1FTSA

Signal recognition particle receptor from e. coli
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
295
structure length
295
Chain Sequence
RSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signal recognition particle receptor
molecule keywords FTSY
publication title Crystal structure of the NG domain from the signal-recognition particle receptor FtsY.
pubmed doi rcsb
source organism Escherichia coli
total genus 106
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 1996-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1ftsA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ftsA02
4M1MA 3B60A 4NHOA 1PLJA 3LA6A 2VBCA 2BIFA 1N5KA 3TJZA 1P3JA 2IYRA 5EUQB 5BYJA 1JR3D 2WWHA 2ONKA 1UFQA 3CZQA 4DZZA 2ZRLA 3TGPA 3GFTA 1H8HA 1XTQA 3ZD6A 3EXAA 3U3MA 1E0AA 4GL2A 2GNOA 1J99A 1VYVA 2XEXA 4US2R 2B8WA 3TR0A 2HT1A 3ZVNA 1DVRA 1A4RA 1WMSA 4CT5A 4XOIA 2Y8EA 4TTQA 3C15C 2G88A 3U3KA 4JKYA 1G7TA 3AF2A 2PX3A 3TUIC 1Y63A 4D80A 2V1UA 4WOPA 1SULA 1N5JA 1ZAKA 1ONBA 4LBYA 1BIFA 5D3QA 1S9DA 4P4UA 2ZITA 1E2QA 1A5TA 1DG3A 3OFND 3OAAA 2QUZA 1N6KA 1W0KD 3IUYA 3EZFA 1SKYE 1ZCBA 3BC1A 1MO4A 4JLOA 1XMJA 3R9IA 4TZ6A 5FOXA 3AP3A 3CRMA 4XJXA 4M9QA 3OEHD 5BQ5A 1K5GA 3RVBA 4C0BA 1WCV1 1ZC3A 4QM6A 1ZCAA 4P4TA 3SBEA 4QKQA 2F3RA 1NNEA 3O8CA 1OXUA 3DZDA 3LFUA 4NBSA 4UNQA 4Z8YA 4DSOA 3QBVA 1G5TA 3V4RA 1E0KA 1W48A 1E79A 4KFTA 1GUAA 2ZJOA 1XRJA 1G7SA 4QHTA 3QVUA 4AG5A 5KUTA 4E22A 2LCFA 2HV8A 4P0TA 1OH5A 2FSIA 2XAUA 2PL3A 4A36A 1KTVA 3OZXA 3TQCA 2JCSA 2AFHE 2W6ID 3Q85A 5HE8A 2W83A 5BWMA 2DWOA 3K0CC 4YMSA 3X1XA 1WDTA 1E9BA 1X1RA 1LF5A 1II8A 1G4AE 1K8RA 1NIPA 4JVNA 1C4OA 3ZS9A 1U0LA 1Z0JA 2YJTD 2YHSA 1IM2A 1N6OA 3P27A 3B1XA 2X8AA 1CIPA 3WRXC 3K9GA 2GAOA 1KGDA 3KJGA 4B6FA 3CPEA 1XXHB 3WMEA 3AM1A 1KKMA 2C5LA 1Z0KA 2WWXA 3TAHA 5KDOA 1GKUB 3B1ZA 3D7MA 4Z1MD 2ZM5A 5DISB 5EXSA 4YMUA 3WNBA 2NPIA 2ZRAA 3FE2A 4CW7A 4OI2A 5C4GB 2O8BA 4QBHA 4POAA 2VP0A 4Q21A 4BFSA 4B3GA 1OJLA 2GBLC 1XMIA 2OG2A 3TSZA 2CJWB 3SHWA 1ZVQA 2GF9A 2J45A 3HDTA 3QNUA 4R7ZA 3RLFA 4BASA 2H18A 1KDRA 1OXXK 3FKSD 1GRRA 4D6PA 4QHSA 1IONA 1HV8A 2OILA 4KCGA 1QHHB 2P65A 3SNHA 3KKPA 4Y0VA 1KSGA 3AF0A 1II0A 4G5OA 1E2KA 2JJ8A 1X3SA 1E2EA 1OE0A 2PT5A 1MABA 1UEIA 3I61A 1OB2A 3VAAA 5AUOB 4C2UA 3KFXA 1CRQA 4EDHA 4F93B 3A8TA 5HTKA 3OF5A 1IXZA 1VYUA 4FCWA 1SVMA 1ZM3A 2WMNB 1FUUA 4LBZA 2R6AA 2R6GA 4EJSC 4JLVA 1D2MA 4B48A 2GCOB 5F2EA 4B2IA 5SZIA 2IA5A 1DEKA 2ZSFA 3QPWA 1GKIA 3HR8A 4JLDA 1AQYA 2G77B 3IILA 2QT1A 3V00A 2FGJA 2XSZD 3HWSA 5EXPA 2Z4SA 1Z6GA 2JDID 4V0OA 4ERNA 2GVZC 2QE7D 3IIJA 4KVGA 3THYB 4C0HA 4MYCA 4YONB 3A1WA 3M6AA 1FL9A 4M8NE 2Q21A 1W46A 3LH5A 4EPYA 4YMVA 1G41A 1OYWA 1FTSA 4WIAA 5JS8A 3FMFA 2BV3A 4DRZA 5CM9C 2QTHA 3SE0A 1P6XA 1E9FA 3IHWA 2EFHB 2IUTA 2WBLC 4I81A 4JVMA 4Q9KA 3QVVA 1E2GA 1KAOA 1IOZA 2C78A 3T1TA 5JRZA 1W4BA 4ESVA 1W2GA 1MKYA 2C77A 4ZCLA 2DHRA 4PQYA 1E0JA 2P0EA 4Q4JB 3PG5A 4JBXA 4UKDA 4JS0A 1JBKA 1NN5A 1F2TA 5DLQC 2FFAA 1DO0A 1IN4A 3RRMA 2F1RA 2FSGA 3DDCA 4A15A 2BJWA 1KMHA 2VIIA 4TYNA 2AFIE 4PO8A 5AR1A 2PCJA 2DFNA 3NDPA 1NLYA 3AF3A 3GEHA 4WVFA 4YXWA 4AYTA 4D4LA 5HKKD 1JR3A 3AEZA 1KI3A 3EA0A 1X8KA 2ODNA 2QAJA 3NDBB 2P6NA 4NL4H 2ZI9A 3DVLA 4JLMA 2AK3A 2X2EA 1OH7A 1IY2A 4XSHA 2JATA 4ZDWA 3PXGA 3FVQA 1OKKA 4KBFA 4PSAA 1FX0A 2OAQ1 3TSWA 5AJWA 1P7CA 2VP6A 1KO5A 1Z3IX 3N70A 4TLDA 5EXXA 3I62A 3I4LA 2QGNA 2Z83A 3QKSB 2E1RA 3QPVA 4PTLA 2WWWA 4GMDA 4HAYA 4URYR 4BFUA 4RCYA 2CHGA 3LQQA 3U7GA 1OIXA 4FMBB 5FPHA 2CDNA 5BYKA 2H16A 2RGNA 4Q9LA 3DMNA 4MGIR 4NCHA 4MYUA 3SI7A 4A0RA 1S9HA 4A2WA 4TYPA 4JYCA 4LHXA 1CJVC 3QPUA 1W0KA 4O25A 1AS2A 4LDJA 3RSOA 1BMFD 2KBFA 4HSEA 4RJLA 3RWMB 1LS1A 1QHYA 1XB2A 3AGPA 5CM8B 4DHEA 3KQUA 2OAP1 5LB4A 2J0SA 1DADA 1Z0DA 1NVUQ 2OCPA 1XEWX 2OT3B 3OEHA 4DLUA 3G0HA 1EK0A 3TE6A 2EFGA 4TYYA 1EWQA 2AKYA 4LBVA 4D0GA 1NKTA 3IQXA 3B7GA 2W58A 1N6NA 1CJKC 2QA5A 1E9RA 4DLRA 2I4IA 3MG9A 1F2UB 1ZU4A 1HQCA 1T91A 4IDPA 3X1WA 4RZ3A 2ZE5A 5B57C 2ZQ5A 2QNRA 4M9SA 5GVRA 1YZNA 1N5IA 1KK0A 3THXA 2XZLA 1H8ED 4PHHA 4OHYA 4NMMA 4TQAA 2OZEA 2RH5A 5LDDC 2D06A 5CYPA 1VCOA 3GCGA 2FSHA 1G7CA 4YMWA 2YZ2A 3LBIA 3RS4A 2OBNA 3R7WA 1N6LA 5KPDA 2IS2A 4HLUC 4GMXA 1W0JD 1Q12A 4LUCA 1AZTA 1F48A 1SXJA 2C96A 4PO9A 5JRJA 2HYDA 3NC1C 4EKDA 1EX6A 3DZ8A 4JSYA 1AZSC 1OFHA 4B74A 2XZOA 1P9NA 5CJPA 3KJIA 4IDQA 1B0UA 1WRBA 2C9CA 4Z1MA 3N5CA 3GJ6A 4UNPA 3EWSA 2QI9C 1GNQA 1S96A 2ERXA 1SVLA 5CLLA 4A8JC 1QVAA 2RMKA 3PEWA 1LS6A 4TYWA 4YMTA 3AP2A 3C14C 1Q3HA 3D31A 3MLEA 2A5FA 2K5UA 1JB1A 2IC5A 3CWZA 1E2JA 4UXIA 3P20A 4HAVA 2O8FA 5EXTA 1YU9A 4JJKA 1Z28A 2O0KA 3SYLA 2W0MA 3C8UA 4QFMA 3AB3A 1E9DA 2ZU0C 4IJMA 2OE2A 2WPDA 2IS1A 3KQKA 4UJ3A 2OFWA 3FKSA 2J3EA 1HH4A 5FUYA 3K09C 1DAIA 2OBLA 2KBEA 4RY2A 4GOJA 2VHTA 4HLDA 4PHGA 3HR7A 2QP3A 3TKLA 5LPNA 3GJ7A 3LD9A 3T1QA 3IBGA 1JPNA 1XPUA 3M1IA 4Q19A 2EW1A 1Z06A 1P9WA 2VTKA 1W4CA 1GG2A 1UF9A 5JSZA 1NN0A 4BPBA 4QGFA 1HUQA 1OIWA 4C0AC 1I4TD 4CVNA 4XD7D 3LBNA 4G1UC 2VQSA 1CEEA 1CJMA 2AK2A 2E87A 3DMDA 2BMDA 3VU9B 3FHCB 2YWGA 4DLYA 3VQTA 4BFZA 1Z5ZA 1CRPA 4AKEA 2JDIA 4HZIA 3DO6A 3UG6A 2IXFA 4TMXA 4LYAA 3IPXA 3GPLA 1XJ0A 4LJ8A 4TTPA 1KO1A 1G3IA 1ZYUA 2Z43A 1W5SA 3L2OB 4DVGA 1MO6A 2ZS9A 4XSGA 5AJXA 2JEOA 1SVOA 4LBWA 4EFNA 5TY0A 3SHFA 3PEUA 3OIYA 3QKRA 2QPOA 1NVVQ 2ZSEA 1CLUA 2GRJA 3CX6A 2VP4A 2V3CC 1Y3AA 1ZNWA 4QJ4A 3TVTA 4HLCA 5HZHA 2O8BB 2XB4A 4NKRA 4RD0A 4LYFA 4IKEA 1NL3A 1DTSA 4BFTA 4CGZA 5DSZA 2J5XA 4DB4A 2IYLD 3NH9A 4FCVA 4D81A 3FKQA 2FE4A 2CE7A 4L5BA 1VG8A 2WAXA 3UMSA 4V0LA 3A4MA 1VECA 2FJUA 2J7KA 4MKIA 1DARA 2QP4A 3W3ZB 4LY6A 1JXOA 2GWHA 4KYIB 2ZAOA 1AK2A 2JLWA 1PVOA 2XNDD 3KKMA 1VHLA 4B33A 1G16A 5E4FA 2UZ3A 3TW8B 4ZI3A 2IYZA 2NQ2C 2ZI6A 4W5WA 3BOSA 1OLOA 2G83A 1MABB 5DYIA 2WICA 4LYJA 3KXKA 1UKEA 3VMFA 1XXHA 2ZU6A 3MWYW 2GDJA 4LJ4A 4U00A 1G3UA 3PUZA 4JVLA 2RKOA 1K5DA 1X8LA 1G64A 3SDZA 1GITA 3EZ2A 4ZV4A 4RKFA 3I32A 1DE0A 4O2LA 2OESA 1FQKA 2ATVA 3MGCA 5L3SB 2CBZA 1EFUA 1CR2A 3SJAA 2IEYA 2KSQA 3IGFA 1OH6A 2W2VA 3RAPR 1O87A 2ATXA 1VHTA 3QKUA 4BLRA 5IRCD 3ZGXA 3GFOA 2J41A 2CJWA 1SHKA 1AA9A 4P33A 4RVCA 4PZLA 4U02A 1NN3A 5L8VA 2V9PA 3OAAD 1LY1A 5C46F 3TMKA 2ZETA 2O8CA 3BE4A 2I3BA 3HU1A 2RHMA 3T5GA 2WJJA 1YZTA 1TQ6A 2ZE6A 2GHIA 4EPXA 5JI3E 1NN1A 2R8RA 2F9MA 2YC4C 3KTAA 3PIRA 5BN3A 3TBKA 1II9A 4LJ5A 2EWVA 4IOLA 4HLQB 2RB4A 1A2BA 2VHUA 4M1SA 4QG7A 1F2TB 5EE0A 1H8EA 3IIKA 1XP8A 4B76A 3QOFA 3WBKA 1DS6A 3QY0A 4NYJQ 3GLIA 4QJ3A 1E2PA 1KO8A 3W8NA 1WBDA 3I8SA 4MRPA 2CK3A 3AP1A 1Q1BA 3L0SA 2GCOA 1VG9B 1DAKA 4GFDA 4R9UC 5SZHB 1Z47A 2OLKA 2OO7A 3FGNA 2CE2X 4D4JA 4U7DA 2CL6X 2NZJA 4B44A 3A1TA 1OT3A 4PC3A 3SOPA 3VKHA 2VHQA 2PZFA 4Q1AA 1K6MA 3I8XA 2GXUA 2X19A 3THYA 3B1VA 1SKQA 4LPSA 4DEXA 3WRYC 1KOFA 1TNDA 4N0DA 2GEDA 4GDFA 2REBA 5KO2A 1GP2A 1N5LA 3NBZC 3QXJA 3EARA 1FX0B 1E1RA 1KI1A 2JLSA 4UQOA 4HYYA 1O3YA 4NTZA 3KFVA 3AV0B 1MT0A 1BYUA 2CXXA 2YOGA 2F1IA 1NJGA 1TF7A 3GFPA 3V4FA 1S2MA 2GCNA 1GFIA 1R6BX 4YQFA 2W0SA 3I5YA 621PA 4Z51A 1Q22A 2BC9A 2PT7A 1T0HB 5KYKA 1GRQA 2NGRA 4Q7LA 1Q20A 4UXHA 5G3ZA 4QC2A 3SJZA 5HE9A 5J4YA 2DWPA 3MAAC 3P26A 5JHHB 3QIAA 4I1SA 4LC1A 3BJIC 5UKDA 4DEYA 1TU4A 3CBQA 1FW6A 4GSYA 1KZ7B 4Q9IA 5F9FA 3C5HA 3T35A 5KOYA 4X8OA 3GJXC 5EZ6B 5B30A 4OI4A 3THXB 1G3QA 2MSEB 3NKVA 1W4AA 3U44A 2OFOA 4W7SA 2QZ4A 2FFHA 3QKSA 4URZR 3SZRA 4Q7JB 2WZQA 3R8CA 2ZRNA 2W00A 3CONA 4C2TA 1QG4A 721PA 4EPTA 3ZD7A 1JJVA 1SXJB 2OCBA 3OEEA 2GVDC 4LHWA 2QM8A 5DI3A 4ZIRB 1T3LA 2JJ2A 4HB3A 4UNRA 2GILA 4DDTA 3KQNA 1CF4A 4RFVA 1BOFA 3A6PC 4WA7A 4JYBA 2QBYA 3OESA 1T6NA 4IW3B 2C2HA 4L9WA 1OW3B 3VHXA 3T5DA 3GEEA 5EUMA 2VEDA 3F8TA 3L0PA 4EUNA 5KTYA 3B82A 3Q3JB 1DG1G 1F2UA 5FBRB 2O8FB 4BEJA 1IN7A 2HXYA 3U7HB 3KL4A 3CH4B 3GLFE 2GZDA 1P73A 3D8BA 2G1JA 4NZYA 4Q4AB 3SU8A 3SQWA 5H1YA 3LXRA 1FMLA 2ZRKA 1CJTC 3EA5A 2JIZD 3U61B 3CLVA 2ZR7A 4YXWD 4NCJA 4TMKA 2DB3A 5EP4A 1UJ2A 1S4QA 1CKEA 3BGWA 1J8YF 3AVVA 5FBQB 5JSZB 1W47A 2YV5A 1Z2AA 4B3CA 3EIHA 3KXLA 4BFYA 1FOEB 4CT4B 4E07A 2OCAA 1YR6A 2JLRA 1SVKA 1JALA 2VHCA 3ZJYA 4HUTA 1S3GA 4YLGA 4CIDA 2CL0X 1OKKD 2IK8A 3GLGB 2W6JA 2AWOA 2H5EA 4HDCA 1U9IC 2CCKA 2WAYA 4Q18A 2RGCA 1HQYE 1ZD8A 2ZSDA 1YZUA 2ZYVX 4IVRA 2E9SA 1JJ7A 3NC0C 4O2RA 3K0FA 3CPJB 4PX9A 5TDHA 2GA8A 2NO6A 1EFCA 3FTQA 4ITRC 1DPFA 3AUXA 4JBYA 5CYOA 2FOLA 4M1OA 3OIVA 3SFZA 3VNVA 1G8PA 3GLHE 1M74A 2B6HA 3B2EA 4TQ9A 4DWJA 2ZRJA 2IT1A 2A5GA 1PUJA 3VR1A 3RHFA 2FFBA 4GP7A 1S0UA 4LPKA 2FPMA 2N42A 4IDNA 2DBYA 3QKRB 4LGMA 4P32A 2B7BA 3TR5A 1ZU5A 1IJFA 2C04A 5FOWA 4FINA 5SZJA 5BN4A 4FWTA 2FN4A 2GBLA 4US1R 3SJBA 4JT2A 2OEPA 4OQLA 2V54A 2X2FA 2ZUBA 1KZGB 1T3SA 1XJQA 4ZPXA 1SQ5A 4LHZA 1S1MA 2QEQA 2GZAA 4RZ2A 3NHAA 3O47A 2J0QA 4M4SA 1H65A 5AJZA 3AVPA 3SFVA 1R5NA 3H4MA 4G5QA 4TMZA 2C99A 3DM5A 3VU9A 1D9ZA 1G6OA 1Z07A 4A0HA 3KQLA 3ADCA 3VX4A 4QHYA 1US8B 3KDSE 5JJIA 4KITB 4E03A 5E95A 1E2IA 1E32A 3O8BA 4MRVA 2XTZA 5FUWA 5CDFE 2C03A 1SXJD 2YNMA 4GZMA 3S1AB 4OI0A 1E9EA 2O0HA 1KK2A 2CLSA 3FWYA 1VCNA 4NYMR 2KJQA 4NPHA 4OQXA 2BCGY 2L0XA 3K70B 4M1YA 1FFHA 2CVFA 2DPXA 1QHIA 3CX7A 4JVSB 2DFKB 1TX4B 1RYHA 2JLVA 3ZVLA 1NMZA 4EPWA 5G41A 1E2MA 1JAHA 1RVDA 3DOEA 221PA 2RGGA 3U5ZB 1YKSA 1KHTA 2FA9A 1Q0UA 4PPQA 1ZM9A 2FSFA 2GEVA 1D8TA 4H9GA 1ZM2A 1ESMA 2H17A 4K81B 2D7DA 1J70A 4OJQA 2CCJA 4MQBA 1E94E 1D6JA 3FOZA 1DAEA 1T8TA 3RDPA 1HA3A 1TQ2A 1FMJA 1Q1EA 3CF2A 2WPDD 2NO1A 4JZKA 5JFGA 3R8FA 2O8CB 4BWYA 1OFUX 1KY2A 5JECA 2Z6VA 4I1UA 5FPTA 4CDGA 4DIEA 1BKDR 2O52A 1LFDB 5FPSA 1WB9A 1E2LA 5FOSA 3NIBA 3T1VA 3KTAB 4UXJA 5G3YA 4WZAE 1UBFA 1OXTA 1KSFX 2CCGA 2BOVA 1QHSA 3FMIA 4NP6A 3U4QB 4KU4A 1M1YE 2QRNA 3UANA 5L3QB 1NKSA 4A2QA 4B73A 3P4YA 2FZLA 1W4RA 2HF9A 1GM5A 3LW7A 1GNPA 2WJGA 3WHLA 3LX8A 4OHWA 1OV4A 4V0ME 1XTRA 4B6EA 3LY5A 3GLIB 3W90A 2PZEA 1CR4A 2G0TA 4CEIB 1R0YA 4S35A 5L3SA 3EX7C 2QROA 2X77A 3QSYA 3DEFA 5LD2B 1XBTA 1T5LA 1BO6A 1WA5A 3R9WA 4MUBA 1I4LD 3H86A 1R2QA 3VNUA 3ONWA 4DCVA 3V9PA 1YZLA 2YOFA 4FXPA 4QL3A 4BLSA 4HAUA 3TLXA 1ZUHA 1TPZA 3BB3A 2WJIA 2FEOA 2J9RA 4C0LA 2D7CA 2ZVPX 1KK3A 1FNNA 1M6NA 3HPRA 4TL9A 4B2PA 4DCUA 3JZMA 2AR7A 2Q9CA 4GI7A 4DDVA 3TVDA 5JZVA 2C98A 5JCPA 2HLDA 4Q66C 3SS8A 2A5DA 3SYNA 2WKPA 5ANRB 4F91B 1RRPA 2GJSA 1NY5A 1W1WA 4NYMQ 5AUQA 4DCSA 4ZKDA 5K8LA 2F9LA 5FBVB 2NIPA 3UWKA 4BUJA 4L4UA 1UDWA 1KMQA 1DAMA 1VMAA 3D3QA 4OK6A 2Q0HA 3NBFA 5IF9A 4DUGD 3U6BA 4XVQA 2XGJA 1W36B 3LBHA 1HE1C 1ZM4A 1N3BA 2WMOB 1HE8B 5A0FA 2JIZA 4ASUD 4CEHB 4ABYA 1NF3A 4GP6A 3TQFA 2ZREA 4QGAA 421PA 1XD8A 1EFTA 2HEIA 1GILA 5KNBA 3ZQ6A 1NBME 1Q44A 2VHJA 4KBGA 2CMKA 3LLMA 1Z0AA 1PLKA 2QAGA 4P4SB 1IXSB 3MUFA 1E4YA 3I73A 2ZRBA 5FR1A 4KSBA 1U0JA 4ZCMA 1XMVA 2IF2A 3GJ0A 1XPOA 2HJGA 3U44B 1SHZA 4Q02A 2NMVA 1N6PA 2V55B 4MGZR 4TN1A 1AQUA 2C95A 3KB1A 5CB6A 4HLUA 3R9XA 1KAGA 4IXNA 2NG1A 4DKXA 1QZXA 2ZJAA 3EIEA 1X86B 2PJRA 1GOTA 1PV4A 1YZKA 2HDNB 1IY1A 3EG5A 2IXGA 3RC8A 3IO3A 2JLXA 3CWQA 3AVYA 2DFTA 4URUR 5LBIA 4DSTA 3LXXA 3QXXA 4KO8A 2P2LA 1EFHA 1NLZA 2WV9A 2BBTA 3VFDA 4ZDIA 2WWIA 4TL6A 5DI3B 1NRJB 1D2NA 3QG1A 1DOAA 4TYQA 4A8JA 4EFLA 2AHOA 2HT6A 1UBGA 4AD8A 2QBYB 4G5SA 2ZYWX 3CO5A 3CPHA 2QG6A 4F4IA 1JR3E 1HY3A 2D3WA 2P5SA 2ZROA 2PEYA 3B9QA 2R6DA 2ZYUX 1M7HA 1JQJC 1Z22A 1BS1A 2MMGA 1GDDA 4C30A 1VTKA 3EPKA 1XCMA 2OXRA 4BGDA 4XWOA 4PC1A 4V02A 3A4NA 1L7VC 3LX5A 3N2EA 3F0TA 1DO2A 3K09A 3ZQJA 4QM7A 1IN5A 1KYIA 2OFXA 1LV7A 1UM8A 4DDWA 2Z4RA 4O0MA 1CU1A 1TF2A 2CK3D 4G5GA 4Q03A 5FH9A 2QMOA 2ZTSA 2PEZA 3PUWA 2R6FA 3PENA 4Q1FA 5IDVA 2CL7X 3UK6A 2AN9A 1NLFA 2JASA 1NVVR 2ZAMA 4L15A 1MV5A 3CNOA 3PR1A 4QBFA 2I1VB 3MJHA 3IEVA 2WOJA 3NEYA 3CF6R 1E1QA 4ZIRA 4NONA 3ND9A 1LW7A 3NBXX 1YRBA 1JAIA 2D2EA 4TSFD 3P1JA 4B3DA 3LWNA 1RRGA 1SKYB 3MRSA 4C0JA 2ODEA 1NG9A 4FMCF 1WGWA 1ANKA 3IDQA 4KFSA 4PXAA 1E1RD 1DAFA 2BDTA 4HUQA 4R2IA 2BVNA 3X1ZA 4TLCA 1P61B 4TWZA 3KQHA 1COWA 3GJ3A 2BJVA 3FHOA 3B8HA 2IWHA 4C0KA 4M21A 3K0FB 3BB4A 4JJZA 5DHAA 3A1UA 4GOKA 1IN8A 2ZPTX 4W9MC 2ODWA 4IXMA 4OQFA 2ZUCA 1DBSA 2QTFA 2RGNC 2G9NA 2NPFA 1N0WA 2B7CA 4Q9HA 4JT4A 4Q4AA 4XWKA 5J4VA 3Q9LA 2BBWA 2GXQA 2O8EB 2R6CA 1QBKC 1E2DA 1W5TA 4Q1EA 4ZDKA 3Q7PA 4B3XA 2ZRIA 4AURA 1W36D 2ZYTX 3TSOA 2QMUA 3F3YA 2QP9X 4NE2A 4V0NA 2BMEA 5EQTA 1AS3A 2QN6A 2A30A 4IFEA 3PFIA 1KSJA 1D2EA 1TADA 1KDPA 1UKVY 5E7MA 3RC3A 1E98A 2ONJA 4NH0A 4IFBA 2P5TB 2XTNA 2F43A 4DJTA 3NWJA 4TZ0A 4RD1A 4Z54A 2J0VA 4GBMA 1RRFA 1W49A 1FP7A 4GZLA 4PHTA 2ZE8A 1IY0A 1VG0B 3GLGA 1Z0FA 2ZRPA 2IYXA 2J7PD 2GJAA 3FMPB 3GEIA 2FZ4A 4F7WA 3CR7A 3X2SA 3H0KA 5EE9A 3W34A 3I1FA 3ADKA 3RS3A 4R2HA 1Z0IA 4ZKEA 4DDUA 1XD2B 2W2TA 1KO7A 3QE0A 3JVUA 3AVTA 2QY9A 5AJVB 2A78A 1U8ZA 4TLAA 1I2MA 3OEED 2GKSA 4M53A 4N3NA 5CIQA 2BMFA 4G3XA 3QF4A 3HU2A 1RRCA 5DE3A 1V5WA 2OBMA 2CNWD 4EJSB 2YKGA 2JJ2D 2H1LA 1S1CA 2NOAA 5KSZA 5L3VA 2BBSA 4C4PA 2VSXA 4NYJR 1ZNXA 1Q1ZA 3KKNA 3REFA 3J81k 2V7QA 4A6XA 2AD1A 2O8DB 2RGEA 3C41J 4LI0A 1BH2A 1DAGA 1Q21A 2BWJA 5KNDA 3K0AB 4DUGA 5IT5A 4LRWA 4M9ZA 1AM4D 1VPLA 4C3ZA 1N2CE 4ASUA 1G9XA 3NH6A 2ZJZA 5H8WA 3PUXA 2EQBA 2CEAA 3MMPA 4A92A 1E99A 5BXQC 1ZD9A 2WOOA 2QMHA 2KB0A 4QGGA 2HUPA 4U5XA 2Q3FA 4MYTA 4IDHA 2BHRA 3BWDD 1KIMA 1SVSA 1US8A 1G1MA 4PC6A 2Q3HA 3B1WA 3TRFA 5FOUA 4D25A 2Q6TA 2UVQA 4QJ5A 2REOA 3VKGA 2A5YB 4GOXA 5JMTA 2XNSA 3S1AA 4KI0A 1JR6A 3LV8A 3C4JA 1KNQA 2V4ZA 4G01B 2EWWA 3MCAA 1OHHA 3A1SA 3HYRA 4M1TA 2O5VA 4KXFB 2KWIA 3CRW1 1RC8A 4GT1A 2LWIA 1KO4A 5GJVC 2WTUA 2W6JD 2H7VA 3AF4A 4MYHA 4ZO4A 1NJFA 1KJYA 4BQSA 4XVUA 4LJ7A 1XTSA 5FR2A 3DL0A 3T1OA 4Q4HB 3MFYA 4ZCIA 1R0XA 1E9SA 4LHVA 5FUVA 3SBDA 4A0FA 2LKDA 2WKRA 1VIYA 5K8IA 2J0UA 4F4JA 4BLPA 2ZSAA 1NY6A 2J59A 4KHZA 3WMFA 4H1UA 3X1YA 4KJZA 2BEKA 3EW9A 3E70C 1EWRA 2VYFA 3K9LA 3DM9B 3EASA 1J90A 3MD0A 4DBLC 2FWRA 1SZPA 5KHOC 3BK7A 4JLKA 1IQPA 5IK2A 3QUSA 2AXPA 5AK0A 1R5OA 3RANA 4C9BA 4C0QC 4Q01A 3ZLJA 4AKGA 5FPYA 3EPLA 4DLTA 4PSVA 4CF7A 2V6IA 3VR3A 3KKQA 4KYUA 3U4QA 3O8DA 3MWJA 1J8MF 5L3QA 1AGPA 4CRWB 1ZP6A 2DYKA 3EIQA 4TL7A 5DIFA 3L8ZA 3QENA 1OYYA 1P5ZB 3CX8A 5C4MA 1XXHE 3AVQA 4PAQA 1OXSC 3FB4A 3ZS8A 3NTUA 1HEIA 4KAXA 3TNFA 1AJEA 4DLXA 3IIMA 4EQ6B 4CEIA 2ZJ2A 1F60A 4WZBE 2IYTA 3L8YA 4FMCB 5AJYA 1G5PA 2UKDA 3JZAA 4LJAA 5CLQA 2QT0A 5JWOA 1M2OB 4JLAA 4IRUB 1GRNA 1IBRA 2XITA 4IOKA 4ZDJA 4FI3C 2I1QA 5JWHA 4BLQA 1AIPA 1UKZA 4NDZA 2BKUA 4RFSA 4TSFA 5KPJA 2QAGB 1CULC 2WIBA 4HAZA 3HYTA 4AG6A 4KLZA 4EFMA 1XTJA 4IEEA 5DHFA 1KI8A 2FPKA 4AK9A 3RNLA 4B3BA 4PFSA 3Q5DA 4DXAA 4B32A 1TQDA 4OHVA 5FL3A 3W8RA 3B13B 3ADBA 1WXQA 1KK1A 1NP6A 3AH8A 2YWFA 1EG7A 2IYYA 5FTKA 1G3MA 1Z83A 1E2NA 1E9AA 2ZRGA 4ILEA 3T12A 2VA8A 2HCJB 1ZUIA 3CH5A 1U2RA 1QF9A 2GEUA 3BFKA 2BCJQ 4CEHA 4B75A 3KJHA 1E0SA 4OL0A 4A8JB 4BEBA 2BKEA 2VPPA 3ZVMA 2GXAA 5DGXA 1Z6AA 1KDTA 2JGNA 3AKYA 2A9KA 3MWKA 5E7JA 1XEXA 5F9HA 4LSGA 4EPVA 3KUDA 4WW0A 1XWIA 5F98A 3T15A 1A82A 1VDZA 5CITA 2YC2C 1XDBA 3I92A 4F4CA 4P4SA 2VRWA 1KSHA 4B34A 2OXCA 4TLBA 4HZUB 1HT2E 4YDHB 2J7PA 3WNCA 1S8FA 1G18A 1QHGA 3DKPA 4DLVA 1R8QA 3PCRB 1Z63A 2GXSA 2ZRFA 4OK5A 5TB5A 2JLUA 2ZS8A 1J7KA 4TMVA 2GJ8A 1MR3F 3EC1A 5FOVA 2VP5A 5LD2C 3U7EB 2PZGA 4UNNA 1R8SA 2FU5C 4LK2A 5E7IA 1EGAA 3U3RA 2IYWA 2ORIA 3OE7A 3RABA 1OH8A 2SHKA 4ON9A 5K8UA 1T9HA 1YE8A 3FDIA 4A0GA 2CNWA 3GJ5A 3CUEF 3UMFA 5J4HA 1ZRHA 2D2FA 1WE2A 2FG5A 5FFMA 3KX2A 1Z6XA 2ZR9A 1X1SA 2QPTA 5GJBA 4MA4A 1MRSA 3NVAA 5FOTA 3ASZA 4HUQB 3WHKA 5FTNA 3THWA 5EE3A 4D4MA 2ASEA 2HLDD 4LWZA 3VR4A 3VR6A 1IAQA 1U94A 4A9AA 3I3SR 2W2XA 1LVGA 1YR8A 3CKLA 2P6RA 4M1KA 4R98A 1OPXA 4PC2A 3IBYA 2ZVQX 1VKJA 1KI6A 5ELXA 3AKDA 4KSCA 1JXMA 3OIUA 1TMKA 2HCBA 3CF0A 3WY9A 2D4HA 2V1XA 3BB1A 2RHDA 2WHXA 1UEJA 3TW4A 1ESNA 3DKVA 5CB8A 4M1WA 2XJ9A 1DAHA 2B8TA 4URXR 2GJ9A 2WSSA 1M34E 4LHYA 2TMKA 3U3JA 1P75A 3AUYA 5EJEA 2J1LA 4YDSA 4TQUS 3WYFA 4PAOA 3UIEA 4MITA 1TU3A 2A3RA 3WMGA 2F43B 4Q1DA 1XTKA 2KI5A 2A5JA 3Q7QA 3AVWA 5GVSA 4PZYA 2F6RA 3BS4A 1LNZA 3K0CA 5FBLB 4BFWA 3SJCA 2QMEA 1LTQA 3GMTA 3ZDQA 2R44A 3DHWC 2GZHA 4PHFA 1E6CA 1KNXA 4JLJA 3TAUA 4CYMA 1P2UA 1PUIA 5JS7A 2QQEA 3RS0A 4JBWA 2JLYA 2ZJYA 3ZVRA 4PPNA 3BH7A 4IHQA 2IX3A 5LB2A 4AIIA 1Z8FA 2ORWA 4DSUA 2QPAA 4N0EA 1QHXA 2O8EA 4XTCS 3PVSA 2H92A 3QF4B 1P72A 1SVIA 2DCUA 1N6HA 2EFDB 4XIGS 2ERYA 1NSFA 2GESA 1G3RA 4MKFA 2AKAB 1I4DD 4FD2A 3SN6A 3CRRA 4BZXA 3N2IA 5C1BA 1XF9A 4V03A 5J5CA 4IDOA 2IF0A 2FF7A 1E4VA 3QBTA 4N1AA 5M04A 3TUZC 4BECA 5CDFA 1JPJA 1ZUNB 5H70A 2GTPA 2WM9B 3FYHA 3ZIAA 4DLZA 3PUVA 2ZSBA 4HAWA 4BRWA 1G4UR 3THOA 5DO9A 3MWLA 3WYGA 1QRAA 3RRZA 1C9KA 4OHXA 2ZJBA 2ZI7A 1A7JA 1NG1A 1OB5A 4RCZA 5KDLA 4JLBA 1ZC4A 1KI2A 1XU4A 2P6UA 1ETUA 2YWHA 3LQRA 5FTMA 4EAQA 4NYIQ 1GL7A 2Z5FA 2G6BA 4W5HA 2IBMA 2FEMA 1XD2A 3IEUA 4GNKA 3AGQA 1GIAA 1L2TA 1HT1E 1TUEA 1XJCA 2WIAA 3HP1A 5EP1A 4D2IA 2FPLA 1P62B 5JJKA 3K9NA 2ECKA 5FI1B 3Q72A 3TUJC 3PEVA 1GTVA 3UMRA 1L4UA 1EFRA 1ZNZA 4RKEA 1G291 3A1VA 4EJSA 1E1QD 1G8HA 3CNLA 2Q9BA 2RGAA 1KI9A 3GD7A 4RZUA 4LZZA 1E9CA 3WYAA 2VO1A 2ZRMA 2X1VA 1L8QA 1YVDA 3RWOA 2Z0MA 3A4LA 1G8YA 3P4XA 3F5FA 3ZZUA 2J46A 1OSNA 3PUYA 4PPGA 4FWIB 4A6PA 2O8DA 1RJ9A 1COWD 1UAAA 4MRSA 2AXNA 3UG7A 3WBJA 4RSGA 1YR9A 1E96A 2XXAA 1Q3TA 4EIWA 1N25A 1KDOA 1AN0A 3K0AA 3HU3A 4AWXA 2J0UB 1ZBDA 2VF8A 1CR1A 3JVVA 1YQTA 5KSYA 4V0MA 2A7QA 5DI9A 1QDEA 2CVHA 3R20A 3GP8A 1EX7A 1N6RA 2FNAA 4LYHA 3QQ5A 1LF0A 3VX3A 3UXMA 1U81A 1L4YA 2GETA 2ZRCA 3E2IA 3ZZTA 1Z08A 4C7OB 1JI0A 4HATA 4WZ6A 4WXPA 1U98A 3ICQB 3QXCA 2OHFA 1WP9A 3W6NA 4GPTA 4WXRA 2GK6A 2DWQA 1JQLB 3BAFA 3K53A 2ANBA 1FUKA 1Q1QA 2QU8A 3LNCA 2AD5A 4Q1BA 5TV2A 2JA1A 2EVWX 5TXGA 4Q4HA 4QGHA 3LDAA 4MKHA 3KXIA 2FMXA 2CLCX 5HR5A 1XEWY 2QQ0A 3BH0A 3I5XA 2AL7A 1T8UA 5AUNB 1OXVA 2G0NA 5FTLA 4RFSB 2V8OA 3UPUA 2WJYA 3U6KA 1ZD1A 1CR0A 2GJKA 5TARA 1CXZA 4WBSA 1YHNA 5J40A 3L0OA 5FPKA 3ZH9B 1S3SA 3B5JA 2OCYC 3Q8XB 1NBMA 2LKCA 3EPHA 4ESHA 2V7QD 3EWAA 2ZUDA 1G19A 1FQJA 4D26A 5DN6A 3RS7A 3W6OA 4AC9A 2QGZA 3QXSA 2RGBA 4BRUA 4K46A 3KJEA 2EYUA 4BLTA 4A82A 2R9VA 4LJ9A 4OYHA 3A37A 4H1VA 4DT1A 3B9PA 3U7FB 4EQ6A 4TTRA 2XOKD 3UKDA 4RD4A 4A4DA 4EPRA 1P9RA 5GADl 1JEDA 2EFCB 3X1DA 1FPMA 2JLQA 1F5NA 3TK1A 1G6HA 1RFLA 1XMSA 1XEXB 2HJVA 1XNJA 3QXHA 1E3MA 3EAQA 3B85A 3Q5EA 4HB0A 1NI3A 1X6VA 2DR3A 2JJ1A 2CHVA 1M7GA 2XX3A 3K0EA 3IO5A 3W5IA 2D62A 1F3OA 1PZNA 5J4LA 121PA 4LV6A 2F1HA 4LJYA 4V0KA 1XPRA 2QL6A 3LO5A 3T06B 3K70D 4O3MA 5J47A 3PITA 1OHHD 2XJ4A 1D9XA 5A5GA 2BM1A 3ASYA 1QHNA 2H8KA 5AUPB 1TUIA 1MO5A 2YVUA 5KDDA 4A1FA 5GJCA 3KKOA 4RD2A 4OBEA 1YZQA 2IS4A 1GKYA 2YOHA 2ZI4A 1CS4C 1ZJ6A 2P67A 3A36A 5BW8A 2FGKA 4Q00A 1WBBA 5D3MB 2VL7A 3ZYCA 4B35A 2VF7A 3GLFB 4KLNA 4FIDA 3VKWA 1TL7C 4M2LA 3ETLA 4M0LA 4QNMA 1GL9B 1VG1A 3AVXA 4TT3D 1XD9A 4HEJA 2YYZA 4NCKA 3EC2A 1JEEA 2IYUA 3CNNA 1X8JA 1CBUA 3GQBA 1R0ZA 5B58C 1J2JA 5IK2D 4L16A 3THWB 1DELA 3HJNA 4DCNA 2N46A 3OFNA 2G1KA 3FMOB 4XWAA 1G8GA 1RW4A 1RKBA 2ZI5A 4OKSA 5JJLA 1KJWA 3OHMA 1HTWA 2AWNA 3PV0A 4HB2A 4KV9A 4ZI2A 2DFLA 4FW9A 5C18A 2IYQA 3BERA 4II7A 4HZUA 3ECCA 4TMWA 3RRNA 2IS6A 1KI6B 2IEZA 1OFIA 2ZJ5A 3NXSA 4D0NA 2EFEB 3MJRA 2GCPA 1A1VA 5EP2A 2YINC 5JWRA 4HDOB 1FP6A 2GAAA 3W6PA 3K1JA 3RS5A 2VSFA 4ARZB 4IVQA 5H68A 4BZPA 1TEXA 1ZIPA 4B3FX 3OIWA 3NHBA 1ZIOA 2EU8A 1E69A 2B92A 4L9SA 4M22A 2C9YA 2BM0A 1TF5A 4LV8B 2AX4A 4Q48A 8OHMA 3GLHB 1GL6A 1OF1A 2F3TA 5G40A 5BN5A 2QAGC 5FBWB 1JECA 2W6IA 5JHGB 3PQCA 3BORA 4FMDF 2HYIC 3BIFA 1Z6TA 821PA 2NO9A 4X8MA 4P31A 2OLJA 4I1VA 2BEJA 3QG5A 5HPYB 2IHBA 3RS2A 3CRVA 1G8FA 3C16C 3LLUA 3REGA 5CJ2A 2C8VA 2EYQA 3G5UA 2VP2A 2V6JA 4LV5B 1XCPA 2DY1A 3EZ6A 1KKLA 4CEJA 1B23P 2ZRDA 4XTRA 1MRNA 4JL8A 3UWOA 4LCBA 1W7AA 2CHQA 4D82A 3NBYC 1NMYA 2OUKA 5DNYB 1KI4A 3QI2A 3K8YA 3RYTC 1AS0A 5FL7D 1ZMXA 4BFVA 3SQXA 1W2HA 2G3YA 1SXJE 4JL6A 1E2HA 1D5CA 3FFBA 1JNYA 1TAGA 3QKTA 2IUSA 4FN5A 2VLIA 5JLJA 4TL8A 2QTVB 4JL5A 1R4AA 3BXZA 1MOZA 4QXAA 1LB1B 3K0SA 2ZXUA 2IL1A 5EZ5A 1G7RA 2MMCA 3GJ4A 1U0HC 1CJUC 1EESA 3C5CA 1R0WA 4XVRA 1VCIA 5KU1A 2XTMA 2FH5B 3PEYA 3B6EA 2P3SA 4NCNA 4Z8XA 1P60A 1E2FA 1SXJC 2VSOA 2PMDA 5A4JA 2RAPA 4B47A 4BE7B 3LVRE 4OHZA 3OE7D 3BFVA 3WP0A 3LAWA 4UNSA 2ODBA 4MGKR 1C1YA 2CLDX 1WF3A 1F6BA 4QRHA 4OQNA 4US0R 4PR0A 4PPFA 3QF7A 3SEAA 4AKHA 4CZ2A 2RGDA 4JLPA 2ZEJA 3D6TB 4DSNA 3L0IB 2Q3MA 2FDCA 2KE5A 1NIJA 2XSZA 1WQ1R 1II8B 4AYWA 2QE7A 1RJ9B 1W44A 2IXEA 4OQMA 2XXAB 2IHYA 5J4KA 2ANCA 2FV8A 521PA 3EZ7A 4PC7A 2C9OA 2BBOA 2XOKA 2ZRHA 1N6IA 1NVWQ 3W9YA 3GLGE 5HCNA 1OFTA 2PJZA 3W5JA 4B43A 4URVR 1BYIA 3SYKA 3EZ9A 5JEEA 1IN6A 1GSIA 4I4LA 4KFUA 1T4GA 4AY2A 2PLFA 5SZKB 2WWGA 1ZINA 2WSSD 3U60B 4KODA 4E5UA 1GNRA 1T5IA 1XCGB 4D0LB 2D74A 3FHTA 3U3OA 3TH5A 5JEDA 5C2JB 5HKKA 4MGYR 3K9HA 1FTNA 1UADA 4MRRA 3BBPA 3CRQA 2PLRA 4L8GA 4UJ5A 1FNMA 1VCMA 5F3WB 2R62A 2ZR0A 5EE5B 4F92B 4PZZA 4Q47A 2N1BA 4TMTA 1CTQA 1PLLA 2RGXA 1H8HD 1T3HA 2IWRA 4MDEA 4MDFA 1AKEA 4QBGB 3IHLA 2ORVA 4RD6A 4AYXA 5EP3A 4TLEA 5IHPA 3PJRA 4ACBA 4TT3A 4OJKA 2RCNA 4YC7A 3SR0A 3IPYA 1KJZA 2PCLA 2NO0A 5HZKA 2PMKA 4PQFA 4IOJA 1GAJA 3E1SA 4WAUA 1UBEA 1U99A 1R10A 4PQRA 3CZPA 3ADDA 1RE0A 3P32A 4LJ6A 3CIOA 1VIAA 3G82C 4GRAA 4QOSA 4PSKA 4RZXA 4C7OA 1T0JB 4F38A 1BMFA 3LRPA 3QJYA 3EPJA 4Q1CA 2WJVA 3VR5A 1TQ4A 2IYVA 2YWEA 3ZIAD 6Q21A 1RIFA 3KUCA 3ZZ0A 4Q9JA 3NEJA 5TMPA 3VR2A 3M0EA 5DH9A 4DT1B 2R2AA 2GK7A 1VYTA 3DPUA 2UZIR 4LOAA 1Q57A 5B64A 3AVUA 1QHHA 3H84A 2ZANA 1IJEA 4G0NA 1QVRA 1HYQA 4HDQB 1AGRA 2JLZA 4Q7KA 4FMDB 3IQWA 1ZNYA 2PBRA 2OSBA 3AVOA 1XX6A 2F55A 1XTIA 3AQ4A 4LX0A 3WXMA 4ACAA 1UKYA 3RRYA 2WSMA 2O0JA 1GWNA 2PH1A 4XH9B 3M4YA 1E79D 2F1JA 2ZI3A 4OI1A 1KMHB 2NTYC 1EFRD 3K70C 1IHUA 3AF1A 1MH1A 1ZW6A 4FCTA 3KB2A 5EE1A 1G5RA 2OM2A 3LVQE 3T34A 3ND8A 4HI0E 1W0JA 3CM0A 1G17A 4DIDA 3RSLA 1HURA 1OIVA 5CIWA 2Q9AA 1UBCA 2XB2A 3TIFA 4DCTA 2H57A 3C7KA 4PANA 4JKIA 4URWR 5CK4A 4IEIA 1NVXQ 4P3YA 2QORA 1V43A 2XZPA 4OK3A 1YR7A 1YRAA 2QSYA 2BMJA 2A2ZA 4HAXA 4MUAA 5KSPA 1R7RA 3AKEA 4D4KA 3CB4A 5GJWC 3GLIE 1ZM7A 1UPTA 4JSTA 1Z6YA 5FL7A 4RD3A 5K8TA 4AI6A 1G21E 1Z2CA 4DLWA 4JLNA 2WWYA 1CP2A 4HB4A 4A2PA 1YJ5A 3KZ1E 1M8PA 2MSDB 4QBIA 5JCZA 2MSCB 5HCIA 4Q4JA 3MSXA 3E5HA 3B78A 5FI0B 4B2LA 2FX3A 2GF0A 5G53C 5JBQA 3CR8A 3ICEA 4AKIA 1ELOA 1EXMA 4PO1A 3U2QA 3CW2A 4DC9A 1A2KC 2ZS7A 2IW3A 4Q7MB 1ODFA 1Z29A 4Q5IA 5KNCA 2JAQA 1FZQA 1SGWA 5DYGA 2NO7A 3H1TA 2ZE7A 1UDXA 1XEFA 3FFAA 4Q4LA 4JIMA 3NG1A 3O8RA 1U8AA 2HXSA 2R65A 4MKGA 1MO3A 4Y0AA 4BLOA 1G20E 2VP9A 3BD9A 3B1YA 2QENA 4MRNA 1P4SA 3HPQA 5JI2E 5B2ZA 4I1OA 3UATA 3W3AA 4DB2A 5D3MA 1QG2A 3GLFA 1TTTA 2WJHA 1U8YA 4MH0R 4XD7A 3VTKA 2FFQA 1GZSA 2B21A 1I2DA 1U9IA 3BFXA 4W5JA 4QNRA 4IOMA 2WVJA 4J0QA 5L3RA 1P2TA 3T61A 3FPAA 2ZIAA 1P2VA 2IUUA 4X8LA 2ZJ8A 2NZ8A 3R7WB 1P2SA 3BRWD 1KI7A 3GJ8A 4X8HA 4E09A 4NU0A 2REXB 3BH6A 4KFRA 5FTJA 1NBMD 2J87A 1RYFA 3H2YA 4NYIR 2VH5R 3LW8A 2IYSA 4R71A 5CK5A 4IVPA 5DN6D 5AWFC 2QM7A 2OV2A 1RPZA 2WKQA 2HF8A 4K8OA 2PX0A 5TVKA 4CEJB 5P21A 4I99A 3VHLB 3QEJA 3A58B 3AKCA 1W36C 4DLSA 1NMXA 1M7BA 4NCIA 1GVNB 1IXRC 5KSOA 1R5BA 3WNDA 1XFAA 1YZGA 1KY3A 4PAMA 1U90A 4JMPA 3IKJA 1SVWA 3SC3A 4ARZA 1RZ3A 3QEOA 2WWFA 4KVAA 1AKYA 4M9XA 1N0UA 5E3HA 4C0SA 3L82B 4LC0A 2F7SA 4S2EA 1NSTA 2JJ1D 3I72A 5FUXA 2QRZA 3GLHA 1PJRA 4BZQA 4G5RA 2QSZA 3DOFA 3WP1B 1TEVA 4BFXA 1N0VC 4B71A 2XNDA 1XZPA 1XZQA 3L43A
chains in the Genus database with same CATH superfamily
2BHLA 3PK0A 3UJPA 1ZH0A 2W8ZA 5JAOA 1RKCA 2JX0A 2ONKA 1UFQA 3CS3A 4KKVA 1XTQA 3EGXA 4GL2A 2QVCA 1PP4A 1YVIA 1KZ6A 4AY4A 1DZ3A 3C15C 4UDXX 3NANA 3HDGA 3HNJA 2E4VA 1AE1A 4PZUA 1EG2A 2Z57A 3QWAA 4D4NA 3KLPX 5H3HA 5EA2A 5FO0A 2IHNA 2IPLA 3VU3A 3RVBA 4ZTZB 1SXQA 2AQKA 3DZDA 5DM4A 3RCBA 2XCRB 2FSIA 2R0QC 3R40A 4D6XA 2AFHE 4MW0A 1L4MA 1R4MB 2XD4A 1IM2A 1QIDA 1A8UA 4JLWA 1KMMA 4UPEA 5C8ZA 1CQPA 3H18A 4WFKA 4Z1MD 3AFHA 2OU6A 1L9XA 3D8RA 4BVLA 2HW8A 4P53A 3OQNA 3WDSA 4OGKA 4GOMD 1H2HA 4Z0NA 1W5FA 3NM6B 2D0OB 2H18A 3IR5A 1SCJA 4MZDA 3DAOA 3PTZA 5EMLA 5CEEA 4J03A 4J8PA 4G5OA 2JJ8A 2CNNA 1FFYA 4MK4A 4KLCA 4TS1A 1GKIA 1NE2A 3UGQA 5IU6A 4YJWA 3L7NA 4BMXA 3KDAA 4KVGA 4RORA 1R6UA 5ECDA 3E2MA 1QQ5A 2Q21A 4P5EA 4WN3A 2WVOA 4N8DA 2C3UA 1CVRA 1RKEA 4OP1A 3HY6A 4Q4JB 2QTNA 1H0SA 3P9SA 3DXXA 1ZIYA 4JI3B 1IUPA 3INGA 2V0CA 3E5RA 3MHPA 3NS7A 5EXEA 4D4LA 4KDFA 3F49S 5HKKD 1JR3A 2EQ5A 4FN4A 1MP0A 4IG4A 2WYHA 4CKBB 1ECBA 2XHEA 1SEPA 3CH6A 2IM8A 4ZDWA 2BL4A 1JTVA 1P7CA 2ACEA 4FESA 2E1RA 3RT1A 3QKWA 4URYR 3PGJA 2G5GX 1C0LA 3NPMA 1KEKA 2GMWA 2PVSA 4PGMA 4J91A 1AS2A 2Q5IA 5DHRA 3B0UX 5CM8B 5A6AA 4EHNA 3GM1A 1DADA 2HJ9A 2XQJA 2EARA 3JWHA 3G0HA 3UW1A 3ZWVA 5LP6F 3WYEA 3UMJA 4G2NA 1CJKC 2QA5A 4BCBA 3MG9A 2H07A 2INGX 1OXBA 2JPUA 4YMIA 1T26A 4F46A 4IILA 3UT5B 5BQ3A 1SCUA 3NC1C 1EX6A 2OZVA 3NB0A 1P1KA 4ZQHA 2FMTA 3DZCA 1NA5A 2FDXA 3OFVA 4QU0A 2ID8A 4MDHA 3PNPA 4KQJA 1V5EA 2LD6A 2F3UA 3WQSB 4MMXB 3LHFA 4N03A 4X44A 3W3AH 3E9ZA 4X7BA 4H77A 4BUCA 2VXYA 1HMOA 4FDLA 2CFOA 4QGFA 2Y0EA 4ALKA 1QPGA 3WDKA 3E22B 3GYBA 3A06A 1RXWA 3RQEA 2B6NA 3KOUA 2VTVA 3EEFA 3DO8A 4L6RA 5A5DA 7ABPA 2Q46A 1NVVQ 1U3VA 4G5YA 4GBJA 3QFTA 2KS6A 2ONZA 4LYFA 1RLMA 1XZIA 3V5XA 4DB4A 1N77A 3E53A 2ICAA 2PUFA 3KB6A 4NAVA 2C4UA 5D51S 3T4PA 1LZLA 4HPJB 2XUFA 2ZI6A 1YCGA 1OR3A 3IUBA 1WVGA 3L41A 3ROZA 2P7IA 4REOA 1WMFA 5EPUA 4WZBA 5FLKA 2ATVA 1LE4A 4UHBA 1VHTA 4QUIA 2XMCA 2NVBA 2JCXA 1N3YA 3HV0A 5JI3E 3IR6A 2RB5A 3B3GA 1WW3A 3KTAA 1PL7A 4JLUA 1H8EA 4PU0A 2NTJA 1DXQA 3PNYA 4NYJQ 1E2PA 2H85A 3Q7RA 3TEFA 2CE2X 4OHOA 3LDFA 5DTRA 2X19A 1D1PA 1MQ9A 3S0JA 3TLYA 3WZMA 5KNLA 1RRMA 5J1SB 1GP2A 1FDIA 3HBJA 1PL0A 1E1RA 1SFRA 4HYYA 1ZQ1A 4LXHA 1L7DA 4WHMA 2YOGA 1MC4A 4L5JA 5KKNB 1DQZA 2VCYA 5CHEA 2E85A 3U7QB 2JJQA 2JIQA 5UKDA 1TU4A 1NBEA 4AE4B 5AVUA 1KZ7B 2VHVA 3E48A 1O97D 2MSEB 1W4AA 1XYVA 1BROA 2BGLA 3RTGA 3H1EA 3ZGVA 1H7IA 4PJNA 5EIBC 4LHWA 1EP2B 5JNLA 2P3QA 3VVBA 4Q15A 2NADA 5HZMA 3EDCA 1K0FA 1UZNA 5KTPA 3OM9A 1ZN7A 1RBZA 3ZWXA 5HBGA 2X15A 4NZYA 2QRMA 1H94A 3AESB 3RVNA 2Q5HA 5AVJA 5KNBD 5REQA 2ZJ6A 3SKXA 4XIYA 2YV5A 2O7SA 2VHCA 2I4TA 4RY0A 5IUJC 1ECFA 1C2TA 1X19A 2E9SA 1JJ7A 1I36A 5BMVA 4MX8A 4LSZA 4DWJA 3W5BA 4Y7CA 3EAFA 1NKVA 5C7OO 5HF6A 2GBLA 4I44A 4OQLA 5B2FA 1ZN9A 2OCIA 4AL4A 5DLDA 5BV2P 4LHZA 1S1MA 2VP3A 3MMXA 4Y2PA 4QFDA 4LOIA 3PRHA 4X1IA 3VU9A 1G6OA 4H7IA 4YECA 1KRXA 1BE0A 3L8JA 5E95A 3S4YA 4RDCA 4BO5A 3BXPA 1T5OA 1FFHA 2OGZA 3JWGA 2I71A 4A91A 4DADA 3B9BA 3UC9A 3Q9UA 1GZ7A 5K0JA 4KQHA 1Z62A 1J70A 4AJNA 3V2IA 3BHNA 4QOFA 2QX9A 3QW4B 4AO7A 3IVRA 4X6LA 2R6JA 4HZGA 4RHTA 4P35A 4DIEA 3I3OA 1LFDB 1K8YB 3T1VA 2AR0A 2CD7A 5F51A 2NNLD 3OA2A 4WY2A 3C3MA 1NKSA 4A2QA 4B73A 4JGIA 2YXDA 2I8BA 2FMIA 2HS5A 4D8WA 3EX7C 3K1YA 4KQ6A 3ZW8A 3QSYA 3MUNA 1L3IA 1X1TA 5LMUB 4P83A 4DPLA 4QDKA 1LD3A 3R7DA 1HTTA 4XCVA 3ITFA 1FNNA 3QFRA 5DX1A 4CL2A 5E7QA 3UJ6A 2HWUA 4TMFA 1G20B 4ZKDA 2F9LA 5DM70 1MVNA 2DPGA 2QUHA 3GWZA 2IDMA 1K9VF 1P4GA 421PA 2AW5A 2W4QA 4HDSB 1MLDA 4IR7A 4ZPJA 2XH8A 3LLMA 2OP1A 1IXSB 5DIZA 3U44B 4MGZR 1FE8A 1DEHA 2ZWAA 3EIEA 4BPMA 1D5WA 4JBNA 1EFKA 1YDHA 3VFDA 5BYAA 4KO1S 3F7OA 1JEQB 1TYDE 2JKZA 2LVBA 1SOVA 2R1TB 4J7TA 4KGZA 4Y2UA 4J49A 1QOZA 2X0FA 1LV7A 5EJ9A 1TF2A 4Q24A 2QMOA 3TPZA 3BWXA 5TPWB 3KZMA 4BVKA 4FYPA 1WXGA 2BISA 2GN2A 3AETB 3MRSA 3WKAA 4FYIA 1BHSA 1A8HA 3KQHA 1Y6ZA 5FA6A 2BJVA 5B1EA 1XSEA 1T9KA 3A1UA 3U26A 2WNSA 4AFNA 4OOEA 1XQYA 3Q9LA 4V1CI 3IE1A 3HO8A 1Q1NA 3C3AA 1WG8A 3FOFC 2QQ5A 3P9CA 3PFNA 3TOXA 4CV3A 3OPYA 3DD5A 5JG7A 3EQ8A 3HKBA 2F43A 5DYNA 2YJ4A 1RRFA 3CVYA 1U0TA 4HNUA 4KMRA 2QVXX 2J7PD 3LIPA 2WVQA 1A71A 3LLCA 4Y7DA 3TJMA 1PD1A 4A0QA 3LM8A 1X7GA 3HU2A 4X7PA 2WIJA 1V5WA 3DUWA 4ZAYA 1HLFA 2FX2A 1ZNXA 1KERA 1U28A 2PR2A 2RGEA 2PG3A 4D43A 2HSEA 2CFSA 2HTFA 3NWEA 4DZRA 1WZUA 1VPLA 3D2BA 4D3SA 4RCVA 3WAQA 1K97A 2DUWA 1SVSA 2QK4A 4LF6B 4UTXA 4H7DA 3WXBA 4Q3AA 3L8HA 2BW0A 3VZBA 2P0NA 5HKOA 3MCAA 1Q2XA 1C50A 4M1TA 4XM2A 3MFYA 1ZGJA 3KEQA 1QIKA 1SOMA 2BEKA 2FTKE 4OLJA 1J90A 5L4NA 3OLZA 3CRNA 1GPMA 4IGGA 1AC5A 2PXXA 3DONA 1AKTA 2Y1KA 3MJTA 3BMOB 1DKQA 3KQPA 4RVDA 3JZAA 1A76A 2VAPA 1K98A 2I1QA 2YNMD 4RFSA 4F4UA 2Z3WA 2WIBA 4DUPA 4ZAGA 2YHAA 2I2FA 4W82A 2WFAA 4S1OA 4FYWA 1E3JA 1KS9A 4LXXA 2EJTA 2CDAA 3GMIA 4OIQF 1SBZA 2XNCA 3RB8A 2HCJB 3TQQA 2W6QA 2P79A 1RRKA 3DLTA 2GXAA 3OZTA 3MWKA 1P0CA 1NXXA 1Z7EA 1RWPA 5JSFA 2Y92A 2AYXA 4KMSA 2A68F 2ZXEA 5TB5A 3D5TA 4TWIA 3VDMA 4H0FA 5A9SA 1OR2A 3TKYA 2IPNA 3IPAA 1ZK0A 4JTDB 5BN5B 3WGYA 2FZKA 4MA4A 2PX2A 4EG8A 1GUFA 1MAWA 3HKEA 3KVYA 4A9AA 3F4LA 4OXIA 2IV3A 1EXVA 1MIOA 3IBYA 4YL1A 1QAQA 1XDZA 1Z33A 1JXMA 2IOHA 1TMKA 3OIUA 3FYTA 1Q19A 4JP5A 4EI2A 3COZA 3JPWA 4YL3A 1U9ZA 1Z4KA 3DBRB 3GVCA 3AVWA 2E5FA 5BSHA 1O94C 3GMTA 1YZAA 2QQEA 3VVCA 5I9MA 2XGSA 1OREA 4H6PA 4N0EA 4XTCS 2H92A 2Y27A 2DR2A 2VUIB 3HCEA 4BKMA 1WNTA 3CRRA 1IXKA 2PS3A 2RE8A 3A10A 5JDIA 2ZT5A 3QVXA 3LESA 4JC0A 4ZCTA 4B6SA 5ALUA 5AOVA 2WD7B 1NFNA 1REQB 3HJCA 3WGMA 1GIAA 4Z4CA 4K6FA 1PFWA 2YJ3A 1LXCA 2PWBA 1ZNZA 1PT6A 4KR6A 3UWMA 5FZTA 3UZUA 2MSNA 3REQB 4AJLA 1YL6A 1YZFA 4A6PA 1SPXA 5KJCA 1YR9A 1JMWA 4PE5B 3FNRA 4V0MA 4DBZA 2BKAA 4BJ3A 2A94A 4YJGA 1EPUA 1L4YA 3E2IA 5C3UA 1FFCA 1DUIA 1KTIA 4FGJA 5DHSA 4WXPA 3ICQB 3QXCA 1UIRA 4H18A 3U09A 2V9ZA 3VSBA 3HK2A 3K2QA 3HO6A 3AI1A 1YDMA 1DQSA 4XDHA 2V7GA 4Q1VA 2Q4OA 3R5TA 3EXHA 1CR0A 3BRWA 3ZH9B 4BL5A 3JTMA 5KVSA 3DLPX 5D5QA 2Z6UA 2XUKA 3D1VA 2R9VA 5C7YA 3I9KA 3GYGA 1VFPA 1C7ZA 1OFUA 3WIEA 3DE7X 1J1IA 1JEDA 1FPMA 1AKWA 2WP0A 1L9KA 1CYDA 3QU9A 3JQ7B 1QQAA 3UXHA 4LV6A 2IV2X 2VJMA 3KWMA 3PITA 4KGDA 4LGYA 1UFBA 1MO5A 2JFUA 1Z75A 1S2LA 1R50A 1CS4C 4Q00A 3ZW7A 3GRYA 1F8XA 2JHAA 1Z7YA 3V2HA 2W2LD 1RPNA 4ENRA 4ZI2A 3SM3A 3BERA 2ZJ5A 4RYDA 2BHNA 3EF0A 3UAZA 2GCPA 2WUEA 1E3TA 5SICE 1TEXA 1N9GB 2EU8A 4M6WA 4PFPA 1QF7A 1Y5NA 1M5TA 1JJIA 5BV1A 4P6VF 3VZRA 4L27A 1OF1A 4RXUA 4QOJA 3NTOA 5L0DA 3K6SB 2BEJA 4PZ9A 4YPFA 1P5JA 2PLWA 3CRVA 3RFFA 3U9TA 3I4UA 3ZBTA 4CFYA 4EG0A 1E4EB 1XCPA 4CEJA 1SMKA 1DRJA 1NMYA 1E63A 1DCTA 4CR6A 3L7YA 4NOLA 4Y9DA 5EC8A 1YR2A 2JAPA 3QKTA 4XZ3A 3STVA 4BAZA 4PS1A 1LB1B 3K1TA 3WG7C 3VYUB 2EKDA 4BQEA 1PSWA 2F67A 3B6EA 5C4IA 4ND1A 3QVYA 2PRKA 1EHIA 2HSWA 1TWAA 3VR4H 4CPDA 1OWPA 3RD5A 1KMNA 4MGKR 1F6BA 1QCCA 5BSWA 1GDTA 1O0SA 2XB8A 3MOSA 2IZZA 2CHUA 1POWA 3U8VA 4IIJB 2CFCA 3SPXA 4IL5A 5LLTA 1MGOA 3PC8A 1RI3A 4FDAA 3SEFA 4JJ7A 1APCA 1N57A 2UXBB 2PLFA 2WUDA 2DP4E 4E2YA 5ITZA 1ZZEA 3ZLBA 3ZW9A 1PI3A 2YW2A 1L5OA 3DMRA 3K9HA 4BX2A 1PR6A 3KD3A 3DE5X 2R7AA 5IHXA 4OSEA 4TMTA 1XZLA 2RH4A 1QK3A 1T3HA 3PS9A 2P9FA 2F3SA 4L85A 2RD9A 1ZWLA 5HSGA 1K9SA 2FW9A 3W79A 3MWEB 1QLJA 3EGIA 3NIGB 1THMA 4OSPA 4OJMX 5B12A 3ZIAD 5ICMA 3A31A 3KAKA 1P91A 1OU4A 3TPFA 1IOLA 3X2FA 4TZKA 4ER3A 2JGKA 4JAVC 1M0EA 1YV9A 1ENZA 4G9GA 2UDPA 1GWNA 1NQWA 2CDCA 2NTYC 4A4AA 3AY3A 2BAGA 4BCCA 4DIDA 2BYTA 1HURA 3LUFA 2FFJA 3MINA 5JNRA 1JKJA 5H0IA 3DUFB 4EW1A 1FUIA 1YRAA 2QSYA 4D4KA 1BDJB 1OAOC 1NXTA 1CP2A 3GQBB 4LFBB 3MSXA 2VOEA 3ZWDA 3LNMB 3ZCXA 4P54A 2VDJA 3JVEA 1IK4A 4TXHA 3KEOA 1WX1A 2AE1A 1UDXA 1FR0A 3O8RA 4C76A 3RF6A 2C2BA 4R05A 2QENA 3L0YA 4YGXB 3HPQA 1AUPA 5ALXA 3UATA 2E55A 5A03A 2W48A 4JP2A 2N3ZA 4Z7NB 3LYUA 2L81A 4GKJB 3N0XA 3QI7A 4GQAA 2D5LA 1AZWA 2HIHA 3TSCA 2IYSA 3FTNA 5HV9A 2L82A 2OV2A 4PJMA 5CT9A 4TUYB 4PLZA 4MB0A 3DXZA 1VE1A 3AKCA 5TEWA 3C43A 5B37A 2PH3A 4WINA 2VAMA 1AKYA 4CDVA 3D3EA 2QSZA 1IEXA 1JNXX 4DM4A 1PLJA 3RHSA 4NTAA 3MQFA 1IPHA 1Z17A 3AQIA 4KNWA 1CUYA 2QM3A 3UGJA 4ZODA 2H9AA 4O6MA 3TUIC 2JHCA 4D80A 2J9FB 4E0BA 2V6BA 4R0MA 4A0SA 2OYCA 4K6CA 3AG1C 4MVJF 1A5TA 1DG3A 2ZBQA 4FLMA 2QR2A 3KLBA 4JLOA 3W9BA 1WCV1 3E58A 4DMUB 4NNPA 2ZB8A 3CXRA 4HDKB 5AIBA 1VE3A 1E1DA 4A36A 3H3JA 1E5DA 1WDTA 4YAJA 2WSLA 2YHSA 3QX8A 5INTA 3WRXC 2DOKA 2B2NA 4PGGA 1ZHTA 5KDOA 2WWXA 2YFHA 1YARO 4WBNB 2O8BA 3GBPA 1NT2A 5KWSA 4LXGA 4MP6A 1P3Y1 2AA3A 1I3NA 2DQSA 4D6PA 1RVV1 3AF0A 5IZCC 4Y1RA 2PO7A 5JH7A 2R6AA 2R6GA 4B48A 4CUJA 3JQFA 2ZSFA 4J6EA 4WDRA 2J3HA 5HMMA 2A9QA 1O5IA 1CZNA 4HWSA 3ZE6A 1P6XA 3SSAA 2X7JA 4C7KA 4DV2B 3CNHA 4ZLDA 1C29B 3UBTA 4Z2AA 1JBKA 3UMKA 4JTCB 1DO0A 1TGYA 2QL7A 4QJIA 4Q3EA 4AIRA 4XLNF 4FR5A 1IC6A 2C8JA 1T3ZA 2FPIA 4EENA 2P2YA 3OO0A 4QVIA 1QS0A 1C0PA 1XA0A 4V1CA 3A04A 3K05A 3PXDA 4IJ5A 1ML3A 4H1HA 1HNXB 3ZHXA 1R00A 5E1OA 4L2IB 1P45A 1CYEA 4QVKA 3DMNA 3C8DA 3TAXA 2CXUA 1TFKB 2GJ4A 2OCPA 2GPSA 3TE6A 4DCPA 1GRCA 4ND7A 4F5YA 2G9ZA 4YMHA 2IS2A 1T6UA 4LUCA 1GLVA 4IARA 2HYDA 4H7PA 4JP8A 3FIUA 3X3HA 4E2WA 3GJRA 4ROSA 2LSEA 2QI9C 4XYBA 3STWA 2CJYA 4UM8B 4MW7A 4DJEC 1HRDA 5CH5A 1LPAB 4IJMA 3PDCA 3HA3A 3Q11A 2IS1A 3KR0A 2W4MA 3CR3C 3EVCA 1BXRB 3NGLA 3NIFB 2EW1A 2VJKA 1KEWA 4HNAA 4MHOA 1CEEA 3GDGA 5IWCA 3IP7A 1NF2A 4R7TA 3GUVA 4TRRA 3TNJA 4RF5A 3ZHQA 4OB7A 3ANTA 1R5JA 5HF9A 4LBWA 3SHFA 2FPWA 1CLUA 2RHCA 3KSRA 1R6TA 3W5AA 1ZD5A 3NH9A 2CE7A 4IVNA 4CX9A 4P9TA 1VECA 2Y6VA 4PACA 2ZAOA 1YOVB 4QXRA 4L76A 1K4KA 4IUYA 1CS0A 5TQ0A 3N8DA 3HBMA 3OJWA 3LX4A 1UKEA 4N47A 3SDZA 4PZ0A 1ORHA 5JJBA 3L6RA 2JCYA 2LTAA 2ATXA 5J5VA 1SHKA 4CF3A 3WGUA 5F3RA 2LFDA 1G9SA 1NN3A 2ZBFA 3HXKA 4HTFB 1NYLA 2I6QA 3F6PA 1MG0A 2VN8A 1RM5A 1F0KA 3RIMA 2IZ5A 4JDPA 4OHKA 3FNFA 2VHUA 1XVLA 4WCFB 1R12A 5EFOA 1DS6A 4WLNA 4UD2A 3AP1A 1GTRA 1IM5A 1T2UA 2JIRA 5SZHB 4W7IA 1W30A 3GFBA 5TJ9A 1QYCA 2CL6X 1MW9X 4DCCA 1VC2A 4ZXFA 3KQMA 4RETA 3VMMA 3B5IA 1Q0ZA 3GPCA 1V9LA 2MIIA 1KI1A 2BKLA 4MVJG 3CT4A 4WOKA 1MT0A 2ZUSA 5CA0B 3CWCA 4X60A 1O4WA 5G0SA 4WD3A 3G17A 4Q9NA 2NGRA 2F2TA 5J4YA 3D7NA 2DQZA 2GCEA 2G72A 3L5KA 1YT5A 5FPQA 4O2AB 4CLOB 4JT9A 1FW6A 3FDJA 1WUHS 3OT4A 5IAKA 3MK31 4A10A 1G3QA 4ZQBA 3AEUA 2OFOA 3QKSA 3KKZA 3OM1A 5CFNA 2W00A 2AV6A 4ARVA 4YRTA 2NV2B 2XE7A 5LYJF 4OO3A 4AMGA 4EHJA 3DEYX 3TPCA 1T3LA 3ESXA 1CF4A 2Y1GA 5AM4A 4G37A 3M6IA 3GEEA 3GGSA 1KQOA 5DCUA 3C3JA 2IYEA 4CN8A 3BQ9A 1CDDA 4Q4AB 3SZOA 1M2KA 3LTNC 1C8KA 2ROQA 2O14A 1J33A 1JL3A 2OBYA 1HY5A 2OQRA 1TA9A 5DHUA 4L1KA 3Q3VA 1YAUO 3RROA 5EP4A 3IKLA 3AVVA 5FBQB 4W8PA 4YV1A 2GD1O 3ADOA 3KQSA 3KXLA 2OCAA 3ZJYA 2IK8A 2H5EA 4U4AA 3ZV3A 3DBHA 4JXXA 3A6GA 1XC7A 1U0OC 3C98A 1EFCA 4ITRC 3VOAA 1ZZPA 4JYAB 2WYWA 1ZRMA 3E0XA 4BGVA 2IPAB 3KALA 2PKXA 1MNAA 3Q0TA 3PHJA 1NFRA 1Y80A 1YTLA 2Q49A 3KU1A 4WWHA 1H65A 2HGSA 1K86A 3C6BA 3VX4A 5ENVA 3HB1A 4O4IB 4P3PA 1ORIA 2BCGY 4KAAA 2CVFA 3ZQ4A 1E1NA 1HDOA 2JVKA 4X9XA 5FQNA 4WKCA 2H17A 4LNUB 1HC7A 4L8WB 2P27A 5EZYB 3LC0A 4D4XA 1F38A 2LP4Y 1Q1EA 1QFXA 2B78A 4E88A 4MIKA 1YE5A 1WVMA 1KSFX 1J2YA 3FMIA 3GPDG 2QRNA 4ZMRA 3WLRA 3P4YA 1TCVA 4O7GA 1KYXA 1KPGA 1GU1A 3L4SO 1FXWA 4OHWA 2QTCA 1JTEA 1QZZA 2NZVG 3C6XA 4OEHA 4MUBA 1PU2A 3DOUA 4TTIA 3ONWA 5KTMA 3SSNA 2MJLA 2I2AA 4GGPA 3BB3A 4AS1A 3D3NA 4G7HF 5D84A 2MT9A 2Q9CA 4DDVA 1Q1AA 4KHPB 2VPWA 3SYNA 1W5BA 1LVHA 5EMJA 2NIPA 3BWMA 2R96A 2GH1A 1TW2A 4OQPA 1H66A 3MVEA 2HQ1A 4JW1A 4AJHA 5DHPA 1W76A 3FFXA 4DSAA 3LYLA 4I8IA 4EGFA 1Q44A 2PRYA 2IPXA 2QAGA 1O08A 3M82A 5K0CA 1NM5C 4H4KC 5EUCA 3BGOS 3ANMA 3WB2A 3H9JA 1PV4A 5LBIA 2UUBB 2WV9A 2BBTA 1TUBA 2QRVB 4TYQA 4C7XA 4U9UA 3QLVA 2PH7A 4ZYYA 3VPXA 1DQRA 3HXTA 3ZC3A 4CMBA 2WJ6A 1TT5B 5K99A 3U1BA 1YLMA 4NBUA 1YRLA 4DDWA 3DJNB 5L3ZA 4DIBA 3SBXA 3E3LA 2CK3D 2X58A 5IKXA 4E12A 4UHEA 5I7FA 1TJ4A 2VSYA 3KT3A 3ZG1A 4FFPA 1ZGGA 4QBFA 4YAIA 1AUQA 3M4BA 1WPQA 1V2HE 4NONA 3C48A 1RRGA 3A2KA 4C0JA 4KFSA 3H5AA 1TVCA 4BB0A 3SHQA 1COWA 4LOKA 5DHAA 4NEGA 2ZPTX 4O1HA 4JSRA 3T3HA 4M89A 3LY7A 3F3YA 1DKOA 4PHCA 2HREA 1RU3A 4QPPA 3VPDA 5M34A 1WHTA 2AZMA 1FVHA 1HQDA 4I3HA 1SBNE 4MVMA 1EZ4A 2FZ4A 4F7WA 5AKEA 3H0KA 3CE9A 4NV3A 3RS3A 4R1OA 3F96A 2FWPA 3AVTA 3ZJ5A 1MAUA 2BTEA 1GNTA 4EUHA 2JJ2D 1ISIA 5KSZA 4I55B 3JALA 5JROA 1B4DA 3UAVA 4NVRA 1DJLA 1RADA 1BH2A 2Z30A 4CKCB 1DRKA 3K0AB 3KFLA 4DRXA 1YVRA 3FXAA 3QMKA 2HUPA 4MYTA 4IIBA 3VRCA 3D2LA 1US8A 5FOUA 1SBIA 2NYVA 3C4JA 3HKCA 2B4KA 4DBLE 3RK0A 1KYVA 5WRFA 2AI1A 2H7VA 4CN9A 3BFPA 3A9WA 3NOVA 2ZWOA 5K8IA 1HPLA 1KTMA 2ZTVA 3GRZA 4EARA 4YO7A 3V8PA 3VSEA 3W5CA 1GSHA 9MHTA 3QUSA 3MXOA 4AKGA 3LKZA 3D4PA 1KE2A 3E8MA 1TM2A 1J8MF 5AOAA 5DIFA 2A9PA 3Q1LA 1VL1A 4KAXA 1DQPA 4GBED 4J0HA 1QOPB 1YDIA 4Q05A 3IBTA 2QLJA 1IBRA 4FI3C 1PQ4A 5E9WA 4ZHQA 5CYGA 2ZWVA 4DL9A 1XTJA 1SAYA 1Z5GA 2X8BA 3TECE 4PR9A 4B32A 4OHVA 1TC1A 4PYRA 1P0PA 3BEDA 4BRSA 2J6BA 5FTKA 3T12A 2VA8A 2YL0A 2EWMA 5T4FA 1UMCA 3DEIA 5T4BA 3C3PA 3AKYA 4I5DA 2XRMA 2YW9A 4BVGA 4M7OA 4N4WA 4DCJA 1DT5A 2XKJE 4HZUB 1DB3A 3LVFO 4W9NA 3QX9A 3DKPA 3ES9A 5JZ9A 4WKBA 4DS3A 4YJ3F 1E2UA 4NCXA 1XRRA 4MS2A 2ID4A 2R7SA 2I3GA 5FXMA 2FB9A 1NGSA 1U94A 2HMQA 3IOEA 4YK5A 4MWGA 4Q7CA 3ZXYA 2V65A 2GFIA 2IEAA 4LDRA 4YDSA 1V0JA 2KI5A 1LKZA 1JDUA 3DLHA 4FPXA 3TZCA 2QMEA 3PQ4A 1SIUA 4PHFA 4CYMA 1P5HA 1OCRC 1N2EA 3JYPA 4DSUA 3AY6A 1J0DA 1JWLA 2AZTA 4FHDA 3UUEA 3SN6A 5J5CA 5M04A 2DC1A 2BR3A 3H1PA 5F33A 3T3EA 5CT4A 1Z6ZA 1M8KA 2ZI7A 1EUCB 4KREA 3UQYS 2AUMA 2PSDA 1GL7A 3IVXA 1ZISA 3SZMA 2HSQA 2ICWG 3MTEA 3A1VA 4G4GA 2IU0A 3CNLA 1A8IA 4JI7B 3UUGA 1L8QA 5L51A 3P4XA 3WQQA 2O8DA 2AXNA 3AJ9A 2L17A 1WSAA 1Q3TA 4X6UA 2CLOB 1CR1A 3VYTB 4WMLA 1YQTA 1KDZA 1ZWKA 3U49A 3AR3A 3GP8A 1Y81A 1JZQA 4GAEA 4B46A 3VSDA 3IA7A 1NBBA 2W2MA 2PZKA 1RXUA 3BA1A 2YKZA 3T9AA 1U0BB 1RMQA 4C7OB 4WZ6A 3R3YA 1U98A 4XPZA 4FSDA 2GRUA 2R6R1 4BNUA 3A9UA 2IV7A 4WXRA 1QHFA 2O20A 1SRRA 4MKHA 2BFDA 5AUNB 3OCVA 4U8HA 2VRCD 3V4VB 4JU8A 3DEKA 2H7CA 4BJ6A 3IUQA 3B5JA 2HV7A 4OX9Y 2VUHB 1HKUA 2ZUDA 1FQJA 1ZW2A 3RH0A 5ADHA 1FU7A 5KMGA 5KNDD 1QQ7A 1FXUA 1PG0A 4RD4A 1GHTA 2PKEA 1F9EA 5TGTA 1MOPA 5E0KB 1M2OA 1NI3A 1X7WB 1WMAA 1PEKE 3CPSA 1YFLA 1XPRA 2I4RA 3L4BA 4LVOA 5I9NA 1RHRA 1OHHD 4BFCA 4DRIB 1TUIA 4NBLA 4OXRA 3K15A 2JIPA 2P67A 2XM4A 3Q7SA 2WB4A 4RVHA 1SCDA 3R4VA 2YZSA 1J24A 2YJNA 3EMBA 4Z9IA 1E2XA 1X8JA 1O5TA 2L42A 4WK4B 5AKHA 3VZCA 3E9QA 4MLDA 3KIPA 1HTWA 4KV9A 1UBUS 5F5FA 1APBA 4TTJA 3LLKA 5J3JA 1P7PA 1YC2A 1XEAA 5H68A 4B3FX 4AP9A 2C9YA 1FNSA 3VGJA 3LQ2A 4Q48A 8OHMA 5F4BA 4X95A 2VNKA 1PG5A 3EMDA 3L4EA 2Q27A 3NYJA 1ZA2A 1CEQA 3VU1A 3MJDA 2CNDA 5HPYB 4FE3A 3WKEA 3TZKA 3QMPA 3LLUA 3K2IA 2VP2A 2VDRB 2YYSA 2G9QA 3T0GA 4OIMA 1B23P 3HMQA 3QZUA 4ARSA 3UWOA 3DR5A 4E0HA 3K8YA 1DL5A 2BC5A 1E3LA 4FHZA 2C2MA 5JADA 3JZ0A 1UT5A 2QTVB 4WKNA 3KC2A 4MTCA 3LLIA 1H6BA 1RP7A 2XTMA 1C4KA 1T6ZA 1A3CA 1WXIA 5HQJA 5B7QA 5AW1A 1SXJC 4RPLA 3OZVA 2PWAA 3AG5A 2FP3A 4UNSA 1EUDA 3RYIA 3HJUA 5B3SC 2XSZA 2Q9UA 5CT6A 2LUOA 5C1DA 1IPFA 4HN2A 2BBOA 4KMMA 2RJNA 3IUMA 4JP3A 5T67A 1VPDA 3GR6A 1P77A 3Q12A 5CR9A 3VZDA 2D0PB 1IZ0A 1XUOA 4H2DA 4ATNA 4I9HA 4BZZA 3OVMA 4RV4A 4MUHA 1YCHA 4MGYR 2CHEA 4H7HA 3G2OA 2Y66A 1T8PA 1DC6A 2WWTA 4NFHA 3QWBA 3OIFA 3PFKA 3VNQA 5IHPA 1QF6A 4OJKA 2BFFB 1T5BA 3TF5A 4WAUA 2IXOA 2PD4A 2HMSA 4I0WB 1AK1A 1EX9A 4PSDA 1T4CB 1M1XB 1QQ6A 2IYVA 1GKLA 1N2HA 3V4LA 4F6RB 1PJ2A 3EBLA 1VYTA 3RE1A 2BMWA 2C5HA 2AG8A 1CGNA 1M72A 3NOXA 5ADUS 3QBJA 2WJPA 1BMQA 2JK1A 5KWJA 5LNK6 1XTIA 1WABA 2XLMA 1U0EA 2IITA 3NCHA 1NW9B 1D2CA 1T5HX 5E0OA 3T34A 4G41A 3NM4A 4HI0E 1W0JA 3FYUA 2V6FA 1WQ4A 3UQZA 4EYEA 4PANA 1ZD3A 4IEIA 4J16A 4B7XA 1ZM7A 1LRLA 1M6HA 3ZJ4A 3E5HA 5ALPA 3Q4GA 5G53C 3ICEA 4C01A 3LLVA 1TFUA 4JI1B 1TM5E 4R3NA 2IW3A 2NUAB 4TM7A 3LHSA 4Q4LA 3BXXA 4XPYA 4GS5A 3DFUA 1MO3A 3RARA 2B5VA 4HD8A 4X94A 4F9EA 3ZIUA 3OEWA 4MH0R 4I5GA 3VTKA 5CB4B 3NTXA 5CG2A 3R7WB 1JQDA 5IF3A 3T94A 2PS9A 2VH5R 4AROA 2YZKA 4XLPF 3FCUB 2IIVA 3CSUA 3X0DA 4ARZA 4JMPA 3IKJA 3ZNOA 5LZ5A 3TOCA 1GQ2A 3VAZA 3PX3A 1VIDA 4E14A 1TEVA 5DQTA 3B60A 2MOKA 1N5KA 3G1UA 1U3WA 4FGLA 2FEXA 1FTYA 1LPSA 1E0AA 4BJ1A 1J99A 5DT2A 1EP9A 3RRBA 5DQZA 2BT4A 5JPCA 1HZJA 2F8MA 4R2XA 4QWWA 1N6KA 3EZFA 1ZCBA 1LSJA 3EXIA 1XMJA 3R9IA 3RVZA 3HB5X 4X66B 5AXDA 2OCDA 2XT6A 4WGZA 4P4TA 3K8QA 1LH0A 4QHTA 5KUTA 4YRGA 4BN4A 1RLJA 4E22A 1VPWA 1G0OA 2XAUA 3STXA 5JDCC 3UGTA 4EP1A 4EA6A 5COBA 3HNOA 4EHBA 1SA0B 1NIPA 3BMQA 1U5BA 2CZQA 3FCYA 4L9RA 1KGDA 5TE9A 3IL2A 3CZAA 2R00C 1YQEA 5DISB 2WTAA 4RHXA 3P19A 5L6LB 3W8IA 3CU5A 3L7AA 4AO8A 3ASVA 4B3GA 3EDQA 4HGYA 4QGSA 1H2AS 3RU9A 2WFLB 4KCGA 3SNHA 3TW8A 5KOJB 3AR9A 4G0OA 1MABA 1KDYA 2X4GA 1CRQA 3KEFA 3LP6A 1QVZA 1SCBA 2C4WA 4JLVA 1D2MA 4GR5A 2GCOB 4RIEA 2G77B 4RMIA 3M6AA 1W46A 1G41A 1FTSA 1YIOA 2CVOA 4MVWA 3LQKA 5F64A 1I4ZA 5EIAA 1L3BA 3F6SA 4YB8A 1MJFA 2M1ZA 1IN4A 1BXKA 2PVCA 2PCJA 4NE7A 3TXAA 1X8KA 2QAJA 1HQKA 2SKDA 2PYIA 5GAJA 4KKXB 4DW8A 3IP9A 1CUEA 3WA6A 3L8MA 3BGVA 1AXGA 2V7TA 1M34B 4JI8B 2RGNA 4NCHA 4A0RA 1S9HA 4GI3A 1T6QA 1RM3A 3RKSA 4KQ1A 3VR5D 5LB4A 4KYTA 1Z0DA 2AUNA 3L7IA 3FGZA 2NU8A 4TYYA 2JFGA 1JZTA 1FS4A 2NAPA 3TQSA 2P9YA 1HQCA 3A3OA 3TKAA 2J6HA 4LE2A 3OC6A 1YZNA 1V55C 2IY7A 4CKZA 2AG1A 5CURA 4JN6B 1KPHA 4HLUC 5JRJA 2C96A 4P0QB 2GYYA 4B74A 1IPEA 1W59A 4V3BA 3GJ6A 5IJ9B 1C9YA 4CIVA 2ERXA 1U0GA 4F3KA 2A5FA 3GGPA 3MMZA 3W5HA 1E2JA 2O8FA 1YBHA 4M1ZA 1Z45A 1Z28A 1IMJA 1E9DA 5A5EA 3OD5A 5LUAA 4TRJA 2GVNA 2OXEA 1FNDA 4D9HA 5AJHA 3D6MA 1NVKA 3UK0A 2EEZA 4DUZB 1VMKA 2VTKA 1N2CA 1O9BA 3LBNA 4N82A 3PPXA 2OKGA 2IXFA 2FPGA 4CR8A 3GPLA 1QR2A 4PICA 2IXAA 5FHQA 4XSGA 4YRCA 2MHRA 3E8XA 2X4DA 3PEUA 4BYMA 2YMLA 1RM0A 2VP4A 1RZRD 4OU4A 3LUTB 5JD4A 3C24A 2PUBA 3WMWA 1JXOA 1EAMA 4LDPA 4G26A 3O0TA 4PYNA 3NBKA 3R7FA 5KYNA 5T3UA 2NQ2C 3L4KA 1I51A 3R3XA 2QXUA 1A8QA 4LYJA 3AHGA 4JVLA 3NMUF 1QIGA 3BRCA 1KU0A 2OPHA 4AMVA 3W2TA 2CBZA 3TOZA 3UJCA 1CR2A 2VQDA 3OHPA 2KSQA 1DP4A 5E6RB 1EDZA 3OETA 2NP6A 4H4EA 3BG5A 3W4JA 1U2GC 2CDQA 2I2CA