1FTSA

Signal recognition particle receptor from e. coli
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
295
structure length
295
Chain Sequence
RSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the NG domain from the signal-recognition particle receptor FtsY.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signal recognition particle receptor
molecule keywords FTSY
total genus 106
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 1996-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1ftsA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ftsA02
1R0ZA 3X1ZA 2ZAOA 4JKYA 1N2CE 2CXXA 3AUXA 2XZPA 4L8GA 5DH9A 3RWMB 3FMOB 2WWHA 4V0LA 1XRJA 2WSMA 2FH5B 4PQRA 1AIPA 5CK4A 3IO3A 3D8BA 3WMGA 1N6IA 2OBMA 1DAFA 3OFND 2VHJA 2C77A 2VHUA 3B1VA 2BHRA 3B9QA 1Z0FA 5IDVA 1N6HA 3ZVNA 1CJMA 1G8GA 3AP2A 1JAIA 3BFXA 1HE8B 4PQYA 4Q02A 1CRPA 4XVQA 5JFGA 1NP6A 1AK2A 3S1AB 1E6CA 1HT1E 1KKLA 2QEQA 3B13B 5SZIA 4B3BA 4B3DA 5FTKA 1SKYE 1CJKC 1W0KA 5FTLA 2IS4A 4HZUB 1IXRC 2IUUA 1G20E 2ASEA 5FPHA 2GTPA 2H17A 4HAXA 4RKEA 1TF5A 3OAAA 1G8YA 2R9VA 3RRZA 4LJ6A 2OFXA 1MRSA 3TAHA 2FF7A 1GIAA 4ITRC 3B1ZA 1JXOA 2GVZC 4X8OA 1M74A 2QBYB 1FP6A 4Z8YA 2OM2A 1A2KC 3NKVA 1NY6A 1IJFA 3UKDA 5BW8A 4ILEA 4TTPA 3I72A 4DDWA 4EJSA 1S96A 4UQOA 4NMMA 4PXAA 3NBYC 5JSZB 4OQLA 3GLIB 3K0AB 3TMKA 1G3RA 2QAGA 2JLWA 3W6OA 1ODFA 4XWKA 4TYPA 2ZI5A 1RVDA 4I99A 4DLSA 1FTNA 3SC3A 3MWJA 1AKEA 2KSQA 5DNYB 4Q7MB 1UDWA 1Z5ZA 4FXPA 4P0TA 2B7BA 1FOEB 4FMBB 1T3HA 1G1MA 4AG6A 1XEWY 4DB4A 2G1JA 2JASA 2QP4A 4DCTA 1JAHA 2GNOA 1FMLA 2QMHA 4M1SA 3EASA 4ZDWA 3CX8A 3EA5A 4PX9A 5E7JA 4LJ7A 5CIQA 4KJZA 1ZNZA 3K0FA 3T15A 2GK6A 3QOFA 1G3UA 2LKCA 4FI3C 2ZYUX 2YHSA 1E9SA 1M34E 2QTHA 3EWSA 1PZNA 2ZR0A 1W36D 5CITA 2GVDC 3NIBA 3QF4B 2C96A 2HYDA 4RFSB 1KZ7B 4JLPA 5LPNA 1Q44A 5FPYA 2ZI4A 1KMQA 3CRVA 5LB4A 5JWRA 2ORVA 1CJVC 4G5OA 2ZPTX 2F3TA 3KTAB 1A82A 4NPHA 3CX6A 3RC3A 4KHZA 4BRUA 5E7IA 4MRVA 1WGWA 3WYAA 3CW2A 4B6FA 3VFDA 1E1QA 1W49A 2QAGC 3T35A 3R9WA 2W83A 3X1WA 1BYUA 1KI2A 2P3SA 3FHTA 1E9EA 1S1CA 2AXNA 1J70A 4Q9KA 4AG5A 3I62A 4JVLA 4CIDA 3THOA 4PHFA 3CF0A 3QKRA 3WHKA 4EUNA 1NVXQ 1G8HA 1SVLA 2ZS8A 3CRQA 4QL3A 4W5WA 2V7QA 2ZRGA 4RFSA 1W7AA 2AXPA 2ODWA 3IIJA 1WB9A 3UMRA 1N0VC 1Q20A 3KQLA 4DCSA 1QRAA 3ZVLA 1VIYA 3OIWA 1X1SA 3QPWA 4B75A 4OYHA 2ATXA 1NN0A 1YR7A 4A2QA 4CEJB 2OV2A 5SZJA 2GCOA 3HJNA 4H1UA 1NVWQ 3PUWA 4HLDA 1GNPA 4D25A 3L2OB 3WBJA 2XJ4A 3RYTC 2BJWA 2ZRLA 1IBRA 2HV8A 2J7PD 4AKEA 4G01B 4S2EA 4HB2A 1MABB 1QF9A 4RSGA 2NGRA 3GJ3A 3GPLA 2HXSA 2NPFA 2FSIA 3M6AA 1F3OA 1G17A 3U7HB 2GEDA 3SOPA 2D74A 3V9PA 2FPLA 2G88A 3K9HA 3CH5A 2N42A 2WWFA 5JHGB 4ESHA 3L8YA 3QXCA 4JVNA 2ZUDA 3LW7A 3DHWC 1E2GA 1KK3A 4LHVA 1ZU5A 5D3MA 3HDTA 2PZEA 5EXXA 4IOJA 3VR1A 3VKHA 3KL4A 4G1UC 3RHFA 4NP6A 1GILA 4FMCB 4Q1CA 1P9NA 1NMXA 3CRRA 3I92A 4I4LA 2ORWA 5FFMA 4HAZA 4PC3A 2KE5A 2Q6TA 4BZPA 1WRBA 2HLDA 3RS7A 2WAXA 2P65A 4UJ5A 5LB2A 1IY1A 3QY0A 1N5JA 2FX3A 1Z0DA 4HAWA 4IEIA 4U5XA 5EP2A 4TL9A 5F3WB 1AM4D 5TVKA 4WA7A 1UDXA 4OI2A 4IDHA 4DJTA 3PUYA 2YKGA 3DKVA 3TNFA 1D6JA 4Q5IA 2F1JA 2J1LA 4A8JA 2WIAA 3NG1A 2VHTA 4MKFA 2QI9C 2K5UA 3EPKA 2MSCB 1G291 1HQYE 2E87A 3RVBA 3CWZA 1F2TB 3CRMA 3H2YA 1Z06A 3SJZA 1PLLA 4N0EA 1MH1A 5CK5A 4G0NA 4DWJA 1WBBA 1ZIOA 4LV6A 3A1TA 3I32A 2V7QD 4HLCA 1XEXB 3C16C 5BN5A 1XD2A 4PHGA 4TQ9A 2PT7A 2IWHA 3PUXA 4D0LB 3FDIA 5H8WA 3RC8A 1E79D 2WTUA 1QBKC 1KK1A 1VG9B 2ODEA 1N6PA 1EXMA 4OJQA 4BFZA 2Z4SA 1BKDR 1CKEA 2PZGA 2A5YB 4F4JA 2QM7A 1I4TD 3NC0C 4IXMA 1MV5A 5C18A 2ZEJA 1Z29A 1PVOA 2VP0A 2PJRA 1II9A 1RRGA 2QN6A 5JS8A 2NIPA 4V02A 3JZAA 1M7GA 2NZ8A 1NN3A 2W6IA 3GLGE 1BO6A 2F9MA 2OCBA 2FZLA 4Q03A 3K70B 4JL8A 4EJSC 3D6TB 1IY0A 2B21A 2R6DA 1KOFA 2B7CA 4E03A 2R6AA 1K5DA 1ZM2A 1TNDA 3TR0A 3NHBA 4DT1B 5HKKD 3KFVA 5ELXA 1YRBA 2RGXA 3QNUA 3K9LA 4RD2A 4XH9B 1TQ2A 2I3BA 1U94A 2YWFA 2OUKA 2DFLA 2RGNC 3U6BA 2Z0MA 4BFSA 1VTKA 1J99A 1ZBDA 1E9CA 1S3SA 1WXQA 2D2FA 3QKRB 4EKDA 1TU3A 2H1LA 4AY2A 4BLPA 3K70C 3KUCA 1R2QA 4XSGA 1DELA 2QRNA 2XOKA 1E2HA 2FSHA 3MUFA 2E1RA 4IDOA 4QFMA 4N0DA 5H68A 1W44A 1OB2A 1DE0A 5FOWA 3Q72A 4B34A 4BE7B 3U7GA 3AVXA 1Q21A 5TY0A 5B64A 2D3WA 1D8TA 4OQNA 2DB3A 4C9BA 3NDBB 4HDCA 2ZRKA 3FOZA 1A7JA 3BH0A 5F9FA 4WXRA 1Z3IX 2ERYA 2I4IA 4LHWA 2NO6A 1LF0A 3CH4B 2QSZA 4LHZA 3ADDA 2JLQA 4H9GA 4IOMA 3U3RA 2IXFA 5DE3A 2ZXUA 1LS6A 5J5CA 2NG1A 1DAMA 2G0TA 3TLXA 3ZIAA 2G3YA 1VYUA 2JIZD 4A6XA 4M1OA 3BS4A 5JSZA 1AGRA 4NU0A 4D0GA 1NVUQ 3PIRA 4OI0A 1XBTA 1ZINA 3VTKA 4DBLC 3C14C 1HQCA 2ZRFA 3H84A 2QGNA 3MD0A 4WZBE 4BLRA 3LH5A 4AKGA 1H8HA 3MCAA 3OEED 1E2IA 4KAXA 1JR3A 1Z6YA 3QG5A 2ZUBA 2OLKA 1E0SA 3WNCA 5B57C 3THXA 4Z54A 3AVVA 2QM8A 3TBKA 3THWA 2RHDA 2ZRNA 2Q3FA 2VYFA 5KUTA 1HYQA 3AP1A 3U6KA 5KSOA 4HZUA 2ZSFA 3X1YA 2PJZA 3TUZC 4DLUA 2CVFA 4GI7A 4BEJA 1SXJD 4DEXA 2QT1A 2F1RA 2F43B 4EFMA 1UJ2A 1X1RA 1P9WA 1JQJC 5F2EA 4V0NA 3QPUA 4M1TA 1OHHA 3O8BA 2WMNB 1FX0A 2ATVA 4ZPXA 3T61A 3GJ6A 3G5UA 2ZQ5A 5CM8B 1CIPA 1CJUC 5B58C 3CRW1 2ZE7A 2ZR7A 4X8HA 3T5GA 1CEEA 4GOJA 1XXHA 1E2PA 2FA9A 4QJ4A 1OH6A 3NHAA 2OEPA 4I1OA 3FMFA 3MAAC 3AVTA 4HLUA 4EPTA 4HZIA 2RGCA 5JI3E 1KO7A 1U90A 2CJWA 1MO5A 1V43A 3QXHA 4X8LA 4C0QC 3QF7A 3SFVA 4MDFA 5DLQC 4XVUA 2LCFA 4MRPA 3P32A 4M9XA 3BE4A 4BQSA 3O8CA 1II8B 3NXSA 1NSFA 4BFXA 4QRHA 2WJGA 4CF7A 2UVQA 5EUMA 1UBGA 4FIDA 1Z0IA 4DIDA 1SXJC 3QKTA 1G5RA 2JJ2A 3QIAA 3DPUA 4GT1A 2OZEA 3NBXX 3ZLJA 2D7CA 4A2PA 3FGNA 4JT2A 4YMSA 5EP1A 4D4MA 2QPOA 1PLJA 2XXAB 1Y63A 2XOKD 1RJ9B 4LJYA 1CLUA 3AKDA 1W0JA 2CHGA 3GFOA 3MG9A 1O3YA 1DO2A 2YOFA 3MMPA 4JIMA 4P3YA 4DSOA 3GLFB 4EQ6B 2JATA 1KI7A 2IWRA 1KK2A 4QJ3A 1OH5A 1XZPA 2Z83A 3I5YA 1OKKD 2D62A 4NONA 3CPJB 1P7CA 4ZO4A 2WM9B 1II8A 4U00A 2EU8A 3OAAD 4WBSA 4EFNA 3QVVA 2IYXA 3BXZA 4WIAA 3WMFA 2WKRA 4DKXA 5EXSA 3W34A 2WWYA 1GM5A 1QVAA 5FBQB 2JJ2D 3K0CA 2LWIA 4Q9HA 4Q4HB 4DLWA 5L3SB 3ZD6A 2EVWX 3QEOA 1G3QA 2F1HA 2FSFA 2KBFA 4GZMA 4IDQA 4KFRA 3LAWA 3KXIA 2QRZA 5L8VA 3B1WA 1Z28A 2BC9A 3GLGA 2IF2A 1TUIA 2G83A 2JGNA 3ZQJA 5HZKA 3U3MA 1JEDA 2XSZA 3H4MA 2OFWA 3ZVRA 2HT6A 3U3OA 2ZI3A 4Z1MA 3E1SA 3BH6A 3CPHA 3DL0A 3FKQA 4LCBA 3KQUA 1J2JA 3QUSA 4DZZA 1UKZA 2C99A 4DSUA 4NKRA 3VU9B 1HH4A 1C1YA 1SVOA 4NDZA 4URYR 1GKYA 1R10A 4XD7A 2P6NA 1KI6A 2ZITA 1W47A 3ASYA 4ZI2A 2WPDD 3QENA 5FUVA 1SVMA 2H16A 3OEHD 1T91A 1L2TA 2GA8A 1Z6AA 1XU4A 1OE0A 2PZFA 1P62B 1YZUA 4AI6A 3GD7A 3ICQB 4UNRA 4GPTA 5FOVA 1IQPA 4M9ZA 4PSVA 2CMKA 1RKBA 1XTJA 5C2JB 3IEUA 3K9GA 3GLGB 1G5PA 1VIAA 3EZ2A 4LOAA 4DUGD 5M04A 1XZQA 1KO4A 3LV8A 4CEHB 3GEHA 4UJ3A 1NJGA 2IHYA 4JLKA 1OIVA 4QXAA 3VNVA 1N6OA 2P67A 4I81A 3ZDQA 4A6PA 2CE2X 3QXXA 5FBLB 1M1YE 1NKTA 3MWYW 4O2RA 4B76A 2DR3A 1C4OA 2VQSA 4GDFA 2VP5A 1CTQA 4Q1DA 4EPXA 1VMAA 1OSNA 3EIHA 5JRJA 3AUYA 2BJVA 3KXKA 1XMJA 1J7KA 4DDVA 1JPJA 3GLFA 4EPRA 3GLHA 3DEFA 4LRWA 3CWQA 4DSTA 1SULA 2ZRBA 4ESVA 3K0EA 5KHOC 1Z83A 3RWOA 5JS7A 4LWZA 3GMTA 5JLJA 3LX5A 1OLOA 4FCTA 1E2FA 3KTAA 5FOUA 2ZYVX 5EUQB 4KODA 3VR6A 1W48A 3X1DA 1DPFA 2JJ1D 1B0UA 1HY3A 2QTFA 1DEKA 1RIFA 2B6HA 5KPJA 2VSFA 4C2TA 4LJ9A 1EWQA 1E94E 1L7VC 4MYTA 3PEUA 5E4FA 2XNDA 3ND8A 4QG7A 4CZ2A 2N1BA 2IS6A 1XX6A 5GJCA 1KY3A 2P5SA 1SKQA 3AKYA 3UG6A 1DAEA 2HJVA 1W36B 3H86A 1ZM9A 3GLHE 3TAUA 2BMDA 3B1YA 3IIKA 2VIIA 4MKHA 2VF8A 1QHGA 4IDPA 1X86B 1VCNA 3KX2A 3FHOA 1SHZA 3ECCA 3KJEA 3EC2A 1FNMA 4JLBA 4XD7D 3U60B 3LLMA 3U61B 3R9IA 1NVVR 2NO7A 2IYVA 3BFVA 2BBTA 1Q57A 3CR7A 3AV0B 4FCVA 4MKIA 3RS2A 4CYMA 4XVRA 1RW4A 5KYKA 1JR6A 2BVNA 3GJ8A 2EFEB 3DZDA 4JVSB 4LC0A 4TMVA 1SKYB 2VL7A 3RSLA 3GLIA 1GP2A 1VYTA 1ZP6A 2J7PA 1GAJA 1Z47A 5F9HA 3PJRA 4JLOA 4ACBA 4NBSA 2W6ID 1OXSC 2IUSA 2ZS9A 4B47A 3GJ7A 3MSXA 1RZ3A 2A30A 2CHQA 2QPTA 2CDNA 3RS0A 1BMFA 1XPUA 3SQXA 4LYHA 2X77A 1HEIA 5G40A 1ELOA 1ZC3A 3VHXA 2EFHB 1OFHA 5LDDC 5JWHA 3NTUA 2WICA 1TMKA 3KQKA 1N6RA 4HEJA 2WMOB 3OZXA 3F0TA 2WIBA 1ZUHA 1QHNA 4RZXA 4YMWA 2ZVPX 4C0AC 4DLZA 1MOZA 2J45A 4TSFD 2HF8A 5BN4A 1R0YA 1FNNA 4KYUA 2HLDD 2QPAA 2XTMA 2VHCA 721PA 1EFRA 4JLNA 1NN5A 1KDRA 1TQ4A 3IUYA 4HI0E 1W4AA 2F9LA 1T6NA 1ZCBA 3ICEA 1E2DA 2XGJA 3ONWA 1M7HA 3IPXA 2WWIA 2PX3A 2FGJA 3HWSA 4K46A 3VR5A 1EGAA 3B60A 4L9WA 2ZYWX 4EPWA 2IYUA 4GZLA 1VG8A 2BEKA 1DO0A 2JJ8A 3T34A 4KSBA 1E9AA 3FFBA 5BYKA 3SJBA 1ZU4A 2QROA 1GITA 3FPAA 5JEEA 2QMEA 5AK0A 1MRNA 1VPLA 4C0HA 1U9IC 2A78A 4YMTA 3MJRA 3CR8A 1H8EA 2IS1A 3HU1A 2O8FA 5G3YA 5EJEA 4N1AA 2DYKA 2XTNA 1KSFX 1K5GA 2ZRJA 4US1R 5FTJA 3SHWA 3HYTA 4OQFA 1LVGA 3QXJA 4IRUB 2BM1A 4KLZA 5FUXA 5JBQA 1E1RD 3T1VA 2XNDD 4R7ZA 4DCNA 1S3GA 1S0UA 3K0FB 5DSZA 1OPXA 4KLNA 2ZUCA 1X3SA 1GNRA 1GL7A 1VCMA 2BCGY 2FFQA 3QKSB 3WY9A 3P20A 4IVPA 3MWLA 4DIEA 3WYFA 1XD9A 3BIFA 4W7SA 2OBLA 3UATA 2GHIA 2VSXA 2QG6A 2YNMA 4NYMR 2X2EA 2X8AA 1E2MA 3ND9A 4W5HA 4WAUA 4ZI3A 1HE1C 4JL5A 1T8UA 1XTIA 5KU1A 3I61A 2PH1A 1KDOA 1N6KA 2BKUA 5EE1A 1QVRA 2XZLA 3Q7QA 4YXWD 4W5JA 3W3AA 3GFTA 2HEIA 2YC2C 3I8SA 421PA 4AD8A 2HCJB 4Q7KA 2ZI6A 3B2EA 4F93B 4HDQB 2QL6A 2XJ9A 2OFOA 2XAUA 5JRZA 4I1UA 1UKEA 1E79A 1XPRA 1Z6GA 2V6IA 2ERXA 2R65A 2WOJA 3TKLA 1IHUA 1D2EA 3LA6A 3K70D 1TADA 1DG1G 5KO2A 2NO0A 2JEOA 5LD2C 3BB4A 1H8HD 1LB1B 5HCIA 4QC2A 3GP8A 1CR1A 5KSPA 2AKYA 2IBMA 2J5XA 3PR1A 3FMIA 4Q21A 3S1AA 2CLCX 4TSFA 1G3IA 4X8MA 1KI4A 1TAGA 4YMVA 3TSOA 3OEHA 1XXHE 2QU8A 3K8YA 2GCPA 4KVAA 4BZQA 4JVMA 2NO1A 2VO1A 3W8RA 4JSYA 5EP3A 4EQ6A 4JLJA 4KBFA 1AS0A 1ANKA 4LGMA 1ZUNB 3REGA 4C30A 4ABYA 3AVUA 1U0LA 2PEZA 2R8RA 3T1OA 2GZDA 3AVOA 2GJAA 2REBA 4Q1FA 3OFNA 4WZ6A 5JWOA 2BBSA 1MO3A 4Q18A 4UXHA 3L0PA 3UIEA 1UM8A 3C41J 5EXPA 1ZVQA 2VSOA 3NC1C 3PEYA 2VH5R 1JR3D 3AGQA 2AK2A 4Q1AA 4PC7A 1ZCAA 1GG2A 3IHLA 4NL4H 2W6JD 4MYUA 1NNEA 2BMEA 4MGIR 5DYIA 5BYJA 1W0KD 4OHXA 2QA5A 2PBRA 3CONA 2KB0A 2ZI9A 4HLUC 3BB3A 3SYNA 1X8LA 2VF7A 4Q00A 5C4GB 3W5JA 2WOOA 3VX3A 4CEJA 2R6FA 3KFXA 2ZU0C 1KSGA 4DEYA 3C5CA 4ARZA 1U0JA 3GJ5A 3F3YA 3C4JA 2GCNA 4JYBA 3B9PA 3UXMA 2ZETA 1CF4A 5F98A 1Z6TA 3TQCA 1WA5A 2AD1A 3WNBA 1LNZA 2WPDA 1G5TA 1IXSB 2ZSAA 4FW9A 2R6CA 5J4YA 2CNWD 3BORA 2CJWB 2R6GA 1XF9A 5CB6A 1PV4A 3Q9LA 2ZRCA 5BN3A 1G3MA 4KU4A 2ZIAA 4TL7A 5GJWC 5TDHA 4NE2A 4JL6A 1NVVQ 1S1MA 2OSBA 4PPNA 1I2DA 4UNQA 5JI2E 5IHPA 2ODBA 2RGBA 1RRPA 3I8XA 1Q3HA 5DI9A 1R4AA 5DN6D 1AQUA 4FWIB 2YOGA 4QBFA 2PLRA 3TUIC 2RGNA 4POAA 2ZTSA 2ZRHA 5J4HA 2JLSA 2F43A 2XTZA 3SNHA 5SZKB 1VKJA 5L3QA 1W2HA 4GBMA 2O8EB 2C9OA 5KNCA 1FQJA 3EZ7A 4Q9JA 1UF9A 2J7KA 1ZUIA 5K8IA 1H65A 5FH9A 4MDEA 3M0EA 2W00A 1T0JB 1B23P 3GJXC 1YJ5A 3DVLA 3OF5A 4KCGA 4LJAA 4NHOA 3TSWA 3A37A 3CNLA 2FPKA 3UMSA 4FINA 4ZDJA 1R6BX 3CLVA 1GKIA 3AGPA 4G5SA 2OG2A 1SHKA 2IXGA 2MMCA 4E22A 3IHWA 1GL6A 4QHYA 3RABA 3WXMA 1NF3A 3H1TA 4QBHA 1ZD1A 2HT1A 1XJQA 2ZE5A 4ON9A 2C98A 2XITA 4OI4A 4Q4AA 1E3MA 1EFTA 1JNYA 4NCKA 4NH0A 3F8TA 3IILA 2WWGA 3IQXA 4JYCA 4NYIR 621PA 4E5UA 4PPFA 2G9NA 3K0CC 5IT5A 1DAGA 4TL8A 3HPRA 1O87A 3FVQA 4OQMA 3A8TA 4Y0AA 5GJBA 2VP4A 1K8RA 2QP9X 4F4CA 4WZAE 4M0LA 1JB1A 1G7RA 1K6MA 1OIWA 1E96A 4ZDIA 4CVNA 1A1VA 1M6NA 1QZXA 2AWOA 3D31A 4II7A 221PA 2JLVA 3AVWA 1X8JA 1KI9A 3V4FA 4B35A 2BBWA 4Q19A 2H57A 1JBKA 3KKPA 5KPDA 1J8MF 3ADKA 1YZNA 4FMDF 4LPKA 5KDLA 3VR2A 1GSIA 2EFGA 1KNQA 3A4MA 1S8FA 5EZ6B 3CBQA 1E2EA 5FTNA 3SZRA 4B43A 4C7OB 1NBMD 3LW8A 3HU2A 4AYTA 4BLTA 1LS1A 1ZRHA 5FI0B 3K53A 1FQKA 4KFSA 3NH9A 3U7EB 3B5JA 5L3VA 4KFTA 2AR7A 2NPIA 2V1UA 2JLRA 1E9BA 5DIFA 4PZZA 2GBLA 2IW3A 1P3JA 1BH2A 3GEEA 3L0OA 2O8BB 1KMHB 2BMFA 5FR2A 4GSYA 3U3KA 1RRCA 3WRYC 2EW1A 2O5VA 3TW4A 2IS2A 4MH0R 4LSGA 4P31A 4K8OA 1UFQA 3JVVA 1SVKA 2CEAA 3BERA 2ZS7A 2Q21A 4A82A 1COWD 1Q1BA 1TTTA 1RJ9A 2ANCA 2QTVB 3RANA 4Q47A 5G53C 4IVQA 4YLGA 5KSYA 2Z4RA 4B73A 1SZPA 3M4YA 4GRAA 1PUJA 2JCSA 3MRSA 4DLXA 4LYFA 6Q21A 1ZM4A 4KITB 1VG1A 1NN1A 3VX4A 4J0QA 2H7VA 3W8NA 2IA5A 2WJJA 3TQFA 5DYGA 5IRCD 4TTQA 1VCOA 3AF0A 1FFHA 4B3XA 2O8FB 3PEWA 1WMSA 2JDIA 4A2WA 1FW6A 4UNNA 2QE7A 5UKDA 1HA3A 4YC7A 2JLXA 4GL2A 4G3XA 4HB0A 3RAPR 4OHZA 3LWNA 4XIGS 5CJ2A 1OV4A 3UANA 1E4YA 3KUDA 1EFCA 1R5BA 1Z0JA 2JJ1A 1QHXA 2WKPA 2XZOA 1AKYA 2A5GA 4MQBA 3GLFE 5JEDA 4TT3D 4V03A 1OXVA 4KV9A 1XCGB 1MO6A 1ESMA 2ZE8A 4PZLA 2IUTA 1WF3A 3DOEA 521PA 4KXFB 3ASZA 3EIEA 1R0XA 1UKYA 2ZRAA 5IK2D 4A8JB 1D2MA 4QBGB 4NYJR 3QG1A 3KB2A 3DKPA 4JLVA 1A4RA 1BMFD 4QNMA 2ZAMA 3EPHA 2H8KA 1KGDA 1F6BA 3KKNA 3K1JA 4ZCLA 4PPQA 1U8YA 2C8VA 4P4UA 4A36A 4PFSA 4S35A 4EDHA 3ZQ6A 4LHYA 5LBIA 5TB5A 1YZLA 2IYLD 3ZGXA 5KOYA 4PAQA 4BPBA 4CDGA 4O2LA 5J4VA 4JJKA 3WNDA 3TSZA 4TZ6A 1BYIA 1AA9A 3QPVA 4B3FX 4UKDA 4FD2A 3CZPA 4EPYA 3CM0A 2FFHA 4HUTA 1G16A 1NRJB 3HPQA 4KI0A 3SE0A 2ZSBA 1Z0AA 2OILA 3R7WB 2WSSD 2PCJA 1JXMA 4JZKA 3TH5A 5JCPA 3FHCB 1KTVA 2DCUA 2PEYA 4WOPA 2OAP1 2GDJA 1IN6A 1X6VA 2UKDA 4IFBA 4LHXA 3SN6A 1YR6A 3T12A 4OBEA 2V3CC 2O8CA 2B8TA 2H18A 1FUKA 1E4VA 4DRZA 3WRXC 1JI0A 4A0GA 4Q4AB 1OT3A 3JZMA 2VTKA 1NLYA 3Q85A 4JLAA 3B78A 1NIPA 1N6NA 1PJRA 2VPPA 1U98A 4IOKA 4Q9IA 3TIFA 3W3ZB 3ZIAD 5KDDA 1NI3A 2DY1A 4AC9A 1RC8A 3IQWA 1U81A 3QJYA 4LBVA 5HKKA 3QBVA 5AUNB 2JLZA 1FMJA 4LBZA 1JJVA 4L9SA 2E9SA 821PA 3TK1A 2AL7A 2FV8A 4LC1A 4Q66C 1PUIA 2ZYTX 1UPTA 2H92A 5L3QB 4TN1A 4D26A 5C1BA 2FWRA 4C0KA 2UZIR 2X19A 2JLUA 1YQTA 1ZYUA 5J47A 2GZAA 4LDJA 2YV5A 4RZ3A 4RZ2A 4A15A 3IDQA 2QE7D 3Q5EA 4DXAA 1E98A 3ADCA 1FPMA 4GMDA 2DHRA 1H8ED 3GLHB 3M1IA 1VHTA 1YZKA 1OXTA 4RVCA 1W2GA 2GF9A 3EG5A 2W0MA 3HU3A 4TQUS 4IEEA 2O0HA 1SQ5A 4Y0VA 5FPKA 2J41A 3AM1A 5L3RA 4OK6A 1E99A 1XMSA 4A4DA 3VMFA 4BEBA 3KXLA 4FN5A 1G4AE 1OXXK 4XJXA 2D2EA 1YRAA 1T5LA 3P1JA 3REFA 3U4QB 3FWYA 2GXSA 4TLEA 3HP1A 4O3MA 3P4XA 4IKEA 2QAGB 2FU5C 1U2RA 5J4KA 3EZ6A 1T9HA 5LD2B 1DBSA 2NZJA 2QMOA 1D9XA 1SXJE 3LQQA 2IXEA 1U8AA 1L4UA 3I4LA 3V4RA 1UEJA 2DWPA 1AQYA 2O0JA 3RRYA 1RRFA 3EAQA 3GFPA 2CHVA 2ODNA 2IT1A 3SDZA 3C8UA 5DI3A 3B85A 1GOTA 2QBYA 4I1SA 2HJGA 2GK7A 3W5IA 1JPNA 3SQWA 1F2TA 2OE2A 3CF6R 2QSYA 2PMDA 1F60A 4C3ZA 2Q9CA 2CK3A 1N0UA 2O8CB 1NG9A 2G77B 4QJ5A 4RD4A 2J87A 4KBGA 5AJYA 4YXWA 3SFZA 1OW3B 2YYZA 3SYLA 2VHQA 2I1VB 3C7KA 1EFUA 3PUVA 4EJSB 2CBZA 3OE7D 1AN0A 1MT0A 1XJ0A 2AD5A 3LXXA 4O25A 4M9SA 1ZNXA 5H1YA 3C15C 1T5IA 1A5TA 3ZZUA 3CNOA 1AGPA 1ZM3A 1SGWA 2BBOA 2BEJA 1CJTC 1GUAA 2FSGA 1KK0A 1Z22A 2J3EA 4A8JC 1G7SA 3Q8XB 1VCIA 4LK2A 3L0IB 2YWEA 4CRWB 1MR3F 4MGZR 3OIVA 3LXRA 4BFWA 4DLRA 4NCJA 1W0JD 1ZJ6A 3VKGA 1QG2A 1HT2E 2OCPA 2FNAA 4JMPA 5BQ5A 1GZSA 1VG0B 3FYHA 4LI0A 2PCLA 3DMDA 1VHLA 4PANA 5CB8A 3ETLA 4AKIA 4D4KA 3PUZA 1QHHB 1G8FA 3BK7A 4XTCS 2A5DA 3SHFA 2ZI7A 2FE4A 4BWYA 1BOFA 4IHQA 3VR4A 2FMXA 1P2TA 3HYRA 5CJPA 1FTSA 1RFLA 2WVJA 2C03A 2P6UA 2IYZA 1Z2AA 5FBRB 1NKSA 1Q1ZA 2RGGA 4TZ0A 3Q7PA 2FZ4A 2C95A 1YR8A 4I1VA 3LY5A 4AWXA 4EAQA 4TMTA 1XMVA 2BV3A 3A36A 3E70C 4OHYA 4PZYA 2ZSDA 2XSZD 4LX0A 3OIUA 1N3BA 4CT4B 1FUUA 4M1MA 4TLAA 4QHSA 2UZ3A 2IEYA 4P33A 3AP3A 3UWKA 5K8UA 5FOXA 2ZJ2A 4BLOA 5SZHB 2GEVA 1YZQA 4XOIA 2V6JA 2Q3HA 4PHTA 2AN9A 5TV2A 2CNWA 1T3LA 4F38A 3W90A 1SVIA 5DHAA 3H0KA 2C9CA 2IYSA 4C7OA 1XXHB 3DOFA 1N5KA 3BD9A 1OFTA 1XEWX 1XEFA 1G19A 1P4SA 3L82B 2IEZA 5GVSA 4M53A 2IL1A 2KJQA 1RPZA 4HATA 5DHFA 4ACAA 2Y8EA 3U4QA 1KMHA 3DZ8A 2VRWA 5HPYB 5FOTA 1L4YA 1G18A 4U02A 5FBVB 1C9KA 1E0AA 3SU8A 4DUGA 1UAAA 5JECA 5FUWA 1W5SA 4Q1EA 1AS2A 2CL7X 3EW9A 3RRMA 4YMUA 4MYHA 5BWMA 2X1VA 2ZRDA 4PC1A 1W46A 3IEVA 1A2BA 2RH5A 4IJMA 1EX6A 3CPEA 5DGXA 2GAAA 3BB1A 5CIWA 4JBYA 2RGAA 2V1XA 3DM9B 5HZHA 2FDCA 4F4IA 1JR3E 2AK3A 4B33A 3VR3A 1GNQA 3CB4A 3VQTA 4KSCA 3KKMA 2QENA 2YJTD 4Q4JB 4L4UA 3DO6A 5AUPB 3NEYA 1LFDB 4QHTA 5GVRA 4LY6A 3KJIA 5TXGA 3RSOA 3QF4A 3AF3A 3N5CA 4Q48A 2EFCB 4JBWA 2BMJA 1ZNWA 3VKWA 1EWRA 2DWOA 4GOKA 4TYNA 4F7WA 4MYCA 3TR5A 2D06A 5IF9A 1ONBA 1Q3TA 1FZQA 1E1RA 1XDBA 4LYJA 3IPYA 4TQAA 2J9RA 2FJUA 1G8PA 1GFIA 4M1YA 4QM6A 5EE5B 1I2MA 2BM0A 3LBIA 3O8DA 4KVGA 2AHOA 1QDEA 1P61B 4CGZA 3K0SA 1E9DA 5AJVB 3T1QA 1E32A 5CM9C 3LQRA 3B82A 3I5XA 1SXJB 3U44A 2F1IA 3N2IA 1G6OA 3ZJYA 1P2UA 3MJHA 4YDHB 2OCAA 5AJWA 4YDSA 5IK2A 3R8FA 1KKMA 1AS3A 3EA0A 2LKDA 2PT5A 4TLCA 2IC5A 5HR5A 1Q0UA 3IGFA 4URUR 4ZDKA 2BWJA 2PLFA 2BDTA 2N46A 4R71A 4WVFA 2ORIA 3THYB 1OXUA 5KNDA 2ZVQX 1OFUX 2EQBA 4XTRA 1G41A 3D7MA 3IO5A 2EWWA 1ZW6A 2O0KA 3I1FA 5D3QA 2GJ8A 3WP0A 1CULC 2P0EA 2QGZA 5FOSA 1YZGA 4U7DA 5FR1A 1E2QA 5GADl 2OBNA 1JALA 4QKQA 1RYHA 3LLUA 1US8B 1GDDA 3ZS8A 4DC9A 4C0LA 1S2MA 2HXYA 1E9FA 4DLVA 3FKSA 2CCJA 3QSYA 3BOSA 4YQFA 4LZZA 2YWGA 4IDNA 4UXJA 2ZJ5A 4PC2A 3DMNA 3PEVA 1KNXA 4A9AA 2FOLA 5FBWB 4BLSA 4QGGA 2H5EA 3UWOA 3QI2A 4PO1A 2QUZA 1CXZA 5KSZA 3PCRB 4PAMA 2Q0HA 4TMWA 1P73A 2GF0A 5FPSA 5FUYA 3TW8B 1NY5A 2QORA 4QGHA 4DLYA 1F5NA 4KO8A 5FTMA 2ZE6A 4CEIA 4E07A 3UPUA 3J81k 1ZD8A 4RD3A 3A6PC 4OJKA 4A0RA 2MMGA 4FCWA 4MRSA 4LYAA 3QEJA 3BFKA 2WJYA 1L8QA 1ZMXA 5DO9A 5ANRB 5JMTA 1ZD9A 4L5BA 1ZC4A 1F2UA 4MGYR 4FMCF 2D7DA 3AB3A 4PHHA 1J90A 1QHHA 3AF2A 3A1UA 3OIYA 3K09A 4BFVA 2P6RA 3NDPA 4MUAA 4C0BA 4ZKDA 4F91B 2XX3A 4D6PA 3ZS9A 4K81B 1QHIA 3ZZ0A 5JZVA 1IN8A 1EG7A 2CLSA 1KJZA 2JAQA 1GRRA 2F6RA 2G6BA 3K9NA 3AH8A 3CUEF 1R8QA 5FL7D 2R62A 1YU9A 2VBCA 4RJLA 1EFHA 3KB1A 4ZCIA 1DTSA 1DAIA 5AUOB 2WAYA 2B92A 1Z07A 4NCHA 2QNRA 2IYTA 4RD6A 1E9RA 4G5RA 5E3HA 1FX0B 2V4ZA 2ZJBA 4QGFA 2FPMA 1LV7A 4OL0A 2IX3A 2X2FA 1QG4A 1XTSA 2D4HA 3A4NA 4M21A 4ZV4A 4BLQA 2XB2A 1CS4C 4DDTA 3THYA 1UBEA 4YONB 1E0JA 2ZJZA 4RY2A 2V9PA 1PLKA 3BAFA 3I73A 3N2EA 4QNRA 4TT3A 3O8RA 3GLIE 1ZIPA 2FFAA 2ZREA 1X8KA 4M1KA 3LBNA 4TTRA 1KI1A 5KNBA 2NQ2C 4B2IA 2XB4A 4GMXA 3L0SA 4HSEA 2MSDB 3JVUA 4DVGA 5E95A 3TGPA 3EPJA 4RD1A 3KQHA 2B8WA 1SXJA 5G3ZA 3MWKA 3PITA 5DI3B 3EZ9A 3P26A 2GBLC 4DDUA 1GKUB 2GCOB 4Q4LA 5HTKA 5GJVC 1ZAKA 2QY9A 4B2PA 2JLYA 3LRPA 1GL9B 4M8NE 4A0HA 3UMFA 4A0FA 2OAQ1 1NG1A 2R44A 1KJYA 2DWQA 2DBYA 3MLEA 3ZYCA 3KQNA 3KKOA 2C5LA 1DADA 4R2IA 1KO1A 4PC6A 3QE0A 1LW7A 4V0MA 4DCUA 2OHFA 2VP9A 3OE7A 4A1FA 1WCV1 2IYWA 4BFUA 1YR9A 4JKIA 8OHMA 2HYIC 2J0QA 2REXB 3ZH9B 1NIJA 1RE0A 3FB4A 4URZR 3QXSA 3U3JA 2CL0X 4JBXA 3A58B 3GJ0A 2ZJYA 3PFIA 1S9DA 1YVDA 5EP4A 1W36C 2XXAA 1Z6XA 1GWNA 2FN4A 3EPLA 5EQTA 2ZROA 4IW3B 1KDTA 1D2NA 4A92A 4D4LA 2NO9A 1IOZA 1ESNA 1ZNYA 2IF0A 4MITA 4B48A 2PMKA 4GP6A 2O8EA 3LD9A 2RGEA 2EWVA 1UKVY 3U7FB 4FMDB 3KJGA 1IONA 1F48A 5H70A 1IN7A 1OH8A 2BOVA 4R98A 5CYOA 1P2SA 3ADBA 2CE7A 1CR0A 2J0UA 4ARZB 3CF2A 3V00A 1M8PA 2C78A 2P2LA 5FPTA 1OHHD 3O47A 4HYYA 3A1WA 3GCGA 3PXGA 4PO8A 4GNKA 4RKFA 2OESA 1UEIA 4RFVA 4B71A 3R20A 2CLDX 1LTQA 1QHSA 2O52A 1OF1A 2JIZA 4P4SA 4US2R 1US8A 4GOXA 1T8TA 4O0MA 1GRNA 4M1WA 4RZUA 4NTZA 2NOAA 3SJAA 3CX7A 2CCGA 5HE9A 2QZ4A 2XEXA 4TMZA 5EXTA 2HUPA 1EESA 1E2NA 2NTYC 4H1VA 2RB4A 3PVSA 2GXQA 4NYMQ 4OHWA 5D3MB 5B30A 2YC4C 4D82A 1TU4A 3GQBA 5J40A 4XWAA 4V0KA 1EX7A 1XD2B 3KDSE 1KSHA 4LPSA 2W6JA 3T1TA 1P60A 3AKCA 3SEAA 1XCPA 4D0NA 1P75A 1T0HB 1TUEA 3UK6A 4DCVA 3D3QA 3THXB 2A2ZA 1R5OA 2Q3MA 3EX7C 4TYWA 3W9YA 5DISB 1N5LA 1Z08A 4R9UC 1P9RA 3RRNA 1TEVA 3I3SR 3R9XA 4P4SB 1JJ7A 4M2LA 3BGWA 3B7GA 2CL6X 4JT4A 1YKSA 1SVWA 2DFTA 1W4BA 1XFAA 2REOA 5EZ5A 3LFUA 4ZCMA 1G4UR 1KYIA 2Z5FA 1G21E 1TEXA 2GJ9A 4PAOA 4AIIA 3ZD7A 1BS1A 1TX4B 3TVDA 4TWZA 3LBHA 1OH7A 5J4LA 5E7MA 3WMEA 2ZM5A 3PG5A 4HLQB 1CR2A 4URWR 1U8ZA 2NMVA 1DS6A 3MFYA 4JS0A 4Q01A 2A7QA 4DLTA 1DARA 5EE3A 2IYYA 3WBKA 5A4JA 4AK9A 2QQ0A 3SBDA 2OLJA 3TE6A 3P4YA 2IHBA 4G5GA 1U99A 2GRJA 4NCIA 3NBZC 2ZRMA 4OK3A 3WYGA 2J0UB 1XPOA 2CK3D 3TRFA 2DFNA 1NJFA 2WHXA 2EYQA 1KDPA 4HAUA 2J46A 2Z6VA 4HAYA 4IVRA 1TQDA 4EPVA 1G64A 4TL6A 3TJZA 4D2IA 4MA4A 1W4RA 2ZRPA 4MUBA 1N5IA 3B6EA 2A5FA 3N70A 5KDOA 1J8YF 1AJEA 2J0SA 4HB4A 1OYYA 2QT0A 3QBTA 1NSTA 1HURA 4QM7A 1P2VA 3QKUA 3EXAA 1MABA 4TMXA 5HE8A 1E1QD 4LUCA 4ZKEA 4ASUA 3KZ1E 2QAJA 4L16A 1XWIA 2JA1A 3C5HA 3QKSA 4US0R 1E69A 4LJ4A 1E0KA 1XTQA 5CDFA 1Z63A 4BFTA 1P6XA 1U9IA 1G7TA 3T06B 1XTKA 3FFAA 4MRNA 2F7SA 2KI5A 3AEZA 1CR4A 4ERNA 1HV8A 4M4SA 2F3RA 2OCYC 2YWHA 2VLIA 2VA8A 5EE9A 1XCMA 3R8CA 2YOHA 3SI7A 2AFHE 1Z0KA 1M2OB 1KI6B 1GRQA 5C46F 1WE2A 2W2VA 1OFIA 3EARA 3DDCA 2FEMA 2PL3A 1XB2A 1OB5A 4PTLA 3E5HA 4LV5B 2RMKA 4V0ME 4PR0A 3X1XA 3SBEA 1R7RA 5JHHB 3BJIC 1DG3A 3NBFA 1IAQA 3TUJC 3SYKA 1KAOA 1IJEA 2ZR9A 4E09A 1KO5A 2G1KA 3EZFA 1DVRA 4Q7LA 4D80A 3NWJA 4PPGA 5JJKA 3PV0A 4TYQA 2CVHA 3NVAA 1U0HC 5AWFC 4R2HA 4TLBA 2AWNA 2WJHA 1NMYA 1MO4A 2EYUA 2ZU6A 2GAOA 2W0SA 4B2LA 1G7CA 2ZJ8A 2A9KA 5JJLA 1COWA 2GJKA 3UG7A 1XMIA 5AJZA 2QQEA 1NBMA 4Q4HA 5L3SA 4IFEA 1DAKA 1TL7C 1KAGA 2HCBA 3CNNA 1KIMA 3IIMA 2Z43A 3OESA 4B44A 4D81A 2ZRIA 4Q7JB 4DHEA 1KHTA 1KZGB 2VP2A 2WKQA 2WV9A 1YHNA 4PQFA 1P5ZB 1NLFA 1S9HA 4P4TA 4B3GA 4JLMA 2JDID 2AX4A 1QHYA 4CW7A 1EFRD 1CU1A 3MGCA 5FL3A 3KJHA 3BC1A 1F2UB 1XJCA 5FI1B 5TARA 2I1QA 2WZQA 2DPXA 1G6HA 3AF4A 4PSKA 4BFYA 2W58A 4URXR 1YE8A 3OHMA 4C0SA 3ZVMA 2CCKA 1IM2A 3PQCA 1OYWA 4NYIQ 1OKKA 4OQXA 4CEIB 2SHKA 4LJ8A 4KYIB 1LY1A 4F92B 3CKLA 1WP9A 4WXPA 4NYJQ 2YINC 1E2KA 3LDAA 2FGKA 1SVSA 3NH6A 1KY2A 4ZIRA 1R5NA 1KJWA 3KKQA 5FL7A 5G41A 4B3CA 1HTWA 2ONJA 1UBFA 1VYVA 2W2TA 2BIFA 3LNCA 3HR7A 1V5WA 1TPZA 2GETA 2VP6A 4QGAA 5KTYA 3U5ZB 4UNPA 3CO5A 1DAHA 1R8SA 2GKSA 1W5TA 4GP7A 3EWAA 3U2QA 5JJIA 4QOSA 1ETUA 5HCNA 4OK5A 2WWWA 3LVQE 4NCNA 4Z8XA 2W2XA 2L0XA 3SJCA 4Z1MD 1UBCA 4L15A 1GTVA 1G9XA 2IK8A 2WJIA 4MGKR 3SS8A 3QVUA 2J0VA 4GFDA 2AKAB 2RGDA 4Q1BA 5B2ZA 2HDNB 4IXNA 5AR1A 1OJLA 1GVNB 4EFLA 1Q22A 5JCZA 2O8BA 1XD8A 4JSTA 4M22A 5K8LA 1Q1EA 4AYWA 3Q5DA 5P21A 3W6NA 2HF9A 4MKGA 5A0FA 2GWHA 1I4LD 1TQ6A 4RD0A 3RDPA 2IYRA 2QP3A 3WHLA 1ZM7A 1KSJA 3LX8A 3GEIA 2ANBA 1JECA 4QBIA 1BIFA 2R2AA 4AYXA 1N6LA 3RS3A 3HR8A 3SR0A 2RAPA 3EIQA 4PO9A 4G5QA 3U44B 1T4GA 2ZSEA 3W6PA 4BGDA 4ZIRB 1D5CA 1Q1QA 3E2IA 4Z51A 4W9MC 3IKJA 1Z8FA 3FE2A 4IOLA 4OHVA 2GZHA 2XNSA 1FL9A 2FG5A 3FKSD 1D9ZA 4BECA 4JJZA 2OXRA 4KFUA 4Q9LA 3A1SA 4PSAA 2OT3B 2FEOA 4D4JA 1CBUA 2IYQA 121PA 4AURA 2WBLC 3THWB 4M9QA 3G82C 4CEHA 4XWOA 1WDTA 2GILA 2PX0A 4V0OA 2Q9AA 4HDOB 3IBGA 3WP1B 2WWXA 1IN4A 2F55A 4EIWA 3IBYA 2OXCA 2RHMA 2WJVA 4BZXA 1TF2A 4Q4JA 4CT5A 4DB2A 1T3SA 4NZYA 3F5FA 1YZTA 1Y3AA 2YVUA 3AVQA 2DFKB 2FFBA 1M7BA 1LF5A 3BWDD 3LVRE 4BUJA 4TYYA 3VHLB 3RLFA 4WW0A 1XP8A 3RNLA 5K8TA 1IY2A 2ECKA 3FTQA 3CZQA 4RCYA 3TVTA 2C04A 1FP7A 3AVPA 1E2LA 2GJSA 3A1VA 3PENA 1W1WA 3BBPA 4UXIA 4HUQA 4B32A 1WQ1R 1I4DD 4BASA 1Q12A 4AKHA 3VU9A 3A4LA 3AF1A 5CLQA 4OI1A 3VNUA 3EC1A 1KI8A 3B1XA 3K0AA 3AVYA 1E2JA 4LJ5A 2O8DA 1P72A 1Z2CA 2QMUA 2KBEA 1N0WA 4HAVA 3R7WA 3K09C 2C2HA 1DOAA 3B8HA 2KWIA 5BXQC 4C0JA 1OIXA 4JLDA 3CIOA 1NL3A 1XNJA 1IN5A 2J59A 4BRWA 4DT1A 2WSSA 1NLZA 1S4QA 2VEDA 5A5GA 1RYFA 1NMZA 4RCZA 1CP2A 1MKYA 2O8DB 1W4CA 4LBWA 3AKEA 4C2UA 2V55B 5AJXA 2ZANA 2TMKA 5TMPA 3VAAA 4HUQB 2RKOA 3OEEA 2ONKA 2C9YA 3DM5A 2EFDB 1VDZA 1JQLB 1HUQA 1NBME 2G0NA 2GXUA 2A5JA 3LO5A 3GJ4A 4URVR 3AQ4A 4TMKA 3X2SA 5CLLA 5AUQA 4FWTA 1CRQA 4TLDA 3ZZTA 4B74A 2AFIE 1KI3A 5CDFE 4P32A 3QQ5A 1VECA 4DSNA 5EE0A 1TF7A 1IXZA 2A3RA 2MSEB 3NEJA 1AZSC 3P27A 4UNSA 4ASUD 2RCNA 5CYPA 2V54A 1KO8A 1JEEA 2YZ2A 1XEXA 3G0HA 4B6EA 1EK0A 4MRRA 1WBDA 2P5TB 4OKSA 2Q9BA 2BKEA 1UADA 3L8ZA 4LV8B 1XTRA 3RS5A 2BCJQ 4HB3A 3BRWD 3Q3JB 2GXAA 2GESA 3FMPB 1AZTA 2V8OA 3T5DA 4LBYA 5DN6A 4N3NA 2ZJOA 5C4MA 1N25A 3BH7A 3L43A 2OO7A 1II0A 1R0WA 2GEUA 3RS4A 2ZJAA 4C4PA 4XSHA
chains in the Genus database with same CATH superfamily
1R0ZA 3EEQA 3HN7A 2HK9A 3OURA 2WINI 4GPAA 1A9YA 1N2CE 2IDMA 2CXXA 2G4LA 2OY0A 3OZAA 5DH9A 4Z4HA 1QTRA 1FEZA 1HLFA 3KVVA 1T4MA 2V7XA 2FH5B 4KC0A 1AIPA 4PZ9A 5CK4A 4DPLA 1AH2A 1IOVA 3D8BA 4YLYA 2OBMA 5KWSA 1O96A 4ZEWA 4EMBA 4TWIA 3JVDA 4GWKA 1YFLA 4U5HA 4O6MA 4AE4B 5FV4A 1AV6A 1BVHA 4LGYA 4EHLA 1QFZA 3D7NA 2E6KA 1AHHA 3WGLA 3HI4A 3B1KA 4BB9A 1GPNA 1CJMA 1G8GA 3BFXA 1PSWA 4WZBB 2C8JA 3MJSA 3NORA 3FUCA 2YX1A 1NP6A 4AMBA 3L4JA 4Q3BA 4BLWA 2IQ5A 2F17A 1E6CA 1KKLA 2QEQA 3W1WA 3UWSA 1QZUA 4E6PA 1VE7A 1NU9C 1EFKA 1O97D 2NWQA 4CNBA 1CJKC 3EUEA 1N2CA 1YI8A 4HZUB 5JNLA 2O3SA 1CNEA 5ITZB 5IT9A 1NDQA 1CPRA 2BDEA 2OZLA 2W8ZA 4R9NA 5I4KA 4AS1A 3U4IA 5TC4A 4XW2A 1M5RA 2E18A 4RKEA 1TF5A 5JADA 1QRUA 1R66A 3IS3A 1UMDA 2OFXA 1FFCA 3RRZA 4FP9A 5MHTA 2C4NA 3TGWA 4C6TA 1MRSA 4XARA 1M2VA 2FF7A 2PSFA 3DNPA 3K0KA 4HYQA 4ITRC 2FQXA 2GVZC 2ZBUA 4X8OA 3K2QA 1M74A 1FTYA 4LZAA 4JB3A 2IM8A 3VDMA 3WK8A 3E3AA 1PW5A 3KAJA 3POVA 4RSHA 5HIMA 5JCJA 4TWJA 2OXTA 2DB4A 4G89A 4C06A 3VKFA 2JJMA 5BW8A 5DCYA 2HHLA 3VR2D 4GR5A 4Q9AA 4PXAA 5CCBA 4RUKA 2G5PA 1BOOA 1TLLA 2JIRA 2QLBA 3KT6A 3K0AB 2QJWA 3S2UA 5TPWA 4CV0A 3GLIB 2OCIA 2O48X 2BAGA 3E03A 1JF8A 4XWKA 4GF5A 5A0TA 1JLLB 3TSCA 5JQGB 3GVIA 3HV2A 1FTNA 4QOHA 5GM1A 5LL6P 4W5NA 2KSQA 5DNYB 4Q7MB 3O4JA 1IMJA 2VUHB 4H3HB 3AWIA 4HXFB 4P0TA 2B7BA 5JSKA 4C04A 4RVUA 4JYPA 1I7LA 5DT2A 1G1MA 3KALA 2W6NA 3A04A 4D98A 1JEAA 3VUEA 3ZVKA 3ZH9B 1GZ7A 2B2CA 2A1IA 2QMHA 2WDPA 4M1SA 3BJEA 5T1DB 5B1BC 3EZXA 6REQA 3NRJA 4EHFA 5E7JA 4G36A 1ZNZA 3K0FA 3T15A 3C5WP 3TKAA 5CB4F 3BG5A 4TUYB 5SICE 4CMIA 3M2PA 1G3UA 1JQ5A 4ZI7A 2HAEA 1M34E 4N3CA 4WUTA 2ZR0A 1OXKB 3D6FA 3G6WA 5CITA 4OY3A 1V1MA 2C96A 3I0ZA 5JISA 2HMZA 3AR3A 1JTEA 1FA9A 4LYYA 2IDZA 4MUJA 3CRVA 4J43A 3MD9A 2Q3EA 1A82A 1O08A 1Y8AA 2QRVB 3AR7A 3L01A 4H3KB 4NPHA 2J3IA 4PO3X 4D5GA 4BRUA 5A4FS 2FWIA 5BQXA 3JQFA 5EZYB 3WYAA 3CW2A 2R8XA 2VNKA 4GGOA 4PBRA 1TZCA 2LP4A 2XYPA 4WOJA 3MINB 4G0HA 3T35A 2QRKA 4KFCA 2EJWA 4EHKA 2G71A 5EPOA 5KYXA 1X19A 1HE3A 4L02A 2BR3A 3VU0A 1ORHA 1WNFA 4B6GA 4X0RA 3FHTA 1S1CA 2C5AA 4F2PA 5I9SA 3H5TA 4MTGA 3SPXA 1XCBA 2R1TA 1ZD5A 2L69A 3QKRA 3DBOB 4KB5A 3WHKA 5I45A 1AXEA 2CKMA 2P11A 3R2JA 5FQOA 4KPYA 1GAXA 3CRQA 4QL3A 5T7BA 2RD2A 4DSAA 4CHTA 5JZSA 1RRMA 2ZRGA 2WYOA 4YT4A 3V1MA 3W0LB 4RFSA 5LQDA 1QU2A 2AXPA 1MH9A 3R5TA 1KJQA 1WB9A 3A1EA 4M0MA 3L8JA 2XI4A 5CM2Z 5EGNA 4DCSA 1SO8A 1Y1LA 3GGDA 3ZVLA 1L7BA 3QPWA 3B8EA 5BQ3A 4IIHA 1PL6A 1D6SA 1FY2A 1U7XA 3K0HA 3MJDA 3SEFA 4N8DA 1EK1A 4B75A 3ZWAA 1YR7A 3OKPA 4QT0A 2I3GA 3DA8A 1JFFA 3EG9A 1S7CA 4HEQA 5HEKA 3HJNA 4H1UA 5H9WA 2WR8A 3PUWA 1BXGA 2ONCA 4P3OA 2D2XA 3HTKC 5ALUA 3HJGA 4M86A 2EBUA 3SS7X 1XVIA 3RYTC 2ZRLA 1IBRA 2C59A 5K3FB 1R15A 4DG9A 5BR8B 1T13A 1X1EA 1YZFA 4ILKA 5JVDB 4FZ5A 5DGCA 2NGRA 2X9LA 2HXSA 3HSKA 3OPYB 5BO5A 4DMRA 2H2WA 4NMXB 4PZPA 2NPFA 1JQ3A 2C2ZA 3OCZA 3I0NA 3M6AA 1DRWA 2P30A 4ZI5A 2OORC 1L7AA 2XMCA 2JX0A 4ZCQA 1Y1PA 2GEDA 3SOPA 4Y67A 4WJKB 3V9PA 4FLMA 2ASRA 4C7XA 3HACA 2AZ4A 3FRIA 1TDJA 3MN1A 4JR1A 1RQPA 3QXCA 5LDGA 1RYYA 3IUBA 1TM1E 2V7TA 1ZU5A 1EVQA 2BE9A 5GY7A 1LE2A 3IDSA 4OIOF 2J33A 2PDAA 3ZD8A 4G1UC 1NF9A 4K6MA 1O9GA 4FMCB 5COMA 1P9NA 2AEFA 4YA6A 2NU6B 1NMXA 1YB1A 3T7TA 4DMGA 2DPGA 3I92A 4G0ZA 1L1EA 2AH5A 2G40A 5JS5A 2XVYA 3GRFA 3LWDA 4P5PA 4R31A 2Q6TA 4X1IA 3FIUA 5FQNA 1NV8A 4IIGA 5B37A 1PJBA 3BCUA 4I5EA 4LOKA 3ZU6A 3ZWNA 1XLTC 5DTJA 4K6HA 5L51A 4KXYA 1QVZA 1SXHA 4KGDA 4BU0A 5LB2A 4EX6A 5GOZA 4G37A 3CSKA 1H5NA 1XZCA 3RFXA 1N5JA 3R3HA 2X0IA 4JCCA 3X43A 1VRVA 5IMBA 1K66A 3E7FA 1L5HA 4R83A 3TTXA 4V1CB 5EP2A 1FSSA 2HD4A 1NXVA 3FOCA 1AM4D 3KYDA 5TVKA 4WEQA 4YVFA 5F5HA 1NZJA 2V97A 3G9UA 3AEQA 3JQFC 1UDXA 2FR0A 4OI2A 4X6LA 2G08A 2P2NA 4E2YA 3R7FA 1KQGA 3PTAA 1D6JA 4Q5IA 5JO0A 5BQPA 1Y6ZA 3K72B 2WIAA 5AVQA 3NG1A 4R1PA 5I7EA 1M0WA 3DEYX 4MKFA 4P4LA 1M34B 2K5UA 1G291 5FPQA 2E87A 1U8FO 1WUIS 1SIOA 3BD7A 3SBXA 3CWZA 2PYZA 1EIZA 1PLLA 1POWA 1MH1A 5ERGB 4WY8A 1SBTA 4EGCB 3KELA 2HGSA 3ROQA 1SQ6A 3G13A 4DWJA 1WBBA 2RE8A 4LV6A 4H16A 3A1TA 3AY6A 4PRZA 3I32A 2PMFA 4N18A 4TN5A 5ESRA 1S3FA 3TOSA 3W5UA 1XEXB 5B1HA 3WADA 1XD2A 1A7DA 1FFDA 3DC2A 1MFPA 2X3FA 3GU3A 5DBIA 4MVMA 5JT1A 1QBKC 4QTXA 5ECGC 3GRKA 3LOUA 1VG9B 4BFZA 3WLHA 2Z4SA 1F4PA 2PZGA 4QATA 5ALQA 3V4VB 1LLUA 5IN4A 3MGAA 1R5JA 1Q7RA 1Z29A 5HTOA 1ESZA 1HNXB 2ZSKA 1NAHA 3BSFA 3VVLA 5JS8A 5IG2A 2Y77A 4E70A 2GPWA 3NWOA 2W6IA 3HKDB 1F8GA 1Y37A 1BO6A 2F9MA 2QR2A 3HE3A 4NC3A 2AN1A 1CY2A 4Q03A 2Q6LA 3K70B 4JSRA 3G88A 3SWWA 1L5OA 1NM5A 3D6TB 6LDHA 2IGTA 2PZMA 4XAQA 4ZVVA 1H7IA 2GD1O 2XBLA 3D6AA 4K86A 1CE8B 3GOQA 1U9CA 3MUNA 4XFJA 2QV7A 4DY4A 2A9QA 1ZM2A 2R6AA 3DYBA 3H3JA 2I62A 2R2GA 1KZ4A 3TR0A 2BJHA 3H1BA 3L49A 1U04A 2CVZA 3VH1A 4DC0A 3VF0A 3FAJA 1EHIA 4MMYB 3IC5A 4BO6A 1Y3BE 3K9LA 4RD2A 4MVJG 2BR5A 3C45A 2OBBA 4I5FA 2OUKA 2RGNC 3TMYA 1D2GA 2E6UX 3S0XA 3I1IA 4R8MA 1VI2A 2MWQA 1ZBDA 2CEKA 1S3SA 2GK3A 2I6TA 2JFBA 2PN1A 3QKRB 4BX0A 1Z13A 1UXIA 3MBIA 1YR1A 2O3JA 3CLRC 4F3KA 1IMOA 1C8VB 3R0VA 3PLNA 4XSGA 1DELA 3RVZA 2QRNA 4C2BA 1KU6A 1OILA 1ESEA 3FFWA 3ZHBA 3KWJA 2XLVA 4M54A 3CY6A 3JSXA 3LG2A 4JKVA 1SNYA 1XAGA 1XYVA 4QFMA 2OXFA 5H68A 2DECA 5KYVA 5IEBA 2NACA 3GJRA 3L77A 4RF2A 1IBKB 1PO7A 3TIXB 1J0BA 3LFTA 5EQDA 4BE7B 3U7GA 3AVXA 2ECFA 3U13A 1EP1B 1APCA 4LDZA 3X1KA 1HMOA 4MHTA 3AJ8A 3NDBB 1Z75A 3DONA 5E38A 2ZRKA 1CW2B 3BH0A 4R5HA 3HCFA 1Z3IX 1W75A 2I4IA 5JTUA 1KZ6A 1GG9A 4GX1A 1XZGA 2Q3TA 4MS1A 1LF0A 4NG5A 3WV5A 2I4OA 3FZEA 4FJ0A 3EGOA 1Z33A 1ADCA 1MEOA 3CEHA 3FZGA 4J4TA 1X1CA 1PK9A 4Y0NA 5LXTF 3EZGA 4F3TA 2W37A 4WK0B 5J5CA 4OYRA 1GTJ1 1UBKS 3ZIAA 3WOVA 3ZV7A 3H2BA 3C8GA 2Y1CA 9LDTA 5BVHA 4M1OA 5M3BA 2R97A 4I8IA 1R4NA 5KX5F 3KSMA 4WOKA 1FSPA 2I2DA 6REQB 2P69A 3BJZA 4D56A 3FNGA 3PWTA 1ZINA 2ZBPA 3P9KA 3H7IA 3U8PA 2ZRFA 1JIKA 3H84A 3MD0A 4MVSA 3E8MA 3QX7A 1H8HA 4NBUA 3MCAA 4EITA 1KVQA 5KQPA 3C6BA 4C3BA 3A9TA 3ITEA 1LLQA 1M2VB 1NBEA 2H08A 3H83A 4G07A 4E7ZA 2C4KA 1YA6A 3AUSA 1OI7A 4YCAA 2R7OA 3DE6X 4EO9A 3WL4A 4M1EA 5KNCH 2RHDA 3THWA 3AK4A 1K8QA 3KQSA 1N5OX 3Q8KA 1E7QA 3DC7A 3SLKA 2OB1A 2RK6A 5ITZA 3DEZA 1XVTA 2GLTA 2B37A 2EW2A 2HJRA 3OMLA 3TL6A 3QJGA 3D2CA 5K3BA 4KO3S 5A6BA 3NDIA 4IDDA 4FQ7A 1Y4ZA 4BEJA 1SXJD 1KOLA 3TNYA 2QT1A 5ICCA 1W88A 3FUXA 2VA9A 3OY7A 4LSMA 1OCZC 1U6HA 4CS8C 1SUPA 4FFLA 5NLLA 2MSWA 3HUDA 3IMKA 1JQJC 3H5AA 5HOEA 3DOUA 3OOYA 4FEAA 3AUAA 2WMNB 3LP5A 3R6TA 4GNRA 3U17A 4HF7A 2ZQ5A 4Q6WA 1P1KA 3WV4A 1CJUC 1UR5A 1F4LA 4KQEA 5DE3A 2QJTA 1YCDA 4BQRA 1CEEA 5DNWA 3DDSA 2RH4A 4KVFA 1CUGA 1RBQA 2WC1A 3OJCA 4AE4A 5DWDA 5A7GA 1V1RB 3EZLA 1BEZA 3NALA 2YVQA 5F5LA 3L7BA 3PNVA 1ZUD1 3DH0A 1N2CB 3G2MA 2VBFA 3V55A 4HLUA 3FBWA 4HZIA 4V1CI 3ICWA 4L9RA 2QTRA 1U90A 3A1DA 2GBIA 2P2GA 3QF7A 3RNOA 1NJ1A 1K7SN 3HM2A 1A7EA 2FVXA 2MYSA 4FK8A 5DLQC 4EVIA 2YV1A 2LCFA 1CLEA 4MDFA 5KJEA 4RV5A 3BE4A 3SDSA 3F4KA 4YCNA 3OM9A 2YJNA 4PYKA 3UKJA 1USVA 3IHUA 4OXIA 2V96A 2XCIA 2N9UA 3IOCA 3NATA 2WJGA 1M54A 2PTGA 3BWXA 3W8DA 4Z9HA 3OM0A 2KJGA 1SCKA 1H0RA 1R0LA 1JWLA 1EFAA 1WPGA 4XX0B 2IP1A 2VQ6A 3PHGA 2H31A 2GMWA 2OZEA 1SJ9A 2PGIA 4ENPA 2QT9A 1H4SA 4A2PA 2FTKE 3HA3A 2O1WA 2CZQA 4H7PA 2PMBA 4IZIA 4F1JA 5BV7A 2XOKD 1SM4A 1UMCB 1M6EX 1XP5A 1RJ9B 3UA4A 2WNIA 4LJYA 1O3YA 1DO2A 1DX6A 2AXQA 3MMPA 4YASA 2JJYA 3COJA 3QPAA 2C88A 1UODA 1G5HA 2VJKA 3MCWA 4QJ3A 3AHDA 1XZPA 2Z83A 4N49A 4WBNF 2ZZKA 3I5YA 1OKKD 4NONA 4PRLA 3CPJB 4ZO4A 1II8A 1SN7A 4G84A 3PFWO 4U00A 4DC1A 2EU8A 4C21A 1X2BA 4EQZA 4CS8A 5J2UB 3BXZA 5KMGB 3WMFA 1V5IA 4D8TA 2GZ3A 2WPNA 2ACVA 3HRKA 5CCDA 1RT9A 3CG4A 4K5QA 3KT8A 3K33A 2HWYA 4DLWA 2EFYA 3ZD6A 1P7YA 3AFOA 3QEOA 7GPBA 1G3QA 2O54A 2IXNA 4GMFA 1GTL1 4IDQA 5TPZD 3WIOA 3KXIA 1Q7EA 4JA2A 2X1MA 4NJOA 3ZGNA 5KNDH 4RDAA 1NSYA 3GLGA 1TUIA 4V3BA 5TQJA 2ST1A 3GYBA 5LQRA 3U9JA 1M2JA 2HK6A 2HQBA 3ZQJA 3RIGA 2QUAA 2HDOA 3U3MA 3KPWA 1Z4NA 4DV7B 1GPJA 3O7MA 2AN4A 3VZDA 3FHJA 4HS9A 3FCYA 4KQJA 2ODTX 1NPTO 1AX9A 1QGUB 4PCVA 2VZEA 4G8JA 3GEDA 4ULVA 4I3MA 1OZAA 3A6DA 2I8CA 4LCBA 1I4OA 3CRNA 1NBWB 4G81A 4DQXA 1J25A 3QUSA 3U31A 4MTOA 2FLVA 1T3TA 1V7CA 2C99A 3HCOA 2WAOA 4HQFA 4XQ0A 3FZNA 3ZXXA 4CQJA 4DSUA 1JFTA 3LGXA 2JRCA 4XD7A 1K6JA 4X3CA 3A7DA 5C8VA 2PU5A 4I8DA 2Q50A 4ND5A 2A3NA 2HSEA 4D92A 2BKVA 1BR4A 3NHLA 3EB9A 1H94A 2ONYA 1ZH2A 2IXOA 1QIDA 2I2BA 2FUNB 2B35A 4RGYA 1WW8A 1R9JA 2PZFA 4ZOLF 2VDUE 5HKAA 1YZUA 2XT9A 2XLOA 2WTBA 1FP1D 4FGLA 4KQGA 2MHRA 2JGLA 3MCVA 4QYIB 2QRJA 4KK3A 3A1NA 4MR9A 4Q05A 5IP5A 3WBBA 4CR7A 3AKZA 2C3MA 4CMEA 3HZZA 4J0CA 5EZQA 4AY6A 1XTJA 3K92A 1B14A 3K9GA 1ECBA 1X80A 1EAYA 4LOAA 2BE5F 4C7JA 4XPIB 1DAOA 1MJNA 1O03A 5GQSA 1PEYA 3BE6A 4IUYA 1W30A 4CEHB 2B4RO 3S5JA 4KDEA 2ETSA 2QRPA 4QI0A 2GN6A 3OCWA 3QWIA 1ULSA 3Q9SA 1OIVA 4FT2A 4JLKA 5AI4A 2AMLA 4KE9A 3VNVA 2VT7A 3V2IA 3QEMB 1D0IA 3QXXA 4OA5A 3E84A 3MWYW 1NKTA 4HVTA 4OL9A 4G25A 5DCUA 1XMPA 3JAWA 1C4OA 4B76A 5C9ZA 4HL6A 5CG1A 3HRIA 4E4TA 1JLKA 1Q19A 2AR9A 2IUEA 3AUYA 2HBYA 1ML3A 3KXKA 1X1QA 1D09A 3LHSA 4O2BF 1B8NA 2J67A 4BDTA 4RELA 1EWKA 3P2OA 4X94A 3OEWA 1U28C 2AUTA 4QPJC 2IH2A 1OC4A 3HKCA 3BSYA 3T7DA 4OAPA 2X0FA 1WG8A 4ZOQI 1DIBA 1BDBA 4E5VA 2XLEA 3KVYA 4FCTA 1DCFA 1D07A 1E2FA 1EZZA 1T24A 3O6VA 3FUUA 5JANA 3AQCA 3V33A 4O1IA 1HY3A 1Q7GA 5GV7A 1PFVA 5AM2A 3QWBA 2AFHA 3VNSA 3WMRA 2VSFA 5GINE 4FKMA 3N6XA 1EWQA 1EZ4A 4RV4A 3JZFA 3H18A 1ABEA 3TRDA 3CVUA 3RIPA 1ILWA 2BCEA 3AOUA 3OLVA 3PEUA 4QDZA 2VDMB 3BHIA 2IELA 1DWUA 2Q2OA 8AT1A 1A41A 3IPMO 2EARA 2N1BA 5B6JA 1XUOA 2HRZA 5AHXA 2ETVA 1SKQA 1DAEA 4O4JB 4MNDA 3V7FA 1O97C 2QD5A 1ZM9A 4BWVA 3ONVA 1CVRA 3HNRA 5MFZA 2AW5A 5CDYA 3CLUC 2F62A 3AI7A 1ULUA 3E22A 2OM6A 3ENKA 4IDPA 5IUKC 4MVRA 4GLLA 2FQQA 2YIJA 3UHPA 1KWGA 1H1TA 3CUVA 3JT1A 1NOJA 2M2IA 4CI9A 1QR2A 3EC2A 4JI3B 3PUHA 4AL1A 2PNOA 4MQMA 1KVTA 3BT7A 1ZW1A 1GEEA 3GV0A 1NVVR 2NO7A 1PWYE 3BM5A 4AUMA 3U4CA 3JU3A 4GR9A 4TOIA 4FHEA 2QN7A 3RS2A 1FLVA 4EI2A 1R4TA 4O3FA 1J97A 4QREA 2R3SA 4DEVA 2NQTA 3DP9A 2BVNA 1JR6A 2TMVP 3R44A 3PFCA 2VL7A 4E0HA 3JD4A 2DHCA 4FESA 2HMSA 2XUFA 3QELA 4TV8F 4BP3A 5ULLA 2H1CA 4ZAFA 1OCCC 1JYSA 4NBSA 3FKJA 1A04A 2W11A 2KW3C 2ZS9A 1RZ3A 2A30A 3JZDA 4UHKA 2H65A 5TVGA 3ILYA 1DJPA 3ZGZA 4IWNA 4FMPA 3VHQA 5DT9A 3RS0A 3F73A 3RARA 4LQCA 3UAWA 1FMFA 2UVDA 1RXUA 1JKJB 4IH9A 2Q5QA 1C80A 1FPQA 3GELA 4HGNA 4A6DA 5G40A 1C30B 1ELOA 2CC2A 3Q0TA 3I39X 3UC9A 4UE6A 3JZ0A 2ECQA 4BO7A 1YK0A 4JJ6A 5LDDC 3ML1A 2XM0A 2YVLA 4QUEA 1U89A 2QX7A 3LNMB 4LA4A 4MW0A 3AYZB 1NBBA 2H29A 1TMKA 2W2KA 1JU3A 1N6RA 3KDPA 3OOJA 4TRRA 2WJ3A 3F0TA 5G4LA 1M6VA 5EUBA 5E6SA 3BJMA 2ZVPX 4C0AC 1UZUA 5CVDA 3B52X 5DYWA 4MV0A 4U6SA 4EABA 4OINF 2QE9A 1YACA 1FQWA 3EZHA 2PSDA 3MUOA 4WV3A 2HO4A 5BN4A 1FNNA 1Q91A 1AXGA 721PA 5FZTA 5HV9A 1EFRA 4RL4A 5HRUA 5ITWA 3WWOA 1Z6PA 1TQ4A 5CH8A 3WBFA 5FLXA 4DBVO 3ICEA 1CDEA 1VTMP 3ZZMA 4CKBB 4M0KA 2WWIA 2B20A 4YJDA 4K46A 4EECA 4L9WA 4EPWA 1HOXA 1SZIA 2EAUA 2IYUA 2L82A 5KVAA 3KLMX 3R23A 1ISJA 2W4IA 3UGOA 4OXKA 2BEKA 1XZ8A 2PQ0A 1FRNA 2JJ8A 3EEIA 3PHHA 4TTSA 5H83A 3FCOA 4F9FA 1E9AA 2JI9A 2ZXRA 3ESAA 3PKIA 2PMWB 2XYRA 3GWZA 5ALSA 4MV9A 3VR0A 5BYKA 2HV9A 4R1LA 4CM1A 1Y4DE 4PX2A 3NM5A 1GS9A 1GITA 4EAAA 1JTFA 1Y7PA 2Z3ZA 3CHYA 2A78A 5J5AA 3DJNB 2ATIA 3CR8A 3AOEA 3VTAA 2C9BA 1YZVA 1USIA 2I87A 4N1AA 5EJEA 2DYKA 3LJBA 1V5EA 4EB8A 2WVOA 1CDDA 2C92A 3WQSB 4A6EA 2ZRJA 2GYUA 4L22A 4US1R 1YWGO 2C2XA 3WLKX 4UDVA 4G0OA 4W9NA 3RSCA 4DZTA 3AW8A 4LDNA 4V0QA 2BM1A 5DU2A 3CFYA 2PX5A 2RGWA 1IQRA 5IPFA 1JZSA 5IN5A 2EJBA 4YRIA 5K0NA 3NNNA 1FUEA 5F2KA 2ZBGA 1YXMA 4CMCA 1EFVB 2IYNA 3JQ9A 1XLUA 4S1VA 4LNHA 4DCNA 3E0XA 1S3GA 1S0UA 1TCBA 1CUEA 3KD3A 4TS3A 5DKFA 1LKXA 4QOGA 4YN0B 1R4ZA 3PGJA 4BQEA 3WFJA 5U1PA 1TZKA 2VHVA 3KETA 5IC5A 2QDXA 2HA3A 4QYIA 4JHXA 1NXSA 3LTEA 4LYEA 1OBCA 1TE2A 3SIPA 5C1DA 5CG2A 3LC1O 3NHFA 2O1XA 1GGJA 1V11A 5C52B 4H17A 2ZBRA 1CS0B 2ZCVA 1Z38A 2OBLA 3FSGA 1HMDA 2GEJA 2WA2A 1ZAYA 1OI4A 2F8MA 2VSXA 1K7EB 2YNMA 5H82A 4RTMA 2PA3A 3WL3A 1VLQA 3RHTA 5B12A 2X2EA 3VZRA 4DV3B 4TUYF 3CNQS 2WD7A 2YH2A 1JHAA 5AHRA 3I5AA 1XTIA 4KQWA 3I61A 3OD5A 1N6KA 1N8SA 3OM8A 5DTIA 3ZOKA 5H5JA 3JQCA 4AKTA 5BQFA 5L7YA 2GDCA 5EMMA 5E9AA 1FCJA 5EE1A 3OZGA 1GPUA 4M7RA 3Q7QA 3BE8A 1TLTA 4CM4B 1I3CA 1N7HA 4NMWA 4GSLA 2AWCA 2F1KA 3U80A 5GV8A 5CGQB 5L3SA 4LKRA 2REQB 4HDMA 2VWQA 1T1GA 1IUKA 4PVCA 1NUAA 4Q7KA 1NI4B 4HPWA 5CW2A 1XZLA 2PRZA 1N3IA 5GONB 1FDSA 3VPBA 2VAXA 3OZDA 5EIBC 3AOEC 1UKEA 4HAOA 2IFTA 1B3RA 2NQ8A 2OL4A 2XMSA 4YECA 4BMXA 3U19A 2V6IA 3ZY2A 3TI9A 2A59A 5CRIA 3TKLA 1IHUA 1XRMA 2XQIA 3E2MA 3HFGA 4FS3A 3K70D 1KVUA 1ZUWA 1DG1G 2X58A 3DD5A 1A9XA 3BB4A 3PVCA 6GPBA 1CR1A 4PZEA 1KEEA 2I99A 4XIYA 2J5XA 3QUAA 3PR1A 4AUNA 4J0EA 4Q21A 2HMUA 1QH9A 2CLCX 3EUWA 1K7XB 4EW6A 1KI4A 1HYHA 1UDCA 3DAPA 5HJ2A 4DDHA 2Q2WA 1XXHE 3GEBA 3LDHA 4I9HA 4EY6A 2I91A 4FGWA 4KVAA 4BZQA 4K2AA 4OAQA 2NSYA 2GZ2A 2ZIEA 3FNFA 4M98A 3RVKA 3CBGA 1NFQA 1GUFA 4LGMA 3F74A 2VCYA 5CNMA 1RM0A 2ENWA 3T6JA 1LQUA 5AW6A 1BZYA 1YBAA 5M34A 4YJ2A 2MR6A 4FYYA 5F7OA 3R09A 2R8RA 1SEPA 3SKXA 1FLNA 5IAAA 4NENB 3OFNA 5JWOA 1J5XA 4MV4A 3A4IA 4FW8A 3A10A 3MT0A 3L0PA 2ZAGA 5I7WA 2GCEA 5FLKA 5EJ2A 3BIOA 4REQB 1IK4A 1ZVQA 5EXPA 3NC1C 3M89A 2VH5R 3FTPA 1PZFA 2PSJA 3AGQA 2R87A 1DXOA 2PUGA 1P4RA 9GPBA 1ZCAA 3VHRA 1RI5A 3DBVO 5D51S 3EF3A 2CV1A 4GPZA 1JDTA 2XE6A 4MYUA 4H18A 4IS2A 1R6TA 5EC8A 4MGIR 1KR2A 1SHTX 5DYIA 5TLSA 1DTWB 2FJ0A 2Q1WA 5EZSA 4FZRA 1RNLA 2QA5A 3EIOA 1XJWA 1U9JA 4KO1S 4ZO7A 5E0OA 4ZK2A 2RKWA 3OVMA 1K98A 1X7ZB 3GGCA 2Q1TA 5CLIA 5A62A 3C3BA 4Q00A 5C4GB 2B2NA 2WOOA 4LQDA 3T7SA 2DI3A 2FWAA 2R6FA 3WYEA 1WDKA 4P2BA 2B1JA 2JB9A 2VDWB 4L74A 1MXFA 2A4MA 2FQYA 1E83A 2OXIA 5C3UA 1WTAA 1QP4A 3PE6A 3F3YA 2UDPA 4JJEA 4MV8A 2LCQA 2GCNA 4JYBA 2BH9A 4JI0B 4DTIA 5F98A 1H2HA 4DNPA 3WNBA 1RHUA 1J5EB 1LNZA 3CLSC 1UAYA 4YHHB 4BEMJ 1EXDA 3BORA 3FPGA 3QE2A 1A5AB 3PYLA 4J3FA 1NLUA 1Z5OA 1G6KA 2R1TB 4L1KA 4NBWA 3FAKA 1G3MA 5DHUA 5LOVF 5GJWC 5HNKA 4NE2A 4JC8A 4LGVA 1GTRA 2G5CA 4UDOA 4UTVA 2W2QA 1A8UA 2ODBA 4CV2A 3LTNC 1RRPA 4HV4A 1BJKA 3T9DA 3B3FA 3DI5A 1MX9A 4JI2B 4OX9B 2CYDA 3EQ2A 4NV3A 3OZFA 2PLRA 4QBFA 4LX8A 3WFZA 2O05A 2YYAA 4CLRA 1M5UA 2G1PA 4XZ3A 3SP1A 2XTZA 3PC4A 1SPXA 3GFGA 1SKBA 4LDRA 1W2HA 4JTCB 3FRJA 3IE1A 4HFFB 3R7CA 2ZWMA 3EZ7A 3PSHA 4YAFA 1ZZEA 3C5VA 2VHYA 1ZUIA 2WHEA 4EF5A 5FH9A 3M0EA 1EUZA 3IA7A 3AY0A 3DMPA 4IYJA 1EXWA 4X93A 3CXRA 3TZKA 1ZVJA 2WAAA 3TSWA 5H16A 4GC9A 4WY2A 4MRMA 4AMYA 1E4OA 4Z49A 1JDSA 3EGCA 4G5SA 1WPQA 3WL7A 2XGGA 1ZH4A 5FJJA 1GL6A 2UUIA 1FS5A 1NJ5A 3K6JA 4QHYA 3RABA 3WXMA 5EJ5A 4AUKA 1SKMA 3PHLA 1YQGA 1FYEA 1GU7A 3DXXA 3FCCA 3H1TA 4PFJA 5DGIA 3TL2A 2FPXA 3VPDA 2J07A 3ZV3A 1E3MA 1H0KA 1GSAA 2PL1A 2J9BA 3H2JA 3AX6A 3NBMA 2NXWA 4JYCA 1Y3HA 3DAGA 3ABQB 3I2YX 4O2AF 2G9NA 2DHEA 5IBRA 4YREA 2QUJA 4V38A 5A7HA 3HPRA 1O87A 3FVQA 3MW8A 4OQMA 1F4VA 1U1IA 3G7NA 3MERA 4YTEA 5A6JA 2VP4A 1K8RA 2QP9X 2FB9A 2M32A 4EHPA 4Y2QA 4WZAE 2PZAA 1HEYA 3M3DA 4E88A 4ZDIA 1M6NA 4IMJB 5EESA 4JJFA 1Y4UA 1GGHA 1TYCA 221PA 3L8DA 5THQA 1J4AA 3DLTA 2PJDA 2BBWA 1A2OA 4Q19A 3PNPA 4BC1A 2PV7A 3C6MA 4PCLA 3M6LA 2G36A 4RVGA 5CDHA 4LPKA 2EX1A 4FMDF 3VR2A 5KDLA 4JEAA 1T6XA 2EFGA 4FDVA 4DQDA 1RAGA 4FGSA 3H1PA 3UV3A 4BEVA 2WSLA 1NZDA 1EM8A 1NW4A 1IXYA 4QTZA 1V8ZA 3LW8A 1IVSA 3HU2A 4BLTA 2IZ7A 5HQ3B 2H8GA 2SBTA 2DP4E 3I9JA 4E0BA 3V5XA 4CKCB 3U7EB 4HR7A 4YBRA 1AHIA 3CZAA 4P7KA 2AR7A 2NPIA 3OF3A 3KUXA 2LE0A 1E9BA 3AETB 5DIFA 4PZZA 2V1UA 3VH3A 1FAPB 4FYVA 1P3JA 4M88A 4CLXA 4DVJA 5ALXA 1DCMA 1PWXA 2BMFA 3E3LA 3L3BA 4GSYA 3TFQA 5CU7A 5JROA 4PZAA 3RBXA 5ABPA 4MH0R 1JI3A 2IH5A 5AK6A 1MGOA 5TPZA 1CUFA 4BKMA 3DAYA 2RH8A 1M73E 3BPSA 3C6ZA 1SVKA 4O02B 4F9EA 1NR1A 1OBVA 2Q21A 4NLLA 3QLJA 4C87A 2ZUTA 1YZHA 1P4JA 4MPPA 1FNBA 4UHHA 4AF7A 2MTBA 4C05A 3E9NA 4MMXB 1YA7O 2ANCA 4Q47A 4IVQA 2OP0A 4G9EA 2OD2A 4XIJA 3DEIA 4J1TA 3HGQA 5DNDA 2A33A 4PQEA 2QM0A 1PUJA 2JCSA 1Y9AA 2VF4X 3MRSA 1VLTA 2G07A 1KVSA 2IW1A 3ER6A 4LYFA 4RY0A 4M1ZA 1VG1A 4DLXA 3GCWA 1DI0A 2H7VA 2IA5A 3A7EA 3H5LA 4D41A 3P9QA 4B7XA 1U1FA 1Y7HA 2C4TA 5A6AA 4IJ5A 1FFHA 2X15A 1GSOA 4B3XA 2BHTA 2BONA 3T0FA 1HG1A 1REQA 1BGVA 3ED1A 3EVBA 3R3UA 3CJRA 4F9GA 1FW6A 3LKZA 1DX4A 3IDOA 4XYBA 3W8FA 1WHSB 1OPRA 1I94B 2Y4NA 3ES9A 4KAFA 1RTKA 1MGPA 1JG7A 3LU1A 4BEWA 4G65A 3W4JA 4XIGS 1K89A 1Q2XA 4KV7A 1E1NA 3H6GA 3KUDA 1Z7GA 4J4BA 1YIOA 3PDUA 1EFCA 4IPTA 1QHXA 2VDQB 3QMMA 2XZOA 1AKYA 1Y6FA 2Y05A 4MQBA 3MTQA 4GGMX 5DWQA 2OZPA 5IFLA 4TT3D 4V03A 1OXVA 1XQWA 4Y2UA 3K4PA 4KV9A 1XCGB 4ZEXA 4DHWA 1MO6A 4HWGA 5HQJA 3ZNQA 3WSWA 1XWWA 4B3MB 1TIBA 3Q7IA 1WF3A 3DOEA 4XE5A 4HH3C 4ENTA 1NXOA 2JD2A 4KXFB 1R0XA 3D5QA 3HKEA 4MW5A 4ETIA 3NWPA 4A8JB 5B36A 5K8VA 1RZVA 1YJ8A 5EFOA 4QBGB 1MPXA 4NYJR 3HUEA 3DKPA 2OHVA 4TV9A 1A4RA 3L40A 4H7JA 1ZA1A 2ZAMA 4I6EA 4QNMA 5IMSA 3EPHA 1Y6DA 2YWBA 5CLJA 3RSFA 4E1BA 4R9RA 5IVIA 2HIAA 4PPQA 3R7AA 4P4UA 3F6CA 3VYVA 5EIXA 1ENZA 2DZDA 2PUVA 3EEYA 4QDJA 4DR4B 1USWA 4RZHA 2ACEA 1RRVA 2UZ1A 3BGSA 5LBIA 1N1MA 3TECE 1SG0A 4JJKA 4Y2SA 3U4DA 2A67A 4GUAA 5EMNA 1M8KA 2D13A 3QPCA 1ZESA 1IIRA 1MEEA 3AUTA 4JYZA 4B3FX 3JW8A 5IY5C 1WPXA 4MV3A 2TS1A 3B1JA 1ULZA 3CM0A 4JXJA 2FFHA 3TIVA 2QUIA 1V71A 4I5GA 3EVTA 2ZSBA 1EGVB 1IH8A 1NUUA 1BXGB 1U7UA 2C9ZA 3R7WB 4X64B 4EHHA 4RTLA 5FKJA 4A8PA 2PCJA 5IUJC 4MA5A 4BBZA 3GA7A 1SBYA 1X2EA 4JZKA 2Q07A 5JCPA 4O6YA 2JZNA 1KTVA 4HFKB 3PJEA 4N4AA 2OAP1 3LS2A 1YCGA 1P1CA 3FYUC 1UDBA 1QLHA 1FFAA 2NTVA 3LY8A 3R0XA 5JNVA 1DFHA 1JZTA 2QTZA 4H15A 4XOUA 4IFIA 5JRAA 4YQEA 2O8CA 1G4WR 3ZLTA 3BZWA 5C1IA 3WWCA 1GRCA 1FLAA 4DRZA 4IWXA 3SEOA 3MOSA 2CXSA 1L7MA 4IRMA 8GPBA 1DQNA 1P3DA 2UVPA 3BCRA 2YWCA 4TS4A 1VFNA 1Z5PA 3UTDA 3HNOA 3Q85A 5B7NA 1YQ9A 3D3WA 1PQUA 3DAOA 4WLEA 4IOKA 5A4AA 1RC8A 3QXGA 4HRXA 3N2GA 1Z4JA 1WCWA 2JKYA 3ISVA 3PD0A 3KHUA 3QJYA 4LBVA 3TEFA 5A6SA 1O0CA 3CX3A 2JLZA 3C70A 3IPAA 2CDAA 2E9SA 1H4QA 2Y3IA 4HNAA 4CJXA 3MWDB 2AZXA 2V6GA 3DWEX 2NVWA 4Q66C 3FUWA 4HG2A 2O2DA<