA 4OHWA 1YACA 3JRTA 1ORWA 4LX8A 1SKAA 3DXFA 2QSJA 1HRDA 3BA1A 1XZEA 4PAMA 1YRAA 3VGPA 4TSFD 3RASA 3KBOA 1N5OX 3EEIA 5IDXA 4JFRA 1KYTA 3UUEA 4ZV7A 1FVOA 3ZLBA 2VJLA 1XZMA 4YO8A 4P80A 4JKOA 2JGAA 2W0MA 5FUYA 1RKCA 5LDHA 2QD1A 3UUGA 1LK5A 4I8IA 4C1NA 3GEDA 3SFTA 4U7FA 5KCMA 3D5EA 4Q24A 2VPWA 2ZUCA 2PSFA 4RF3A 3OIFA 1EWTA 2IHTA 1UWKA 4RFLA 3L8IA 1RZRA 1A4XA 4XQEA 3C6QA 2JIBA 2VPZA 1OXBA 3TXXA 3RT1A 2J0SA 3TR6A 1XRMA 3CZ4A 1HDYA 1GPAA 5A3VA 2QDKA 1K6EA 5EJ2A 1NFOA 3J80A 1EE9A 3K53A 4TQAA 5IASA 4ZCQA 1I7DA 4JW1A 4YBRA 4WN9B 2EWMA 3FCOA 3IVMA 1T3GA 1TCCA 1HURA 3WQRA 1XTPA 2ANBA 4MV0A 4MDYA 4HB4A 4M8IA 2PL3A 2YOHA 1DCFA 3LD9A 1L7NA 3GIDA 3QHAA 1TR2A 2HIGA 1LGYA 1CR6A 4RLQA 5I3CA 3V1NA 4RULA 5IC5A 3RC9A 3G5TA 1Y48E 2I4RA 3VXKA 1YRYE 3OF5A 5AJTA 3FMSA 4R3NA 5ER6A 1XTQA 4S04A 2OC4A 4X97A 1GUBA 4GSKA 1P5JA 4OSOA 2YLDA 4BTVA 2IUSA 2FSHA 4DIUA 4TYWA 4PNZA 4MQLA 3P0JA 3L7OA 2REBA 3O1HB 1FNMA 2HWUA 1L5ZA 3CF2A 4DIKA 3WI7A 3LPAA 4CQMA 2PD6A 3H75A 2AR9A 2P90A 4CQJA 1XCJA 5LU9A 1EU1A 1MFZA 1XEXB 5KQRA 4NMWA 1AS2A 3A9UA 5JD5A 2LZ0A 3SBXA 3KQVA 1XJQA 1HA3A 1VMDA 4N76A 4H7HA 1VKOA 2AHOA 1XPRA 2CKMA 5DN6A 3WB9A 3HJFA 4TLDA 3VR3D 3ZGNA 5KOHA 3PV0A 1Y9DA 3IDQA 5HM8A 5LQRA 2QGFA 2X23A 1NZFA 4MB0A 4Q39A 4AE4A 1VTMP 2AJCA 3PNLA 4FEGA 2IRWA 4GSYA 4R1NA 2YWXA 3RRNA 4YAKA 2XB2A 5AH0A 1Q0TA 3E22B 3GFQA 4Q4HB 1J6UA 4MKFA 3IKTA 1B2RA 4G41A 4WJLA 1USUA 1T5HX 1CY7A 3KSDO 4LXXA 4KLAA 1NVVQ 1WP9A 3QZUA 1BYIA 4GE0A 1MG5A 3V48A 5SY9A 3T35A 4IQ4A 2GN9A 4RY9A 3BE8A 2XUAA 4J0DA 3QQ5A 1SOMA 1CUXA 3HDHA 4Z49A 2CFRA 5DXAA 4WZAA 2R96A 1P9WA 1PLLA 1TADA 4X8LA 1E0SA 1NLXA 3ESAA 5HZGA 2ORVA 2MINB 4G0VA 3FDZB 2HKIA 3V5ZA 2ZPAA 1A9QA 1XF1A 1RFLA 3HR7A 3GVXA 1HOTA 3IESA 2NUTA 1GU1A 2C31A 2DUJA 1V26A 1XAIA 3AF5A 5ALOA 2P3OA 1N6PA 5LDGA 1Y3AA 4LOKA 5B1SA 3K6SA 4D4XA 2ZJ5A 1O0SA 3V4RA 1H05A 4TVSA 1IJKA 3ZHBA 4JGIA 5K20A 1IG3A 3B5IA 5KQLA 3IQ5A 4M1MA 1P6QA 4QDOA 4ZO4A 4CWAA 3RIPA 4FWIB 5C8YA 4CIWA 4QUIA 3AONB 4Q47A 4UCQA 2B37A 4YECA 3WLIA 1GPLA 3A9CA 1XYVA 4P58A 2CXSA 3U09A 4GWKA 1PZEA 1MV8A 4J0GA 1JTEA 1WTYA 4LPKA 5FEUA 1T35A 2ZJ8A 3HVKA 4DG5A 4UXHA 5BP7A 4OV6B 5JBNA 2PKQO 2TMDA 3E4DA 1QFZA 4B3BA 3ZV6A 2BFPA 4I6JA 4DBLE 4J76A 2PLFA 1XROA 2NP7A 2W90A 3IA2A 3ICQB 3BMCB 3PL5A 3KKQA 3U7GA 3QSGA 5KKCA 2Z5LA 2D2XA 4QLBA 2PWAA 2JHFA 1X1BA 1J0DA 2I8CA 3KKEA 3KE8A 2O48X 2IBSA 1N33B 4IJ6A 3JSEO 3S40A 4KFTA 1A97A 3RT7A 3MCWA 2ZRAA 2D2VA 3NP7A 3V33A 3CNOA 3H0EA 4ODIA 1WHTB 3VH3A 5JV5A 1LIHA 3W1WA 3RYHA 4ED9A 3SJAA 5DOVA 2WNSA 1K8ZB 3BMNA 1WTCA 2PUBA 5AKEA 2RAPA 1NXTA 3WAKA 1WXDA 1IK4A 1EK0A 4KSBA 3D4PA 3TZEA 1T0JB 1OD6A 3LY5A 1UWLA 2YUTA 1JSXA 2QTVA 3RABA 4TRMA 4EG8A 1U7ZA 1SQ5A 4JXJA 2PCLA 4Z9JA 2M64A 2RFLA 2Y3HA 2EG9A 1LM3B 3PWTA 5FPYA 2PF4E 4KPEC 3ZKWA 1UCFA 4PU0A 2NO9A 1JV2B 4G4SP 1GRQA 4QGGA 3CJTA 1T6BY 4M9QA 1CEYA 2BL4A 3P9PA 5G1NA 5ADVA 3K31A 2WJ6A 3ANTA 3Q87B 3KJFA 3GRKA 3W06A 3AEQA 5JXJA 2JAWA 3RKSA 1ZMRA 1CPRA 1P1KA 3ROZA 3BL6A 2OCBA 4O4LF 2QRPA 1EP1B 3MLGA 5DU2A 1PKEA 3RSFA 1MQVA 5C35A 1GUFA 4JR1A 5IXYA 1ZCZA 1XFAA 5TJHA 1E4YA 1ETHA 2AN4A 1XZGA 2WOJA 3ASUA 4QFMA 5CVDA 5EZSA 5LXTA 2XGJA 1FJ2A 2O8FB 4UVGA 1QGDA 1ST2A 1FVFA 3FBTA 1EDOA 1KYXA 1WVGA 1UKEA 1E7SA 1I3NA 3WLJA 3K09A 4NRDA 2MYTA 4TYNA 4KFCA 1Z88A 3LDAA 4XM2A 1U9YA 3TM4A 3GEHA 5FNVF 3H2JA 3S81A 2QM7A 2V8BA 3JQ7B 2H57A 1VJGA 3ZWKA 1ZRHA 5EUBA 1V55C 1GEEA 5IM5A 4ENVA 1FRNA 1M76A 5C1IA 3VYVA 4HSGA 2FXIA 4JOBA 4EI8A 4XR9A 3BD6A 3L7DA 5CP8A 3KZMA 3M6VA 3ZQ6A 4I9GA 1X7HA 4NVRA 1A4RA 2IQ5A 4UQLA 3K9CA 2C4UA 3W90A 5JRJA 2R03A 1MO6A 5IBPA 2CEKA 1NR5A 4RF2A 3G5AA 3RSZA 2IOQA 4M22A 3BSSA 1T26A 3G9XA 3WV5A 4C7OA 1U0GA 4IDAA 1YS4A 3GZ4A 3K4PA 7AT1A 3F90A 3IPCA 4R9SA 1VBMA 4HNVA 4C7KA 1YZQA 1PQUA 5HCNA 3FLBA 2WF7A 2ZSFA 1A5TA 3V8PA 3BXFA 1XK6A 4MZXA 4AZ0A 1XGKA 4RVGA 4CKEB 2DGJA 3LBHA 5IS2A 4PYNA 1YQGA 1ZR2A 3WNQA 1GL9B 4TZ0A 4XGRA 4TZ6A 4HQFA 2QTZA 4XR4A 1P9NA 2CN1A 1G291 2XKJE 1Q44A 4GOLD 8MHTA 4B80A 3DLHA 3Q3EA 5LBTA 3KVNA 3C5WP 4G5GA 4PRLA 3QPAA 2QBYB 4RENA 5IVDA 1HY5A 4P1ZA 4HP8A 3F1LA 4C04A 1KQFA 3ETHA 4D97A 3E8XA 3OBBA 3E9DA 1GKYA 2WIAA 4TWRA 4BRSA 4DLLA 3JQ8A 1KJIA 4I5DA 1DBRA 1NP3A 2Z57A 3E3MA 3ENKA 5L0IA 5H8WA 1Y8QA 2EP8A 4F6RB 3S2GA 3B38A 2WJGA 4I9NA 1L4LA 3B0UX 1JXQA 1ZEJA 4TWIA 1WDKA 3RK0A 4FXPA 4IW3B 2Y76A 1Y3HA 3H87A 5ALTA 4UTVA 2QY9A 2QAGA 3PDJA 3AY6A 5FORA 5I8ZA 1RAEA 3A1NA 1RQ2A 4JJ8A 3BJIC 1OU0A 1QTIA 3ABRB 4FFDA 3BJRA 4D0LB 4UJ3A 1EUCB 2ATVA 4BB0A 2J6BA 2RKOA 1N1EA 3B1YA 2HC9A 4ZCTA 3H4IA 1GZDA 4ZRDA 2OBLA 3TBKA 2IBFA 3NHRA 4MP3A 3GDFA 3IA7A 2ZVDA 3KAKA 5DV9A 4UBIA 2UUPA 2HDNB 4FYHA 3E0XA 4ZFNA 4J30B 2YWAA 3FXHA 3FCAA 2I99A 4X44A 1XMVA 3IHKA 2G71A 4ZJPA 1EVEA 4UOEA 4YCMA 2BSXA 1GQSA 2IYNA 2REQA 4WXMA 1I6MA 1EGQA 3GEIA 1ZN8A 1UBCA 2VPYA 4EZBA 2B9EA 3EXHC 4L8GA 2ONJA 3I28A 1RHMA 3ZU2A 4CMEA 8ATCA 3I52A 1N8SA 1GFWA 3MWGA 1KI6B 4O08A 1CDZA 1C1HA 4G5RA 4BLQA 4LJYA 2QR5A 4HGNA 4FYVA 1YJCA 2C4WA 4K6CA 3U31A 3RH0A 5CCBA 4CLOA 3TDKA 1WGWA 3SHVA 1OXXK 1FYFA 2P6NA 3ZOZA 2EEPA 3RTDA 4G1VA 4PPFA 1LNZA 2O5RA 4HEJA 2QLJA 2XWQA 1JJFA 1H0RA 4IHQA 2G62A 1K86A 4FX2A 1RI1A 1S4MA 3EEFA 5KREA 3VOTA 4DRZA 1EWRA 1LB1B 5AI9A 3MB8A 4FTWA 3ZCUA 4IS2A 4W99A 1RPJA 5ALWA 2XMCA 1W5TA 1K5DA 4EHBA 3UIEA 3GD7A 1S7GA 3UBMA 2NTJA 1QQTA 1M0EA 3KYJA 2XWJI 1I1NA 3G1TA 4LE0A 1GXSB 3T1QA 2FW6A 2C5SA 2C83A 4O2AA 4AAYA 5FXMA 1AXRA 3U8VA 1Y4CA 4FCVA 2XYVA 3HSYA 3IULA 1Y9AA 3FVYA 2GN1A 2VSFA 1TM2A 2XNDA 1U3CA 2LUOA 2ZT6A 2OQVA 4INZA 4JMLA 5B37A 5CG2A 1C0PA 3D0QA 4K5QA 1TK3A 5DSTA 3AP3A 3VDQA 4E08A 3HB5X 4JY7A 1RKUA 2YYSA 1EHCA 1O95D 2XUPA 3V9PA 4Y9TA 2VF5X 5FWYA 2H2FA 4FJ1A 3KYCA 1RRVA 4K6OA 2PYZA 3TQHA 4K05A 1ZL2A 5EQDA 3S8MA 4BN4A 2C9ZA 2ICWG 1V39A 3SIWA 5JPDA 5K3EA 5KOJB 4RA6A 5CNMA 3WLEA 3IRUA 5GAJA 3R5TA 1B8UA 2OWDA 3CWCA 4NJEA 3OIGA 4ECAA 1OQCA 3WHIA 1DMRA 2R8EA 1DKRA 4U5HA 4YJGA 3RTGA 3PX3A 3M6AA 1HEIA 4CI0B 1VHWA 3QE4A 5J5VA 2QUJA 2YIDA 5LYYA 1N0WA 4UNIA 1NW8A 1WATA 4QULA 1Z6YA 5K8LA 4QLAA 1D07A 4EIWA 2CLOB 2ETXA 2QM8A 1O6FA 1VPEA 4FLMA 5K3CA 3UV6A 2Z98A 2XLEA 3ZGYA 1XZKA 1U1CA 2L69A 5FLYA 3F67A 3PMRA 4ZJUA 1ZIYA 1XA0A 1BZYA 2KJGA 3C70A 4PQYA 2O52A 4QG7A 2AI2A 4HPJB 4DNOA 4PBSA 5K3BA 4YCSA 1JECA 2FSSA 1KS9A 1A0BA 2A0BA 1Q57A 5CA1B 2BFDA 1DL5A 5FYQA 1GTJ1 3H5OA 3G7NA 2XUDA 2KW3C 3N8IA 3I6YA 4HWGA 3OKFA 2ZR8A 2VXBA 1QH1B 3I8XA 3ZWQA 4JJEA 1SRQA 3I12A 5AXDA 2EKPA 4BVBA 4DV7B 2JIPA 1Y81A 3KPJA 3GMIA 3KYDB 1A2BA 3LT4A 5ICFA 2VZ8A 1B6GA 3HEAA 4DDUA 3K92A 3KXDA 3NHPA 2JPDA 5CGQB 3WDLA 1KEEB 3SX2A 2CW0F 4YAJA 3FZYA 1EGVB 4YRSA 3HVIA 3TUJC 2OV6A 3NEPX 3P4YA 1ADFA 5IVKA 2B3DA 4L85A 2HFIA 3PUIA 1P2TA 3CB2A 5K51A 5EUQB 4O1IA 3V80A 4BV2A 2BEKA 1O96B 2JCGA 4OHCA 4NYJQ 4MEBA 3UQZA 3WNDA 1Q2XA 2PRYA 1E58A 4HADA 3AVQA 2NSFA 1W5AA 4D3YA 5EWMB 1BHO1 1G3UA 1H42A 4LLCA 2C8VA 1PBTA 4W1SA 1FP1D 1VE9A 2O20A 3K8OE 3L04A 3IP7A 3R23A 4Z9AA 4L0CA 3HKEB 3HHEA 4WK2B 5A6SA 2Q5OA 4WL0A 1NRWA 4MIEA 4L9SA 1M73E 1PFGA 1GGFA 4IVPA 1UBRS 5SZHB 2AOTA 3DUFA 1LVUA 3GRAA 3Q8LA 1HYBA 3WGHA 5CT9A 1T9BA 2KNHA 3GLRA 5DI9A 4B3TB 2IFTA 4DIEA 5DM4A 2BGIA 5CH8A 2R2AA 1N5JA 2A4KA 3WGZA 3X1ZA 1BDIA 1QAOA 2QYHA 1R4MA 3FFXA 3N5CA 1RMTA 4WCDA 2GPYA 5CB4A 4B6FA 4EB6B 2UUOA 4RQAA 3WL3A 4BVAA 4RPLA 2AP3A 4IG9A 3O47A 2J9VA 4KNVA 5J2TF 2BGKA 1X13A 3ASVA 1BIFA 2MDTA 1PZFA 1FDOA 5L9AA 4HVLA 3TINA 1Z26A 5DBEX 3QYPA 2QAGC 3AP2A 4DKJA 1I5RA 1K7XB 3EWSA 2PX8A 5EJMA 4CCYA 1YS1X 3ROKA 1IEWA 1G9TA 1G7SA 3U1VA 1ZMBA 3B1XA 4FDVA 2F1JA 4WFKA 1K5HA 2FRDA 4DCJA 1G6KA 3DLPX 3ZIAA 1VKNA 4IXDA 1L1FA 3VR4H 1OUMA 4PJMA 4C4SA 3WTCA 4EJMA 4ARIA 2H4XA 4K46A 1ULZA 1CY4A 3EUEA 3FMFA 2JPUA 5DTRA 1E3JA 1FLNA 2Q9CA 4RD9A 4GI5A 3JCZA 5KU1A 1WWKA 1VHTA 5KJFA 4OD5A 1GL3A 3MTGA 2VJCA 5AOCA 3U2MA 4GNRA 5CYPA 3ORRA 4JI4B 4NJMA 5JJBA 4KXLA 2PBZA 4CMEC 5ISMA 2ALJA 2R85A 4MS4B 3U4AA 1ACJA 3ONDA 5D2CA 2ZUVA 1YCGA 1YIDA 1R7RA 3JTMA 1FLDA 1KI2A 1S3FA 4U9IS 3EIEA 1G21A 2P5UA 2R25A 1P0MA 4LV8B 4PCAA 2O8BA 2QW8A 3DPSA 1P9OA 4CG3A 3A4VA 4CF7A 4XEUA 3RC3A 5CPBA 2C5BA 3BE6A 4GGPA 2QM3A 2NU9B 2HQRA 2UYCA 4LWZA 3VO8A 4HUJA 4G24A 5KWEA 1V8BA 2FB9A 5IDYA 3QU4A 2F64A 2ZSHA 2EBFX 2GYWA 1K9SA 2ET6A 1KVUA 1JAHA 2VSNA 4KZPA 1H69A 1YBVA 3ZDXB 3JARB 1K8RA 4QYXA 1GZ7A 1E0DA 3O73A 3PCXA 1W4AA 3QLVA 2QG4A 3MYFA 3NM4A 1P0PA 3CT4A 3W5UA 2EVWX 5L4SA 4AUNA 4ZICA 4C07A 3OU2A 1OFTA 1LC3A 1V4VA 3POVA 1V11B 5CD9A 4EB8A 3K0FA 4GKVA 3T1HB 1T15A 3OCVA 1V1MA 4NZOA 1XXHB 2HUPA 3A1VA 1K63A 1RXWA 3V4OA 3L1IA 4ZOLF 2A88A 4OQMA 4U4AA 4UZFA 2ODWA 5JPIA 3A06A 3PZBA 1OX4B 3ZTWA 1W75A 3B5JA 3QY9A 4ZCLA 5U4QA 1EHYA 3KAJA 1QV6A 5C53B 1SZIA 3KOMA 4HNHA 3ABIA 1MO3A 2CDRA