1FTSA

Signal recognition particle receptor from e. coli
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
295
structure length
295
Chain Sequence
RSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the NG domain from the signal-recognition particle receptor FtsY.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signal recognition particle receptor
molecule keywords FTSY
total genus 106
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 1996-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1ftsA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ftsA02
4I1SA 2JA1A 2QPOA 2YWGA 5DO9A 2AWNA 3BOSA 4EFMA 3AP1A 4EQ6B 1J7KA 3LDAA 4QHYA 5DYGA 3TAUA 2WVJA 1W2GA 3K53A 2IYYA 3A8TA 1U8AA 3K09C 1NMXA 4HUTA 2GK6A 4UNRA 2CCKA 1KO5A 1I2MA 4ZI3A 4ACAA 5E95A 4BASA 1Y63A 2IF2A 2P5TB 3SJAA 4AYTA 5IDVA 4A2PA 4DLZA 3RWOA 3LW8A 4DRZA 3OEEA 2HYIC 4TLEA 1FUKA 1U90A 2FX3A 4NMMA 1MO4A 1HY3A 3HPQA 2VP4A 4JBWA 3LXRA 3CZPA 1YR9A 1G7SA 2OCBA 4G1UC 4OHVA 2FGKA 3GLIE 1FTSA 1NRJB 4Q48A 3RDPA 4MUBA 4TMKA 1F2TA 3MRSA 4HLCA 3LVQE 4YDSA 5FBVB 1LF5A 4PZYA 1JXOA 1WA5A 3WP0A 3ASZA 3THXA 2F1JA 4L5BA 1P61B 4BUJA 5CK4A 1DBSA 1M8PA 5DN6D 3VHXA 2PZGA 1W4RA 2GCNA 4Z8YA 4ILEA 2YC4C 4KLNA 2VF8A 3KXLA 1KAOA 2V7QD 4YQFA 2OBMA 4LBZA 2JLYA 1WXQA 3NHBA 4ERNA 2JJ1A 3AVPA 4FD2A 4AYWA 3R9WA 3U3JA 1KJWA 3KJIA 4MGYR 1KK2A 1IY2A 3FVQA 4JS0A 2EYQA 2ZI7A 3BE4A 2WJYA 1FQKA 3C8UA 4KSCA 2V7QA 4NYMR 2J7KA 4TWZA 3IQXA 2GZDA 4IEEA 1UBEA 1OH8A 1Z0IA 5KTYA 5EP3A 4LHYA 5L3QA 1IAQA 3PITA 4B32A 1NMZA 3QG5A 1W36B 3H2YA 2QPAA 1XX6A 4Q4AB 5F2EA 4OK3A 2O8DB 1NP6A 5DGXA 3EC1A 1N6PA 1H8ED 1NNEA 3PJRA 1JQLB 3A4MA 1S2MA 2XXAB 3KKPA 3OIWA 4Q01A 2GVDC 5LD2B 2D7DA 3GLGA 2O8CB 4M9QA 2GZHA 2ZRLA 2HUPA 4TTPA 2ZXUA 2VH5R 3B9QA 4DLVA 4Q4JA 1XRJA 4DB2A 3D3QA 1DO0A 1NMYA 2WOOA 3M6AA 3Q7QA 1TMKA 3KJGA 3TUIC 4JVLA 3M1IA 1KK1A 2QQEA 3AVXA 2ZM5A 1OB5A 3NH6A 1Z6TA 3NXSA 1XCGB 2BMFA 1G3IA 4DCTA 3K70C 1IN5A 2B92A 2C9OA 1I2DA 2ANBA 4K81B 1W48A 4RCYA 1G4UR 1E2MA 1TAGA 1LB1B 1BKDR 1OHHD 1OSNA 1ZC3A 4QHTA 1E0KA 2JEOA 5LB2A 2H57A 3OHMA 3QF7A 5B58C 3ZS8A 2LKDA 4DLXA 3QXHA 4Q7MB 3IHLA 5EXSA 5SZIA 3K8YA 2YHSA 1K8RA 3GLIB 3RS0A 4CDGA 2JLWA 5HR5A 3LH5A 4EJSA 1R6BX 1AM4D 1SGWA 1E2JA 4NYJR 2OCYC 2D74A 3OAAD 3NC1C 2ZSDA 3L0PA 3SNHA 1MV5A 1XU4A 2VP6A 4NYMQ 1KDOA 4Y0VA 3VX4A 4PC1A 3OIYA 4IJMA 4UXIA 1T3LA 5EP2A 2G88A 4MYTA 2H18A 3CRQA 1EWQA 1SHKA 4A0HA 1HT1E 1X1RA 3JZMA 2QMHA 3KB1A 3QOFA 3BC1A 4F38A 1RPZA 3IEVA 1EWRA 4PSKA 5EUMA 1OIVA 3NH9A 1QZXA 2VL7A 4IFBA 1W4CA 4JLDA 3DEFA 4RJLA 4LC1A 3IIMA 4TLDA 4FMDB 5TXGA 1S9DA 1Z0AA 4CEIA 2IUTA 4PXAA 4GZLA 4EFNA 1NBMA 3QKUA 2AD5A 1GOTA 4OKSA 4MGIR 1XPUA 1OV4A 5CB8A 2WMOB 5TARA 2XNDD 4QJ3A 2BKUA 4PAMA 2OAP1 3LXXA 3HR8A 4LWZA 1XPOA 1Q57A 3EASA 2QGNA 3DMDA 1M74A 3I73A 4B34A 4HUQA 5FUWA 2GVZC 3AF4A 4KO8A 2IUUA 3QJYA 3SN6A 5FR2A 5HZHA 2YKGA 3WMGA 3WBKA 2MSEB 4HLQB 3LX5A 4P4TA 2ZVQX 1KMHB 1GM5A 3EIHA 3FWYA 2NG1A 1MABB 3TR5A 1GAJA 1KI4A 1ZUNB 2QAGC 4WVFA 2C96A 2GKSA 4XSGA 2C8VA 1FFHA 1E9AA 4PO8A 4Q9IA 1DELA 3TGPA 3DVLA 5EQTA 4GMXA 4FIDA 5DI3B 2ONJA 1G21E 2QUZA 4FXPA 2OFWA 4NCKA 3ADCA 2OFXA 4IVPA 3ZGXA 5CITA 3PEWA 3FB4A 1ZC4A 3FMFA 3GEIA 4JT2A 2G9NA 1XZQA 2JIZD 1E2LA 4FI3C 4LHXA 4OI1A 1XTKA 3W3AA 1J2JA 4Q00A 1E6CA 1QHHA 2ZE7A 3CWQA 1DTSA 3VR4A 2JJ8A 4FN5A 5DH9A 1II8A 1EX7A 1IM2A 1S96A 3LW7A 3MMPA 1ZYUA 3RC8A 2F3TA 5AJYA 2YOGA 4A82A 3OF5A 4YMWA 3AVOA 1U81A 2ERYA 3SBEA 3UK6A 1CEEA 1NSTA 1OH5A 4P4SA 2P3SA 1ZMXA 2BM1A 4RZ3A 4XIGS 2FGJA 3VKWA 3N70A 4B48A 2O8FA 2F1IA 1UEJA 3CW2A 1HV8A 2X77A 1TUEA 4LBWA 1RW4A 4GZMA 2Z5FA 4O2RA 2AR7A 4D0GA 1X1SA 2IXGA 3CX7A 3D31A 1VCMA 3TMKA 3IPYA 5JJLA 3TVTA 1EK0A 2C04A 3NTUA 4K46A 1N6OA 1U9IC 1KTVA 2QTHA 1K5GA 1LS1A 4ZCLA 4F4CA 2A78A 4PHHA 5F98A 3EXAA 3G5UA 2FU5C 2CNWA 1ZUHA 4H1VA 4HZUA 5E4FA 4M9XA 2YNMA 1KMQA 4AIIA 1N6LA 2XB2A 2CK3D 1ZCBA 1JQJC 5JWOA 4D4JA 5C46F 1WDTA 2ZRJA 2VHUA 4Q19A 3C16C 2W6JA 3MWLA 4HDCA 2C03A 1Q1BA 1OFIA 2ZRIA 3TIFA 5BN5A 5EXTA 2HT1A 2JASA 3PFIA 4M1YA 5FOXA 3U7FB 4LI0A 2QZ4A 3CX8A 4TL7A 4TMVA 4JL5A 5FI1B 4WOPA 5KSPA 3ZZ0A 2VPPA 1ZM2A 4D0LB 1ZU5A 3VR3A 1KK0A 5TY0A 1VG9B 2ONKA 3DHWC 1W2HA 3NC0C 1L8QA 4M53A 4W7SA 5FL3A 2IXEA 2JAQA 2L0XA 2WSMA 4B3GA 1N2CE 2ZJ8A 3HU1A 2ASEA 1JPJA 2NO1A 3TSOA 5L3RA 2ZETA 3RC3A 3KXKA 1F5NA 5JRZA 2JLZA 3T1QA 2WWWA 5EZ5A 3T61A 2C2HA 2GXUA 4I1VA 421PA 5K8LA 3QENA 5SZJA 3CPEA 3SDZA 4JLMA 5CYPA 2NTYC 2H17A 1YZLA 4BZPA 3BFKA 3CX6A 4LRWA 1SVLA 4DWJA 1X3SA 2A5YB 3WHKA 4DDWA 3E5HA 2ODBA 4QBGB 1T6NA 3LNCA 2IYVA 4LPSA 1CR0A 3GJ4A 4HAXA 4NP6A 2RGXA 3EAQA 5FOTA 4KBFA 3RSOA 5DHFA 2OUKA 1P9RA 4TLAA 1A4RA 3P1JA 4W5WA 1MRNA 3MSXA 3GLHB 3R9IA 3X1XA 2J9RA 4DJTA 3ZVMA 4Q4JB 1NBMD 5TMPA 4I81A 3W5IA 1CR1A 4Q4HB 3FFBA 1LS6A 1SXJB 2WJIA 4GNKA 2R6CA 1E2DA 3OEHD 4MA4A 5BWMA 4BECA 1U0LA 4LBVA 3VAAA 2F6RA 2PMDA 3ICEA 1QG4A 4LYHA 1XTQA 3GJ6A 1W4AA 4DEYA 3NBFA 4BRWA 3ZDQA 2C77A 2VA8A 5EE5B 3QI2A 4KAXA 4B73A 5JI2E 4RY2A 2IC5A 2O8DA 2OESA 2EW1A 4DT1A 5LBIA 1ZBDA 1NJFA 1ZAKA 2REOA 4KU4A 4Z54A 4URVR 2ZYUX 2P65A 1HQCA 1MOZA 3X1DA 5J4HA 2CDNA 3VR1A 1G3UA 5DHAA 4OQXA 1P2TA 1T4GA 1TL7C 4GL2A 1H8EA 4EJSB 1J8YF 2WSSD 2BDTA 3U2QA 2VHQA 1JEDA 2RMKA 5GJVC 4F92B 2J87A 1NVUQ 4QXAA 2BBTA 1Z2CA 3Q3JB 5DSZA 1UF9A 3UIEA 3PEYA 2PEZA 4V03A 1AGRA 4IDNA 1QHGA 4TYYA 4RFVA 4WXRA 4EPWA 4URWR 3QKRB 2UZIR 4H1UA 4HB4A 2KBEA 3TVDA 2GJ9A 4JVNA 2I1VB 4V0ME 2RHDA 2ZJ2A 3ZVRA 4RD6A 1G8HA 1Z83A 4DC9A 4BFSA 3AP2A 1E2IA 1XZPA 3JVVA 1JB1A 1AZSC 4D82A 2MSDB 1AN0A 1N5LA 3AEZA 4QM7A 4CEIB 2ZREA 3TQFA 4FW9A 4JJZA 5JEEA 2GAOA 1MO3A 1T5IA 1W0JA 2ZANA 1QHXA 4Z8XA 3B1YA 1E9SA 4QGAA 4M21A 4ZPXA 4FWTA 1J70A 3B1VA 3O8CA 3FDIA 2O0KA 1VG1A 2QQ0A 3W6OA 1KZ7B 3QXXA 5C4GB 2V8OA 4PHTA 2WJGA 3SJBA 1XD8A 3SE0A 5JRJA 5L3VA 1G4AE 3B60A 3QPWA 1FW6A 3L2OB 4JVMA 4FMDF 3VMFA 5TVKA 2JLRA 1OXUA 3TK1A 4DSUA 1RRCA 1LF0A 1KMHA 2ZUDA 3EPJA 4BEBA 2KJQA 4QFMA 1MR3F 1UDXA 4BEJA 2GJAA 1XNJA 3REFA 1GKIA 3QEJA 1HE1C 3QNUA 1YZUA 4F4JA 1E2NA 2GA8A 2HCBA 5AJZA 2I1QA 4LV8B 5P21A 2JLSA 3I4LA 1E1QA 1U8ZA 4JLJA 1Z2AA 3RSLA 1DG1G 1HA3A 3K70D 1NY5A 3NDPA 3LQQA 2NO6A 3P4YA 3SQXA 2OSBA 1OT3A 2WWHA 4ZDJA 3AF2A 3N2EA 1YVDA 2WJJA 1SXJE 5BW8A 1CIPA 1V5WA 3P26A 1ZNXA 4W5HA 1GKUB 2OHFA 2C9YA 2NMVA 3VX3A 3SHWA 3U7GA 3IO3A 2F9MA 3CR8A 1M7GA 1U94A 1G3MA 1JJ7A 3GLGB 1QHHB 3B1WA 1RRPA 2PT7A 3HJNA 4PHFA 1NJGA 3VU9A 3E70C 2IYUA 3EWAA 1KSFX 3VR2A 1BH2A 1MABA 1GP2A 1L4YA 1E98A 1W44A 4EPVA 2WIAA 3IKJA 2ZI5A 1A1VA 2GK7A 3BJIC 4XJXA 5JCPA 3U44B 2R65A 5GJCA 5FTKA 3ZYCA 1M6NA 4O2LA 5J4VA 2O8FB 3UMSA 4C0LA 2IS6A 4Q9JA 2QRZA 2WAXA 4TQAA 5IF9A 1VIYA 4A8JC 1M2OB 2B8WA 3AM1A 4OI2A 1NKSA 1TADA 3B7GA 1RRFA 1X8LA 2G1JA 2PMKA 1H65A 3SFVA 4JIMA 2PZEA 5LDDC 4BLPA 3A6PC 1HE8B 3IBYA 3B78A 3NVAA 1CR2A 4OHZA 4E5UA 2O0HA 1LW7A 3LVRE 2QBYA 1FOEB 2BHRA 4I4LA 3V4RA 2RAPA 1JALA 2ZR9A 3PV0A 3WMEA 1Z29A 1KNXA 1GUAA 2ATVA 3B6EA 1R8SA 4OK6A 2SHKA 5M04A 2WWIA 2XNDA 2BOVA 1XXHE 4OL0A 2ODWA 5AK0A 2QY9A 2Q3HA 4C2TA 2JDID 2Q3FA 4L9WA 2EFHB 4JL8A 4M1OA 3TE6A 2ZYVX 2RCNA 4LYFA 3VNVA 4A0FA 1L4UA 3I3SR 4I99A 5IT5A 1DE0A 1P75A 4FCVA 3BXZA 2DFLA 4M1KA 4CIDA 4NBSA 2YWHA 2O8BA 4DDUA 1XJ0A 2QSYA 4JLVA 5AUOB 2ZJBA 1FNNA 1TF7A 4I1UA 1VMAA 4NZYA 1G17A 3RWMB 1P72A 2BMJA 4Q1DA 3K9GA 3QKTA 3SHFA 3K9NA 1XTIA 1P2VA 1YZKA 2JJ2A 5FOWA 4JVSB 2NO7A 2ZE8A 4CGZA 2QM7A 1Z0KA 1KAGA 4Q4AA 4DLSA 1P2SA 5KSOA 1P73A 4YMTA 2DR3A 3L0SA 4G5QA 1ODFA 2V1XA 4WZAE 4F7WA 1DAFA 4TYPA 2RGNC 3SYNA 3EA5A 2ZSBA 5A5GA 2BWJA 1IXRC 2WAYA 1YR6A 4D4KA 2C99A 4TTQA 3ZQJA 2QL6A 4DKXA 2FSIA 4B74A 3GJ8A 1JAHA 1BMFA 3IILA 5FOSA 1E2EA 2J0QA 2GF9A 1EG7A 1WE2A 4ZIRA 4FCTA 3NWJA 4FMCF 3QUSA 5KDLA 3CM0A 2PX3A 2YC2C 2Z6VA 2XJ4A 4LJ6A 4P4UA 3ZVLA 3SC3A 2RGCA 5C2JB 1W5SA 3NBXX 2ORVA 3FYHA 3KUCA 3ZJYA 2HJGA 5AWFC 5JECA 3VKGA 4QKQA 2W58A 3QKSB 4IOJA 1TQDA 1D9XA 1VHTA 1BYUA 1E1QD 5FBRB 4G3XA 3NBZC 1L7VC 2IHYA 4GDFA 4Q1CA 2W2XA 4F4IA 4ZO4A 4BWYA 2WKPA 1ZJ6A 5FL7D 5K8TA 3AB3A 5EXXA 1H8HA 1CS4C 3UANA 1D8TA 4C2UA 3LA6A 4Q4LA 3AVWA 1HQYE 4OI4A 2ZRAA 4UNSA 4LY6A 2W0MA 4JLBA 3QBTA 2IL1A 4B3DA 3TW8B 2RGAA 4MYUA 4U00A 1R10A 3MG9A 3EC2A 3ZLJA 5CB6A 3TJZA 1H8HD 1XD2A 3A1TA 3DOEA 5HTKA 5J4YA 1TPZA 1G41A 4CRWB 1E0JA 2GXQA 1DAHA 5CM9C 4L9SA 3KX2A 2Z83A 2VP2A 4N0EA 4TT3A 1SKYE 2PZFA 1RYHA 2W2TA 1JNYA 1TEXA 3KL4A 1CF4A 3BK7A 1IN8A 3DKPA 2NGRA 2JLQA 1DS6A 3CR7A 3AF3A 3FMOB 1NVVR 3PVSA 2YWEA 1SVKA 1NF3A 2OXRA 4IXNA 5AJXA 1XEXB 5JWHA 3KFXA 1KI3A 2C5LA 4OBEA 1E2FA 4TMWA 1S3GA 3VR5A 2J41A 3KB2A 4R98A 4OHWA 3LD9A 3T1VA 2EVWX 4AKIA 2WICA 4KFUA 1CRQA 1MO5A 4MYHA 2ODNA 1ZW6A 2HEIA 1KJZA 3QF4A 4ZCIA 1GIAA 3DMNA 4AKEA 2WMNB 4EPXA 1P6XA 3U5ZB 4PC6A 2FFHA 4A0GA 2PH1A 2ZQ5A 3KJEA 4WZBE 1TU3A 5DI3A 1PLJA 3GCGA 5FOUA 3ZZTA 4IFEA 3FHCB 4LZZA 4PQFA 1A82A 2XX3A 2KE5A 3CF0A 2WKQA 3OFND 2WBLC 1OH7A 4JKYA 1IXSB 1G1MA 2V6IA 4Q1BA 4X8LA 4XD7A 3UG7A 2P0EA 4HEJA 4HB3A 3BWDD 1WF3A 3DL0A 4GPTA 1SQ5A 4HZIA 4MRSA 3QPVA 5C4MA 2WTUA 1Y3AA 3MWYW 2J46A 4A6XA 3Q85A 2XZOA 1FNMA 2JDIA 3TQCA 2CLDX 3GEHA 1NVXQ 2EQBA 3A1VA 4NONA 3BFXA 1DAGA 2JIZA 3WRXC 1XF9A 2RGDA 3A58B 3NG1A 3AP3A 1KI2A 5SZKB 2ZTSA 1E79A 4TL9A 3U6KA 3WNDA 5K8UA 1VKJA 3D8BA 4KV9A 1HYQA 3GJ7A 4EIWA 4DCSA 2FZLA 2ERXA 5EXPA 3L82B 1S4QA 1XEWX 5HE9A 4TQ9A 4V0MA 3L0OA 2G0NA 1VTKA 1E2QA 2DWPA 3W34A 2VIIA 3G82C 3THOA 1EFRA 1YZNA 5FPHA 4DCNA 1JBKA 2AN9A 3F3YA 1N6IA 4TSFD 2CL7X 5FTNA 3TSZA 2QA5A 1RE0A 1ZNZA 4KVAA 3OE7D 5L3SA 4A9AA 2CNWD 3CBQA 4QRHA 3RS2A 4LUCA 1G5PA 2X2EA 4Q1FA 4ARZA 4IVQA 1YZTA 2OO7A 4JT4A 1WMSA 4AYXA 4URXR 1FUUA 2BBWA 1ELOA 1YR8A 4RKEA 5JJIA 2GCOA 4NYJQ 5J47A 3EPHA 4GMDA 4TQUS 4IVRA 2BKEA 1FX0B 3T5DA 1TTTA 2A5GA 2QROA 4A4DA 2A5FA 4YONB 2FV8A 3HR7A 4KITB 1OIXA 3P32A 1XTRA 3BGWA 4KHZA 2ZJYA 1US8B 2EFDB 3MUFA 2ZRMA 1CXZA 2FA9A 1KY3A 3BB3A 3RAPR 1CLUA 2QBYB 4R7ZA 5EJEA 2VTKA 1D2MA 2MMCA 3PIRA 3RS3A 2PCLA 1TF2A 4BFXA 5H68A 3OAAA 1IJFA 3CRMA 2Y8EA 5FH9A 3QG1A 3BB4A 3CUEF 1RC8A 1FP6A 4TZ6A 5E3HA 1E2KA 4LJ9A 2J0UB 3WBJA 1MRSA 2A3RA 4DDVA 1ZD8A 3RS5A 1Z6YA 5AUPB 3BH0A 1OH6A 5FI0B 4C7OB 1SVMA 4BLRA 5FPKA 2ZU0C 1VDZA 3AGQA 3I1FA 4HAVA 3JVUA 1TU4A 2RH5A 3RNLA 1T8UA 3KKQA 4LV5B 1SKQA 3RYTC 3PR1A 2F43B 1ZU4A 2J7PD 2WJHA 2B21A 2R8RA 3E2IA 3KJHA 4X8OA 1E96A 2KI5A 2CL0X 4NCNA 4QGHA 5FTLA 5H8WA 1FL9A 4PSVA 1GL7A 2OXCA 2NZJA 3GJ5A 3UMFA 2ORIA 2CLSA 1XEXA 1YQTA 2QM8A 1R0ZA 3X1ZA 2Z0MA 3ZQ6A 3QPUA 3U60B 2RB4A 5JBQA 3SOPA 4LYJA 5LD2C 2IT1A 4B76A 1QVAA 2J45A 721PA 4JSYA 3GLHA 2NO9A 2VEDA 2DBYA 1F2TB 2HF8A 4EJSC 1N6NA 2DWQA 3K0CA 2GDJA 1F60A 1KO4A 4NH0A 4BFUA 1E0SA 4GP6A 3HDTA 4GP7A 1Q44A 3DPUA 1HT2E 1FMJA 4AG6A 1A7JA 4TLCA 5FUXA 5ELXA 3KUDA 4KODA 3AUYA 4Q7LA 4UXHA 3IIKA 5EP1A 3RS4A 4BFVA 4EFLA 1G9XA 4M1TA 4EPTA 1UJ2A 1YE8A 4LJAA 1DPFA 2FFBA 5JEDA 1TNDA 1UBFA 2BVNA 4UJ5A 4DLYA 3GEEA 4DT1B 5KSZA 4M9SA 1NLZA 2AFIE 3BERA 2VO1A 4B2IA 2JATA 4WXPA 4JSTA 3Q9LA 4V02A 3PXGA 1XTSA 1UM8A 4MRNA 3U7EB 2J0UA 4YXWD 5JS7A 1CJUC 3Q5DA 3RRNA 4XVUA 3UWKA 4B3CA 1GZSA 2XOKA 4EQ6A 1RJ9B 4KVGA 2IWRA 2OM2A 3NEYA 3QBVA 3GLFB 1UAAA 4N3NA 5G41A 3FHTA 2ZIAA 4RZXA 2ZS9A 3DKVA 3QE0A 3I8SA 5FTJA 1JECA 4PQYA 3CNOA 4JBXA 1WBBA 1D2EA 2ZRGA 2IS1A 3AKEA 4C0SA 4G01B 3BFVA 1IJEA 5KNBA 4Q18A 3BRWD 1DEKA 1KYIA 1SVWA 1EX6A 3PCRB 3MCAA 3CRVA 3W6PA 1ZD1A 3FGNA 4TZ0A 2R6AA 2XOKD 2FJUA 1K5DA 1YR7A 4PZLA 3O47A 2CBZA 4JBYA 1NKTA 2AK2A 4DIDA 5GJBA 4AK9A 1JPNA 5CDFE 1NLYA 4YXWA 4GT1A 3QF4B 4CW7A 1DAEA 3MWKA 4M8NE 1GITA 4JYBA 3R7WB 3O8RA 1GVNB 1F6BA 2OAQ1 1UBGA 5DLQC 1DAIA 2AFHE 5AJWA 1I4LD 1ZM4A 1G18A 5KO2A 3Q72A 4JMPA 5EE9A 1ZM7A 1GILA 3T34A 3AGPA 4DSOA 3OZXA 5IRCD 1G16A 1N0VC 1F2UB 4NYIR 2P2LA 2CVHA 4IOLA 2GEUA 3B85A 4NE2A 3FOZA 2XZLA 1P62B 2V1UA 2Z4SA 2HLDA 2PT5A 2X19A 4E03A 4BQSA 3WNBA 1II9A 1Z6XA 2GF0A 3G0HA 4KSBA 4DB4A 2O8EA 3A37A 3BD9A 2A7QA 4TMZA 3ZIAD 4M9ZA 1KI6A 2BCJQ 3EZ2A 2PBRA 1NVWQ 5B64A 3H84A 1KKMA 2G83A 2ORWA 2ZROA 4C0HA 4B75A 3GFTA 1SVIA 2BIFA 1B23P 1E9FA 3NIBA 4LHZA 2AXNA 3WY9A 1OXTA 4NCIA 3HU2A 2FH5B 4GBMA 4R71A 2IYXA 2IWHA 2H5EA 2CCJA 4MRRA 1OIWA 3A36A 5CDFA 3RRZA 4DSTA 4U7DA 2O8BB 5FUYA 2QNRA 3THXB 2GTPA 4B3FX 1U0HC 3X2SA 2CHQA 4LJ4A 1YJ5A 5GADl 1IY1A 4QGGA 1NN5A 3UWOA 1SXJC 3T06B 1D6JA 5JWRA 2GJ8A 3RHFA 4M1WA 2Z43A 5EUQB 4I1OA 3PUZA 2IYQA 5FTMA 4C3ZA 5FL7A 5A0FA 3K0AB 4Q9HA 1AZTA 4ZDKA 2I3BA 2EFCB 1P9WA 3U3MA 5ANRB 1UFQA 1QG2A 1LVGA 1XXHB 3K09A 4B43A 4B47A 1COWA 3RABA 4YLGA 1UKZA 1RRGA 2XTNA 1E3MA 1D9ZA 1ESNA 4JLNA 2IUSA 3VQTA 4ZI2A 2OFOA 2ZR0A 4G5OA 2QMUA 1E2HA 5FPSA 3DDCA 4ZIRB 1Z22A 1OXXK 3CLVA 3MGCA 3IDQA 1W49A 3SR0A 2CK3A 1XD2B 4A15A 2IS2A 4RCZA 3KQNA 1RVDA 5IHPA 1G8PA 1Q1EA 1OPXA 4UXJA 1OKKA 3CPJB 1KOFA 1X86B 1B0UA 2HCJB 1EXMA 4DIEA 821PA 1GWNA 2B6HA 2V4ZA 1T0JB 2IK8A 1AGPA 5J4LA 5GVRA 4LJYA 2ZJAA 3GJ3A 3LAWA 4C0AC 4PPFA 3V9PA 1V43A 2QI9C 3RLFA 3PG5A 4G5RA 4LOAA 1OKKD 2D2EA 3A1UA 3AUXA 3ND8A 1S8FA 3M0EA 3TNFA 4Q47A 3AVQA 2ZRKA 4A2QA 4Q7KA 3AQ4A 2ZAOA 3I5YA 2ZRBA 5JCZA 4C7OA 4MITA 3CONA 4L16A 4WZ6A 1AS3A 3QIAA 2REBA 2XTZA 2QN6A 4TN1A 1XP8A 3CF6R 2X1VA 2ZUCA 3I8XA 4PC7A 2V55B 2QRNA 1KIMA 2VF7A 4G5GA 3GLHE 1COWD 2C95A 1SKYB 3EWSA 1R8QA 4KFRA 4MDFA 1GRQA 3THYB 2FOLA 4E09A 4O0MA 4MDEA 4D25A 4A36A 3LX8A 4FCWA 2P6NA 4HAZA 1G8FA 4P31A 5HCNA 2BJVA 2A2ZA 2WIBA 3NDBB 2YV5A 4PPGA 1UADA 4WAUA 3C41J 1E94E 2KB0A 3C4JA 1UPTA 1YZQA 2YINC 3NBYC 1US8A 2Q21A 2CJWA 1XXHA 3OIUA 5J5CA 4QJ4A 1T5LA 2OILA 4DXAA 5C18A 4OQFA 3PQCA 4LK2A 4F91B 1RZ3A 2F43A 1OHHA 3R20A 2E1RA 5KNDA 1DAKA 1WP9A 2ZVPX 4R9UC 5H70A 2D3WA 4XH9B 3IQWA 4MRPA 3T5GA 4XVQA 4KLZA 2FE4A 1XMIA 1A2BA 1QHSA 3LRPA 5CJPA 4B2PA 5J4KA 2ANCA 4Q66C 3U4QA 4Q03A 4RFSB 1G7CA 1OYWA 1OXVA 3K1JA 3B8HA 3WYGA 4PTLA 1UBCA 2YWFA 3ADDA 3AV0B 2OV2A 4DHEA 3X1WA 1U99A 3FKSA 3H0KA 2VSXA 3K9LA 1W0KA 2ZI3A 4OQLA 3GMTA 4Q21A 4V0OA 2FMXA 4S2EA 4C0QC 4LDJA 1G7TA 3IGFA 1W47A 3OEHA 1N3BA 1XWIA 3SU8A 4ZV4A 2R62A 3W6NA 2YJTD 1QHNA 4IDOA 3ETLA 2AKYA 1Q1QA 3I5XA 3IBGA 2KWIA 5D3MA 1R5BA 2Q6TA 3Q7PA 4TYQA 1XPRA 4CT4B 2HDNB 1KY2A 3F0TA 4BZQA 3FMIA 4B3BA 1HUQA 2UVQA 4KXFB 3EW9A 4HDQB 5FPYA 4U5XA 3U3RA 2C98A 1PUIA 5AJVB 4XD7D 3BIFA 2OZEA 1AQUA 4IOKA 1A5TA 2H1LA 3PEUA 2CXXA 3L8YA 1NN0A 1C9KA 4DLRA 2QAGA 1JEEA 1Z28A 1LNZA 1G6HA 4RD3A 1CJKC 2IEZA 1N5JA 3TLXA 4ESVA 2WWGA 1OE0A 1G20E 5JZVA 3V4FA 1ZD9A 3QXJA 121PA 4P0TA 2LCFA 3F5FA 3TRFA 4BZXA 4RD1A 1QHIA 3EPKA 1JAIA 5EE3A 1W36D 2ZITA 2OCAA 1OJLA 1QBKC 5E7MA 2CE7A 1GSIA 3LBNA 4W5JA 3PUWA 2IA5A 3DM9B 2IX3A 1DADA 3A4LA 3UMRA 4PPNA 2GCPA 1AJEA 2FFQA 2NIPA 2QAJA 2VLIA 4HLUC 1E4VA 3MJRA 1M7HA 1IN4A 1ZNWA 2J1LA 2OG2A 2VSOA 4PQRA 4XTRA 4OHXA 1G291 3PUVA 4TMTA 2IYSA 2OBNA 1CKEA 2BMDA 1K6MA 2FEMA 3WYFA 2P5SA 4FMCB 5SZHB 4TL8A 1MT0A 2ZRNA 2ZSEA 1L2TA 3UG6A 1Q20A 4EDHA 2J3EA 1Z6GA 2FSFA 4EKDA 2OT3B 1TEVA 2WM9B 5BN4A 5JSZA 3FTQA 3T1TA 1IOZA 3F8TA 3PUYA 1AQYA 1W1WA 4PO9A 1VIAA 1YRAA 4C9BA 1FX0A 4JL6A 3EIQA 4U02A 2FFAA 4QBFA 4Z1MA 2J59A 3WP1B 2XAUA 5G53C 4YMUA 1XMSA 1SVOA 2BMEA 4B2LA 3HWSA 4A6PA 1XEWY 3B13B 3FHOA 4Q7JB 2VP5A 1OFTA 1E32A 4WA7A 1EFHA 4CEHA 2WSSA 2YOFA 1Q22A 4IKEA 1PV4A 1VG0B 4OK5A 1ONBA 1E9CA 1W0JD 4RKFA 5JMTA 1N5IA 1LY1A 4CT5A 2G77B 3ECCA 4US0R 5KDOA 1ZCAA 3EA0A 5CLQA 4XWKA 1ZUIA 5E7IA 4TYWA 5DISB 4W9MC 3MLEA 1DG3A 2FNAA 2FSHA 2ZS7A 1XB2A 5EE1A 2ZEJA 4S35A 621PA 4MYCA 3GPLA 2LWIA 4EUNA 1G3RA 1ZNYA 3RVBA 2YZ2A 2CEAA 3HYRA 2B7CA 1OB2A 4O3MA 4KFSA 4KCGA 2ODEA 4N1AA 1CULC 3KKNA 5UKDA 3TW4A 4CYMA 1GTVA 2GESA 4Z1MD 4BFTA 2V9PA 5KHOC 1G6OA 1KGDA 1E0AA 5KSYA 4KYIB 1R0WA 1XJQA 2NQ2C 4A8JB 1YHNA 4PPQA 2ZI9A 3OESA 3KDSE 2R6GA 4GOJA 4C30A 3LO5A 1J99A 4L8GA 1W36C 2V6JA 2WWXA 1VECA 3LLUA 1G8GA 1T3SA 1VG8A 2DPXA 3ZIAA 5L8VA 1BS1A 1CU1A 3SBDA 4GOXA 1XMVA 2XJ9A 3BBPA 2GAAA 3H86A 4LHWA 4XWOA 4IDQA 5HKKD 5EP4A 3W8RA 2ECKA 3W9YA 3R9XA 3AH8A 2R44A 1XDBA 2EWWA 4KFTA 5TV2A 1BMFD 3Q5EA 4JJKA 1Z8FA 5FBWB 1NVVQ 4GFDA 2B8TA 1MKYA 5G3YA 2REXB 2FPMA 4JYCA 4JLPA 1BYIA 2WWFA 3RANA 3GLFE 4LCBA 3THWB 1W4BA 3C7KA 2NOAA 2HF9A 4US1R 2QENA 2F1HA 1PLLA 1R0XA 5IK2D 4IEIA 5KPDA 1ZIPA 5KOYA 1BOFA 1KI1A 1I4DD 1MH1A 2JJ2D 2MMGA 1IONA 3CB4A 4FINA 3QVUA 2E87A 1ANKA 1VCIA 1O3YA 4EPYA 2JCSA 1NY6A 1LV7A 1W7AA 3GLFA 1LTQA 1P9NA 4AC9A 1N6KA 4PR0A 1R7RA 3ONWA 1JR6A 4BPBA 1NN1A 4M22A 1GKYA 2H16A 1S3SA 4DUGD 1F3OA 4RD2A 2DCUA 2IXFA 4UNQA 5KNCA 2QPTA 4AD8A 1XJCA 5D3QA 4YC7A 1GRNA 2H8KA 2UKDA 3QSYA 4QHSA 3AKCA 1CP2A 2N42A 1GNPA 3AF0A 3KZ1E 1KDPA 1IY0A 1DVRA 1QHYA 2IYRA 2QE7A 4UKDA 2YVUA 4V0LA 1KO7A 2R9VA 2VRWA 4POAA 3SFZA 2FG5A 1PUJA 4HI0E 4DCVA 1JR3A 3KFVA 1E79D 3K0EA 2HT6A 4B6EA 1G5RA 2XEXA 4BFWA 3SJCA 1VPLA 1SVSA 4QNMA 2WZQA 1EFUA 3DZ8A 4GRAA 1PLKA 2AKAB 4HATA 3ASYA 4AG5A 2IBMA 1AK2A 3GJXC 4MUAA 3FPAA 3N5CA 4DDTA 3FE2A 4JLOA 4C0KA 2D62A 1JI0A 2XZPA 3K0SA 1BIFA 2FWRA 1OF1A 4DUGA 5HKKA 4KYUA 3AVYA 3QVVA 1SULA 2D7CA 2WHXA 2V54A 4JLKA 4HYYA 3EZ6A 1YKSA 1RYFA 2OLKA 2RGNA 3GFPA 5G3ZA 4D26A 1F2UA 3PEVA 3T15A 1KO1A 4URZR 3VTKA 4WIAA 521PA 2AXPA 2VHCA 3VU9B 2FSGA 2XB4A 2HXSA 2HXYA 1ESMA 1CR4A 1Q1ZA 1WQ1R 2XNSA 4MKGA 4ZKEA 3TBKA 1FP7A 2QAGB 4J0QA 2V3CC 3T35A 4ASUD 2ZJZA 2GEVA 4ESHA 3SQWA 2E9SA 1HEIA 2AHOA 1JJVA 2XSZA 4FMBB 3AVTA 2DY1A 4Z51A 3IPXA 3K0AA 1GL9B 5F9FA 4AI6A 4PSAA 1N5KA 5DN6A 1O87A 3CPHA 1EESA 2IHBA 3P20A 1ZINA 5J40A 4JKIA 5HE8A 2FPKA 4TT3D 5CM8B 1X6VA 4H9GA 1DOAA 2AWOA 1R2QA 2KSQA 4DLTA 1S1CA 3LWNA 5HZKA 2OCPA 4AURA 4XOIA 3M4YA 3SYKA 4BLQA 3K70B 2G3YA 3P4XA 4D80A 1TQ2A 1YZGA 3OIVA 1AS2A 1U2RA 1GFIA 1KNQA 6Q21A 3EZ9A 2EU8A 1U0JA 4UQOA 1E9BA 4N0DA 2X8AA 3KQKA 3IIJA 3OEED 1Z0JA 4MRVA 4TL6A 2GBLC 4ACBA 4OYHA 1KI8A 5CLLA 4RVCA 5BQ5A 4MKFA 2W6JD 3W5JA 2IYLD 3L0IB 4BGDA 3A4NA 2JLVA 2J7PA 3WRYC 1OFHA 4HDOB 2QEQA 3DO6A 4YDHB 4NL4H 2XSZD 2CVFA 1II0A 4QG7A 2QE7D 1NLFA 5JHHB 2EFEB 1T0HB 2DFNA 1N6HA 4XVRA 4URYR 4CZ2A 1OW3B 2Q9AA 2IYWA 5JSZB 4D4LA 3TSWA 5DI9A 5BXQC 1VCOA 3EZ7A 2VSFA 4PAQA 5GVSA 1FQJA 2EFGA 4LX0A 1P2UA 2F3RA 4LJ8A 3BH7A 3QY0A 1ZIOA 2D06A 1AIPA 3FFAA 4E07A 1W46A 1XD9A 3KTAB 4A2WA 4D0NA 1E9EA 3D7MA 4HSEA 2PJZA 1MO6A 3LY5A 3IHWA 1EGAA 4OQNA 3R8FA 4IOMA 2XITA 5K8IA 1KDTA 4URUR 1RFLA 5A4JA 3I61A 2HLDD 5CIWA 3THWA 4LV6A 3CO5A 3EARA 4D2IA 2G0TA 4A1FA 2DYKA 2HV8A 2F55A 1G64A 3U61B 4F93B 2A9KA 5IK2A 5KU1A 1DO2A 5CJ2A 2OE2A 2ZS8A 4IRUB 4Q9KA 1BO6A 1OLOA 5TB5A 4KI0A 4ASUA 2BEJA 3TAHA 1HTWA 3HYTA 4X8HA 3U44A 2PLFA 1C4OA 4LJ5A 1EFRD 3MWJA 4NPHA 4WW0A 4CF7A 4DLWA 2FEOA 2O52A 1IN6A 2VHJA 1R0YA 4MGZR 4XTCS 1Z06A 2K5UA 4M2LA 3SJZA 2ZI4A 2ZRHA 3AKDA 2WPDD 4RD0A 2NPFA 8OHMA 3BH6A 2BEKA 1WCV1 2AK3A 3SZRA 4BLSA 4GSYA 2ZRPA 2ZSFA 1IXZA 1J90A 2GRJA 3C15C 2Z4RA 3QXCA 5FOVA 4JLAA 5GJWC 3EIEA 3BB1A 3U3OA 2ZJOA 2ZE5A 4LHVA 1FPMA 4C0JA 3U7HB 4LYAA 1M1YE 1OFUX 2J0SA 1S9HA 2ZRCA 3GP8A 1Z63A 2WKRA 3QEOA 4KBGA 3DM5A 4NTZA 2N46A 2QG6A 3O8DA 3S1AB 3CWZA 4MKIA 3U4QB 1J8MF 3LV8A 3O8BA 1QDEA 1AKEA 4B6FA 4BFZA 4UNNA 3NKVA 4QOSA 1VHLA 1G5TA 1IBRA 5BN3A 1XTJA 3UKDA 1NBME 4A92A 2GJKA 4BFYA 5F9HA 4B44A 3LQRA 1Z5ZA 3NHAA 1D5CA 3X1YA 4M0LA 4QBIA 2NZ8A 3TUZC 3RS7A 4CVNA 2ZR7A 3IEUA 4P4SB 5CYOA 3PUXA 3UATA 4L15A 3GLGE 1IN7A 2YOHA 2CE2X 4CEJA 1GG2A 4PFSA 1Q3HA 3R8CA 4A8JA 1E9DA 1XEFA 1NG1A 1T8TA 2DHRA 3C14C 5D3MB 2JLXA 4US2R 1G3QA 4IDPA 4V0KA 3TR0A 3DZDA 3EX7C 4MQBA 4NKRA 3VR6A 1JR3E 2GXSA 4D81A 2W00A 4DLUA 4BRUA 4ZCMA 2AX4A 1AKYA 2Q9CA 1XFAA 1ZVQA 3L8ZA 4QC2A 3CNNA 4TTRA 5JJKA 1U98A 4DZZA 1YU9A 1D2NA 3SS8A 4ABYA 4E22A 1UDWA 1ZP6A 2ZJ5A 2OLJA 2PX0A 5AR1A 3TH5A 4AY2A 2IYTA 1IQPA 1TX4B 3K0FB 4G0NA 4Q1EA 3KKMA 4NDZA 5B2ZA 1G19A 3T12A 1KKLA 1TUIA 1KHTA 1UKEA 1P60A 2VYFA 2IS4A 5AUNB 3IUYA 4RZUA 2QMOA 4RD4A 5B57C 3SYLA 2PJRA 2CMKA 1T3HA 3H1TA 3C5HA 2GNOA 4LPKA 1II8B 2ZRFA 3L43A 2GXAA 2AL7A 2A5JA 2CHVA 2RKOA 2FF7A 4C0BA 2NPIA 5HPYB 4CEHB 1KDRA 2RGGA 1JR3D 1KZGB 2GBLA 2EYUA 3KQHA 2GILA 4HAYA 5FBQB 4Y0AA 5BYKA 3AF1A 3SI7A 3K0CC 2ZRDA 4QM6A 3LLMA 2QTFA 1VYVA 3W8NA 1P3JA 5DYIA 1VYTA 1Z08A 5FBLB 1Z3IX 3REGA 5KUTA 4QNRA 4CEJB 1AA9A 1CJVC 5AUQA 4DBLC 2ZI6A 5DNYB 4K8OA 2VP9A 1N0UA 1P5ZB 1Z47A 4BLOA 4C4PA 3H4MA 4V0NA 1Q12A 2F7SA 2W83A 3B1ZA 2XXAA 5CK5A 5LPNA 3CKLA 4OJQA 4PAOA 3RRYA 2QT0A 3A1WA 2G6BA 4B3XA 2WPDA 3CZQA 1SXJD 3T1OA 2AD1A 1M34E 3B1XA 3VKHA 1QRAA 4UNPA 4PANA 4D6PA 4NCJA 2ZU6A 2B7BA 1ETUA 5FFMA 3SEAA 3ZZUA 3LBHA 5B30A 3KQUA 3HP1A 1OXSC 4DCUA 3HU3A 1A2KC 4BE7B 1GL6A 1IHUA 3ICQB 4B35A 2VP0A 5F3WB 4A0RA 3W3ZB 1N25A 4LJ7A 4Q4HA 3LFUA 5JLJA 1W0KD 4YMSA 1X8KA 3LBIA 4GI7A 1NL3A 5DE3A 2IF0A 5KPJA 1YRBA 1X8JA 1EFTA 1TQ4A 4MKHA 4GOKA 2WV9A 3E1SA 3VNUA 1Z0FA 3EPLA 1Z6AA 5KDDA 4M1MA 5FUVA 4PC2A 3AKYA 1EFCA 2HJVA 1E69A 4IDHA 1FZQA 2N1BA 1DAMA 4Q1AA 4OHYA 1W5TA 4Q02A 3THYA 5FPTA 4FWIB 3FMPB 4M1SA 2R2AA 2CHGA 2DFTA 2QORA 4DVGA 1FMLA 1I4TD 1E2GA 4O25A 5L3SB 1XCPA 1Q0UA 4P32A 1F48A 3EZFA 2H7VA 4L4UA 3A1SA 1PZNA 1NI3A 2PCJA 3BAFA 3UXMA 1R4AA 2GZAA 4B33A 2VBCA 3ZD6A 3HPRA 4PO1A 4TSFA 4UJ3A 1ZRHA 2Q0HA 4HZUB 3AVUA 5H1YA 5JS8A 3N2IA 1NN3A 1SZPA 2JGNA 1P4SA 2DWOA 4TYNA 2QP4A 4HUQB 3ZVNA 3EG5A 3GJ0A 1M7BA 2XTMA 1GRRA 4RSGA 3WNCA 2I4IA 2BC9A 3JZAA 1WRBA 4AKGA 2O5VA 4TLBA 4HLUA 3WXMA 3ZD7A 1CRPA 3W90A 3ZH9B 2DFKB 5JFGA 2RGBA 5G40A 2PLRA 2R6DA 2PEYA 3WYAA 1QVRA 4ARZB 3ADBA 2MSCB 1E2PA 1T9HA 4OI0A 1RIFA 3CRW1 2P67A 4Q5IA 1G8YA 1R5OA 3GQBA 4PZZA 4EPRA 3I62A 1KI9A 1TQ6A 4YMVA 1E1RA 2YYZA 2XGJA 2GEDA 1U9IA 4IW3B 5E7JA 4WBSA 4D4MA 1C1YA 1JXMA 2QP9X 2HYDA 3P27A 1HURA 2QMEA 3S1AA 3OFNA 4HAWA 1QF9A 2J0VA 4QJ5A 4XWAA 2O8CA 1RKBA 3B5JA 2BM0A 5L3QB 3I72A 2FN4A 2BCGY 4NCHA 3WMFA 5JHGB 3KQLA 4JZKA 2IEYA 2QT1A 2W6ID 2ZAMA 1CJTC 2WJVA 4AWXA 2FPLA 2ZE6A 2ZUBA 5BYJA 2CL6X 3CNLA 1SHZA 5CIQA 1Q3TA 4BLTA 1CTQA 2Q3MA 1PJRA 1ZM3A 2PL3A 2LKCA 1KJYA 1HH4A 3CIOA 1R5NA 5EZ6B 2QSZA 1LFDB 2GWHA 2Q9BA 1KK3A 1GDDA 1E1RD 1KO8A 2IW3A 2O0JA 4PC3A 2QGZA 3GFOA 2ZYTX 4IXMA 5JI3E 3K9HA 3Q8XB 3UPUA 1NIPA 4OQMA 4X8MA 4IHQA 2DB3A 3BS4A 4PX9A 1XCMA 1UKVY 2ZSAA 2W0SA 3MD0A 2CCGA 2GCOB 3QXSA 5DIFA 3B9PA 2JJ1D 2W2VA 2OEPA 2JLUA 4ZDWA 1KSHA 3U6BA 3TUJC 2GETA 2UZ3A 1CBUA 3DOFA 3GD7A 3WHLA 1GNQA 3FKQA 2BV3A 2QU8A 2W6IA 2WOJA 3MJHA 1ZM9A 4ITRC 2RHMA 3B82A 221PA 4P3YA 2BBSA 1NSFA 2TMKA 2X2FA 4NHOA 1FTNA 3RRMA 5EE0A 1KSJA 3ZS9A 3KXIA 3IO5A 1UKYA 3BORA 5FR1A 1VYUA 3D6TB 1KI7A 2BJWA 2FZ4A 1T91A 1P7CA 1GNRA 3K0FA 4HLDA 1NIJA 3NEJA 3KKOA 2QP3A 3KTAA 1CJMA 4RZ2A 2CLCX 2D4HA 2VHTA 3V00A 2C78A 4R2HA 1U8YA 2C9CA 2O8EB 1G7RA 1PVOA 4HB0A 1UEIA 4ZKDA 4QL3A 2RGEA 4HB2A 4TMXA 4Q9LA 2A30A 3MAAC 4LGMA 1Z07A 2BBOA 4HAUA 2GJSA 3QKRA 3I92A 1E99A 1S1MA 1XBTA 1S0UA 3OE7A 3TKLA 3VHLB 1Z0DA 2G1KA 1OYYA 4DSNA 4ZDIA 2A5DA 1N0WA 4LC0A 3CF2A 1RJ9A 3ND9A 3CH5A 2ZPTX 4G5SA 2R6FA 4LSGA 3R7WA 1NG9A 2P6UA 4B71A 2J5XA 4QGFA 4EAQA 2F9LA 2H92A 2WWYA 3QQ5A 4MH0R 3PENA 2KBFA 4PHGA 3B2EA 5LB4A 3MFYA 3ADKA 4DEXA 3AVVA 1TF5A 3J81k 1AS0A 2FDCA 4AKHA 2IYZA 1WB9A 2ZYWX 4RFSA 2ATXA 2F1RA 1KSGA 2EWVA 1WGWA 1E9RA 2D2FA 2OBLA 4NYIQ 4QBHA 3GLIA 3U3KA 4KJZA 2CJWB 3FKSD 4MGKR 2VQSA 1E4YA 4XSHA 4OJKA 3CRRA 1DARA 5KYKA 1SXJA 2GHIA 1XMJA 5TDHA 1KI6B 3QKSA 1Q21A 4LBYA 4P33A 1WBDA 4R2IA 2QTVB 3CH4B 1VCNA 2NO0A 4II7A 3VFDA 5C1BA 4M4SA 4NU0A 2P6RA 1N6RA 3C5CA 4ON9A 5HCIA 3I32A
chains in the Genus database with same CATH superfamily
2W2LD 5EINA 2NZYA 3L8EA 3WLLA 4D45A 2UYGA 1GGMA 3BOSA 2OZKA 5IAGA 4QHYA 5H3CA 1SOAA 4DVJA 1J2RA 1R9NA 4Z9HA 2PKXA 5LC1A 3TAUA 2F1KA 1WZEA 2Q7RA 1IPEA 5BRJA 3O0TA 4LE2A 1VL0A 2A86A 4MYSA 3BQ9A 1TMOA 3EUAA 4XEUA 1ESEA 3A9UA 1T9GS 1LPNA 2CCKA 1YMQA 5EJ6A 1CY8A 3NVDA 3BJZA 5E95A 1VRVA 3ZDAA 1Y63A 2ADFA 3EY9A 3RHTA 5IDVA 3RWOA 1XWFA 3OEEA 1C81A 1FUKA 2FX3A 4KUHA 4TLEA 1RBQA 1T4BA 1MX3A 4M1ZA 3NHLA 2OV4A 3OT1A 1G7SA 2OCBA 1EXNA 1FSZA 3OM1A 4G1UC 4OHVA 2FGKA 3JD3A 5JYDA 3EPLA 1DJPA 3UUGA 5AHXA 3KWFA 5DP1A 1P4AA 2R7KA 5E1OA 2D00A 3IPMO 4Q7QA 4TMKA 3NAGA 3ZE2B 5AVUA 4HLCA 3LVQE 3F4LA 4R3NA 4KDEA 5C8VA 3PLNA 2Z9BA 3IPLA 1JXOA 4DJ9A 1SK9A 2ODQA 3BHNA 5TPZD 7AT1A 5J58A 3WP0A 1Z4PX 4QTYA 1QU2A 3THXA 2SICE 2F1JA 3HN2A 1QQ3A 4L5BA 3C5WP 1H1LB 3KL2A 4ALIA 1F06A 2AWYA 3QW4B 5I8ZA 1JFFB 1NQVA 3NHMA 3C5EA 2PZGA 4FK8A 1EI7A 3EISA 4MUXA 4J0GA 1PG0A 4WCFC 4X61A 4ZO7A 4J4HA 4M0UA 3K2IA 3L7LA 1EXDA 3LESA 2YASA 4FOLA 1NV8A 5LZ2A 1TM1E 4ML3A 3D6MA 4B82A 1JG2A 5AW3A 2OAGA 1ZICA 4FSDA 2QJRA 1Q7GA 1U3CA 1XALA 3ML1A 4FD2A 4K6CA 4ERNA 2PRJA 1WLSA 3T41A 2XCTB 2DR0A 1LCIA 3F6YA 2GAIA 3I53A 2Q8NA 3DE3X 2P1RA 1KJWA 3KJIA 1KK2A 3N2LA 4IWXA 3FVQA 3TR0A 1SG6A 2ZI7A 3MCUA 4IXTA 1HMPA 2V7QA 4H4KC 3AXTA 2VDRB 4I55F 4AT1A 3DNMA 3SGLA 3EAGA 1A72A 1DFGA 3ICPA 4EX7A 1D2AA 5IXYA 1CNEA 1Z0IA 1JMVA 4XJVA 1QP4A 4PR9A 1UDBA 1JUDA 4OXXA 5JO9A 1GTRA 4FWBA 5HUJA 5FX2A 2V9CA 1KDZA 1H9CA 1CVRA 1T2DA 2WV7A 5FPPA 4IG9A 2O8DB 3PPVA 1NP6A 3GI1A 5DGXA 4B2YA 1H8ED 1E6WA 1P2DA 3AEUB 3MRVA 4ZRDA 2JARA 3LOPA 1SUCA 4FFOA 4ATNA 1JQLB 2BGTA 4KO1S 2XUPA 4I8DA 4L9RA 2IHTA 1TCUA 3QM1A 3RSSA 5JXIA 1S2MA 4EA6A 5DBHX 1QK5A 2LTAA 2PZAA 4Z7QB 3R0QA 3UJ7A 3DZIA 4NCXA 2HUPA 3IDAA 4IIXA 4XM0A 4DLVA 2HBYA 3EBPA 2PV7A 3D3QA 2XMBA 3Q7QA 2WOOA 3O10A 3HFJA 3M6AA 1Q95A 4HTFB 4NSNA 3TUIC 4JVLA 5K0FA 2ZKLA 3I9NA 1USKA 1PFWA 2AQIA 2WM8A 1ISPA 3I2YX 4JYMA 4NPAA 5AOCA 2JAHA 1EBFA 1YYJA 3UEOA 2FUNB 5B4TA 2ZK7A 3F96A 3ADPA 4D6XA 5JDIC 1OW8A 3I01M 3L6RA 3QW2A 2M1ZA 1WCIB 4H17A 2POCA 5B1AC 1DSSG 2B92A 4S1WA 1WEHA 3V1KA 4K81B 3K9QO 1NVGA 3A6FA 5I9LA 2WVAA 1G4UR 2WB2A 1E2MA 1LB1B 2R86A 3K2BA 1OHHD 1E0KA 3VZQA 4Q3DA 2F8TA 5GJBA 5JPIA 3LUFA 3OHMA 1OTXA 4X20A 4FFNA 3LZCA 5JSFA 3NBUA 4XOUA 1RT9A 1YI1A 4JR1A 3VYVA 2LKDA 1ZK3A 3SHQA 1E18A 1ISGA 2PZJA 2WB4A 3NMJA 1GQAA 1M76A 4FOTA 4FX2A 1K68A 4P4GA 3FMSA 2A6HF 1T8RA 1K8RA 3IOCA 4CDGA 1NPTO 3AG5A 5HR5A 1YS1X 1LRJA 2CL5A 1ZJYA 3UT5A 2IE0A 3G89A 4ZVTA 3OZSA 1KS9A 1JRAA 2HV6A 1VC2A 1XZJA 2OCYC 3DE6X 1LNQA 2R5WA 1VZ2A 3TCXB 3WAKA 1ZSVA 3TKAA 1XZNA 1YCGA 1I4WA 1MV5A 2VP6A 2YYAA 3DE0X 1KDOA 3MS4A 2IPMA 1IUOA 1KRHA 3TIXB 5D51S 3HMQA 4MVJE 1WXIA 5I5GA 5IVIA 3HBJA 4MQFA 4ZOAA 5K0JA 2R25A 3CRQA 2ODPA 4Z4EA 1NJ8A 3MWEA 1JT9A 3C62A 2P4SA 1JSLA 1HT1E 2HR1A 1EDEA 5EC8A 3BC1A 3KO8A 3ENVA 1EWRA 2QHXA 5KHLB 1OIVA 3NH9A 4AL0A 2BEUB 3HZHA 4L5AA 3VUFA 4BCDA 2GHQA 2YWCA 1N4DA 3H87A 4JLDA 5EJ9A 2VAVA 3OO1A 1KYYA 4WKPA 4CG1A 1LRKA 1P44A 2IUTA 4Q34A 4M8KA 1UKAA 1NBMA 4FGLA 1YJBA 1JJAA 3K0BA 4XR9A 1XCBA 3K4QA 5CVTA 3VSDA 4LY3A 5TARA 1H2HA 4QJ3A 4PAMA 1OBHA 2EX0A 3Q0EA 3HR8A 1BCSB 5LA6B 3NPAA 2I2DA 3EASA 3U4IA 5DF1A 4IDFA 4J1TA 2O8VA 3FSGA 3I73A 4M7PA 5FUWA 4B34A 2GVZC 5ALDA 4KO8A 2I67A 3KZMA 3TM5A 4FBMA 1MT3A 3FH0A 5DTQA 1X1CA 2QRQA 2I03A 3SZMA 2GYUA 3H1GA 1RYDA 1Y7TA 1ZPDA 1IEWA 2MSEB 2E5WA 2NUBA 2WT4A 3LX5A 2GUWA 1T5HX 4P4TA 3SYMA 1PQUA 3WRXA 3CMMA 4QBKA 1M2OA 1ORWA 3K20A 4XWJA 4KGDA 2REQA 4NENB 1RWMA 2Q4BA 2H1CA 2QAGC 4IHJF 2P3QA 5ITWA 3MEQA 4L8WB 1W96A 4XSGA 3GJYA 1FFHA 1E9AA 4HX5A 5KJEA 4BZPA 1DELA 1GCUA 3JD1A 1RM0A 8ATCA 1FVOA 1KP9A 2AOUB 2ECQA 3FGOA 1QTNA 3FD8A 2O4CA 1LGYA 1Q91A 2LW7A 4FIDA 4JCCA 5EIWA 5CJJA 2AG5A 1FFXB 1RIIA 2WNIA 2UU9B 2O2CA 1J0BA 4FXPA 4I1YA 5EI5A 1T5SA 13PKA 2OKUA 1AKRA 2P4QA 3ZGXA 1KRWA 3DC7A 1D1CA 1L7EA 5IJWA 4EO7A 2G9NA 1XZQA 4FI3C 4LHXA 3QYPA 1M56C 1JDNA 2Q8QA 2OCKA 4N9WA 5H59A 2X40A 1IUKA 3LTNC 1U28A 2J9FB 2DHCA 4WOKA 4X90A 2HMAA 4DNOA 2J5RA 3CWQA 3VR4A 1IPHA 2G3VA 1D2CA 2JJ8A 4FN5A 4LSMA 5DH9A 1II8A 2G04A 4HH3C 1EX7A 1IM2A 1H66A 1CK4A 1OX4B 1S96A 1Z9BA 4TKLA 1JFVA 4JTDB 3MJDA 2BONA 2F3TA 5AJYA 2QTWB 3BRCA 1CG6A 3RSQA 4A3SA 3OF5A 4YMWA 2PUFA 5EZSA 1GZ6A 4FYIA 4XCXA 2HWYA 3QELB 3O93A 2P3SA 1QIGA 1RZUA 1Q7TA 3PXBA 1PX0A 4XQGA 4XIGS 1HZJA 1HRKA 3EXHA 3LYLA 1CJSA 3VZPA 3OKCA 1SOWA 1VBFA 2AC7A 1DBRA 1QV7A 2LV8A 2VUIB 3CQ9A 1TC2A 3ME5A 2HTEA 1HLGA 1RW4A 3AJEA 4H27A 4K6FA 2Z5FA 5L4NA 4X94A 4POOA 3AQCA 2IXGA 5JAPA 4B4UA 1FQOA 4MXDA 2AS0A 2ZZMA 2YWRA 2PRZA 3ZWBA 4INAA 8AT1A 4PZEA 2HW8A 3K1IC 1DI0A 1T2VA 1GAQA 2CDAA 4PLZA 3CNBA 5CEEA 3GGSA 4G89A 2YL3A 3QHAA 4J7UA 2QTHA 5IWCA 1K5GA 1EVYA 3NWEA 5F98A 1O95C 4DRXB 1WUIS 4HZUA 5HUHA 1DOWA 5E4FA 1U3UA 1KMQA 3E4DA 4CM9A 3MJFA 4NCQA 1XG5A 1H3NA 4DYVA 5LKRA 1M10A 1ZCBA 1QE0A 2FK8A 3URMA 3I39X 1MNDA 3RVDA 4X5OA 2WY2D 5E6RA 1WDTA 3TD2A 2VHUA 2Q5JA 4IIJA 4IS2A 4CT0A 5B7PA 5JXWA 4LF5B 1MP0A 4MR9B 3ITEA 5EPOA 1EUZA 3IQ6A 2JPDA 1Q1BA 1OFIA 1B4DA 5EXTA 3ZV3A 2A94A 3BMNA 3CKMA 4IIDA 2HT1A 2NSGA 4FESA 5IYZF 4QI2A 3MUEA 5B37A 1AK9A 3GMIA 2X5XA 2QZ4A 5FKJA 1MC4A 4TL7A 1M8FA 1UMCB 3NX4A 3OX2A 5GAJA 1NWCA 4PAGA 4TMVA 5M5BA 3L04A 3U2LA 1U7ZA 1OZAA 2C58A 2VPPA 1R0LA 1OX4A 1ZM2A 3TL6A 4D9NA 3EXFB 1ZU5A 4F1WA 1P2FA 3RK4A 3CUSA 4UBIA 3DHWC 3VYRB 5CG2A 1NMSA 3D8SA 1W2HA 3F3MA 1ZHHA 1B76A 4U5CE 2FZWA 3G0BA 2GWRA 4P08A 3SP1A 2WSMA 3QVSA 4Y2JA 2WU1A 1YB1A 2HBQA 2PIAA 2D6FA 3CLSC 4QEDA 2PR7A 2J85A 4GG1A 5C3UA 2IU4A 2ZETA 2IH2A 2H11A 4R2LA 4MDYA 1Q84A 3T1QA 1C4KA 5EZ5A 2C2HA 5EYPB 2EBHX 3F9IA 5K4HA 4OX9Y 4CMCA 4EKGA 2D7JA 3VPXA 1IULA 2JIPA 1UIMA 2ZW9A 421PA 3HCCA 3FIUA 1O03A 4Y2TA 3EVTA 3SC2B 3C1TA 3CPEA 5K8LA 2WTXA 4D0SA 4ZT7A 1TW3A 3PHF2 2C2MA 5CYPA 3NJRA 1S2GA 2H17A 2FW9A 1IZ0A 2JFFA 1JJBA 4NBKA 5EERA 3GLUA 3PGXA 1MX9A 5F2OA 1SVLA 3IX7A 5G2OA 1WG8A 3OLVA 4EG0A 1QV9A 1O6BA 3U8PA 3M2PA 3PL5A 1YBFA 2ODBA 2OZVA 3U4QA 2Y3GA 1MAVA 4QBGB 1NXSA 1T6NA 2DGDA 2PG3A 5BVGB 2RGXA 1EQ1A 1YR3A 1WCIA 4RH0A 1L4FA 2OUKA 1RD4A 3STYA 3TZHA 1T5BA 1LWOA 1YSCA 3TTVA 3W0LB 4EB6B 4YB8A 5JRDS 3PX7A 5E38A 4LMRA 1ECLA 5B4VA 3NGMA 3X1XA 1Z35A 2J9RA 3HKDB 5EQJB 4EL0A 4U7TB 4DJTA 5JSKA 1J56A 2R4UA 1NBMD 2E55A 4TRNA 2W42A 4HNGA 4DUZB 3BF7A 1IEXA 1E4EA 3FFBA 1T2EA 1WQ4A 3WADA 1WTCA 4AN4A 3HA7A 2G76A 3PHJA 4GI5A 5DVWA 1E2DA 2RC6A 3IODA 3NHZA 3QP9A 3E2PA 4LBVA 2DHEA 4MR8B 4BECA 5B2EA 1XJWA 5JC8A 3LL7A 2Z8YM 3ETEA 4LYHA 1XTQA 3RUIA 4EW1A 4YJ2B 5KTKA 5CCDA 1JIVA 4UMEA 4TGLA 2EEZA 2J3LA 4N18A 2NUPA 4PBRA 2XBLA 3GWLA 4L3VA 5F77A 2VA8A 3V8MA 2WHEA 1WXHA 4KAXA 4DNXA 5JI2E 5JZ9A 3TZLA 4ADSG 2AZ4A 3LFTA 2I7VA 4CU5A 2VQ3A 3L7MA 4IM7A 4DT1A 1ZBDA 3ABKC 2REOA 1ZBQA 4INJA 2FSVA 1YDFA 4IHKA 3LA8A 2C5GA 3KEQA 2X86A 3OQPA 3E3AA 2ES4A 2WTUA 4IAOA 3C39A 4QQ8A 3TECE 2CDNA 5E6UB 4CFSA 2G62A 1NVKA 1SKBA 3MUOA 1QQTA 1G98A 2GCEA 3D3EA 3A1EA 2DBRA 3H9UA 4YCJA 1V55C 2W8BA 1KBZA 4JT9A 3TGWA 1OROA 2GK4A 4B3IA 3LKBA 5HQTA 4LDKA 5JD5A 3UOWA 3QWBA 5GJVC 3VOAA 3TCNA 3DG9A 1YBHA 4BMCA 1Z7YA 2J87A 3FG9A 3H5AA 3UYKA 4OX9B 1W93A 1MXHA 3CBGA 2PEZA 2E4AA 3NGXA 4B8WA 1AGRA 3EVDA 2IYOA 2WPNA 5IZCA 3NRCA 3RYCB 2UUIA 5A6SA 1ZO8A 4TYYA 4YBZA 3TVDA 3QKRB 4BWGA 1B1AA 2KBEA 4I19A 4JBHA 1JV2B 3TQQA 5ALVA 2C61A 1MU0A 1JDPA 3BXGA 3EIWA 2I4RA 3T9CA 2BHLA 2ZJ2A 2O7RA 4EGFA 1G8HA 4DC9A 5JIBA 1WL8A 4QWWA 3N05A 4I4NA 5GONB 1XZPA 2P2NA 1FUEA 2HADA 1AZSC 1DBWA 4I0WB 2PTHA 3AEZA 4MKRA 2NSLA 2C88A 2VRCA 3C6MA 3EXEA 4EBKA 2D4AA 3GVIA 3OKFA 4I9NA 4ND5A 1U6IA 2O3JA 4U2GA 5A7HA 1XAIA 2IXMA 1GCIA 4DMKA 4PHCA 1GHTA 2RGRA 2VDNB 3OICA 1W0JA 4YMHA 1QHXA 1W76A 1E9SA 1V4VA 1K2VN 1Z5NA 4ZPXA 2QD1A 2GI4A 1PAUA 3ROQA 4QYMA 4JCHA 1FEZA 1FFCA 2RARA 2ICWG 1CPYA 3QXXA 1XMOB 2AG6A 7MHTA 3JQFC 2WJGA 4TUYB 4MEJA 1XD8A 4XYMA 5KOHA 4BP3A 3B60A 3UBTA 3L2OB 4FYXA 4XQ1A 3A10A 3I4CA 5TVKA 3TFWA 1KC1A 1QFXA 1V1MB 1LF0A 1T8PA 3KEOA 4KMSA 2ZUDA 3LUBA 3JSAA 4LZJA 2R1TB 5CMLA 3V55A 2W90A 3RBXA 2GEBA 4BEBA 5K6TA 3QU7A 4BIMA 4REQA 2EIHA 3E53A 2WAMA 3WXBA 3DVAB 2V26A 3REFA 4K9LA 3SAJA 1ZN2A 3I9V1 1YZUA 4ALNA 3FKJA 2GA8A 4F4JA 5BUZA 1A8SA 2BGKA 1V7ZA 2QU7A 4LV8B 4EHKA 1MG0A 4GH5A 4PYOA 2JJQA 3AR5A 3I4LA 2PF4E 5P21A 4ZCRA 1U8ZA 4ETWA 1BOOA 4M6WA 1X39A 3K70D 1NY5A 4NBNA 4PCUA 3WOVA 5LR6A 1A71A 2IZ7A 3DE2X 4KHPB 4MWSA 2WFLA 2WWHA 3ZLVA 5K0GA 5LP6B 2BGIA 2R7XA 1SXJE 4LEIA 1L4MA 1UK6A 2EKLA 4BNDA 4ARBA 4G9GA 5CTJA 5DCYA 5JCJA 2B0HA 1AB5A 2OHFA 5KYTA 4Q93A 4G5HA 1K6XA 3EWNA 1LC3A 1M7GA 1G3MA 1DZIA 1UZLA 2A92A 3B1WA 3D4LA 4QYXA 3WL6A 4PHFA 1GZVA 1LPSA 1JSZA 2EERA 1M83A 2Y2VA 3MHPA 4BNKA 2Z09A 4JJAA 3E70C 1VIDA 1WVMA 3DE1X 3PE3A 1B42A 1BH2A 4UVDA 1ZJJA 4FIZA 3BG5A 4XJTA 3V33A 4WCFB 2J4FA 3SVTA 3HXQA 4EPVA 2WIAA 3K0KA 1N9KA 1P7PA 1WUTA 5CT4A 2ZI5A 1XQVA 2ISCA 2GK7A 3BJIC 1INLA 1JIXA 1GZ4A 3JQBC 3N07A 4Y6SA 3G2MA 3F7TA 2H48A 3HXKA 4BVEA 4EFKA 3V6LA 3IKVA 5GJCA 1D09A 4PLWA 1X1BA 4IQ8A 2KS6A 2VJMA 2O8FB 4H18A 4HGZA 4WLUA 4KE9A 5A4IS 4RBNA 1U9YA 4LQDA 5IKEA 4IP0A 1UZAA 3X1OA 4A8JC 1G66A 1M2OB 1OTYA 1ZMBA 3A32A 1ZUNA 1RRFA 4FYJA 4FZJA 5CDGA 1ZHZA 1VLQA 5IEJA 1H65A 5ENDA 1I0LA 1ZHWA 4JIMA 3LUKA 5LDDC 5KWIA 2JCXA 3ROZA 4MKZA 3PFHA 2QM0A 1CR2A 1Y6JA 3ABQB 4E1AA 2BKLA 4XX0B 1BR4A 4E5UA 1MB3A 3LVRE 4C14A 1FOEB 1GU0A 3QYAA 2DBQA 2RG1A 1JALA 3REOA 1UJ6A 2OHIA 3CA8A 3O3NB 3NHWA 4DQLA 1Z29A 4YJFB 3B6EA 4YCDA 3ISTA 1R8SA 3KBBA 1OOEA 5GPBA 3ZHVA 5A02A 2WWIA 2XNDA 3BHJA 3VV3A 1DC4A 2I15A 5JP7A 4IZHA 5AK0A 5IT0A 3I9V6 2QY9A 1Y34E 1G5HA 2VYQA 1DEHA 3OJLA 4OBBA 3KG2A 1IOLA 4M37A 5TMDA 2YBEA 2HEGA 1SBQA 4MO9A 4LYFA 4YRTA 1DDOA 4TM8A 4UTVA 1UJMA 3I3SR 3MBIA 4I99A 1CUXA 3E3OA 4J49A 3LXUX 4C08A 2FPSA 1HSOA 2CJYA 2DFLA 4N5MA 4NBSA 3W2GA 3RC1A 4FDLA 4QEKA 4RFLA 5HFJA 3F1LA 4JB2A 4JLVA 2O8BA 2HHHB 3DH0A 4JW1A 1YL6A 4NZYA 5DVZA 3ZOKA 3QJ5A 5HMMA 4MVXA 4M49A 4DCCA 5BQHA 1P72A 4XVHA 1LD3A 4Q1DA 3ZDYB 3K9GA 3FZNA 4CDYA 3RFXA 4CJGA 3K9NA 2JJ2A 1YZKA 1UCFA 1VP3A 3GGCA 4MWEA 4WT7A 1Q19A 2WQ7A 1Z5WA 4CGZA 2QM7A 1Z0KA 3WO0A 1GYPA 4Q4AA 16PKA 5J2UB 2EGHA 3UVEA 3S28A 3WMXA 5KSOA 1C1XA 4JNKA 5AKIA 2DR3A 3L0SA 1K3UB 4RK0A 4WZAE 3T5CA 4AKTA 1BEUB 2AUNA 1Z6QA 5EWMB 4CIHA 4ZT3A 2QRHA 4TYPA 3SYNA 3BL6A 1GS9A 2WAYA 3BGSA 1ZK4A 1RI3A 3U9SA 2C99A 2XADA 1JU3A 1Y48E 3Q6IA 3ZCTA 4CL3A 2FSIA 5F73A 1CHDA 4BFLA 3VR5D 5BW5A 4A7PA 4CLDA 5C8DA 1BMFA 3U6BA 3SR4A 3IILA 3VISA 4D9KA 4RA6B 5BMVA 1SHTX 2Y1CA 1EG7A 1FMTA 1WE2A 3V5ZA 1ZHFA 4KQ2A 2Z9DA 4FMCF 1WXFA 3NWJA 1X9HA 1Y8QB 4QDTA 3P0FA 2Z6VA 3QRWA 3G0OA 2XGOA 4RNDB 3UAZA 4ZI7B 2VS1A 4N7RA 5MGBA 4UAGA 3MFNA 5A69A 5C2JB 1NULA 2H0RA 1W5SA 3FWPA 4IIJB 4UTOA 2ORVA 1C1DB 5DOVA 4ZV9A 1I94B 2C9BA 4UM9D 2XQJA 2GBPA 3E4CA 5FHQA 5DHUA 3UK1A 3P96A 4AZTA 3WAJA 4IOJA 4E15A 1D9XA 1VHTA 4UE3S 1WDWB 4G3XA 4J4BA 5DU2A 3WGNA 2IXNA 3U7IA 3NBQA 1GKKA 4Q1CA 1XQYA 3MCTA 1N33B 1BCRA 5CA1B 3ZDDA 2W48A 4BWYA 2R8EA 2WKPA 3M3PA 1SBCA 4Z3OA 1PTKA 4OQYA 4EEXA 10MHA 1UXKA 1Z3CA 4IGFA 1CS4C 1D8TA 4Q4LA 1C5KA 1HQYE 2GAJA 3LO8A 2O2DA 4OI4A 4D9MA 2Y27A 4IKPA 4XYLA 5AK5A 3E61A 4TSKA 3ZWDA 2IL1A 1CUSA 3V4ZA 3TW8B 3D7KA 3GNQA 4EW2A 5LQJA 4U00A 3MYIA 2R66A 4UU7A 3ZV4A 3TJZA 3TR6A 1XD2A 4NR0A 3A1TA 1QPBA 2HPAA 4WEQA 5HTKA 4KWHA 3LUTB 3Q6MA 1C8LA 1HORA 2OV6A 3A28A 1FTGA 1TJ4A 1NI5A 2FSVC 1Z73A 4IH1A 4LJKA 3ZE0B 4X60A 5CM9C 3UJHA 5CEFA 4MRMB 1FUYB 2R1VA 3S2GA 1VI5A 5J2UF 2EPOA 2XVZA 4U2CA 3CNQS 5BOSB 1YR1A 4MW4A 1FDTA 1LBIA 2VSNA 3MAGA 3ZW8A 2JANA 2J0WA 2ASVA 3DDSA 4BKUA 3GUHA 4O79A 2VQDA 1T2NA 3C8MA 1SKYE 4WCVA 2BH2A 2PZFA 1ID8A 2IVFA 1JNYA 1TEXA 2ZIEA 3W2EA 4BVHA 4W6ZA 3DWEX 3GGJA 2ZCVA 2B1QA 3NUGA 3PVSA 4MVJM 4EBBA 3T6GB 1TFUA 2YWEA 1SVKA 2O6HA 2OXRA 3FWNA 4H4CA 3T5MA 5AJXA 3FCOA 3S2YA 2FI1A 5JWHA 3ENKA 5FJIA 3HBFA 1KP2A 2IIQA 3DLAA 3PEFA 2H1WA 3D1VA 4TMWA 2ZXOA 1SOVA 1T2FA 1CUDA 3UO8B 3VR5A 3WWOA 4R98A 3Q8KA 3NXKA 4MPJA 3LD9A 4OHWA 4HYQA 4UTNA 3NFRA 3PKIA 2PUAA 5IWAB 1YDHA 4W1SA 1Q0RA 4XR4A 2H2DA 4JJ4A 2XF2A 1L4LA 2WUFA 3OOEA 4H6XA 4MYHA 4YUZA 4PQGA 2REQB 4TUYA 3U0CA 4RIEA 1AMNA 2DH6A 1ZW6A 2Z5GA 3QF4A 4ZCIA 3WKBA 4WD3A 5EWLA 1GFZA 1PQWA 1GIAA 3DOIA 3OMXA 4AKEA 4CSAA 3AUJB 1L5HB 1JDSA 1RI4A 3AILA 4GX0A 4L6AA 2C5EA 1A7UA 2YVLA 4HP8A 4L0CA 3U19A 3HKKA 2WKWA 4HN4B 1ECBA 4CKEA 4KXYA 4O2BA 4PRKA 2A0UA 2NADA 2EL9A 2P0AA 2V4UA 4MIEA 1OCEA 3O03A 2HJWA 3DJUB 2VJYA 2WKQA 1NQ5A 3UGOA 1MEOA 4JKYA 2QRVA 2FTKE 4OYLA 5CHEA 5LDGA 4RGBA 5T4FA 3TZCA 4BN5A 3K5IA 2WINI 2QTZA 1Q0SA 2PUVA 5C8XA 4HEJA 1SZDA 3BIXA 2XMZA 3IQTA 4JNCA 3DL0A 4RE6A 4XUEA 4RESA 4AL4A 4CWAA 2I3ZA 3MWYW 1NLUA 1AKNA 1OW7A 1OU0A 1TCBA 1U8FO 3Q85A 4HGQA 4HNHA 5ALKA 1QO0A 1FNMA 3SYRA 3UWSA 2HHCA 1J2EA 1IHYA 1QMGA 2LBPA 5FIUA 4CGYA 4N8SA 3A1VA 4ZYZA 2IUEA 3GV0A 2R1VB 2JIOA 4OP2A 5BN5B 1ENPA 2EFJA 2XMPA 3EGXB 1C3LA 3T1YB 3A58B 1QQAA 3QW0A 3OZGA 1G8XA 3AP3A 3H0CA 3RROA 1HFJA 2X0KA 3OO0A 1E79A 2C4NA 5D3QA 2WIKA 3GHYA 4PIPA 4CS9C 3T52A 3WNDA 1U02A 3EK2A 3O26A 4RVDA 5K8UA 2B35A 2QR2A 4EIWA 3GXBA 3ZH2A 2O05A 2FZLA 2A1IA 2ERXA 2J9YB 3P0HA 4HTFA 5EXPA 5ETJA 5F76A 3WLIA 5JJ5A 3LS2A 4AICA 4OIRF 3UHAA 1XEWX 1DQSA 4RTNA 4FGSA 5K0IA 2E4UA 1E1YA 2VDOB 4Z6KA 3H0EA 4KXXA 1VTKA 3CCCA 4ROTA 1DKOA 4MUIA 1UDAA 5AQEA 3KR2A 4D1YA 3ILVA 3DTNA 1A0BA 4JI5B 1LE2A 3G82C 1Q0LA 2GN1A 3THOA 3WK4A 4P5DA 3JQ8A 3ZBTA 3WG9A 4Z4GA 1J22A 2QG9A 1EK5A 3F3YA 4PNZA 4DCNA 1M6VB 3KSZO 5FTNA 2R47A 3Q7LA 3G7NA 3TSZA 4UUBA 3F3KA 3LZDA 2QA5A 3EGOA 3HVIA 5L4SA 3A1NA 3CBQA 3HCPA 3RS2A 4B6OA 3TEFA 5E2QA 4IVQA 5DGCA 4YJ2A 3A6EA 4LFCB 1UK8A 3PA8A 4KPYA 1FUUA 2XDQA 1JEJA 1Y7LA 2BBWA 1N1MA 4G86A 2B8JA 2ZM6B 3HB7A 3O4HA 4NG5A 3N3BC 2CV0A 1XGKA 3L5KA 4NYJQ 2R00A 4I9GA 1R4MB 3ZXIA 8MHTA 2XM4A 1RI5A 1XZLA 3ANNA 4ZEVA 3R77A 5GV8A 3VJMA 3T5DA 4EYGA 5I7OA 4HNVA 1TTTA 2QROA 1OT5A 2ZIWB 4P7KA 3DFKA 2A5FA 2J9FA 1EHYA 2FV8A 4YONB 5C7LO 1AKTA 4KITB 1AQNA 1I3CA 2SKDA 1CLEA 4KHZA 3CLSD 1C9JA 1TVEA 3MUFA 1HBJA 3RAPR 1NLXA 1CXZA 1GUFA 1CLUA 3DHEA 3GRKA 2XLEA 1B8UA 3C7AA 2QR3A 2W2QA 3FJOA 1WHTB 5THKA 3DD5A 4WFQA 4GQAA 1G2IA 5TGZA 1PV3A 4BFXA 5JXHA 2E5FA 2D0DA 4D02A 4M9CA 4D92A 1WUYA 3CRMA 2NZWA 3WV5A 1MGOA 2E4XA 4K9QA 1N8TA 4QD3A 1AQJA 1SHJA 4HEA6 3TRIA 2HLHA 3KOUA 3HDHA 5LU9A 3BBLA 4TZ6A 1LFAA 1CJBA 4HVTA 3L9WA 3NUZA 2JF0A 4YL3A 1JLMA 1XA3A 1ZD8A 1AT1A 1OH6A 4PCLA 1QKKA 1Y9JA 3DLIA 3QOWA 4QGBA 4WGGA 5FI0B 4BLRA 4COOA 1YFZA 1Z4IA 2ZU0C 4UOZA 1TU4A 1RXQA 3G6WA 3IUPA 3PD0A 1IWOA 4MW5A 3RNLA 2W70A 3KKQA 3KKZA 1ISSA 5AVOA 3NEAA 5HQ3A 1E3LA 1M75A 3QVZA 1SKQA 3E15A 4UUMA 4AJ1A 3NVKI 3GO4A 2D4UA 3F49S 2F43B 1Y4SA 2OHVA 2FN8A 3OIGA 3PR1A 4RMGA 4FHFA 4JC4A 2FLWA 4UD6A 4WN9A 2BISA 2KI5A 1YVEI 2CCYA 5BW4A 1EVJA 1ORSC 4PSVA 5ALTA 3KLBA 4TS1A 1A8HA 1XLTC 2YXPX 1T26A 1YQTA 3VRCA 2QM8A 2VHYA 2Z0MA 3AUAA 2MJLA 3A6DA 3QPUA 4NTBA 4FDTA 4L95C 3SOPA 4YR7A 1NVEA 3SE7A 3V1MA 2YMPA 4YL0A 1ML3A 2NO9A 3GLHA 4JGGA 3E1KA 1RQRA 4MLDA 5IM5A 3ELYA 2CXPA 4TXHA 3JQBA 5K8VA 1SBYA 1SQ6A 2DE0X 1RWNA 1WPGA 2A0YA 2HF8A 3E82A 3UJ9A 3VSAA 5KVSA 3K0CA 4KREA 2GDJA 1HNWB 1F60A 4JT8A 3U7QA 2GO1A 2HI0A 2QD5A 2OB1A 1XMPA 4GP7A 3BL8A 2BMAA 1HT2E 1FF9A 1FMJA 1ZY2A 2HU7A 2OO5C 3NTOA 4MTLA 5FUXA 3RYHA 1K7CA 1P2GA 2AC2A 1KBOA 1XXLA 2X0FA 5EP1A 3WODF 1J0DA 5CX4A 1YNOA 4E5YA 4EPTA 1UJ2A 1Q7CA 2CSUA 5DTIA 4OG2A 1NFFA 2F62A 2HIAA 3FB1A 4MROA 2DTDA 2PU5A 5HS4A 4HFFB 1TNDA 2X5NA 4KQ9A 5KSZA 1P29A 1M0EA 5F4BA 2Z98A 1I7PA 4HNUA 4EHAA 2BE9A 2WFZA 1TKNA 2CDCA 3Q9LA 4V02A 3PXGA 4YUAA 3U7EB 2ZCUA 4G2TA 3ANXA 2BFBA 1CJUC 1XZAA 4P38A 1NNUA 3WLKX 4WCDA 4EUSA 1IG0A 4RLSA 4AN0A 4OHBA 1PWHA 4OSEA 3UWKA 4XVUA 5BWCA 1KOGA 2G9VA 1M2VB 1OR8A 3B0PA 5LLSA 1QIJA 2OM2A 4JBIA 3QBVA 2P30A 2XPCA 2BP7A 3OPMA 4N3NA 1YS2X 2VZ0A 2X0IA 2FN3A 5F2NA 1DZ3A 2QTTA 4P3KA 4ZAWA 3ZCQA 4KP7A 3I04M 3T3EA 4WOCA 4IMRA 3H1PA 4B9AA 4NMWA 2EGUA 3BD7A 1J2YA 4IX9A 1QK4A 2V6MA 1U0FA 1DXOA 5CPBA 5FTJA 1P4GA 3GCZA 5HZGA 3RYCA 2XF8A 2OV8A 1ECPA 2LPMA 3TSAA 4RTJA 1H9TA 4FP9A 5JAOA 3PD7A 2PZLA 3AKEA 4NJEB 2J5QA 3OCVA 2IS1A 1MJGM 3CJQA 3BFVA 1IJEA 3H5IA 5JV5A 3CLUD 3EPRA 3H5OA 1Z7BA 1SVWA 2OCDA 1EGHA 3AHFA 1T3GA 1C0PA 3CRVA 3JPYA 1ZD1A 1VQ1A 4TZ0A 4RPHA 2XE4A 3AI7A 1UPXA 3W5CA 2XOKD 2WUGA 1CQIA 5GZ6A 1YR7A 4IWNA 3OU7A 1U9ZA 2CBZA 3R6TA 1HW1A 4JBYA 2W2KA 1GPNA 4KXQA 3RQIA 4DIDA 4AK9A 5JTTA 4JYAB 1F0KA 2H7BA 1VIVA 1GUDA 1NLYA 1N7IA 1O96A 2Q1YA 1RADA 3L3BA 3QF4B 4GT1A 4X92A 3RIXA 3S8MA 3MWKA 5BW6B 2IBFA 1GITA 1GLGA 2X9GA 4H08A 1GVNB 5A9SA 2L2QA 3P0EA 1UBGA 2JHPA 5DLQC 3CZRA 3GA7A 1LKZA 4WZBA 3W5HA 4F46A 2C5BA 1NKVA 1XFDA 5BRNA 3DJNB 2XV1A 1KR2A 4GOOD 4YRAA 3F8WA 3Q3VA 5EE9A 1MZPA 2AEJA 4PE5B 1E4OA 1MV8A 5EUCA 1L7DA 4FOPA 3VVMA 4II2A 2P4EA 2JGIA 3JQPA 3PXDA 3USCS 2VHWA 1R5JA 3M5WA 3CKYA 4Q9DA 1YS4A 1PSDA 3N2KA 1FUIA 4TN5A 1MHTA 4HKTA 1ORTA 2V1UA 2Y6VA 2HLDA 3ZTZA 2PT5A 3R6LA 3FETA 4LE1A 2ZJ1A 4EELA 3TDNA 1FFTC 2VJCA 3MC1A 1M8JA 4M0CA 3LCJA 3WNBA 1YI0A 1Z6XA 3AU8A 4KSBA 1DRWA 3BTSA 3P71T 5AJUA 4A8TA 3A2NA 3A37A 2FQWA 4WUTA 3ZIAD 3EZ2A 2UXDB 1NVWQ 3KD2A 4O4JA 5B64A 4YC7A 1SQ0A 1S2IA 1NOIA 1R6TA 4AZ3A 2EIXA 2WF5A 2NYAA 2ZROA 4GXTA 2QQFA 4NZ9A 2H5IA 1GPKA 2XMQA 4K7BA 1DDGA 3WRWA 1H3EA 3NIBA 4E5PA 2AXNA 4R1NA 2FW6A 3L41A 1SOUA 3WY9A 4EBFA 2ZTLA 4MTFA 4Y6PA 2IWHA 1ZS9A 2H5EA 1L5MA 1LI7A 4LYDA 3CNHA 3A36A 2VDKB 1BH6A 1JAFA 3H83A 4M54A 3BEHA 2WAAA 1EUDB 5ES3A 4U7DA 5IJAA 1Z5VA 5K3OA 1LBEA 4IQ4A 2G4VA 3KLNA 3THXB 1ZD3A 1RYMA 4CQLB 1E1CB 5F12A 2E4VA 5A4FS 1SEPA 1V8DA 4NU6A 5ALQA 2BSQA 5GINE 2P79A 3BTUA 1F9AA 2AGVA 5ECYA 5FB3A 4QGGA 4Z7OB 1JYSA 1ZUD1 5AHOA 3EYAA 3LK7A 4HDMA 1SXJC 1Y3CE 4F4BA 4XWTA 3RPEA 1JHDA 3UWOA 5EIEA 4IDDA 5JWRA 1X42A 2YX1A 3QMWA 3VVCA 1K6IA 2H5JA 2IOHA 2EBFX 4ZZ1A 2C92A 3K16A 5AP9A 5FL7A 5A0FA 3ACBA 2BFPA 2R0QC 1LDMA 1MC8A 1YIDA 2I3BA 4QI0A 1YIAA 3FVRA 3MX3A 4RK1A 4EG8A 1A76A 1P9WA 2Q4DA 4WPGA 3QW1A 3TXAA 5AVQA 1UFQA 1QG2A 4PZPA 5KQSA 1LVGA 3K09A 3TB4A 2FVXA 4XX0A 3MWDB 1COWA 4YJ3B 1T1IA 1CUJA 1RRGA 2YLIA 1P31A 3B89A 4ZI2A<