1FTSA

Signal recognition particle receptor from e. coli
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
295
structure length
295
Chain Sequence
RSLLKTKENLGSGFISLFRGKKIDDDLFEELEEQLLIADVGVETTRKIITNLTEGASRKQLRDAEALYGLLKEEMGEILAKVDEPLNVEGKAPFVILMVGVNGVGKTTTIGKLARQFEQQGKSVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNIDVLIADTAGRLQNKSHLMEELKKIVRVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDGTAKGGVIFSVADQFGIPIRYIGVGERIEDLRPFKADDFIEALFAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the NG domain from the signal-recognition particle receptor FtsY.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signal recognition particle receptor
molecule keywords FTSY
total genus 106
structure length 295
sequence length 295
ec nomenclature
pdb deposition date 1996-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00448 SRP54 SRP54-type protein, GTPase domain
A PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1ftsA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ftsA02
1NKSA 2BMDA 4FMDB 1XFAA 3L2OB 3MWLA 4IDNA 1N0WA 2W58A 1OFUX 1R5NA 3X1DA 3Q7PA 2C8VA 5FR1A 2W6IA 5FTNA 4C0SA 1L8QA 1T4GA 1I2MA 2KE5A 2OXCA 3P26A 1NLFA 4BASA 3SR0A 3AVYA 4FMDF 4QBHA 2RGAA 2E87A 1Y3AA 5FH9A 5KYKA 4DLWA 2GTPA 1ONBA 3CH5A 1A2BA 2HEIA 3W3AA 1QHXA 2ZI9A 1TF5A 1UAAA 3GJ4A 4I1UA 2YINC 3U7GA 4II7A 2IX3A 2GXAA 2QMOA 4YDHB 2ONJA 3BD9A 4UNNA 2V7QD 3RWOA 3D31A 5JLJA 2GCOA 3AVXA 4OI1A 2AWNA 3GQBA 4QBIA 1P2SA 4OQMA 3ADCA 3SC3A 3SI7A 2WJVA 4H9GA 4BFYA 2F1IA 2GESA 1S4QA 2MMCA 2ZJBA 4M21A 1KYIA 4D4JA 1E9RA 4Q9JA 2J41A 1G7SA 2O8FB 2FV8A 4B3FX 1Z28A 2JJ2D 1ZJ6A 1FUKA 2FFAA 3OIWA 1N25A 1VYVA 4U7DA 4DDVA 3FPAA 3IGFA 4A82A 1GNQA 1VPLA 5LBIA 2D3WA 3BK7A 1YRAA 5BW8A 4Q4AA 2J5XA 4G1UC 3OEED 3DOEA 4Z8YA 2OUKA 2C9OA 1II9A 2W0SA 3KFXA 2XSZA 2OAQ1 3CRMA 4GZLA 4AY2A 1VCOA 4C0KA 1DBSA 2FSFA 1KOFA 2IC5A 3U2QA 1XXHB 3NBZC 4L15A 2ONKA 1ZIOA 4B6FA 4HB3A 5LD2B 4JLVA 1X8KA 2PLRA 5F9FA 3REGA 5GJWC 2J0UA 2PCJA 3E2IA 4TL7A 4NU0A 4PQYA 3O8RA 1JEEA 3LW8A 2NO0A 1G5TA 2ZANA 4FWIB 3GMTA 1W1WA 3F8TA 4D4MA 4BRWA 4X8MA 1G8FA 4JL8A 1NN3A 3GD7A 1Z6AA 1KO7A 3DL0A 4MKHA 3B9PA 3U7EB 3T12A 4MH0R 1GTVA 2PJRA 3B82A 1YHNA 2BMEA 4BRUA 1W47A 4IOLA 2Z83A 2C9CA 5FTKA 1YE8A 2JLUA 5L3RA 3T1OA 4ARZB 1N6PA 2PT7A 1VIYA 1JR3E 5FBQB 1R2QA 4ZIRB 2ZM5A 3MRSA 2YOGA 4HDQB 4FXPA 2CCJA 2MSEB 1II8A 2PEZA 2ZRHA 3GJ3A 3GLFB 3KQHA 5JJLA 1QG4A 2W6ID 1EX6A 2GK6A 4QNMA 4EQ6B 3KKMA 2H16A 3C41J 1R8QA 2I3BA 1Z0IA 2IEZA 3HDTA 4AYTA 4QM6A 4DIEA 2YYZA 3PUYA 1P3JA 3BGWA 1IJFA 3TBKA 5C4GB 4YQFA 3QKSA 1H8HD 4PZYA 3TW8B 4HDOB 3RS2A 2QBYB 3PJRA 2QP9X 3BE4A 3RYTC 3P20A 4L4UA 5DI3B 1FTNA 4P4SA 4PTLA 1HEIA 1W4CA 5GVRA 2F55A 1KSJA 3HP1A 4XOIA 5HCIA 1J99A 2GWHA 4FMCB 4X8HA 1RC8A 4CGZA 2XXAB 4KVGA 1I4LD 2C03A 4D0GA 3RWMB 1SVKA 3BOSA 3FHOA 2V54A 1PJRA 2V4ZA 4CIDA 5J4VA 3U4QB 3THYB 1TMKA 2DR3A 3L43A 3UWKA 1KO4A 4HLDA 2FJUA 3UMFA 1E79D 2RHDA 4BFZA 4Z8XA 4DVGA 2FPMA 2A2ZA 3GLGA 3RAPR 3IUYA 4ABYA 1KZGB 4DIDA 1II8B 3AM1A 2YOFA 2AKAB 4MRNA 2CCGA 3CB4A 1II0A 2CJWB 4GPTA 4KFSA 1BS1A 1Q12A 3CNOA 4A36A 1PV4A 4Q7KA 3LA6A 3M6AA 2ZYVX 3QOFA 4DLVA 4MGYR 2ATVA 3IBGA 4JLKA 4ZKDA 4B75A 5EP4A 5CDFE 3H84A 4PANA 2JLWA 4BWYA 3BC1A 1OKKA 3AP2A 2QAGC 2ZE6A 4D0LB 1OW3B 1VKJA 2RKOA 1OIVA 1DTSA 4H1UA 4NCJA 4C2UA 2AFIE 1KK3A 3I5XA 3R8CA 3GLHA 4BZQA 1P75A 3ZVNA 4LHZA 2YVUA 2ZR7A 1ZNYA 5JZVA 4BQSA 2KBEA 5H8WA 4O25A 2O8CA 4LI0A 3ZJYA 3QVVA 3OE7D 4ZDIA 1TTTA 3ZZUA 1XZQA 3AVTA 2O8EA 2NO1A 4BLSA 1XTJA 4A9AA 2GBLC 2R6CA 1JEDA 2PX3A 5FTLA 4GL2A 3SFVA 4M9QA 4PC1A 1FW6A 5C4MA 3MG9A 4FCTA 4LBWA 2R8RA 1R0ZA 2AWOA 4IW3B 2JJ1D 4CT4B 4URUR 3KXKA 3W9YA 2ZRDA 2F1RA 3KQLA 4FI3C 4GMDA 2ZRIA 4KXFB 4UJ5A 4M1YA 3EWAA 1COWD 4LHXA 1JPJA 4JLJA 4TSFD 1E2DA 1X1RA 1P2UA 3EASA 4RCZA 2Q9CA 2R6AA 1WP9A 3U7FB 2ZU0C 4DEXA 1KDPA 3PEUA 5L3QA 1ZC4A 3GLHB 4LYFA 1JAHA 3B5JA 5J47A 2HT6A 2WMOB 5JS8A 4GMXA 1G7CA 1N3BA 1G7TA 2BOVA 1U9IC 2IYZA 2CNWD 3CPHA 3IHLA 1S1CA 3K0EA 1XEWX 5FI0B 2ORVA 1HYQA 2GZDA 1T9HA 3X1WA 4I81A 4ACAA 5JHGB 3P27A 1ZYUA 4XSGA 2YNMA 3EIEA 5JBQA 3AF3A 2F1HA 1CJUC 2JGNA 3UMRA 1GL6A 4WAUA 3TR5A 3WMEA 1GDDA 1NBMA 4JL5A 1TU4A 4DCUA 4PAMA 4KLNA 2EQBA 4QM7A 1EFCA 1SXJB 3BFXA 1VYTA 3K9HA 3Q7QA 3DZ8A 3RSLA 4D4LA 4V03A 4JYBA 4PHTA 1T0JB 1ZM3A 5K8UA 3TW4A 5CIWA 4DKXA 2W83A 3I8XA 4M4SA 2QGNA 1AM4D 2V3CC 3QBVA 2CL6X 2YC4C 3A1VA 1CF4A 2QTHA 3VR5A 4LY6A 4GOXA 2DWOA 5TVKA 3R20A 4F4IA 3A37A 4DCTA 1CULC 2CVFA 4EFNA 3Q85A 5LDDC 1XTIA 3QE0A 5AJYA 3LV8A 5KNDA 1LNZA 1Z06A 5CIQA 2D2FA 4OQFA 1XEXB 1K5GA 4MGZR 2J9RA 1UM8A 3FOZA 4TL8A 3SYNA 1SVMA 3OFND 1MABA 5HE8A 5BYJA 1AA9A 2ZE5A 2D62A 1ZNWA 1RRGA 1XNJA 1OFIA 5EE0A 421PA 2N42A 3DM5A 1F60A 4YONB 1ETUA 4WBSA 4CEIB 1TEVA 4B3CA 4NYMR 4KBGA 1GRRA 4A2QA 5LD2C 3J81k 4J0QA 4XWAA 4QXAA 3SS8A 1L4YA 1P60A 4M1SA 2IBMA 3QPUA 2DFNA 3T5GA 3THWB 2XOKA 4JVLA 5FUWA 2F1JA 2OBNA 2DFKB 3KKNA 2O8EB 1UEIA 1CIPA 821PA 5FOWA 2JCSA 4LV5B 1HA3A 1SXJC 5K8TA 4MUBA 4XSHA 1Z22A 2AD5A 2IYRA 4F92B 1X86B 1KDTA 2VTKA 3CBQA 2BMFA 1TU3A 4Q02A 4LJ6A 3DMNA 1HTWA 2CK3A 4Z1MD 3U3OA 3GJ0A 4A0FA 5ANRB 1Q1QA 4HUQB 2LKDA 4QL3A 3P4XA 3O8CA 4A4DA 2WJGA 2H17A 1E9AA 3HU3A 3CWQA 3RS4A 3EC1A 4ZO4A 2CLCX 4IEEA 3F3YA 4GT1A 4PZLA 2QPOA 4D26A 4YXWD 3D7MA 1RFLA 3HU1A 2E9SA 1SZPA 2V9PA 1B23P 2RMKA 3GJ5A 3OEHA 2AR7A 2AXNA 4XWOA 4FD2A 2ZQ5A 4HATA 1QHHA 2VP9A 2ZIAA 1DAHA 4B3DA 3TUIC 1F5NA 1D2NA 1E69A 2F7SA 2ZU6A 4F7WA 3ICQB 2HDNB 3IO5A 2CVHA 3ASZA 3QXJA 2BM1A 2YWEA 3RS0A 2ZYTX 3MWYW 4DWJA 3GLFE 2EYQA 3BB1A 2C04A 4WOPA 5AJWA 3MLEA 3OIUA 4Q48A 4KFRA 1HE1C 1KJZA 1LS1A 2MSDB 4TMVA 4B6EA 1ZC3A 4RD0A 3VKHA 4K46A 4HI0E 5EE1A 4A0GA 2BBOA 3UG6A 4DRZA 3T35A 1OIXA 1R8SA 4US2R 1XPUA 5DN6A 1XD9A 1K8RA 2MSCB 2QQ0A 1D2EA 4BLQA 3GLIE 3WMFA 3N5CA 1SVSA 1G8YA 2HYDA 4PO8A 4DT1A 1D5CA 721PA 1XJQA 2JLVA 4DSNA 3OESA 2GJ9A 4KV9A 2HXYA 5KUTA 2C95A 3T15A 1E1RA 2EFCB 2IF2A 4HB4A 2O8DB 3NEYA 2CLSA 1JQLB 2R2AA 2EWWA 1KI4A 1YQTA 1KSFX 4IRUB 5SZJA 3RS5A 4AKHA 3C15C 2QSZA 1NY5A 1SQ5A 5E3HA 2X19A 4DB2A 2ZITA 3VKGA 4CEJB 1D2MA 4M9ZA 2ZSBA 5FL3A 4B34A 4WZBE 3EPKA 4AG6A 4HAWA 4JMPA 2HJVA 2XSZD 3PITA 1W4AA 2WIBA 4PPQA 2FSIA 4AYWA 2IS1A 4FW9A 4D81A 2RH5A 1EFUA 2FPKA 1DG3A 4QGFA 2NQ2C 3EA5A 4KODA 4KYIB 1SVOA 4KHZA 4MYHA 4PSKA 5CM9C 5FBVB 4NZYA 1BMFD 2ODBA 4RD3A 2FN4A 1D8TA 1E2IA 1G5PA 2JJ2A 3JVUA 4GI7A 4RD4A 2RGCA 4XTCS 3UATA 2XB2A 2H7VA 1YVDA 3RHFA 2PJZA 4F38A 3PG5A 1FL9A 1RJ9A 3O8DA 4OQLA 4DLYA 1EFRA 3IQWA 2IHYA 1J2JA 1HQCA 1G7RA 2V8OA 1ZAKA 1ZM9A 4GOJA 1N5IA 3RS3A 4IDQA 5CK5A 1N5JA 1WRBA 2OLJA 3EA0A 3MJHA 3IPYA 2N1BA 4QGAA 1AK2A 3B9QA 2WIAA 3AKDA 4P32A 1N6LA 1SHZA 2EFDB 2GDJA 3CRW1 3KFVA 4C0LA 1XWIA 3CX6A 4B2PA 2ZXUA 4MRRA 4JBWA 1U90A 3HPRA 5HE9A 2QUZA 5FI1B 1BYUA 1ZVQA 3TKLA 3V00A 5UKDA 3SN6A 4DUGD 3K0SA 3EPLA 2WWHA 621PA 2J0QA 5L8VA 5TY0A 4DHEA 5AUPB 3QI2A 3EZ9A 2HV8A 2IS6A 2FPLA 1GL9B 3ZZTA 3U6BA 3SU8A 4OJKA 1U99A 4HB0A 2WTUA 3CUEF 2ODNA 2WAYA 1PUIA 4ILEA 5DISB 3KZ1E 5DH9A 3KQKA 2A7QA 1I4DD 2XTZA 2HYIC 3A1WA 1VMAA 2DPXA 2QM8A 2QBYA 4CYMA 1ZU4A 1KIMA 4ZPXA 4DEYA 3K0CC 2CL7X 1F2UA 4Q1CA 2QROA 2ZSDA 4O3MA 4GBMA 1G3MA 1RYFA 2OM2A 4N3NA 1EXMA 4V0OA 4K81B 1QG2A 3KTAB 2SHKA 4QOSA 1S3SA 3WYAA 4LRWA 1IY1A 2PX0A 3AF1A 1XX6A 3EWSA 3FWYA 3AKYA 3BBPA 3NH9A 3W6NA 1IXRC 1NLYA 2A5GA 3HYTA 3NEJA 5AJZA 1EG7A 1VG8A 2AD1A 1T5LA 5HPYB 2IEYA 5HCNA 4EPXA 5KU1A 2J46A 4LCBA 3D3QA 2XTMA 4AURA 3I5YA 3OIYA 3GEIA 4YMTA 1KI1A 1G4UR 4NHOA 3ONWA 3ZZ0A 1L7VC 4X8OA 4D80A 4KI0A 2R62A 4FIDA 4URXR 5CB6A 2ZRAA 4RKFA 3KL4A 2EFGA 2VIIA 2AFHE 5EXTA 2D06A 4JBYA 3LRPA 1W36D 1KO1A 2J87A 2ZRGA 4HYYA 3BB4A 3LVQE 4CEJA 1DS6A 1SVLA 1Z6GA 4I1SA 4EFMA 1W7AA 2EWVA 4KVAA 3M1IA 3VU9B 4PO9A 5HKKD 3AEZA 2V6IA 2IL1A 1CR4A 1Z6YA 3KQUA 1J70A 2CJWA 5FBLB 1IHUA 2QMUA 4IEIA 1FP7A 5A5GA 3RANA 5CYOA 4DDWA 2WV9A 3M0EA 4UXJA 3SYLA 4ASUD 4MRSA 3B1WA 1BH2A 1YR8A 3G82C 2J7KA 3WNBA 2G77B 3FHTA 1U0JA 3B1VA 4HUTA 2FE4A 1DARA 1WBDA 1G291 5H70A 5AUQA 3HJNA 2V1XA 4C0JA 3PIRA 2P5TB 2FEMA 4P4TA 5C46F 2IS4A 1TAGA 3Q5EA 1E0KA 2JJ8A 2ZJ8A 4LJYA 3EPJA 1GWNA 4L9WA 1KI8A 1NVVQ 2XJ4A 4TLBA 5FL7A 4M22A 3CONA 3NC1C 1TF2A 1VHTA 3SJBA 3M4YA 1DO0A 4DSUA 3TLXA 4NCHA 5E4FA 1UF9A 3QG5A 3VR4A 3IIKA 1KO8A 3WRXC 5GJVC 4D4KA 5IT5A 5JECA 5CITA 5KDOA 1YZKA 3OAAA 1US8A 2XNDA 1UKZA 3FKSD 2OXRA 1NSFA 3CW2A 3GJ6A 1XMSA 1OXVA 3NBYC 3K9NA 4DLTA 1JXMA 3TGPA 1XCGB 2OBMA 1AZSC 3KX2A 3L8YA 5C1BA 3E5HA 2WPDD 5C18A 5HZKA 3AVVA 2YC2C 4WW0A 5IHPA 5FOUA 4CF7A 2A5JA 3TAUA 3ZLJA 1YZGA 2GCOB 2QI9C 2GJAA 5JWOA 1JALA 2RHMA 2ZS7A 5JFGA 3AF2A 1SXJA 3MAAC 1G64A 2W6JD 3QKRB 3RDPA 2JEOA 5J5CA 3U60B 3GLFA 1W48A 1DE0A 1M7GA 1L2TA 4EQ6A 5BN5A 4R2IA 1WCV1 3FMOB 4RZ2A 2ZAMA 5FPYA 1CEEA 4TTQA 4TQAA 1SKYE 5BYKA 3A58B 3T5DA 1WMSA 2JAQA 2ZRBA 3GLIA 5CLQA 2Q21A 4LYAA 1AKEA 3AP1A 4ESVA 1GL7A 4TMKA 1WGWA 4TLAA 2ERYA 1ZP6A 2P6UA 3I4LA 3L0SA 1EX7A 2X2EA 1DPFA 3H0KA 3FDIA 4BE7B 3X1YA 4A8JC 4E5UA 1XJCA 3VHXA 4MYCA 2WM9B 1P7CA 4KYUA 1DAIA 2WSMA 3DKPA 4LSGA 3UG7A 3EIQA 4B74A 1GM5A 1TL7C 2ZREA 4BFTA 1E0AA 1Q3TA 3GCGA 4URYR 2KWIA 3SJCA 4TZ6A 4Q9HA 3L8ZA 4NCIA 3TE6A 3QKSB 1KNXA 3AVPA 4A6PA 2QRNA 3AV0B 5J4HA 2OFWA 3BJIC 1KI6A 1ZIPA 1W2HA 3FKSA 3GFPA 4UJ3A 4YLGA 4B2LA 3EARA 2QQEA 1DVRA 4CEIA 3FMIA 3QXHA 1HV8A 3OAAD 5G3ZA 4L16A 4B44A 4KLZA 3LW7A 1CJMA 2QSYA 4NH0A 2FG5A 1KI9A 1D9XA 1OV4A 3UIEA 1E9EA 2GNOA 1A4RA 2IYUA 1G6HA 1M1YE 1NKTA 1NG1A 2L0XA 1BKDR 1M7HA 2OFXA 3EZ2A 4R7ZA 3A4MA 4P3YA 2HLDA 3CRQA 4EJSC 3IILA 2F9MA 2P0EA 4I4LA 2FX3A 3P32A 3KB1A 5DSZA 5CYPA 3WHLA 1GG2A 1OXTA 1HT1E 4Y0VA 2CE7A 1U2RA 1KDRA 3SQWA 3U3RA 3ZQ6A 4PHHA 3IKJA 3Q9LA 4NYJQ 3TRFA 4ERNA 1TADA 1H65A 5IK2A 1MO4A 4TLEA 2WJIA 1W0JA 1M2OB 3LXRA 3SJAA 2EVWX 2V1UA 5EQTA 1K5DA 1T3HA 1U8YA 1IQPA 3WP0A 1J7KA 4EFLA 5D3MB 1OHHD 4UXIA 4HAYA 5HKKA 3DOFA 5F3WB 2XB4A 3W90A 4BEJA 2IW3A 3FTQA 3FHCB 2JA1A 1W4RA 1KK1A 3IQXA 2YV5A 4OL0A 3L82B 3MWJA 1OB5A 4KAXA 1M8PA 2QRZA 3NXSA 1IN7A 2Z4SA 1BO6A 2VHCA 3W6PA 3LX8A 3A1UA 1VCNA 4C0QC 2ZJAA 2YZ2A 4LX0A 2ECKA 3W8NA 5B57C 4HLUA 2AHOA 1XXHA 2X77A 5H68A 1VG9B 2A30A 3MUFA 2PZGA 1G8PA 1PLJA 1W0KD 4Q5IA 4XJXA 4Z51A 1XTSA 1P9RA 5EE5B 4PQRA 2FFBA 1KY3A 2FFQA 3DHWC 3C4JA 5LB2A 2H18A 2GRJA 3X2SA 2F6RA 2XXAA 1PUJA 1P73A 3H1TA 3UANA 1XD8A 4HDCA 5K8LA 4I1VA 4JT2A 1UFQA 3H86A 4BFVA 3ND8A 1N5KA 4NTZA 2VSXA 2VQSA 3PV0A 1H8ED 4UXHA 2IWRA 3CR8A 1FPMA 2QT1A 2YWHA 2PZFA 1BIFA 4G5SA 3A4NA 4LHWA 5TV2A 4RD1A 1R5BA 3KXLA 2WWXA 4TT3A 3PCRB 4RFSA 1ELOA 2AN9A 2VEDA 1E2KA 2JLQA 5SZIA 1NN1A 2Z4RA 3GPLA 3KDSE 4XD7A 1F2TB 4RSGA 3MD0A 1MH1A 3L0IB 3NDBB 3LX5A 1MV5A 4NP6A 5GJCA 1G3QA 2ATXA 1DAFA 1DEKA 2LWIA 5AUOB 3LO5A 2F43B 2XEXA 2ZRKA 2IF0A 1OSNA 1ZINA 1J8YF 1KI7A 2ZVPX 1TQ4A 3PXGA 4CRWB 3GEHA 4KSBA 1YJ5A 3ZVLA 3GJ8A 3U7HB 3WXMA 4DDUA 3ADBA 1D6JA 2O0KA 4MGKR 1HY3A 1YR9A 4ARZA 1V43A 2ZE8A 3PVSA 2X2FA 1UEJA 1NVXQ 4TL6A 1G6OA 3CF6R 1TUEA 4FN5A 3TIFA 4BFWA 2JASA 1G21E 2B92A 3ASYA 2DWQA 1BOFA 1P2TA 1QVAA 2ZJ2A 3CNNA 1SKQA 4L8GA 4XWKA 2ZI6A 4G5QA 4LPKA 1OYYA 4WXPA 5GVSA 2XZLA 3I61A 1PVOA 5DO9A 4FWTA 1KJYA 2DHRA 2OAP1 3I32A 2O8BB 4S2EA 3OIVA 2VO1A 3BFKA 1CTQA 1E96A 3VR1A 1Z0JA 3AVOA 5AR1A 4DCNA 2WMNB 2MMGA 2YWFA 3BS4A 3CIOA 4V0NA 5FUXA 2IUTA 4CVNA 4JJKA 2R44A 2VP5A 4H1VA 5JSZA 1NJFA 1JJ7A 2I1VB 2K5UA 1YKSA 5CM8B 2BKEA 1E1RD 3AF4A 4JYCA 4QRHA 4UQOA 5B64A 1NVVR 4OK3A 5FPSA 5KPJA 1SXJE 2H1LA 3MCAA 3QXCA 3GFOA 4Z1MA 1QHSA 1U8ZA 3THXB 2JDIA 1R6BX 2CLDX 4HLUC 3T1VA 1TPZA 3AF0A 3QSYA 1EESA 4PZZA 2Q9BA 3ZQJA 2XGJA 2J45A 1KI2A 1S2MA 2WWFA 2XNSA 2RGNC 3U6KA 5BXQC 2VHJA 1NIJA 2NO7A 2NGRA 3VNVA 1ZU5A 1XPRA 1XD2B 2ZAOA 3BFVA 4TN1A 5JRJA 1KMHB 3A1TA 4PC3A 3ADDA 2D7CA 1XF9A 1KK0A 1N2CE 4KFUA 2OCPA 2ZUCA 3TVTA 2ZR9A 4TYPA 1C9KA 4CEHB 2JIZD 4M0LA 4PPFA 1AKYA 1JQJC 4IKEA 3ZD7A 3LAWA 2CEAA 2UZIR 3NBFA 4FINA 4Z54A 2FF7A 3SEAA 1LF5A 3RS7A 2ZR0A 1QHHB 5FTMA 2NOAA 3RABA 5CB8A 1JXOA 1VTKA 1RRPA 1SVIA 3LNCA 4JIMA 2C98A 2VP4A 4DLXA 1GZSA 3OEHD 1OLOA 3VFDA 4C0AC 2ZETA 1M6NA 4E07A 4A2PA 4EUNA 4TMWA 4EJSB 4TWZA 2B8WA 2J1LA 2F9LA 2IK8A 3S1AA 2KI5A 1Q44A 1NY6A 2C5LA 1NG9A 2HJGA 4M2LA 3CF0A 2DCUA 3LY5A 4MKGA 1E1QA 3ETLA 4Q4HA 3SBDA 5DE3A 4AK9A 2C77A 2BBSA 4PAOA 3R9WA 1E2QA 1W5TA 1MRNA 2CK3D 3L0PA 3EX7C 1RJ9B 2PBRA 4N0EA 1GRQA 3Q5DA 4Y0AA 2FZLA 2ZVQX 4G5OA 3DVLA 3SNHA 8OHMA 2P2LA 1N5LA 1DO2A 3D6TB 3T61A 2B8TA 1S3GA 1GKYA 4AKGA 2XOKD 3NHBA 1ZMXA 4QBGB 1VYUA 1TF7A 2QY9A 5KNCA 4PO1A 2A9KA 4AIIA 4WVFA 4ZV4A 2CHVA 3AVUA 3CX7A 1P2VA 2V55B 4OK5A 3AUXA 1FFHA 1G8HA 3THOA 1XJ0A 2QORA 2ZRPA 2C9YA 3QKUA 2WJYA 4D25A 3K70C 1RKBA 1ZW6A 2GAAA 1NL3A 4LJAA 3OFNA 2D74A 3A8TA 1J8MF 2B21A 2JLRA 2O8CB 5IF9A 4TSFA 1AIPA 1MO5A 2OV2A 5FOXA 1S9DA 4CZ2A 1D9ZA 3R9XA 1MOZA 5TARA 3LDAA 3TVDA 2JLXA 2ANBA 1X8JA 3U3JA 3B1ZA 3QEOA 2J0UB 3CRRA 3EZ7A 5DIFA 1Q57A 4V0MA 5HR5A 2BKUA 3RRMA 1LFDB 5GJBA 1ZNXA 1GNRA 1SGWA 3ECCA 3R8FA 2GJ8A 2ZROA 3X1XA 4QC2A 1U0LA 4UNSA 1R7RA 3THXA 2FWRA 1O87A 4BFSA 4BLTA 2FA9A 3B7GA 1KSGA 2QN6A 2FMXA 3SOPA 1KZ7B 1F2UB 4DSOA 6Q21A 4A0RA 1HT2E 2ZRFA 4BPBA 1W36C 4OJQA 3LBHA 3SHWA 3WNDA 4YMUA 2WKQA 4F4CA 2Q3MA 4ITRC 4HZUB 2HUPA 2UKDA 1VECA 1NBMD 1QDEA 2VBCA 2ZS9A 2NPFA 3RRNA 1T3SA 1AZTA 2WWIA 2FFHA 4HB2A 4CW7A 4F93B 2TMKA 1KY2A 1N6KA 4RVCA 3H2YA 1YZTA 2EYUA 5DYIA 1G9XA 1OKKD 1YZLA 2X1VA 1ZD1A 1XEFA 2QPTA 3THYA 1XTRA 1W2GA 2LKCA 5E95A 2Q9AA 4MITA 4US1R 5AUNB 5ELXA 4TMXA 5JWRA 2CNWA 3K70B 1G3RA 2ZRCA 5KHOC 2ZI4A 4AKEA 4P33A 1X6VA 3ZVMA 1Z0FA 1T8TA 3EIHA 1EFHA 2EFEB 1CS4C 3TH5A 4M1WA 3U3MA 5L3VA 3FMPB 3A36A 1Q1ZA 2GXQA 1CJTC 3HU2A 5B2ZA 4C4PA 2P67A 5DGXA 5J40A 2ZUDA 1F3OA 1WQ1R 3B85A 2IYLD 1MRSA 3QXXA 4GP6A 4US0R 3ZDQA 4TZ0A 1AJEA 5JEDA 1E1QD 2DYKA 1DG1G 4OHWA 5JMTA 2W2TA 3BORA 1JNYA 1N6OA 3QEJA 4OBEA 2CDNA 4DJTA 1NJGA 2WWWA 4HUQA 1ZD8A 5FFMA 2OSBA 1IM2A 3CPEA 1IN8A 1E99A 3SE0A 2VHUA 4Q03A 2OESA 3QF4B 3ZVRA 4B76A 2RGGA 2BCJQ 2ZEJA 4PC6A 4EPVA 4WXRA 3V4RA 1OH5A 1P4SA 5CLLA 1UKVY 3AGQA 2PLFA 3F0TA 4QGHA 1IN4A 3ZS9A 5DHFA 1SHKA 3PUVA 2G9NA 1MR3F 1CR1A 1WXQA 2EW1A 1IXZA 1YR6A 2JIZA 3CF2A 2C78A 2VP2A 2NO9A 2PH1A 4C3ZA 2IYYA 4Q47A 4MDFA 3W5IA 2OHFA 1LF0A 2W2VA 1X1SA 5AWFC 2UZ3A 1KI6B 4G01B 4BLRA 3MFYA 2IUUA 5CJPA 2QU8A 1AN0A 2A5FA 1IY0A 1P61B 4IOJA 2GF9A 3GJXC 4UNQA 4ZIRA 1P62B 1NMYA 3QIAA 1AGPA 2P65A 4TYYA 3LVRE 2IYTA 4LUCA 4LBZA 3Q3JB 1DAKA 1XCMA 1AGRA 3VKWA 2OFOA 4URVR 4N1AA 4I99A 1E9FA 2QM7A 3EW9A 3QJYA 2J7PA 3AGPA 1FTSA 2IYVA 2ZJ5A 2ZPTX 1N0UA 2J59A 2W0MA 1T6NA 4V0KA 3DM9B 1LV7A 3JZAA 4KCGA 2XTNA 2EU8A 3C8UA 4NMMA 3W6OA 2FSHA 2JATA 3IEVA 2VPPA 1EFTA 3REFA 1FUUA 4NBSA 4B2IA 2WZQA 1WBBA 3DMDA 1E2NA 1LVGA 3K53A 4DLRA 3GFTA 4NONA 1L4UA 2R65A 1ZUIA 1KAOA 4RCYA 2H8KA 2PCLA 1CU1A 3QNUA 2BVNA 5FBRB 2R9VA 3C14C 3SYKA 2NTYC 2QAGB 5KO2A 4M9XA 2EFHB 4HLQB 4DLSA 2NO6A 2QZ4A 1V5WA 4RJLA 1UDXA 4Q1DA 4M9SA 2VLIA 4LJ4A 1KO5A 3DZDA 4JKYA 3NVAA 1H8HA 4JVMA 5C2JB 3OEEA 1JECA 5KOYA 3GLGB 1A5TA 1VG0B 1P9NA 3QY0A 4PHGA 4MUAA 3W8RA 3ICEA 1Z8FA 2VP0A 2UVQA 3CKLA 3KKQA 1OH7A 3I3SR 1RPZA 1XTKA 1ZRHA 1OXSC 3I62A 1SVWA 2O8DA 5JEEA 1PLLA 1IN6A 2PEYA 1Z83A 4ZI3A 2OEPA 5F2EA 5B30A 2ZJYA 5JCZA 2GCPA 3NIBA 3VNUA 3RSOA 4GFDA 3D8BA 3C16C 2Y8EA 3LBIA 1VDZA 5HZHA 4S35A 1NIPA 2QNRA 2VHTA 1XU4A 4D82A 3LD9A 1GKIA 3SHFA 2Q6TA 3EZ6A 4C0HA 1Z63A 1QZXA 1XBTA 4FCVA 5J4KA 2BC9A 4M1OA 4NE2A 2PZEA 1GNPA 3NG1A 2CL0X 1IBRA 1HQYE 5L3QB 1FZQA 2GF0A 3GLIB 3SZRA 1I2DA 4QGGA 4NKRA 5KDDA 2HT1A 2GHIA 4TT3D 4HZUA 5G53C 1LW7A 2NPIA 3CLVA 4KFTA 1OH6A 1E2PA 1GKUB 1O3YA 1H8EA 2DFTA 3HPQA 3VR2A 4OHXA 2ZI3A 4C7OB 1Z6XA 2GBLA 2CXXA 3IIJA 5J4LA 2WBLC 4JBXA 3BRWD 1VG1A 1Z2CA 2DWPA 4BFXA 4A1FA 1Q22A 3ZS8A 3RC3A 1EK0A 4P4SB 5E7JA 1ZCAA 2P5SA 4LBVA 4MKFA 4AKIA 1KGDA 3FFBA 4ZDKA 3SFZA 4ZCIA 4JSYA 4R98A 3FVQA 4O2RA 4QBFA 4QHYA 3EZFA 2GZAA 4ZCMA 1QBKC 5G41A 2IYXA 4Q4JA 1M34E 1W0KA 4P0TA 5G3YA 4Q19A 3TQCA 4LBYA 3PQCA 4HLCA 4DBLC 3IBYA 3UXMA 1JB1A 1YZUA 1IN5A 2J0VA 4G3XA 1XDBA 4IDPA 5EZ5A 5LPNA 1ZUNB 5IRCD 5HTKA 2BV3A 4NYJR 3NH6A 3T06B 4LK2A 4XH9B 3TMKA 5BN4A 1CRPA 1WF3A 1QHGA 2F3TA 2ZSEA 2ZI5A 3N2IA 1W36B 4GNKA 1NI3A 4TMTA 5FUYA 2V7QA 1PLKA 2J7PD 3LH5A 3K0FB 1E4YA 1XEWY 1XD2A 3AH8A 4P4UA 4C0BA 4NCKA 4W7SA 5K8IA 1YZNA 4JL6A 1Z3IX 4Q1FA 3ZD6A 1KSHA 1AQYA 2Q3FA 3VTKA 4JKIA 4JLDA 2XX3A 2ZRLA 4OKSA 3K0FA 3LBNA 3C5CA 5AJXA 1LTQA 3OZXA 4OI2A 4TYQA 1OE0A 3DKVA 3K0CA 3UPUA 3EXAA 4DXAA 1WE2A 1Q0UA 3R7WA 4DDTA 2VRWA 5A0FA 4ACBA 1N6IA 4U00A 3TSOA 5KNBA 1W4BA 2DFLA 2QT0A 1QHIA 1IXSB 3SDZA 3MJRA 2YWGA 1Z0AA 1Z6TA 2GEVA 3K9GA 1CR2A 4B3BA 3U61B 4MYTA 4EAQA 1W0JD 2WICA 1FQJA 5AK0A 3U44B 1VIAA 5IK2D 1GP2A 4B32A 4FMCF 2G1KA 1S8FA 2QA5A 3VX4A 1E98A 2IT1A 5E7MA 4QJ5A 3TNFA 2QP4A 1ZM7A 3TAHA 2PMKA 4TQUS 3KJEA 1E2HA 4HAXA 4LPSA 3K09A 4R2HA 4IFBA 3VQTA 4LC1A 2CBZA 2IS2A 5EP2A 5A4JA 2G83A 1Q20A 1CBUA 5KSOA 1G5RA 1SKYB 1KMHA 1G8GA 2HLDD 4AI6A 4URZR 5L3SA 2QPAA 3WY9A 1JR3A 1OF1A 4Q7LA 3NTUA 1OB2A 1NMXA 2ZYWX 1BYIA 2ANCA 2QG6A 4ON9A 5BWMA 2AL7A 1HH4A 4RZXA 4MA4A 3X1ZA 3O8BA 4R71A 1E2LA 4OI4A 4K8OA 3LFUA 2VH5R 1EWRA 1Z2AA 1GIAA 1T0HB 3QPVA 2OCBA 4HAVA 2WWYA 1TEXA 1Z0KA 5FTJA 4RZUA 3BB3A 4URWR 2G1JA 3B1YA 2B7BA 5TB5A 3BAFA 3BXZA 4W5JA 3TR0A 3T1TA 3GJ7A 4Q9IA 3CWZA 2BBTA 5F98A 4POAA 4CEHA 1R0YA 5JI3E 1FOEB 3CM0A 1GFIA 4TQ9A 2WOJA 1F48A 2CMKA 1Q1EA 1Q3HA 2AX4A 4QHSA 5IDVA 3F5FA 2ODEA 2R6FA 4IFEA 1XRJA 4A8JA 1NMZA 3UMSA 1N0VC 2R6DA 4CDGA 1GITA 3K8YA 2OE2A 1LS6A 3AB3A 4PPGA 521PA 3TUZC 1RVDA 4LJ7A 3UK6A 4C9BA 3QENA 2XITA 3AVWA 4CT5A 3B60A 4B48A 3NKVA 3GP8A 1E9DA 2QP3A 3S1AB 2WSSD 3FE2A 3PUWA 2BMJA 3PFIA 2XZPA 3FGNA 4IXMA 4V0LA 5B58C 1JAIA 1E94E 1T5IA 2Z5FA 1TUIA 1FQKA 2GJSA 1G16A 2IA5A 2ZRMA 2FSGA 2QEQA 2QE7D 3LQRA 1A1VA 2W2XA 3I72A 1EWQA 4TYNA 3KJHA 4XVUA 1S96A 1CJKC 4ESHA 5CJ2A 1NSTA 1G3UA 4MGIR 1RE0A 2YOHA 3IPXA 1Q21A 2Z6VA 4XIGS 4Q9LA 5TXGA 2C99A 4EKDA 1Z07A 2W6JA 4AWXA 4UNPA 4GDFA 1KK2A 4FCWA 5JJKA 1JI0A 1E2FA 3TSZA 4BGDA 4V02A 2FGJA 4WZ6A 3CPJB 3HR7A 4U02A 3W5JA 4Q00A 1U0HC 1K6MA 1OT3A 2Q3HA 1JPNA 3CO5A 1MO6A 2WPDA 2J3EA 4JLOA 3I73A 4JVSB 4FMBB 2XAUA 3IHWA 3RNLA 1XEXA 3FYHA 4BEBA 1Z47A 3AUYA 4M8NE 1TNDA 1UKYA 1NN0A 3V9PA 4GP7A 2P6RA 3EPHA 5DI3A 3AKCA 4W9MC 1IJEA 1Z08A 3V4FA 2ZTSA 3PEVA 1NF3A 3VMFA 4EDHA 2XNDD 4BUJA 3FFAA 1E32A 3JVVA 3LXXA 3IO3A 4HZIA 1VCMA 1KDOA 1UDWA 3U3KA 5TDHA 4HSEA 3VX3A 5DNYB 2D4HA 4BZPA 4JLMA 1RW4A 4HAUA 2N46A 4MKIA 4RFVA 2QTVB 3KKPA 3QVUA 2BEKA 3CR7A 4ZKEA 3B8HA 3QXSA 5KSPA 4LJ9A 2GXUA 1U9IA 5FL7D 2CE2X 4LGMA 4A92A 4E03A 4NCNA 3WBKA 2AK3A 1DAEA 3KB2A 2HF9A 2RB4A 1KHTA 2FU5C 2CHQA 2ORWA 3QUSA 4M1TA 3K70D 2HCJB 5GADl 3ZIAD 4B33A 5KSZA 2RGXA 2IYWA 4TMZA 4BZXA 1JJVA 3BH0A 4OI0A 1XXHE 1B0UA 1UBFA 4M1KA 1GUAA 2WJJA 2OCYC 4M53A 4ASUA 4RY2A 1ANKA 3VAAA 2DBYA 4IOMA 1C1YA 1FNMA 5EXSA 1NBME 4OK6A 1Z29A 3N70A 4EPWA 5JS7A 5DYGA 4BLPA 4TLCA 2D7DA 1EGAA 3MMPA 4BLOA 2VL7A 2QMEA 1DAMA 1G17A 4KITB 3BWDD 4F4JA 2A5YB 4A15A 2OZEA 4OQXA 3C7KA 1QRAA 1OXUA 2V6JA 5D3MA 2GZHA 4AD8A 4DZZA 1G4AE 2PMDA 1E2MA 1P5ZB 4Q1AA 3TSWA 4LHYA 2R6GA 3LQQA 3PEYA 2JDID 2NG1A 4Q7JB 3BIFA 2IWHA 3SBEA 3QBTA 3ZGXA 4GSYA 4PFSA 5J4YA 4YMWA 1ZNZA 2I4IA 4KO8A 2E1RA 2ASEA 5EP3A 1WB9A 1T3LA 2YKGA 5EUMA 2VF7A 1GVNB 1P6XA 3FB4A 3RC8A 3QQ5A 1OFHA 4BECA 1S0UA 4ZDJA 1TQ2A 2ZJOA 1Z5ZA 2JLSA 1E0JA 1G19A 2OG2A 4HAZA 2GVDC 2GK7A 2OCAA 4OHZA 4TYWA 2YHSA 1HURA 1OFTA 2KBFA 4KU4A 3SQXA 4D2IA 3NHAA 1E4VA 1E9SA 4QNRA 5DHAA 5KTYA 4TTPA 4C30A 2P3SA 3TJZA 1XCPA 3WNCA 4Q1BA 2WOOA 3P1JA 2Z43A 4QHTA 1DELA 1UPTA 4B3GA 4NYMQ 2ZJZA 2BWJA 3DPUA 1DADA 1E2EA 2IHBA 2OLKA 3AQ4A 3JZMA 4GOKA 4WA7A 2ODWA 3QG1A 3FKQA 4IDOA 4WZAE 4XTRA 4LV8B 1KJWA 3IDQA 1VHLA 3KXIA 1W49A 4PXAA 4A6XA 1CKEA 3DDCA 5FUVA 1S1MA 1N6NA 5BQ5A 1AS2A 2REXB 2ZRJA 4QJ4A 4DUGA 2O52A 2RAPA 3VR3A 5H1YA 4W5HA 1E0SA 4HEJA 1NVWQ 4Q4JB 3AKEA 3H4MA 4IHQA 4EJSA 4M1MA 1RYHA 2VYFA 4YDSA 4RD6A 4XD7D 1E9BA 3C5HA 1YR7A 3K9LA 3I1FA 1IONA 1CJVC 1GRNA 1FX0A 221PA 2OILA 1NP6A 3R9IA 4QKQA 3WMGA 4Q4HB 1DAGA 2GAOA 1RRCA 1GSIA 1FP6A 2A5DA 2VHQA 4LC0A 1W5SA 4C7OA 1XB2A 2GILA 4LOAA 1R10A 2BBWA 2IXGA 4RKEA 2ORIA 4U5XA 5D3QA 2JLZA 1KKMA 1EFRD 2F43A 1KTVA 4TTRA 2O5VA 5F9HA 5JCPA 4PSVA 4WIAA 4B47A 3Q72A 5JWHA 3MSXA 3HR8A 3K0AA 2D2EA 1BMFA 2X8AA 4A8JB 2VF8A 3B78A 4B35A 3T34A 3TQFA 1QF9A 2KJQA 4B73A 3K0AB 1T91A 2ZS8A 4NDZA 4G5GA 1FMJA 1TQ6A 3QKRA 4JJZA 1CLUA 4O0MA 5P21A 2H57A 3CZPA 3W3ZB 2WWGA 3BH6A 2WKRA 4L5BA 4EPTA 2BIFA 1AS3A 1A2KC 3KUDA 4W5WA 4Q4AB 2GA8A 4QFMA 1T8UA 2O0JA 4PSAA 4LJ8A 5EE9A 2BHRA 2H5EA 3UWOA 1UBEA 4P31A 4G5RA 1UBCA 2B7CA 2WJHA 4B43A 2F3RA 5TMPA 1XP8A 2CCKA 3THWA 4ZI2A 2NIPA 2GKSA 5CK4A 1DOAA 4NL4H 5SZKB 1S9HA 3WYFA 1IAQA 1M74A 4GZMA 5L3SB 4O2LA 3G5UA 5JJIA 4I1OA 5AJVB 3KTAA 3LLMA 1JBKA 2WKPA 1RIFA 1KKLA 4XVRA 2NZ8A 3HWSA 1GOTA 2DY1A 4YMSA 3SJZA 2GETA 5DN6D 4RZ3A 2WAXA 1OHHA 1RZ3A 3Q8XB 2G6BA 1MABB 1OXXK 2HCBA 4OHYA 4LJ5A 1KNQA 1LB1B 4BFUA 2OBLA 3E1SA 4XVQA 5KSYA 3EC2A 3RRYA 2HXSA 2GVZC 2VSFA 3PR1A 3OHMA 1G20E 2GXSA 3ZIAA 3U5ZB 2YJTD 1UBGA 3RLFA 1R0XA 3A6PC 2ERXA 1A7JA 2C96A 3O47A 2A3RA 4IOKA 3PUZA 3CH4B 2G0NA 1P9WA 121PA 4EPRA 2KB0A 3A4LA 2IXFA 2RCNA 2FH5B 3WP1B 5DLQC 3B13B 3KJGA 4JSTA 4DCSA 4D0NA 2FDCA 4LYHA 4IDHA 4KSCA 3GEEA 1AS0A 1GILA 4YXWA 2VSOA 1NRJB 2FOLA 4JZKA 2OO7A 2Q0HA 5FPTA 5JSZB 1TQDA 1YU9A 2CHGA 1IY2A 4ZDWA 2RGDA 1NN5A 3CRVA 2Z0MA 3KJIA 2ZE7A 2IYSA 1CXZA 2LCFA 5FPKA 4PX9A 4OQNA 4V0ME 4YC7A 2H92A 4LWZA 4LDJA 3R7WB 4MDEA 1ZD9A 4QG7A 2FNAA 5KPDA 2HF8A 2IXEA 1UJ2A 1ZM4A 3I8SA 4RD2A 3TUJC 3BH7A 2OT3B 4NPHA 4PC2A 1HUQA 2QTFA 1ZM2A 3B2EA 4RFSB 1G41A 2BJVA 3PUXA 1UKEA 3A1SA 2ZYUX 1SULA 4JT4A 4MQBA 4PQFA 3KUCA 5FPHA 1PZNA 3OF5A 2AKYA 2BJWA 2PT5A 4E09A 2QAJA 4JLBA 1GAJA 5E7IA 2JLYA 2A78A 5EUQB 4MRVA 5EXXA 2J0SA 3VR6A 1ZUHA 1IOZA 3CZQA 4JS0A 3KKOA 4JLNA 1QVRA 4LV6A 4OYHA 5EXPA 5FOTA 4DB4A 4EPYA 1XZPA 3E70C 3U4QA 3ADKA 2RGBA 3NDPA 5EZ6B 3WHKA 1N6HA 4TLDA 2B6HA 2QAGA 4B71A 2I1QA 5BN3A 4AC9A 4UKDA 4B3XA 1ODFA 2C2HA 2FEOA 1ESMA 4AG5A 1E2JA 2O8FA 1QHNA 1OIWA 3QF4A 1XTQA 2RGNA 3WYGA 2WHXA 2NMVA 4Q21A 4TL9A 1YRBA 4IVRA 1SXJD 1CP2A 4LHVA 1F6BA 1US8B 1ESNA 3NC0C 1TX4B 4Q4LA 3W34A 4L9SA 4JLAA 2GCNA 1FX0B 1FNNA 2FZ4A 3HYRA 2REOA 2QL6A 2VA8A 3P4YA 3PENA 5EJEA 1QHYA 4KJZA 4Q18A 4Q66C 2FGKA 4LZZA 3VU9A 2P6NA 3IEUA 4G0NA 1NVUQ 4PHFA 3EAQA 3RRZA 1E9CA 3LLUA 5JHHB 2ZI7A 4D6PA 4DLZA 4Q9KA 1XPOA 4C2TA 5FR2A 3ZH9B 3PEWA 4DC9A 4DLUA 4R9UC 3CNLA 1VCIA 3K09C 3DEFA 2GEUA 5LB4A 3WBJA 5G40A 1LY1A 1R0WA 1W44A 1OPXA 1FMLA 5SZHB 3ZYCA 1U94A 5EE3A 1MKYA 4PC7A 1YZQA 2QGZA 1E3MA 1C4OA 1Y63A 1XMIA 3I92A 2BM0A 3GLGE 1RRFA 1NNEA 1J90A 2G0TA 1Q1BA 3NWJA 2GEDA 1JR3D 2KSQA 4A0HA 2W00A 1P72A 1OYWA 1COWA 1JR6A 1XMJA 2BEJA 3VHLB 3QPWA 1R5OA 1U8AA 2QE7A 1G18A 3FMFA 4Q01A 4EIWA 5JRZA 3TK1A 4AYXA 2AXPA 3EG5A 4JLPA 5CDFA 2DB3A 4KBFA 2JJ1A 2WSSA 2IUSA 1KMQA 4MYUA 1WA5A 1OJLA 1X3SA 1NLZA 1R4AA 2G3YA 3DO6A 1U81A 3OE7A 4LYJA 1X8LA 3GLHE 4MRPA 4Q1EA 1G3IA 1F2TA 4UNRA 2XZOA 1CR0A 1UADA 1ZCBA 5EP1A 3NBXX 1HE8B 1U98A 2WVJA 2RGEA 1I4TD 3WRYC 1MO3A 4E22A 1XMVA 1ZBDA 2AK2A 2QMHA 3AVQA 4X8LA 1OH8A 2O8BA 4QJ3A 3QF7A 1E2GA 2G88A 5KDLA 1MT0A 1A82A 3AP3A 5DI9A 4OHVA 2BCGY 2PL3A 5JI2E 2VP6A 3LWNA 3MWKA 3N2EA 4IVPA 1AQUA 1W46A 2QENA 4NYIR 4Q7MB 5FBWB 3B6EA 3KQNA 2XJ9A 3BERA 3IIMA 4IXNA 5M04A 3T1QA 1KAGA 1N6RA 5FOVA 2IYQA 4GRAA 2NZJA 3B1XA 1E6CA 1G1MA 2BDTA 2ZUBA 4JVNA 4YMVA 1E79A 4DSTA 4DCVA 2ZSFA 4DT1B 3UKDA 4A2WA 3RVBA 4IJMA 4PPNA 3L0OA 4NYIQ 3CX8A 2O0HA 3QKTA 4F91B 1Z0DA 1M7BA 2ZRNA 3ND9A 1CRQA 2ZSAA 4N0DA 4PR0A 4PAQA 3MGCA 5FOSA 3U44A 1KI3A 3K1JA 4ZCLA 4IVQA 2GJKA 3G0HA 2REBA 1WDTA
chains in the Genus database with same CATH superfamily
4BG0A 1F8FA 4DQXA 2UVDA 5A2GA 4IDDA 3T9BA 1EK6A 2Z58A 2HV7A 3B0PA 2BFEA 3MWLA 3DTVD 1NXSA 3NMIA 2XDQA 1ETHA 2PM8A 4BNVA 1PVVA 3Q7PA 2JVJA 4QUIA 3NOXA 5FCDA 2W6IA 4NULA 1M5RA 4LE1A 3V5YA 1L8QA 2GZ3A 4HDAA 4Q05A 4C3VA 3U7RA 1QANA 1NLFA 1F38A 4L0MA 2P27A 2X76A 4FMDF 4UU0A 5DGIA 4LQDA 2ZPUA 2E87A 1XZLA 1Y3AA 2C54A 1ADJA 5JCJA 3ZYZA 4D9FA 1GTRA 3UFXB 1W5FA 3O74A 2GTPA 4DJEC 3LVBA 3A28A 4U39A 1ULTA 4GLBA 2O9JA 3RW9A 1B8OA 2HEIA 4OBWA 2Y67A 2I54A 3S6JA 3U48A 1HI9A 2ID4A 4EDFA 4I1UA 2BGMA 1EP3B 1R0RE 1CQWA 4ZEOA 3R5KA 4UMDA 2PJDA 4I50B 1CUFA 2WSLA 2QRVB 4R41A 4LF7B 2P6OA 3NEAA 4RQBA 1I7DA 2QG4A 3RWOA 2R02A 1KEWA 3D31A 2O2DA 1RAAA 1CZKA 3AVXA 3QVLA 3GIDA 3I2GA 4XWGA 1P2SA 2QTNA 4OQMA 3ADCA 2HJSA 5B53A 3SI7A 3TO5A 1J39A 4QVIA 2QRUA 2WJVA 2XD9A 1ZZPA 1FE8A 3MK31 3NORA 5JXIA 2BHTA 4PYJA 3QVZA 1PT5A 4W1PA 4X90A 3FJYA 4Q9JA 2J41A 5JDCA 4M8SA 3HNPA 5GONF 1VLSA 3OCJA 1Z28A 3AG5A 1CGOA 2QTGA 1ZJ6A 3KS9A 3CVXA 3HLZA 1QE5A 1VYVA 2VXCA 3EVEA 3F6YA 3OJXA 4QOIA 1GNQA 4X44A 4A82A 3SDSA 2HMYB 2H7OA 3BK7A 4WGFA 2JEZA 3MS2A 3M83A 4O2AF 1ZOSA 4JBLA 4ED9A 3OEED 5IVPA 2ZSJA 2C9OA 1DIGA 3KFXA 4JODA 2GT1A 2DSTA 1QVWA 3X43A 2CLMB 3EIFA 3EGWA 4N8EA 1TO1E 4HNAA 3VR2D 2HQOA 2NUPB 1PJCA 3SBXA 4RZQA 2PS1A 4C0KA 1XOIA 3G02A 3GA5A 4I5FA 2IXMA 4R2KA 4HB3A 1H5QA 1V1RB 4JOQA 1AUEA 4GBGA 4LNAA 5LD2B 3CRZA 3U44A 5CGQB 3REGA 2J0UA 3VTFA 4TL7A 2ZIEA 4Z9HA 1DCMA 2FSVC 3NIDB 3OMLA 3O8RA 3KOOA 3LW8A 2JANA 4I36A 5D7NA 4U9HS 3MBGA 2IYPA 2IQ5A 3FI0A 3M9XA 4FWIB 3VOSA 5TQ0B 2MR6A 3F8TA 3KD2A 3ZV7A 1G8FA 4JL8A 1VI6A 1NN3A 4U3JA 3ECSA 3CZRA 1AC5A 4M9RA 4X24A 3OETA 4EKWA 1L5RA 1JFVA 1P4HA 3QEMB 4MV1A 4OJNA 1X0VA 1YDGA 3VRCA 4D8TA 4YAGA 2X5NA 1UPCA 3KLPX 1AV6A 2XB8A 3SG0A 3DMPA 1ZPDA 4XM0A 3T3GA 4JI7B 2Z1DA 1J33A 4TXLA 5K0GA 2BMEA 3EGDB 4K2AA 4L6AA 3K9BA 4IOLA 1C7FA 4KYTA 2JAOA 3V2UA 2VRBA 5FTKA 3T7IA 3M6LA 1YSCA 1LDNA 5F5FA 3TPZA 4DUYB 3EUAA 4MYSA 3EBOA 1TMGE 4MKRA 4JW1A 4FDMA 3CNBA 3LT0A 4MUKA 2IIPA 2G6TA 3WDMA 4EB6B 2ZM5A 3W8FA 5HHTA 1RTKA 2P0YA 1OUMA 3K35A 4HDQB 1IOWA 3M9LA 2I6FA 3PGLA 2MSEB 4P5DA 1RQXA 2ZRHA 3KQHA 1NHWA 3PI7A 2VI5A 1MNAA 2HRZA 4EQ6B 1QAMA 1P74A 2EX4A 3ROKA 3VJLA 5HFJA 1RI5A 3AHGA 3VNRA 1C7JA 1JE1A 2XWJI 4HXFB 2QZSA 3P0IA 2IEZA 1Z0IA 3PT5A 5DT9A 2B8EA 4AYTA 4DIEA 3C43A 3I4CA 3TBKA 1WM1A 1X1QA 8ATCA 1FLDA 3QKSA 3VC7A 1MEEA 3WBFA 2UAGA 1LDEA 2YHIA 3U4AA 5JT4A 1WTYA 4G09A 4AJ1A 3WIDA 2QP9X 5AW3A 4GVPA 5KHAA 4E5VA 3QWFA 2OZPA 4RX1A 1VMKA 2D4AA 3L84A 1W4CA 4MK4A 1AOXA 4EUKB 3AUFA 3B6IA 3B5IA 3H97A 3SICE 4BYGA 1F12A 1LPNA 1J99A 1Y5IA 1HM5A 2EPOA 5K03A 2XXAB 3GRVA 2C03A 5K0FA 1ORRA 5AKGA 4D0GA 3S2IA 3FHOA 1YMQA 2V4ZA 1LPPA 4CN9A 5BMVB 5J4VA 1ZXLA 1EMDA 2FMHA 3NAGA 1UC8A 2X3UA 3WLIA 2DR3A 4JV5B 4BFZA 4HLDA 3NHZA 2RHDA 2Q7OE 4E7ZA 4DKJA 3VDQA 2FPMA 2AQ8A 3E03A 4IEFB 2CXHA 4JBHA 1RLUA 3CF4G 4IQ8A 1HMDA 1DLIA 3RAPR 1XI2A 6CHYA 1II8B 4MR9B 2ZTLA 4HMQA 3TSAA 1UDAA 1QLWA 1NX9A 1II0A 1SUIA 2D0IA 1EGMB 3LP5A 4GXNA 3VC2A 5JAMA 1CD5A 1Y8CA 2CJWB 2JD2A 2O14A 3G5LA 4KFSA 4KLCA 3HJCA 3Q9SA 4GYTA 1Y42X 2A69F 4EWCA 1Y7LA 5LZ2A 4ZKDA 3ET5A 4LF6B 1OFVA 2KS6A 1XWFA 5B5SA 4BS9A 1S7CA 4HDSB 4ZO7A 1NTOA 2JLWA 5KNDA 3EVDA 1DKNA 3H8WA 2PTHA 3SXUB 1OKKA 3DKAA 5A03A 1LV8A 1BX1A 2EKPA 1JLLB 5C8YF 1DFIA 4G63A 4H1UA 2QD1A 5AM2A 4C5BA 1AUXA 4OHUA 3ONNA 1JTEA 1EJ0A 2XGOA 4R1NA 4BZQA 3KETA 1QWOA 2R8XA 3TOZA 3ZVNA 2NYRA 2WHRA 1NE7A 4CMBA 1ZNYA 4JURI 1L8XA 1P1FA 1Y8RA 3SF0A 3DYVA 4ZEWA 4F6CA 4ZO6A 3C3MA 4CIAA 1BKYA 4FS8A 2L6HA 3ZJYA 3DDUA 4ZDIA 2O8EA 2C9ZA 4GLOA 3JAWB 1BXZA 1XTJA 2R5FA 3UHFA 4A9AA 3OC0A 5FTLA 1P44A 1TZCA 2JAPA 2VBIA 4PC1A 3RC9A 4CIVA 4YAIA 3HJAA 3LQKA 4FCTA 1CRZA 2QW8A 3DFIA 2JJ1D 1K6XA 1GUDA 4KWIA 4JI0B 2PTGA 1W30A 2WDPA 1OI3A 5H81A 4DHWA 4RDIA 3A9RA 4PY2A 2AX3A 4DABA 3W9YA 1JFFA 1A8SA 2EFJA 2P79A 4K1XA 1KFJB 3DEIA 4KXFB 4J7AA 2IW1A 4I2VA 1OXKA 3GFQA 4F2HA 5JXJA 2R7XA 3EWAA 1COWD 2O7RA 1U04A 2PGNA 1P91A 2BZSA 1L3PA 1JPJA 4JLJA 4PZCA 3VRHA 2RONA 3IL2A 3R0VA 2X5JO 4DJ5X 2Q9CA 1A3CA 2BRUC 1XUOA 2R6AA 2CY0A 4J0EA 2CLHB 4DM7A 3UXEA 5J47A 5EGNA 4IMJB 4W1QA 2HT6A 2JIRA 2YXNA 2JGDB 4JI1B 5JS8A 4ZJZA 4EH1A 1J6UA 4MWGA 3RSGA 1FSFA 4I55F 3FDZB 5GM2A 3DLHA 1GKLA 3SIRA 5H0IA 3HB7A 1RBYA 3AHHA 4MW1A 3WIVA 2B1IA 3K0EA 2IE0A 5FI0B 4EHBA 5K8VA 2C2OA 2ORVA 3WQHA 4HX5A 2OB1A 2GZDA 1TJNA 1U5AA 3ZVKA 3OOHA 3B89A 1PS8A 4I81A 4R6WA 3SXKA 1WKBA 4MHTA 1C14A 3WYDA 3GM3A 1ZYUA 1TECE 4MLZA 2YDYA 2YNMA 3EIEA 4NBNA 5F1YA 5HOEA 2JGNA 4YP9A 1MHTA 3MBIA 3ZIBA 4DCUA 2PZMA 1NBMA 2IHZA 3FPLA 3WMEA 3P9PA 3ZBTA 2PD6A 4KB5A 5KJ6A 4QM7A 2D8MA 2BM8A 3OO1A 3QV2A 4G0UA 3BFXA 1YA7O 5C7LO 4D4LA 3DZ8A 2OKUA 4V03A 4JYBA 2PGJA 1ZMOA 3EGEA 1XJ5A 3ESBA 1KU2A 4LDRA 1F8YA 4Z4IA 1WTAA 3DAFA 3I37X 4OB8A 1SC9A 2F17A 5K3AA 1VPEA 4GF5A 2I8BA 4LKRA 5AW6A 1DOWA 4WUTA 5KHLB 1N75A 3RU7A 1QE0A 2ZBEA 4GOXA 1UFKA 2QQFA 4F4IA 3N75A 4KGVA 4ZAVA 3KCQA 4LY0A 3A37A 3TTUA 5G4KA 1O6GA 3PQ4A 2OD2A 5BRAA 3BD7A 4E11A 4RH1A 3G59A 1V5GA 1XTIA 1ULHA 3MTBA 1HF3A 1N5MA 2OY0A 3KAKA 4JVSA 2I6UA 5DCUA 2HF7A 5NULA 1WR8A 9LDBA 1Z06A 1E7MA 1NUUA 1V7ZA 4GLFA 1XEXB 4H7HA 4U7JA 3H2BA 4NX2A 5CIQA 3T7AA 1KZ1A 2XA1A 4XZ3A 3FOZA 1QYDA 3K33A 5BYJA 1WO8A 3MTJA 3OEWA 4HDMB 5HE8A 2FGYA 1VP3A 1C3XA 2YIDA 3TRIA 5ARCA 1ZGAA 421PA 3DM5A 1F60A 3EHDA 4N12A 4OXNA 5CT8A 1M6YA 2WF9A 3K5IA 4B3CA 3NM5A 4NYMR 3ZCSA 3NTQA 4ZOLF 2PMFA 3IOEA 1E1DA 3RSQA 2PLWA 1PFWA 3D6VA 5EZYA 2Z8YA 4J0QA 3PDJA 4O1IA 3UK2A 1UMBA 4O4HA 5ESRA 3QLTA 4ZVVA 1YB6A 1SUSA 4YJHB 1Y4UA 3MCZA 3PFNA 1CUDA 3QPUA 4JFRA 2DFNA 3INGA 3GXOA 2Z9CA 2BH2A 1XQ1A 4FZ5A 1TWHA 3KYCA 1K88A 4BX0A 2JCSA 5K8TA 2I76A 2VNJA 1QPUA 5BN4B 1XZDA 1HT3A 3GMIA 5K0ZA 1TU3A 3PFBA 1F8XA 3COZA 3DMNA 5AIBA 1QS0B 2VXOA 2WWTA 1YE5A 2CK3A 2IPNA 4Z1MD 1Q95A 1VKRA 3NBUA 2DHDA 1RYDA 4TROA 1Q1QA 4Y9SA 2LKDA 3MJVA 1G2QA 3MPUA 3ND7A 4YREA 4E5YA 4QODA 4RTRA 1G8KA 2EPNA 2EQ5A 1WVGA 4AM8A 3ZOKA 3A2MA 3F3YA 4WTOA 3MS7A 4IRUA 1TM3E 2JCVA 4G1EB 3D7MA 4IM7A 4KI7A 4KQEA 5MHTA 3QZUA 4Z9JA 5LQDA 1F1BA 4R1PA 2V9PA 1SZPA 3GRCA 1R6VA 4XWOA 2EIMC 3H18A 3LQ2A 3SS7X 1QHHA 2VP9A 3KQQA 13PKA 4EQZA 1KXJA 2CCYA 5EHQA 2F00A 3DAGA 2N75A 3MJDA 1CETA 4N4WA 1PKXA 3PA6A 1JA9A 3PQEA 4LXQA 2F7SA 5IJXA 3VISA 3ZKAA 3ZHQA 3R7LA 3A25A 2GPNA 1GT6A 1TVMA 3AO0B 3NYQA 4XVCA 3T9DA 1YOVA 4HD8A 2HDWA 3IUMA 3JAMA 1CDOA 2ID9A 3KSMA 1XNGA 1WG8A 5ECDA 4BYMA 3E9VA 3FRJA 3HCEA 2ZYTX 2WA2A 1ORVA 3WLFA 5IKEA 1U28C 1PO7A 2C04A 1BTOA 3OIUA 3H2ZA 2XLCA 2Q46A 4KFRA 4Q48A 1VOTA 4RUKA 1OQAA 5DFAA 4TMVA 5A06A 1V35A 1QV9A 2HJ9A 2YWXA 1I5OA 3NDJA 4K46A 4HI0E 4U6QA 5HIMA 4A0GA 2BBOA 3UG6A 3WQBA 2OAEA 1OIXA 1R8SA 1TLLA 2IY7A 2JFZA 3T35A 3F9RA 5DN6A 3ZI4A 1K8RA 1NPDA 4IB4A 1Q0ZA 1GL3A 2BMAA 3F2VA 3LQFA 4WWHA 5FADA 4PFPA 1XYYA 1JWBB 3MC1A 5L95A 1TA9A 3IAAA 3K72B 6ADHA 1DBPA 2GX6A 2Y0EA 1G8YA 4PO8A 3TSWA 3PHGA 4IIJB 2V7UA 4D1YA 2IM8A 1D5CA 3AESA 2QD2A 4GOOD 4DSNA 4F3KA 1XWJA 4FESA 3UV7A 4JYPA 4X1OA 1ONPA 2GJ9A 2HXYA 1NUTA 3AQIA 2EFCB 3G0BA 2BR5A 3LKVA 2IF2A 5EIEA 5BOVA 2YW9A 4C4ZA 3LYHA 1ZIYA 3GBSA 3T7TA 4ARIA 3TOXA 2R2AA 4IRUB 5SZJA 1YQTA 4JLSA 4JQYA 1CY1A 3GW8A 4RPGA 2JAHA 3RCBA 3C15C 5E3HA 2FMIA 1KARA 4DB2A 3IUJA 5JLAA 2FW0A 2XV1A 5F7OA 3EJNA 4A23A 3R7BA 3OOEA 4CEJB 3MW8A 4PNHA 3O8OB 3MLGA 4B34A 4WZBE 5DGHA 4KK3A 4AZWA 4CUZA 4JMPA 2HJVA 2QW0X 4OJMX 5CB4A 1XMQB 5CGZA 4KMSA 4O4LB 4PPQA 3OA0A 4IDAA 4PS0A 3LZDA 2RH5A 3DEKA 2V6MA 2AMLA 1EFUA 3ESXA 2FPPB 4P3XA 2FPKA 1DG3A 2V03A 2YKZA 3MOGA 4QGFA 4RM3A 1UZUA 3R24A 1L1RA 4R69A 3SVLA 2DZDA 4MYHA 1OXMA 1NW6A 3QUCA 1TQHA 5CG1A 1GZ7A 2TYSB 4RD3A 4YRKA 5BOSB 4XTCS 1V25A 3STHA 1GTMA 2IDKA 2ZXFA 4G25A 1YVDA 4QPZA 1M2HA 4JXZA 3G2HA 2DUJA 3DD5A 4ANJA 3IQWA 2IHYA 1QGUB 3NANA 2IY9A 3WLRA 1U11A 5C8DA 1ZAKA 3E1GA 2E48A 4ZVKA 1DMRA 3F6SA 3KDPA 4IDQA 1NR1A 2OLJA 1DRJA 3KH2A 3CISA 1Y5NA 5ALPA 2HAEA 5JD6A 3ZK7A 4OL9A 4YRBA 2PUDA 1Y37A 2IPMA 2HFIA 1U2DC 1IZMA 1E20A 4BVKA 3AKDA 3ZHVA 4JA2A 4YRCA 1SHZA 3ROXA 1PFKA 1EJ6A 2P90A 2PUTA 4IGKA 5CNKA 4ZOCA 1LPSA 3KFVA 4C0LA 1MGOA 4NARA 2DF8A 3HPRA 4CR7A 5SY6A 3O82A 3OU6A 5I4IA 1ZVQA 4BMXA 4E4RA 1YBVA 1ZD5A 3ZCVA 4DUGD 3LPCA 1J9EA 3N3BC 1NQWA 5ALZA 1I32A 1RAGA 1M2EA 2F48A 1L8OA 3ODPA 5FA6A 2OPHA 3RV4A 4C6TB 3FOEC 4DMFA 3SVZA 1GL9B 1NKVA 3ZZTA 1JN0A 2DQKA 1Q6ZA 2PKRA 2YRFA 1AE1A 3R3HA 3SU8A 3DTVA 1HWYA 3A6GA 5G0SA 4OJKA 5BR4A 1WL8A 2ODNA 4ILEA 2QRLA 2PXCA 3IAUA 4FXOA 4GXRA 5EWMB 1G5HA 2A7QA 2XCIA 3KT0A 1YCGA 2XTZA 4Z0NA 4QDLA 5JNLA 3NDRA 1VMAA 1EUCB 1U0SY 2DPXA 4M9UA 3WL6A 4P83A 1Y82A 2Q6LA 3PNPA 1F06A 4E7OA 2FF5A 4O7GA 5BRJA 2XYPA 4G2TA 1J24A 4FHEA 3QLEA 1Y33E 3GEGA 3HGMA 1J8FA 1SA0B 2WU8A 3KKEA 3GPBA 4GBMA 4N3NA 3G7NA 1EGVB 1AURA 4HJRA 3SX4A 4PLYA 5I6DA 2BL4A 2JKVA 2OUIA 4YA6A 5ALWA 3WYAA 3EA4A 1H2BA 2PX0A 2W2OA 4QUKA 3F3KA 4RA9A 3AF1A 3FWYA 3NH9A 4Q7QA 3QW1A 2YV4A 2WU4A 5DDIP 2EKLA 4W5OA 1CNFA 1BCSB 4EHJA 4GQIA 1Q5PA 2AC7A 1T5LA 1XRSB 1UOPA 3HCBA 4BLUA 5D86A 4B46A 4A10A 4DILA 2J46A 4LCBA 4RULA 4KIFA 3I5YA 2ONYA 3SXPA 3GFVA 1L5ZA 3ONWA 1U4SA 1L7VC 3EAFA 4OH7A 3SM9A 2GBCA 3BMQA 5GM1A 3WB1A 3N8IA 4HEHA 4D80A 5IJ9B 1PJ4A 4OQQA 2I2FA 2ZRAA 2EFGA 2AFHE 3LPNA 4RK6A 3ZNPA 4EVSA 1N8KA 4JBYA 4IJ6A 2I4MA 3OZDA 4HYYA 3BB4A 2ECQA 5F73A 1FUEA 1ECCA 1GTG1 1CE8A 2X9GA 1SVLA 2FJPA 2ZQYA 1AKNA 3E82A 3N58A 4GUAA 4I1SA 4LWOA 3JARB 3V2IA 4RKYA 3NKFA 4X7PA 4PO9A 3WGKA 3WGLA 3ILVA 1SCUA 4RK1A 3ZHCA 1TM7E 1Z4JA 4UDOA 4GECA 3Q12A 4DSZA 1WVMA 2DSNA 3WAKA 2C9DA 2HQRA 4CMIA 2CJWA 5C5DA 4IEIA 5A5GA 2Z04A 3RANA 1SZIA 1OA0A 2HSDA 5FWYB 4DIBA 4ZVUA 3S5JA 1M0SA 2H63A 4UXJA 4ASUD 1HEYA 1XK7A 3W2WA 2V97A 1YA9A 1YR8A 1T4DA 1HE9A 1O5IA 1PK7A 1RE1A 2J7KA 2R6ZA 3GJSA 3JYNA 3MINA 2XRFA 4HUTA 1DARA 1JH8A 1RYZA 5M34A 5DWDA 3L7LA 2DRIA 3K4PA 1TC2A 4FJ0A 3S27A 3L0YA 5T1DB 1AZWA 4CS7A 2JGJA 3HHEA 3PIRA 1JHRA 3IMKA 4OD5A 5C46F 2IBTA 1MQAA 4GS5A 2IS4A 2JJ8A 1W85B 1VLLA 3K1AA 3N8DA 4L4RA 4LJYA 2RSEB 3GM1A 2HY7A 4MQ6A 2C2BA 4E7PA 1MRZA 2RHOA 3D7SA 4DE5A 5CBPA 1NBWB 4TLBA 5FL7A 5IXYA 2ZXOA 3U0CA 4ND1A 2JPUA 5ED4A 2Y0BA 3GRZA 2TMDA 2P41A 3RFUA 1VHTA 1QB7A 2WRZA 2WM8A 1OW8A 2GYVA 3KAPA 4NCHA 1Z15A 4JR1A 1D2CA 1RPTA 3MQ2A 3BYZA 4UCXA 4QOFA 5GJVC 1WHTB 2XBMA 5IT5A 5ITWA 2X6QA 1KYWA 5KDOA 2A1UA 1D2HA 3ZI0A 3ETCA 1E18A 2C5HA 2KGOA 4LOIA 1I9CA 3OAAA 5GZ3A 1VTMP 4P5PA 3AEKA 1ISMA 2GS9A 3JD4A 3G8DA 3S68A 5B3JA 1OXVA 5B2EA 2CVPA 2NNLD 1XCGB 4HNHA 4YV7A 1JX6A 3KQPA 1UKAA 2Q4DA 3UGPA 2LD4A 2ZT7A 3D8RA 1VKOA 1U1FA 3L0CA 3PNLA 5C1BA 2B1RA 3RREA 1WY7A 2XPCA 3RJ9A 3AG3C 2QPLA 5JD5A 1RZRD 4PYQA 2F3PA 1MXHA 4XEKA 2YC2C 2Z4TA 5IHPA 4E5SA 1SFRA 3AHIA 4I1IA 3CLSD 1R4NA 2OCIA 1KVSA 1YZGA 4RE5A 1Z8DA 3R6DA 5A7FA 3ZLJA 1JALA 2YQ5A 3OC6A 3BHMA 4G56A 2PQ6A 4LJRA 2CFIA 3KVOA 2W6JD 3MAAC 4P53A 2GF2A 3A14A 2NVBA 3U60B 3WKBA 1NJ6A 5JYBA 3PGA1 3FSGA 2VCYA 2UYGA 1M7GA 1L2TA 4PCUA 2RK6A 3VOBA 2Q27A 1J8DA 3DUFA 2OHIA 1B00A 4RZ2A 4B8YA 3RBXA 3T7EA 4DY6A 1ZR4A 2VC9A 2LBPA 2NT4A 3BJZA 4BE4A 4TTQA 3O94A 2A9JA 5I7UA 1CT9A 2LDXA 3T5DA 4FLFA 3U5SA 4OQZA 3V46A 3GLIA 3G4ZA 3AP1A 1GL7A 2JFQA 2OLEA 2WNHA 1C0LA 1ZP6A 1V71A 2O6LA 1U1GA 3L0SA 5ETJA 3KFLA 1GDTA 1E60A 4KACA 4HGRA 2I7XA 4G0HA 3MERA 2PGDA 4E5UA 5CVVA 3D0OA 1XJCA 5CX1B 3HNKA 4O4IF 1ACLA 1IVSA 3HXOA 1PD0A 4YRFA 1DAIA 3HL0A 5LP6A 5BT8A 5ITVA 1EFAA 3DV9A 4I7EA 4RM2A 1Q0GA 2HJMA 5IPFA 2R1TA 2HIMA 1G9SA 2BKLA 1Q3TA 1QZUA 2RK3A 3GCGA 4URYR 2P0NA 3KTDA 4GOMD 4L6RA 4KXQA 3VMMA 3EYWA 2CBGA 2ZYHA 3L8ZA 5GONA 2XUAA 4NCIA 4OIFA 4AF8A 4P3OA 3I3OA 3X1OA 3D8UA 3QKSB 4A6PA 3AV0B 3MELA 3RK1A 5LQKA 1ZWLA 4M0KA 1VSBA 2CSXA 3UNXA 1ZIPA 2CXPA 4YLGA 3FKSA 3GFPA 4PN3A 1T0UA 2W42A 3FMIA 3QXHA 2PBEA 2H4FA 1G8SA 5DYYA 4DSAA 1FRFS 4L16A 5H4HA 5D85A 1D8AA 1FNDA 4D3ZA 2FG5A 4P4NA 3ZE2B 4QI2A 1ZRSA 3NOOA 4TUYA 4MCJA 2P77A 1EYZA 4DEVA 1OLUA 3LXUX 3S0XA 5EHIA 3OE4A 4IDCA 1GUBA 3SCZA 1L1QA 1QC5A 1GTSA 3JAKB 1H93A 2QYHA 4ZT4A 4Q3AA 3Q0EA 3VHXB 3O10A 2B30A 3H2GA 3C87A 2HEGA 1Q92A 5DLDA 2FWBA 3IILA 3JQEA 2B4TO 1NJ2A 3CLRC 4HOYA 5CUQA 1VPTA 3UJPA 5AK3A 3JATB 4I4LA 4L51A 1U2ZA 4QTUB 1KR5A 4BCCA 4H4EA 1CRLA 1NSYA 2EDCA 3FYUB 5ICFA 2Q2OA 1BJKA 2WTMA 3GDWA 3U3RA 1I3LA 2QI9F 2V74B 1YNSA 1XKXA 2D8AA 1G5IA 4ZTBA 3RJZA 4QO7A 4NYJQ 5AESA 1TADA 4K40A 5IK2A 3NZEA 3S2SA 2ZYGA 2MHRA 2H1WA 3LBFA 3T3EA 5JO0A 1BEZA 1W0JA 4X97A 4A26A 4MIYA 1ISHA 1LH0A 1R0SA 1TUGA 1EI7A 3SMVA 4BQEA 5BUZA 1M2OB 1KXZA 2RGWA 3ELDA 2R1TB 3L7OA 3KZKA 2XDYA 1D7AA 3FZYA 3UGKA 3EHEA 1K5DA 2ACVA 4EG1A 3D7KA 1U8YA 4BDSA 3JD1A 3WP0A 2C1EA 1J7KA 4LZOA 1YJXA 2JAWA 3CUTA 3IUQA 4C4TA 1OHHD 3E9RA 1OAOA 4EHLA 4E2FA 3TXAA 4YLEA 4D3YA 5ICSA 3N8HA 1X9IA 2Q4FA 1YVRA 1B42A 2XB4A 3N6VA 2IW3A 4LQ4A 5ADUS 1E1MA 1IFXA 4GNRA 4J7TA 2FAXA 1TOAA 2GUGA 2YV5A 5FWXA 3L82B 4RE6A 5BQGA 1XLTC 4KAXA 2PWYA 1EDBA 2NUTB 1PGQA 3JVIA 4WFJA 3IOMA 3M4BA 1PS0A 2D1RA 2ONCA 2WJ3A 1BO6A 2HMQA 1IC6A 3LX8A 3A1UA 3TNDA 4BVJA 2YZ2A 3SLKA 4LX0A 3PCVA 4F1JA 1F7UA 3DF9A 3BCHA 1G21B 3GRFA 2XUHA 4MVCA 1Z25A 4HLUA 4O1MA 4RV9A 4TV9B 1BX3A 4C4RA 1XXHA 5KOHA 3U4DA 3ITFA 1Y1TA 4QUGA 4TKVB 1ZSVA 1GY8A 2Q1UA 3DLPX 4GMHA 4Z7NB 3FPCA 4S1VA 5JXWA 3NB0A 3LESA 2B69A 4LVNA 1VQ1A 1FFTC 1JHUA 3LJKA 4OAOA 4UD2A 4G24A 4UTOA 4ZI7B 4YRRA 2QWXA 3AHJA 1XTSA 1KPHA 2LK4A 1Q11A 1KETA 1ISPA 3OWXA 4JEIA 1FFXA 1XAGA 1XCLA 3DBVO 4LQCA 3UV6A 2W2LD 3EXFB 3EEBA 3VDMA 4JJAA 4MR7A 3N7AA 2PH7A 3UANA 5HW0A 2B4QA 2GO7A 3G23A 3BRWA 4HDCA 4I1VA 4ZQCB 5EWJA 5JJCA 4JT2A 4E0HA 4BZZA 5FNVF 3ST7A 3USCS 4EJ2A 1UFQA 3O4HA 1VGRA 4CS8C 4BFVA 1RXSA 1FTGA 1HRKA 1MZVA 1ENZA 3AJ8A 4NTZA 5U4QA 2VQSA 3KXDA 3D6NB 1LA2A 4YJ3B 5FF9A 3WHIA 5L45A 3ROMA 5ALSA 4E17A 4DQ0A 5BWOA 2CVQA 1BIFA 5HF6A 4G26A 4G5SA 1JTFA 1P1RA 1TVCA 4OIQF 1RWOA 1XNHA 2QX8A 1U2SA 2ENUA 3PPVA 4TVBA 3TIGA 4J9VA 1HQDA 2PKQO 5HJEA 2VCEA 5DK6A 1H4VB 4TT3A 3PCRB 1CPQA 1ELOA 3DTYA 5I9NA 4CCSA 2SECE 4WN9A 5JAIA 4PCLA 2JLQA 1NT4A 2IY8A 5A4AA 3CNHA 2Z4RA 1R27A 5ER9A 2HA6A 3RODA 3GPLA 2Q3TA 3KDSE 4XD7A 4N7RA 3R5JA 1J00A 3RO7A 3JSEO 1CS0A 1QM5A 4EZBA 1DTWB 3L0IB 5CDHA 2I71A 3NDBB 2OGWA 2V6BA 1R88A 4EK9A 2HOQA 5KNCH 3CT6A 4GM0A 5GJCA 4RMHA 5IULC 1B8NA 1RRKA 3ISTA 2LDBA 3UW3A 5LWQA 2LWIA 2QTTA 1YBHA 1E2UA 3BE6A 2JAUA 3C8HA 3ZX5A 4DNXA 4EUSA 4MVYA 5ADWA 2IF0A 3BQNB 3HGQA 4BJHB 4E70A 4CRWB 4CR6A 4TKVA 1UODA 3ZR4B 1GGVA 3NMUF 2JCYA 5LZ7A 3BXPA 3WXMA 5LL6P 1RAIA 1VHJA 2A9OA 4Y30A 5DRYA 3NYWA 3T4UA 1R8YA 4RTMA 1YT5A 1QU3A 5CDYA 4H54A 3PHIA 4MGKR 1OAAA 1YR9A 4GKJB 2ADMA 1PQUA 1Z4NA 3QH4A 3PVSA 1Y1LA 2X2FA 1UEJA 3AJ9A 4TL6A 2BP7A 3GO4A 2I3AA 4L8YA 4P9NA 2Q1WA 1HG0A 4WKNA 4ZPJA 2IU4A 2QTWB 4K1OA 2VNIA 2PG3A 3CN7A 2P2DA 3H2SA 3OZIA 4TUYB 1G21E 2A7XA 4WE3A 1BOFA 2GO1A 1TCBA 1QYXA 1MENA 4LGVA 4F12A 4XWKA 2RCYA 4G5QA 3W9SA 2XMZA 3BJMA 5CA1B 4CLOA 5GVSA 5IMSA 1YVEI 2XZLA 1JG3A 2C7BA 3NR2A 2PMEA 1Z4LA 1ZHZA 5DO9A 1EQAA 7MDHA 2OAP1 1C03A 4MQUA 1RCPA 3AIMA 2DR2A 2O8BB 4R81A 3WWYA 1UOEA 3D5QA 3B1KA 5FZTA 2X6TA 2I87A 3BFKA 3FOAA 4RDHA 1RAEA 5L0GA 1G6Q1 1Z0JA 2Y77A 3HA5A 1AXGA 4UHCA 5DEOA 4MPPA 2WMNB 2MMGA 2YWFA 2Z1MA 1BX0A 3CIOA 3EQZA 4G9EA 3ND5A 1B16A 4M76B 5FUXA 3HJRA 3A32A 1U0BB 3KZOA 2EEZA 1W5BA 4E2XA 3C74A 2A5LA 4XB1A 4B45A 3HCAA 5B3KA 2PWPA 1PNTA 5CM8B 1QAOA 2BUCA 2BKEA 2I80A 3AF4A 3NV7A 4OP3A 1LQ2A 2Z09A 5EVCA 2PPLA 4UEJA 1SXJE 2H1LA 3MCAA 1JHQA 1Y8AA 1K2WA 2C3PA 1MA0A 3GJZA 1XHLA 3H7IA 4HL6A 1B6SA 5LP6C 3RIXA 4EYGA 2Z8XA 3NALA 2X5KO 5BSVA 3F4BA 4ND8B 4ENWA 1OILA 4C5AA 3QSYA 4K9SA 4NU5A 2WVAA 2ZGVA 5FUQA 1EESA 3A4IA 4QPCA 2P2YA 4U4AA 1PKEA 2Q9BA 4ISBA 1JV2B 1V8OA 4X1IB 1KI2A 1KF0A 3A9WA 5TMDA 2W2KA 3SNKA 4DR1B 3EDCA 1GZVA 5AM4A 3U6KA 3F96A 2ZWOA 3QVTA 2VAXA 3U2MA 4ML3A 5ESDA 2VHJA 3H5NA 1E6LA 3HKKA 2WZCA 2ZBRA 3BK1A 3LNTA 2NGRA 3CLUD 3F8WA 3PHBE 1J2EA 5A62A 4Z53A 4WGZA 1OLSB 1QPBA 2GARA 1QV7A 1XPRA 1I30A 2PRKA 3D5TA 3PGXA 3IBCA 4QDUA 4KH1A 4PC3A 3RIHA 1XF9A 4MW9A 2CXSA 1FAPB 1FSGA 3VR4H 5C0OE 2LR0A 1NQTA 4O6NA 1PF7E 4WCDA 1CG6A 3JU3A 4KFCA 4ZAXA 1B2RA 1YDEA 1AKYA 4IMIB 5K2OA 3QVGB 1ND6A 1P1IA 3C48A 2VT7A 2J9VA 2RI6A 3DC2A 3K0KA 3IMGA 1OWLA 1KTMA 5CB8A 4XUGB 3DJYA 3LNCA 3NAZA 3R8XA 2L82A 4RLHA 3SS9X 2C98A 3NNNA 2XTJA 4KR6A 4UM9D 1GZSA 3OEHD 1OLOA 3VFDA 4C0AC 3R6TA 4ZEXA 2GWWA 1U7WA 4HVCA 4E07A 2R00C 2DCMA 1H85A 4HDKB 5ALUA 2B8WA 1X7YA 1K27A 1R15A 2R8EA 3OA1A 2YJ4A 3FYSA 1FF9A 4MW5A 3S1AA 2C5LA 3PUKA 1F1JA 3R7FA 2HJGA 4DCJA 4QQ8A 4BMPB 4J2HA 4IXTA 3IH5A 1NC1A 1YQWA 2PD3A 2YXBA 3SBDA 4TWAA 3SXUA 2ZB7A 5DCLA 3WSVA 4N76A 1K2VN 3R9WA 2GZMA 2AG5A 3EX7C 2PL5A 3NPAA 4AAYA 1RJ9B 5DBOA 1H05A 3GUVA 1ACMA 1TJ4A 1U80A 1LSJA 4RIFA 2C2MA 5E3CA 1YFZA 2FZLA 2XODA 2ZVQX 3BGVA 3FPBA 2P2LA 1LDBA 1N5LA 4PLFA 4QDJA 2B8TA 1WXDA 4OUKX 3O95A 3RFCA 3UFXA 3KYDA 1LDMA 1TO2E 1VC2A 2XOKD 4M3NA 1PSDA 1P29A 4XEUA 3F49S 5FBKA 5FI3A 4B84A 5HGXA 5LOVF 1E86A 1I3CA 5HV9A 4WVFA 3OM1A 5D7BA 4Y2GA 4YWQA 4O29A 3CX7A 4HS4A 4OK5A 5BVGB 3AUXA 2P1AA 4BEWA 1G8HA 2VH2A 3M33A 4J0GA 3W05A 1R66A 1XJ0A 4J3FA 4NVRA 1CYEA 1I3MA 5GOZA 1GZ3A 2O59A 3SXMA 2JL1A 2UYOA 3OLXA 3QKUA 1QIJA 2P8JA 3OCXA 4RGYA 5DTQA 1RKBA 4BMNA 2R7UA 3QI7A 3DCNA 4LJAA 2XKAA 2D74A 2NPUA 3A8TA 3JYPA 2B21A 3VYTB 2IV7A 4QUBA 1AIPA 1UIRA 1H3EA 5DXFA 1GVHA 2G9UA 2BE9A 4CCYA 2DXIA 1SF8A 2Q0XA 1X8JA 3U3JA 3B1ZA 3EZ7A 5F76A 1SH7A 4PRLA 1Q57A 3AR7A 3UA4A 2O7QA 3VSBA 4RTJA 3P45A 3R8FA 4TWBA 2CMHA 5JPCA 1TWCA 3U40A 2HXGA 1CEYA 1U0LA 1Y1KE 3THXA 3MVEA 3FWKA 1DJNA 3RLIA 4BLTA 1BDJB 1CUUA 2FA9A 1NM5C 4I1OB 1C3OB 3FCEA 1KSGA 3SOPA 1F2UB 4DJFC 1P8JA 5KTPA 1HT2E 1ZMTA 3PZRA 4OJQA 1BZ4A 3WNDA 4FNMA 4JX9A 2WKQA 3I0MA 4F4CA 1MAWA 3JQGB 4HZUB 2R7MA 1TB4A 1VECA 3KYJA 1BS2A 5EIOA 4E1BA 2OQIA 4NESA 3RRNA 2COEA 3MGGA 2WWIA 1OR8A 1EKYA 4TRNA 5FQOA 2VYCA 3DE5X 3V8NA 5J23A 2LFFA 4X20B 4P7BA 4RF3A 3RYCB 1RKVA 5FXMA 1K4MA 2DBQA 3IAHA 2KK1A 5DYIA 5CEEA 1F9AA 2CKMA 1XEFA 5FEMA 4EMTA 4KK4A 3VH1A 1W2GA 4HAIA 4JH0A 2Q9AA 3T9OA 3GNSA 3NONA 4NCXA 4GPEA 3L0ZA 4US1R 2AW3A 2NSYA 4ROSA 4KQCA 1P7WA 5AVXA 2PUFA<